3EEAA

The crystal structure of the gaf domain/hd domain protein from geobacter sulfurreducens
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
155
structure length
153
Chain Sequence
ERLSGLTDVDEVIKDLSRLLRKLVKTRWIAVYFFDRRDFAPARSTGLPASFLPVFREMPLAPDKIPLLKSMLRKRQHLMLTDPGSSDLLTPKLRKLLRNLCVLAVPMVVRTQVIGAVFMARTRDNPPFSDAETAIIRDLVSHAALVVSHMQLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAF domain/HD domain protein
publication title The crystal structure of the GAF domain/HD domain protein from Geobacter sulfurreducens
rcsb
source organism Geobacter sulfurreducens
molecule tags Structural genomics, unknown function
total genus 42
structure length 153
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13492 GAF_3 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3eeaA00
4RQ9A 2XROA 2M7UA 3OBFA 4O01A 2VKSA 2IA2A 3R4KA 4Y5FA 3KO6A 2W3DA 5HL6A 3TRCA 4DMZA 2XRNA 4ZRRA 4Z1WA 2O99A 3E98A 3MF0A 4G3KA 2LB9A 2VZWA 3D3OA 4Q0HA 5C5KA 3E0YA 3S7QA 3NOTC 4E04A 4O0PA 3DBAA 4IJGA 3MQ0A 2QYBA 4GLQA 4BWIA 3KSFA 2XSSA 4MCWA 3ZQ5A 4EUVA 1STZA 2VEAA 1TD5A 2W3GA 2W3EA 3CI6A 5AJGA 5DFYA 4Y2FA 3VV4A 4G3WA 3CITA 2Y79A 4R6LA 2O9BA 5LBRA 2W3HA 4Q0IA 3EEAA 3HCYA 3S7PA 2G7UA 5K5BA 2M7VA 1YKDA 3K2NA 2W1RA 3BJNA 5HSQA 5DFXA 1MKMA 3OOVA 3S7OA 3NHQA 4MN7A 2GX5A 2O0YA 5HPIA 4ETZA 4LRXC 4ME4A 3NOPC 4IUKA 2OOLA 4PAUA 2LB5A 3KSGA 1YSQA 4GW9A 5I5LA 4R70A 4ETXA 2K31A 2K2NA 3G6OA 5HPFA 1TF1A 4MDZA 2VJWA 4IUHA 2O9CA 1VHMA 3S7NA 1MC0A 3LFVA 3KSIA 4QPRA 2O9AA 3KSHA 4G3VA 2Y8HA 4CQHA 4YOFA 1YSPA 3NOUC 3O5YA 2W1TA 3IBJA 2B18A 4DN0A 4YNRA 5L8MA 2W3FA 1F5MA 4MMNA 3C2WA 2HGVA 3W2ZA 5TJJA 3RFBA 4O8GA 2KOIA 4LRZE 4FOFA 4Q0JA 2W1TB 4Y3IA 3IBRA 2KLIA 4LRYC 3MMHA 4EU0A 1ZTUA 2ZMFA
chains in the Genus database with same CATH superfamily
4WM9A 4KZ3A 4RQ9A 2XROA 4ZTKA 5DTSA 3BRMA 3GTCA 4Y5FA 2W3DA 4DMZA 4PPRA 2GJ3A 3GDIA 1VM1A 5EVIC 1XFNA 4WMCA 5TFQA 1W8QA 3NOTC 2HZ5A 4LLOB 4R1GA 2WKEA 1DP6A 1VEUA 4QU3A 1G6AA 3H7WB 4HJ6A 1W63Q 1Q2QA 4MLLA 1AWIA 2Z2LB 4KG6A 2ACGA 3EEHA 5TBMA 3PBSA 1SCWA 5FAQA 2JKRM 2B02A 2M7VA 1DP9A 3OPPA 4K91A 3OCLA 4F3LA 1ODVA 2PDRA 3BJNA 3UO9A 1NYYA 4BBUA 1FILA 4HBTA 3CWFA 4DRTA 4CLCB 3TG9A 1XGJA 1LL9A 2EWWA 3UNWA 3BFEA 4R70A 3E4PA 3A3DA 4O7DA 1JWVA 1IEMA 3VP3A 3C5AA 4DJ3A 4KZ7A 2V1BA 4CLCD 5FQIA 4JGPA 1XA1A 4G3VA 2JN7A 1YSPA 4HESA 1SKOA 2B18A 5GLBA 3E2LA 3E4QA 3GQZA 4KQQA 2OV5A 2V2FF 1W5DA 4ZJ2A 4Y13A 5KIZA 4BBVA 3N8RA 4WF0A 3ZNYA 3LICA 2PD8A 1PWDA 3UDXA 3OBFA 2Y2KA 5GLAA 1HD8A 3R7WA 1O7EA 5M18A 1GHMA 1P9WA 3UE1A 1YLPA 4HEFA 4WUJA 4PM8A 4GDNA 3NDGA 2QJ5A 3GR2A 3LR0A 1FCMA 4MBFA 3HLGA 4E04A 1KE4A 1OPXA 2HF6A 3DWKA 1JWPA 2WUQA 4KZ8A 4GDBA 3C4PA 1IELA 4WZ5C 2PR5A 1VEUB 1K57A 3FV7A 1YAXA 2P7JA 3BM6A 3ULFA 5TGFA 4PM5A 3O86A 5HSQA 3SS5A 4WMCD 5TBMB 3AGFA 1NLYA 1BSGA 2HDQA 4X1LA 3NOPC 2QKPA 4X55A 4KQRA 4PM9A 3TOIA 2K2NA 3G6OA 1HVBA 1P0ZA 4PMAA 5CHJA 2INWA 3G32A 4IUHA 2O9CA 3ITBA 4S2MA 3PBNA 3ZGAB 1JTDA 1K4FA 3WRTA 1BLCA 3IBJA 2M1CA 3JPUA 2PBDP 3QP4A 5A8BA 3ZDJA 5FI7A 1FQGA 2BG1A 1OMEA 3UB7A 4Q0JA 4GKUA 1KVMA 4UAAA 5F69A 5GHYA 1GSWA 1L0FA 1WA9A 3UB6A 4PKYA 2M7UA 4OQGA 4BQMA 4RX2A 2H5SA 3ZHHA 4DXCA 1XP4A 1XKZA 2V8FA 2Y2OA 4H6JA 3WS4A 4X6TA 5FASA 3M6HA 4Q0HA 1MPLA 1XGIA 3R7WB 4E3JA 3LGOA 5KZHA 1GHIA 2L1MA 3ZQ5A 3MZDA 2B5RA 1ZG4A 3DTEA 4BLMA 2H10A 3PXPA 4P6ZS 2PU2A 3HCYA 3OPHA 4X1MA 2XA7M 3K2NA 4S2PA 5F6AA 3TSGA 5FI6A 1GCEA 4FTXA 3ZYTA 1LHYA 5CTNA 2Z2MB 2JKTM 3LCEA 4U0TA 4Q8IA 3Q7VA 1IKGA 4HJ3A 5M19A 5CGXA 2K31A 3IWQA 3LYXA 1SKFA 3OCNA 2P04A 1CI9A 5DJUA 4U3TA 1BYWA 4XXRA 5G4YA 2ZMVA 2XR0A 1CJFA 3Q7ZA 2NUTC 4UQIS 3LY3A 4RX3A 1SDNA 3IWOA 5FEGA 2EXBA 1OTBA 1ACFA 3Q07A 1K55C 4U0XA 3HUMA 2WZZA 2OAQ1 1IYOA 1K25A 5FSRA 3G30A 4NXBA 3MQQA 5EV0A 3CUEA 4I39A 1TDGA 2ZMFA 3UE6A 3HLWA 5IU1A 2YKFA 3LY4A 4JF6A 4KQOA 1J3WA 3UB5P 5IT5A 2H28A 2RL3A 3SH8A 3I7JA 4LENA 4QB8A 2ZMAA 3FYZA 3CHWP 4JPMA 4ID4A 4KG2A 3UDIA 3C7UA 1OTIA 4O0PA 5FQQA 2ZM0A 2P9VB 3IF5A 3T4JA 4ZJ3A 5HZHA 4C6YA 1Q2PA 4G3WA 4EETB 1S6RA 3G34A 4HIAA 2XF3A 4LCLA 3DTMA 2VK3A 3FZCA 4RVAA 3LI8A 4L9EA 5DFXA 1MKMA 3BQAA 4D2OA 3OC2A 4UA7A 3KYZA 2UV0E 2XK1A 5F82A 1X0OA 2O0YA 4I5SA 4BL3A 3KYEA 1W63M 3T1QB 1KGEA 4A5RA 4IHQA 4GW9A 3V39A 1ESUA 2XFTA 2V1AA 2V20A 3FPWA 5HPFA 4KQDA 1TF1A 4MDZA 2QPNA 3S7NA 3CAXA 5DTTA 4DDYA 4N9LA 4S2KA 3EGXC 4RYEA 2WADA 4OH0A 3IHAA 1T1BA 3NOUC 2VV8A 3IX8A 1MWSA 2EXAA 3WS2A 4EWFA 4Y0OA 3IF6B 2ZOHA 4LRZE 4FOFA 4X25A 3CJMA 3NY4A 4HHDA 4LV3A 4FSFA 2KLIA 3C4OA 4QWOA 5CXWA 1EWZA 2BASA 3UE3A 3UMDA 5DF7A 3A3FA 3V3RA 4X56A 4OOMA 3R4KA 4S2IA 2W27A 5HL6A 3V5MA 3NCKA 4C3QA 2Y2MA 3PBTA 3N8SA 2VA0A 2QJ7A 5AQAA 3IWIA 4GHIA 1FIKA 3S7QA 1XJ6A 5AVEA 2VGLS 2Y2NA 1MXOA 2Y2JA 1TD5A 3B47A 2IWCA 3O87A 3EOIA 4MNRA 1C3BA 4MEZA 3TW8A 5EVIA 2Y2LA 1DJCA 1LT0A 5FQ9A 5EECA 1S4RA 5U47A 4GJ4A 1FOFA 2ZM2A 4ME4A 1G6OA 3KSGA 5GLDA 3JYIA 1YLTA 1SDEA 1S66L 2H0TA 2WZXA 3PAEA 2A3UA 1TS0A 4N9KA 1VHMA 3CZDA 4QPRA 4LCMA 3N7WA 1LSXA 3LEQA 1BLHA 3LIFA 1NYMA 1WE4A 4YNRA 4CJNA 1OTEA 2Q0OA 4UA6A 4S2NC 4IEDA 5I94A 5GHZA 1XJ3A 2EX9A 4LPZA 2X71A 4I38A 4HI4A 4QY5A 3EWKA 2XFSA 5HDSA 1DJBA 2V0WA 3VMAA 5EVEA 4OKPA 3D4FA 2DMWA 1MWUA 3IXBA 4NKPA 4OOLA 3CMZA 3C8CA 3A0VA 2XH9A 5AQBA 2ZLYA 3MS6A 1OT6A 3A3IA 4QD4A 1RCJA 3DBAA 2ZQDA 2WGWA 3F1OB 3Q82A 4C75A 3QP1A 2J9PA 4NEED 3CITA 3BEBA 1TS6A 1Y54A 2K7SA 3V3SA 5HWTA 1VQQA 2J9OA 2EX8A 3HLCA 4FH2A 5CECA 1Z6FA 2Y4AA 2P08A 4NG2A 2J3TD 3QNCA 2PU4A 5G4ZA 2ZQCA 3T4OA 3DAVA 2OSUA 3UMEA 4LRXC 1ZHHB 4X69A 3WS0A 2HP6A 2B95A 3QP2A 1NWZA 4WZ5A 1S0WA 3B33A 2EA9A 5E2FA 3IS2A 4WELA 3KSHA 3HVFA 4JGQA 5EVID 3VFHA 1LSWA 2XD5A 4NXEA 3IQAA 3CPTA 3DTIA 3RFBA 2QHKA 2JHEA 2R78A 1PRQA 2IWBA 2JBFA 3T4KA 4R3AA 2PYPA 1KDWA 1XA7A 3MXRA 5HD5A 1ZTUA 4JF5A 4P85A 1N9NA 4XT2B 1CI8A 4WZ4A 2WKRA 1IFQA 3A0SA 3F1PA 1LI0A 4YINA 3D3OA 2PBYA 1CK3A 5J4EA 3T4SA 1ES4A 1OTAA 4ZBEA 3S4XA 3LIEA 3N8LA 1STZA 4K0WA 3T4LA 2D01A 2ZL1B 2J7VA 3CG5A 3T1RA 2G7UA 5MC7A 1M40A 1JTGA 2JCHA 2PD7A 1GA0A 1ZC2A 4N1XA 5KMWA 4JGOA 2Y2PA 3UPOA 3UB8A 3HUOA 2OOLA 4F94A 5F68A 3HREA 1FR6A 2Y2QA 2G2UA 2Y59A 3HLDA 1RGZA 4HH2A 4PHTA 5DTKA 2OWHA 2WGIA 3S1YA 3U4LP 4KZ5A 1AXBA 4F3LB 3S22A 3M2KA 1IYSA 5TJJA 2KOIA 1RP5A 2HDUA 4NXFA 3LO7A 5CGSA 5HWVA 4MBKA 3K3DA 1VETA 3SH9A 2ZQ8A 3RXXA 2JKRI 3VOLA 4OONA 3BLMA 1WYBA 3QHYA 1PZOA 5J7EA 1PW8A 1K55A 2EFUA 5FDSA 4Z9QA 3EQVA 3SS3A 4KZBA 4RA7A 5A91A 1PNEA 1OTDA 1BZAA 1SKOB 1XXMA 3E4OA 3E0YA 3BFGA 5DKKA 4HQAA 3VSKA 5FAPA 1T1AA 3F1PB 1JNUA 1OT9A 5DVAA 5CTMA 4YWZA 3EGDC 2ZJ9A 4EBNA 1WYCA 4UEYA 5DFYA 2PHYA 4EQIA 2A2LA 1Z09A 3UPNA 3NJAA 4Q0IA 4DE0A 2ZBBA 3VP1A 3PBOA 1NJ4A 2J80A 2XDMA 1YKDA 2W1RA 1PWGA 3T12B 3RJUA 3BFCA 1YLYA 2C6WB 2EWVA 1ZKJA 4Y7PA 1YMXA 3T4TA 1F98A 2LB5A 3P98A 2VGKA 4N92A 3NDEA 4OLDA 5E2GA 1L2SA 1K6SA 2CMNA 4YOFA 2FH5A 1BT5A 4DN0A 2Y91A 1QMFA 3ZCZA 3VE3A 1FSYA 1ERMA 3MZFA 5FAOA 1MWTA 3H82A 2A49A 3ZG7B 1I2WA 4BBTA 1S67L 4L9GA 4E6XA 1DP8A 3T4QA 1JVJA 1I2SA 3HLBA 2WKHA 3QP6A 4R4RA 2OLVA 3ZG9B 5F1GA 5DF8A 4B88A 3B42A 1YQSA 1DRMA 2C5WB 3VP0A 4GD6A 4UA9A 4Y0TA 1YLWA 1BUEA 5HFOA 2L0WA 3C38A 3LUQA 4GD8A 3WRZA 1EW0A 4M4XA 4MCWA 1LLBA 1MBLA 4DXBA 4QJGA 3HL9A 1H8MA 4WN5A 4E3OA 2GZAA 2JKFA 5DKLA 2ZC3B 3OOVA 4H6JB 3S7OA 4DDSA 4WYYA 5GLCA 4MN7A 5HX9A 5KSHA 3M2JA 4ETZA 1K56A 2VV6A 5CGWA 2HDRA 1XJ2A 4PAUA 3LR3A 4GB7A 4ESPA 4E6WA 3RTYA 4S2LA 4JBFA 4OPYA 3VOYA 2WGVA 3UE0A 4R23A 4XUXA 5DJTA 5CERA 1PW1A 1YLJA 2QMIA 4L0LA 2Y8HA 3IHBA 4WLAA 3ZG0A 2VX8A 1D7EA 3C2WA 3Q7VB 1PWCA 3MMHA 3OLOA 4I3AA 4JXSA 2QZ6A 3BWLA 1I5QA 4HP9A 3A3JA 1NRJA 3BECA 4UHUA 4HY8A 5FEFA 2X02A 4R3JA 4O01A 3B3XA 2IA2A 3KO6A 1YT4A 2JKTI 5E2HA 3TRCA 4OOYA 3PR6A 3IH8A 2VZWA 4HJ4A 3VP4A 1MWRA 5CEBA 3IF6C 3N6IA 3LIBA 1K54C 2QYBA 4BWIA 4E3MA 3BW6A 5EOEA 2VEAA 1RGYA 5EM1A 2XA7S 3T1XA 3IXGA 1GHPA 4DE1A 3ICYA 4GCZA 3D72A 5FQJA 3TE8A 2WAEA 1H8ZA 5K5BA 4Y15A 4Y17A 3GECA 4II7A 4B4ZA 1ERQA 1PI5A 4B9OA 1NRFA 4IUKA 2BTFP 3L9KA 4LV2A 2L4RA 5A92A 4S2JA 3G4PA 2Y2IA 4JGRA 1XJ4A 4B93A 2FZ0A 1P97A 4NETA 3GMWA 4NK3A 2HPBA 1G68A 5M1AA 1LL8A 1YM1A 3DW0A 4B4XA 4MMNA 1ZG6A 1ONGA 1TVFA 3IH9A 5AVFA 5GHXA 3MR0A 1K56D 1PYYA 4ZAMA 2Y2HA 3WS1A 1F2KA 3IBRA 4EXOA 3ZVTA 2KX6A 1XPBA 5EVLA 5E43A 2UWXA 4I3IA 1KVLA 3P09A 3MJQA 2I72A 1ONHA 4FUWA 3SW1A 3NIAA 3TJZC 4PKYG 4EQ1A 2ZQ9A 5C5KA 2V8CA 1FCNA 4X53A 3GSGA 2XSSA 5FA7A 5HWWA 3MKFA 5HL1A 3CI6A 2AVXA 3VE4A 2GNXA 4PM6A 4D60A 3S7PA 2Y55A 5F1FA 3P01A 2ZC7A 4OP8A 4KZ4A 4HNBA 3MFXA 4QHCA 1HZOA 1UWPX 5HPIA 3LR5A 4GHIB 3IXHA 1BTLA 5I5LA 5F5YA 3BY9A 5CEDA 3ZNTA 2J3TC 3K3CA 2VJWA 3PHYA 2KDKA 4XUZA 2OLUA 1ES5A 3KSIA 3IXDA 5E2EA 2JKGA 2Q9MA 4CQHA 3FKVA 1F5MA 1K4EA 4JXWA 4OVDA 5EVIB 3BLSA 5FQMA 2YKHA 4GOGA 5FL3A 2XGNA 5JYPA 3NI9A 3NBLA 3UB9A 1V9YA 2HJEA 2HV1A 4MBHA 1XFQA 3H9WA 1KE3A 3MSHA 3DTKA 4OQHA 5HDDA 5HAIA 2V0UA 2I9VA 3F1NA 4DF6A 4CLCC 4NXGA 3E98A 4IBXA 2LB9A 4FH4A 2OAP1 4X68A 4Y0UA 4ZJ1A 3KSFA 1ESIA 4EUVA 3P7NA 4KZAA 5AJGA 4MN6A 3HJKA 3BQ8A 5DF9A 2E8IA 4R6LA 5EOOA 3EEAA 2G2WA 3MKEA 3PBQA 2PR6A 1SHVA 3RXWA 3NULA 4KG5A 1Y28A 2ZOIA 1K0KA 1YPRA 5HDCA 4P6ZM 1OJGA 1KGGA 5EE8A 3UPPA 1YLZA 4BMWA 3PTEA 1NXYA 5EUAA 2PT7A 3Q1FA 3AGDA 3G2YA 2WGWB 1Y4OA 4BJPA 4JF4A 5IHVA 4DKIA 4E3LA 1K38A 4IVIA 5CRFA 4K08A 5JYOA 3FC7A 3MBZA 4WEKA 2W1TA 1U60A 4KZ6A 4BD0A 3FPVA 4UQIM 3QNBA 5AQ9A 5CX7A 3W4OA 1UGUA 3SOIA 1VB6A 1PIOA 2EX2A 3LI9A 3KX0X 2WKIA 4DJ2A 2MJ6A 1IOUA 3VSLA 3IS2B 1DY6A 3AGEA 5CHUA 2ZC5B 3CLOA 3NC8A 4JXGA 3DWZA 4I3JA 4EEPA 3G35A 5FATA 3F1NB 3CPTB 4IBRA 3PAGA 2DNSA 4EEUA 5HARA 3WS5A 4JLFA 5GL9A 2Z6DA 3IT9A 3VV4A 2BLSA 1HTZA 4KUOA 4GN2A 4KZ9A 1W79A 1CEGA 4LGWA 2PAVP 1DJAA 5EM0A 5HD3A 3O88A 3NHQA 4N1HA 1W7FA 1E3UA 4FCFA 4P87A 4CLCE 1CQAA 3C7VA 1FCOA 4HBUA 3ZG5A 1YSQA 4OQIA 1LI9A 2W0NA 4OPZA 2D02A 3V50A 3OPLA 3O3VA 5HW3A 2XD1A 1LSVA 1HLUP 3M6BA 4PM7A 3LIAA 1LL5A 5L8MA 2OWJA 1N9LA 4OPQA 1CF0A 1BULA 3ISGA 1K6RA 1M6KA 5KSCA 4JKTA 2W1TB 3VOZA 5A90A 2P9VA 4Y3IA 1S1ZA 3FG8A 1KOUA 4L9FA 3IX3A 4EU0A 4DE2A 5HAPA 4R4SA 2HJ9C 2ZQAA 2XQZA 4GNUA 3QP5A 3NECA 4EERA 3MXQA 5EPHA 5IS1A 5L2FA 1K57C 2O99A 3MF0A 3ZFZA 3SH7A 1OJ5A 3UN7A 1MKIA 4DE3A 1T18A 3BFDA 5J8XA 4R0QA 3BY8A 3E2KA 1VETB 2XLNA 3W4QA 3JVVA 2VGLM 1D06A 3QP8A 2O9BA 2V9AA 2W3HA 3HLEA 3UY6A 1T19A 3LR4A 1YMSA 2WK0A 1H0MA 4BL2A 2H0YA 2VGJA 4S2OA 3ZVWA 2J8YA 1N4OA 3HBRA 2VV7A 3OPRA 3IF6A 1K54A 2GX5A 1KGFA 3PYPA 1FSWA 2RCXA 4E3NA 1T1CA 3T50A 1ES2A 3T1SA 3G31A 3WWXA 1A0KA 1MC0A 3LFVA 5FDHA 3RH8B 4BENA 2VLGA 4LFUA 4EBLA 2HP9A 2Q9NA 2WKQA 3O5YA 4BD1A 1PZPA 2W3FA 1BLSA 1E3UD 4ZDXA 3W8KA 3GV9A 4EUZA 1E4DA 4EESA 4GZBA 3SZTA 2EX6A 1H3QA 3U2AA 5D3OA 4WL9A 2EFXA 3LEZA 5FI2A 2ZC4B 2A24A 1NLZA 1KE0A 4WBGA 3V67A 5A93A 2XRNA 4ZRRA 1MZUA 3D9YA 4Z1WA 1H8YA 1L3LA 4G3KA 4GS9A 2FFYA 2J3WA 3C30A 2V1ZA 4HH3A 4IJGA 2XEPA 1G5UA 4GLQA 2Z6CA 1TEMA 2W3GA 4M3KA 3H82B 2PYRA 1N9OA 2W3EA 2JC7A 4YFMA 4Y2FA 1L0EA 5FQKA 1ES3A 4OPRA 1MY8A 2Y79A 5LBRA 1NY0A 3GVBA 3EQUA 3W4PA 4E3IA 4EW7A 4S2NA 3ZG8B 3MXSA 5HAQA 3HJIA 2ZC6B 4KENB 1BLPA 4HP4A 2R9WA 4OP5A 3MQOA 5F83A 5EFWA 4QY6A 2WYXA 2NUPC 1S4SA 4K0XA 1JWZA 4H8RA 5BOHA 3JVUA 3CUEC 4LV0A 2WAFA 3MZEA 1CEFA 1TDLA 2ZD8A 3G2ZA 3KYQA 2R9XA 3BYDA 3GRJA 3BFFA 5J3WA 2HP5A 3SS4A 4ARZA 4AFIA 2HGVA 3HLFA 4IVKA 3F1OA 3Q81A 1NZOA 3LIDA 3VP2A 3FKWA 1SZVA 5L07A 4R38A 4OQ0A 1L0GA 4JXVA 4HOIA 3MFDA 2GDNA 4FD8A 5CHMA 4WEJA 3L7HA 1QMEA 3ITAA 2VKSA 2Y2GA 3OZHA 1GSXA 3A0RA 1KDSA 1F9IA 2A24B 1W8YA 1TS8A 3H7WA 1J9MA 1P9RA 3VFFA 4R3BA 3N4IA 3MQ0A 2JE5A 3A3EA 4GS9B 2ZQ7A 1EROA 1N9BA 1O07A 3PBRA 1IKIA 1L0DA 2ZM8A 1V9ZA 5AQ7A 1IYQA 4CLCA 1IYPA 1XX2A 1S1YA 3IX4A 1UWNX 2FFFB 3FWLA 4EBPA 4EV4A 2PRFA 1EI5A 1TS7A 2E8JA 1GSVA 2HDSA 2DCFA 4ETXA 4MN5A 1D1JA 4P6BA 5L09A 4XT2A 4KUKA 5TR7A 2WKPA 2O9AA 5L10A 1G28A 2QWSA 4E3KA 2IWDA 4LV1A 2DRWA 1E25A 2CC1A 4OLGA 4P0MA 1NZUA 4CPKA 3W2ZA 4O8GA 5G18A 1PI4A 3UDFA 1FR1A 2X01A 1PFLA 4ARZB 1H5XA 1GA9A 1ALQA 4LRYC 2ZL1A 2P74A 3HUNA
chains in the Genus database with same CATH topology
2MJ6A 3T4QA 1IOUA 4RQ9A 2XROA 3UE3A 3IS2B 4OOMA 3R4KA 4Y5FA 2W3DA 2W27A 5HL6A 3CLOA 4DMZA 3B42A 2GJ3A 3GDIA 1DRMA 3PBTA 2VA0A 2QJ7A 4I3JA 4GHIA 4EEPA 1XFNA 3S7QA 1XJ6A 2L0WA 3C38A 3LUQA 3NOTC 3F1NB 5AVEA 1EW0A 2VGLS 4M4XA 4MCWA 4LLOB 4EEUA 1DP6A 1TD5A 3H7WB 4HJ6A 3B47A 1W63Q 2Z6DA 3VV4A 1H8MA 4WN5A 3EEHA 5TBMA 4KUOA 3PBSA 2JKRM 2B02A 2M7VA 1DP9A 3EOIA 4F3LA 3OCLA 2GZAA 1ODVA 2PDRA 5DKLA 3BJNA 3TW8A 3OOVA 4H6JB 5HD3A 4BBUA 3S7OA 1LT0A 3CWFA 3NHQA 4MN7A 4CLCB 1S4RA 5KSHA 4GJ4A 4CLCE 4ETZA 2VV6A 4ME4A 1XJ2A 1G6OA 4PAUA 3KSGA 1YSQA 2EWWA 3LR3A 4R70A 3RTYA 3E4PA 1S66L 2W0NA 1TS0A 2D02A 5DJTA 1VHMA 4QPRA 4DJ3A 4CLCD 2V1BA 4JGPA 1LSVA 4G3VA 4L0LA 2JN7A 2Y8HA 1LSXA 3LIAA 1YSPA 4WLAA 2B18A 3LIFA 2VX8A 4YNRA 5L8MA 1D7EA 2OWJA 3C2WA 1N9LA 1OTEA 3E4QA 1XJ3A 2W1TB 4Y3IA 1S1ZA 4LPZA 3FG8A 5KIZA 1KOUA 4I38A 4L9FA 3MMHA 3OLOA 4I3AA 4BBVA 4HI4A 4EU0A 4WF0A 3EWKA 3LICA 3BWLA 2PD8A 4HP9A 5HDSA 1NRJA 2V0WA 3OBFA 2HJ9C 4HY8A 4O01A 3R7WA 4EERA 3MXQA 2DMWA 2IA2A 5IS1A 4NKPA 3KO6A 2JKTI 4OOLA 1P9WA 3TRCA 3C8CA 3A0VA 2O99A 3PR6A 3MF0A 4WUJA 2VZWA 1OT6A 1OJ5A 2QJ5A 4HJ4A 3LR0A 1T18A 4E04A 3DBAA 1OPXA 3LIBA 2QYBA 4BWIA 2HF6A 3F1OB 3BW6A 2VEAA 3BY8A 2XA7S 4NEED 3CITA 2VGLM 3JVVA 1D06A 1TS6A 2O9BA 2V9AA 2K7SA 3ICYA 2PR5A 4GCZA 2W3HA 3D72A 5HWTA 3TE8A 1T19A 3LR4A 5K5BA 1YAXA 2P7JA 3ULFA 5HSQA 2P08A 2VV7A 3GECA 4II7A 5TBMB 2J3TD 1NLYA 5G4ZA 3T4OA 2GX5A 4B9OA 3UMEA 3PYPA 4LRXC 1ZHHB 3NOPC 2QKPA 4IUKA 1T1CA 2L4RA 3T50A 3UMDA 2K2NA 3G6OA 1P0ZA 1NWZA 3B33A 2INWA 2EA9A 4JGRA 1XJ4A 4IUHA 2O9CA 3IS2A 4B93A 1MC0A 3LFVA 3RH8B 2FZ0A 1P97A 2VLGA 3PBNA 4WELA 3KSHA 4JGQA 1LL8A 2WKQA 3IBJA 2M1CA 3O5YA 1LSWA 2W3FA 4NXEA 4MMNA 5A8BA 5AVFA 3MR0A 3RFBA 3UB7A 2QHKA 4Q0JA 2JHEA 2R78A 4EESA 5F69A 3T4KA 4R3AA 1GSWA 3IBRA 1WA9A 2PYPA 3UB6A 1H3QA 3U2AA 5HD5A 4PKYA 4EXOA 1ZTUA 4WL9A 2KX6A 4I3IA 2M7UA 2A24A 1N9NA 4XT2B 1NLZA 3MJQA 2WKRA 3V67A 4H6JA 1IFQA 2XRNA 3A0SA 3F1PA 1MZUA 4ZRRA 3SW1A 4Z1WA 3TJZC 4G3KA 4GS9A 3D3OA 4PKYG 4Q0HA 3R7WB 2J3WA 4EQ1A 5C5KA 5J4EA 3T4SA 3C30A 1OTAA 4HH3A 3LIEA 4IJGA 4GLQA 2Z6CA 2XSSA 2L1MA 3ZQ5A 1STZA 5HWWA 2W3GA 3H82B 2PYRA 1N9OA 2W3EA 3CI6A 3VE4A 2GNXA 4Y2FA 3T4LA 2D01A 3PXPA 2Y79A 5LBRA 4P6ZS 3EQUA 3HCYA 4EW7A 3S7PA 2G7UA 5MC7A 2XA7M 3K2NA 3P01A 2PD7A 3HJIA 5F6AA 4JGOA 4HNBA 3MFXA 3ZYTA 4HP4A 3MQOA 1UWPX 5EFWA 5HPIA 2JKTM 3UB8A 3LR5A 4GHIB 2NUPC 4HJ3A 2OOLA 5F68A 5I5LA 5F5YA 3BY9A 2K31A 3LYXA 1S4SA 3OCNA 2J3TC 2P04A 3JVUA 3CUEC 5DJUA 3K3CA 2VJWA 3PHYA 1BYWA 5G4YA 2KDKA 2ZMVA 4HH2A 4PHTA 2OWHA 3KSIA 2NUTC 4UQIS 3KYQA 4CQHA 1OTBA 5J3WA 4F3LB 1F5MA 4ARZA 4AFIA 2HGVA 2OAQ1 5TJJA 2KOIA 2YKHA 3F1OA 5FL3A 4NXFA 5HWVA 3LIDA 4NXBA 3K3DA 3MQQA 4R38A 3CUEA 4I39A 3UB9A 1V9YA 2HJEA 2JKRI 3VOLA 2HV1A 2ZMFA 1XFQA 3UE6A 4HOIA 3H9WA 5IU1A 5HDDA 2YKFA 4WEJA 4KQOA 2VKSA 2V0UA 5IT5A 1GSXA 2H28A 5J7EA 2I9VA 3A0RA 3F1NA 3EQVA 4CLCC 4NXGA 3E98A 2A24B 1F9IA 2LB9A 1OTDA 1TS8A 3E4OA 3H7WA 3E0YA 2OAP1 5DKKA 1P9RA 4HQAA 1T1AA 1OTIA 3F1PB 4O0PA 1JNUA 3MQ0A 1OT9A 3KSFA 4GS9B 4EUVA 4YWZA 3P7NA 3EGDC 3T4JA 5AJGA 5HZHA 2PHYA 3HJKA 3PBRA 3BQ8A 4MN6A 2A2LA 4UEYA 5DFYA 4G3WA 4EETB 5DF9A 4R6LA 3NJAA 4HIAA 1V9ZA 4Q0IA 2ZBBA 3EEAA 3PBOA 2J80A 3PBQA 2PR6A 4CLCA 1YKDA 2W1RA 1S1YA 1Y28A 2ZOIA 3LI8A 4L9EA 5HDCA 4P6ZM 5DFXA 1MKMA 3BQAA 1UWNX 3OC2A 1OJGA 3KYZA 1X0OA 1TS7A 2EWVA 1GSVA 2O0YA 4I5SA 1W63M 4BMWA 3T4TA 1F98A 2LB5A 4IHQA 4GW9A 2PT7A 4ETXA 2V1AA 3FPWA 4MN5A 5HPFA 4KQDA 1TF1A 4MDZA 4BJPA 4XT2A 4KUKA 2WKPA 3S7NA 3CAXA 2O9AA 1G28A 4K08A 3FC7A 3EGXC 2QWSA 2CMNA 4WEKA 1T1BA 4YOFA 2FH5A 3NOUC 4DN0A 2W1TA 2VV8A 3FPVA 4UQIM 3W2ZA 3VE3A 5CX7A 4O8GA 1UGUA 2ZOHA 4LRZE 1VB6A 4FOFA 3LI9A 3H82A 4HHDA 4ARZB 4FSFA 3KX0X 2KLIA 4LRYC 4BBTA 4DJ2A 1S67L 4L9GA 2BASA 1DP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQ9 A;  2XRO A;  2M7U A;  3OBF A;  4O01 A;  2VKS A;  2IA2 A;  3R4K A;  4Y5F A;  3KO6 A;  2W3D A;  5HL6 A;  3TRC A;  4DMZ A;  2XRN A;  4ZRR A;  4Z1W A;  2O99 A;  3E98 A;  3MF0 A;  4G3K A;  2LB9 A;  2VZW A;  3D3O A;  4Q0H A;  5C5K A;  3E0Y A;  3S7Q A;  3NOT C;  4E04 A;  4O0P A;  3DBA A;  4IJG A;  3MQ0 A;  2QYB A;  4GLQ A;  4BWI A;  3KSF A;  2XSS A;  4MCW A;  3ZQ5 A;  4EUV A;  1STZ A;  2VEA A;  1TD5 A;  2W3G A;  2W3E A;  3CI6 A;  5AJG A;  5DFY A;  4Y2F A;  3VV4 A;  4G3W A;  3CIT A;  2Y79 A;  4R6L A;  2O9B A;  5LBR A;  2W3H A;  4Q0I A;  3EEA A;  3HCY A;  3S7P A;  2G7U A;  5K5B A;  2M7V A;  1YKD A;  3K2N A;  2W1R A;  3BJN A;  5HSQ A;  5DFX A;  1MKM A;  3OOV A;  3S7O A;  3NHQ A;  4MN7 A;  2GX5 A;  2O0Y A;  5HPI A;  4ETZ A;  4LRX C;  4ME4 A;  3NOP C;  4IUK A;  2OOL A;  4PAU A;  2LB5 A;  3KSG A;  1YSQ A;  4GW9 A;  5I5L A;  4R70 A;  4ETX A;  2K31 A;  2K2N A;  3G6O A;  5HPF A;  1TF1 A;  4MDZ A;  2VJW A;  4IUH A;  2O9C A;  1VHM A;  3S7N A;  1MC0 A;  3LFV A;  3KSI A;  4QPR A;  2O9A A;  3KSH A;  4G3V A;  2Y8H A;  4CQH A;  4YOF A;  1YSP A;  3NOU C;  3O5Y A;  2W1T A;  3IBJ A;  2B18 A;  4DN0 A;  4YNR A;  5L8M A;  2W3F A;  1F5M A;  4MMN A;  3C2W A;  2HGV A;  3W2Z A;  5TJJ A;  3RFB A;  4O8G A;  2KOI A;  4LRZ E;  4FOF A;  4Q0J A;  2W1T B;  4Y3I A;  3IBR A;  2KLI A;  4LRY C;  3MMH A;  4EU0 A;  1ZTU A;  2ZMF A; 
#chains in the Genus database with same CATH topology
 4WM9 A;  4KZ3 A;  4RQ9 A;  2XRO A;  4ZTK A;  5DTS A;  3BRM A;  3GTC A;  4Y5F A;  2W3D A;  4DMZ A;  4PPR A;  2GJ3 A;  3GDI A;  1VM1 A;  5EVI C;  1XFN A;  4WMC A;  5TFQ A;  1W8Q A;  3NOT C;  2HZ5 A;  4LLO B;  4R1G A;  2WKE A;  1DP6 A;  1VEU A;  4QU3 A;  1G6A A;  3H7W B;  4HJ6 A;  1W63 Q;  1Q2Q A;  4MLL A;  1AWI A;  2Z2L B;  4KG6 A;  2ACG A;  3EEH A;  5TBM A;  3PBS A;  1SCW A;  5FAQ A;  2JKR M;  2B02 A;  2M7V A;  1DP9 A;  3OPP A;  4K91 A;  3OCL A;  4F3L A;  1ODV A;  2PDR A;  3BJN A;  3UO9 A;  1NYY A;  4BBU A;  1FIL A;  4HBT A;  3CWF A;  4DRT A;  4CLC B;  3TG9 A;  1XGJ A;  1LL9 A;  2EWW A;  3UNW A;  3BFE A;  4R70 A;  3E4P A;  3A3D A;  4O7D A;  1JWV A;  1IEM A;  3VP3 A;  3C5A A;  4DJ3 A;  4KZ7 A;  2V1B A;  4CLC D;  5FQI A;  4JGP A;  1XA1 A;  4G3V A;  2JN7 A;  1YSP A;  4HES A;  1SKO A;  2B18 A;  5GLB A;  3E2L A;  3E4Q A;  3GQZ A;  4KQQ A;  2OV5 A;  2V2F F;  1W5D A;  4ZJ2 A;  4Y13 A;  5KIZ A;  4BBV A;  3N8R A;  4WF0 A;  3ZNY A;  3LIC A;  2PD8 A;  1PWD A;  3UDX A;  3OBF A;  2Y2K A;  5GLA A;  1HD8 A;  3R7W A;  1O7E A;  5M18 A;  1GHM A;  1P9W A;  3UE1 A;  1YLP A;  4HEF A;  4WUJ A;  4PM8 A;  4GDN A;  3NDG A;  2QJ5 A;  3GR2 A;  3LR0 A;  1FCM A;  4MBF A;  3HLG A;  4E04 A;  1KE4 A;  1OPX A;  2HF6 A;  3DWK A;  1JWP A;  2WUQ A;  4KZ8 A;  4GDB A;  3C4P A;  1IEL A;  4WZ5 C;  2PR5 A;  1VEU B;  1K57 A;  3FV7 A;  1YAX A;  2P7J A;  3BM6 A;  3ULF A;  5TGF A;  4PM5 A;  3O86 A;  5HSQ A;  3SS5 A;  4WMC D;  5TBM B;  3AGF A;  1NLY A;  1BSG A;  2HDQ A;  4X1L A;  3NOP C;  2QKP A;  4X55 A;  4KQR A;  4PM9 A;  3TOI A;  2K2N A;  3G6O A;  1HVB A;  1P0Z A;  4PMA A;  5CHJ A;  2INW A;  3G32 A;  4IUH A;  2O9C A;  3ITB A;  4S2M A;  3PBN A;  3ZGA B;  1JTD A;  1K4F A;  3WRT A;  1BLC A;  3IBJ A;  2M1C A;  3JPU A;  2PBD P;  3QP4 A;  5A8B A;  3ZDJ A;  5FI7 A;  1FQG A;  2BG1 A;  1OME A;  3UB7 A;  4Q0J A;  4GKU A;  1KVM A;  4UAA A;  5F69 A;  5GHY A;  1GSW A;  1L0F A;  1WA9 A;  3UB6 A;  4PKY A;  2M7U A;  4OQG A;  4BQM A;  4RX2 A;  2H5S A;  3ZHH A;  4DXC A;  1XP4 A;  1XKZ A;  2V8F A;  2Y2O A;  4H6J A;  3WS4 A;  4X6T A;  5FAS A;  3M6H A;  4Q0H A;  1MPL A;  1XGI A;  3R7W B;  4E3J A;  3LGO A;  5KZH A;  1GHI A;  2L1M A;  3ZQ5 A;  3MZD A;  2B5R A;  1ZG4 A;  3DTE A;  4BLM A;  2H10 A;  3PXP A;  4P6Z S;  2PU2 A;  3HCY A;  3OPH A;  4X1M A;  2XA7 M;  3K2N A;  4S2P A;  5F6A A;  3TSG A;  5FI6 A;  1GCE A;  4FTX A;  3ZYT A;  1LHY A;  5CTN A;  2Z2M B;  2JKT M;  3LCE A;  4U0T A;  4Q8I A;  3Q7V A;  1IKG A;  4HJ3 A;  5M19 A;  5CGX A;  2K31 A;  3IWQ A;  3LYX A;  1SKF A;  3OCN A;  2P04 A;  1CI9 A;  5DJU A;  4U3T A;  1BYW A;  4XXR A;  5G4Y A;  2ZMV A;  2XR0 A;  1CJF A;  3Q7Z A;  2NUT C;  4UQI S;  3LY3 A;  4RX3 A;  1SDN A;  3IWO A;  5FEG A;  2EXB A;  1OTB A;  1ACF A;  3Q07 A;  1K55 C;  4U0X A;  3HUM A;  2WZZ A;  2OAQ 1;  1IYO A;  1K25 A;  5FSR A;  3G30 A;  4NXB A;  3MQQ A;  5EV0 A;  3CUE A;  4I39 A;  1TDG A;  2ZMF A;  3UE6 A;  3HLW A;  5IU1 A;  2YKF A;  3LY4 A;  4JF6 A;  4KQO A;  1J3W A;  3UB5 P;  5IT5 A;  2H28 A;  2RL3 A;  3SH8 A;  3I7J A;  4LEN A;  4QB8 A;  2ZMA A;  3FYZ A;  3CHW P;  4JPM A;  4ID4 A;  4KG2 A;  3UDI A;  3C7U A;  1OTI A;  4O0P A;  5FQQ A;  2ZM0 A;  2P9V B;  3IF5 A;  3T4J A;  4ZJ3 A;  5HZH A;  4C6Y A;  1Q2P A;  4G3W A;  4EET B;  1S6R A;  3G34 A;  4HIA A;  2XF3 A;  4LCL A;  3DTM A;  2VK3 A;  3FZC A;  4RVA A;  3LI8 A;  4L9E A;  5DFX A;  1MKM A;  3BQA A;  4D2O A;  3OC2 A;  4UA7 A;  3KYZ A;  2UV0 E;  2XK1 A;  5F82 A;  1X0O A;  2O0Y A;  4I5S A;  4BL3 A;  3KYE A;  1W63 M;  3T1Q B;  1KGE A;  4A5R A;  4IHQ A;  4GW9 A;  3V39 A;  1ESU A;  2XFT A;  2V1A A;  2V20 A;  3FPW A;  5HPF A;  4KQD A;  1TF1 A;  4MDZ A;  2QPN A;  3S7N A;  3CAX A;  5DTT A;  4DDY A;  4N9L A;  4S2K A;  3EGX C;  4RYE A;  2WAD A;  4OH0 A;  3IHA A;  1T1B A;  3NOU C;  2VV8 A;  3IX8 A;  1MWS A;  2EXA A;  3WS2 A;  4EWF A;  4Y0O A;  3IF6 B;  2ZOH A;  4LRZ E;  4FOF A;  4X25 A;  3CJM A;  3NY4 A;  4HHD A;  4LV3 A;  4FSF A;  2KLI A;  3C4O A;  4QWO A;  5CXW A;  1EWZ A;  2BAS A;  3UE3 A;  3UMD A;  5DF7 A;  3A3F A;  3V3R A;  4X56 A;  4OOM A;  3R4K A;  4S2I A;  2W27 A;  5HL6 A;  3V5M A;  3NCK A;  4C3Q A;  2Y2M A;  3PBT A;  3N8S A;  2VA0 A;  2QJ7 A;  5AQA A;  3IWI A;  4GHI A;  1FIK A;  3S7Q A;  1XJ6 A;  5AVE A;  2VGL S;  2Y2N A;  1MXO A;  2Y2J A;  1TD5 A;  3B47 A;  2IWC A;  3O87 A;  3EOI A;  4MNR A;  1C3B A;  4MEZ A;  3TW8 A;  5EVI A;  2Y2L A;  1DJC A;  1LT0 A;  5FQ9 A;  5EEC A;  1S4R A;  5U47 A;  4GJ4 A;  1FOF A;  2ZM2 A;  4ME4 A;  1G6O A;  3KSG A;  5GLD A;  3JYI A;  1YLT A;  1SDE A;  1S66 L;  2H0T A;  2WZX A;  3PAE A;  2A3U A;  1TS0 A;  4N9K A;  1VHM A;  3CZD A;  4QPR A;  4LCM A;  3N7W A;  1LSX A;  3LEQ A;  1BLH A;  3LIF A;  1NYM A;  1WE4 A;  4YNR A;  4CJN A;  1OTE A;  2Q0O A;  4UA6 A;  4S2N C;  4IED A;  5I94 A;  5GHZ A;  1XJ3 A;  2EX9 A;  4LPZ A;  2X71 A;  4I38 A;  4HI4 A;  4QY5 A;  3EWK A;  2XFS A;  5HDS A;  1DJB A;  2V0W A;  3VMA A;  5EVE A;  4OKP A;  3D4F A;  2DMW A;  1MWU A;  3IXB A;  4NKP A;  4OOL A;  3CMZ A;  3C8C A;  3A0V A;  2XH9 A;  5AQB A;  2ZLY A;  3MS6 A;  1OT6 A;  3A3I A;  4QD4 A;  1RCJ A;  3DBA A;  2ZQD A;  2WGW A;  3F1O B;  3Q82 A;  4C75 A;  3QP1 A;  2J9P A;  4NEE D;  3CIT A;  3BEB A;  1TS6 A;  1Y54 A;  2K7S A;  3V3S A;  5HWT A;  1VQQ A;  2J9O A;  2EX8 A;  3HLC A;  4FH2 A;  5CEC A;  1Z6F A;  2Y4A A;  2P08 A;  4NG2 A;  2J3T D;  3QNC A;  2PU4 A;  5G4Z A;  2ZQC A;  3T4O A;  3DAV A;  2OSU A;  3UME A;  4LRX C;  1ZHH B;  4X69 A;  3WS0 A;  2HP6 A;  2B95 A;  3QP2 A;  1NWZ A;  4WZ5 A;  1S0W A;  3B33 A;  2EA9 A;  5E2F A;  3IS2 A;  4WEL A;  3KSH A;  3HVF A;  4JGQ A;  5EVI D;  3VFH A;  1LSW A;  2XD5 A;  4NXE A;  3IQA A;  3CPT A;  3DTI A;  3RFB A;  2QHK A;  2JHE A;  2R78 A;  1PRQ A;  2IWB A;  2JBF A;  3T4K A;  4R3A A;  2PYP A;  1KDW A;  1XA7 A;  3MXR A;  5HD5 A;  1ZTU A;  4JF5 A;  4P85 A;  1N9N A;  4XT2 B;  1CI8 A;  4WZ4 A;  2WKR A;  1IFQ A;  3A0S A;  3F1P A;  1LI0 A;  4YIN A;  3D3O A;  2PBY A;  1CK3 A;  5J4E A;  3T4S A;  1ES4 A;  1OTA A;  4ZBE A;  3S4X A;  3LIE A;  3N8L A;  1STZ A;  4K0W A;  3T4L A;  2D01 A;  2ZL1 B;  2J7V A;  3CG5 A;  3T1R A;  2G7U A;  5MC7 A;  1M40 A;  1JTG A;  2JCH A;  2PD7 A;  1GA0 A;  1ZC2 A;  4N1X A;  5KMW A;  4JGO A;  2Y2P A;  3UPO A;  3UB8 A;  3HUO A;  2OOL A;  4F94 A;  5F68 A;  3HRE A;  1FR6 A;  2Y2Q A;  2G2U A;  2Y59 A;  3HLD A;  1RGZ A;  4HH2 A;  4PHT A;  5DTK A;  2OWH A;  2WGI A;  3S1Y A;  3U4L P;  4KZ5 A;  1AXB A;  4F3L B;  3S22 A;  3M2K A;  1IYS A;  5TJJ A;  2KOI A;  1RP5 A;  2HDU A;  4NXF A;  3LO7 A;  5CGS A;  5HWV A;  4MBK A;  3K3D A;  1VET A;  3SH9 A;  2ZQ8 A;  3RXX A;  2JKR I;  3VOL A;  4OON A;  3BLM A;  1WYB A;  3QHY A;  1PZO A;  5J7E A;  1PW8 A;  1K55 A;  2EFU A;  5FDS A;  4Z9Q A;  3EQV A;  3SS3 A;  4KZB A;  4RA7 A;  5A91 A;  1PNE A;  1OTD A;  1BZA A;  1SKO B;  1XXM A;  3E4O A;  3E0Y A;  3BFG A;  5DKK A;  4HQA A;  3VSK A;  5FAP A;  1T1A A;  3F1P B;  1JNU A;  1OT9 A;  5DVA A;  5CTM A;  4YWZ A;  3EGD C;  2ZJ9 A;  4EBN A;  1WYC A;  4UEY A;  5DFY A;  2PHY A;  4EQI A;  2A2L A;  1Z09 A;  3UPN A;  3NJA A;  4Q0I A;  4DE0 A;  2ZBB A;  3VP1 A;  3PBO A;  1NJ4 A;  2J80 A;  2XDM A;  1YKD A;  2W1R A;  1PWG A;  3T12 B;  3RJU A;  3BFC A;  1YLY A;  2C6W B;  2EWV A;  1ZKJ A;  4Y7P A;  1YMX A;  3T4T A;  1F98 A;  2LB5 A;  3P98 A;  2VGK A;  4N92 A;  3NDE A;  4OLD A;  5E2G A;  1L2S A;  1K6S A;  2CMN A;  4YOF A;  2FH5 A;  1BT5 A;  4DN0 A;  2Y91 A;  1QMF A;  3ZCZ A;  3VE3 A;  1FSY A;  1ERM A;  3MZF A;  5FAO A;  1MWT A;  3H82 A;  2A49 A;  3ZG7 B;  1I2W A;  4BBT A;  1S67 L;  4L9G A;  4E6X A;  1DP8 A;  3T4Q A;  1JVJ A;  1I2S A;  3HLB A;  2WKH A;  3QP6 A;  4R4R A;  2OLV A;  3ZG9 B;  5F1G A;  5DF8 A;  4B88 A;  3B42 A;  1YQS A;  1DRM A;  2C5W B;  3VP0 A;  4GD6 A;  4UA9 A;  4Y0T A;  1YLW A;  1BUE A;  5HFO A;  2L0W A;  3C38 A;  3LUQ A;  4GD8 A;  3WRZ A;  1EW0 A;  4M4X A;  4MCW A;  1LLB A;  1MBL A;  4DXB A;  4QJG A;  3HL9 A;  1H8M A;  4WN5 A;  4E3O A;  2GZA A;  2JKF A;  5DKL A;  2ZC3 B;  3OOV A;  4H6J B;  3S7O A;  4DDS A;  4WYY A;  5GLC A;  4MN7 A;  5HX9 A;  5KSH A;  3M2J A;  4ETZ A;  1K56 A;  2VV6 A;  5CGW A;  2HDR A;  1XJ2 A;  4PAU A;  3LR3 A;  4GB7 A;  4ESP A;  4E6W A;  3RTY A;  4S2L A;  4JBF A;  4OPY A;  3VOY A;  2WGV A;  3UE0 A;  4R23 A;  4XUX A;  5DJT A;  5CER A;  1PW1 A;  1YLJ A;  2QMI A;  4L0L A;  2Y8H A;  3IHB A;  4WLA A;  3ZG0 A;  2VX8 A;  1D7E A;  3C2W A;  3Q7V B;  1PWC A;  3MMH A;  3OLO A;  4I3A A;  4JXS A;  2QZ6 A;  3BWL A;  1I5Q A;  4HP9 A;  3A3J A;  1NRJ A;  3BEC A;  4UHU A;  4HY8 A;  5FEF A;  2X02 A;  4R3J A;  4O01 A;  3B3X A;  2IA2 A;  3KO6 A;  1YT4 A;  2JKT I;  5E2H A;  3TRC A;  4OOY A;  3PR6 A;  3IH8 A;  2VZW A;  4HJ4 A;  3VP4 A;  1MWR A;  5CEB A;  3IF6 C;  3N6I A;  3LIB A;  1K54 C;  2QYB A;  4BWI A;  4E3M A;  3BW6 A;  5EOE A;  2VEA A;  1RGY A;  5EM1 A;  2XA7 S;  3T1X A;  3IXG A;  1GHP A;  4DE1 A;  3ICY A;  4GCZ A;  3D72 A;  5FQJ A;  3TE8 A;  2WAE A;  1H8Z A;  5K5B A;  4Y15 A;  4Y17 A;  3GEC A;  4II7 A;  4B4Z A;  1ERQ A;  1PI5 A;  4B9O A;  1NRF A;  4IUK A;  2BTF P;  3L9K A;  4LV2 A;  2L4R A;  5A92 A;  4S2J A;  3G4P A;  2Y2I A;  4JGR A;  1XJ4 A;  4B93 A;  2FZ0 A;  1P97 A;  4NET A;  3GMW A;  4NK3 A;  2HPB A;  1G68 A;  5M1A A;  1LL8 A;  1YM1 A;  3DW0 A;  4B4X A;  4MMN A;  1ZG6 A;  1ONG A;  1TVF A;  3IH9 A;  5AVF A;  5GHX A;  3MR0 A;  1K56 D;  1PYY A;  4ZAM A;  2Y2H A;  3WS1 A;  1F2K A;  3IBR A;  4EXO A;  3ZVT A;  2KX6 A;  1XPB A;  5EVL A;  5E43 A;  2UWX A;  4I3I A;  1KVL A;  3P09 A;  3MJQ A;  2I72 A;  1ONH A;  4FUW A;  3SW1 A;  3NIA A;  3TJZ C;  4PKY G;  4EQ1 A;  2ZQ9 A;  5C5K A;  2V8C A;  1FCN A;  4X53 A;  3GSG A;  2XSS A;  5FA7 A;  5HWW A;  3MKF A;  5HL1 A;  3CI6 A;  2AVX A;  3VE4 A;  2GNX A;  4PM6 A;  4D60 A;  3S7P A;  2Y55 A;  5F1F A;  3P01 A;  2ZC7 A;  4OP8 A;  4KZ4 A;  4HNB A;  3MFX A;  4QHC A;  1HZO A;  1UWP X;  5HPI A;  3LR5 A;  4GHI B;  3IXH A;  1BTL A;  5I5L A;  5F5Y A;  3BY9 A;  5CED A;  3ZNT A;  2J3T C;  3K3C A;  2VJW A;  3PHY A;  2KDK A;  4XUZ A;  2OLU A;  1ES5 A;  3KSI A;  3IXD A;  5E2E A;  2JKG A;  2Q9M A;  4CQH A;  3FKV A;  1F5M A;  1K4E A;  4JXW A;  4OVD A;  5EVI B;  3BLS A;  5FQM A;  2YKH A;  4GOG A;  5FL3 A;  2XGN A;  5JYP A;  3NI9 A;  3NBL A;  3UB9 A;  1V9Y A;  2HJE A;  2HV1 A;  4MBH A;  1XFQ A;  3H9W A;  1KE3 A;  3MSH A;  3DTK A;  4OQH A;  5HDD A;  5HAI A;  2V0U A;  2I9V A;  3F1N A;  4DF6 A;  4CLC C;  4NXG A;  3E98 A;  4IBX A;  2LB9 A;  4FH4 A;  2OAP 1;  4X68 A;  4Y0U A;  4ZJ1 A;  3KSF A;  1ESI A;  4EUV A;  3P7N A;  4KZA A;  5AJG A;  4MN6 A;  3HJK A;  3BQ8 A;  5DF9 A;  2E8I A;  4R6L A;  5EOO A;  3EEA A;  2G2W A;  3MKE A;  3PBQ A;  2PR6 A;  1SHV A;  3RXW A;  3NUL A;  4KG5 A;  1Y28 A;  2ZOI A;  1K0K A;  1YPR A;  5HDC A;  4P6Z M;  1OJG A;  1KGG A;  5EE8 A;  3UPP A;  1YLZ A;  4BMW A;  3PTE A;  1NXY A;  5EUA A;  2PT7 A;  3Q1F A;  3AGD A;  3G2Y A;  2WGW B;  1Y4O A;  4BJP A;  4JF4 A;  5IHV A;  4DKI A;  4E3L A;  1K38 A;  4IVI A;  5CRF A;  4K08 A;  5JYO A;  3FC7 A;  3MBZ A;  4WEK A;  2W1T A;  1U60 A;  4KZ6 A;  4BD0 A;  3FPV A;  4UQI M;  3QNB A;  5AQ9 A;  5CX7 A;  3W4O A;  1UGU A;  3SOI A;  1VB6 A;  1PIO A;  2EX2 A;  3LI9 A;  3KX0 X;  2WKI A;  4DJ2 A;  2MJ6 A;  1IOU A;  3VSL A;  3IS2 B;  1DY6 A;  3AGE A;  5CHU A;  2ZC5 B;  3CLO A;  3NC8 A;  4JXG A;  3DWZ A;  4I3J A;  4EEP A;  3G35 A;  5FAT A;  3F1N B;  3CPT B;  4IBR A;  3PAG A;  2DNS A;  4EEU A;  5HAR A;  3WS5 A;  4JLF A;  5GL9 A;  2Z6D A;  3IT9 A;  3VV4 A;  2BLS A;  1HTZ A;  4KUO A;  4GN2 A;  4KZ9 A;  1W79 A;  1CEG A;  4LGW A;  2PAV P;  1DJA A;  5EM0 A;  5HD3 A;  3O88 A;  3NHQ A;  4N1H A;  1W7F A;  1E3U A;  4FCF A;  4P87 A;  4CLC E;  1CQA A;  3C7V A;  1FCO A;  4HBU A;  3ZG5 A;  1YSQ A;  4OQI A;  1LI9 A;  2W0N A;  4OPZ A;  2D02 A;  3V50 A;  3OPL A;  3O3V A;  5HW3 A;  2XD1 A;  1LSV A;  1HLU P;  3M6B A;  4PM7 A;  3LIA A;  1LL5 A;  5L8M A;  2OWJ A;  1N9L A;  4OPQ A;  1CF0 A;  1BUL A;  3ISG A;  1K6R A;  1M6K A;  5KSC A;  4JKT A;  2W1T B;  3VOZ A;  5A90 A;  2P9V A;  4Y3I A;  1S1Z A;  3FG8 A;  1KOU A;  4L9F A;  3IX3 A;  4EU0 A;  4DE2 A;  5HAP A;  4R4S A;  2HJ9 C;  2ZQA A;  2XQZ A;  4GNU A;  3QP5 A;  3NEC A;  4EER A;  3MXQ A;  5EPH A;  5IS1 A;  5L2F A;  1K57 C;  2O99 A;  3MF0 A;  3ZFZ A;  3SH7 A;  1OJ5 A;  3UN7 A;  1MKI A;  4DE3 A;  1T18 A;  3BFD A;  5J8X A;  4R0Q A;  3BY8 A;  3E2K A;  1VET B;  2XLN A;  3W4Q A;  3JVV A;  2VGL M;  1D06 A;  3QP8 A;  2O9B A;  2V9A A;  2W3H A;  3HLE A;  3UY6 A;  1T19 A;  3LR4 A;  1YMS A;  2WK0 A;  1H0M A;  4BL2 A;  2H0Y A;  2VGJ A;  4S2O A;  3ZVW A;  2J8Y A;  1N4O A;  3HBR A;  2VV7 A;  3OPR A;  3IF6 A;  1K54 A;  2GX5 A;  1KGF A;  3PYP A;  1FSW A;  2RCX A;  4E3N A;  1T1C A;  3T50 A;  1ES2 A;  3T1S A;  3G31 A;  3WWX A;  1A0K A;  1MC0 A;  3LFV A;  5FDH A;  3RH8 B;  4BEN A;  2VLG A;  4LFU A;  4EBL A;  2HP9 A;  2Q9N A;  2WKQ A;  3O5Y A;  4BD1 A;  1PZP A;  2W3F A;  1BLS A;  1E3U D;  4ZDX A;  3W8K A;  3GV9 A;  4EUZ A;  1E4D A;  4EES A;  4GZB A;  3SZT A;  2EX6 A;  1H3Q A;  3U2A A;  5D3O A;  4WL9 A;  2EFX A;  3LEZ A;  5FI2 A;  2ZC4 B;  2A24 A;  1NLZ A;  1KE0 A;  4WBG A;  3V67 A;  5A93 A;  2XRN A;  4ZRR A;  1MZU A;  3D9Y A;  4Z1W A;  1H8Y A;  1L3L A;  4G3K A;  4GS9 A;  2FFY A;  2J3W A;  3C30 A;  2V1Z A;  4HH3 A;  4IJG A;  2XEP A;  1G5U A;  4GLQ A;  2Z6C A;  1TEM A;  2W3G A;  4M3K A;  3H82 B;  2PYR A;  1N9O A;  2W3E A;  2JC7 A;  4YFM A;  4Y2F A;  1L0E A;  5FQK A;  1ES3 A;  4OPR A;  1MY8 A;  2Y79 A;  5LBR A;  1NY0 A;  3GVB A;  3EQU A;  3W4P A;  4E3I A;  4EW7 A;  4S2N A;  3ZG8 B;  3MXS A;  5HAQ A;  3HJI A;  2ZC6 B;  4KEN B;  1BLP A;  4HP4 A;  2R9W A;  4OP5 A;  3MQO A;  5F83 A;  5EFW A;  4QY6 A;  2WYX A;  2NUP C;  1S4S A;  4K0X A;  1JWZ A;  4H8R A;  5BOH A;  3JVU A;  3CUE C;  4LV0 A;  2WAF A;  3MZE A;  1CEF A;  1TDL A;  2ZD8 A;  3G2Z A;  3KYQ A;  2R9X A;  3BYD A;  3GRJ A;  3BFF A;  5J3W A;  2HP5 A;  3SS4 A;  4ARZ A;  4AFI A;  2HGV A;  3HLF A;  4IVK A;  3F1O A;  3Q81 A;  1NZO A;  3LID A;  3VP2 A;  3FKW A;  1SZV A;  5L07 A;  4R38 A;  4OQ0 A;  1L0G A;  4JXV A;  4HOI A;  3MFD A;  2GDN A;  4FD8 A;  5CHM A;  4WEJ A;  3L7H A;  1QME A;  3ITA A;  2VKS A;  2Y2G A;  3OZH A;  1GSX A;  3A0R A;  1KDS A;  1F9I A;  2A24 B;  1W8Y A;  1TS8 A;  3H7W A;  1J9M A;  1P9R A;  3VFF A;  4R3B A;  3N4I A;  3MQ0 A;  2JE5 A;  3A3E A;  4GS9 B;  2ZQ7 A;  1ERO A;  1N9B A;  1O07 A;  3PBR A;  1IKI A;  1L0D A;  2ZM8 A;  1V9Z A;  5AQ7 A;  1IYQ A;  4CLC A;  1IYP A;  1XX2 A;  1S1Y A;  3IX4 A;  1UWN X;  2FFF B;  3FWL A;  4EBP A;  4EV4 A;  2PRF A;  1EI5 A;  1TS7 A;  2E8J A;  1GSV A;  2HDS A;  2DCF A;  4ETX A;  4MN5 A;  1D1J A;  4P6B A;  5L09 A;  4XT2 A;  4KUK A;  5TR7 A;  2WKP A;  2O9A A;  5L10 A;  1G28 A;  2QWS A;  4E3K A;  2IWD A;  4LV1 A;  2DRW A;  1E25 A;  2CC1 A;  4OLG A;  4P0M A;  1NZU A;  4CPK A;  3W2Z A;  4O8G A;  5G18 A;  1PI4 A;  3UDF A;  1FR1 A;  2X01 A;  1PFL A;  4ARZ B;  1H5X A;  1GA9 A;  1ALQ A;  4LRY C;  2ZL1 A;  2P74 A;  3HUN A; 
#chains in the Genus database with same CATH homology
 2MJ6 A;  3T4Q A;  1IOU A;  4RQ9 A;  2XRO A;  3UE3 A;  3IS2 B;  4OOM A;  3R4K A;  4Y5F A;  2W3D A;  2W27 A;  5HL6 A;  3CLO A;  4DMZ A;  3B42 A;  2GJ3 A;  3GDI A;  1DRM A;  3PBT A;  2VA0 A;  2QJ7 A;  4I3J A;  4GHI A;  4EEP A;  1XFN A;  3S7Q A;  1XJ6 A;  2L0W A;  3C38 A;  3LUQ A;  3NOT C;  3F1N B;  5AVE A;  1EW0 A;  2VGL S;  4M4X A;  4MCW A;  4LLO B;  4EEU A;  1DP6 A;  1TD5 A;  3H7W B;  4HJ6 A;  3B47 A;  1W63 Q;  2Z6D A;  3VV4 A;  1H8M A;  4WN5 A;  3EEH A;  5TBM A;  4KUO A;  3PBS A;  2JKR M;  2B02 A;  2M7V A;  1DP9 A;  3EOI A;  4F3L A;  3OCL A;  2GZA A;  1ODV A;  2PDR A;  5DKL A;  3BJN A;  3TW8 A;  3OOV A;  4H6J B;  5HD3 A;  4BBU A;  3S7O A;  1LT0 A;  3CWF A;  3NHQ A;  4MN7 A;  4CLC B;  1S4R A;  5KSH A;  4GJ4 A;  4CLC E;  4ETZ A;  2VV6 A;  4ME4 A;  1XJ2 A;  1G6O A;  4PAU A;  3KSG A;  1YSQ A;  2EWW A;  3LR3 A;  4R70 A;  3RTY A;  3E4P A;  1S66 L;  2W0N A;  1TS0 A;  2D02 A;  5DJT A;  1VHM A;  4QPR A;  4DJ3 A;  4CLC D;  2V1B A;  4JGP A;  1LSV A;  4G3V A;  4L0L A;  2JN7 A;  2Y8H A;  1LSX A;  3LIA A;  1YSP A;  4WLA A;  2B18 A;  3LIF A;  2VX8 A;  4YNR A;  5L8M A;  1D7E A;  2OWJ A;  3C2W A;  1N9L A;  1OTE A;  3E4Q A;  1XJ3 A;  2W1T B;  4Y3I A;  1S1Z A;  4LPZ A;  3FG8 A;  5KIZ A;  1KOU A;  4I38 A;  4L9F A;  3MMH A;  3OLO A;  4I3A A;  4BBV A;  4HI4 A;  4EU0 A;  4WF0 A;  3EWK A;  3LIC A;  3BWL A;  2PD8 A;  4HP9 A;  5HDS A;  1NRJ A;  2V0W A;  3OBF A;  2HJ9 C;  4HY8 A;  4O01 A;  3R7W A;  4EER A;  3MXQ A;  2DMW A;  2IA2 A;  5IS1 A;  4NKP A;  3KO6 A;  2JKT I;  4OOL A;  1P9W A;  3TRC A;  3C8C A;  3A0V A;  2O99 A;  3PR6 A;  3MF0 A;  4WUJ A;  2VZW A;  1OT6 A;  1OJ5 A;  2QJ5 A;  4HJ4 A;  3LR0 A;  1T18 A;  4E04 A;  3DBA A;  1OPX A;  3LIB A;  2QYB A;  4BWI A;  2HF6 A;  3F1O B;  3BW6 A;  2VEA A;  3BY8 A;  2XA7 S;  4NEE D;  3CIT A;  2VGL M;  3JVV A;  1D06 A;  1TS6 A;  2O9B A;  2V9A A;  2K7S A;  3ICY A;  2PR5 A;  4GCZ A;  2W3H A;  3D72 A;  5HWT A;  3TE8 A;  1T19 A;  3LR4 A;  5K5B A;  1YAX A;  2P7J A;  3ULF A;  5HSQ A;  2P08 A;  2VV7 A;  3GEC A;  4II7 A;  5TBM B;  2J3T D;  1NLY A;  5G4Z A;  3T4O A;  2GX5 A;  4B9O A;  3UME A;  3PYP A;  4LRX C;  1ZHH B;  3NOP C;  2QKP A;  4IUK A;  1T1C A;  2L4R A;  3T50 A;  3UMD A;  2K2N A;  3G6O A;  1P0Z A;  1NWZ A;  3B33 A;  2INW A;  2EA9 A;  4JGR A;  1XJ4 A;  4IUH A;  2O9C A;  3IS2 A;  4B93 A;  1MC0 A;  3LFV A;  3RH8 B;  2FZ0 A;  1P97 A;  2VLG A;  3PBN A;  4WEL A;  3KSH A;  4JGQ A;  1LL8 A;  2WKQ A;  3IBJ A;  2M1C A;  3O5Y A;  1LSW A;  2W3F A;  4NXE A;  4MMN A;  5A8B A;  5AVF A;  3MR0 A;  3RFB A;  3UB7 A;  2QHK A;  4Q0J A;  2JHE A;  2R78 A;  4EES A;  5F69 A;  3T4K A;  4R3A A;  1GSW A;  3IBR A;  1WA9 A;  2PYP A;  3UB6 A;  1H3Q A;  3U2A A;  5HD5 A;  4PKY A;  4EXO A;  1ZTU A;  4WL9 A;  2KX6 A;  4I3I A;  2M7U A;  2A24 A;  1N9N A;  4XT2 B;  1NLZ A;  3MJQ A;  2WKR A;  3V67 A;  4H6J A;  1IFQ A;  2XRN A;  3A0S A;  3F1P A;  1MZU A;  4ZRR A;  3SW1 A;  4Z1W A;  3TJZ C;  4G3K A;  4GS9 A;  3D3O A;  4PKY G;  4Q0H A;  3R7W B;  2J3W A;  4EQ1 A;  5C5K A;  5J4E A;  3T4S A;  3C30 A;  1OTA A;  4HH3 A;  3LIE A;  4IJG A;  4GLQ A;  2Z6C A;  2XSS A;  2L1M A;  3ZQ5 A;  1STZ A;  5HWW A;  2W3G A;  3H82 B;  2PYR A;  1N9O A;  2W3E A;  3CI6 A;  3VE4 A;  2GNX A;  4Y2F A;  3T4L A;  2D01 A;  3PXP A;  2Y79 A;  5LBR A;  4P6Z S;  3EQU A;  3HCY A;  4EW7 A;  3S7P A;  2G7U A;  5MC7 A;  2XA7 M;  3K2N A;  3P01 A;  2PD7 A;  3HJI A;  5F6A A;  4JGO A;  4HNB A;  3MFX A;  3ZYT A;  4HP4 A;  3MQO A;  1UWP X;  5EFW A;  5HPI A;  2JKT M;  3UB8 A;  3LR5 A;  4GHI B;  2NUP C;  4HJ3 A;  2OOL A;  5F68 A;  5I5L A;  5F5Y A;  3BY9 A;  2K31 A;  3LYX A;  1S4S A;  3OCN A;  2J3T C;  2P04 A;  3JVU A;  3CUE C;  5DJU A;  3K3C A;  2VJW A;  3PHY A;  1BYW A;  5G4Y A;  2KDK A;  2ZMV A;  4HH2 A;  4PHT A;  2OWH A;  3KSI A;  2NUT C;  4UQI S;  3KYQ A;  4CQH A;  1OTB A;  5J3W A;  4F3L B;  1F5M A;  4ARZ A;  4AFI A;  2HGV A;  2OAQ 1;  5TJJ A;  2KOI A;  2YKH A;  3F1O A;  5FL3 A;  4NXF A;  5HWV A;  3LID A;  4NXB A;  3K3D A;  3MQQ A;  4R38 A;  3CUE A;  4I39 A;  3UB9 A;  1V9Y A;  2HJE A;  2JKR I;  3VOL A;  2HV1 A;  2ZMF A;  1XFQ A;  3UE6 A;  4HOI A;  3H9W A;  5IU1 A;  5HDD A;  2YKF A;  4WEJ A;  4KQO A;  2VKS A;  2V0U A;  5IT5 A;  1GSX A;  2H28 A;  5J7E A;  2I9V A;  3A0R A;  3F1N A;  3EQV A;  4CLC C;  4NXG A;  3E98 A;  2A24 B;  1F9I A;  2LB9 A;  1OTD A;  1TS8 A;  3E4O A;  3H7W A;  3E0Y A;  2OAP 1;  5DKK A;  1P9R A;  4HQA A;  1T1A A;  1OTI A;  3F1P B;  4O0P A;  1JNU A;  3MQ0 A;  1OT9 A;  3KSF A;  4GS9 B;  4EUV A;  4YWZ A;  3P7N A;  3EGD C;  3T4J A;  5AJG A;  5HZH A;  2PHY A;  3HJK A;  3PBR A;  3BQ8 A;  4MN6 A;  2A2L A;  4UEY A;  5DFY A;  4G3W A;  4EET B;  5DF9 A;  4R6L A;  3NJA A;  4HIA A;  1V9Z A;  4Q0I A;  2ZBB A;  3EEA A;  3PBO A;  2J80 A;  3PBQ A;  2PR6 A;  4CLC A;  1YKD A;  2W1R A;  1S1Y A;  1Y28 A;  2ZOI A;  3LI8 A;  4L9E A;  5HDC A;  4P6Z M;  5DFX A;  1MKM A;  3BQA A;  1UWN X;  3OC2 A;  1OJG A;  3KYZ A;  1X0O A;  1TS7 A;  2EWV A;  1GSV A;  2O0Y A;  4I5S A;  1W63 M;  4BMW A;  3T4T A;  1F98 A;  2LB5 A;  4IHQ A;  4GW9 A;  2PT7 A;  4ETX A;  2V1A A;  3FPW A;  4MN5 A;  5HPF A;  4KQD A;  1TF1 A;  4MDZ A;  4BJP A;  4XT2 A;  4KUK A;  2WKP A;  3S7N A;  3CAX A;  2O9A A;  1G28 A;  4K08 A;  3FC7 A;  3EGX C;  2QWS A;  2CMN A;  4WEK A;  1T1B A;  4YOF A;  2FH5 A;  3NOU C;  4DN0 A;  2W1T A;  2VV8 A;  3FPV A;  4UQI M;  3W2Z A;  3VE3 A;  5CX7 A;  4O8G A;  1UGU A;  2ZOH A;  4LRZ E;  1VB6 A;  4FOF A;  3LI9 A;  3H82 A;  4HHD A;  4ARZ B;  4FSF A;  3KX0 X;  2KLI A;  4LRY C;  4BBT A;  4DJ2 A;  1S67 L;  4L9G A;  2BAS A;  1DP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...