4E6WA

Clbp in complex with 3-aminophenyl boronic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
335
structure length
329
Chain Sequence
b'ERLSTLIHQRMQEAKVPALSVSVTIKGVRQRFVYGVADVASQKANTLDTVYELGSMSKAFTGLVVQILIQEGRLRQGDDIITYLPEMRLNYQGKPASLTVADFLYHTSGLPFSTLARLEAVAQQLRNENLLFAPGAKFSYASANYDVLGAVIENVTGKTFTEVIAERLTQPLGMSATVAVKGDEIIVNKASGYKLGFGKPVLFHAPLARNHVPAAYIHSTLPDMEIWIDAWLHRKALPATLREAMSNSWRGNSDVPLAADNRILYASGWFIDQNQGPYISHGGQNPNFSSCIALRPDQQIGIVALANMNSNLILQLCADIDNYLRIGKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ClbP peptidase
molecule tags Hydrolase
source organism Escherichia coli
publication title The NRP peptidase ClbP as a target for the inhibition of genotoxicity, cell proliferation and tumorogenesis mediated by pks-harboring bacteria
rcsb
total genus 98
structure length 329
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4e6wA00
3SH7A 1WE4A 2WGVA 3OC2A 4OLGA 5FATA 4PM9A 1MWTA 3NI9A 5DVAA 3S4XA 3QNBA 3HL9A 2WK0A 5AQ9A 3ISGA 3VFHA 2JCHA 1TEMA 1ES3A 3BYDA 1K6RA 3ZDJA 5GLBA 4ZTKA 2H5SA 3HLFA 2HP6A 4X56A 4DRTA 1XXMA 2ZC3B 1LL5A 5FQMA 3M2KA 1QMFA 4QJGA 1ES5A 1TVFA 4R3JA 1BLCA 4IEDA 4JXGA 4OQIA 4WEKA 5CEDA 4E3JA 2JBFA 1K25A 3LY3A 2DRWA 1RCJA 1ERQA 5FAPA 1XGJA 1MWRA 4IBXA 5JYPA 5F1GA 1LI9A 3N8SA 1K55A 3ITBA 4GOGA 3TG9A 5AQBA 5L2FA 4GDBA 2Y4AA 3MXRA 1L0FA 1PW1A 4JXWA 4BD1A 5EVIC 1KE4A 2H0TA 5E2GA 2XGNA 3VOYA 5CERA 1JTGA 2Y2KA 5FQJA 3ZG7B 2I72A 2Q9NA 2WAEA 3MKFA 2EX2A 1K55C 2WKIA 2ZQ7A 4LCLA 4RX2A 4OKPA 4FCFA 1DJCA 4EUZA 1CEGA 1XX2A 3GRJA 3GQZA 4JPMA 1RP5A 4GD6A 1Q2QA 2IWCA 4KQQA 1PW8A 2OV5A 4ID4A 2C5WB 1E3UA 4OH0A 3BLMA 1SDEA 3BECA 3LEZA 2ZM2A 1ZC2A 3GV9A 4GKUA 5DF9A 2HDRA 1L0DA 2V1ZA 4EBLA 4P87A 4E3KA 3UPOA 1SKFA 1GHIA 5EVID 1DY6A 4KZ6A 4BQMA 3MZEA 1BLHA 4R4SA 1ONHA 1MWSA 4S2NC 5J8XA 4MNRA 3RJUA 3UPNA 2Y2NA 3IH8A 4X68A 4M3KA 2X01A 1FSYA 3ZG9B 4DF6A 3C4OA 3PBNA 3G30A 5AQAA 1BT5A 4K91A 4A5RA 1NY0A 1K54A 5FQIA 2QPNA 3ZHHA 1HZOA 1MY8A 5EVIB 3IXDA 4MBFA 4CPKA 1M40A 3C7UA 4RA7A 1EROA 4KG6A 4E3OA 1I2SA 1FCNA 2Y2HA 3DWKA 4OLDA 4LV3A 1YM1A 2HP9A 3OCNA 3OPRA 1W8QA 2ZC5B 5BOHA 5GHZA 2Y91A 3C7VA 4DE1A 2HDQA 5D3OA 4LCMA 4EBNA 4DE0A 1KDWA 2CC1A 4S2JA 5CHMA 4UHUA 3M6HA 3VMAA 4KQRA 3BEBA 2ZQCA 2QZ6A 3NIAA 4FSFA 5HX9A 3ZNYA 5CHUA 4KZBA 3HLBA 1VQQA 5HAPA 5FASA 2WGWA 4JF5A 3O88A 3FYZA 3OPLA 2ZMAA 1J9MA 3QNCA 1IYQA 3PBOA 4OP8A 5EOEA 3M6BA 4S2IA 1ES4A 3BFEA 4LENA 1YT4A 4R3BA 1BTLA 1NZOA 3MXSA 2Y55A 3W8KA 4BL3A 1K38A 5GL9A 1PWGA 1YMSA 5FAQA 5TGFA 5DF7A 2HP5A 3IHAA 4WZ4A 4HESA 5KSCA 5KZHA 1I5QA 1HTZA 5U47A 3JYIA 5JYOA 1YLWA 2Y59A 4XUXA 4XUZA 3N7WA 4EBPA 1PWDA 4L0LA 2QMIA 1JVJA 4MLLA 1MXOA 3HUMA 3IQAA 4NK3A 2ZJ9A 3N8RA 2A3UA 5CXWA 4P6BA 3V50A 5GLCA 3MKEA 4KENB 3UNWA 3HLCA 4ZDXA 2X71A 4ZJ3A 5EE8A 5HL1A 1ESUA 5CRFA 3HREA 3FWLA 5FDHA 3BRMA 2ZM0A 2Z2MB 3HLDA 4GZBA 1S6RA 3S1YA 3UE0A 4O7DA 4WBGA 5HFOA 3CZDA 4GB7A 1K56D 1NZUA 1LLBA 4BLMA 3BFCA 1KVLA 5KSHA 3IF6A 4PM7A 3GMWA 3MBZA 4HBUA 4S2KA 1IKIA 4S2MA 3A3DA 2H0YA 1Q2PA 5E43A 2HDUA 3WS1A 4GD8A 5E2FA 2EX9A 3G35A 4N92A 1N9BA 1SHVA 2ZC4B 3FV7A 1FR6A 3ZVWA 4OQHA 5FI7A 5AQ7A 4CJNA 4DXBA 3UY6A 1E25A 1GA0A 3AGEA 1K4FA 4WMCD 1IKGA 4QU3A 4WEJA 5CECA 1YMXA 3AGFA 3OZHA 5FAOA 1O07A 3UDXA 1XA1A 1VM1A 5M1AA 3OPHA 4E3IA 1WYCA 4BD0A 4KZ4A 1CEFA 2EFUA 3ZG8B 4PM8A 3AGDA 1L2SA 4C6YA 3IWQA 4GDNA 4P0MA 5M18A 4K0WA 2Y2OA 3HLGA 3ITAA 3NY4A 4FH2A 4KZAA 4JF6A 3C4PA 1YLYA 1HVBA 4EQIA 4P85A 2XK1A 1IEMA 2J9OA 3IT9A 1NXYA 5A91A 3VOZA 3BFFA 2FFYA 3SS3A 3BFDA 1BLPA 4U3TA 3HBRA 2WZZA 4UA9A 4Q8IA 4JKTA 4Z9QA 2C6WB 2JC7A 1K6SA 2RL3A 1YLTA 1IYPA 1FOFA 1MKIA 3I7JA 4OPZA 4X53A 5E2HA 3SOIA 4QY6A 2WGIA 4OONA 4K0XA 4S2PA 2VGKA 4PMAA 1G6AA 3Q81A 1JWPA 3EQUA 4R4RA 2J9PA 4DDSA 1DJAA 4ZAMA 3WRTA 5DF8A 5CGXA 3VP0A 3UPPA 4JF4A 5HAIA 1S0WA 4UA7A 3UN7A 1BSGA 1Y54A 2EFXA 4HEFA 2ZD8A 3IXHA 3D4FA 4LV0A 4MEZA 1FQGA 5HW3A 5DTTA 3UE1A 2ZQ8A 3W4OA 3CMZA 3LO7A 3NCKA 5CHJA 3BM6A 3OCLA 4E6XA 1YLZA 4KZ3A 1NJ4A 2ZM8A 1ZG6A 4KG2A 1K57A 3C5AA 1OMEA 4XXRA 4BJPA 4DE3A 4EWFA 4Y0OA 4GNUA 3HLWA 2X02A 3NC8A 4OPYA 4QB8A 3HLEA 4RVAA 2ZC6B 4DDYA 4B88A 3ZNTA 4D2OA 3ZFZA 4C3QA 5TFQA 5M19A 5GHYA 3P98A 3WS2A 2XDMA 5KMWA 4E3NA 4JXVA 1C3BA 2J7VA 4IBRA 3DWZA 4EV4A 3M2JA 4R1GA 5F83A 1BZAA 5E2EA 3IF6C 2XH9A 4B4ZA 1ES2A 1U60A 1HD8A 2OSUA 1E3UD 2DCFA 1G68A 3GSGA 1NYMA 4OOMA 4ZJ1A 1PI5A 2WGWB 2XQZA 3HUNA 4OP5A 3VSKA 3IXBA 3VSLA 2UWXA 4E6WA 1XA7A 3VP4A 1LI0A 2PBYA 3W4QA 3TSGA 4RYEA 4E3MA 4PM5A 4IVKA 3SH8A 4DXCA 1W7FA 1M6KA 2Y2GA 3V39A 3UDIA 2PU2A 3NDGA 4HBTA 1RGYA 5CGWA 4KZ5A 2EX6A 4OPQA 4WZ5A 5EVLA 1ZG4A 2DNSA 2HPBA 2XD1A 4ZJ2A 2IWDA 3MFDA 3O3VA 2Y2PA 2XFTA 1ONGA 2EXAA 2EXBA 3MZFA 4S2LA 4E3LA 1GHPA 5GLDA 4OQ0A 5TR7A 2PU4A 2G2UA 3Q7VA 4JLFA 3ZCZA 3PBQA 1KGGA 4BENA 1FCMA 4YFMA 1ZKJA 4Y0UA 1XPBA 5I94A 3O87A 3FKWA 3IHBA 2BLSA 3GR2A 4QHCA 4WELA 1PI4A 3DTMA 2ZQ9A 3IXGA 3G34A 1L0EA 2WADA 5FQ9A 3VFFA 4KQOA 1MWUA 1XP4A 2IWBA 3HVFA 2WUQA 1K4EA 4X69A 3Q07A 2RCXA 5EVIA 3FKVA 1QMEA 1FSWA 1GCEA 1W8YA 3IF6B 1KE3A 1PYYA 1SDNA 4U0TA 3N4IA 3SH9A 1W79A 2ZC7A 5GHXA 4S2NA 2ZQAA 2VGJA 1CI8A 1LHYA 1TDGA 3QHYA 4B4XA 1ALQA 2Z2LB 1Z6FA 4QY5A 5CGSA 3UO9A 1GHMA 5CEBA 1TDLA 1XGIA 1KE0A 1H8YA 2WKHA 1H8ZA 1K57C 2Y2QA 4UAAA 3ZGAB 3NDEA 3NBLA 3WS5A 3PBTA 3G32A 5CTNA 4ZBEA 3P09A 1BULA 1KGFA 1N4OA 3E2KA 5GLAA 3RXWA 3WS0A 1JWZA 3V3RA 3Q7ZA 4DKIA 4X55A 1JWVA 3G4PA 2GDNA 5CTMA 4NETA 2XF3A 1L0GA 1IYOA 4BL2A 4Y0TA 4OPRA 3V5MA 3Q7VB 4OOLA 2WYXA 3A3EA 1EWZA 5FSRA 2Y2IA 5HAQA 1CK3A 2WZXA 3Q82A 2B5RA 1FR1A 2XFSA 3G2ZA 3ZG0A 1ESIA 2Y2LA 3IF5A 4UA6A 5EUAA 5FI6A 3A3FA 4KG5A 3PBSA 4WMCA 5FI2A 4FD8A 3VP3A 3A3IA 4Y7PA 1RGZA 4N9KA 1FCOA 4OQGA 4WM9A 3DW0A 1I2WA 1YLPA 1SCWA 3GVBA 3IWOA 4F94A 3IWIA 2Y2JA 5HARA 1ERMA 1CI9A 3A3JA 2OLVA 4MBHA 4YINA 4FH4A 4N1HA 3O86A 2A49A 1KGEA 4OOYA 4RX3A 2OLUA 5F82A 3RXXA 3EQVA 4DE2A 3N6IA 5F1FA 1E4DA 3G2YA 3G31A 5EPHA 2P74A 4OVDA 3VP2A 3WS4A 4WZ5C 1MPLA 1AXBA 4N9LA 1KDSA 3Q1FA 3ZG5A 4X6TA 2WKEA 3WRZA 2WAFA 1BUEA 2V20A 2XR0A 5FA7A 3IH9A 1K56A 3B3XA 3PTEA 1O7EA 3S22A 2V2FF 5DTSA 3LCEA 2ZQDA 4QD4A 5IHVA 3SS4A 2JE5A 1BLSA 4KZ7A 2E8IA 3FZCA 4WYYA 1DJBA 3MZDA 2R9WA 3E2LA 5EECA 1NRFA 5FQKA 2XLNA 4LV2A 4S2OA 4MBKA 4IVIA 1GA9A 4R23A 1YQSA 1H5XA 2R9XA 4GN2A 4U0XA 5A90A 3V3SA 3W4PA 4JBFA 1XKZA 3UDFA 2XD5A 4H8RA 5A92A 3BFGA 3N8LA 4KZ9A 1IELA 2XEPA 1IYSA 2H10A 1WYBA 5FQQA 2P9VA 3BLSA 3LY4A 1JTDA 1NYYA 2Q9MA 3CG5A 4PPRA 2G2WA 5G18A 1MBLA 3UE3A 3PAEA 3GTCA 4LV1A 3VP1A 2P9VB 1K54C 1PZPA 3HUOA 1LL9A 4JXSA 2HDSA 5DTKA 5EOOA 3OPPA 3ZVTA 1PIOA 4C75A 4PM6A 2J8YA 2Y2MA 2ZLYA 3PAGA 1EI5A 3PBRA 1YLJA 3SS5A 4KZ8A 1PZOA 1PWCA 3CJMA 4R0QA 3WWXA 4N1XA 1W5DA 2EX8A 2FFFB 2BG1A 5A93A 1KVMA 3TOIA
chains in the Genus database with same CATH superfamily
4OLGA 4PM9A 1VHMA 3NI9A 2OWHA 2WK0A 5AQ9A 3H7WA 1K6RA 3T12B 5EM0A 1QMFA 2ZMFA 4IEDA 3OOVA 4WEKA 2K7SA 3RFBA 3S7NA 1K25A 1S67L 3LY3A 1RCJA 1ERQA 1XGJA 5F1GA 1LI9A 4Q0IA 4DJ2A 1OTBA 2WKRA 1CQAA 3IS2B 5EVIC 5E2GA 2J3WA 2OAQ1 3F1OB 1JTGA 3ZG7B 2Q9NA 3MKFA 1XJ2A 3D3OA 4GD6A 4I3AA 4ID4A 3T1QB 2C5WB 4KUKA 3BLMA 2ZM2A 1ZC2A 1L0DA 3TE8A 1SZVA 4KZ6A 2XROA 4ESPA 3MZEA 4R4SA 5J8XA 2X01A 1FSYA 4K91A 3CPTA 3ZHHA 3C7UA 4E3OA 1I2SA 4XT2B 3E4PA 4LV3A 3LIFA 2YKHA 4DE0A 1KDWA 2Y8HA 5HPFA 2VV6A 3M6HA 3VMAA 4KQRA 3JVUA 2ZQCA 2QZ6A 4P6ZM 3BQ8A 3HLBA 5HAPA 2VGLM 3FYZA 3OPLA 2VZWA 4UQIS 1IYQA 4S2IA 3KYQA 3MXSA 1PWGA 1T1BA 5FAQA 4HIAA 4EW7A 4JGRA 3IHAA 3OLOA 2Y59A 1D06A 1PWDA 4D60A 4NK3A 1MXOA 2V8FA 4P6BA 3MKEA 4KENB 2Z6DA 4ZJ3A 4WBGA 2O9AA 5HFOA 4BLMA 1KVLA 3IF6A 3MBZA 3MS6A 4S2KA 3A0RA 3A3DA 1Q2PA 3BW6A 2ZL1A 2HDUA 4GD8A 2EX9A 1N9BA 1P0ZA 2LB9A 4OQHA 4DXBA 3UY6A 1E25A 2V1BA 4QU3A 1ACFA 1AWIA 4Y3IA 2PD8A 3AGFA 4HH3A 2P04A 3ZG8B 3KX0X 4PM8A 2PAVP 1L2SA 5EV0A 2ACGA 4P0MA 1LT0A 2Y2OA 3HLGA 3ITAA 1VETB 4KZAA 2WKQA 1HVBA 3C8CA 3LGOA 3OBFA 4P85A 1DRMA 4G3KA 2D01A 3VOZA 2FFYA 3HBRA 2WZZA 4JKTA 2C6WB 1G6OA 1K6SA 1MKIA 3I7JA 4OPZA 3SOIA 4OONA 4QPRA 3T4JA 5I5LA 4DDSA 1STZA 3WRTA 3VP0A 4JF4A 5HAIA 1S0WA 3H7WB 2EFXA 2ZD8A 3D4FA 3ZYTA 4LV0A 4MEZA 3W4OA 5CHJA 3BM6A 2IA2A 1YLZA 2ZM8A 4Y15A 4XXRA 4EWFA 2X02A 3NOPC 4QB8A 3HLEA 2ZOIA 3ZNTA 4ETXA 3CUEC 3WS2A 3P98A 5KMWA 2CMNA 2J7VA 5L8MA 5FDSA 3M2JA 2O9CA 1BZAA 2XH9A 2J80A 1NYMA 4EXOA 2W0NA 4MMNA 2UWXA 3GECA 3QP4A 4I39A 3BWLA 2PYRA 1W7FA 1M6KA 2Z6CA 2PU2A 2PHYA 2PT7A 1SKOA 5CGWA 2EA9A 4HY8A 4Y13A 3EGDC 2PR5A 4M4XA 5EVLA 2XD1A 2HJ9C 4S2LA 2EXBA 2L0WA 2G2UA 3ZCZA 1ZKJA 4WELA 3IHBA 1X0OA 3G34A 1L0EA 3VFFA 3F1PA 4BMWA 3HVFA 1K4EA 3T1XA 3FKVA 2GX5A 1QMEA 3PYPA 1W8YA 1KE3A 1OTIA 3E4QA 3N4IA 1VEUB 1W79A 2ZC7A 3B42A 3U4LP 4QY5A 1KE0A 1H8YA 2WKHA 2Y2QA 1YAXA 4MCWA 3WS5A 4E04A 4H6JB 5CTNA 3E2KA 1JWZA 1Y4OA 4X55A 1JWVA 2GDNA 5CTMA 4P6ZS 1L0GA 3V5MA 4OOLA 5FSRA 2Y2IA 2WZXA 3Q82A 2B5RA 4BBTA 3A3FA 4KG5A 4WMCA 5FI2A 5DFYA 3T4LA 3VP3A 4HQAA 1IFQA 3IS2A 1ERMA 1CI9A 3A3JA 4CLCC 4MBHA 4N1HA 3O86A 1H8MA 1F98A 2JN7A 1E4DA 3G2YA 4R70A 3G31A 5EPHA 5AVEA 2P74A 1LSXA 5TBMB 3VP2A 3VE3A 1MPLA 5HWVA 1KOUA 3Q1FA 2W27A 3IH9A 5F69A 5K5BA 3MJQA 2V2FF 3CWFA 2VK3A 3FPWA 4WYYA 3MZDA 2R9WA 4HJ3A 4LV2A 4UEYA 4MBKA 3LYXA 1H5XA 2JHEA 1XKZA 2HF6A 4PPRA 5G18A 4LV1A 3F1NB 1K54C 4X1LA 4LRZE 5EOOA 1HLUP 2ZLYA 3FG8A 2V0WA 3H82B 3PBRA 4NG2A 3SS5A 2QJ5A 4KZ8A 1PZOA 1PWCA 4WLAA 4G3VA 3TOIA 1YPRA 5FATA 2K31A 1H0MA 5DVAA 2K2NA 3QNBA 2VJWA 4EEUA 2Y79A 2O0YA 3ISGA 2AVXA 3BYDA 1ES3A 2L1MA 5GLBA 3K3CA 3HLFA 4X56A 1S1YA 1LL5A 2R78A 4QJGA 1ES5A 3MFXA 4NXFA 1BLCA 4OQIA 2D02A 5DFXA 3KSHA 4CLCE 4E3JA 1F2KA 2DRWA 4EU0A 1EW0A 4G3WA 4L9EA 4IJGA 2Y4AA 1PW1A 5TBMA 5HWTA 2INWA 1KE4A 2XGNA 3PXPA 5FQJA 2I72A 1T19A 2WAEA 2WKIA 4FCFA 3CAXA 3GRJA 3GQZA 1SKOB 3T4QA 4KQQA 5LBRA 3BQAA 3LEZA 1SDEA 2W3GA 4P87A 4E3KA 1GHIA 4LGWA 3C30A 4BQMA 5FEGA 1FILA 1MWSA 1OTAA 3RJUA 1MKMA 5EFWA 3ZG9B 4DF6A 3PBNA 1K54A 1HZOA 3VE4A 3IXDA 4CPKA 3IBJA 1M40A 1EROA 2V8CA 1FCNA 3OPRA 3R7WA 5GHZA 2Y91A 1S66L 4LCMA 4EBNA 1YSQA 1VETA 2CC1A 4LRYC 3BEBA 5HX9A 3ZNYA 1VQQA 2ZOHA 5A8BA 2WGWA 3A0SA 3O88A 1J9MA 3PBOA 1XJ4A 3BFEA 4LENA 1NZOA 2Y55A 2PDRA 2A24B 1ZHHB 4WZ4A 5KZHA 4XUXA 4EBPA 2KX6A 1CJFA 2YKFA 4MLLA 3HUMA 3N8RA 5CXWA 4CLCA 4Y5FA 3HLCA 2ZMVA 5CRFA 4MN5A 3HREA 2Z2MB 4GZBA 3S1YA 2VEAA 4O7DA 3CZDA 1K56D 2OAP1 3MF0A 5KSHA 4PM7A 4HBUA 1XFNA 1IKIA 1OJ5A 2ZC4B 1SHVA 2KDKA 1FR6A 1GA0A 2QYBA 1K4FA 5CECA 1YMXA 2V1AA 3OZHA 3H9WA 1GSXA 5M1AA 1MZUA 3OPHA 4E3IA 1CEFA 4KQDA 3CLOA 4K0WA 1P97A 4JF6A 4EQIA 2XK1A 2J9OA 2JKGA 1NXYA 1G5UA 3BFFA 3SS3A 1LL8A 4DJ3A 2JC7A 2RL3A 5E2HA 1FOFA 1YKDA 2G7UA 4CLCB 4QY6A 2WGIA 4K0XA 3Q81A 1JWPA 3EQUA 4R4RA 2J9PA 1DJAA 4ZAMA 2XA7M 3LEQA 3MSHA 1BSGA 4HEFA 3UE1A 3NCKA 4I3JA 4GCZA 4E6XA 1ZG6A 2H28A 1DP9A 2PRFA 4BJPA 4DE3A 4EERA 4Y0OA 4EEPA 1VEUA 4B88A 1PNEA 2QKPA 5GHYA 4E3NA 4JXVA 3DWZA 3E0YA 5C5KA 5IU1A 1IOUA 4H6JA 1U60A 1NWZA 1HD8A 3QP5A 1E3UD 4OOMA 1PI5A 3HUNA 4WF0A 2GNXA 3DAVA 3IXBA 3PR6A 5F5YA 3VSLA 1D7EA 4DN0A 2OWJA 1GSVA 2PBYA 4I5SA 4EQ1A 2VLGA 2MJ6A 2Q0OA 3CHWP 4IVKA 3SH8A 2Y2GA 3NDGA 3NULA 4HBTA 4GS9B 3GDIA 2EX6A 2JKRI 3QP2A 1ZG4A 2ZBBA 4OQ0A 3Q7VA 3PBQA 1KGGA 4BENA 1FIKA 1H3QA 2B02A 4Y0UA 5I94A 3T50A 3GR2A 1PI4A 2ZQ9A 1CF0A 3IXGA 4KQOA 2IWBA 4NXEA 3IF6B 4MDZA 3SH9A 3DBAA 2VGJA 1TDGA 3HJKA 4GW9A 1Z6FA 3EOIA 4UAAA 1H8ZA 3ZGAB 3F1PB 3RXWA 1KGFA 4DKIA 3G4PA 3IX3A 3DTEA 2NUTC 1K0KA 4Y0TA 5HAQA 1CK3A 5HD5A 1FR1A 3G2ZA 5FI6A 4Y7PA 3LI9A 3DW0A 1I2WA 3KSGA 3CPTB 4F94A 4GHIB 4WN5A 2V9AA 1S4SA 4DE2A 2JKFA 4OVDA 2GZAA 4WZ5C 3ICYA 5FL3A 3IX4A 1NLZA 5FA7A 1K56A 3PTEA 1O7EA 2QWSA 3LCEA 4QD4A 2KOIA 5L07A 2XLNA 1GA9A 1YQSA 5HDDA 2R9XA 3CI6A 4R6LA 5A92A 4KZ9A 1IELA 1WYBA 5FQQA 2A2LA 2P9VA 3CG5A 2G2WA 3GTCA 3VP1A 4BWIA 1PZPA 1LL9A 5DTKA 1PIOA 4PM6A 2Y2MA 5AJGA 1EI5A 1YLJA 3JVVA 4R0QA 4N1XA 2EX8A 1TS8A 1KVMA 1WE4A 2WGVA 3OC2A 2HJEA 1MWTA 3JPUA 4ARZA 2FZ0A 5HWWA 4PHTA 3S4XA 4PKYA 4NEED 4Z1WA 4BBVA 1TEMA 2H5SA 2HP6A 3HCYA 5FQMA 1TVFA 3H82A 3L7HA 4I38A 5CEDA 3P7NA 5FAPA 1MWRA 4IBXA 3EEHA 3N8SA 1K55A 3ITBA 2VX8A 3TG9A 3MXRA 5HZHA 2W1TB 4BD1A 3VOYA 5CERA 2Y2KA 4LCLA 2EX2A 1K55C 4OKPA 2P08A 4ZRRA 1CEGA 3LR4A 2J3TD 1PW8A 2OV5A 2VV7A 4O8GA 1E3UA 3SZTA 4OH0A 3S7QA 4CQHA 4EBLA 3UPOA 5EVID 2HZ5A 1XJ6A 4MNRA 3UPNA 4ARZB 3IH8A 1T1CA 3LI8A 5AQAA 1BT5A 5FQIA 1MY8A 4MBFA 1F5MA 4KG6A 2Y2HA 1LSVA 1N9LA 3OCNA 5BOHA 1W8QA 3C7VA 5D3OA 5KIZA 2JKTM 3EEAA 4UHUA 2WKPA 3NIAA 4NXBA 1ZTUA 2W1TA 5FASA 4JF5A 2ZMAA 3QNCA 4II7A 4OP8A 3DTKA 5EOEA 1ES4A 1YT4A 1VB6A 3W8KA 4BL3A 5GL9A 5TGFA 2HP5A 3KYEA 5KSCA 1TS0A 5U47A 1HTZA 4B93A 1YLWA 2BASA 3N7WA 3KSIA 3F1NA 2QMIA 3TW8A 2ZJ9A 2A3UA 3V50A 5GLCA 3UNWA 4QWOA 1W63Q 4X1MA 1ESUA 3FWLA 4AFIA 3BRMA 2ZM0A 3HLDA 3UE0A 1NZUA 3EWKA 1NLYA 2O99A 3GMWA 3LR5A 4S2MA 3WS1A 5E2FA 5HL6A 3LIBA 3FV7A 3ZVWA 5FI7A 5AQ7A 3NJAA 5HDCA 3AGEA 5J7EA 4YOFA 3PHYA 2QHKA 1IKGA 4WMCD 4WEJA 3UB9A 2PBDP 1O07A 3UDXA 1XA1A 1VM1A 5J3WA 2EFUA 3AGDA 3U2AA 3IWQA 3UMDA 3NY4A 4F3LA 4JGPA 3C4PA 5G4ZA 4GS9A 4IUKA 1IEMA 5DKLA 4HHDA 5A91A 3ULFA 4U3TA 4Q8IA 4Z9QA 1YLTA 1IYPA 4X53A 4S2PA 5AVFA 3UMEA 5DF8A 3UPPA 3P01A 1Y54A 1TF1A 3IXHA 3CUEA 2ZQ8A 3CMZA 3LO7A 3OCLA 5CX7A 3E98A 4KZ3A 1NJ4A 4LRXC 1K57A 3C5AA 1OMEA 4L9GA 4GNUA 2PD7A 3HLWA 3NC8A 4LFUA 4DDYA 5TFQA 2NUPC 5M19A 3S7OA 2XDMA 4HJ4A 1C3BA 4R1GA 5F83A 3IF6C 4B4ZA 3LFVA 2OSUA 4FTXA 1G68A 4HI4A 3GSGA 2WGWB 3VSKA 4E6WA 1XA7A 4WUJA 1LI0A 4NXGA 3W4QA 4E3MA 2W3EA 4PM5A 3V39A 3UDIA 2BTFP 2P7JA 1RGYA 5HSQA 3VOLA 4OPQA 4ZJ2A 4MN7A 4EUVA 2IWDA 3MFDA 1OJGA 2Y2PA 3MZFA 2W3DA 4E3LA 1GHPA 5GLDA 2PU4A 2E8JA 4PKYG 2M1CA 3FKWA 2BLSA 4QHCA 3DTMA 5FQ9A 2DMWA 1XP4A 2WUQA 4X69A 3Q07A 2RCXA 2PYPA 5EVIA 3IX8A 1GSWA 2HGVA 1PYYA 1SDNA 3SW1A 2ZQAA 1CI8A 1LHYA 2Z2LB 3DTIA 1GHMA 1S1ZA 1TDLA 1OT9A 3O5YA 4R38A 3NBLA 4LPZA 5GLAA 1BULA 3V3RA 1A0KA 3NHQA 3T4KA 1IYOA 3Q7VB 3LIDA 1EWZA 3BY8A 3V67A 2XFSA 5EUAA 1ESIA 3IF5A 4UA6A 4FOFA 4HP4A 5IT5A 3PBSA 3MXQA 4XT2A 4FD8A 3A3IA 1RGZA 4WM9A 1YLPA 1SCWA 3IWIA 2Y2JA 1L3LA 1Y28A 2OLVA 4YINA 4GLQA 5HD3A 1WA9A 2A49A 3A0VA 4RX3A 5F1FA 2XRNA 4KUOA 3ZG5A 4X6TA 4ME4A 3S22A 3QP8A 2ZQDA 5IHVA 2JE5A 1BLSA 2E8IA 3VV4A 1DJBA 3NECA 3E2LA 5EECA 1NRFA 4S2OA 1G28A 4IVIA 1PRQA 4GN2A 5L09A 3BFGA 3N8LA 1IYSA 2H10A 3BLSA 3LY4A 1JTDA 1NYYA 2Q9MA 1MBLA 1OPXA 1XFQA 5MC7A 3PAEA 2P9VB 2ZL1B 4Q0HA 3HUOA 4JXSA 2HDSA 3OPPA 4C75A 3B33A 3MQQA 2A24A 1DP8A 3QP1A 3CJMA 4EESA 1DP6A 3WWXA 1W5DA 5A93A 4L9FA 3MQOA 1F9IA 3MQ0A 3SH7A 3HL9A 1ODVA 3VFHA 2JCHA 1OT6A 3ZDJA 4ZTKA 5DJUA 2JKTI 4DRTA 1XXMA 2ZC3B 3FPVA 3M2KA 4R3JA 4JXGA 4EETB 2JBFA 5L10A 3K3DA 4X25A 5EVEA 5JYPA 4GOGA 5L2FA 5AQBA 4GDBA 4O0PA 3KO6A 1L0FA 1T18A 4JXWA 2H0TA 4I3IA 2ZQ7A 4RX2A 2JKRM 1DJCA 1TD5A 4EUZA 1V9YA 1XX2A 4JPMA 1RP5A 2VA0A 1Q2QA 2IWCA 3T1RA 4HJ6A 4O01A 4HNBA 4YNRA 3BECA 4GKUA 5DF9A 3GV9A 2HDRA 2V1ZA 1SKFA 1DY6A 1BLHA 5G4YA 1ONHA 4LLOB 4S2NC 3T4SA 2Y2NA 4X68A 4M3KA 2B18A 3C4OA 3G30A 3K2NA 2V0UA 4A5RA 1NY0A 2QPNA 3R7WB 5EVIB 4RA7A 3UB8A 3DWKA 4OLDA 1YM1A 2HP9A 2ZC5B 4DE1A 2J3TC 2HDQA 2HV1A 4S2JA 5CHMA 3T4OA 3CITA 5DJTA 4FSFA 5CHUA 4KZBA 4HP9A 4WL9A 2UV0E 1T1AA 3M6BA 4UQIM 4R3BA 1BTLA 1K38A 1YMSA 5DF7A 3LIEA 4HESA 1P9WA 1I5QA 1MC0A 3JYIA 5JYOA 4XUZA 4L0LA 1JVJA 3IQAA 5IS1A 1TS7A 4PAUA 4K08A 4ZDXA 2X71A 4Q0JA 5EE8A 5HL1A 2M7UA 5FDHA 1S6RA 4GB7A 1LLBA 1XJ3A 3BFCA 3MR0A 1NRJA 2VKSA 5HPIA 2H0YA 5E43A 2L4RA 3G35A 2KLIA 4N92A 3B47A 4CJNA 4NKPA 1BYWA 3UB7A 3NOUC 2QJ7A 3T1SA 2EWVA 5FAOA 1WYCA 4BD0A 1OTEA 4KZ4A 3KYZA 2O9BA 4JGOA 4C6YA 4GDNA 5M18A 1N9OA 3IBRA 4FH2A 2I9VA 1YLYA 2LB5A 2B95A 3IT9A 3L9KA 3BFDA 3S7PA 1BLPA 4DMZA 4YWZA 3NOTC 4UA9A 3LR3A 3G6OA 5F68A 2VGKA 4PMAA 1G6AA 2EWWA 2PR6A 4GHIA 5CGXA 3UB6A 4B9OA 4F3LB 3LICA 4UA7A 2FH5A 2W1RA 3UN7A 1V9ZA 2W3FA 5HW3A 1FQGA 5DTTA 1TS6A 3TRCA 1S4RA 2VGLS 4KG2A 4OPYA 3W2ZA 4RVAA 2ZC6B 4D2OA 2VV8A 3ZFZA 4C3QA 3FC7A 5HDSA 4IBRA 4EV4A 5TJJA 4JGQA 5E2EA 1ES2A 1Z09A 3RTYA 3D9YA 2DCFA 4ZJ1A 2XQZA 2GJ3A 4OP5A 3BY9A 5FEFA 3VP4A 2W3HA 3TSGA 4RYEA 1UWPX 3F1OA 4DXCA 4Y17A 4ETZA 4KZ5A 4WZ5A 3RH8B 2DNSA 2HPBA 3O3VA 3R4KA 2XFTA 1ONGA 2EXAA 5TR7A 3QP6A 1J3WA 3EGXC 4JLFA 3ZQ5A 1FCMA 2XA7S 4YFMA 1XPBA 4Y2FA 3O87A 2WADA 1MWUA 3T4TA 1N9NA 3TJZC 1FSWA 1GCEA 1YSPA 4U0TA 5GHXA 4S2NA 4B4XA 3QHYA 4CLCD 3UO9A 5CGSA 5CEBA 1XGIA 4FUWA 1K57C 4MN6A 3NDEA 3PBTA 3G32A 4ZBEA 1LSWA 3P09A 1N4OA 3WS0A 3Q7ZA 4HH2A 4NETA 2XF3A 4BL2A 3D72A 4BBUA 4OPRA 2WYXA 3A3EA 4R3AA 4IHQA 3LUQA 3ZG0A 2Y2LA 5F6AA 1D1JA 3KSFA 4N9KA 1FCOA 4OQGA 1OTDA 3LIAA 4RQ9A 3GVBA 3IWOA 5HARA 3UB5P 4FH4A 1KGEA 1JNUA 3E4OA 4OOYA 2OLUA 5F82A 3RXXA 3EQVA 3N6IA 3WS4A 4N9LA 1AXBA 1KDSA 2WKEA 3WRZA 2WAFA 1BUEA 2V20A 2XR0A 1PFLA 3HJIA 3B3XA 1UGUA 3LR0A 5DTSA 4HOIA 3SS4A 4KZ7A 3FZCA 3C38A 5DKKA 5FQKA 4R23A 4GJ4A 4U0XA 5A90A 3V3SA 3W4PA 4JBFA 3UDFA 2XD5A 4H8RA 3UE6A 2XEPA 5J4EA 2OOLA 1W63M 3MMHA 3UE3A 3C2WA 2XSSA 3ZVTA 4IUHA 5EM1A 2J8YA 3PAGA 1P9RA 1UWNX 2M7VA 2FFFB 2BG1A 3BJNA 1ALQA
chains in the Genus database with same CATH topology
3SH7A 1WE4A 2WGVA 3OC2A 4OLGA 5FATA 4PM9A 1MWTA 3NI9A 5DVAA 3S4XA 3QNBA 3HL9A 2WK0A 5AQ9A 3ISGA 3VFHA 2JCHA 1TEMA 1ES3A 3BYDA 1K6RA 3ZDJA 5GLBA 4ZTKA 2H5SA 3HLFA 2HP6A 4X56A 4DRTA 1XXMA 2ZC3B 1LL5A 5FQMA 3M2KA 1QMFA 4QJGA 1ES5A 1TVFA 4R3JA 1BLCA 4IEDA 4JXGA 4OQIA 4WEKA 5CEDA 4E3JA 2JBFA 1K25A 3LY3A 2DRWA 1RCJA 1ERQA 5FAPA 1XGJA 1MWRA 4IBXA 5JYPA 5F1GA 1LI9A 3N8SA 1K55A 3ITBA 4GOGA 3TG9A 5AQBA 5L2FA 4GDBA 2Y4AA 3MXRA 1L0FA 1PW1A 4JXWA 4BD1A 5EVIC 1KE4A 2H0TA 5E2GA 2XGNA 3VOYA 5CERA 1JTGA 2Y2KA 5FQJA 3ZG7B 2I72A 2Q9NA 2WAEA 3MKFA 2EX2A 1K55C 2WKIA 2ZQ7A 4LCLA 4RX2A 4OKPA 4FCFA 1DJCA 4EUZA 1CEGA 1XX2A 3GRJA 3GQZA 4JPMA 1RP5A 4GD6A 1Q2QA 2IWCA 4KQQA 1PW8A 2OV5A 4ID4A 2C5WB 1E3UA 4OH0A 3BLMA 1SDEA 3BECA 3LEZA 2ZM2A 1ZC2A 3GV9A 4GKUA 5DF9A 2HDRA 1L0DA 2V1ZA 4EBLA 4P87A 4E3KA 3UPOA 1SKFA 1GHIA 5EVID 1DY6A 4KZ6A 4BQMA 3MZEA 1BLHA 4R4SA 1ONHA 1MWSA 4S2NC 5J8XA 4MNRA 3RJUA 3UPNA 2Y2NA 3IH8A 4X68A 4M3KA 2X01A 1FSYA 3ZG9B 4DF6A 3C4OA 3PBNA 3G30A 5AQAA 1BT5A 4K91A 4A5RA 1NY0A 1K54A 5FQIA 2QPNA 3ZHHA 1HZOA 1MY8A 5EVIB 3IXDA 4MBFA 4CPKA 1M40A 3C7UA 4RA7A 1EROA 4KG6A 4E3OA 1I2SA 1FCNA 2Y2HA 3DWKA 4OLDA 4LV3A 1YM1A 2HP9A 3OCNA 3OPRA 1W8QA 2ZC5B 5BOHA 5GHZA 2Y91A 3C7VA 4DE1A 2HDQA 5D3OA 4LCMA 4EBNA 4DE0A 1KDWA 2CC1A 4S2JA 5CHMA 4UHUA 3M6HA 3VMAA 4KQRA 3BEBA 2ZQCA 2QZ6A 3NIAA 4FSFA 5HX9A 3ZNYA 5CHUA 4KZBA 3HLBA 1VQQA 5HAPA 5FASA 2WGWA 4JF5A 3O88A 3FYZA 3OPLA 2ZMAA 1J9MA 3QNCA 1IYQA 3PBOA 4OP8A 5EOEA 3M6BA 4S2IA 1ES4A 3BFEA 4LENA 1YT4A 4R3BA 1BTLA 1NZOA 3MXSA 2Y55A 3W8KA 4BL3A 1K38A 5GL9A 1PWGA 1YMSA 5FAQA 5TGFA 5DF7A 2HP5A 3IHAA 4WZ4A 4HESA 5KSCA 5KZHA 1I5QA 1HTZA 5U47A 3JYIA 5JYOA 1YLWA 2Y59A 4XUXA 4XUZA 3N7WA 4EBPA 1PWDA 4L0LA 2QMIA 1JVJA 4MLLA 1MXOA 3HUMA 3IQAA 4NK3A 2ZJ9A 3N8RA 2A3UA 5CXWA 4P6BA 3V50A 5GLCA 3MKEA 4KENB 3UNWA 3HLCA 4ZDXA 2X71A 4ZJ3A 5EE8A 5HL1A 1ESUA 5CRFA 3HREA 3FWLA 5FDHA 3BRMA 2ZM0A 2Z2MB 3HLDA 4GZBA 1S6RA 3S1YA 3UE0A 4O7DA 4WBGA 5HFOA 3CZDA 4GB7A 1K56D 1NZUA 1LLBA 4BLMA 3BFCA 1KVLA 5KSHA 3IF6A 4PM7A 3GMWA 3MBZA 4HBUA 4S2KA 1IKIA 4S2MA 3A3DA 2H0YA 1Q2PA 5E43A 2HDUA 3WS1A 4GD8A 5E2FA 2EX9A 3G35A 4N92A 1N9BA 1SHVA 2ZC4B 3FV7A 1FR6A 3ZVWA 4OQHA 5FI7A 5AQ7A 4CJNA 4DXBA 3UY6A 1E25A 1GA0A 3AGEA 1K4FA 4WMCD 1IKGA 4QU3A 4WEJA 5CECA 1YMXA 3AGFA 3OZHA 5FAOA 1O07A 3UDXA 1XA1A 1VM1A 5M1AA 3OPHA 4E3IA 1WYCA 4BD0A 4KZ4A 1CEFA 2EFUA 3ZG8B 4PM8A 3AGDA 1L2SA 4C6YA 3IWQA 4GDNA 4P0MA 5M18A 4K0WA 2Y2OA 3HLGA 3ITAA 3NY4A 4FH2A 4KZAA 4JF6A 3C4PA 1YLYA 1HVBA 4EQIA 4P85A 2XK1A 1IEMA 2J9OA 3IT9A 1NXYA 5A91A 3VOZA 3BFFA 2FFYA 3SS3A 3BFDA 1BLPA 4U3TA 3HBRA 2WZZA 4UA9A 4Q8IA 4JKTA 4Z9QA 2C6WB 2JC7A 1K6SA 2RL3A 1YLTA 1IYPA 1FOFA 1MKIA 3I7JA 4OPZA 4X53A 5E2HA 3SOIA 4QY6A 2WGIA 4OONA 4K0XA 4S2PA 2VGKA 4PMAA 1G6AA 3Q81A 1JWPA 3EQUA 4R4RA 2J9PA 4DDSA 1DJAA 4ZAMA 3WRTA 5DF8A 5CGXA 3VP0A 3UPPA 4JF4A 5HAIA 1S0WA 4UA7A 3UN7A 1BSGA 1Y54A 2EFXA 4HEFA 2ZD8A 3IXHA 3D4FA 4LV0A 4MEZA 1FQGA 5HW3A 5DTTA 3UE1A 2ZQ8A 3W4OA 3CMZA 3LO7A 3NCKA 5CHJA 3BM6A 3OCLA 4E6XA 1YLZA 4KZ3A 1NJ4A 2ZM8A 1ZG6A 4KG2A 1K57A 3C5AA 1OMEA 4XXRA 4BJPA 4DE3A 4EWFA 4Y0OA 4GNUA 3HLWA 2X02A 3NC8A 4OPYA 4QB8A 3HLEA 4RVAA 2ZC6B 4DDYA 4B88A 3ZNTA 4D2OA 3ZFZA 4C3QA 5TFQA 5M19A 5GHYA 3P98A 3WS2A 2XDMA 5KMWA 4E3NA 4JXVA 1C3BA 2J7VA 4IBRA 3DWZA 4EV4A 3M2JA 4R1GA 5F83A 1BZAA 5E2EA 3IF6C 2XH9A 4B4ZA 1ES2A 1U60A 1HD8A 2OSUA 1E3UD 2DCFA 1G68A 3GSGA 1NYMA 4OOMA 4ZJ1A 1PI5A 2WGWB 2XQZA 3HUNA 4OP5A 3VSKA 3IXBA 3VSLA 2UWXA 4E6WA 1XA7A 3VP4A 1LI0A 2PBYA 3W4QA 3TSGA 4RYEA 4E3MA 4PM5A 4IVKA 3SH8A 4DXCA 1W7FA 1M6KA 2Y2GA 3V39A 3UDIA 2PU2A 3NDGA 4HBTA 1RGYA 5CGWA 4KZ5A 2EX6A 4OPQA 4WZ5A 5EVLA 1ZG4A 2DNSA 2HPBA 2XD1A 4ZJ2A 2IWDA 3MFDA 3O3VA 2Y2PA 2XFTA 1ONGA 2EXAA 2EXBA 3MZFA 4S2LA 4E3LA 1GHPA 5GLDA 4OQ0A 5TR7A 2PU4A 2G2UA 3Q7VA 4JLFA 3ZCZA 3PBQA 1KGGA 4BENA 1FCMA 4YFMA 1ZKJA 4Y0UA 1XPBA 5I94A 3O87A 3FKWA 3IHBA 2BLSA 3GR2A 4QHCA 4WELA 1PI4A 3DTMA 2ZQ9A 3IXGA 3G34A 1L0EA 2WADA 5FQ9A 3VFFA 4KQOA 1MWUA 1XP4A 2IWBA 3HVFA 2WUQA 1K4EA 4X69A 3Q07A 2RCXA 5EVIA 3FKVA 1QMEA 1FSWA 1GCEA 1W8YA 3IF6B 1KE3A 1PYYA 1SDNA 4U0TA 3N4IA 3SH9A 1W79A 2ZC7A 5GHXA 4S2NA 2ZQAA 2VGJA 1CI8A 1LHYA 1TDGA 3QHYA 4B4XA 1ALQA 2Z2LB 1Z6FA 4QY5A 5CGSA 3UO9A 1GHMA 5CEBA 1TDLA 1XGIA 1KE0A 1H8YA 2WKHA 1H8ZA 1K57C 2Y2QA 4UAAA 3ZGAB 3NDEA 3NBLA 3WS5A 3PBTA 3G32A 5CTNA 4ZBEA 3P09A 1BULA 1KGFA 1N4OA 3E2KA 5GLAA 3RXWA 3WS0A 1JWZA 3V3RA 3Q7ZA 4DKIA 4X55A 1JWVA 3G4PA 2GDNA 5CTMA 4NETA 2XF3A 1L0GA 1IYOA 4BL2A 4Y0TA 4OPRA 3V5MA 3Q7VB 4OOLA 2WYXA 3A3EA 1EWZA 5FSRA 2Y2IA 5HAQA 1CK3A 2WZXA 3Q82A 2B5RA 1FR1A 2XFSA 3G2ZA 3ZG0A 1ESIA 2Y2LA 3IF5A 4UA6A 5EUAA 5FI6A 3A3FA 4KG5A 3PBSA 4WMCA 5FI2A 4FD8A 3VP3A 3A3IA 4Y7PA 1RGZA 4N9KA 1FCOA 4OQGA 4WM9A 3DW0A 1I2WA 1YLPA 1SCWA 3GVBA 3IWOA 4F94A 3IWIA 2Y2JA 5HARA 1ERMA 1CI9A 3A3JA 2OLVA 4MBHA 4YINA 4FH4A 4N1HA 3O86A 2A49A 1KGEA 4OOYA 4RX3A 2OLUA 5F82A 3RXXA 3EQVA 4DE2A 3N6IA 5F1FA 1E4DA 3G2YA 3G31A 5EPHA 2P74A 4OVDA 3VP2A 3WS4A 4WZ5C 1MPLA 1AXBA 4N9LA 1KDSA 3Q1FA 3ZG5A 4X6TA 2WKEA 3WRZA 2WAFA 1BUEA 2V20A 2XR0A 5FA7A 3IH9A 1K56A 3B3XA 3PTEA 1O7EA 3S22A 2V2FF 5DTSA 3LCEA 2ZQDA 4QD4A 5IHVA 3SS4A 2JE5A 1BLSA 4KZ7A 2E8IA 3FZCA 4WYYA 1DJBA 3MZDA 2R9WA 3E2LA 5EECA 1NRFA 5FQKA 2XLNA 4LV2A 4S2OA 4MBKA 4IVIA 1GA9A 4R23A 1YQSA 1H5XA 2R9XA 4GN2A 4U0XA 5A90A 3V3SA 3W4PA 4JBFA 1XKZA 3UDFA 2XD5A 4H8RA 5A92A 3BFGA 3N8LA 4KZ9A 1IELA 2XEPA 1IYSA 2H10A 1WYBA 5FQQA 2P9VA 3BLSA 3LY4A 1JTDA 1NYYA 2Q9MA 3CG5A 4PPRA 2G2WA 5G18A 1MBLA 3UE3A 3PAEA 3GTCA 4LV1A 3VP1A 2P9VB 1K54C 1PZPA 3HUOA 1LL9A 4JXSA 2HDSA 5DTKA 5EOOA 3OPPA 3ZVTA 1PIOA 4C75A 4PM6A 2J8YA 2Y2MA 2ZLYA 3PAGA 1EI5A 3PBRA 1YLJA 3SS5A 4KZ8A 1PZOA 1PWCA 3CJMA 4R0QA 3WWXA 4N1XA 1W5DA 2EX8A 2FFFB 2BG1A 5A93A 1KVMA 3TOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SH7 A;  1WE4 A;  2WGV A;  3OC2 A;  4OLG A;  5FAT A;  4PM9 A;  1MWT A;  3NI9 A;  5DVA A;  3S4X A;  3QNB A;  3HL9 A;  2WK0 A;  5AQ9 A;  3ISG A;  3VFH A;  2JCH A;  1TEM A;  1ES3 A;  3BYD A;  1K6R A;  3ZDJ A;  5GLB A;  4ZTK A;  2H5S A;  3HLF A;  2HP6 A;  4X56 A;  4DRT A;  1XXM A;  2ZC3 B;  1LL5 A;  5FQM A;  3M2K A;  1QMF A;  4QJG A;  1ES5 A;  1TVF A;  4R3J A;  1BLC A;  4IED A;  4JXG A;  4OQI A;  4WEK A;  5CED A;  4E3J A;  2JBF A;  1K25 A;  3LY3 A;  2DRW A;  1RCJ A;  1ERQ A;  5FAP A;  1XGJ A;  1MWR A;  4IBX A;  5JYP A;  5F1G A;  1LI9 A;  3N8S A;  1K55 A;  3ITB A;  4GOG A;  3TG9 A;  5AQB A;  5L2F A;  4GDB A;  2Y4A A;  3MXR A;  1L0F A;  1PW1 A;  4JXW A;  4BD1 A;  5EVI C;  1KE4 A;  2H0T A;  5E2G A;  2XGN A;  3VOY A;  5CER A;  1JTG A;  2Y2K A;  5FQJ A;  3ZG7 B;  2I72 A;  2Q9N A;  2WAE A;  3MKF A;  2EX2 A;  1K55 C;  2WKI A;  2ZQ7 A;  4LCL A;  4RX2 A;  4OKP A;  4FCF A;  1DJC A;  4EUZ A;  1CEG A;  1XX2 A;  3GRJ A;  3GQZ A;  4JPM A;  1RP5 A;  4GD6 A;  1Q2Q A;  2IWC A;  4KQQ A;  1PW8 A;  2OV5 A;  4ID4 A;  2C5W B;  1E3U A;  4OH0 A;  3BLM A;  1SDE A;  3BEC A;  3LEZ A;  2ZM2 A;  1ZC2 A;  3GV9 A;  4GKU A;  5DF9 A;  2HDR A;  1L0D A;  2V1Z A;  4EBL A;  4P87 A;  4E3K A;  3UPO A;  1SKF A;  1GHI A;  5EVI D;  1DY6 A;  4KZ6 A;  4BQM A;  3MZE A;  1BLH A;  4R4S A;  1ONH A;  1MWS A;  4S2N C;  5J8X A;  4MNR A;  3RJU A;  3UPN A;  2Y2N A;  3IH8 A;  4X68 A;  4M3K A;  2X01 A;  1FSY A;  3ZG9 B;  4DF6 A;  3C4O A;  3PBN A;  3G30 A;  5AQA A;  1BT5 A;  4K91 A;  4A5R A;  1NY0 A;  1K54 A;  5FQI A;  2QPN A;  3ZHH A;  1HZO A;  1MY8 A;  5EVI B;  3IXD A;  4MBF A;  4CPK A;  1M40 A;  3C7U A;  4RA7 A;  1ERO A;  4KG6 A;  4E3O A;  1I2S A;  1FCN A;  2Y2H A;  3DWK A;  4OLD A;  4LV3 A;  1YM1 A;  2HP9 A;  3OCN A;  3OPR A;  1W8Q A;  2ZC5 B;  5BOH A;  5GHZ A;  2Y91 A;  3C7V A;  4DE1 A;  2HDQ A;  5D3O A;  4LCM A;  4EBN A;  4DE0 A;  1KDW A;  2CC1 A;  4S2J A;  5CHM A;  4UHU A;  3M6H A;  3VMA A;  4KQR A;  3BEB A;  2ZQC A;  2QZ6 A;  3NIA A;  4FSF A;  5HX9 A;  3ZNY A;  5CHU A;  4KZB A;  3HLB A;  1VQQ A;  5HAP A;  5FAS A;  2WGW A;  4JF5 A;  3O88 A;  3FYZ A;  3OPL A;  2ZMA A;  1J9M A;  3QNC A;  1IYQ A;  3PBO A;  4OP8 A;  5EOE A;  3M6B A;  4S2I A;  1ES4 A;  3BFE A;  4LEN A;  1YT4 A;  4R3B A;  1BTL A;  1NZO A;  3MXS A;  2Y55 A;  3W8K A;  4BL3 A;  1K38 A;  5GL9 A;  1PWG A;  1YMS A;  5FAQ A;  5TGF A;  5DF7 A;  2HP5 A;  3IHA A;  4WZ4 A;  4HES A;  5KSC A;  5KZH A;  1I5Q A;  1HTZ A;  5U47 A;  3JYI A;  5JYO A;  1YLW A;  2Y59 A;  4XUX A;  4XUZ A;  3N7W A;  4EBP A;  1PWD A;  4L0L A;  2QMI A;  1JVJ A;  4MLL A;  1MXO A;  3HUM A;  3IQA A;  4NK3 A;  2ZJ9 A;  3N8R A;  2A3U A;  5CXW A;  4P6B A;  3V50 A;  5GLC A;  3MKE A;  4KEN B;  3UNW A;  3HLC A;  4ZDX A;  2X71 A;  4ZJ3 A;  5EE8 A;  5HL1 A;  1ESU A;  5CRF A;  3HRE A;  3FWL A;  5FDH A;  3BRM A;  2ZM0 A;  2Z2M B;  3HLD A;  4GZB A;  1S6R A;  3S1Y A;  3UE0 A;  4O7D A;  4WBG A;  5HFO A;  3CZD A;  4GB7 A;  1K56 D;  1NZU A;  1LLB A;  4BLM A;  3BFC A;  1KVL A;  5KSH A;  3IF6 A;  4PM7 A;  3GMW A;  3MBZ A;  4HBU A;  4S2K A;  1IKI A;  4S2M A;  3A3D A;  2H0Y A;  1Q2P A;  5E43 A;  2HDU A;  3WS1 A;  4GD8 A;  5E2F A;  2EX9 A;  3G35 A;  4N92 A;  1N9B A;  1SHV A;  2ZC4 B;  3FV7 A;  1FR6 A;  3ZVW A;  4OQH A;  5FI7 A;  5AQ7 A;  4CJN A;  4DXB A;  3UY6 A;  1E25 A;  1GA0 A;  3AGE A;  1K4F A;  4WMC D;  1IKG A;  4QU3 A;  4WEJ A;  5CEC A;  1YMX A;  3AGF A;  3OZH A;  5FAO A;  1O07 A;  3UDX A;  1XA1 A;  1VM1 A;  5M1A A;  3OPH A;  4E3I A;  1WYC A;  4BD0 A;  4KZ4 A;  1CEF A;  2EFU A;  3ZG8 B;  4PM8 A;  3AGD A;  1L2S A;  4C6Y A;  3IWQ A;  4GDN A;  4P0M A;  5M18 A;  4K0W A;  2Y2O A;  3HLG A;  3ITA A;  3NY4 A;  4FH2 A;  4KZA A;  4JF6 A;  3C4P A;  1YLY A;  1HVB A;  4EQI A;  4P85 A;  2XK1 A;  1IEM A;  2J9O A;  3IT9 A;  1NXY A;  5A91 A;  3VOZ A;  3BFF A;  2FFY A;  3SS3 A;  3BFD A;  1BLP A;  4U3T A;  3HBR A;  2WZZ A;  4UA9 A;  4Q8I A;  4JKT A;  4Z9Q A;  2C6W B;  2JC7 A;  1K6S A;  2RL3 A;  1YLT A;  1IYP A;  1FOF A;  1MKI A;  3I7J A;  4OPZ A;  4X53 A;  5E2H A;  3SOI A;  4QY6 A;  2WGI A;  4OON A;  4K0X A;  4S2P A;  2VGK A;  4PMA A;  1G6A A;  3Q81 A;  1JWP A;  3EQU A;  4R4R A;  2J9P A;  4DDS A;  1DJA A;  4ZAM A;  3WRT A;  5DF8 A;  5CGX A;  3VP0 A;  3UPP A;  4JF4 A;  5HAI A;  1S0W A;  4UA7 A;  3UN7 A;  1BSG A;  1Y54 A;  2EFX A;  4HEF A;  2ZD8 A;  3IXH A;  3D4F A;  4LV0 A;  4MEZ A;  1FQG A;  5HW3 A;  5DTT A;  3UE1 A;  2ZQ8 A;  3W4O A;  3CMZ A;  3LO7 A;  3NCK A;  5CHJ A;  3BM6 A;  3OCL A;  4E6X A;  1YLZ A;  4KZ3 A;  1NJ4 A;  2ZM8 A;  1ZG6 A;  4KG2 A;  1K57 A;  3C5A A;  1OME A;  4XXR A;  4BJP A;  4DE3 A;  4EWF A;  4Y0O A;  4GNU A;  3HLW A;  2X02 A;  3NC8 A;  4OPY A;  4QB8 A;  3HLE A;  4RVA A;  2ZC6 B;  4DDY A;  4B88 A;  3ZNT A;  4D2O A;  3ZFZ A;  4C3Q A;  5TFQ A;  5M19 A;  5GHY A;  3P98 A;  3WS2 A;  2XDM A;  5KMW A;  4E3N A;  4JXV A;  1C3B A;  2J7V A;  4IBR A;  3DWZ A;  4EV4 A;  3M2J A;  4R1G A;  5F83 A;  1BZA A;  5E2E A;  3IF6 C;  2XH9 A;  4B4Z A;  1ES2 A;  1U60 A;  1HD8 A;  2OSU A;  1E3U D;  2DCF A;  1G68 A;  3GSG A;  1NYM A;  4OOM A;  4ZJ1 A;  1PI5 A;  2WGW B;  2XQZ A;  3HUN A;  4OP5 A;  3VSK A;  3IXB A;  3VSL A;  2UWX A;  4E6W A;  1XA7 A;  3VP4 A;  1LI0 A;  2PBY A;  3W4Q A;  3TSG A;  4RYE A;  4E3M A;  4PM5 A;  4IVK A;  3SH8 A;  4DXC A;  1W7F A;  1M6K A;  2Y2G A;  3V39 A;  3UDI A;  2PU2 A;  3NDG A;  4HBT A;  1RGY A;  5CGW A;  4KZ5 A;  2EX6 A;  4OPQ A;  4WZ5 A;  5EVL A;  1ZG4 A;  2DNS A;  2HPB A;  2XD1 A;  4ZJ2 A;  2IWD A;  3MFD A;  3O3V A;  2Y2P A;  2XFT A;  1ONG A;  2EXA A;  2EXB A;  3MZF A;  4S2L A;  4E3L A;  1GHP A;  5GLD A;  4OQ0 A;  5TR7 A;  2PU4 A;  2G2U A;  3Q7V A;  4JLF A;  3ZCZ A;  3PBQ A;  1KGG A;  4BEN A;  1FCM A;  4YFM A;  1ZKJ A;  4Y0U A;  1XPB A;  5I94 A;  3O87 A;  3FKW A;  3IHB A;  2BLS A;  3GR2 A;  4QHC A;  4WEL A;  1PI4 A;  3DTM A;  2ZQ9 A;  3IXG A;  3G34 A;  1L0E A;  2WAD A;  5FQ9 A;  3VFF A;  4KQO A;  1MWU A;  1XP4 A;  2IWB A;  3HVF A;  2WUQ A;  1K4E A;  4X69 A;  3Q07 A;  2RCX A;  5EVI A;  3FKV A;  1QME A;  1FSW A;  1GCE A;  1W8Y A;  3IF6 B;  1KE3 A;  1PYY A;  1SDN A;  4U0T A;  3N4I A;  3SH9 A;  1W79 A;  2ZC7 A;  5GHX A;  4S2N A;  2ZQA A;  2VGJ A;  1CI8 A;  1LHY A;  1TDG A;  3QHY A;  4B4X A;  1ALQ A;  2Z2L B;  1Z6F A;  4QY5 A;  5CGS A;  3UO9 A;  1GHM A;  5CEB A;  1TDL A;  1XGI A;  1KE0 A;  1H8Y A;  2WKH A;  1H8Z A;  1K57 C;  2Y2Q A;  4UAA A;  3ZGA B;  3NDE A;  3NBL A;  3WS5 A;  3PBT A;  3G32 A;  5CTN A;  4ZBE A;  3P09 A;  1BUL A;  1KGF A;  1N4O A;  3E2K A;  5GLA A;  3RXW A;  3WS0 A;  1JWZ A;  3V3R A;  3Q7Z A;  4DKI A;  4X55 A;  1JWV A;  3G4P A;  2GDN A;  5CTM A;  4NET A;  2XF3 A;  1L0G A;  1IYO A;  4BL2 A;  4Y0T A;  4OPR A;  3V5M A;  3Q7V B;  4OOL A;  2WYX A;  3A3E A;  1EWZ A;  5FSR A;  2Y2I A;  5HAQ A;  1CK3 A;  2WZX A;  3Q82 A;  2B5R A;  1FR1 A;  2XFS A;  3G2Z A;  3ZG0 A;  1ESI A;  2Y2L A;  3IF5 A;  4UA6 A;  5EUA A;  5FI6 A;  3A3F A;  4KG5 A;  3PBS A;  4WMC A;  5FI2 A;  4FD8 A;  3VP3 A;  3A3I A;  4Y7P A;  1RGZ A;  4N9K A;  1FCO A;  4OQG A;  4WM9 A;  3DW0 A;  1I2W A;  1YLP A;  1SCW A;  3GVB A;  3IWO A;  4F94 A;  3IWI A;  2Y2J A;  5HAR A;  1ERM A;  1CI9 A;  3A3J A;  2OLV A;  4MBH A;  4YIN A;  4FH4 A;  4N1H A;  3O86 A;  2A49 A;  1KGE A;  4OOY A;  4RX3 A;  2OLU A;  5F82 A;  3RXX A;  3EQV A;  4DE2 A;  3N6I A;  5F1F A;  1E4D A;  3G2Y A;  3G31 A;  5EPH A;  2P74 A;  4OVD A;  3VP2 A;  3WS4 A;  4WZ5 C;  1MPL A;  1AXB A;  4N9L A;  1KDS A;  3Q1F A;  3ZG5 A;  4X6T A;  2WKE A;  3WRZ A;  2WAF A;  1BUE A;  2V20 A;  2XR0 A;  5FA7 A;  3IH9 A;  1K56 A;  3B3X A;  3PTE A;  1O7E A;  3S22 A;  2V2F F;  5DTS A;  3LCE A;  2ZQD A;  4QD4 A;  5IHV A;  3SS4 A;  2JE5 A;  1BLS A;  4KZ7 A;  2E8I A;  3FZC A;  4WYY A;  1DJB A;  3MZD A;  2R9W A;  3E2L A;  5EEC A;  1NRF A;  5FQK A;  2XLN A;  4LV2 A;  4S2O A;  4MBK A;  4IVI A;  1GA9 A;  4R23 A;  1YQS A;  1H5X A;  2R9X A;  4GN2 A;  4U0X A;  5A90 A;  3V3S A;  3W4P A;  4JBF A;  1XKZ A;  3UDF A;  2XD5 A;  4H8R A;  5A92 A;  3BFG A;  3N8L A;  4KZ9 A;  1IEL A;  2XEP A;  1IYS A;  2H10 A;  1WYB A;  5FQQ A;  2P9V A;  3BLS A;  3LY4 A;  1JTD A;  1NYY A;  2Q9M A;  3CG5 A;  4PPR A;  2G2W A;  5G18 A;  1MBL A;  3UE3 A;  3PAE A;  3GTC A;  4LV1 A;  3VP1 A;  2P9V B;  1K54 C;  1PZP A;  3HUO A;  1LL9 A;  4JXS A;  2HDS A;  5DTK A;  5EOO A;  3OPP A;  3ZVT A;  1PIO A;  4C75 A;  4PM6 A;  2J8Y A;  2Y2M A;  2ZLY A;  3PAG A;  1EI5 A;  3PBR A;  1YLJ A;  3SS5 A;  4KZ8 A;  1PZO A;  1PWC A;  3CJM A;  4R0Q A;  3WWX A;  4N1X A;  1W5D A;  2EX8 A;  2FFF B;  2BG1 A;  5A93 A;  1KVM A;  3TOI A; 
#chains in the Genus database with same CATH topology
 4OLG A;  4PM9 A;  1VHM A;  3NI9 A;  2OWH A;  2WK0 A;  5AQ9 A;  3H7W A;  1K6R A;  3T12 B;  5EM0 A;  1QMF A;  2ZMF A;  4IED A;  3OOV A;  4WEK A;  2K7S A;  3RFB A;  3S7N A;  1K25 A;  1S67 L;  3LY3 A;  1RCJ A;  1ERQ A;  1XGJ A;  5F1G A;  1LI9 A;  4Q0I A;  4DJ2 A;  1OTB A;  2WKR A;  1CQA A;  3IS2 B;  5EVI C;  5E2G A;  2J3W A;  2OAQ 1;  3F1O B;  1JTG A;  3ZG7 B;  2Q9N A;  3MKF A;  1XJ2 A;  3D3O A;  4GD6 A;  4I3A A;  4ID4 A;  3T1Q B;  2C5W B;  4KUK A;  3BLM A;  2ZM2 A;  1ZC2 A;  1L0D A;  3TE8 A;  1SZV A;  4KZ6 A;  2XRO A;  4ESP A;  3MZE A;  4R4S A;  5J8X A;  2X01 A;  1FSY A;  4K91 A;  3CPT A;  3ZHH A;  3C7U A;  4E3O A;  1I2S A;  4XT2 B;  3E4P A;  4LV3 A;  3LIF A;  2YKH A;  4DE0 A;  1KDW A;  2Y8H A;  5HPF A;  2VV6 A;  3M6H A;  3VMA A;  4KQR A;  3JVU A;  2ZQC A;  2QZ6 A;  4P6Z M;  3BQ8 A;  3HLB A;  5HAP A;  2VGL M;  3FYZ A;  3OPL A;  2VZW A;  4UQI S;  1IYQ A;  4S2I A;  3KYQ A;  3MXS A;  1PWG A;  1T1B A;  5FAQ A;  4HIA A;  4EW7 A;  4JGR A;  3IHA A;  3OLO A;  2Y59 A;  1D06 A;  1PWD A;  4D60 A;  4NK3 A;  1MXO A;  2V8F A;  4P6B A;  3MKE A;  4KEN B;  2Z6D A;  4ZJ3 A;  4WBG A;  2O9A A;  5HFO A;  4BLM A;  1KVL A;  3IF6 A;  3MBZ A;  3MS6 A;  4S2K A;  3A0R A;  3A3D A;  1Q2P A;  3BW6 A;  2ZL1 A;  2HDU A;  4GD8 A;  2EX9 A;  1N9B A;  1P0Z A;  2LB9 A;  4OQH A;  4DXB A;  3UY6 A;  1E25 A;  2V1B A;  4QU3 A;  1ACF A;  1AWI A;  4Y3I A;  2PD8 A;  3AGF A;  4HH3 A;  2P04 A;  3ZG8 B;  3KX0 X;  4PM8 A;  2PAV P;  1L2S A;  5EV0 A;  2ACG A;  4P0M A;  1LT0 A;  2Y2O A;  3HLG A;  3ITA A;  1VET B;  4KZA A;  2WKQ A;  1HVB A;  3C8C A;  3LGO A;  3OBF A;  4P85 A;  1DRM A;  4G3K A;  2D01 A;  3VOZ A;  2FFY A;  3HBR A;  2WZZ A;  4JKT A;  2C6W B;  1G6O A;  1K6S A;  1MKI A;  3I7J A;  4OPZ A;  3SOI A;  4OON A;  4QPR A;  3T4J A;  5I5L A;  4DDS A;  1STZ A;  3WRT A;  3VP0 A;  4JF4 A;  5HAI A;  1S0W A;  3H7W B;  2EFX A;  2ZD8 A;  3D4F A;  3ZYT A;  4LV0 A;  4MEZ A;  3W4O A;  5CHJ A;  3BM6 A;  2IA2 A;  1YLZ A;  2ZM8 A;  4Y15 A;  4XXR A;  4EWF A;  2X02 A;  3NOP C;  4QB8 A;  3HLE A;  2ZOI A;  3ZNT A;  4ETX A;  3CUE C;  3WS2 A;  3P98 A;  5KMW A;  2CMN A;  2J7V A;  5L8M A;  5FDS A;  3M2J A;  2O9C A;  1BZA A;  2XH9 A;  2J80 A;  1NYM A;  4EXO A;  2W0N A;  4MMN A;  2UWX A;  3GEC A;  3QP4 A;  4I39 A;  3BWL A;  2PYR A;  1W7F A;  1M6K A;  2Z6C A;  2PU2 A;  2PHY A;  2PT7 A;  1SKO A;  5CGW A;  2EA9 A;  4HY8 A;  4Y13 A;  3EGD C;  2PR5 A;  4M4X A;  5EVL A;  2XD1 A;  2HJ9 C;  4S2L A;  2EXB A;  2L0W A;  2G2U A;  3ZCZ A;  1ZKJ A;  4WEL A;  3IHB A;  1X0O A;  3G34 A;  1L0E A;  3VFF A;  3F1P A;  4BMW A;  3HVF A;  1K4E A;  3T1X A;  3FKV A;  2GX5 A;  1QME A;  3PYP A;  1W8Y A;  1KE3 A;  1OTI A;  3E4Q A;  3N4I A;  1VEU B;  1W79 A;  2ZC7 A;  3B42 A;  3U4L P;  4QY5 A;  1KE0 A;  1H8Y A;  2WKH A;  2Y2Q A;  1YAX A;  4MCW A;  3WS5 A;  4E04 A;  4H6J B;  5CTN A;  3E2K A;  1JWZ A;  1Y4O A;  4X55 A;  1JWV A;  2GDN A;  5CTM A;  4P6Z S;  1L0G A;  3V5M A;  4OOL A;  5FSR A;  2Y2I A;  2WZX A;  3Q82 A;  2B5R A;  4BBT A;  3A3F A;  4KG5 A;  4WMC A;  5FI2 A;  5DFY A;  3T4L A;  3VP3 A;  4HQA A;  1IFQ A;  3IS2 A;  1ERM A;  1CI9 A;  3A3J A;  4CLC C;  4MBH A;  4N1H A;  3O86 A;  1H8M A;  1F98 A;  2JN7 A;  1E4D A;  3G2Y A;  4R70 A;  3G31 A;  5EPH A;  5AVE A;  2P74 A;  1LSX A;  5TBM B;  3VP2 A;  3VE3 A;  1MPL A;  5HWV A;  1KOU A;  3Q1F A;  2W27 A;  3IH9 A;  5F69 A;  5K5B A;  3MJQ A;  2V2F F;  3CWF A;  2VK3 A;  3FPW A;  4WYY A;  3MZD A;  2R9W A;  4HJ3 A;  4LV2 A;  4UEY A;  4MBK A;  3LYX A;  1H5X A;  2JHE A;  1XKZ A;  2HF6 A;  4PPR A;  5G18 A;  4LV1 A;  3F1N B;  1K54 C;  4X1L A;  4LRZ E;  5EOO A;  1HLU P;  2ZLY A;  3FG8 A;  2V0W A;  3H82 B;  3PBR A;  4NG2 A;  3SS5 A;  2QJ5 A;  4KZ8 A;  1PZO A;  1PWC A;  4WLA A;  4G3V A;  3TOI A;  1YPR A;  5FAT A;  2K31 A;  1H0M A;  5DVA A;  2K2N A;  3QNB A;  2VJW A;  4EEU A;  2Y79 A;  2O0Y A;  3ISG A;  2AVX A;  3BYD A;  1ES3 A;  2L1M A;  5GLB A;  3K3C A;  3HLF A;  4X56 A;  1S1Y A;  1LL5 A;  2R78 A;  4QJG A;  1ES5 A;  3MFX A;  4NXF A;  1BLC A;  4OQI A;  2D02 A;  5DFX A;  3KSH A;  4CLC E;  4E3J A;  1F2K A;  2DRW A;  4EU0 A;  1EW0 A;  4G3W A;  4L9E A;  4IJG A;  2Y4A A;  1PW1 A;  5TBM A;  5HWT A;  2INW A;  1KE4 A;  2XGN A;  3PXP A;  5FQJ A;  2I72 A;  1T19 A;  2WAE A;  2WKI A;  4FCF A;  3CAX A;  3GRJ A;  3GQZ A;  1SKO B;  3T4Q A;  4KQQ A;  5LBR A;  3BQA A;  3LEZ A;  1SDE A;  2W3G A;  4P87 A;  4E3K A;  1GHI A;  4LGW A;  3C30 A;  4BQM A;  5FEG A;  1FIL A;  1MWS A;  1OTA A;  3RJU A;  1MKM A;  5EFW A;  3ZG9 B;  4DF6 A;  3PBN A;  1K54 A;  1HZO A;  3VE4 A;  3IXD A;  4CPK A;  3IBJ A;  1M40 A;  1ERO A;  2V8C A;  1FCN A;  3OPR A;  3R7W A;  5GHZ A;  2Y91 A;  1S66 L;  4LCM A;  4EBN A;  1YSQ A;  1VET A;  2CC1 A;  4LRY C;  3BEB A;  5HX9 A;  3ZNY A;  1VQQ A;  2ZOH A;  5A8B A;  2WGW A;  3A0S A;  3O88 A;  1J9M A;  3PBO A;  1XJ4 A;  3BFE A;  4LEN A;  1NZO A;  2Y55 A;  2PDR A;  2A24 B;  1ZHH B;  4WZ4 A;  5KZH A;  4XUX A;  4EBP A;  2KX6 A;  1CJF A;  2YKF A;  4MLL A;  3HUM A;  3N8R A;  5CXW A;  4CLC A;  4Y5F A;  3HLC A;  2ZMV A;  5CRF A;  4MN5 A;  3HRE A;  2Z2M B;  4GZB A;  3S1Y A;  2VEA A;  4O7D A;  3CZD A;  1K56 D;  2OAP 1;  3MF0 A;  5KSH A;  4PM7 A;  4HBU A;  1XFN A;  1IKI A;  1OJ5 A;  2ZC4 B;  1SHV A;  2KDK A;  1FR6 A;  1GA0 A;  2QYB A;  1K4F A;  5CEC A;  1YMX A;  2V1A A;  3OZH A;  3H9W A;  1GSX A;  5M1A A;  1MZU A;  3OPH A;  4E3I A;  1CEF A;  4KQD A;  3CLO A;  4K0W A;  1P97 A;  4JF6 A;  4EQI A;  2XK1 A;  2J9O A;  2JKG A;  1NXY A;  1G5U A;  3BFF A;  3SS3 A;  1LL8 A;  4DJ3 A;  2JC7 A;  2RL3 A;  5E2H A;  1FOF A;  1YKD A;  2G7U A;  4CLC B;  4QY6 A;  2WGI A;  4K0X A;  3Q81 A;  1JWP A;  3EQU A;  4R4R A;  2J9P A;  1DJA A;  4ZAM A;  2XA7 M;  3LEQ A;  3MSH A;  1BSG A;  4HEF A;  3UE1 A;  3NCK A;  4I3J A;  4GCZ A;  4E6X A;  1ZG6 A;  2H28 A;  1DP9 A;  2PRF A;  4BJP A;  4DE3 A;  4EER A;  4Y0O A;  4EEP A;  1VEU A;  4B88 A;  1PNE A;  2QKP A;  5GHY A;  4E3N A;  4JXV A;  3DWZ A;  3E0Y A;  5C5K A;  5IU1 A;  1IOU A;  4H6J A;  1U60 A;  1NWZ A;  1HD8 A;  3QP5 A;  1E3U D;  4OOM A;  1PI5 A;  3HUN A;  4WF0 A;  2GNX A;  3DAV A;  3IXB A;  3PR6 A;  5F5Y A;  3VSL A;  1D7E A;  4DN0 A;  2OWJ A;  1GSV A;  2PBY A;  4I5S A;  4EQ1 A;  2VLG A;  2MJ6 A;  2Q0O A;  3CHW P;  4IVK A;  3SH8 A;  2Y2G A;  3NDG A;  3NUL A;  4HBT A;  4GS9 B;  3GDI A;  2EX6 A;  2JKR I;  3QP2 A;  1ZG4 A;  2ZBB A;  4OQ0 A;  3Q7V A;  3PBQ A;  1KGG A;  4BEN A;  1FIK A;  1H3Q A;  2B02 A;  4Y0U A;  5I94 A;  3T50 A;  3GR2 A;  1PI4 A;  2ZQ9 A;  1CF0 A;  3IXG A;  4KQO A;  2IWB A;  4NXE A;  3IF6 B;  4MDZ A;  3SH9 A;  3DBA A;  2VGJ A;  1TDG A;  3HJK A;  4GW9 A;  1Z6F A;  3EOI A;  4UAA A;  1H8Z A;  3ZGA B;  3F1P B;  3RXW A;  1KGF A;  4DKI A;  3G4P A;  3IX3 A;  3DTE A;  2NUT C;  1K0K A;  4Y0T A;  5HAQ A;  1CK3 A;  5HD5 A;  1FR1 A;  3G2Z A;  5FI6 A;  4Y7P A;  3LI9 A;  3DW0 A;  1I2W A;  3KSG A;  3CPT B;  4F94 A;  4GHI B;  4WN5 A;  2V9A A;  1S4S A;  4DE2 A;  2JKF A;  4OVD A;  2GZA A;  4WZ5 C;  3ICY A;  5FL3 A;  3IX4 A;  1NLZ A;  5FA7 A;  1K56 A;  3PTE A;  1O7E A;  2QWS A;  3LCE A;  4QD4 A;  2KOI A;  5L07 A;  2XLN A;  1GA9 A;  1YQS A;  5HDD A;  2R9X A;  3CI6 A;  4R6L A;  5A92 A;  4KZ9 A;  1IEL A;  1WYB A;  5FQQ A;  2A2L A;  2P9V A;  3CG5 A;  2G2W A;  3GTC A;  3VP1 A;  4BWI A;  1PZP A;  1LL9 A;  5DTK A;  1PIO A;  4PM6 A;  2Y2M A;  5AJG A;  1EI5 A;  1YLJ A;  3JVV A;  4R0Q A;  4N1X A;  2EX8 A;  1TS8 A;  1KVM A;  1WE4 A;  2WGV A;  3OC2 A;  2HJE A;  1MWT A;  3JPU A;  4ARZ A;  2FZ0 A;  5HWW A;  4PHT A;  3S4X A;  4PKY A;  4NEE D;  4Z1W A;  4BBV A;  1TEM A;  2H5S A;  2HP6 A;  3HCY A;  5FQM A;  1TVF A;  3H82 A;  3L7H A;  4I38 A;  5CED A;  3P7N A;  5FAP A;  1MWR A;  4IBX A;  3EEH A;  3N8S A;  1K55 A;  3ITB A;  2VX8 A;  3TG9 A;  3MXR A;  5HZH A;  2W1T B;  4BD1 A;  3VOY A;  5CER A;  2Y2K A;  4LCL A;  2EX2 A;  1K55 C;  4OKP A;  2P08 A;  4ZRR A;  1CEG A;  3LR4 A;  2J3T D;  1PW8 A;  2OV5 A;  2VV7 A;  4O8G A;  1E3U A;  3SZT A;  4OH0 A;  3S7Q A;  4CQH A;  4EBL A;  3UPO A;  5EVI D;  2HZ5 A;  1XJ6 A;  4MNR A;  3UPN A;  4ARZ B;  3IH8 A;  1T1C A;  3LI8 A;  5AQA A;  1BT5 A;  5FQI A;  1MY8 A;  4MBF A;  1F5M A;  4KG6 A;  2Y2H A;  1LSV A;  1N9L A;  3OCN A;  5BOH A;  1W8Q A;  3C7V A;  5D3O A;  5KIZ A;  2JKT M;  3EEA A;  4UHU A;  2WKP A;  3NIA A;  4NXB A;  1ZTU A;  2W1T A;  5FAS A;  4JF5 A;  2ZMA A;  3QNC A;  4II7 A;  4OP8 A;  3DTK A;  5EOE A;  1ES4 A;  1YT4 A;  1VB6 A;  3W8K A;  4BL3 A;  5GL9 A;  5TGF A;  2HP5 A;  3KYE A;  5KSC A;  1TS0 A;  5U47 A;  1HTZ A;  4B93 A;  1YLW A;  2BAS A;  3N7W A;  3KSI A;  3F1N A;  2QMI A;  3TW8 A;  2ZJ9 A;  2A3U A;  3V50 A;  5GLC A;  3UNW A;  4QWO A;  1W63 Q;  4X1M A;  1ESU A;  3FWL A;  4AFI A;  3BRM A;  2ZM0 A;  3HLD A;  3UE0 A;  1NZU A;  3EWK A;  1NLY A;  2O99 A;  3GMW A;  3LR5 A;  4S2M A;  3WS1 A;  5E2F A;  5HL6 A;  3LIB A;  3FV7 A;  3ZVW A;  5FI7 A;  5AQ7 A;  3NJA A;  5HDC A;  3AGE A;  5J7E A;  4YOF A;  3PHY A;  2QHK A;  1IKG A;  4WMC D;  4WEJ A;  3UB9 A;  2PBD P;  1O07 A;  3UDX A;  1XA1 A;  1VM1 A;  5J3W A;  2EFU A;  3AGD A;  3U2A A;  3IWQ A;  3UMD A;  3NY4 A;  4F3L A;  4JGP A;  3C4P A;  5G4Z A;  4GS9 A;  4IUK A;  1IEM A;  5DKL A;  4HHD A;  5A91 A;  3ULF A;  4U3T A;  4Q8I A;  4Z9Q A;  1YLT A;  1IYP A;  4X53 A;  4S2P A;  5AVF A;  3UME A;  5DF8 A;  3UPP A;  3P01 A;  1Y54 A;  1TF1 A;  3IXH A;  3CUE A;  2ZQ8 A;  3CMZ A;  3LO7 A;  3OCL A;  5CX7 A;  3E98 A;  4KZ3 A;  1NJ4 A;  4LRX C;  1K57 A;  3C5A A;  1OME A;  4L9G A;  4GNU A;  2PD7 A;  3HLW A;  3NC8 A;  4LFU A;  4DDY A;  5TFQ A;  2NUP C;  5M19 A;  3S7O A;  2XDM A;  4HJ4 A;  1C3B A;  4R1G A;  5F83 A;  3IF6 C;  4B4Z A;  3LFV A;  2OSU A;  4FTX A;  1G68 A;  4HI4 A;  3GSG A;  2WGW B;  3VSK A;  4E6W A;  1XA7 A;  4WUJ A;  1LI0 A;  4NXG A;  3W4Q A;  4E3M A;  2W3E A;  4PM5 A;  3V39 A;  3UDI A;  2BTF P;  2P7J A;  1RGY A;  5HSQ A;  3VOL A;  4OPQ A;  4ZJ2 A;  4MN7 A;  4EUV A;  2IWD A;  3MFD A;  1OJG A;  2Y2P A;  3MZF A;  2W3D A;  4E3L A;  1GHP A;  5GLD A;  2PU4 A;  2E8J A;  4PKY G;  2M1C A;  3FKW A;  2BLS A;  4QHC A;  3DTM A;  5FQ9 A;  2DMW A;  1XP4 A;  2WUQ A;  4X69 A;  3Q07 A;  2RCX A;  2PYP A;  5EVI A;  3IX8 A;  1GSW A;  2HGV A;  1PYY A;  1SDN A;  3SW1 A;  2ZQA A;  1CI8 A;  1LHY A;  2Z2L B;  3DTI A;  1GHM A;  1S1Z A;  1TDL A;  1OT9 A;  3O5Y A;  4R38 A;  3NBL A;  4LPZ A;  5GLA A;  1BUL A;  3V3R A;  1A0K A;  3NHQ A;  3T4K A;  1IYO A;  3Q7V B;  3LID A;  1EWZ A;  3BY8 A;  3V67 A;  2XFS A;  5EUA A;  1ESI A;  3IF5 A;  4UA6 A;  4FOF A;  4HP4 A;  5IT5 A;  3PBS A;  3MXQ A;  4XT2 A;  4FD8 A;  3A3I A;  1RGZ A;  4WM9 A;  1YLP A;  1SCW A;  3IWI A;  2Y2J A;  1L3L A;  1Y28 A;  2OLV A;  4YIN A;  4GLQ A;  5HD3 A;  1WA9 A;  2A49 A;  3A0V A;  4RX3 A;  5F1F A;  2XRN A;  4KUO A;  3ZG5 A;  4X6T A;  4ME4 A;  3S22 A;  3QP8 A;  2ZQD A;  5IHV A;  2JE5 A;  1BLS A;  2E8I A;  3VV4 A;  1DJB A;  3NEC A;  3E2L A;  5EEC A;  1NRF A;  4S2O A;  1G28 A;  4IVI A;  1PRQ A;  4GN2 A;  5L09 A;  3BFG A;  3N8L A;  1IYS A;  2H10 A;  3BLS A;  3LY4 A;  1JTD A;  1NYY A;  2Q9M A;  1MBL A;  1OPX A;  1XFQ A;  5MC7 A;  3PAE A;  2P9V B;  2ZL1 B;  4Q0H A;  3HUO A;  4JXS A;  2HDS A;  3OPP A;  4C75 A;  3B33 A;  3MQQ A;  2A24 A;  1DP8 A;  3QP1 A;  3CJM A;  4EES A;  1DP6 A;  3WWX A;  1W5D A;  5A93 A;  4L9F A;  3MQO A;  1F9I A;  3MQ0 A;  3SH7 A;  3HL9 A;  1ODV A;  3VFH A;  2JCH A;  1OT6 A;  3ZDJ A;  4ZTK A;  5DJU A;  2JKT I;  4DRT A;  1XXM A;  2ZC3 B;  3FPV A;  3M2K A;  4R3J A;  4JXG A;  4EET B;  2JBF A;  5L10 A;  3K3D A;  4X25 A;  5EVE A;  5JYP A;  4GOG A;  5L2F A;  5AQB A;  4GDB A;  4O0P A;  3KO6 A;  1L0F A;  1T18 A;  4JXW A;  2H0T A;  4I3I A;  2ZQ7 A;  4RX2 A;  2JKR M;  1DJC A;  1TD5 A;  4EUZ A;  1V9Y A;  1XX2 A;  4JPM A;  1RP5 A;  2VA0 A;  1Q2Q A;  2IWC A;  3T1R A;  4HJ6 A;  4O01 A;  4HNB A;  4YNR A;  3BEC A;  4GKU A;  5DF9 A;  3GV9 A;  2HDR A;  2V1Z A;  1SKF A;  1DY6 A;  1BLH A;  5G4Y A;  1ONH A;  4LLO B;  4S2N C;  3T4S A;  2Y2N A;  4X68 A;  4M3K A;  2B18 A;  3C4O A;  3G30 A;  3K2N A;  2V0U A;  4A5R A;  1NY0 A;  2QPN A;  3R7W B;  5EVI B;  4RA7 A;  3UB8 A;  3DWK A;  4OLD A;  1YM1 A;  2HP9 A;  2ZC5 B;  4DE1 A;  2J3T C;  2HDQ A;  2HV1 A;  4S2J A;  5CHM A;  3T4O A;  3CIT A;  5DJT A;  4FSF A;  5CHU A;  4KZB A;  4HP9 A;  4WL9 A;  2UV0 E;  1T1A A;  3M6B A;  4UQI M;  4R3B A;  1BTL A;  1K38 A;  1YMS A;  5DF7 A;  3LIE A;  4HES A;  1P9W A;  1I5Q A;  1MC0 A;  3JYI A;  5JYO A;  4XUZ A;  4L0L A;  1JVJ A;  3IQA A;  5IS1 A;  1TS7 A;  4PAU A;  4K08 A;  4ZDX A;  2X71 A;  4Q0J A;  5EE8 A;  5HL1 A;  2M7U A;  5FDH A;  1S6R A;  4GB7 A;  1LLB A;  1XJ3 A;  3BFC A;  3MR0 A;  1NRJ A;  2VKS A;  5HPI A;  2H0Y A;  5E43 A;  2L4R A;  3G35 A;  2KLI A;  4N92 A;  3B47 A;  4CJN A;  4NKP A;  1BYW A;  3UB7 A;  3NOU C;  2QJ7 A;  3T1S A;  2EWV A;  5FAO A;  1WYC A;  4BD0 A;  1OTE A;  4KZ4 A;  3KYZ A;  2O9B A;  4JGO A;  4C6Y A;  4GDN A;  5M18 A;  1N9O A;  3IBR A;  4FH2 A;  2I9V A;  1YLY A;  2LB5 A;  2B95 A;  3IT9 A;  3L9K A;  3BFD A;  3S7P A;  1BLP A;  4DMZ A;  4YWZ A;  3NOT C;  4UA9 A;  3LR3 A;  3G6O A;  5F68 A;  2VGK A;  4PMA A;  1G6A A;  2EWW A;  2PR6 A;  4GHI A;  5CGX A;  3UB6 A;  4B9O A;  4F3L B;  3LIC A;  4UA7 A;  2FH5 A;  2W1R A;  3UN7 A;  1V9Z A;  2W3F A;  5HW3 A;  1FQG A;  5DTT A;  1TS6 A;  3TRC A;  1S4R A;  2VGL S;  4KG2 A;  4OPY A;  3W2Z A;  4RVA A;  2ZC6 B;  4D2O A;  2VV8 A;  3ZFZ A;  4C3Q A;  3FC7 A;  5HDS A;  4IBR A;  4EV4 A;  5TJJ A;  4JGQ A;  5E2E A;  1ES2 A;  1Z09 A;  3RTY A;  3D9Y A;  2DCF A;  4ZJ1 A;  2XQZ A;  2GJ3 A;  4OP5 A;  3BY9 A;  5FEF A;  3VP4 A;  2W3H A;  3TSG A;  4RYE A;  1UWP X;  3F1O A;  4DXC A;  4Y17 A;  4ETZ A;  4KZ5 A;  4WZ5 A;  3RH8 B;  2DNS A;  2HPB A;  3O3V A;  3R4K A;  2XFT A;  1ONG A;  2EXA A;  5TR7 A;  3QP6 A;  1J3W A;  3EGX C;  4JLF A;  3ZQ5 A;  1FCM A;  2XA7 S;  4YFM A;  1XPB A;  4Y2F A;  3O87 A;  2WAD A;  1MWU A;  3T4T A;  1N9N A;  3TJZ C;  1FSW A;  1GCE A;  1YSP A;  4U0T A;  5GHX A;  4S2N A;  4B4X A;  3QHY A;  4CLC D;  3UO9 A;  5CGS A;  5CEB A;  1XGI A;  4FUW A;  1K57 C;  4MN6 A;  3NDE A;  3PBT A;  3G32 A;  4ZBE A;  1LSW A;  3P09 A;  1N4O A;  3WS0 A;  3Q7Z A;  4HH2 A;  4NET A;  2XF3 A;  4BL2 A;  3D72 A;  4BBU A;  4OPR A;  2WYX A;  3A3E A;  4R3A A;  4IHQ A;  3LUQ A;  3ZG0 A;  2Y2L A;  5F6A A;  1D1J A;  3KSF A;  4N9K A;  1FCO A;  4OQG A;  1OTD A;  3LIA A;  4RQ9 A;  3GVB A;  3IWO A;  5HAR A;  3UB5 P;  4FH4 A;  1KGE A;  1JNU A;  3E4O A;  4OOY A;  2OLU A;  5F82 A;  3RXX A;  3EQV A;  3N6I A;  3WS4 A;  4N9L A;  1AXB A;  1KDS A;  2WKE A;  3WRZ A;  2WAF A;  1BUE A;  2V20 A;  2XR0 A;  1PFL A;  3HJI A;  3B3X A;  1UGU A;  3LR0 A;  5DTS A;  4HOI A;  3SS4 A;  4KZ7 A;  3FZC A;  3C38 A;  5DKK A;  5FQK A;  4R23 A;  4GJ4 A;  4U0X A;  5A90 A;  3V3S A;  3W4P A;  4JBF A;  3UDF A;  2XD5 A;  4H8R A;  3UE6 A;  2XEP A;  5J4E A;  2OOL A;  1W63 M;  3MMH A;  3UE3 A;  3C2W A;  2XSS A;  3ZVT A;  4IUH A;  5EM1 A;  2J8Y A;  3PAG A;  1P9R A;  1UWN X;  2M7V A;  2FFF B;  2BG1 A;  3BJN A;  1ALQ A; 
#chains in the Genus database with same CATH homology
 3SH7 A;  1WE4 A;  2WGV A;  3OC2 A;  4OLG A;  5FAT A;  4PM9 A;  1MWT A;  3NI9 A;  5DVA A;  3S4X A;  3QNB A;  3HL9 A;  2WK0 A;  5AQ9 A;  3ISG A;  3VFH A;  2JCH A;  1TEM A;  1ES3 A;  3BYD A;  1K6R A;  3ZDJ A;  5GLB A;  4ZTK A;  2H5S A;  3HLF A;  2HP6 A;  4X56 A;  4DRT A;  1XXM A;  2ZC3 B;  1LL5 A;  5FQM A;  3M2K A;  1QMF A;  4QJG A;  1ES5 A;  1TVF A;  4R3J A;  1BLC A;  4IED A;  4JXG A;  4OQI A;  4WEK A;  5CED A;  4E3J A;  2JBF A;  1K25 A;  3LY3 A;  2DRW A;  1RCJ A;  1ERQ A;  5FAP A;  1XGJ A;  1MWR A;  4IBX A;  5JYP A;  5F1G A;  1LI9 A;  3N8S A;  1K55 A;  3ITB A;  4GOG A;  3TG9 A;  5AQB A;  5L2F A;  4GDB A;  2Y4A A;  3MXR A;  1L0F A;  1PW1 A;  4JXW A;  4BD1 A;  5EVI C;  1KE4 A;  2H0T A;  5E2G A;  2XGN A;  3VOY A;  5CER A;  1JTG A;  2Y2K A;  5FQJ A;  3ZG7 B;  2I72 A;  2Q9N A;  2WAE A;  3MKF A;  2EX2 A;  1K55 C;  2WKI A;  2ZQ7 A;  4LCL A;  4RX2 A;  4OKP A;  4FCF A;  1DJC A;  4EUZ A;  1CEG A;  1XX2 A;  3GRJ A;  3GQZ A;  4JPM A;  1RP5 A;  4GD6 A;  1Q2Q A;  2IWC A;  4KQQ A;  1PW8 A;  2OV5 A;  4ID4 A;  2C5W B;  1E3U A;  4OH0 A;  3BLM A;  1SDE A;  3BEC A;  3LEZ A;  2ZM2 A;  1ZC2 A;  3GV9 A;  4GKU A;  5DF9 A;  2HDR A;  1L0D A;  2V1Z A;  4EBL A;  4P87 A;  4E3K A;  3UPO A;  1SKF A;  1GHI A;  5EVI D;  1DY6 A;  4KZ6 A;  4BQM A;  3MZE A;  1BLH A;  4R4S A;  1ONH A;  1MWS A;  4S2N C;  5J8X A;  4MNR A;  3RJU A;  3UPN A;  2Y2N A;  3IH8 A;  4X68 A;  4M3K A;  2X01 A;  1FSY A;  3ZG9 B;  4DF6 A;  3C4O A;  3PBN A;  3G30 A;  5AQA A;  1BT5 A;  4K91 A;  4A5R A;  1NY0 A;  1K54 A;  5FQI A;  2QPN A;  3ZHH A;  1HZO A;  1MY8 A;  5EVI B;  3IXD A;  4MBF A;  4CPK A;  1M40 A;  3C7U A;  4RA7 A;  1ERO A;  4KG6 A;  4E3O A;  1I2S A;  1FCN A;  2Y2H A;  3DWK A;  4OLD A;  4LV3 A;  1YM1 A;  2HP9 A;  3OCN A;  3OPR A;  1W8Q A;  2ZC5 B;  5BOH A;  5GHZ A;  2Y91 A;  3C7V A;  4DE1 A;  2HDQ A;  5D3O A;  4LCM A;  4EBN A;  4DE0 A;  1KDW A;  2CC1 A;  4S2J A;  5CHM A;  4UHU A;  3M6H A;  3VMA A;  4KQR A;  3BEB A;  2ZQC A;  2QZ6 A;  3NIA A;  4FSF A;  5HX9 A;  3ZNY A;  5CHU A;  4KZB A;  3HLB A;  1VQQ A;  5HAP A;  5FAS A;  2WGW A;  4JF5 A;  3O88 A;  3FYZ A;  3OPL A;  2ZMA A;  1J9M A;  3QNC A;  1IYQ A;  3PBO A;  4OP8 A;  5EOE A;  3M6B A;  4S2I A;  1ES4 A;  3BFE A;  4LEN A;  1YT4 A;  4R3B A;  1BTL A;  1NZO A;  3MXS A;  2Y55 A;  3W8K A;  4BL3 A;  1K38 A;  5GL9 A;  1PWG A;  1YMS A;  5FAQ A;  5TGF A;  5DF7 A;  2HP5 A;  3IHA A;  4WZ4 A;  4HES A;  5KSC A;  5KZH A;  1I5Q A;  1HTZ A;  5U47 A;  3JYI A;  5JYO A;  1YLW A;  2Y59 A;  4XUX A;  4XUZ A;  3N7W A;  4EBP A;  1PWD A;  4L0L A;  2QMI A;  1JVJ A;  4MLL A;  1MXO A;  3HUM A;  3IQA A;  4NK3 A;  2ZJ9 A;  3N8R A;  2A3U A;  5CXW A;  4P6B A;  3V50 A;  5GLC A;  3MKE A;  4KEN B;  3UNW A;  3HLC A;  4ZDX A;  2X71 A;  4ZJ3 A;  5EE8 A;  5HL1 A;  1ESU A;  5CRF A;  3HRE A;  3FWL A;  5FDH A;  3BRM A;  2ZM0 A;  2Z2M B;  3HLD A;  4GZB A;  1S6R A;  3S1Y A;  3UE0 A;  4O7D A;  4WBG A;  5HFO A;  3CZD A;  4GB7 A;  1K56 D;  1NZU A;  1LLB A;  4BLM A;  3BFC A;  1KVL A;  5KSH A;  3IF6 A;  4PM7 A;  3GMW A;  3MBZ A;  4HBU A;  4S2K A;  1IKI A;  4S2M A;  3A3D A;  2H0Y A;  1Q2P A;  5E43 A;  2HDU A;  3WS1 A;  4GD8 A;  5E2F A;  2EX9 A;  3G35 A;  4N92 A;  1N9B A;  1SHV A;  2ZC4 B;  3FV7 A;  1FR6 A;  3ZVW A;  4OQH A;  5FI7 A;  5AQ7 A;  4CJN A;  4DXB A;  3UY6 A;  1E25 A;  1GA0 A;  3AGE A;  1K4F A;  4WMC D;  1IKG A;  4QU3 A;  4WEJ A;  5CEC A;  1YMX A;  3AGF A;  3OZH A;  5FAO A;  1O07 A;  3UDX A;  1XA1 A;  1VM1 A;  5M1A A;  3OPH A;  4E3I A;  1WYC A;  4BD0 A;  4KZ4 A;  1CEF A;  2EFU A;  3ZG8 B;  4PM8 A;  3AGD A;  1L2S A;  4C6Y A;  3IWQ A;  4GDN A;  4P0M A;  5M18 A;  4K0W A;  2Y2O A;  3HLG A;  3ITA A;  3NY4 A;  4FH2 A;  4KZA A;  4JF6 A;  3C4P A;  1YLY A;  1HVB A;  4EQI A;  4P85 A;  2XK1 A;  1IEM A;  2J9O A;  3IT9 A;  1NXY A;  5A91 A;  3VOZ A;  3BFF A;  2FFY A;  3SS3 A;  3BFD A;  1BLP A;  4U3T A;  3HBR A;  2WZZ A;  4UA9 A;  4Q8I A;  4JKT A;  4Z9Q A;  2C6W B;  2JC7 A;  1K6S A;  2RL3 A;  1YLT A;  1IYP A;  1FOF A;  1MKI A;  3I7J A;  4OPZ A;  4X53 A;  5E2H A;  3SOI A;  4QY6 A;  2WGI A;  4OON A;  4K0X A;  4S2P A;  2VGK A;  4PMA A;  1G6A A;  3Q81 A;  1JWP A;  3EQU A;  4R4R A;  2J9P A;  4DDS A;  1DJA A;  4ZAM A;  3WRT A;  5DF8 A;  5CGX A;  3VP0 A;  3UPP A;  4JF4 A;  5HAI A;  1S0W A;  4UA7 A;  3UN7 A;  1BSG A;  1Y54 A;  2EFX A;  4HEF A;  2ZD8 A;  3IXH A;  3D4F A;  4LV0 A;  4MEZ A;  1FQG A;  5HW3 A;  5DTT A;  3UE1 A;  2ZQ8 A;  3W4O A;  3CMZ A;  3LO7 A;  3NCK A;  5CHJ A;  3BM6 A;  3OCL A;  4E6X A;  1YLZ A;  4KZ3 A;  1NJ4 A;  2ZM8 A;  1ZG6 A;  4KG2 A;  1K57 A;  3C5A A;  1OME A;  4XXR A;  4BJP A;  4DE3 A;  4EWF A;  4Y0O A;  4GNU A;  3HLW A;  2X02 A;  3NC8 A;  4OPY A;  4QB8 A;  3HLE A;  4RVA A;  2ZC6 B;  4DDY A;  4B88 A;  3ZNT A;  4D2O A;  3ZFZ A;  4C3Q A;  5TFQ A;  5M19 A;  5GHY A;  3P98 A;  3WS2 A;  2XDM A;  5KMW A;  4E3N A;  4JXV A;  1C3B A;  2J7V A;  4IBR A;  3DWZ A;  4EV4 A;  3M2J A;  4R1G A;  5F83 A;  1BZA A;  5E2E A;  3IF6 C;  2XH9 A;  4B4Z A;  1ES2 A;  1U60 A;  1HD8 A;  2OSU A;  1E3U D;  2DCF A;  1G68 A;  3GSG A;  1NYM A;  4OOM A;  4ZJ1 A;  1PI5 A;  2WGW B;  2XQZ A;  3HUN A;  4OP5 A;  3VSK A;  3IXB A;  3VSL A;  2UWX A;  4E6W A;  1XA7 A;  3VP4 A;  1LI0 A;  2PBY A;  3W4Q A;  3TSG A;  4RYE A;  4E3M A;  4PM5 A;  4IVK A;  3SH8 A;  4DXC A;  1W7F A;  1M6K A;  2Y2G A;  3V39 A;  3UDI A;  2PU2 A;  3NDG A;  4HBT A;  1RGY A;  5CGW A;  4KZ5 A;  2EX6 A;  4OPQ A;  4WZ5 A;  5EVL A;  1ZG4 A;  2DNS A;  2HPB A;  2XD1 A;  4ZJ2 A;  2IWD A;  3MFD A;  3O3V A;  2Y2P A;  2XFT A;  1ONG A;  2EXA A;  2EXB A;  3MZF A;  4S2L A;  4E3L A;  1GHP A;  5GLD A;  4OQ0 A;  5TR7 A;  2PU4 A;  2G2U A;  3Q7V A;  4JLF A;  3ZCZ A;  3PBQ A;  1KGG A;  4BEN A;  1FCM A;  4YFM A;  1ZKJ A;  4Y0U A;  1XPB A;  5I94 A;  3O87 A;  3FKW A;  3IHB A;  2BLS A;  3GR2 A;  4QHC A;  4WEL A;  1PI4 A;  3DTM A;  2ZQ9 A;  3IXG A;  3G34 A;  1L0E A;  2WAD A;  5FQ9 A;  3VFF A;  4KQO A;  1MWU A;  1XP4 A;  2IWB A;  3HVF A;  2WUQ A;  1K4E A;  4X69 A;  3Q07 A;  2RCX A;  5EVI A;  3FKV A;  1QME A;  1FSW A;  1GCE A;  1W8Y A;  3IF6 B;  1KE3 A;  1PYY A;  1SDN A;  4U0T A;  3N4I A;  3SH9 A;  1W79 A;  2ZC7 A;  5GHX A;  4S2N A;  2ZQA A;  2VGJ A;  1CI8 A;  1LHY A;  1TDG A;  3QHY A;  4B4X A;  1ALQ A;  2Z2L B;  1Z6F A;  4QY5 A;  5CGS A;  3UO9 A;  1GHM A;  5CEB A;  1TDL A;  1XGI A;  1KE0 A;  1H8Y A;  2WKH A;  1H8Z A;  1K57 C;  2Y2Q A;  4UAA A;  3ZGA B;  3NDE A;  3NBL A;  3WS5 A;  3PBT A;  3G32 A;  5CTN A;  4ZBE A;  3P09 A;  1BUL A;  1KGF A;  1N4O A;  3E2K A;  5GLA A;  3RXW A;  3WS0 A;  1JWZ A;  3V3R A;  3Q7Z A;  4DKI A;  4X55 A;  1JWV A;  3G4P A;  2GDN A;  5CTM A;  4NET A;  2XF3 A;  1L0G A;  1IYO A;  4BL2 A;  4Y0T A;  4OPR A;  3V5M A;  3Q7V B;  4OOL A;  2WYX A;  3A3E A;  1EWZ A;  5FSR A;  2Y2I A;  5HAQ A;  1CK3 A;  2WZX A;  3Q82 A;  2B5R A;  1FR1 A;  2XFS A;  3G2Z A;  3ZG0 A;  1ESI A;  2Y2L A;  3IF5 A;  4UA6 A;  5EUA A;  5FI6 A;  3A3F A;  4KG5 A;  3PBS A;  4WMC A;  5FI2 A;  4FD8 A;  3VP3 A;  3A3I A;  4Y7P A;  1RGZ A;  4N9K A;  1FCO A;  4OQG A;  4WM9 A;  3DW0 A;  1I2W A;  1YLP A;  1SCW A;  3GVB A;  3IWO A;  4F94 A;  3IWI A;  2Y2J A;  5HAR A;  1ERM A;  1CI9 A;  3A3J A;  2OLV A;  4MBH A;  4YIN A;  4FH4 A;  4N1H A;  3O86 A;  2A49 A;  1KGE A;  4OOY A;  4RX3 A;  2OLU A;  5F82 A;  3RXX A;  3EQV A;  4DE2 A;  3N6I A;  5F1F A;  1E4D A;  3G2Y A;  3G31 A;  5EPH A;  2P74 A;  4OVD A;  3VP2 A;  3WS4 A;  4WZ5 C;  1MPL A;  1AXB A;  4N9L A;  1KDS A;  3Q1F A;  3ZG5 A;  4X6T A;  2WKE A;  3WRZ A;  2WAF A;  1BUE A;  2V20 A;  2XR0 A;  5FA7 A;  3IH9 A;  1K56 A;  3B3X A;  3PTE A;  1O7E A;  3S22 A;  2V2F F;  5DTS A;  3LCE A;  2ZQD A;  4QD4 A;  5IHV A;  3SS4 A;  2JE5 A;  1BLS A;  4KZ7 A;  2E8I A;  3FZC A;  4WYY A;  1DJB A;  3MZD A;  2R9W A;  3E2L A;  5EEC A;  1NRF A;  5FQK A;  2XLN A;  4LV2 A;  4S2O A;  4MBK A;  4IVI A;  1GA9 A;  4R23 A;  1YQS A;  1H5X A;  2R9X A;  4GN2 A;  4U0X A;  5A90 A;  3V3S A;  3W4P A;  4JBF A;  1XKZ A;  3UDF A;  2XD5 A;  4H8R A;  5A92 A;  3BFG A;  3N8L A;  4KZ9 A;  1IEL A;  2XEP A;  1IYS A;  2H10 A;  1WYB A;  5FQQ A;  2P9V A;  3BLS A;  3LY4 A;  1JTD A;  1NYY A;  2Q9M A;  3CG5 A;  4PPR A;  2G2W A;  5G18 A;  1MBL A;  3UE3 A;  3PAE A;  3GTC A;  4LV1 A;  3VP1 A;  2P9V B;  1K54 C;  1PZP A;  3HUO A;  1LL9 A;  4JXS A;  2HDS A;  5DTK A;  5EOO A;  3OPP A;  3ZVT A;  1PIO A;  4C75 A;  4PM6 A;  2J8Y A;  2Y2M A;  2ZLY A;  3PAG A;  1EI5 A;  3PBR A;  1YLJ A;  3SS5 A;  4KZ8 A;  1PZO A;  1PWC A;  3CJM A;  4R0Q A;  3WWX A;  4N1X A;  1W5D A;  2EX8 A;  2FFF B;  2BG1 A;  5A93 A;  1KVM A;  3TOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...