3EEAA

The crystal structure of the gaf domain/hd domain protein from geobacter sulfurreducens
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
155
structure length
153
Chain Sequence
ERLSGLTDVDEVIKDLSRLLRKLVKTRWIAVYFFDRRDFAPARSTGLPASFLPVFREMPLAPDKIPLLKSMLRKRQHLMLTDPGSSDLLTPKLRKLLRNLCVLAVPMVVRTQVIGAVFMARTRDNPPFSDAETAIIRDLVSHAALVVSHMQLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAF domain/HD domain protein
publication title The crystal structure of the GAF domain/HD domain protein from Geobacter sulfurreducens
rcsb
source organism Geobacter sulfurreducens
molecule tags Structural genomics, unknown function
total genus 42
structure length 153
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13492 GAF_3 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3eeaA00
3E98A 4GLQA 5DFYA 3R4KA 1YKDA 4IJGA 2XROA 5AJGA 2QYBA 2O99A 4G3VA 1ZTUA 1MC0A 4O01A 4CQHA 3MMHA 3W2ZA 5HPFA 4Q0IA 3RFBA 3LFVA 4G3KA 2KOIA 2Y8HA 3CI6A 4MMNA 3G6OA 4O0PA 2O9CA 1VHMA 4R6LA 4QPRA 4EUVA 1YSQA 1YSPA 4Z1WA 2LB9A 2VZWA 2G7UA 4Y5FA 2B18A 3VV4A 2VJWA 4Q0JA 5LBRA 5C5KA 4MN7A 3MQ0A 3O5YA 1TD5A 2W1TA 3KO6A 4DMZA 4YNRA 4MCWA 3KSIA 4PAUA 5I5LA 3OOVA 4ZRRA 2XSSA 2W1RA 2ZMFA 2LB5A 3IBJA 4LRXC 4O8GA 1STZA 4G3WA 2M7VA 3D3OA 5DFXA 3KSHA 3KSGA 3NOUC 4LRYC 3E0YA 2O9AA 4ETXA 3HCYA 5HSQA 5K5BA 2GX5A 5HPIA 3OBFA 5HL6A 4IUHA 4ETZA 2W3HA 2K2NA 3TRCA 4EU0A 3IBRA 4IUKA 2W3GA 2IA2A 3NOTC 1F5MA 3S7PA 4Q0HA 2W1TB 3S7OA 4R70A 3DBAA 4BWIA 3MF0A 4LRZE 3NHQA 3S7NA 3S7QA 3BJNA 4RQ9A 3KSFA 3CITA 4ME4A 4MDZA 5L8MA 2M7UA 4DN0A 4YOFA 3NOPC 2O0YA 2O9BA 2OOLA 5TJJA 4FOFA 2HGVA 1MKMA 3K2NA 1TF1A 4Y3IA 2K31A 2KLIA 2W3FA 2VKSA 4GW9A 4E04A 2W3DA 3C2WA 2W3EA 4Y2FA 3EEAA 3ZQ5A 2XRNA 2Y79A 2VEAA
chains in the Genus database with same CATH superfamily
5EV0A 2GNXA 4EBLA 5CHUA 4ZAMA 4EERA 2O99A 1GA9A 3SOIA 3SW1A 2PRFA 2WKRA 5AQAA 4UQIM 3VOZA 4B93A 4WEKA 2Y8HA 1XPBA 3GVBA 5DKLA 1E3UA 1K0KA 1IKIA 1K6RA 4QPRA 4GHIA 1LLBA 3UB5P 2EX6A 2OV5A 3PBTA 2V0UA 5HARA 3N8LA 4B9OA 5DJTA 2OAQ1 4GHIB 4BJPA 2QWSA 4GKUA 3PR6A 3T4LA 4IBRA 2V2FF 2Y2QA 3CUEA 2Y2NA 2A49A 3C7UA 4DDYA 1K38A 4JF4A 2OAP1 1SDEA 3ZCZA 4GS9A 1XX2A 3UO9A 3MFDA 4NXFA 4UA6A 2IWBA 4ETZA 1OTAA 4DRTA 2GDNA 1IOUA 4QY6A 1BT5A 3CHWP 4X25A 4EBPA 1ESIA 4B88A 2ZM8A 1GSVA 3LICA 4OVDA 3Q7VA 3S7QA 3JYIA 3UMEA 4ME4A 1YLPA 4EEPA 3H7WA 3CZDA 4CLCC 3NOPC 2OOLA 3E4OA 1XGIA 3IS2A 4HESA 4JF6A 5IU1A 1NJ4A 3N4IA 4HNBA 1W8YA 4X69A 3A0SA 3T50A 2ZL1A 3H7WB 3R4KA 3GTCA 3IS2B 4X55A 4WZ5C 1CJFA 3MZDA 1ONHA 4N92A 1ACFA 4UQIS 4R3JA 2W27A 3TOIA 2VGKA 2J3TD 1YLTA 4NXEA 5EPHA 3FKVA 3B33A 1WE4A 3PYPA 3ZGAB 4K08A 3MXRA 4S2KA 1ZG4A 4GD6A 5G4ZA 2OSUA 1NXYA 4Y5FA 1W79A 1P9RA 1T1CA 5TBMB 2Z2LB 2ZC6B 2B02A 3E4PA 2ZQAA 4MNRA 4OOLA 2QJ5A 1MY8A 1ODVA 2OLUA 2W1RA 4LENA 3CWFA 3BECA 1K55A 3ZFZA 5EM0A 1WYCA 2Y2GA 3SS4A 3M6BA 2PT7A 1MXOA 4P6ZS 5L10A 4LGWA 2NUPC 1L0DA 4JGQA 4Y0OA 1BYWA 3GECA 1ERQA 2ZC3B 2JC7A 3VFFA 4JGRA 1S1YA 3LR5A 1L3LA 2JN7A 5CRFA 2V0WA 2Y2MA 4JBFA 4Y17A 1H5XA 4EETB 1CI9A 5HAQA 1O7EA 4RQ9A 1YLYA 3RTYA 4OQIA 4F94A 2J8YA 1MWTA 5FI7A 4D60A 2HP9A 3GV9A 1PW8A 3IWOA 4N9KA 4NG2A 1PIOA 2VEAA 3HJKA 1K57A 5DF7A 3MKEA 2XD5A 2XQZA 5FSRA 3F1PA 3T4QA 3OZHA 3FC7A 5EE8A 4LV1A 3LFVA 4KZ7A 4G3KA 2ZOIA 1YAXA 4WF0A 2ZQ9A 3F1PB 4C6YA 3P7NA 1XXMA 4PM7A 2CC1A 3DTKA 3HLFA 1IFQA 1JWPA 4RYEA 4GD8A 2EWVA 1DP9A 1RGZA 4KZ9A 1FCMA 3BW6A 2QPNA 1KVMA 1CEGA 2RL3A 4II7A 2P08A 4HBUA 1YLJA 3QP1A 1ZHHB 2HV1A 3N7WA 3RJUA 4RVAA 3KSIA 1W7FA 1BLHA 4I3AA 4XUZA 3W8KA 3BQAA 1XJ3A 3SH8A 2FZ0A 3D9YA 2ZC5B 1M6KA 5DFXA 2L1MA 3BLSA 4S2PA 3UB6A 2PYPA 3KSGA 1I2SA 4LRYC 1SKOA 2E8IA 3M2JA 2UV0E 3MQQA 4OPQA 3QP2A 4EU0A 4ZDXA 2R9XA 1SKOB 3VP2A 2ZM0A 2EA9A 3BFGA 2W1TB 5L2FA 2V1AA 5FQ9A 4R1GA 3S7NA 2P9VB 2VV7A 4CLCD 3U4LP 3DTMA 4HBTA 1XJ4A 2H5SA 2WGVA 1PI5A 1IELA 3S22A 1NWZA 3O88A 2XF3A 2Z6DA 3HBRA 3VFHA 2A24B 4HEFA 4B4ZA 5GLCA 1RCJA 4MN5A 3FG8A 2XDMA 3VSKA 4E3NA 2JKFA 4R23A 4DXBA 3VP1A 3OC2A 1D06A 4BD1A 3P01A 5TGFA 3AGEA 2KOIA 4O0PA 4OQ0A 3MS6A 5HDDA 5IT5A 4R6LA 3UE3A 3NDEA 1YM1A 3EGDC 2VJWA 1X0OA 1Z6FA 1FOFA 5A91A 3MXQA 5C5KA 3MQ0A 2PD8A 4PM5A 3C4PA 4KZ8A 4YNRA 3QP5A 4HH2A 1N9BA 4ZTKA 4OQGA 2PBDP 4JPMA 2Y91A 3IQAA 2ZMVA 1OT6A 1DJCA 3NBLA 1IYQA 1BLPA 4OOMA 3MKFA 3G2YA 4JGPA 3KSHA 3PBSA 3IXBA 2J7VA 3LIAA 1JVJA 4WM9A 4R0QA 5FAOA 5EUAA 5FDHA 4BL3A 4ZBEA 3V67A 4WMCD 1L0GA 4WZ4A 4JXGA 1CI8A 3RH8B 5EVIB 2BLSA 2ZD8A 3FPVA 4PKYA 2WKPA 3S7PA 2FFYA 4GDNA 4BWIA 2WAFA 4EQ1A 2Y2PA 2BTFP 1FCOA 3B42A 4HHDA 3M6HA 1MKMA 4ARZA 2G2WA 3WS4A 5GLDA 1I2WA 1W8QA 1L0FA 2VV6A 3UB7A 2W3DA 1K57C 4LCLA 5I94A 3T4SA 4DJ2A 5IS1A 4ARZB 1VETB 3E2LA 4CQHA 3MMHA 1E3UD 3QP8A 4MMNA 2QHKA 2R78A 3G6OA 3UDXA 3ZNTA 4JXWA 1F2KA 1A0KA 2XD1A 4BD0A 5FASA 4XXRA 2B18A 2XK1A 3JVVA 1KDWA 2Q9NA 3R7WA 1TS8A 3QHYA 5L09A 3IX4A 3CAXA 5I5LA 1MWUA 3G2ZA 5CTMA 1J9MA 3G30A 2ZC4B 4KZAA 4ZJ2A 3BY9A 1ES3A 1ESUA 2J9OA 1S1ZA 4GJ4A 1GSWA 2EFUA 1VEUB 2IWDA 1BUEA 1PYYA 5EFWA 1ONGA 3A0VA 2HJ9C 1SZVA 4M4XA 3N8SA 4OOYA 1GSXA 2VA0A 2R9WA 5EVEA 1H8MA 3IHAA 2XR0A 5AQ9A 4MBFA 4K91A 5CHJA 2L4RA 2A2LA 4AFIA 1PWGA 4OP8A 4Y3IA 2QZ6A 3PBNA 1S66L 3OPHA 1ES4A 3IH9A 2HDQA 3RXXA 1YKDA 2XROA 1LSXA 2VK3A 3GR2A 4HJ4A 4Y13A 5M18A 1MC0A 2HP5A 1VB6A 4O01A 3RFBA 2Z2MB 1K6SA 4WELA 1KGEA 5M1AA 2O9CA 4X6TA 1VHMA 3T1QB 4JKTA 3LO7A 1YSQA 1N9OA 3IT9A 5FEFA 3DTEA 2DMWA 1GHMA 2WYXA 3AGFA 1TDGA 4OKPA 5E2EA 3MXSA 3G32A 3O5YA 2PHYA 3E4QA 3LI9A 2XSSA 3BLMA 3GSGA 2LB5A 4G3WA 3IWQA 4H6JA 1LT0A 4P85A 5EVIC 1LI9A 3ZNYA 5HFOA 4KZBA 3PXPA 1XJ6A 2WZZA 4BQMA 3LI8A 5E2FA 2AVXA 1AXBA 4H8RA 3W4PA 2Y2KA 3SS3A 4YINA 1BZAA 4X56A 1LHYA 3C5AA 5DF8A 3KX0X 4HP4A 5A93A 1U60A 3IXDA 4GS9B 4PPRA 3IX3A 2JE5A 1ZKJA 3B3XA 5M19A 1T19A 4HJ3A 3C7VA 3VP0A 3PBRA 4R3AA 5AJGA 2QYBA 2YKHA 3T4TA 1G28A 3CG5A 3UPNA 3CPTA 3N8RA 1NZOA 1H0MA 4I39A 5HX9A 3C8CA 4UHUA 3LIDA 3Q7VB 3CPTB 1HTZA 2C6WB 5FQQA 5A8BA 4BLMA 4GCZA 4FSFA 3T12B 3MBZA 4KQRA 1QMEA 4MBKA 5KSHA 4QD4A 4QY5A 3MJQA 1JNUA 1RGYA 4GZBA 2ZL1B 3BFFA 3MSHA 4NXGA 3LIEA 3CJMA 2PBYA 2WK0A 2M7VA 4E6XA 3D3OA 5E43A 4DJ3A 1NY0A 1LSVA 4NKPA 1SKFA 5DTSA 4DE0A 2V9AA 4CLCE 3L9KA 5HL6A 1NYYA 2V8FA 5L07A 2EFXA 4L9EA 5HDCA 3O86A 3QNBA 2IA2A 3QNCA 4OPRA 4S2NA 5JYOA 2ZC7A 4LRZE 4OONA 3T4OA 5HWWA 3BJNA 3IXGA 1EI5A 4KQOA 4FUWA 3NJAA 4DE3A 1IEMA 3GMWA 5TR7A 1JWZA 1HVBA 5GHZA 3SS5A 2E8JA 5CGSA 1K4EA 3LGOA 1FCNA 5FQKA 2VGJA 1KVLA 4K0XA 5EM1A 5EVLA 3ZQ5A 2Y79A 1MZUA 4OLGA 4C3QA 5DFYA 3CLOA 2Y2OA 2A3UA 5J4EA 1N4OA 2WKQA 5F82A 4WEJA 3HLBA 2W0NA 3KYEA 3WRTA 4IEDA 1YLWA 4QHCA 2WAEA 4NXBA 1XFNA 2VZWA 4ZJ1A 1LL8A 2ZM2A 3FWLA 1S4RA 4KG2A 3TG9A 1ES2A 3GRJA 4KENB 1N9LA 4FH2A 4PM9A 1PW1A 1VM1A 4WUJA 1ALQA 2ZJ9A 5EVID 3A0RA 3LEZA 2PDRA 3PAGA 1MWRA 4EW7A 3I7JA 3E0YA 3L7HA 4NK3A 4GNUA 4CPKA 5HPIA 3CUEC 4HOIA 3EWKA 3UN7A 1HD8A 5GLBA 3NDGA 4HQAA 1EW0A 2W3GA 3UNWA 4OP5A 1HLUP 4DXCA 3DBAA 4U0XA 3NHQA 4S2LA 3LR4A 3VP4A 2PR5A 1PZPA 3LYXA 2PAVP 5F5YA 4O7DA 2QKPA 5CGXA 2KLIA 3N6IA 3QP4A 4GOGA 5HL1A 5F68A 3HL9A 1S67L 3G35A 1Y4OA 1DRMA 2G2UA 2EX8A 4R4RA 3WS0A 1NRFA 3LIFA 5MC7A 1C3BA 1YPRA 1L0EA 2GZAA 3AGDA 2HZ5A 2EX2A 4JLFA 3P09A 4BBTA 4EUVA 4E3JA 1LI0A 2V1ZA 3VV4A 4HP9A 1DY6A 1IKGA 4IBXA 3SZTA 5U47A 1TD5A 3KO6A 3ZG5A 4E6WA 4L9FA 3ZDJA 3ZG7B 5CEDA 2QJ7A 3GQZA 4LFUA 3ZYTA 4I38A 4ZRRA 1S6RA 3ZG8B 4ID4A 3GDIA 4K0WA 4DKIA 3NOUC 1V9YA 1W63Q 2M1CA 1CF0A 4IUHA 2Y2LA 1PWCA 5FI6A 3Q07A 4E3LA 2EXAA 5DF9A 4PMAA 4S2NC 5GHXA 4BL2A 1K55C 5CEBA 3C4OA 3S7OA 1T1BA 4JF5A 3A3DA 1PWDA 4KG6A 2X71A 4R3BA 1YMXA 4FOFA 4E3IA 3T4KA 2K31A 1EWZA 2W3FA 2VKSA 3FV7A 1JTGA 2OLVA 3A3JA 3EEAA 2Y4AA 4I3IA 5KIZA 5KZHA 5EOOA 3DWKA 4FD8A 4G3VA 3RXWA 3Q81A 3W4QA 3HUMA 2P74A 4EESA 1YQSA 4Y0UA 5EOEA 4HIAA 4Q0IA 1KGGA 4E3OA 4P6BA 3M2KA 4GB7A 2WGIA 1FQGA 1AWIA 4MBHA 1H8YA 4ESPA 3H9WA 4WYYA 3EGXC 2VGLM 5IHVA 3P98A 1S4SA 3VOYA 4X1MA 5AQBA 3C30A 3TE8A 4M3KA 2JBFA 5HAIA 4NEED 3W4OA 2HDRA 3ZVWA 2Y59A 2DCFA 1GCEA 1TVFA 2D02A 1J3WA 1KDSA 3DWZA 1BLCA 3IXHA 5HSQA 5K5BA 3ITAA 2GX5A 1Y28A 1GHPA 2OWHA 3UE1A 3IBRA 4IUKA 1Z09A 3BY8A 5CECA 3R7WB 4Z9QA 4R70A 1KE4A 3D4FA 2VX8A 3ITBA 3Q7ZA 4GN2A 3T1RA 4XUXA 1O07A 1TDLA 2J80A 2O0YA 2DRWA 2HGVA 1TF1A 2V8CA 2WKHA 1ZG6A 4IVKA 3C2WA 4F3LA 3FYZA 5F83A 4GLQA 5F1FA 2J9PA 4IJGA 5F69A 4B4XA 1OPXA 3V5MA 3BFDA 3W2ZA 5DTKA 1YT4A 4PM6A 3V3RA 2GJ3A 3WS2A 5HDSA 4N9LA 3B47A 4BBVA 1K56A 2LB9A 5CGWA 3PBQA 3UE6A 5AVEA 3HUNA 2D01A 3F1NA 2WGWA 3HVFA 2ZQ7A 4Y7PA 3Q82A 3S4XA 4EQIA 2I9VA 4YWZA 1CQAA 5DTTA 1BULA 3F1NB 2WGWB 1STZA 3TW8A 5A90A 3ZVTA 1LL5A 4U0TA 2O9AA 1YMSA 2HDSA 5G4YA 4FTXA 4BBUA 4LV0A 1CEFA 2W3HA 2KX6A 3TRCA 3LUQA 1CK3A 4HY8A 5AVFA 2HDUA 2C5WB 3O3VA 3OCLA 5JYPA 5TFQA 4QJGA 1UWNX 3IH8A 5FA7A 2HP6A 4DE1A 3FPWA 4H6JB 3EQVA 4OPZA 1P97A 1S0WA 4OH0A 1XJ2A 2P7JA 2KDKA 3IF5A 2PD7A 1H3QA 1NYMA 3IF6A 4LLOB 2XA7M 2ZBBA 3HLEA 4HI4A 5FI2A 3IF6B 4N1HA 3G4PA 2RCXA 4CJNA 1F98A 5KSCA 1WYBA 3BEBA 2ZOHA 3VP3A 2I72A 2PU2A 1OJGA 4Q0JA 1SDNA 3BWLA 5HWTA 4MN7A 2WADA 4PKYG 1BSGA 2J3WA 4P6ZM 5A92A 4DMZA 3HUOA 4PAUA 2X01A 4U3TA 4BENA 1GA0A 4A5RA 1I5QA 3HLGA 3BYDA 3NY4A 3IBJA 4LRXC 3UMDA 3OPPA 3UE0A 4R38A 1OTIA 2FH5A 2ZMAA 3SH7A 3WRZA 4LCMA 5GHYA 4PM8A 2H10A 1TS0A 2PU4A 3E2KA 3G34A 1XGJA 2WZXA 4FH4A 5GL9A 3WS5A 1FILA 1DJAA 4X53A 1K54A 2Q9MA 3KYQA 1IYOA 5CERA 3DW0A 3PHYA 3FZCA 2H0YA 3T1SA 4I3JA 1T1AA 4C75A 3OLOA 5TJJA 3BM6A 5TBMA 4LV2A 3U2AA 5BOHA 2W3EA 1OTEA 1WA9A 2XRNA 3DTIA 2B95A 3TSGA 1PFLA 1K25A 3HJIA 4RX2A 1FIKA 3VSLA 4JXVA 1Q2QA 5DJUA 3LEQA 2XA7S 1LSWA 3LR3A 3K3CA 3ULFA 2Y55A 5HW3A 4LV3A 4S2OA 1P9WA 1UWPX 3NI9A 3CMZA 4UAAA 1YSPA 4OLDA 2ZLYA 2MJ6A 5LBRA 4IHQA 2Q0OA 5FQJA 5DKKA 1DP6A 4N1XA 3LIBA 5FAPA 1NLZA 1MBLA 1KOUA 1NRJA 2HJEA 4E3MA 1XP4A 2ZMFA 5F6AA 3T4JA 5KMWA 3UY6A 3EEHA 1TS6A 1KE0A 3ISGA 2CMNA 5GLAA 4HJ6A 3NC8A 3VMAA 4JGOA 2PR6A 1BTLA 3TJZC 1UGUA 2DNSA 2XEPA 4WBGA 1TS7A 2VV8A 4KQQA 2JKRM 2XGNA 3UPOA 2JKTM 2L0WA 4L9GA 5HD3A 1MKIA 3BQ8A 3UPPA 1NLYA 3C38A 1QMFA 1G6OA 2V1BA 1F5MA 3PTEA 1XA1A 3VE4A 3A3FA 1KGFA 3CITA 3NIAA 3VOLA 5L8MA 1K4FA 3UB9A 2HF6A 2M7UA 4Y0TA 4QU3A 2B5RA 1SCWA 3VE3A 2WKIA 2IWCA 2OWJA 3IF6C 4I5SA 1G6AA 3SH9A 4S2MA 1PRQA 4JXSA 3DAVA 4DF6A 4GDBA 2JCHA 1JTDA 5HAPA 3LY4A 4EBNA 3T1XA 4RX3A 2Y2JA 4QWOA 2ZQCA 3A3EA 4DE2A 3Q1FA 2K7SA 3ZG0A 1JWVA 2G7UA 1W63M 1ERMA 5FQIA 5HZHA 2P04A 4KG5A 3K3DA 4MLLA 3NECA 1TEMA 3S1YA 2W1TA 1E25A 1FR6A 4MCWA 3V3SA 1P0ZA 3OOVA 2P9VA 3UB8A 1OTBA 3MZFA 5CX7A 1DJBA 4L0LA 3WWXA 3LCEA 4X68A 2NUTC 2A24A 3IX8A 4PHTA 4UEYA 5FAQA 4NETA 4E3KA 3F1OA 1MWSA 4HH3A 1K54C 2INWA 4WLAA 3WS1A 3F1OB 3HREA 5HWVA 2XFSA 3KSFA 1PNEA 4DN0A 2O9BA 1FSWA 1HZOA 2Y2IA 5D3OA 4Y15A 4GW9A 3JVUA 3BFCA 3QP6A 5FATA 3EOIA 4MEZA 2VLGA 3BRMA 3IHBA 4FCFA 3PAEA 2XLNA 3HLWA 2Z6CA 1ZTUA 4P87A 2V20A 2JKGA 5HPFA 2H0TA 1D7EA 1Y54A 3LY3A 2Y2HA 1K56D 5E2GA 4MN6A 4XT2A 2XFTA 4Z1WA 4WN5A 4Q8IA 2ACGA 2WKEA 1XA7A 2H28A 5EVIA 3NULA 4XT2B 3A3IA 1V9ZA 1ZC2A 4KZ5A 4LPZA 4ZJ3A 4KUKA 5F1GA 3V50A 5J7EA 1GHIA 1BLSA 3G31A 1LL9A 1VQQA 1NZUA 4D2OA 3UDIA 4KQDA 5FDSA 3IWIA 1N9NA 5CTNA 4ETXA 4UA9A 2EXBA 4RA7A 4S2JA 5CHMA 4EEUA 1DP8A 1OMEA 2BG1A 3MZEA 1VETA 4R4SA 4EXOA 3D72A 3NOTC 4Q0HA 4KUOA 1FR1A 3MF0A 4OPYA 1OT9A 3OCNA 5CXWA 2EWWA 2QMIA 1XKZA 2HPBA 3NCKA 5J3WA 1PI4A 4YOFA 1G5UA 2ZQDA 4YFMA 4CLCA 3MFXA 3V39A 1SHVA 1OTDA 2YKFA 4E04A 4Y2FA 3FKWA 3E98A 1H8ZA 1FSYA 3MR0A 4IVIA 5E2HA 2EX9A 3LR0A 4CLCB 3UDFA 3O87A 5AQ7A 5FEGA 1OJ5A 4WZ5A 2WUQA 3H82A 3CI6A 1D1JA 1EROA 2J3TC 3EQUA 1L2SA 3ZHHA 1VEUA 5FL3A 3H82B 1IYPA 4DDSA 1M40A 3MQOA 3KYZA 4F3LB 5FQMA 1MPLA 1G68A 2FFFB 1PZOA 3ICYA 4EWFA 1RP5A 2VGLS 4O8GA 1W5DA 4QB8A 4OQHA 5HD5A 2PYRA 3BFEA 5EECA 3HCYA 4KZ3A 2JKRI 5G18A 1E4DA 3JPUA 3OBFA 4EUZA 1ES5A 2JKTI 2K2NA 4KZ6A 1F9IA 4X1LA 3HLCA 1Q2PA 2UWXA 3HLDA 1KE3A 4WMCA 4EV4A 3ZG9B 2ZQ8A 1YLZA 1XFQA 4WL9A 4MDZA 4S2IA 3OPRA 4BMWA 2BASA 4UA7A 1IYSA 3K2NA 2X02A 3PBOA 2XH9A 5DVAA 1T18A 3OPLA 4P0MA 4KZ4A 2JHEA 5J8XA
chains in the Genus database with same CATH topology
1DRMA 3T4SA 4DJ2A 2GNXA 5IS1A 3HJIA 4ARZB 4EERA 2O99A 3LIFA 3SW1A 5MC7A 5DJUA 4CQHA 2WKRA 3MMHA 2XA7S 1LSWA 3LR3A 4UQIM 3K3CA 3ULFA 4B93A 4WEKA 2Y8HA 4MMNA 2QHKA 2GZAA 2R78A 3G6OA 5DKLA 1P9WA 1UWPX 4BBTA 4QPRA 4EUVA 4GHIA 1YSPA 2B18A 3VV4A 3PBTA 3JVVA 2V0UA 4HP9A 2MJ6A 4B9OA 5LBRA 5DJTA 4IHQA 2OAQ1 4GHIB 5DKKA 1DP6A 4BJPA 3R7WA 2QWSA 1TD5A 3KO6A 3LIBA 4L9FA 1TS8A 1NLZA 3PR6A 3T4LA 1KOUA 2QJ7A 3CAXA 1NRJA 2HJEA 3CUEA 5I5LA 3ZYTA 4I38A 4ZRRA 2ZMFA 5F6AA 3T4JA 3BY9A 3EEHA 1TS6A 2OAP1 4GS9A 3GDIA 2CMNA 1S1ZA 4GJ4A 4HJ6A 4JGOA 3NOUC 1GSWA 1V9YA 1W63Q 2PR6A 3TJZC 1UGUA 2M1CA 4NXFA 1TS7A 4ETZA 2VV8A 4IUHA 1OTAA 2JKRM 2JKTM 2L0WA 4L9GA 1IOUA 5HD3A 3BQ8A 5DF9A 1NLYA 3C38A 5EFWA 1G6OA 2V1BA 3A0VA 2HJ9C 1F5MA 1GSVA 4M4XA 3LICA 3S7OA 1GSXA 1T1BA 2VA0A 3S7QA 3UMEA 3CITA 3VE4A 4ME4A 3VOLA 4EEPA 1H8MA 5L8MA 3UB9A 2HF6A 3H7WA 4CLCC 2M7UA 3NOPC 2L4RA 2OOLA 2A2LA 3E4OA 4FOFA 4AFIA 3IS2A 3T4KA 4Y3IA 2K31A 3PBNA 3VE3A 1S66L 2W3FA 2VKSA 5IU1A 4HNBA 3A0SA 3EEAA 3T50A 4I3IA 3H7WB 2OWJA 4I5SA 3R4KA 1YKDA 5KIZA 3IS2B 2XROA 1LSXA 4HJ4A 4G3VA 4EESA 1MC0A 1VB6A 4O01A 4UQIS 4HIAA 4Q0IA 2W27A 3RFBA 2J3TD 4NXEA 4WELA 3B33A 2O9CA 3PYPA 3H9WA 1VHMA 4K08A 3EGXC 2VGLM 2K7SA 1YSQA 1N9OA 1S4SA 5G4ZA 2G7UA 4Y5FA 1W63M 1P9RA 1T1CA 2DMWA 5TBMB 5HZHA 2P04A 3C30A 3K3DA 2B02A 3E4PA 3O5YA 2W1TA 2PHYA 4OOLA 3E4QA 2QJ5A 4MCWA 3TE8A 1ODVA 3LI9A 1P0ZA 3OOVA 2XSSA 2W1RA 3UB8A 4NEED 2LB5A 3CWFA 1OTBA 5CX7A 4G3WA 4H6JA 1LT0A 4L0LA 2PT7A 2D02A 2NUTC 2A24A 4PHTA 3PXPA 4UEYA 4P6ZS 5HSQA 5K5BA 2GX5A 1XJ6A 2NUPC 1Y28A 4JGQA 3LI8A 1BYWA 3GECA 2OWHA 3F1OA 3IBRA 4JGRA 1S1YA 3LR5A 4HH3A 2JN7A 4IUKA 2INWA 2V0WA 3BY8A 4WLAA 3R7WB 4R70A 3F1OB 2VX8A 4EETB 5HWVA 4RQ9A 3KSFA 3RTYA 3KX0X 4HP4A 4DN0A 2J80A 2O0YA 2O9BA 4GS9B 2HGVA 1TF1A 4GW9A 3JVUA 3C2WA 4F3LA 1T19A 4HJ3A 2VEAA 4GLQA 3EOIA 3HJKA 2VLGA 3PBRA 4IJGA 4R3AA 5AJGA 2QYBA 2YKHA 3F1PA 1G28A 3T4TA 5F69A 3T4QA 2Z6CA 1OPXA 1ZTUA 3FC7A 3W2ZA 5HPFA 3LFVA 4G3KA 4I39A 2ZOIA 1YAXA 3C8CA 1D7EA 4WF0A 3LIDA 2GJ3A 3F1PB 3P7NA 4MN6A 4XT2A 5HDSA 5A8BA 4GCZA 3B47A 4FSFA 4BBVA 4Z1WA 2LB9A 4WN5A 1IFQA 2EWVA 1DP9A 2H28A 3PBQA 3UE6A 5KSHA 5AVEA 3BW6A 4XT2B 1V9ZA 2D01A 3F1NA 3MJQA 4II7A 1JNUA 2P08A 4LPZA 4KUKA 1ZHHB 2HV1A 3KSIA 5J7EA 2I9VA 4YWZA 4I3AA 4NXGA 3LIEA 3BQAA 3F1NB 1XJ3A 2FZ0A 1STZA 2M7VA 3D3OA 3TW8A 5DFXA 4DJ3A 2L1MA 3UB6A 2PYPA 1LSVA 3KSGA 4NKPA 4KQDA 4LRYC 1N9NA 2O9AA 4ETXA 2V9AA 4CLCE 5G4YA 5HL6A 4BBUA 4EEUA 1DP8A 2W3HA 3MQQA 2KX6A 3TRCA 4L9EA 4EU0A 3LUQA 5HDCA 4EXOA 3D72A 2EA9A 2IA2A 4HY8A 3NOTC 4Q0HA 2W1TB 4KUOA 5AVFA 2V1AA 3MF0A 4LRZE 3T4OA 3S7NA 1OT9A 5HWWA 3BJNA 3OCNA 3OCLA 2EWWA 4KQOA 1UWNX 2VV7A 3NJAA 4CLCD 5J3WA 1XJ4A 3FPWA 4H6JB 3EQVA 4YOFA 1NWZA 4CLCA 2Z6DA 3MFXA 1OTDA 2A24B 2YKFA 4E04A 1P97A 4Y2FA 4MN5A 3ZQ5A 3FG8A 1XJ2A 2Y79A 2P7JA 1MZUA 2KDKA 3E98A 5DFYA 2PD7A 3MR0A 3CLOA 1H3QA 3OC2A 3LR0A 4CLCB 5J4EA 1D06A 3P01A 2WKQA 4LLOB 1OJ5A 2XA7M 2ZBBA 4WEJA 3H82A 2KOIA 4HI4A 3CI6A 2W0NA 2J3TC 4O0PA 3EQUA 5HDDA 5IT5A 4R6LA 3UE3A 1F98A 5FL3A 3H82B 4NXBA 2ZOHA 1XFNA 2VZWA 3EGDC 2VJWA 1OJGA 1LL8A 4Q0JA 3MQOA 1X0OA 3BWLA 3MXQA 3KYZA 5HWTA 4MN7A 5C5KA 3MQ0A 4PKYG 2J3WA 1S4RA 2PD8A 4P6ZM 4F3LB 4DMZA 4YNRA 4HH2A 1N9LA 3ICYA 4PAUA 2ZMVA 1OT6A 4WUJA 2VGLS 3IBJA 4LRXC 4O8GA 3UMDA 3A0RA 4OOMA 4R38A 1OTIA 4JGPA 3KSHA 2FH5A 2PDRA 3PBSA 2PYRA 5HD5A 4EW7A 3E0YA 3LIAA 3HCYA 2JKRI 5HPIA 3OBFA 3CUEC 4HOIA 2JKTI 1TS0A 3EWKA 3V67A 2K2NA 1F9IA 3RH8B 4HQAA 1EW0A 3FPVA 4PKYA 2W3GA 2WKPA 3S7PA 3DBAA 3KYQA 4BWIA 4EQ1A 3NHQA 1XFQA 4WL9A 3LR4A 2PR5A 3PHYA 3B42A 4MDZA 4HHDA 3LYXA 4BMWA 5F5YA 2BASA 4I3JA 1T1AA 3OLOA 5TJJA 2QKPA 1MKMA 3K2NA 4ARZA 5TBMA 2KLIA 3PBOA 3U2AA 1T18A 2VV6A 5F68A 3UB7A 2W3DA 2W3EA 2JHEA 1OTEA 1WA9A 1S67L 2XRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E98 A;  4GLQ A;  5DFY A;  3R4K A;  1YKD A;  4IJG A;  2XRO A;  5AJG A;  2QYB A;  2O99 A;  4G3V A;  1ZTU A;  1MC0 A;  4O01 A;  4CQH A;  3MMH A;  3W2Z A;  5HPF A;  4Q0I A;  3RFB A;  3LFV A;  4G3K A;  2KOI A;  2Y8H A;  3CI6 A;  4MMN A;  3G6O A;  4O0P A;  2O9C A;  1VHM A;  4R6L A;  4QPR A;  4EUV A;  1YSQ A;  1YSP A;  4Z1W A;  2LB9 A;  2VZW A;  2G7U A;  4Y5F A;  2B18 A;  3VV4 A;  2VJW A;  4Q0J A;  5LBR A;  5C5K A;  4MN7 A;  3MQ0 A;  3O5Y A;  1TD5 A;  2W1T A;  3KO6 A;  4DMZ A;  4YNR A;  4MCW A;  3KSI A;  4PAU A;  5I5L A;  3OOV A;  4ZRR A;  2XSS A;  2W1R A;  2ZMF A;  2LB5 A;  3IBJ A;  4LRX C;  4O8G A;  1STZ A;  4G3W A;  2M7V A;  3D3O A;  5DFX A;  3KSH A;  3KSG A;  3NOU C;  4LRY C;  3E0Y A;  2O9A A;  4ETX A;  3HCY A;  5HSQ A;  5K5B A;  2GX5 A;  5HPI A;  3OBF A;  5HL6 A;  4IUH A;  4ETZ A;  2W3H A;  2K2N A;  3TRC A;  4EU0 A;  3IBR A;  4IUK A;  2W3G A;  2IA2 A;  3NOT C;  1F5M A;  3S7P A;  4Q0H A;  2W1T B;  3S7O A;  4R70 A;  3DBA A;  4BWI A;  3MF0 A;  4LRZ E;  3NHQ A;  3S7N A;  3S7Q A;  3BJN A;  4RQ9 A;  3KSF A;  3CIT A;  4ME4 A;  4MDZ A;  5L8M A;  2M7U A;  4DN0 A;  4YOF A;  3NOP C;  2O0Y A;  2O9B A;  2OOL A;  5TJJ A;  4FOF A;  2HGV A;  1MKM A;  3K2N A;  1TF1 A;  4Y3I A;  2K31 A;  2KLI A;  2W3F A;  2VKS A;  4GW9 A;  4E04 A;  2W3D A;  3C2W A;  2W3E A;  4Y2F A;  3EEA A;  3ZQ5 A;  2XRN A;  2Y79 A;  2VEA A; 
#chains in the Genus database with same CATH topology
 5EV0 A;  2GNX A;  4EBL A;  5CHU A;  4ZAM A;  4EER A;  2O99 A;  1GA9 A;  3SOI A;  3SW1 A;  2PRF A;  2WKR A;  5AQA A;  4UQI M;  3VOZ A;  4B93 A;  4WEK A;  2Y8H A;  1XPB A;  3GVB A;  5DKL A;  1E3U A;  1K0K A;  1IKI A;  1K6R A;  4QPR A;  4GHI A;  1LLB A;  3UB5 P;  2EX6 A;  2OV5 A;  3PBT A;  2V0U A;  5HAR A;  3N8L A;  4B9O A;  5DJT A;  2OAQ 1;  4GHI B;  4BJP A;  2QWS A;  4GKU A;  3PR6 A;  3T4L A;  4IBR A;  2V2F F;  2Y2Q A;  3CUE A;  2Y2N A;  2A49 A;  3C7U A;  4DDY A;  1K38 A;  4JF4 A;  2OAP 1;  1SDE A;  3ZCZ A;  4GS9 A;  1XX2 A;  3UO9 A;  3MFD A;  4NXF A;  4UA6 A;  2IWB A;  4ETZ A;  1OTA A;  4DRT A;  2GDN A;  1IOU A;  4QY6 A;  1BT5 A;  3CHW P;  4X25 A;  4EBP A;  1ESI A;  4B88 A;  2ZM8 A;  1GSV A;  3LIC A;  4OVD A;  3Q7V A;  3S7Q A;  3JYI A;  3UME A;  4ME4 A;  1YLP A;  4EEP A;  3H7W A;  3CZD A;  4CLC C;  3NOP C;  2OOL A;  3E4O A;  1XGI A;  3IS2 A;  4HES A;  4JF6 A;  5IU1 A;  1NJ4 A;  3N4I A;  4HNB A;  1W8Y A;  4X69 A;  3A0S A;  3T50 A;  2ZL1 A;  3H7W B;  3R4K A;  3GTC A;  3IS2 B;  4X55 A;  4WZ5 C;  1CJF A;  3MZD A;  1ONH A;  4N92 A;  1ACF A;  4UQI S;  4R3J A;  2W27 A;  3TOI A;  2VGK A;  2J3T D;  1YLT A;  4NXE A;  5EPH A;  3FKV A;  3B33 A;  1WE4 A;  3PYP A;  3ZGA B;  4K08 A;  3MXR A;  4S2K A;  1ZG4 A;  4GD6 A;  5G4Z A;  2OSU A;  1NXY A;  4Y5F A;  1W79 A;  1P9R A;  1T1C A;  5TBM B;  2Z2L B;  2ZC6 B;  2B02 A;  3E4P A;  2ZQA A;  4MNR A;  4OOL A;  2QJ5 A;  1MY8 A;  1ODV A;  2OLU A;  2W1R A;  4LEN A;  3CWF A;  3BEC A;  1K55 A;  3ZFZ A;  5EM0 A;  1WYC A;  2Y2G A;  3SS4 A;  3M6B A;  2PT7 A;  1MXO A;  4P6Z S;  5L10 A;  4LGW A;  2NUP C;  1L0D A;  4JGQ A;  4Y0O A;  1BYW A;  3GEC A;  1ERQ A;  2ZC3 B;  2JC7 A;  3VFF A;  4JGR A;  1S1Y A;  3LR5 A;  1L3L A;  2JN7 A;  5CRF A;  2V0W A;  2Y2M A;  4JBF A;  4Y17 A;  1H5X A;  4EET B;  1CI9 A;  5HAQ A;  1O7E A;  4RQ9 A;  1YLY A;  3RTY A;  4OQI A;  4F94 A;  2J8Y A;  1MWT A;  5FI7 A;  4D60 A;  2HP9 A;  3GV9 A;  1PW8 A;  3IWO A;  4N9K A;  4NG2 A;  1PIO A;  2VEA A;  3HJK A;  1K57 A;  5DF7 A;  3MKE A;  2XD5 A;  2XQZ A;  5FSR A;  3F1P A;  3T4Q A;  3OZH A;  3FC7 A;  5EE8 A;  4LV1 A;  3LFV A;  4KZ7 A;  4G3K A;  2ZOI A;  1YAX A;  4WF0 A;  2ZQ9 A;  3F1P B;  4C6Y A;  3P7N A;  1XXM A;  4PM7 A;  2CC1 A;  3DTK A;  3HLF A;  1IFQ A;  1JWP A;  4RYE A;  4GD8 A;  2EWV A;  1DP9 A;  1RGZ A;  4KZ9 A;  1FCM A;  3BW6 A;  2QPN A;  1KVM A;  1CEG A;  2RL3 A;  4II7 A;  2P08 A;  4HBU A;  1YLJ A;  3QP1 A;  1ZHH B;  2HV1 A;  3N7W A;  3RJU A;  4RVA A;  3KSI A;  1W7F A;  1BLH A;  4I3A A;  4XUZ A;  3W8K A;  3BQA A;  1XJ3 A;  3SH8 A;  2FZ0 A;  3D9Y A;  2ZC5 B;  1M6K A;  5DFX A;  2L1M A;  3BLS A;  4S2P A;  3UB6 A;  2PYP A;  3KSG A;  1I2S A;  4LRY C;  1SKO A;  2E8I A;  3M2J A;  2UV0 E;  3MQQ A;  4OPQ A;  3QP2 A;  4EU0 A;  4ZDX A;  2R9X A;  1SKO B;  3VP2 A;  2ZM0 A;  2EA9 A;  3BFG A;  2W1T B;  5L2F A;  2V1A A;  5FQ9 A;  4R1G A;  3S7N A;  2P9V B;  2VV7 A;  4CLC D;  3U4L P;  3DTM A;  4HBT A;  1XJ4 A;  2H5S A;  2WGV A;  1PI5 A;  1IEL A;  3S22 A;  1NWZ A;  3O88 A;  2XF3 A;  2Z6D A;  3HBR A;  3VFH A;  2A24 B;  4HEF A;  4B4Z A;  5GLC A;  1RCJ A;  4MN5 A;  3FG8 A;  2XDM A;  3VSK A;  4E3N A;  2JKF A;  4R23 A;  4DXB A;  3VP1 A;  3OC2 A;  1D06 A;  4BD1 A;  3P01 A;  5TGF A;  3AGE A;  2KOI A;  4O0P A;  4OQ0 A;  3MS6 A;  5HDD A;  5IT5 A;  4R6L A;  3UE3 A;  3NDE A;  1YM1 A;  3EGD C;  2VJW A;  1X0O A;  1Z6F A;  1FOF A;  5A91 A;  3MXQ A;  5C5K A;  3MQ0 A;  2PD8 A;  4PM5 A;  3C4P A;  4KZ8 A;  4YNR A;  3QP5 A;  4HH2 A;  1N9B A;  4ZTK A;  4OQG A;  2PBD P;  4JPM A;  2Y91 A;  3IQA A;  2ZMV A;  1OT6 A;  1DJC A;  3NBL A;  1IYQ A;  1BLP A;  4OOM A;  3MKF A;  3G2Y A;  4JGP A;  3KSH A;  3PBS A;  3IXB A;  2J7V A;  3LIA A;  1JVJ A;  4WM9 A;  4R0Q A;  5FAO A;  5EUA A;  5FDH A;  4BL3 A;  4ZBE A;  3V67 A;  4WMC D;  1L0G A;  4WZ4 A;  4JXG A;  1CI8 A;  3RH8 B;  5EVI B;  2BLS A;  2ZD8 A;  3FPV A;  4PKY A;  2WKP A;  3S7P A;  2FFY A;  4GDN A;  4BWI A;  2WAF A;  4EQ1 A;  2Y2P A;  2BTF P;  1FCO A;  3B42 A;  4HHD A;  3M6H A;  1MKM A;  4ARZ A;  2G2W A;  3WS4 A;  5GLD A;  1I2W A;  1W8Q A;  1L0F A;  2VV6 A;  3UB7 A;  2W3D A;  1K57 C;  4LCL A;  5I94 A;  3T4S A;  4DJ2 A;  5IS1 A;  4ARZ B;  1VET B;  3E2L A;  4CQH A;  3MMH A;  1E3U D;  3QP8 A;  4MMN A;  2QHK A;  2R78 A;  3G6O A;  3UDX A;  3ZNT A;  4JXW A;  1F2K A;  1A0K A;  2XD1 A;  4BD0 A;  5FAS A;  4XXR A;  2B18 A;  2XK1 A;  3JVV A;  1KDW A;  2Q9N A;  3R7W A;  1TS8 A;  3QHY A;  5L09 A;  3IX4 A;  3CAX A;  5I5L A;  1MWU A;  3G2Z A;  5CTM A;  1J9M A;  3G30 A;  2ZC4 B;  4KZA A;  4ZJ2 A;  3BY9 A;  1ES3 A;  1ESU A;  2J9O A;  1S1Z A;  4GJ4 A;  1GSW A;  2EFU A;  1VEU B;  2IWD A;  1BUE A;  1PYY A;  5EFW A;  1ONG A;  3A0V A;  2HJ9 C;  1SZV A;  4M4X A;  3N8S A;  4OOY A;  1GSX A;  2VA0 A;  2R9W A;  5EVE A;  1H8M A;  3IHA A;  2XR0 A;  5AQ9 A;  4MBF A;  4K91 A;  5CHJ A;  2L4R A;  2A2L A;  4AFI A;  1PWG A;  4OP8 A;  4Y3I A;  2QZ6 A;  3PBN A;  1S66 L;  3OPH A;  1ES4 A;  3IH9 A;  2HDQ A;  3RXX A;  1YKD A;  2XRO A;  1LSX A;  2VK3 A;  3GR2 A;  4HJ4 A;  4Y13 A;  5M18 A;  1MC0 A;  2HP5 A;  1VB6 A;  4O01 A;  3RFB A;  2Z2M B;  1K6S A;  4WEL A;  1KGE A;  5M1A A;  2O9C A;  4X6T A;  1VHM A;  3T1Q B;  4JKT A;  3LO7 A;  1YSQ A;  1N9O A;  3IT9 A;  5FEF A;  3DTE A;  2DMW A;  1GHM A;  2WYX A;  3AGF A;  1TDG A;  4OKP A;  5E2E A;  3MXS A;  3G32 A;  3O5Y A;  2PHY A;  3E4Q A;  3LI9 A;  2XSS A;  3BLM A;  3GSG A;  2LB5 A;  4G3W A;  3IWQ A;  4H6J A;  1LT0 A;  4P85 A;  5EVI C;  1LI9 A;  3ZNY A;  5HFO A;  4KZB A;  3PXP A;  1XJ6 A;  2WZZ A;  4BQM A;  3LI8 A;  5E2F A;  2AVX A;  1AXB A;  4H8R A;  3W4P A;  2Y2K A;  3SS3 A;  4YIN A;  1BZA A;  4X56 A;  1LHY A;  3C5A A;  5DF8 A;  3KX0 X;  4HP4 A;  5A93 A;  1U60 A;  3IXD A;  4GS9 B;  4PPR A;  3IX3 A;  2JE5 A;  1ZKJ A;  3B3X A;  5M19 A;  1T19 A;  4HJ3 A;  3C7V A;  3VP0 A;  3PBR A;  4R3A A;  5AJG A;  2QYB A;  2YKH A;  3T4T A;  1G28 A;  3CG5 A;  3UPN A;  3CPT A;  3N8R A;  1NZO A;  1H0M A;  4I39 A;  5HX9 A;  3C8C A;  4UHU A;  3LID A;  3Q7V B;  3CPT B;  1HTZ A;  2C6W B;  5FQQ A;  5A8B A;  4BLM A;  4GCZ A;  4FSF A;  3T12 B;  3MBZ A;  4KQR A;  1QME A;  4MBK A;  5KSH A;  4QD4 A;  4QY5 A;  3MJQ A;  1JNU A;  1RGY A;  4GZB A;  2ZL1 B;  3BFF A;  3MSH A;  4NXG A;  3LIE A;  3CJM A;  2PBY A;  2WK0 A;  2M7V A;  4E6X A;  3D3O A;  5E43 A;  4DJ3 A;  1NY0 A;  1LSV A;  4NKP A;  1SKF A;  5DTS A;  4DE0 A;  2V9A A;  4CLC E;  3L9K A;  5HL6 A;  1NYY A;  2V8F A;  5L07 A;  2EFX A;  4L9E A;  5HDC A;  3O86 A;  3QNB A;  2IA2 A;  3QNC A;  4OPR A;  4S2N A;  5JYO A;  2ZC7 A;  4LRZ E;  4OON A;  3T4O A;  5HWW A;  3BJN A;  3IXG A;  1EI5 A;  4KQO A;  4FUW A;  3NJA A;  4DE3 A;  1IEM A;  3GMW A;  5TR7 A;  1JWZ A;  1HVB A;  5GHZ A;  3SS5 A;  2E8J A;  5CGS A;  1K4E A;  3LGO A;  1FCN A;  5FQK A;  2VGJ A;  1KVL A;  4K0X A;  5EM1 A;  5EVL A;  3ZQ5 A;  2Y79 A;  1MZU A;  4OLG A;  4C3Q A;  5DFY A;  3CLO A;  2Y2O A;  2A3U A;  5J4E A;  1N4O A;  2WKQ A;  5F82 A;  4WEJ A;  3HLB A;  2W0N A;  3KYE A;  3WRT A;  4IED A;  1YLW A;  4QHC A;  2WAE A;  4NXB A;  1XFN A;  2VZW A;  4ZJ1 A;  1LL8 A;  2ZM2 A;  3FWL A;  1S4R A;  4KG2 A;  3TG9 A;  1ES2 A;  3GRJ A;  4KEN B;  1N9L A;  4FH2 A;  4PM9 A;  1PW1 A;  1VM1 A;  4WUJ A;  1ALQ A;  2ZJ9 A;  5EVI D;  3A0R A;  3LEZ A;  2PDR A;  3PAG A;  1MWR A;  4EW7 A;  3I7J A;  3E0Y A;  3L7H A;  4NK3 A;  4GNU A;  4CPK A;  5HPI A;  3CUE C;  4HOI A;  3EWK A;  3UN7 A;  1HD8 A;  5GLB A;  3NDG A;  4HQA A;  1EW0 A;  2W3G A;  3UNW A;  4OP5 A;  1HLU P;  4DXC A;  3DBA A;  4U0X A;  3NHQ A;  4S2L A;  3LR4 A;  3VP4 A;  2PR5 A;  1PZP A;  3LYX A;  2PAV P;  5F5Y A;  4O7D A;  2QKP A;  5CGX A;  2KLI A;  3N6I A;  3QP4 A;  4GOG A;  5HL1 A;  5F68 A;  3HL9 A;  1S67 L;  3G35 A;  1Y4O A;  1DRM A;  2G2U A;  2EX8 A;  4R4R A;  3WS0 A;  1NRF A;  3LIF A;  5MC7 A;  1C3B A;  1YPR A;  1L0E A;  2GZA A;  3AGD A;  2HZ5 A;  2EX2 A;  4JLF A;  3P09 A;  4BBT A;  4EUV A;  4E3J A;  1LI0 A;  2V1Z A;  3VV4 A;  4HP9 A;  1DY6 A;  1IKG A;  4IBX A;  3SZT A;  5U47 A;  1TD5 A;  3KO6 A;  3ZG5 A;  4E6W A;  4L9F A;  3ZDJ A;  3ZG7 B;  5CED A;  2QJ7 A;  3GQZ A;  4LFU A;  3ZYT A;  4I38 A;  4ZRR A;  1S6R A;  3ZG8 B;  4ID4 A;  3GDI A;  4K0W A;  4DKI A;  3NOU C;  1V9Y A;  1W63 Q;  2M1C A;  1CF0 A;  4IUH A;  2Y2L A;  1PWC A;  5FI6 A;  3Q07 A;  4E3L A;  2EXA A;  5DF9 A;  4PMA A;  4S2N C;  5GHX A;  4BL2 A;  1K55 C;  5CEB A;  3C4O A;  3S7O A;  1T1B A;  4JF5 A;  3A3D A;  1PWD A;  4KG6 A;  2X71 A;  4R3B A;  1YMX A;  4FOF A;  4E3I A;  3T4K A;  2K31 A;  1EWZ A;  2W3F A;  2VKS A;  3FV7 A;  1JTG A;  2OLV A;  3A3J A;  3EEA A;  2Y4A A;  4I3I A;  5KIZ A;  5KZH A;  5EOO A;  3DWK A;  4FD8 A;  4G3V A;  3RXW A;  3Q81 A;  3W4Q A;  3HUM A;  2P74 A;  4EES A;  1YQS A;  4Y0U A;  5EOE A;  4HIA A;  4Q0I A;  1KGG A;  4E3O A;  4P6B A;  3M2K A;  4GB7 A;  2WGI A;  1FQG A;  1AWI A;  4MBH A;  1H8Y A;  4ESP A;  3H9W A;  4WYY A;  3EGX C;  2VGL M;  5IHV A;  3P98 A;  1S4S A;  3VOY A;  4X1M A;  5AQB A;  3C30 A;  3TE8 A;  4M3K A;  2JBF A;  5HAI A;  4NEE D;  3W4O A;  2HDR A;  3ZVW A;  2Y59 A;  2DCF A;  1GCE A;  1TVF A;  2D02 A;  1J3W A;  1KDS A;  3DWZ A;  1BLC A;  3IXH A;  5HSQ A;  5K5B A;  3ITA A;  2GX5 A;  1Y28 A;  1GHP A;  2OWH A;  3UE1 A;  3IBR A;  4IUK A;  1Z09 A;  3BY8 A;  5CEC A;  3R7W B;  4Z9Q A;  4R70 A;  1KE4 A;  3D4F A;  2VX8 A;  3ITB A;  3Q7Z A;  4GN2 A;  3T1R A;  4XUX A;  1O07 A;  1TDL A;  2J80 A;  2O0Y A;  2DRW A;  2HGV A;  1TF1 A;  2V8C A;  2WKH A;  1ZG6 A;  4IVK A;  3C2W A;  4F3L A;  3FYZ A;  5F83 A;  4GLQ A;  5F1F A;  2J9P A;  4IJG A;  5F69 A;  4B4X A;  1OPX A;  3V5M A;  3BFD A;  3W2Z A;  5DTK A;  1YT4 A;  4PM6 A;  3V3R A;  2GJ3 A;  3WS2 A;  5HDS A;  4N9L A;  3B47 A;  4BBV A;  1K56 A;  2LB9 A;  5CGW A;  3PBQ A;  3UE6 A;  5AVE A;  3HUN A;  2D01 A;  3F1N A;  2WGW A;  3HVF A;  2ZQ7 A;  4Y7P A;  3Q82 A;  3S4X A;  4EQI A;  2I9V A;  4YWZ A;  1CQA A;  5DTT A;  1BUL A;  3F1N B;  2WGW B;  1STZ A;  3TW8 A;  5A90 A;  3ZVT A;  1LL5 A;  4U0T A;  2O9A A;  1YMS A;  2HDS A;  5G4Y A;  4FTX A;  4BBU A;  4LV0 A;  1CEF A;  2W3H A;  2KX6 A;  3TRC A;  3LUQ A;  1CK3 A;  4HY8 A;  5AVF A;  2HDU A;  2C5W B;  3O3V A;  3OCL A;  5JYP A;  5TFQ A;  4QJG A;  1UWN X;  3IH8 A;  5FA7 A;  2HP6 A;  4DE1 A;  3FPW A;  4H6J B;  3EQV A;  4OPZ A;  1P97 A;  1S0W A;  4OH0 A;  1XJ2 A;  2P7J A;  2KDK A;  3IF5 A;  2PD7 A;  1H3Q A;  1NYM A;  3IF6 A;  4LLO B;  2XA7 M;  2ZBB A;  3HLE A;  4HI4 A;  5FI2 A;  3IF6 B;  4N1H A;  3G4P A;  2RCX A;  4CJN A;  1F98 A;  5KSC A;  1WYB A;  3BEB A;  2ZOH A;  3VP3 A;  2I72 A;  2PU2 A;  1OJG A;  4Q0J A;  1SDN A;  3BWL A;  5HWT A;  4MN7 A;  2WAD A;  4PKY G;  1BSG A;  2J3W A;  4P6Z M;  5A92 A;  4DMZ A;  3HUO A;  4PAU A;  2X01 A;  4U3T A;  4BEN A;  1GA0 A;  4A5R A;  1I5Q A;  3HLG A;  3BYD A;  3NY4 A;  3IBJ A;  4LRX C;  3UMD A;  3OPP A;  3UE0 A;  4R38 A;  1OTI A;  2FH5 A;  2ZMA A;  3SH7 A;  3WRZ A;  4LCM A;  5GHY A;  4PM8 A;  2H10 A;  1TS0 A;  2PU4 A;  3E2K A;  3G34 A;  1XGJ A;  2WZX A;  4FH4 A;  5GL9 A;  3WS5 A;  1FIL A;  1DJA A;  4X53 A;  1K54 A;  2Q9M A;  3KYQ A;  1IYO A;  5CER A;  3DW0 A;  3PHY A;  3FZC A;  2H0Y A;  3T1S A;  4I3J A;  1T1A A;  4C75 A;  3OLO A;  5TJJ A;  3BM6 A;  5TBM A;  4LV2 A;  3U2A A;  5BOH A;  2W3E A;  1OTE A;  1WA9 A;  2XRN A;  3DTI A;  2B95 A;  3TSG A;  1PFL A;  1K25 A;  3HJI A;  4RX2 A;  1FIK A;  3VSL A;  4JXV A;  1Q2Q A;  5DJU A;  3LEQ A;  2XA7 S;  1LSW A;  3LR3 A;  3K3C A;  3ULF A;  2Y55 A;  5HW3 A;  4LV3 A;  4S2O A;  1P9W A;  1UWP X;  3NI9 A;  3CMZ A;  4UAA A;  1YSP A;  4OLD A;  2ZLY A;  2MJ6 A;  5LBR A;  4IHQ A;  2Q0O A;  5FQJ A;  5DKK A;  1DP6 A;  4N1X A;  3LIB A;  5FAP A;  1NLZ A;  1MBL A;  1KOU A;  1NRJ A;  2HJE A;  4E3M A;  1XP4 A;  2ZMF A;  5F6A A;  3T4J A;  5KMW A;  3UY6 A;  3EEH A;  1TS6 A;  1KE0 A;  3ISG A;  2CMN A;  5GLA A;  4HJ6 A;  3NC8 A;  3VMA A;  4JGO A;  2PR6 A;  1BTL A;  3TJZ C;  1UGU A;  2DNS A;  2XEP A;  4WBG A;  1TS7 A;  2VV8 A;  4KQQ A;  2JKR M;  2XGN A;  3UPO A;  2JKT M;  2L0W A;  4L9G A;  5HD3 A;  1MKI A;  3BQ8 A;  3UPP A;  1NLY A;  3C38 A;  1QMF A;  1G6O A;  2V1B A;  1F5M A;  3PTE A;  1XA1 A;  3VE4 A;  3A3F A;  1KGF A;  3CIT A;  3NIA A;  3VOL A;  5L8M A;  1K4F A;  3UB9 A;  2HF6 A;  2M7U A;  4Y0T A;  4QU3 A;  2B5R A;  1SCW A;  3VE3 A;  2WKI A;  2IWC A;  2OWJ A;  3IF6 C;  4I5S A;  1G6A A;  3SH9 A;  4S2M A;  1PRQ A;  4JXS A;  3DAV A;  4DF6 A;  4GDB A;  2JCH A;  1JTD A;  5HAP A;  3LY4 A;  4EBN A;  3T1X A;  4RX3 A;  2Y2J A;  4QWO A;  2ZQC A;  3A3E A;  4DE2 A;  3Q1F A;  2K7S A;  3ZG0 A;  1JWV A;  2G7U A;  1W63 M;  1ERM A;  5FQI A;  5HZH A;  2P04 A;  4KG5 A;  3K3D A;  4MLL A;  3NEC A;  1TEM A;  3S1Y A;  2W1T A;  1E25 A;  1FR6 A;  4MCW A;  3V3S A;  1P0Z A;  3OOV A;  2P9V A;  3UB8 A;  1OTB A;  3MZF A;  5CX7 A;  1DJB A;  4L0L A;  3WWX A;  3LCE A;  4X68 A;  2NUT C;  2A24 A;  3IX8 A;  4PHT A;  4UEY A;  5FAQ A;  4NET A;  4E3K A;  3F1O A;  1MWS A;  4HH3 A;  1K54 C;  2INW A;  4WLA A;  3WS1 A;  3F1O B;  3HRE A;  5HWV A;  2XFS A;  3KSF A;  1PNE A;  4DN0 A;  2O9B A;  1FSW A;  1HZO A;  2Y2I A;  5D3O A;  4Y15 A;  4GW9 A;  3JVU A;  3BFC A;  3QP6 A;  5FAT A;  3EOI A;  4MEZ A;  2VLG A;  3BRM A;  3IHB A;  4FCF A;  3PAE A;  2XLN A;  3HLW A;  2Z6C A;  1ZTU A;  4P87 A;  2V20 A;  2JKG A;  5HPF A;  2H0T A;  1D7E A;  1Y54 A;  3LY3 A;  2Y2H A;  1K56 D;  5E2G A;  4MN6 A;  4XT2 A;  2XFT A;  4Z1W A;  4WN5 A;  4Q8I A;  2ACG A;  2WKE A;  1XA7 A;  2H28 A;  5EVI A;  3NUL A;  4XT2 B;  3A3I A;  1V9Z A;  1ZC2 A;  4KZ5 A;  4LPZ A;  4ZJ3 A;  4KUK A;  5F1G A;  3V50 A;  5J7E A;  1GHI A;  1BLS A;  3G31 A;  1LL9 A;  1VQQ A;  1NZU A;  4D2O A;  3UDI A;  4KQD A;  5FDS A;  3IWI A;  1N9N A;  5CTN A;  4ETX A;  4UA9 A;  2EXB A;  4RA7 A;  4S2J A;  5CHM A;  4EEU A;  1DP8 A;  1OME A;  2BG1 A;  3MZE A;  1VET A;  4R4S A;  4EXO A;  3D72 A;  3NOT C;  4Q0H A;  4KUO A;  1FR1 A;  3MF0 A;  4OPY A;  1OT9 A;  3OCN A;  5CXW A;  2EWW A;  2QMI A;  1XKZ A;  2HPB A;  3NCK A;  5J3W A;  1PI4 A;  4YOF A;  1G5U A;  2ZQD A;  4YFM A;  4CLC A;  3MFX A;  3V39 A;  1SHV A;  1OTD A;  2YKF A;  4E04 A;  4Y2F A;  3FKW A;  3E98 A;  1H8Z A;  1FSY A;  3MR0 A;  4IVI A;  5E2H A;  2EX9 A;  3LR0 A;  4CLC B;  3UDF A;  3O87 A;  5AQ7 A;  5FEG A;  1OJ5 A;  4WZ5 A;  2WUQ A;  3H82 A;  3CI6 A;  1D1J A;  1ERO A;  2J3T C;  3EQU A;  1L2S A;  3ZHH A;  1VEU A;  5FL3 A;  3H82 B;  1IYP A;  4DDS A;  1M40 A;  3MQO A;  3KYZ A;  4F3L B;  5FQM A;  1MPL A;  1G68 A;  2FFF B;  1PZO A;  3ICY A;  4EWF A;  1RP5 A;  2VGL S;  4O8G A;  1W5D A;  4QB8 A;  4OQH A;  5HD5 A;  2PYR A;  3BFE A;  5EEC A;  3HCY A;  4KZ3 A;  2JKR I;  5G18 A;  1E4D A;  3JPU A;  3OBF A;  4EUZ A;  1ES5 A;  2JKT I;  2K2N A;  4KZ6 A;  1F9I A;  4X1L A;  3HLC A;  1Q2P A;  2UWX A;  3HLD A;  1KE3 A;  4WMC A;  4EV4 A;  3ZG9 B;  2ZQ8 A;  1YLZ A;  1XFQ A;  4WL9 A;  4MDZ A;  4S2I A;  3OPR A;  4BMW A;  2BAS A;  4UA7 A;  1IYS A;  3K2N A;  2X02 A;  3PBO A;  2XH9 A;  5DVA A;  1T18 A;  3OPL A;  4P0M A;  4KZ4 A;  2JHE A;  5J8X A; 
#chains in the Genus database with same CATH homology
 1DRM A;  3T4S A;  4DJ2 A;  2GNX A;  5IS1 A;  3HJI A;  4ARZ B;  4EER A;  2O99 A;  3LIF A;  3SW1 A;  5MC7 A;  5DJU A;  4CQH A;  2WKR A;  3MMH A;  2XA7 S;  1LSW A;  3LR3 A;  4UQI M;  3K3C A;  3ULF A;  4B93 A;  4WEK A;  2Y8H A;  4MMN A;  2QHK A;  2GZA A;  2R78 A;  3G6O A;  5DKL A;  1P9W A;  1UWP X;  4BBT A;  4QPR A;  4EUV A;  4GHI A;  1YSP A;  2B18 A;  3VV4 A;  3PBT A;  3JVV A;  2V0U A;  4HP9 A;  2MJ6 A;  4B9O A;  5LBR A;  5DJT A;  4IHQ A;  2OAQ 1;  4GHI B;  5DKK A;  1DP6 A;  4BJP A;  3R7W A;  2QWS A;  1TD5 A;  3KO6 A;  3LIB A;  4L9F A;  1TS8 A;  1NLZ A;  3PR6 A;  3T4L A;  1KOU A;  2QJ7 A;  3CAX A;  1NRJ A;  2HJE A;  3CUE A;  5I5L A;  3ZYT A;  4I38 A;  4ZRR A;  2ZMF A;  5F6A A;  3T4J A;  3BY9 A;  3EEH A;  1TS6 A;  2OAP 1;  4GS9 A;  3GDI A;  2CMN A;  1S1Z A;  4GJ4 A;  4HJ6 A;  4JGO A;  3NOU C;  1GSW A;  1V9Y A;  1W63 Q;  2PR6 A;  3TJZ C;  1UGU A;  2M1C A;  4NXF A;  1TS7 A;  4ETZ A;  2VV8 A;  4IUH A;  1OTA A;  2JKR M;  2JKT M;  2L0W A;  4L9G A;  1IOU A;  5HD3 A;  3BQ8 A;  5DF9 A;  1NLY A;  3C38 A;  5EFW A;  1G6O A;  2V1B A;  3A0V A;  2HJ9 C;  1F5M A;  1GSV A;  4M4X A;  3LIC A;  3S7O A;  1GSX A;  1T1B A;  2VA0 A;  3S7Q A;  3UME A;  3CIT A;  3VE4 A;  4ME4 A;  3VOL A;  4EEP A;  1H8M A;  5L8M A;  3UB9 A;  2HF6 A;  3H7W A;  4CLC C;  2M7U A;  3NOP C;  2L4R A;  2OOL A;  2A2L A;  3E4O A;  4FOF A;  4AFI A;  3IS2 A;  3T4K A;  4Y3I A;  2K31 A;  3PBN A;  3VE3 A;  1S66 L;  2W3F A;  2VKS A;  5IU1 A;  4HNB A;  3A0S A;  3EEA A;  3T50 A;  4I3I A;  3H7W B;  2OWJ A;  4I5S A;  3R4K A;  1YKD A;  5KIZ A;  3IS2 B;  2XRO A;  1LSX A;  4HJ4 A;  4G3V A;  4EES A;  1MC0 A;  1VB6 A;  4O01 A;  4UQI S;  4HIA A;  4Q0I A;  2W27 A;  3RFB A;  2J3T D;  4NXE A;  4WEL A;  3B33 A;  2O9C A;  3PYP A;  3H9W A;  1VHM A;  4K08 A;  3EGX C;  2VGL M;  2K7S A;  1YSQ A;  1N9O A;  1S4S A;  5G4Z A;  2G7U A;  4Y5F A;  1W63 M;  1P9R A;  1T1C A;  2DMW A;  5TBM B;  5HZH A;  2P04 A;  3C30 A;  3K3D A;  2B02 A;  3E4P A;  3O5Y A;  2W1T A;  2PHY A;  4OOL A;  3E4Q A;  2QJ5 A;  4MCW A;  3TE8 A;  1ODV A;  3LI9 A;  1P0Z A;  3OOV A;  2XSS A;  2W1R A;  3UB8 A;  4NEE D;  2LB5 A;  3CWF A;  1OTB A;  5CX7 A;  4G3W A;  4H6J A;  1LT0 A;  4L0L A;  2PT7 A;  2D02 A;  2NUT C;  2A24 A;  4PHT A;  3PXP A;  4UEY A;  4P6Z S;  5HSQ A;  5K5B A;  2GX5 A;  1XJ6 A;  2NUP C;  1Y28 A;  4JGQ A;  3LI8 A;  1BYW A;  3GEC A;  2OWH A;  3F1O A;  3IBR A;  4JGR A;  1S1Y A;  3LR5 A;  4HH3 A;  2JN7 A;  4IUK A;  2INW A;  2V0W A;  3BY8 A;  4WLA A;  3R7W B;  4R70 A;  3F1O B;  2VX8 A;  4EET B;  5HWV A;  4RQ9 A;  3KSF A;  3RTY A;  3KX0 X;  4HP4 A;  4DN0 A;  2J80 A;  2O0Y A;  2O9B A;  4GS9 B;  2HGV A;  1TF1 A;  4GW9 A;  3JVU A;  3C2W A;  4F3L A;  1T19 A;  4HJ3 A;  2VEA A;  4GLQ A;  3EOI A;  3HJK A;  2VLG A;  3PBR A;  4IJG A;  4R3A A;  5AJG A;  2QYB A;  2YKH A;  3F1P A;  1G28 A;  3T4T A;  5F69 A;  3T4Q A;  2Z6C A;  1OPX A;  1ZTU A;  3FC7 A;  3W2Z A;  5HPF A;  3LFV A;  4G3K A;  4I39 A;  2ZOI A;  1YAX A;  3C8C A;  1D7E A;  4WF0 A;  3LID A;  2GJ3 A;  3F1P B;  3P7N A;  4MN6 A;  4XT2 A;  5HDS A;  5A8B A;  4GCZ A;  3B47 A;  4FSF A;  4BBV A;  4Z1W A;  2LB9 A;  4WN5 A;  1IFQ A;  2EWV A;  1DP9 A;  2H28 A;  3PBQ A;  3UE6 A;  5KSH A;  5AVE A;  3BW6 A;  4XT2 B;  1V9Z A;  2D01 A;  3F1N A;  3MJQ A;  4II7 A;  1JNU A;  2P08 A;  4LPZ A;  4KUK A;  1ZHH B;  2HV1 A;  3KSI A;  5J7E A;  2I9V A;  4YWZ A;  4I3A A;  4NXG A;  3LIE A;  3BQA A;  3F1N B;  1XJ3 A;  2FZ0 A;  1STZ A;  2M7V A;  3D3O A;  3TW8 A;  5DFX A;  4DJ3 A;  2L1M A;  3UB6 A;  2PYP A;  1LSV A;  3KSG A;  4NKP A;  4KQD A;  4LRY C;  1N9N A;  2O9A A;  4ETX A;  2V9A A;  4CLC E;  5G4Y A;  5HL6 A;  4BBU A;  4EEU A;  1DP8 A;  2W3H A;  3MQQ A;  2KX6 A;  3TRC A;  4L9E A;  4EU0 A;  3LUQ A;  5HDC A;  4EXO A;  3D72 A;  2EA9 A;  2IA2 A;  4HY8 A;  3NOT C;  4Q0H A;  2W1T B;  4KUO A;  5AVF A;  2V1A A;  3MF0 A;  4LRZ E;  3T4O A;  3S7N A;  1OT9 A;  5HWW A;  3BJN A;  3OCN A;  3OCL A;  2EWW A;  4KQO A;  1UWN X;  2VV7 A;  3NJA A;  4CLC D;  5J3W A;  1XJ4 A;  3FPW A;  4H6J B;  3EQV A;  4YOF A;  1NWZ A;  4CLC A;  2Z6D A;  3MFX A;  1OTD A;  2A24 B;  2YKF A;  4E04 A;  1P97 A;  4Y2F A;  4MN5 A;  3ZQ5 A;  3FG8 A;  1XJ2 A;  2Y79 A;  2P7J A;  1MZU A;  2KDK A;  3E98 A;  5DFY A;  2PD7 A;  3MR0 A;  3CLO A;  1H3Q A;  3OC2 A;  3LR0 A;  4CLC B;  5J4E A;  1D06 A;  3P01 A;  2WKQ A;  4LLO B;  1OJ5 A;  2XA7 M;  2ZBB A;  4WEJ A;  3H82 A;  2KOI A;  4HI4 A;  3CI6 A;  2W0N A;  2J3T C;  4O0P A;  3EQU A;  5HDD A;  5IT5 A;  4R6L A;  3UE3 A;  1F98 A;  5FL3 A;  3H82 B;  4NXB A;  2ZOH A;  1XFN A;  2VZW A;  3EGD C;  2VJW A;  1OJG A;  1LL8 A;  4Q0J A;  3MQO A;  1X0O A;  3BWL A;  3MXQ A;  3KYZ A;  5HWT A;  4MN7 A;  5C5K A;  3MQ0 A;  4PKY G;  2J3W A;  1S4R A;  2PD8 A;  4P6Z M;  4F3L B;  4DMZ A;  4YNR A;  4HH2 A;  1N9L A;  3ICY A;  4PAU A;  2ZMV A;  1OT6 A;  4WUJ A;  2VGL S;  3IBJ A;  4LRX C;  4O8G A;  3UMD A;  3A0R A;  4OOM A;  4R38 A;  1OTI A;  4JGP A;  3KSH A;  2FH5 A;  2PDR A;  3PBS A;  2PYR A;  5HD5 A;  4EW7 A;  3E0Y A;  3LIA A;  3HCY A;  2JKR I;  5HPI A;  3OBF A;  3CUE C;  4HOI A;  2JKT I;  1TS0 A;  3EWK A;  3V67 A;  2K2N A;  1F9I A;  3RH8 B;  4HQA A;  1EW0 A;  3FPV A;  4PKY A;  2W3G A;  2WKP A;  3S7P A;  3DBA A;  3KYQ A;  4BWI A;  4EQ1 A;  3NHQ A;  1XFQ A;  4WL9 A;  3LR4 A;  2PR5 A;  3PHY A;  3B42 A;  4MDZ A;  4HHD A;  3LYX A;  4BMW A;  5F5Y A;  2BAS A;  4I3J A;  1T1A A;  3OLO A;  5TJJ A;  2QKP A;  1MKM A;  3K2N A;  4ARZ A;  5TBM A;  2KLI A;  3PBO A;  3U2A A;  1T18 A;  2VV6 A;  5F68 A;  3UB7 A;  2W3D A;  2W3E A;  2JHE A;  1OTE A;  1WA9 A;  1S67 L;  2XRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...