3EEAA

The crystal structure of the gaf domain/hd domain protein from geobacter sulfurreducens
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
155
structure length
153
Chain Sequence
ERLSGLTDVDEVIKDLSRLLRKLVKTRWIAVYFFDRRDFAPARSTGLPASFLPVFREMPLAPDKIPLLKSMLRKRQHLMLTDPGSSDLLTPKLRKLLRNLCVLAVPMVVRTQVIGAVFMARTRDNPPFSDAETAIIRDLVSHAALVVSHMQLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords GAF domain/HD domain protein
publication title The crystal structure of the GAF domain/HD domain protein from Geobacter sulfurreducens
rcsb
source organism Geobacter sulfurreducens
total genus 42
structure length 153
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13492 GAF_3 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3eeaA00
4R70A 4G3KA 2O0YA 2Y79A 4IJGA 4R6LA 3W2ZA 3EEAA 3O5YA 3NOUC 2W3GA 4ME4A 1TD5A 3S7PA 5AJGA 2W3FA 3NHQA 4Q0HA 3NOPC 4O8GA 3R4KA 4GLQA 4Q0IA 5I5LA 2K31A 3KSGA 4BWIA 4ZRRA 4O0PA 4Q0JA 5HPFA 4Y2FA 3KSFA 3CI6A 1VHMA 3E0YA 2W3EA 2KLIA 2XROA 3IBRA 2M7UA 4FOFA 3KSIA 4G3WA 2G7UA 3D3OA 3LFVA 1YSQA 2VKSA 4Z1WA 2Y8HA 3KO6A 3K2NA 3OOVA 4RQ9A 4Y3IA 3G6OA 2K2NA 3IBJA 2VJWA 3CITA 5K5BA 3HCYA 5HL6A 3RFBA 5DFYA 1ZTUA 3DBAA 4MCWA 4E04A 4GW9A 2QYBA 5HSQA 4O01A 2IA2A 2W3DA 2ZMFA 3MMHA 5HPIA 1F5MA 5L8MA 2M7VA 2KOIA 3TRCA 2OOLA 2W3HA 2W1RA 3VV4A 4MMNA 3S7NA 2XRNA 4PAUA 5DFXA 3ZQ5A 4EU0A 2VEAA 4Y5FA 2W1TB 4LRZE 1YSPA 4ETZA 1TF1A 4MN7A 1STZA 4LRYC 1YKDA 3S7QA 4DMZA 3BJNA 1MC0A 4QPRA 5TJJA 3C2WA 3KSHA 3MQ0A 2B18A 4EUVA 1MKMA 4IUKA 4LRXC 2LB9A 5LBRA 2O99A 2O9CA 2VZWA 2LB5A 2GX5A 3S7OA 4DN0A 2O9BA 4MDZA 2XSSA 4YNRA 4IUHA 4YOFA 3MF0A 2O9AA 3E98A 4G3VA 2HGVA 4ETXA 3NOTC 5C5KA 2W1TA 3OBFA 4CQHA
chains in the Genus database with same CATH superfamily
4DE0A 4EETB 4MBFA 2QPNA 5EOOA 4LPZA 3S7PA 4HHDA 3MXRA 3SOIA 2V20A 3SS3A 3W4PA 3BQ8A 3PBRA 2EX6A 2OAP1 3CI6A 4KZ5A 2PBYA 3NDGA 3FC7A 3UB6A 5FAQA 2ZC5B 3A3DA 1XA7A 2EX2A 3NULA 5DTKA 4Q8IA 4N1XA 1IYOA 4GS9A 5FQ9A 1VB6A 3CITA 5FASA 1BYWA 1K57C 2QHKA 3HJIA 1RGZA 1K54A 1Y4OA 3LYXA 2V0UA 2I9VA 1TS0A 4PM9A 2ZQ8A 1SCWA 3EQVA 4MMNA 2XRNA 1GA9A 3LGOA 1AWIA 2Y2JA 4X55A 5FDSA 4CLCE 4R3BA 3Q1FA 3L7HA 4FTXA 3GSGA 1HTZA 4JPMA 1VQQA 3OCNA 3C7VA 1LLBA 4F3LA 5GHZA 3IWOA 1JWVA 4Y0TA 4JGOA 1RGYA 3MXQA 1PYYA 1XGIA 1NZOA 4JGQA 2JBFA 1VM1A 4EEUA 3CUEC 1PWDA 3TJZC 1D7EA 3VSLA 5F5YA 4ZJ1A 1GCEA 4IJGA 3H82A 1IYPA 3S4XA 5FEFA 2KX6A 5IU1A 4KUKA 3WS4A 5TBMB 3R7WB 1WE4A 1ERMA 4ZRRA 5AVFA 3C4PA 4QJGA 5HFOA 1WYCA 2PU4A 2XK1A 1V9ZA 2HP9A 5EM1A 4Y13A 3K2NA 4JXGA 4N1HA 3G6OA 2VJWA 3O3VA 4H6JB 3IWQA 1K55C 3WWXA 4LV2A 1LSXA 3MS6A 3O86A 5M1AA 2FZ0A 2H0YA 3IT9A 4NG2A 1BLHA 1BTLA 3S1YA 4AFIA 2OAQ1 1TS6A 2ZM2A 5FI7A 3MFXA 3UY6A 5EFWA 4DDSA 1KE4A 1FSWA 4L9EA 3V5MA 1MBLA 4WL9A 1XKZA 1BUEA 1BLPA 4XT2B 4ZTKA 3VMAA 4BBTA 5J3WA 2ZMVA 3KSHA 4WELA 2Y2IA 2LB9A 4P85A 1VEUA 2XFSA 3HLBA 1NRJA 4X25A 5CX7A 3IHAA 1S0WA 4WZ5C 2XSSA 4MN6A 3QP5A 2Y2MA 3Q7ZA 4YNRA 1I2SA 2QJ5A 2H28A 1KOUA 3A3IA 3IF6A 3PHYA 3TSGA 2PRFA 3NY4A 3N6IA 3E4OA 4DE1A 5C5KA 4WYYA 2J8YA 1JWZA 4NXBA 2XD5A 4U3TA 1S4SA 5A90A 4FCFA 1XFQA 3NOUC 3ZG0A 4EBNA 5EV0A 4C3QA 3ITAA 5JYOA 4BL3A 1H8ZA 2ZQAA 4E3MA 1KGEA 2XROA 3C30A 3QNCA 4KQDA 4KZ8A 3UMEA 5F83A 5E2EA 1E25A 1ES5A 2K2NA 4CLCD 3HCYA 3DTEA 3T12B 3FPWA 3UPPA 5EPHA 2QYBA 4E3LA 4KZ6A 3UB9A 1YLWA 2QKPA 2PYPA 2L4RA 3HUNA 4U0TA 1K57A 2JKTM 1YSPA 1PRQA 3C7UA 2XA7M 3IXDA 5M19A 4MLLA 2P04A 1ES3A 3W4OA 4OOYA 1NY0A 3S22A 2B18A 3HLEA 1XX2A 5LBRA 4C6YA 1W63Q 5KSHA 3ZG9B 2JKGA 1SDNA 3C38A 1ALQA 4OQIA 2ZD8A 3HLCA 5FQJA 1LT0A 5GHXA 3SS5A 1D06A 1S67L 2VV8A 3VOZA 4ETXA 4DDYA 4E3KA 4QWOA 2OWJA 3W2ZA 1GSVA 2P9VB 5J7EA 4R4RA 3T50A 4UHUA 5I5LA 1HZOA 4N9KA 2VGKA 4YINA 2XGNA 3IF5A 3CUEA 4K08A 4Y0OA 1SKOA 2WKPA 1NWZA 4HEFA 3T4JA 3KSFA 4ZAMA 1VHMA 1H8YA 5AQ9A 4WM9A 3ZFZA 4E3JA 4NXGA 4PKYG 3QP4A 3T4OA 2VKSA 3OPLA 4Z1WA 4HIAA 3RJUA 5EUAA 1P9RA 2GNXA 4MNRA 1FOFA 4DXBA 3PYPA 5GLDA 4EWFA 1S1ZA 1IEMA 1CI9A 5HPIA 2OWHA 1UWNX 1ERQA 4I5SA 3LO7A 4ZBEA 4II7A 3UNWA 4OOLA 1K55A 2GZAA 4Y5FA 1OMEA 1E4DA 1WA9A 4MN7A 3LIBA 1T19A 4BD1A 4DMZA 4WLAA 2VV6A 3E2LA 3M6HA 5AQAA 3VSKA 4B93A 3ULFA 5DF7A 5L2FA 1KVMA 5I94A 1BT5A 4R23A 2A24B 2J7VA 3BECA 1W79A 1TDLA 4WN5A 4RX2A 4G3KA 3OCLA 4HESA 5A8BA 5GLCA 4ME4A 4WZ5A 4DE3A 5AJGA 2INWA 1G28A 3E2KA 4OQHA 2HV1A 4KG2A 4M4XA 4P6ZS 4N92A 2Z6CA 3A0SA 3G30A 3AGDA 4ZJ3A 2V1AA 2JCHA 1D1JA 3IX3A 4S2PA 3D4FA 3A3FA 4UA7A 3TG9A 2WGIA 4OOMA 3C5AA 1OTEA 3PBOA 2V9AA 3QP8A 4S2LA 3MBZA 3T1XA 1O7EA 2VX8A 1ESUA 2D02A 2JKTI 1SZVA 1EI5A 3Q7VB 2E8JA 4BLMA 5FAOA 1V9YA 5DTSA 3QP1A 1DY6A 4HI4A 3NECA 2UV0E 4P6ZM 3PAEA 3ZQ5A 1K38A 1QMFA 4GD6A 5DF9A 4FH4A 3T4QA 4A5RA 1Q2QA 1NLZA 4KZBA 4ARZA 5HAQA 1STZA 3OPRA 4LRYC 3S7QA 2B95A 2XDMA 1YQSA 3BJNA 4R3AA 5E2FA 3LIAA 3LR3A 1T1BA 3LR4A 5J4EA 1BLCA 1FILA 2JKFA 4IUKA 3E4QA 3N8LA 1IKGA 3F1NA 2HP5A 1ZKJA 1Y28A 3GQZA 4UAAA 4OH0A 4WZ4A 4GKUA 1G68A 3T1SA 2HDSA 2JHEA 1GSXA 4G3VA 4EQIA 5FDHA 3IQAA 5MC7A 3IF6C 4WEJA 2QWSA 3CAXA 4JBFA 5G4YA 4PM8A 3O87A 1FSYA 4Y0UA 5DTTA 2PBDP 4WMCD 4LV0A 2W3FA 4K0WA 3P01A 4PM5A 1L0DA 2Q0OA 2R78A 4MN5A 4PKYA 5EVLA 1YPRA 3IXHA 4IBRA 1YSQA 4X1LA 4MEZA 1TVFA 5HAIA 2WK0A 3Q81A 4EERA 3DWZA 3PAGA 3PBNA 2Q9NA 1CI8A 3BFGA 5FEGA 1ZTUA 5A92A 2ZL1A 1ZC2A 4E3OA 2IA2A 4GOGA 2BTFP 4R3JA 1NLYA 5KMWA 1YT4A 5EVID 2Y2OA 2OOLA 3ZCZA 2V8FA 1H3QA 1OT6A 4PAUA 3BFDA 2ZMAA 5GL9A 4EU0A 3VP2A 5G18A 3M2KA 3EGDC 4PM6A 2JC7A 1XJ3A 4CLCA 1LSWA 4Y17A 3A3JA 4S2KA 3C2WA 3WS0A 2EX9A 1J3WA 4EUVA 4LFUA 2ZC3B 5A91A 1OPXA 2O99A 2WKQA 2LB5A 2GX5A 2Z2MB 1PNEA 2PD8A 4DN0A 4M3KA 3NIAA 3UB8A 5J8XA 1PI5A 4FD8A 4N9LA 2VGJA 4C75A 4GN2A 1DP9A 4GS9B 1ESIA 3BEBA 5EE8A 2W3GA 2WADA 1NRFA 4QD4A 3IXGA 3BY9A 3FG8A 3FZCA 3KSGA 3LICA 1BSGA 3QHYA 5KZHA 4DJ2A 1E3UD 3MFDA 2BG1A 3F1OA 4Y7PA 3C4OA 1L0GA 1PWGA 1YLJA 5CXWA 4EV4A 1XXMA 3BY8A 3N8RA 3LFVA 3MJQA 3LIDA 4KQQA 2Y8HA 2IWBA 3VOLA 2HJ9C 4Y3IA 1PIOA 4EBPA 3RFBA 2WAEA 1CF0A 3PBSA 4JXVA 4F3LB 1K56D 2NUTC 4HY8A 3VP4A 2W3DA 4R1GA 3F1PA 4JGRA 5F6AA 2XFTA 2YKHA 1NYMA 4JGPA 5IT5A 4ZDXA 2Y2KA 3BWLA 3GMWA 2W3HA 5F1FA 3UN7A 3ICYA 3JVUA 4OONA 4EEPA 3H9WA 5DFXA 4OQGA 4O7DA 4QB8A 4X56A 1VETA 3H82B 1Z6FA 4QHCA 2ZM0A 1XGJA 1TEMA 3UPNA 1QMEA 1NZUA 4OPQA 5HZHA 3ZNTA 3FWLA 1MY8A 2Y2LA 3UPOA 4CPKA 1CEGA 1HLUP 2AVXA 4R0QA 3CWFA 3UB5P 4KENB 4B4XA 1FR6A 4BD0A 4BL2A 4X69A 3BQAA 2H10A 2VGLS 3V3RA 1TD5A 5CRFA 1F9IA 3WS2A 2ZQ7A 3IHBA 5FQQA 5HL1A 2EXAA 3W4QA 4HQAA 3CPTA 2ZC6B 4DE2A 2A49A 2XQZA 2IWCA 4NXEA 1EWZA 4Y2FA 4R38A 1LSVA 2WKHA 2XF3A 3ZGAB 3D3OA 1L2SA 1A0KA 3QP2A 3BYDA 2PU2A 5HWTA 2G2WA 3DTKA 2H0TA 2JN7A 5CEBA 3V3SA 4D60A 1RCJA 4EW7A 2J3TD 1VEUB 2XA7S 3C8CA 4O01A 3ZG7B 3N8SA 3UE1A 1L0EA 5L8MA 2J3WA 2VGLM 5HWVA 1JWPA 2FFYA 3IF6B 4LGWA 3OC2A 1PWCA 4I3AA 2W0NA 4NXFA 1YKDA 1TS8A 2Y2HA 2YKFA 2GJ3A 5DKKA 3KYQA 1AXBA 4KQRA 4WBGA 4HP4A 2P7JA 4BQMA 4R4SA 3UDIA 1K6SA 4PMAA 3ZDJA 5A93A 4GDNA 2O9BA 3SH9A 3UDFA 3U4LP 1IYQA 4HJ6A 1FIKA 4YOFA 3MF0A 2O9AA 5U47A 5CGWA 1YLYA 4OLGA 1DJCA 2R9XA 3JPUA 3TOIA 3B42A 1H8MA 2JKRM 1CEFA 1W5DA 5FQMA 3NOPC 1I2WA 1K4FA 3MSHA 4GLQA 4OPYA 4Q0IA 5DF8A 5HWWA 2K31A 2QJ7A 4KZ7A 1CK3A 4O0PA 4I38A 5DKLA 3BFFA 5TFQA 3DTMA 5CHJA 2VK3A 3HUMA 3WS5A 3GECA 3MQOA 2BLSA 1LL9A 2M1CA 3K3DA 4EBLA 1OTAA 4S2OA 4RQ9A 2NUPC 3VP0A 3N4IA 1ODVA 3IS2A 4I3IA 5HL6A 3LR0A 4GHIA 4E3NA 2QMIA 5DFYA 2KDKA 4UA6A 4JF4A 4XXRA 4RYEA 4S2NC 5CEDA 3T4KA 1L0FA 3VV4A 3MXSA 5DJUA 1T18A 4OLDA 3DAVA 3KYEA 1DJAA 4JF6A 5EOEA 4X68A 3ZHHA 4CLCC 3LCEA 3SW1A 1SKOB 2PHYA 4LCLA 1RP5A 5EVIA 4LV3A 4MDZA 1MWTA 1YM1A 1P9WA 4GZBA 1F98A 3ZNYA 1ONHA 1YLZA 3ZYTA 5F82A 3FYZA 2OSUA 4IHQA 2ZBBA 2W1TA 2EX8A 3OBFA 1LL5A 3HLFA 4R70A 4R6LA 4UEYA 3O5YA 1NJ4A 1KE0A 4EESA 3DWKA 1TDGA 3K3CA 1ZG6A 3VFFA 2ZQ9A 1CQAA 2WGWA 1XJ4A 4Q0JA 5KIZA 4L9GA 3SZTA 5CECA 2W27A 1XPBA 2HJEA 2EFXA 3MZDA 2G7UA 4F94A 1NXYA 1YLTA 1F2KA 2D01A 1M40A 3OOVA 4KUOA 5FSRA 2V1ZA 3HLDA 1XJ2A 3LI8A 2WZZA 3ZVTA 4GW9A 1MWSA 3MMHA 1KGGA 1E3UA 1F5MA 2WGVA 4GB7A 2WGWB 3KX0X 3AGFA 3GTCA 3TW8A 1WYBA 3Q07A 3A0RA 4JXSA 1CJFA 5CERA 3FKVA 1N9NA 4DXCA 3NJAA 3PTEA 4LV1A 2J80A 3EQUA 3NCKA 3AGEA 3EGXC 4FUWA 2ACGA 4E6WA 2WKIA 1OTBA 1PI4A 4KZ4A 4B88A 3BFEA 5IS1A 1K56A 1M6KA 1OTIA 4LRXC 5FI2A 3LEQA 2VZWA 3B47A 4ZJ2A 3S7OA 3HREA 5FI6A 5HD3A 5L09A 5CGXA 1ZHHB 2JKRI 1W8YA 4IUHA 5GLBA 4NETA 3NDEA 3MQQA 3H7WA 5TR7A 4RA7A 3HUOA 2ZOIA 4MBHA 3O88A 5DJTA 4HH3A 1PFLA 4BENA 1S66L 4Q0HA 2E8IA 4HNBA 4NK3A 3R4KA 2OLUA 2OLVA 3UE0A 3CHWP 4CJNA 3U2AA 3CZDA 4YWZA 3NI9A 3UE6A 3FPVA 4BBVA 1DP8A 4OPZA 4P0MA 4BBUA 4D2OA 4QY5A 4ARZB 2WKRA 2EA9A 3GVBA 3OPHA 3B3XA 4P87A 1MWRA 3PR6A 5DVAA 3GRJA 1NYYA 1ONGA 4X1MA 4E04A 3F1NB 4RVAA 1Y54A 2B5RA 1DJBA 4MBKA 3RH8B 3VOYA 2DNSA 3IH8A 5HW3A 2V2FF 4ETZA 4JLFA 2K7SA 4KZ9A 4S2NA 3UDXA 3RXXA 2HDUA 2XR0A 1N9BA 2V8CA 1MKMA 4BMWA 2XH9A 1OT9A 1MZUA 4DJ3A 1K25A 4K0XA 3LR5A 3IX4A 3Q82A 1MKIA 4OQ0A 2V0WA 1Z09A 3E98A 4BJPA 1ES4A 2HGVA 1K4EA 4KQOA 4HJ3A 3IX8A 5FQKA 1JTGA 2Y2NA 3ITBA 3NHQA 3LY4A 1IKIA 1PW8A 2ZL1B 4O8GA 5TGFA 3FV7A 2FH5A 3G34A 4JXWA 2ZQDA 3G4PA 3EOIA 1L3LA 2Y2PA 5FQIA 4I39A 2ZC7A 4S2IA 2P74A 2WYXA 3BLSA 3IBRA 3HLGA 4FOFA 4FH2A 2ZLYA 1DRMA 4CLCB 1XFNA 3EWKA 4FSFA 3E4PA 3WS1A 5FATA 3UMDA 3RTYA 3ISGA 1IYSA 4MCWA 1GSWA 5TBMA 3R7WA 1U60A 3GR2A 3WRZA 2ZMFA 4HJ4A 5AVEA 2WKEA 2M7VA 2KOIA 4I3JA 5L10A 2L1MA 2Y59A 3S7NA 5EVEA 4PHTA 3NBLA 4PPRA 4Z9QA 1N9LA 4RX3A 1FCNA 3VP3A 3HBRA 1MC0A 3T1QB 5HX9A 4H6JA 5HAPA 1PZOA 1OJ5A 3IH9A 4HBUA 3HJKA 3F1OB 4GNUA 1DP6A 1J9MA 4B4ZA 1S4RA 3NC8A 5EVIC 3OPPA 2BASA 5AQBA 4ESPA 3V67A 1XJ6A 5AQ7A 2HP6A 4YFMA 1BLSA 1I5QA 1XP4A 4OVDA 4XT2A 2WAFA 1SHVA 2Y91A 1XA1A 3PBTA 3F1PB 5F69A 1FQGA 3BLMA 2ZC4B 2EWVA 3OZHA 1KVLA 2WUQA 5HPFA 3P98A 1LHYA 1Q2PA 3L9KA 2X71A 3IWIA 4OKPA 5EM0A 2JE5A 2PR5A 2C6WB 3HLWA 1VETB 1YLPA 4HBTA 3MZFA 3PBQA 2PAVP 2ZJ9A 3CJMA 2ZM8A 2FFFB 2X01A 1MPLA 3LUQA 5GHYA 3TE8A 3ZG8B 4GJ4A 2VEAA 1ACFA 1TF1A 4S2JA 1G6OA 4IVIA 3QNBA 1P0ZA 1S1YA 3EEHA 4KG6A 3BRMA 2PDRA 4GDBA 4EXOA 4WF0A 3CPTB 1FCMA 1LL8A 3VE4A 5HDDA 3LIEA 4KZAA 4WEKA 5BOHA 3QP6A 3CLOA 4IBXA 2X02A 2V1BA 4GCZA 3BW6A 1O07A 2P08A 4JF5A 4JKTA 4GD8A 5F1GA 4UQIS 3NOTC 1T1AA 4CQHA 1N4OA 2O0YA 2Y79A 5CGSA 1KDWA 1UGUA 4HH2A 1SDEA 2Y2QA 5FL3A 1GHPA 3MKFA 3WRTA 2Q9MA 5E2HA 2EFUA 5HARA 3N7WA 4BWIA 3UO9A 3V50A 3SH7A 4EUZA 1JNUA 3E0YA 2KLIA 2M7UA 2IWDA 3M2JA 3G2YA 3G2ZA 3PXPA 4L9FA 1YMSA 5CHMA 1PZPA 3BM6A 4Y15A 4UQIM 2P9VA 3KYZA 3BFCA 2RCXA 5HSQA 1YMXA 3LIFA 5JYPA 1GA0A 3MZEA 4HOIA 4DKIA 3P09A 3LI9A 2XEPA 2A3UA 1BULA 2Y4AA 2W1RA 3P7NA 2J9PA 3VE3A 3T4LA 5FAPA 3UB7A 4WMCA 5CTMA 4QY6A 2PD7A 4XUZA 4QPRA 3V39A 5CTNA 1MWUA 1P97A 3G35A 1T1CA 2J3TC 3VFHA 3T1RA 2OV5A 3LEZA 1W8QA 2XLNA 4QU3A 3HL9A 1K0KA 1C3BA 1HVBA 5HDSA 2L0WA 3IS2B 5EECA 2I72A 2PT7A 3EEAA 4UA9A 5G4ZA 1S6RA 1MXOA 2G2UA 4GHIB 2HPBA 5CHUA 2EWWA 1FCOA 3JVVA 3A3EA 3MKEA 3D72A 1IFQA 2GDNA 3CMZA 3OLOA 2W3EA 1K54C 3KSIA 4G3WA 3FKWA 2A24A 1KE3A 5E43A 4WUJA 1ZG4A 1EW0A 2Z2LB 1SKFA 5K5BA 5KSCA 4OP8A 1GHIA 3DBAA 2HDQA 5FA7A 4EQ1A 1LI0A 3CG5A 2Y2GA 3VP1A 3GDIA 4E6XA 5EVIB 3LY3A 1N9OA 1KGFA 2EXBA 5HD5A 2ZQCA 2CC1A 2Y55A 1W7FA 3RXWA 5GLAA 4PM7A 2W1TB 2B02A 2RL3A 2HDRA 3GV9A 4NKPA 1GHMA 5TJJA 4HP9A 1H0MA 3D9YA 4X53A 2DMWA 4OPRA 2J9OA 3Q7VA 2DRWA 5F68A 1G5UA 1LI9A 2QZ6A 1K6RA 4ID4A 3A0VA 3SS4A 1IELA 1FR1A 2UWXA 4B9OA 4DF6A 1G6AA 2XD1A 4K91A 2VLGA 2A2LA 1UWPX 5E2GA 2C5WB 1OJGA 5HDCA 3DTIA 1BZAA 3G32A 3ZG5A 3T4TA 4LCMA 1JTDA 3ZVWA 2R9WA 4LENA 3DW0A 5D3OA 4E3IA 4DRTA 1YAXA 3B33A 3KO6A 4LLOB 5L07A 3IBJA 1ES2A 2Z6DA 4S2MA 1W63M 2VA0A 1JVJA 2HZ5A 4NEED 4IEDA 3HVFA 2PYRA 3SH8A 3MR0A 3TRCA 3I7JA 4KG5A 3JYIA 3H7WB 3IXBA 4OP5A 2WZXA 4LRZE 3M6BA 2PR6A 4X6TA 2MJ6A 2DCFA 2VV7A 4XUXA 3T4SA 1EROA 1X0OA 4P6BA 4KZ3A 3MQ0A 1KDSA 2H5SA 1PW1A 4H8RA 1TS7A 5IHVA 2O9CA 1IOUA 4L0LA 2ZOHA 4U0XA 1H5XA 3UE3A 2HF6A 2CMNA 3G31A 3W8KA 5M18A 4IVKA 1OTDA 1HD8A
chains in the Genus database with same CATH topology
4G3KA 4EETB 1H8MA 2JKRM 3OCLA 5A8BA 4ME4A 4LPZA 3S7PA 5AJGA 4XT2A 2INWA 3NOPC 4HHDA 4GLQA 4Q0IA 5HWWA 1G28A 3PBTA 2K31A 3F1PB 4P6ZS 2HV1A 3BQ8A 4M4XA 5F69A 2QJ7A 3PBRA 2OAP1 4O0PA 4I38A 5DKLA 2Z6CA 3A0SA 2EWVA 5HPFA 3CI6A 2V1AA 3FC7A 3UB6A 3GECA 2PR5A 3MQOA 2M1CA 3K3DA 1OTAA 4RQ9A 2NUPC 3PBQA 1ODVA 3IS2A 4OOMA 4GS9A 1OTEA 3PBOA 1VB6A 2V9AA 3CITA 1BYWA 4I3IA 5HL6A 3LR0A 4GHIA 2QHKA 3HJIA 5DFYA 2KDKA 2VX8A 3LYXA 2D02A 2JKTI 2I9VA 2V0UA 3T4KA 1TS0A 1V9YA 3EQVA 3VV4A 3LUQA 4HI4A 4MMNA 5DJUA 3TE8A 1T18A 2XRNA 4P6ZM 3ZQ5A 4GJ4A 5DF9A 2VEAA 3T4QA 1TF1A 1NLZA 4ARZA 1STZA 4LRYC 1G6OA 3S7QA 4CLCE 1P0ZA 3BJNA 1S1YA 4R3AA 3LIAA 3EEHA 3LR3A 1T1BA 3LR4A 5J4EA 2PDRA 4CLCC 4EXOA 4IUKA 3E4QA 3OCNA 4WF0A 1LL8A 3F1NA 5HDDA 3VE4A 3SW1A 3LIEA 4F3LA 4WEKA 1Y28A 2PHYA 3CLOA 4MDZA 4JGOA 3MXQA 1P9WA 2V1BA 4GCZA 1F98A 2P08A 3BW6A 3ZYTA 2JHEA 4JGQA 1GSXA 4G3VA 4IHQA 4EEUA 4UQIS 3CUEC 2ZBBA 3NOTC 1T1AA 2W1TA 5MC7A 3TJZC 4WEJA 3OBFA 2QWSA 1D7EA 3CAXA 4CQHA 5F5YA 4R70A 4R6LA 2O0YA 2Y79A 4IJGA 4UEYA 5G4YA 3H82A 3O5YA 1UGUA 4HH2A 2KX6A 5IU1A 5FL3A 4KUKA 2W3FA 4EESA 5TBMB 3R7WB 3K3CA 3P01A 4BWIA 4ZRRA 5AVFA 1XJ4A 4Q0JA 2R78A 4L9GA 5KIZA 4MN5A 2W27A 1JNUA 4PKYA 3E0YA 2KLIA 1V9ZA 2HJEA 2M7UA 2G7UA 1YSQA 2D01A 3K2NA 3OOVA 4KUOA 3PXPA 4L9FA 4EERA 3G6OA 2VJWA 3PBNA 1XJ2A 4H6JB 4UQIM 1ZTUA 3LI8A 1LSXA 3KYZA 4GW9A 5HSQA 2IA2A 3MMHA 2FZ0A 3LIFA 1F5MA 1NLYA 3KX0X 4HOIA 3LI9A 2OOLA 4AFIA 2W1RA 3P7NA 1H3QA 1OT6A 2OAQ1 3TW8A 1TS6A 3VE3A 3MFXA 3A0RA 3T4LA 4PAUA 5EFWA 4EU0A 1N9NA 3UB7A 3NJAA 4L9EA 3EGDC 2J80A 3EQUA 3EGXC 4WL9A 1XJ3A 4CLCA 2PD7A 1LSWA 1OTBA 4QPRA 4XT2B 4BBTA 1P97A 5J3WA 3C2WA 2ZMVA 3KSHA 4WELA 5IS1A 4EUVA 1T1CA 1OPXA 1OTIA 4LRXC 2LB9A 2O99A 2J3TC 2VZWA 2WKQA 3B47A 2LB5A 2GX5A 3S7OA 1NRJA 5CX7A 2PD8A 4DN0A 5HD3A 2XSSA 1ZHHB 4MN6A 2JKRI 4YNRA 2QJ5A 4IUHA 2H28A 1KOUA 3UB8A 3PHYA 3MQQA 3H7WA 3E4OA 2ZOIA 5C5KA 5HDSA 2L0WA 5DJTA 3IS2B 4NXBA 1DP9A 4GS9B 2PT7A 1S4SA 3EEAA 4HH3A 1XFQA 3NOUC 2W3GA 5G4ZA 4GHIB 1S66L 4Q0HA 3BY9A 4HNBA 3R4KA 3FG8A 2EWWA 3KSGA 3LICA 3JVVA 3U2AA 4YWZA 3D72A 4DJ2A 1IFQA 3UE6A 3FPVA 3F1OA 3OLOA 4BBVA 1DP8A 2W3EA 2XROA 3C30A 3BY8A 4KQDA 4BBUA 3KSIA 4G3WA 3LFVA 2A24A 3UMEA 3MJQA 4ARZB 3LIDA 2WKRA 2Y8HA 2EA9A 4WUJA 3VOLA 1EW0A 2HJ9C 4Y3IA 3PR6A 2K2NA 4CLCD 5K5BA 3HCYA 3RFBA 3FPWA 3DBAA 4E04A 3F1NB 3PBSA 4EQ1A 2QYBA 4F3LB 2NUTC 4HY8A 2W3DA 3GDIA 5F6AA 3F1PA 4JGRA 2YKHA 4JGPA 1N9OA 5IT5A 3RH8B 3UB9A 3BWLA 5HD5A 2W3HA 2QKPA 3ICYA 2PYPA 3JVUA 4EEPA 2L4RA 3H9WA 5DFXA 2JKTM 2W1TB 1YSPA 4ETZA 2B02A 2XA7M 2K7SA 3H82B 4NKPA 2P04A 5TJJA 2B18A 4HP9A 1MKMA 4BMWA 1OT9A 5LBRA 5HZHA 1W63Q 1MZUA 5KSHA 4DJ3A 2DMWA 3LR5A 3C38A 5F68A 1LT0A 2V0WA 3CWFA 3A0VA 3E98A 1D06A 1S67L 4BJPA 2VV8A 2HGVA 4ETXA 4KQOA 4B9OA 4HJ3A 2OWJA 3W2ZA 2VLGA 3BQAA 2VGLS 2A2LA 1TD5A 3NHQA 1GSVA 5J7EA 1UWPX 4O8GA 1F9IA 3T50A 5I5LA 4HQAA 1OJGA 5HDCA 2FH5A 4NXEA 3CUEA 4K08A 2WKPA 1NWZA 4Y2FA 3T4JA 3KSFA 4R38A 3EOIA 1VHMA 1LSVA 3T4TA 4I39A 3IBRA 4FOFA 4NXGA 4PKYG 3D3OA 1YAXA 3T4OA 2VKSA 4Z1WA 1DRMA 3B33A 3KO6A 4HIAA 4CLCB 1XFNA 3EWKA 4FSFA 5HWTA 3E4PA 4LLOB 3IBJA 1P9RA 2JN7A 2GNXA 3UMDA 3RTYA 3PYPA 2Z6DA 1W63M 2VA0A 4MCWA 4EW7A 2J3TD 1GSWA 2XA7S 3C8CA 4O01A 5TBMA 3R7WA 4NEED 1S1ZA 2ZMFA 4HJ4A 5HPIA 5AVEA 5L8MA 2PYRA 2J3WA 2M7VA 2OWHA 2KOIA 1UWNX 4I3JA 2VGLM 5HWVA 2L1MA 3MR0A 4I5SA 3TRCA 3S7NA 4II7A 3OC2A 4OOLA 3H7WB 4PHTA 2GZAA 4Y5FA 4I3AA 4LRZE 1WA9A 2W0NA 1N9LA 4MN7A 2PR6A 4NXFA 3LIBA 1T19A 1YKDA 1TS8A 2MJ6A 4DMZA 4WLAA 2YKFA 2VV6A 2VV7A 3T4SA 2GJ3A 1MC0A 1X0OA 5DKKA 3KYQA 3MQ0A 4HP4A 4H6JA 2P7JA 4B93A 3ULFA 1TS7A 1OJ5A 2O9CA 1IOUA 4L0LA 2ZOHA 3HJKA 3F1OB 2O9BA 1DP6A 3UE3A 1S4RA 4HJ6A 2HF6A 2CMNA 2BASA 4YOFA 3MF0A 2O9AA 3V67A 1XJ6A 2A24B 1OTDA 3B42A 4WN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R70 A;  4G3K A;  2O0Y A;  2Y79 A;  4IJG A;  4R6L A;  3W2Z A;  3EEA A;  3O5Y A;  3NOU C;  2W3G A;  4ME4 A;  1TD5 A;  3S7P A;  5AJG A;  2W3F A;  3NHQ A;  4Q0H A;  3NOP C;  4O8G A;  3R4K A;  4GLQ A;  4Q0I A;  5I5L A;  2K31 A;  3KSG A;  4BWI A;  4ZRR A;  4O0P A;  4Q0J A;  5HPF A;  4Y2F A;  3KSF A;  3CI6 A;  1VHM A;  3E0Y A;  2W3E A;  2KLI A;  2XRO A;  3IBR A;  2M7U A;  4FOF A;  3KSI A;  4G3W A;  2G7U A;  3D3O A;  3LFV A;  1YSQ A;  2VKS A;  4Z1W A;  2Y8H A;  3KO6 A;  3K2N A;  3OOV A;  4RQ9 A;  4Y3I A;  3G6O A;  2K2N A;  3IBJ A;  2VJW A;  3CIT A;  5K5B A;  3HCY A;  5HL6 A;  3RFB A;  5DFY A;  1ZTU A;  3DBA A;  4MCW A;  4E04 A;  4GW9 A;  2QYB A;  5HSQ A;  4O01 A;  2IA2 A;  2W3D A;  2ZMF A;  3MMH A;  5HPI A;  1F5M A;  5L8M A;  2M7V A;  2KOI A;  3TRC A;  2OOL A;  2W3H A;  2W1R A;  3VV4 A;  4MMN A;  3S7N A;  2XRN A;  4PAU A;  5DFX A;  3ZQ5 A;  4EU0 A;  2VEA A;  4Y5F A;  2W1T B;  4LRZ E;  1YSP A;  4ETZ A;  1TF1 A;  4MN7 A;  1STZ A;  4LRY C;  1YKD A;  3S7Q A;  4DMZ A;  3BJN A;  1MC0 A;  4QPR A;  5TJJ A;  3C2W A;  3KSH A;  3MQ0 A;  2B18 A;  4EUV A;  1MKM A;  4IUK A;  4LRX C;  2LB9 A;  5LBR A;  2O99 A;  2O9C A;  2VZW A;  2LB5 A;  2GX5 A;  3S7O A;  4DN0 A;  2O9B A;  4MDZ A;  2XSS A;  4YNR A;  4IUH A;  4YOF A;  3MF0 A;  2O9A A;  3E98 A;  4G3V A;  2HGV A;  4ETX A;  3NOT C;  5C5K A;  2W1T A;  3OBF A;  4CQH A; 
#chains in the Genus database with same CATH topology
 4DE0 A;  4EET B;  4MBF A;  2QPN A;  5EOO A;  4LPZ A;  3S7P A;  4HHD A;  3MXR A;  3SOI A;  2V20 A;  3SS3 A;  3W4P A;  3BQ8 A;  3PBR A;  2EX6 A;  2OAP 1;  3CI6 A;  4KZ5 A;  2PBY A;  3NDG A;  3FC7 A;  3UB6 A;  5FAQ A;  2ZC5 B;  3A3D A;  1XA7 A;  2EX2 A;  3NUL A;  5DTK A;  4Q8I A;  4N1X A;  1IYO A;  4GS9 A;  5FQ9 A;  1VB6 A;  3CIT A;  5FAS A;  1BYW A;  1K57 C;  2QHK A;  3HJI A;  1RGZ A;  1K54 A;  1Y4O A;  3LYX A;  2V0U A;  2I9V A;  1TS0 A;  4PM9 A;  2ZQ8 A;  1SCW A;  3EQV A;  4MMN A;  2XRN A;  1GA9 A;  3LGO A;  1AWI A;  2Y2J A;  4X55 A;  5FDS A;  4CLC E;  4R3B A;  3Q1F A;  3L7H A;  4FTX A;  3GSG A;  1HTZ A;  4JPM A;  1VQQ A;  3OCN A;  3C7V A;  1LLB A;  4F3L A;  5GHZ A;  3IWO A;  1JWV A;  4Y0T A;  4JGO A;  1RGY A;  3MXQ A;  1PYY A;  1XGI A;  1NZO A;  4JGQ A;  2JBF A;  1VM1 A;  4EEU A;  3CUE C;  1PWD A;  3TJZ C;  1D7E A;  3VSL A;  5F5Y A;  4ZJ1 A;  1GCE A;  4IJG A;  3H82 A;  1IYP A;  3S4X A;  5FEF A;  2KX6 A;  5IU1 A;  4KUK A;  3WS4 A;  5TBM B;  3R7W B;  1WE4 A;  1ERM A;  4ZRR A;  5AVF A;  3C4P A;  4QJG A;  5HFO A;  1WYC A;  2PU4 A;  2XK1 A;  1V9Z A;  2HP9 A;  5EM1 A;  4Y13 A;  3K2N A;  4JXG A;  4N1H A;  3G6O A;  2VJW A;  3O3V A;  4H6J B;  3IWQ A;  1K55 C;  3WWX A;  4LV2 A;  1LSX A;  3MS6 A;  3O86 A;  5M1A A;  2FZ0 A;  2H0Y A;  3IT9 A;  4NG2 A;  1BLH A;  1BTL A;  3S1Y A;  4AFI A;  2OAQ 1;  1TS6 A;  2ZM2 A;  5FI7 A;  3MFX A;  3UY6 A;  5EFW A;  4DDS A;  1KE4 A;  1FSW A;  4L9E A;  3V5M A;  1MBL A;  4WL9 A;  1XKZ A;  1BUE A;  1BLP A;  4XT2 B;  4ZTK A;  3VMA A;  4BBT A;  5J3W A;  2ZMV A;  3KSH A;  4WEL A;  2Y2I A;  2LB9 A;  4P85 A;  1VEU A;  2XFS A;  3HLB A;  1NRJ A;  4X25 A;  5CX7 A;  3IHA A;  1S0W A;  4WZ5 C;  2XSS A;  4MN6 A;  3QP5 A;  2Y2M A;  3Q7Z A;  4YNR A;  1I2S A;  2QJ5 A;  2H28 A;  1KOU A;  3A3I A;  3IF6 A;  3PHY A;  3TSG A;  2PRF A;  3NY4 A;  3N6I A;  3E4O A;  4DE1 A;  5C5K A;  4WYY A;  2J8Y A;  1JWZ A;  4NXB A;  2XD5 A;  4U3T A;  1S4S A;  5A90 A;  4FCF A;  1XFQ A;  3NOU C;  3ZG0 A;  4EBN A;  5EV0 A;  4C3Q A;  3ITA A;  5JYO A;  4BL3 A;  1H8Z A;  2ZQA A;  4E3M A;  1KGE A;  2XRO A;  3C30 A;  3QNC A;  4KQD A;  4KZ8 A;  3UME A;  5F83 A;  5E2E A;  1E25 A;  1ES5 A;  2K2N A;  4CLC D;  3HCY A;  3DTE A;  3T12 B;  3FPW A;  3UPP A;  5EPH A;  2QYB A;  4E3L A;  4KZ6 A;  3UB9 A;  1YLW A;  2QKP A;  2PYP A;  2L4R A;  3HUN A;  4U0T A;  1K57 A;  2JKT M;  1YSP A;  1PRQ A;  3C7U A;  2XA7 M;  3IXD A;  5M19 A;  4MLL A;  2P04 A;  1ES3 A;  3W4O A;  4OOY A;  1NY0 A;  3S22 A;  2B18 A;  3HLE A;  1XX2 A;  5LBR A;  4C6Y A;  1W63 Q;  5KSH A;  3ZG9 B;  2JKG A;  1SDN A;  3C38 A;  1ALQ A;  4OQI A;  2ZD8 A;  3HLC A;  5FQJ A;  1LT0 A;  5GHX A;  3SS5 A;  1D06 A;  1S67 L;  2VV8 A;  3VOZ A;  4ETX A;  4DDY A;  4E3K A;  4QWO A;  2OWJ A;  3W2Z A;  1GSV A;  2P9V B;  5J7E A;  4R4R A;  3T50 A;  4UHU A;  5I5L A;  1HZO A;  4N9K A;  2VGK A;  4YIN A;  2XGN A;  3IF5 A;  3CUE A;  4K08 A;  4Y0O A;  1SKO A;  2WKP A;  1NWZ A;  4HEF A;  3T4J A;  3KSF A;  4ZAM A;  1VHM A;  1H8Y A;  5AQ9 A;  4WM9 A;  3ZFZ A;  4E3J A;  4NXG A;  4PKY G;  3QP4 A;  3T4O A;  2VKS A;  3OPL A;  4Z1W A;  4HIA A;  3RJU A;  5EUA A;  1P9R A;  2GNX A;  4MNR A;  1FOF A;  4DXB A;  3PYP A;  5GLD A;  4EWF A;  1S1Z A;  1IEM A;  1CI9 A;  5HPI A;  2OWH A;  1UWN X;  1ERQ A;  4I5S A;  3LO7 A;  4ZBE A;  4II7 A;  3UNW A;  4OOL A;  1K55 A;  2GZA A;  4Y5F A;  1OME A;  1E4D A;  1WA9 A;  4MN7 A;  3LIB A;  1T19 A;  4BD1 A;  4DMZ A;  4WLA A;  2VV6 A;  3E2L A;  3M6H A;  5AQA A;  3VSK A;  4B93 A;  3ULF A;  5DF7 A;  5L2F A;  1KVM A;  5I94 A;  1BT5 A;  4R23 A;  2A24 B;  2J7V A;  3BEC A;  1W79 A;  1TDL A;  4WN5 A;  4RX2 A;  4G3K A;  3OCL A;  4HES A;  5A8B A;  5GLC A;  4ME4 A;  4WZ5 A;  4DE3 A;  5AJG A;  2INW A;  1G28 A;  3E2K A;  4OQH A;  2HV1 A;  4KG2 A;  4M4X A;  4P6Z S;  4N92 A;  2Z6C A;  3A0S A;  3G30 A;  3AGD A;  4ZJ3 A;  2V1A A;  2JCH A;  1D1J A;  3IX3 A;  4S2P A;  3D4F A;  3A3F A;  4UA7 A;  3TG9 A;  2WGI A;  4OOM A;  3C5A A;  1OTE A;  3PBO A;  2V9A A;  3QP8 A;  4S2L A;  3MBZ A;  3T1X A;  1O7E A;  2VX8 A;  1ESU A;  2D02 A;  2JKT I;  1SZV A;  1EI5 A;  3Q7V B;  2E8J A;  4BLM A;  5FAO A;  1V9Y A;  5DTS A;  3QP1 A;  1DY6 A;  4HI4 A;  3NEC A;  2UV0 E;  4P6Z M;  3PAE A;  3ZQ5 A;  1K38 A;  1QMF A;  4GD6 A;  5DF9 A;  4FH4 A;  3T4Q A;  4A5R A;  1Q2Q A;  1NLZ A;  4KZB A;  4ARZ A;  5HAQ A;  1STZ A;  3OPR A;  4LRY C;  3S7Q A;  2B95 A;  2XDM A;  1YQS A;  3BJN A;  4R3A A;  5E2F A;  3LIA A;  3LR3 A;  1T1B A;  3LR4 A;  5J4E A;  1BLC A;  1FIL A;  2JKF A;  4IUK A;  3E4Q A;  3N8L A;  1IKG A;  3F1N A;  2HP5 A;  1ZKJ A;  1Y28 A;  3GQZ A;  4UAA A;  4OH0 A;  4WZ4 A;  4GKU A;  1G68 A;  3T1S A;  2HDS A;  2JHE A;  1GSX A;  4G3V A;  4EQI A;  5FDH A;  3IQA A;  5MC7 A;  3IF6 C;  4WEJ A;  2QWS A;  3CAX A;  4JBF A;  5G4Y A;  4PM8 A;  3O87 A;  1FSY A;  4Y0U A;  5DTT A;  2PBD P;  4WMC D;  4LV0 A;  2W3F A;  4K0W A;  3P01 A;  4PM5 A;  1L0D A;  2Q0O A;  2R78 A;  4MN5 A;  4PKY A;  5EVL A;  1YPR A;  3IXH A;  4IBR A;  1YSQ A;  4X1L A;  4MEZ A;  1TVF A;  5HAI A;  2WK0 A;  3Q81 A;  4EER A;  3DWZ A;  3PAG A;  3PBN A;  2Q9N A;  1CI8 A;  3BFG A;  5FEG A;  1ZTU A;  5A92 A;  2ZL1 A;  1ZC2 A;  4E3O A;  2IA2 A;  4GOG A;  2BTF P;  4R3J A;  1NLY A;  5KMW A;  1YT4 A;  5EVI D;  2Y2O A;  2OOL A;  3ZCZ A;  2V8F A;  1H3Q A;  1OT6 A;  4PAU A;  3BFD A;  2ZMA A;  5GL9 A;  4EU0 A;  3VP2 A;  5G18 A;  3M2K A;  3EGD C;  4PM6 A;  2JC7 A;  1XJ3 A;  4CLC A;  1LSW A;  4Y17 A;  3A3J A;  4S2K A;  3C2W A;  3WS0 A;  2EX9 A;  1J3W A;  4EUV A;  4LFU A;  2ZC3 B;  5A91 A;  1OPX A;  2O99 A;  2WKQ A;  2LB5 A;  2GX5 A;  2Z2M B;  1PNE A;  2PD8 A;  4DN0 A;  4M3K A;  3NIA A;  3UB8 A;  5J8X A;  1PI5 A;  4FD8 A;  4N9L A;  2VGJ A;  4C75 A;  4GN2 A;  1DP9 A;  4GS9 B;  1ESI A;  3BEB A;  5EE8 A;  2W3G A;  2WAD A;  1NRF A;  4QD4 A;  3IXG A;  3BY9 A;  3FG8 A;  3FZC A;  3KSG A;  3LIC A;  1BSG A;  3QHY A;  5KZH A;  4DJ2 A;  1E3U D;  3MFD A;  2BG1 A;  3F1O A;  4Y7P A;  3C4O A;  1L0G A;  1PWG A;  1YLJ A;  5CXW A;  4EV4 A;  1XXM A;  3BY8 A;  3N8R A;  3LFV A;  3MJQ A;  3LID A;  4KQQ A;  2Y8H A;  2IWB A;  3VOL A;  2HJ9 C;  4Y3I A;  1PIO A;  4EBP A;  3RFB A;  2WAE A;  1CF0 A;  3PBS A;  4JXV A;  4F3L B;  1K56 D;  2NUT C;  4HY8 A;  3VP4 A;  2W3D A;  4R1G A;  3F1P A;  4JGR A;  5F6A A;  2XFT A;  2YKH A;  1NYM A;  4JGP A;  5IT5 A;  4ZDX A;  2Y2K A;  3BWL A;  3GMW A;  2W3H A;  5F1F A;  3UN7 A;  3ICY A;  3JVU A;  4OON A;  4EEP A;  3H9W A;  5DFX A;  4OQG A;  4O7D A;  4QB8 A;  4X56 A;  1VET A;  3H82 B;  1Z6F A;  4QHC A;  2ZM0 A;  1XGJ A;  1TEM A;  3UPN A;  1QME A;  1NZU A;  4OPQ A;  5HZH A;  3ZNT A;  3FWL A;  1MY8 A;  2Y2L A;  3UPO A;  4CPK A;  1CEG A;  1HLU P;  2AVX A;  4R0Q A;  3CWF A;  3UB5 P;  4KEN B;  4B4X A;  1FR6 A;  4BD0 A;  4BL2 A;  4X69 A;  3BQA A;  2H10 A;  2VGL S;  3V3R A;  1TD5 A;  5CRF A;  1F9I A;  3WS2 A;  2ZQ7 A;  3IHB A;  5FQQ A;  5HL1 A;  2EXA A;  3W4Q A;  4HQA A;  3CPT A;  2ZC6 B;  4DE2 A;  2A49 A;  2XQZ A;  2IWC A;  4NXE A;  1EWZ A;  4Y2F A;  4R38 A;  1LSV A;  2WKH A;  2XF3 A;  3ZGA B;  3D3O A;  1L2S A;  1A0K A;  3QP2 A;  3BYD A;  2PU2 A;  5HWT A;  2G2W A;  3DTK A;  2H0T A;  2JN7 A;  5CEB A;  3V3S A;  4D60 A;  1RCJ A;  4EW7 A;  2J3T D;  1VEU B;  2XA7 S;  3C8C A;  4O01 A;  3ZG7 B;  3N8S A;  3UE1 A;  1L0E A;  5L8M A;  2J3W A;  2VGL M;  5HWV A;  1JWP A;  2FFY A;  3IF6 B;  4LGW A;  3OC2 A;  1PWC A;  4I3A A;  2W0N A;  4NXF A;  1YKD A;  1TS8 A;  2Y2H A;  2YKF A;  2GJ3 A;  5DKK A;  3KYQ A;  1AXB A;  4KQR A;  4WBG A;  4HP4 A;  2P7J A;  4BQM A;  4R4S A;  3UDI A;  1K6S A;  4PMA A;  3ZDJ A;  5A93 A;  4GDN A;  2O9B A;  3SH9 A;  3UDF A;  3U4L P;  1IYQ A;  4HJ6 A;  1FIK A;  4YOF A;  3MF0 A;  2O9A A;  5U47 A;  5CGW A;  1YLY A;  4OLG A;  1DJC A;  2R9X A;  3JPU A;  3TOI A;  3B42 A;  1H8M A;  2JKR M;  1CEF A;  1W5D A;  5FQM A;  3NOP C;  1I2W A;  1K4F A;  3MSH A;  4GLQ A;  4OPY A;  4Q0I A;  5DF8 A;  5HWW A;  2K31 A;  2QJ7 A;  4KZ7 A;  1CK3 A;  4O0P A;  4I38 A;  5DKL A;  3BFF A;  5TFQ A;  3DTM A;  5CHJ A;  2VK3 A;  3HUM A;  3WS5 A;  3GEC A;  3MQO A;  2BLS A;  1LL9 A;  2M1C A;  3K3D A;  4EBL A;  1OTA A;  4S2O A;  4RQ9 A;  2NUP C;  3VP0 A;  3N4I A;  1ODV A;  3IS2 A;  4I3I A;  5HL6 A;  3LR0 A;  4GHI A;  4E3N A;  2QMI A;  5DFY A;  2KDK A;  4UA6 A;  4JF4 A;  4XXR A;  4RYE A;  4S2N C;  5CED A;  3T4K A;  1L0F A;  3VV4 A;  3MXS A;  5DJU A;  1T18 A;  4OLD A;  3DAV A;  3KYE A;  1DJA A;  4JF6 A;  5EOE A;  4X68 A;  3ZHH A;  4CLC C;  3LCE A;  3SW1 A;  1SKO B;  2PHY A;  4LCL A;  1RP5 A;  5EVI A;  4LV3 A;  4MDZ A;  1MWT A;  1YM1 A;  1P9W A;  4GZB A;  1F98 A;  3ZNY A;  1ONH A;  1YLZ A;  3ZYT A;  5F82 A;  3FYZ A;  2OSU A;  4IHQ A;  2ZBB A;  2W1T A;  2EX8 A;  3OBF A;  1LL5 A;  3HLF A;  4R70 A;  4R6L A;  4UEY A;  3O5Y A;  1NJ4 A;  1KE0 A;  4EES A;  3DWK A;  1TDG A;  3K3C A;  1ZG6 A;  3VFF A;  2ZQ9 A;  1CQA A;  2WGW A;  1XJ4 A;  4Q0J A;  5KIZ A;  4L9G A;  3SZT A;  5CEC A;  2W27 A;  1XPB A;  2HJE A;  2EFX A;  3MZD A;  2G7U A;  4F94 A;  1NXY A;  1YLT A;  1F2K A;  2D01 A;  1M40 A;  3OOV A;  4KUO A;  5FSR A;  2V1Z A;  3HLD A;  1XJ2 A;  3LI8 A;  2WZZ A;  3ZVT A;  4GW9 A;  1MWS A;  3MMH A;  1KGG A;  1E3U A;  1F5M A;  2WGV A;  4GB7 A;  2WGW B;  3KX0 X;  3AGF A;  3GTC A;  3TW8 A;  1WYB A;  3Q07 A;  3A0R A;  4JXS A;  1CJF A;  5CER A;  3FKV A;  1N9N A;  4DXC A;  3NJA A;  3PTE A;  4LV1 A;  2J80 A;  3EQU A;  3NCK A;  3AGE A;  3EGX C;  4FUW A;  2ACG A;  4E6W A;  2WKI A;  1OTB A;  1PI4 A;  4KZ4 A;  4B88 A;  3BFE A;  5IS1 A;  1K56 A;  1M6K A;  1OTI A;  4LRX C;  5FI2 A;  3LEQ A;  2VZW A;  3B47 A;  4ZJ2 A;  3S7O A;  3HRE A;  5FI6 A;  5HD3 A;  5L09 A;  5CGX A;  1ZHH B;  2JKR I;  1W8Y A;  4IUH A;  5GLB A;  4NET A;  3NDE A;  3MQQ A;  3H7W A;  5TR7 A;  4RA7 A;  3HUO A;  2ZOI A;  4MBH A;  3O88 A;  5DJT A;  4HH3 A;  1PFL A;  4BEN A;  1S66 L;  4Q0H A;  2E8I A;  4HNB A;  4NK3 A;  3R4K A;  2OLU A;  2OLV A;  3UE0 A;  3CHW P;  4CJN A;  3U2A A;  3CZD A;  4YWZ A;  3NI9 A;  3UE6 A;  3FPV A;  4BBV A;  1DP8 A;  4OPZ A;  4P0M A;  4BBU A;  4D2O A;  4QY5 A;  4ARZ B;  2WKR A;  2EA9 A;  3GVB A;  3OPH A;  3B3X A;  4P87 A;  1MWR A;  3PR6 A;  5DVA A;  3GRJ A;  1NYY A;  1ONG A;  4X1M A;  4E04 A;  3F1N B;  4RVA A;  1Y54 A;  2B5R A;  1DJB A;  4MBK A;  3RH8 B;  3VOY A;  2DNS A;  3IH8 A;  5HW3 A;  2V2F F;  4ETZ A;  4JLF A;  2K7S A;  4KZ9 A;  4S2N A;  3UDX A;  3RXX A;  2HDU A;  2XR0 A;  1N9B A;  2V8C A;  1MKM A;  4BMW A;  2XH9 A;  1OT9 A;  1MZU A;  4DJ3 A;  1K25 A;  4K0X A;  3LR5 A;  3IX4 A;  3Q82 A;  1MKI A;  4OQ0 A;  2V0W A;  1Z09 A;  3E98 A;  4BJP A;  1ES4 A;  2HGV A;  1K4E A;  4KQO A;  4HJ3 A;  3IX8 A;  5FQK A;  1JTG A;  2Y2N A;  3ITB A;  3NHQ A;  3LY4 A;  1IKI A;  1PW8 A;  2ZL1 B;  4O8G A;  5TGF A;  3FV7 A;  2FH5 A;  3G34 A;  4JXW A;  2ZQD A;  3G4P A;  3EOI A;  1L3L A;  2Y2P A;  5FQI A;  4I39 A;  2ZC7 A;  4S2I A;  2P74 A;  2WYX A;  3BLS A;  3IBR A;  3HLG A;  4FOF A;  4FH2 A;  2ZLY A;  1DRM A;  4CLC B;  1XFN A;  3EWK A;  4FSF A;  3E4P A;  3WS1 A;  5FAT A;  3UMD A;  3RTY A;  3ISG A;  1IYS A;  4MCW A;  1GSW A;  5TBM A;  3R7W A;  1U60 A;  3GR2 A;  3WRZ A;  2ZMF A;  4HJ4 A;  5AVE A;  2WKE A;  2M7V A;  2KOI A;  4I3J A;  5L10 A;  2L1M A;  2Y59 A;  3S7N A;  5EVE A;  4PHT A;  3NBL A;  4PPR A;  4Z9Q A;  1N9L A;  4RX3 A;  1FCN A;  3VP3 A;  3HBR A;  1MC0 A;  3T1Q B;  5HX9 A;  4H6J A;  5HAP A;  1PZO A;  1OJ5 A;  3IH9 A;  4HBU A;  3HJK A;  3F1O B;  4GNU A;  1DP6 A;  1J9M A;  4B4Z A;  1S4R A;  3NC8 A;  5EVI C;  3OPP A;  2BAS A;  5AQB A;  4ESP A;  3V67 A;  1XJ6 A;  5AQ7 A;  2HP6 A;  4YFM A;  1BLS A;  1I5Q A;  1XP4 A;  4OVD A;  4XT2 A;  2WAF A;  1SHV A;  2Y91 A;  1XA1 A;  3PBT A;  3F1P B;  5F69 A;  1FQG A;  3BLM A;  2ZC4 B;  2EWV A;  3OZH A;  1KVL A;  2WUQ A;  5HPF A;  3P98 A;  1LHY A;  1Q2P A;  3L9K A;  2X71 A;  3IWI A;  4OKP A;  5EM0 A;  2JE5 A;  2PR5 A;  2C6W B;  3HLW A;  1VET B;  1YLP A;  4HBT A;  3MZF A;  3PBQ A;  2PAV P;  2ZJ9 A;  3CJM A;  2ZM8 A;  2FFF B;  2X01 A;  1MPL A;  3LUQ A;  5GHY A;  3TE8 A;  3ZG8 B;  4GJ4 A;  2VEA A;  1ACF A;  1TF1 A;  4S2J A;  1G6O A;  4IVI A;  3QNB A;  1P0Z A;  1S1Y A;  3EEH A;  4KG6 A;  3BRM A;  2PDR A;  4GDB A;  4EXO A;  4WF0 A;  3CPT B;  1FCM A;  1LL8 A;  3VE4 A;  5HDD A;  3LIE A;  4KZA A;  4WEK A;  5BOH A;  3QP6 A;  3CLO A;  4IBX A;  2X02 A;  2V1B A;  4GCZ A;  3BW6 A;  1O07 A;  2P08 A;  4JF5 A;  4JKT A;  4GD8 A;  5F1G A;  4UQI S;  3NOT C;  1T1A A;  4CQH A;  1N4O A;  2O0Y A;  2Y79 A;  5CGS A;  1KDW A;  1UGU A;  4HH2 A;  1SDE A;  2Y2Q A;  5FL3 A;  1GHP A;  3MKF A;  3WRT A;  2Q9M A;  5E2H A;  2EFU A;  5HAR A;  3N7W A;  4BWI A;  3UO9 A;  3V50 A;  3SH7 A;  4EUZ A;  1JNU A;  3E0Y A;  2KLI A;  2M7U A;  2IWD A;  3M2J A;  3G2Y A;  3G2Z A;  3PXP A;  4L9F A;  1YMS A;  5CHM A;  1PZP A;  3BM6 A;  4Y15 A;  4UQI M;  2P9V A;  3KYZ A;  3BFC A;  2RCX A;  5HSQ A;  1YMX A;  3LIF A;  5JYP A;  1GA0 A;  3MZE A;  4HOI A;  4DKI A;  3P09 A;  3LI9 A;  2XEP A;  2A3U A;  1BUL A;  2Y4A A;  2W1R A;  3P7N A;  2J9P A;  3VE3 A;  3T4L A;  5FAP A;  3UB7 A;  4WMC A;  5CTM A;  4QY6 A;  2PD7 A;  4XUZ A;  4QPR A;  3V39 A;  5CTN A;  1MWU A;  1P97 A;  3G35 A;  1T1C A;  2J3T C;  3VFH A;  3T1R A;  2OV5 A;  3LEZ A;  1W8Q A;  2XLN A;  4QU3 A;  3HL9 A;  1K0K A;  1C3B A;  1HVB A;  5HDS A;  2L0W A;  3IS2 B;  5EEC A;  2I72 A;  2PT7 A;  3EEA A;  4UA9 A;  5G4Z A;  1S6R A;  1MXO A;  2G2U A;  4GHI B;  2HPB A;  5CHU A;  2EWW A;  1FCO A;  3JVV A;  3A3E A;  3MKE A;  3D72 A;  1IFQ A;  2GDN A;  3CMZ A;  3OLO A;  2W3E A;  1K54 C;  3KSI A;  4G3W A;  3FKW A;  2A24 A;  1KE3 A;  5E43 A;  4WUJ A;  1ZG4 A;  1EW0 A;  2Z2L B;  1SKF A;  5K5B A;  5KSC A;  4OP8 A;  1GHI A;  3DBA A;  2HDQ A;  5FA7 A;  4EQ1 A;  1LI0 A;  3CG5 A;  2Y2G A;  3VP1 A;  3GDI A;  4E6X A;  5EVI B;  3LY3 A;  1N9O A;  1KGF A;  2EXB A;  5HD5 A;  2ZQC A;  2CC1 A;  2Y55 A;  1W7F A;  3RXW A;  5GLA A;  4PM7 A;  2W1T B;  2B02 A;  2RL3 A;  2HDR A;  3GV9 A;  4NKP A;  1GHM A;  5TJJ A;  4HP9 A;  1H0M A;  3D9Y A;  4X53 A;  2DMW A;  4OPR A;  2J9O A;  3Q7V A;  2DRW A;  5F68 A;  1G5U A;  1LI9 A;  2QZ6 A;  1K6R A;  4ID4 A;  3A0V A;  3SS4 A;  1IEL A;  1FR1 A;  2UWX A;  4B9O A;  4DF6 A;  1G6A A;  2XD1 A;  4K91 A;  2VLG A;  2A2L A;  1UWP X;  5E2G A;  2C5W B;  1OJG A;  5HDC A;  3DTI A;  1BZA A;  3G32 A;  3ZG5 A;  3T4T A;  4LCM A;  1JTD A;  3ZVW A;  2R9W A;  4LEN A;  3DW0 A;  5D3O A;  4E3I A;  4DRT A;  1YAX A;  3B33 A;  3KO6 A;  4LLO B;  5L07 A;  3IBJ A;  1ES2 A;  2Z6D A;  4S2M A;  1W63 M;  2VA0 A;  1JVJ A;  2HZ5 A;  4NEE D;  4IED A;  3HVF A;  2PYR A;  3SH8 A;  3MR0 A;  3TRC A;  3I7J A;  4KG5 A;  3JYI A;  3H7W B;  3IXB A;  4OP5 A;  2WZX A;  4LRZ E;  3M6B A;  2PR6 A;  4X6T A;  2MJ6 A;  2DCF A;  2VV7 A;  4XUX A;  3T4S A;  1ERO A;  1X0O A;  4P6B A;  4KZ3 A;  3MQ0 A;  1KDS A;  2H5S A;  1PW1 A;  4H8R A;  1TS7 A;  5IHV A;  2O9C A;  1IOU A;  4L0L A;  2ZOH A;  4U0X A;  1H5X A;  3UE3 A;  2HF6 A;  2CMN A;  3G31 A;  3W8K A;  5M18 A;  4IVK A;  1OTD A;  1HD8 A; 
#chains in the Genus database with same CATH homology
 4G3K A;  4EET B;  1H8M A;  2JKR M;  3OCL A;  5A8B A;  4ME4 A;  4LPZ A;  3S7P A;  5AJG A;  4XT2 A;  2INW A;  3NOP C;  4HHD A;  4GLQ A;  4Q0I A;  5HWW A;  1G28 A;  3PBT A;  2K31 A;  3F1P B;  4P6Z S;  2HV1 A;  3BQ8 A;  4M4X A;  5F69 A;  2QJ7 A;  3PBR A;  2OAP 1;  4O0P A;  4I38 A;  5DKL A;  2Z6C A;  3A0S A;  2EWV A;  5HPF A;  3CI6 A;  2V1A A;  3FC7 A;  3UB6 A;  3GEC A;  2PR5 A;  3MQO A;  2M1C A;  3K3D A;  1OTA A;  4RQ9 A;  2NUP C;  3PBQ A;  1ODV A;  3IS2 A;  4OOM A;  4GS9 A;  1OTE A;  3PBO A;  1VB6 A;  2V9A A;  3CIT A;  1BYW A;  4I3I A;  5HL6 A;  3LR0 A;  4GHI A;  2QHK A;  3HJI A;  5DFY A;  2KDK A;  2VX8 A;  3LYX A;  2D02 A;  2JKT I;  2I9V A;  2V0U A;  3T4K A;  1TS0 A;  1V9Y A;  3EQV A;  3VV4 A;  3LUQ A;  4HI4 A;  4MMN A;  5DJU A;  3TE8 A;  1T18 A;  2XRN A;  4P6Z M;  3ZQ5 A;  4GJ4 A;  5DF9 A;  2VEA A;  3T4Q A;  1TF1 A;  1NLZ A;  4ARZ A;  1STZ A;  4LRY C;  1G6O A;  3S7Q A;  4CLC E;  1P0Z A;  3BJN A;  1S1Y A;  4R3A A;  3LIA A;  3EEH A;  3LR3 A;  1T1B A;  3LR4 A;  5J4E A;  2PDR A;  4CLC C;  4EXO A;  4IUK A;  3E4Q A;  3OCN A;  4WF0 A;  1LL8 A;  3F1N A;  5HDD A;  3VE4 A;  3SW1 A;  3LIE A;  4F3L A;  4WEK A;  1Y28 A;  2PHY A;  3CLO A;  4MDZ A;  4JGO A;  3MXQ A;  1P9W A;  2V1B A;  4GCZ A;  1F98 A;  2P08 A;  3BW6 A;  3ZYT A;  2JHE A;  4JGQ A;  1GSX A;  4G3V A;  4IHQ A;  4EEU A;  4UQI S;  3CUE C;  2ZBB A;  3NOT C;  1T1A A;  2W1T A;  5MC7 A;  3TJZ C;  4WEJ A;  3OBF A;  2QWS A;  1D7E A;  3CAX A;  4CQH A;  5F5Y A;  4R70 A;  4R6L A;  2O0Y A;  2Y79 A;  4IJG A;  4UEY A;  5G4Y A;  3H82 A;  3O5Y A;  1UGU A;  4HH2 A;  2KX6 A;  5IU1 A;  5FL3 A;  4KUK A;  2W3F A;  4EES A;  5TBM B;  3R7W B;  3K3C A;  3P01 A;  4BWI A;  4ZRR A;  5AVF A;  1XJ4 A;  4Q0J A;  2R78 A;  4L9G A;  5KIZ A;  4MN5 A;  2W27 A;  1JNU A;  4PKY A;  3E0Y A;  2KLI A;  1V9Z A;  2HJE A;  2M7U A;  2G7U A;  1YSQ A;  2D01 A;  3K2N A;  3OOV A;  4KUO A;  3PXP A;  4L9F A;  4EER A;  3G6O A;  2VJW A;  3PBN A;  1XJ2 A;  4H6J B;  4UQI M;  1ZTU A;  3LI8 A;  1LSX A;  3KYZ A;  4GW9 A;  5HSQ A;  2IA2 A;  3MMH A;  2FZ0 A;  3LIF A;  1F5M A;  1NLY A;  3KX0 X;  4HOI A;  3LI9 A;  2OOL A;  4AFI A;  2W1R A;  3P7N A;  1H3Q A;  1OT6 A;  2OAQ 1;  3TW8 A;  1TS6 A;  3VE3 A;  3MFX A;  3A0R A;  3T4L A;  4PAU A;  5EFW A;  4EU0 A;  1N9N A;  3UB7 A;  3NJA A;  4L9E A;  3EGD C;  2J80 A;  3EQU A;  3EGX C;  4WL9 A;  1XJ3 A;  4CLC A;  2PD7 A;  1LSW A;  1OTB A;  4QPR A;  4XT2 B;  4BBT A;  1P97 A;  5J3W A;  3C2W A;  2ZMV A;  3KSH A;  4WEL A;  5IS1 A;  4EUV A;  1T1C A;  1OPX A;  1OTI A;  4LRX C;  2LB9 A;  2O99 A;  2J3T C;  2VZW A;  2WKQ A;  3B47 A;  2LB5 A;  2GX5 A;  3S7O A;  1NRJ A;  5CX7 A;  2PD8 A;  4DN0 A;  5HD3 A;  2XSS A;  1ZHH B;  4MN6 A;  2JKR I;  4YNR A;  2QJ5 A;  4IUH A;  2H28 A;  1KOU A;  3UB8 A;  3PHY A;  3MQQ A;  3H7W A;  3E4O A;  2ZOI A;  5C5K A;  5HDS A;  2L0W A;  5DJT A;  3IS2 B;  4NXB A;  1DP9 A;  4GS9 B;  2PT7 A;  1S4S A;  3EEA A;  4HH3 A;  1XFQ A;  3NOU C;  2W3G A;  5G4Z A;  4GHI B;  1S66 L;  4Q0H A;  3BY9 A;  4HNB A;  3R4K A;  3FG8 A;  2EWW A;  3KSG A;  3LIC A;  3JVV A;  3U2A A;  4YWZ A;  3D72 A;  4DJ2 A;  1IFQ A;  3UE6 A;  3FPV A;  3F1O A;  3OLO A;  4BBV A;  1DP8 A;  2W3E A;  2XRO A;  3C30 A;  3BY8 A;  4KQD A;  4BBU A;  3KSI A;  4G3W A;  3LFV A;  2A24 A;  3UME A;  3MJQ A;  4ARZ B;  3LID A;  2WKR A;  2Y8H A;  2EA9 A;  4WUJ A;  3VOL A;  1EW0 A;  2HJ9 C;  4Y3I A;  3PR6 A;  2K2N A;  4CLC D;  5K5B A;  3HCY A;  3RFB A;  3FPW A;  3DBA A;  4E04 A;  3F1N B;  3PBS A;  4EQ1 A;  2QYB A;  4F3L B;  2NUT C;  4HY8 A;  2W3D A;  3GDI A;  5F6A A;  3F1P A;  4JGR A;  2YKH A;  4JGP A;  1N9O A;  5IT5 A;  3RH8 B;  3UB9 A;  3BWL A;  5HD5 A;  2W3H A;  2QKP A;  3ICY A;  2PYP A;  3JVU A;  4EEP A;  2L4R A;  3H9W A;  5DFX A;  2JKT M;  2W1T B;  1YSP A;  4ETZ A;  2B02 A;  2XA7 M;  2K7S A;  3H82 B;  4NKP A;  2P04 A;  5TJJ A;  2B18 A;  4HP9 A;  1MKM A;  4BMW A;  1OT9 A;  5LBR A;  5HZH A;  1W63 Q;  1MZU A;  5KSH A;  4DJ3 A;  2DMW A;  3LR5 A;  3C38 A;  5F68 A;  1LT0 A;  2V0W A;  3CWF A;  3A0V A;  3E98 A;  1D06 A;  1S67 L;  4BJP A;  2VV8 A;  2HGV A;  4ETX A;  4KQO A;  4B9O A;  4HJ3 A;  2OWJ A;  3W2Z A;  2VLG A;  3BQA A;  2VGL S;  2A2L A;  1TD5 A;  3NHQ A;  1GSV A;  5J7E A;  1UWP X;  4O8G A;  1F9I A;  3T50 A;  5I5L A;  4HQA A;  1OJG A;  5HDC A;  2FH5 A;  4NXE A;  3CUE A;  4K08 A;  2WKP A;  1NWZ A;  4Y2F A;  3T4J A;  3KSF A;  4R38 A;  3EOI A;  1VHM A;  1LSV A;  3T4T A;  4I39 A;  3IBR A;  4FOF A;  4NXG A;  4PKY G;  3D3O A;  1YAX A;  3T4O A;  2VKS A;  4Z1W A;  1DRM A;  3B33 A;  3KO6 A;  4HIA A;  4CLC B;  1XFN A;  3EWK A;  4FSF A;  5HWT A;  3E4P A;  4LLO B;  3IBJ A;  1P9R A;  2JN7 A;  2GNX A;  3UMD A;  3RTY A;  3PYP A;  2Z6D A;  1W63 M;  2VA0 A;  4MCW A;  4EW7 A;  2J3T D;  1GSW A;  2XA7 S;  3C8C A;  4O01 A;  5TBM A;  3R7W A;  4NEE D;  1S1Z A;  2ZMF A;  4HJ4 A;  5HPI A;  5AVE A;  5L8M A;  2PYR A;  2J3W A;  2M7V A;  2OWH A;  2KOI A;  1UWN X;  4I3J A;  2VGL M;  5HWV A;  2L1M A;  3MR0 A;  4I5S A;  3TRC A;  3S7N A;  4II7 A;  3OC2 A;  4OOL A;  3H7W B;  4PHT A;  2GZA A;  4Y5F A;  4I3A A;  4LRZ E;  1WA9 A;  2W0N A;  1N9L A;  4MN7 A;  2PR6 A;  4NXF A;  3LIB A;  1T19 A;  1YKD A;  1TS8 A;  2MJ6 A;  4DMZ A;  4WLA A;  2YKF A;  2VV6 A;  2VV7 A;  3T4S A;  2GJ3 A;  1MC0 A;  1X0O A;  5DKK A;  3KYQ A;  3MQ0 A;  4HP4 A;  4H6J A;  2P7J A;  4B93 A;  3ULF A;  1TS7 A;  1OJ5 A;  2O9C A;  1IOU A;  4L0L A;  2ZOH A;  3HJK A;  3F1O B;  2O9B A;  1DP6 A;  3UE3 A;  1S4R A;  4HJ6 A;  2HF6 A;  2CMN A;  2BAS A;  4YOF A;  3MF0 A;  2O9A A;  3V67 A;  1XJ6 A;  2A24 B;  1OTD A;  3B42 A;  4WN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...