4E6WA

Clbp in complex with 3-aminophenyl boronic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
335
structure length
329
Chain Sequence
ERLSTLIHQRMQEAKVPALSVSVTIKGVRQRFVYGVADVASQKANTLDTVYELGSMSKAFTGLVVQILIQEGRLRQGDDIITYLPEMRLNYQGKPASLTVADFLYHTSGLPFSTLARLEAVAQQLRNENLLFAPGAKFSYASANYDVLGAVIENVTGKTFTEVIAERLTQPLGMSATVAVKGDEIIVNKASGYKLGFGKPVLFHAPLARNHVPAAYIHSTLPDMEIWIDAWLHRKALPATLREAMSNSWRGNSDVPLAADNRILYASGWFIDQNQGPYISHGGQNPNFSSCIALRPDQQIGIVALANMNSNLILQLCADIDNYLRIGKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ClbP peptidase
publication title The NRP peptidase ClbP as a target for the inhibition of genotoxicity, cell proliferation and tumorogenesis mediated by pks-harboring bacteria
rcsb
source organism Escherichia coli
total genus 98
structure length 329
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4e6wA00
4N9KA 1BSGA 1I2SA 4N1XA 2RCXA 2ZJ9A 4GKUA 2ZM0A 3PAGA 3SH9A 4OP5A 4R4RA 5EE8A 4E3IA 1RGYA 1PI5A 3JYIA 5GLAA 4GN2A 1W79A 3BRMA 4N92A 2Q9MA 5DF8A 2JCHA 4WEJA 3V3RA 3WS5A 1XP4A 2EX2A 3GRJA 5FI7A 3ZCZA 1EI5A 4S2NC 1IEMA 3C7UA 3O88A 4JF6A 4P0MA 2ZC3B 4FCFA 2EXAA 2ZQ9A 1CK3A 5AQ7A 3FYZA 5DF7A 3BYDA 5CHUA 4KQOA 4KZ4A 5FI6A 5HARA 3IXGA 2E8IA 3UDIA 4YINA 1XGIA 3HLEA 2ZC4B 2OLUA 5HL1A 3ITAA 3BFEA 2J7VA 1KE3A 4LENA 5GHZA 1G6AA 3G35A 3ZFZA 1K6RA 4XUXA 3ITBA 3IXHA 1J9MA 2IWDA 1DJBA 5TFQA 1FOFA 2Y2KA 4WZ5A 4ZAMA 5FQ9A 4OQHA 1K55C 5GLBA 4S2MA 1WYBA 3BLMA 3OC2A 1ZKJA 2OV5A 4R3BA 1GA9A 3VP1A 4GD6A 1IELA 3M2JA 4E6WA 4C75A 3PAEA 3GQZA 1L0GA 4BL2A 3N8RA 4L0LA 1XXMA 4FH4A 1ERQA 3FV7A 3GTCA 5E2FA 1MWTA 4IVKA 2XLNA 4LV1A 5CEBA 4X69A 5EECA 3IXDA 3MFDA 5M1AA 4DE2A 1CEGA 4XXRA 4E3KA 1NJ4A 5KSCA 3VOYA 4FH2A 4JXVA 3MKEA 2RL3A 3BFCA 2P9VA 2Y2IA 3NY4A 3HLGA 3ZHHA 2BLSA 2XEPA 3LY4A 3ZG8B 2WZXA 2ZM8A 3LO7A 4S2OA 1HVBA 1MWRA 4K0XA 4MBHA 1PW8A 4Y0OA 5E43A 1WYCA 3BECA 1VM1A 5FQKA 3GR2A 4R1GA 4HBTA 4ZJ1A 3Q7ZA 4IEDA 1BLCA 1PZPA 3MZFA 2X01A 4MNRA 1W7FA 3GMWA 5L2FA 4OONA 3V3SA 5HW3A 3VP4A 2XD1A 3NI9A 4DE0A 5TR7A 4DE1A 5FAQA 2DNSA 5CXWA 1HTZA 5F1FA 5CGSA 3ZG5A 4BENA 5FATA 3EQUA 4OH0A 1MXOA 3HBRA 3WRZA 4B88A 1RGZA 2WYXA 5CGXA 1W8QA 1TDGA 2QPNA 4OPQA 4OOYA 2Z2LB 5G18A 3CZDA 5HAPA 4WMCA 4QB8A 3UE3A 1LI0A 3HLFA 3G34A 5HFOA 3UE1A 4P87A 2P74A 3MZEA 4KG6A 2WKEA 1SHVA 4UA7A 4E3MA 4CJNA 1BLPA 2Y2LA 3C5AA 3NC8A 5EVID 1KVLA 4UAAA 2R9XA 3SH8A 3WS1A 4OQIA 1GHPA 1PI4A 2J9PA 4S2KA 2XQZA 3A3JA 4KG2A 3PBTA 1BTLA 3S22A 2WKHA 4KZBA 4LCLA 4NETA 1TEMA 1MPLA 2JE5A 2QMIA 2ZQCA 4OLDA 4KZ6A 1JWZA 1LL9A 1XKZA 2Q9NA 4DRTA 2CC1A 3IF5A 1MWUA 1IKIA 1NYYA 2H5SA 4X68A 3O87A 3QHYA 3Q82A 1K57A 3CMZA 1YLTA 3DWKA 1MBLA 1GA0A 2C6WB 1ERMA 4HBUA 3DTMA 5KZHA 3P09A 4GDNA 4KZ7A 1GHIA 1MWSA 1KDWA 4KZ9A 4LV2A 4KQRA 2EFXA 4RX2A 4JPMA 3V50A 3WS2A 1CI8A 5GLCA 3N4IA 1RCJA 4GDBA 4U3TA 3UDFA 1YLPA 4R0QA 3V5MA 4MLLA 5M18A 1JTDA 1VQQA 3ZVWA 3SS5A 1ZG4A 1ZG6A 1YLYA 5TGFA 3TG9A 1KDSA 3W4QA 1ESIA 2EX6A 1I2WA 3SS4A 3HREA 1GHMA 3Q07A 1FCNA 1FSWA 3A3EA 5GHXA 3VSLA 4WZ5C 4EV4A 1OMEA 3IHAA 4OPYA 3V39A 4OLGA 4E3LA 4FSFA 5D3OA 4C3QA 3WWXA 3A3DA 3LEZA 5CECA 1M40A 5EOOA 3Q7VA 1IYQA 2J9OA 4MBFA 3Q81A 5FA7A 2EX9A 1LHYA 2ZQDA 4O7DA 3P98A 1GCEA 1NXYA 4E3JA 2VGJA 4BL3A 4K0WA 3VFHA 1S6RA 5GHYA 5CTMA 4NK3A 3VP2A 3IH9A 3C4PA 3IWQA 3NCKA 2HP9A 3S1YA 4HESA 1ES5A 3W4OA 4BQMA 3I7JA 3CG5A 4LV0A 4R23A 5F1GA 3PBOA 5FQIA 2ZMAA 5EVIA 4BLMA 3UO9A 3AGDA 4H8RA 4GOGA 1HD8A 1WE4A 4QY6A 5AQAA 2EX8A 1JWVA 4LV3A 4EQIA 4OOLA 2Y2MA 5FASA 4WM9A 2Y59A 5E2EA 3HUOA 2ZC6B 3C7VA 4ID4A 2PBYA 4JKTA 4WZ4A 1PW1A 2P9VB 5EUAA 3UPOA 5CRFA 3NDEA 3Q1FA 2ZC7A 3MZDA 2V1ZA 3OPRA 3SS3A 1CEFA 1E3UD 1K54A 1K56D 5I94A 1YLWA 1DY6A 1QMEA 2WUQA 3EQVA 4QD4A 2V20A 3M6BA 5F82A 5E2HA 3VP0A 2C5WB 1Y54A 2XH9A 5KMWA 1N4OA 2XFSA 1O07A 4X53A 4ZTKA 1ALQA 5FQQA 2WGWA 2UWXA 3HVFA 3A3IA 4WBGA 1AXBA 2DCFA 1XX2A 3G4PA 4U0XA 5DTTA 1EROA 3QNBA 2Y2GA 2OLVA 2HDRA 2HDQA 3PTEA 4UA6A 2IWCA 3G2ZA 1IKGA 3ZNTA 1SDNA 4ZJ2A 1YQSA 1TVFA 5A92A 3OCLA 5CEDA 1K6SA 5FAOA 2HPBA 1SCWA 4DDYA 3ZG0A 2WK0A 2ZM2A 2WGIA 4JXWA 4ZDXA 3VP3A 4GD8A 2EXBA 4HEFA 4EUZA 2Z2MB 5DTKA 3CJMA 1DJAA 3GSGA 3IQAA 4PM9A 4EWFA 3IH8A 5M19A 4WYYA 3MXRA 3HUMA 3G2YA 4JLFA 4OVDA 1NZUA 2XDMA 3LY3A 3NDGA 1K4EA 5FAPA 1K57C 2EFUA 1L0FA 4Y0TA 5FI2A 1NY0A 3FWLA 2HDUA 4MBKA 1ES3A 3BFDA 1PWDA 1K25A 1H5XA 5A91A 4GNUA 1CI9A 5A90A 2BG1A 2ZQ7A 4CPKA 3BM6A 4RX3A 4ZBEA 4KENB 2H0YA 2Y2QA 4DE3A 2A49A 2HP6A 3IF6B 4N1HA 4S2LA 3IF6A 4E3OA 3AGFA 2H10A 3ISGA 4KZ5A 4JBFA 1ONGA 3O86A 2A3UA 3HL9A 5EOEA 3ZVTA 3UPPA 2Y55A 1RP5A 3OPHA 2DRWA 3OZHA 3VSKA 3G31A 1BZAA 3IT9A 5FQMA 2Y2PA 1PWCA 3UDXA 2FFFB 4LCMA 4RYEA 2PU2A 3ZG9B 3NBLA 1NRFA 5GL9A 5EPHA 1E3UA 1ONHA 3G32A 3HLWA 1LI9A 3BLSA 4JXSA 5F83A 3OPPA 4KG5A 5KSHA 3DW0A 2ZD8A 5JYOA 1LLBA 3UY6A 3IHBA 4IBRA 1XGJA 2WAEA 1L2SA 4OKPA 4Y0UA 3IWIA 2XK1A 1SKFA 3GV9A 1FQGA 3Q7VB 4KQQA 1H8YA 2PU4A 2FFYA 3BFFA 2IWBA 1NZOA 3WS4A 4BD1A 1YLZA 5CTNA 1ES2A 2Y2OA 5EVIC 1O7EA 3SOIA 4X56A 3N8LA 4BD0A 1L0EA 3LCEA 3RXXA 2HDSA 4OPZA 2I72A 2WADA 4UA9A 4KZ8A 2JBFA 2VGKA 1FR6A 1MY8A 4OOMA 4U0TA 1KE4A 1KGGA 5EVLA 3C4OA 4S2JA 3ZG7B 1IYOA 3DWZA 4Q8IA 3NIAA 3UN7A 2QZ6A 3PBNA 4RVAA 4Z9QA 5EVIB 3UNWA 1C3BA 2ZC5B 3ZGAB 2XD5A 4WMCD 4QHCA 4E6XA 1IYSA 1ZC2A 4DDSA 4S2NA 1FCOA 2ZLYA 1G68A 3FKWA 4KZ3A 4PM6A 1K54C 1KVMA 4QU3A 3ZNYA 3MBZA 1L0DA 2Y91A 3MKFA 4R3JA 4EBPA 3ZDJA 3PBQA 5J8XA 3PBSA 4RA7A 3W8KA 1BUEA 4S2IA 4KZAA 4P6BA 4Y7PA 5HAIA 1Q2QA 1Z6FA 3E2KA 2WGVA 2Y2JA 3B3XA 2WAFA 4OQ0A 1K38A 4IBXA 3OCNA 1YMSA 2H0TA 4JF5A 1YMXA 4DXCA 5IHVA 3HLBA 1K4FA 1YLJA 2ZQAA 5A93A 2JC7A 1FSYA 3IWOA 2G2UA 2HP5A 3FKVA 2X02A 1K55A 4OP8A 5HAQA 2Y2NA 2ZQ8A 4E3NA 4P85A 1XA7A 2G2WA 2WGWB 2V2FF 1W8YA 1IYPA 4UHUA 1XA1A 4K91A 5FSRA 3BFGA 4DF6A 3FZCA 4JF4A 5CHJA 3O3VA 5JYPA 3QNCA 4GZBA 3PBRA 4PM8A 4EBLA 4WELA 4WEKA 3W4PA 4OQGA 1KGEA 1S0WA 3N6IA 1U60A 2XGNA 4GB7A 3S4XA 2XR0A 4XUZA 1PWGA 5U47A 1PIOA 3BEBA 5DVAA 2XFTA 4ZJ3A 4B4XA 5DF9A 2B5RA 3VMAA 4QJGA 4BJPA 3IXBA 1E25A 4DKIA 1HZOA 2R9WA 5DTSA 3M6HA 1NYMA 1BLSA 2WZZA 4X6TA 1BLHA 3RJUA 4B4ZA 1DJCA 5E2GA 1FR1A 2J8YA 4OPRA 3VOZA 1YM1A 2Y2HA 3E2LA 4MEZA 3TOIA 5BOHA 3VFFA 1QMFA 3UE0A 3IF6C 1N9BA 2XF3A 4M3KA 5CGWA 4QY5A 1JWPA 4JXGA 1KGFA 1JTGA 4EBNA 3D4FA 3TSGA 3N7WA 1BULA 1XPBA 1I5QA 2GDNA 3WS0A 1E4DA 3A3FA 1KE0A 5FQJA 1EWZA 3HLCA 2WKIA 4A5RA 2OSUA 1M6KA 2Y4AA 1JVJA 1MKIA 1ESUA 1Q2PA 4D2OA 4N9LA 4DXBA 1BT5A 1PYYA 4R4SA 3SH7A 4PM7A 4S2PA 4F94A 3HUNA 4IVIA 3RXWA 4YFMA 4C6YA 3UPNA 1LL5A 3M2KA 1ES4A 5CHMA 5AQ9A 5HX9A 5CERA 3N8SA 4PM5A 1PZOA 5AQBA 5GLDA 4PMAA 3G30A 3OPLA 4FD8A 3MXSA 1K56A 4X55A 3WRTA 1YT4A 1FCMA 1H8ZA 1TDLA 3HLDA 2X71A 1W5DA 1SDEA 3GVBA 3AGEA 4PPRA 5FDHA
chains in the Genus database with same CATH superfamily
3TRCA 2ZM0A 2J80A 3LI8A 1RGYA 2WKQA 1H3QA 4NXFA 4WEJA 4HNBA 1XP4A 2EX2A 3WS5A 3C38A 1EI5A 3C7UA 3E4QA 4IJGA 2EXAA 2ZQ9A 1CK3A 2A24A 3BYDA 2XA7S 4KZ4A 3LUQA 3UDIA 1KE3A 3IS2A 5IU1A 5GHZA 3DBAA 1G6AA 3G35A 1FILA 1K6RA 3H9WA 3L9KA 2K7SA 2M7UA 4WZ5A 5FQ9A 4S2MA 1WYBA 3BLMA 2V0UA 5HSQA 2OV5A 4R3BA 4GD6A 4HP4A 3B42A 1L0GA 3GQZA 1XXMA 4FH4A 1ERQA 3FV7A 3GTCA 3ICYA 1MWTA 2W3DA 5EECA 5M1AA 2OAQ1 3T4LA 1JNUA 3VOYA 4FH2A 2RL3A 2P9VA 3B33A 3NY4A 2V8CA 3HLGA 1GSWA 3LY4A 3ZG8B 1MWRA 4HH3A 1PW8A 3BECA 3LICA 4R1GA 4JGOA 4IEDA 2X01A 4MNRA 1N9LA 3V3SA 5HW3A 3VP4A 5CXWA 4OH0A 4O8GA 1S1ZA 3WRZA 4B88A 2WKPA 4L9GA 5G4ZA 1TDGA 4OPQA 3HCYA 1Y28A 5IS1A 3MZEA 3RH8B 2B95A 3C30A 5EVID 4OQIA 2J9PA 2PYPA 2XQZA 3PBTA 1VHMA 3S22A 4LCLA 3LR0A 2ZQCA 3PR6A 4KZ6A 1LL9A 2QWSA 4QPRA 1MWUA 1NYYA 2H5SA 3Q82A 3C2WA 3CMZA 1YLTA 5KZHA 1ERMA 2Y79A 3P09A 4GDNA 2ZOHA 1MWSA 4KZ9A 4LV2A 3NOUC 3FPWA 5GLCA 3LIAA 4GDBA 4R0QA 1ZG6A 4GW9A 3QP8A 3ULFA 2EX6A 3A3EA 5GHXA 3VSLA 2M1CA 4WF0A 4E3LA 3A3DA 3LEZA 5EOOA 3Q81A 3MS6A 1NXYA 2VGJA 5CTMA 3VP2A 4HH2A 1OTBA 4HESA 3T4JA 2Y8HA 5EVIA 5J3WA 2KLIA 4BWIA 5F68A 1WE4A 5DKKA 4QY6A 2J3TC 5AQAA 1JWVA 1T18A 2Y2MA 2Y59A 1DP9A 3C7VA 4LGWA 4BBVA 2AVXA 1GSVA 4EU0A 5CRFA 3T4SA 2V1ZA 1SZVA 1F5MA 3SS3A 1CEFA 1D1JA 2ZBBA 1OTAA 1K54A 2V8FA 1DY6A 1QMEA 2O9CA 3EQVA 1Y54A 2JKRM 1N4OA 1O07A 3MXQA 3HVFA 3A3IA 4U0XA 1W63M 4I38A 1YQSA 1T1AA 2KOIA 3OCLA 5EVEA 2OAP1 2WK0A 2ZM2A 3T1SA 3F1OA 2JKGA 3IQAA 4EWFA 3R4KA 3IH8A 3G2YA 3L7HA 4JLFA 4OVDA 1WA9A 2EFUA 5FI2A 3LR5A 1ES3A 4LPZA 4ZRRA 3LYXA 1XFNA 3KX0X 2BG1A 2ZQ7A 3MJQA 4KENB 2H0YA 3IF6B 1UWPX 3IF6A 4E3OA 4Y5FA 3A0VA 3ISGA 5EOEA 4M4XA 3CUEC 3DTEA 5DFYA 2DRWA 3G31A 1BZAA 3IT9A 3FPVA 2VX8A 3NBLA 4JXSA 3KO6A 4KG5A 2PD8A 5TJJA 3LI9A 3GDIA 4WUJA 1L2SA 2XK1A 2PD7A 3WS4A 5CTNA 3KYEA 1O7EA 3SOIA 4BD0A 4XT2A 4OPZA 4II7A 2WADA 2VGKA 4U0TA 4EQ1A 1KGGA 3C4OA 2UV0E 3MSHA 3ZGAB 2XD5A 4WMCD 4E6XA 1IYSA 2W1RA 1ZC2A 5L8MA 1MZUA 4CLCE 2B18A 1FIKA 5CX7A 4UQIM 4KZ3A 4QU3A 2Y91A 4R3JA 2NUTC 3PBQA 3W8KA 4KZAA 4EEPA 1Q2QA 1PFLA 3CPTB 3B3XA 3CPTA 4GS9A 1TF1A 1YLJA 3CITA 2W3FA 2HP5A 4OP8A 2Y2NA 2PHYA 4WN5A 4P85A 3JVUA 2G2WA 4H6JB 2V2FF 1W8YA 3FZCA 4PKYA 2ZMVA 2EA9A 2JKTM 5AVFA 4CLCB 4CLCA 1STZA 4OQGA 3PHYA 2XR0A 3BEBA 4KUKA 4ZJ3A 1TS6A 4B4XA 4ETZA 2B5RA 2R9WA 3V67A 4X6TA 4LFUA 4B4ZA 2J8YA 3VOZA 2INWA 3TOIA 3VFFA 4YOFA 2VZWA 4M3KA 5CGWA 1KGFA 3D4FA 3N7WA 5I5LA 2GDNA 1E4DA 1EWZA 4A5RA 2OSUA 1JVJA 1TS8A 3EGXC 3E4OA 1PYYA 4PM7A 3K3CA 4IVIA 3SZTA 4YFMA 5HDDA 4C6YA 5HX9A 5CHMA 5LBRA 2XA7M 1YPRA 4I3JA 4X55A 4DE2A 3AGEA 4ARZA 1P0ZA 4N9KA 1I2SA 5F5YA 5AVEA 2RCXA 2ZJ9A 4E3IA 3SH9A 3JYIA 5GLAA 3MR0A 1W79A 3H7WB 4N92A 5DJTA 1OJ5A 3GRJA 4S2NC 2ZC3B 1P9WA 3B47A 4EUVA 5HARA 5FI6A 4KQOA 3IXGA 2E8IA 3A0SA 4YINA 5HL1A 3VV4A 3ITAA 3BFEA 2J7VA 3IXHA 2HZ5A 1J9MA 1FOFA 4FTXA 2K31A 1TS0A 3FG8A 1K55C 4MMNA 4RQ9A 1ZKJA 3LR3A 3M2JA 2V0WA 4C75A 5E2FA 4LV1A 4D60A 1P9RA 3MFDA 1CEGA 2H28A 1NJ4A 2Y2IA 3DAVA 3T12B 1MC0A 3LO7A 5E43A 1HVBA 4MBHA 4HBTA 3BW6A 1BLCA 3MZFA 1IOUA 3UB6A 2ACGA 2XD1A 4G3KA 4HP9A 3NOTC 2DNSA 1OTIA 1HTZA 5F1FA 5CGSA 2VV6A 4JGRA 5L07A 1H0MA 3IX8A 5CGXA 2QPNA 5G18A 1HLUP 5HFOA 5J7EA 2WKEA 1SHVA 4E3MA 3SH8A 2Y2LA 3C5AA 3WS1A 4UAAA 2CMNA 1GHPA 4KG2A 3VOLA 4KZBA 2JE5A 1DRMA 2QMIA 4OLDA 3JVVA 2Q9NA 3IF5A 4GHIA 1IKIA 3NJAA 3QHYA 4HBUA 1GHIA 4RX2A 1KDWA 4KQRA 3TE8A 4JPMA 5C5KA 2PRFA 4UEYA 3EWKA 4I3IA 5TGFA 1F9IA 1GHMA 2O99A 1FSWA 2A24B 3T4OA 3IHAA 4OPYA 5D3OA 4C3QA 3IS2B 1M40A 4MBFA 5FA7A 1LHYA 1KOUA 4DJ3A 3P98A 4P6ZM 3HJIA 1S6RA 1N9NA 4NK3A 3NCKA 2HP9A 4L9EA 3W4OA 2FZ0A 4BQMA 5F1GA 2G7UA 2ZMAA 4HJ6A 1A0KA 4H8RA 4Y13A 2VK3A 3CI6A 4NXGA 3EEHA 4LV3A 2Q0OA 3HUOA 4JKTA 4WZ4A 1S4RA 2P9VB 3UPOA 2EWVA 3MF0A 3MZDA 1F2KA 3OPRA 3EGDC 5I94A 2BASA 3M6BA 2C5WB 4EXOA 3KYZA 2XFSA 3QP5A 1ALQA 4G3VA 1XX2A 3G4PA 1EROA 4F3LA 1CJFA 4MN5A 3PTEA 2IWCA 1SDNA 1OTEA 3CWFA 3H82A 1TVFA 4IUKA 1K6SA 5TBMA 3ZG0A 4CQHA 2OWJA 4B93A 2EXBA 3TW8A 5M19A 3HUMA 4EEUA 3NDGA 1K4EA 1K57C 2VJWA 4Z1WA 3BFDA 1PWDA 4LRXC 1H5XA 4GNUA 3RFBA 3EEAA 4EETB 3BM6A 3S7PA 4ZBEA 5DKLA 4DE3A 1VB6A 4KZ5A 3ZVTA 3UPPA 1NLZA 3OPHA 3U2AA 3LGOA 3OZHA 3MMHA 3VSKA 3T4QA 1XFQA 3LIDA 1PWCA 2FFFB 2GNXA 4RYEA 2PU2A 3ZG9B 2FH5A 2JKRI 5GL9A 5EPHA 3HLWA 4EW7A 5F83A 3BLSA 3NOPC 1L3LA 5L10A 5JYOA 3P7NA 3IHBA 3FC7A 4IBRA 1XGJA 4ME4A 2LB9A 1SKFA 3GV9A 1BYWA 1FQGA 2IWBA 4BD1A 4DJ2A 1YLZA 3KSHA 3QP4A 3BY8A 1AWIA 3DTKA 3ZG7B 1IYOA 3DWZA 4Q8IA 3NIAA 3UN7A 2QZ6A 3PBNA 4RVAA 4Z9QA 5EVIB 3UNWA 4QHCA 4R70A 2O9AA 2ZLYA 5J8XA 3PBSA 1Z6FA 1VETA 2Y2JA 1K38A 4IBXA 4DXCA 3HLBA 1K4FA 3BQAA 4Y2FA 5A93A 3E98A 2G2UA 4MCWA 1T1BA 1D06A 3BFGA 3MQOA 4DF6A 4Y3IA 5JYPA 4GZBA 3KYQA 4EBLA 3W4PA 2XRNA 1KGEA 1S0WA 4YNRA 4XUZA 1TD5A 5U47A 1PIOA 3UB7A 3F1OB 4QJGA 3VMAA 3IXBA 3ZYTA 3D9YA 1HZOA 3M6HA 2LB5A 1NYMA 1YSPA 3TJZC 1DJCA 2W0NA 2L0WA 3BWLA 4MEZA 1ZHHB 4X1MA 4YWZA 2JKFA 4JXGA 2ZOIA 4EBNA 1F98A 1BULA 3WS0A 3OOVA 3A3FA 1Q2PA 2ZL1A 4N9LA 1S66L 3SH7A 4S2PA 3NHQA 1Y4OA 4WL9A 3UPNA 1LL5A 5CERA 1SKOA 3N8SA 3LEQA 5GLDA 1V9YA 4FD8A 1FCMA 2J3TD 3ZHHA 3GVBA 4PPRA 2JKTI 4ZDXA 1BSGA 4N1XA 3E0YA 3PAGA 4R4RA 1PI5A 2K2NA 4GN2A 2HJEA 5K5BA 4XT2B 3ZCZA 1IEMA 4FCFA 5AQ7A 5DF7A 5FEGA 2J3WA 1XGIA 4HOIA 1XJ6A 2ZC4B 3KSFA 4PKYG 3ZFZA 4XUXA 3ITBA 5KIZA 1NWZA 2Y2KA 4ZAMA 4OQHA 3T50A 4NXEA 3OC2A 5HD5A 1Z09A 3VP1A 4GS9B 3U4LP 3HJKA 4BL2A 4R38A 4X69A 4GJ4A 3IXDA 1NLYA 1LT0A 2XSSA 4JXVA 3D72A 5HPFA 2W3HA 2BLSA 2IA2A 2WZXA 4S2OA 3LIBA 5FQKA 3OLOA 3GR2A 2HGVA 2PYRA 3Q7ZA 5FDSA 2NUPC 1PZPA 3UMDA 2VV7A 1W7FA 3K2NA 1GSXA 3NI9A 3ZG5A 4X1LA 3EQUA 3HBRA 1RGZA 1G28A 1XJ2A 4OOYA 3SW1A 3BJNA 5HAPA 4WMCA 4QB8A 3HLFA 3G34A 3UE1A 1S1YA 4KG6A 1S67L 4UA7A 1BLPA 1N9OA 4NG2A 1D7EA 2R9XA 4HHDA 4S2KA 3A3JA 1BTLA 1VEUB 1G6OA 1VEUA 2HF6A 3T1RA 1LSXA 4X68A 1IFQA 3O87A 2KDKA 3IX4A 3DWKA 3DTIA 1MBLA 4ARZB 1GA0A 2I9VA 3S7NA 3DTMA 4ETXA 4KZ7A 3VE4A 3N4IA 1RCJA 3UDFA 2GJ3A 4MLLA 1VQQA 1ZG4A 3TG9A 4LRYC 1KDSA 3T1XA 1ESIA 5F69A 4LRZE 3SS4A 1I2WA 3HREA 3Q07A 1FCNA 3CUEA 2VGLS 1OPXA 4WZ5C 2O9BA 4FSFA 5J4EA 3WWXA 1T19A 5CECA 3Q7VA 2J9OA 4Q0JA 2ZQDA 4E04A 4E3JA 5HZHA 4K0WA 2A2LA 5GHYA 3IH9A 3C4PA 3IWQA 3UB9A 2QKPA 3KSIA 1YAXA 4R23A 3CG5A 4LV0A 2PDRA 3PBOA 4MN6A 5FQIA 4BLMA 3UO9A 3AGDA 3LIFA 2KX6A 1TS7A 4EQIA 4OOLA 4WM9A 5E2EA 2ZC6B 2PBYA 2Z6DA 1PW1A 3Q1FA 3OBFA 2ZC7A 5F6AA 2QJ7A 1E3UD 3UB8A 5HWVA 1K56D 1YLWA 5F82A 3VP0A 2V20A 5E2HA 2XH9A 4GLQA 5KMWA 2WGWA 2UWXA 4WBGA 3GECA 3QNBA 2Y2GA 5HWWA 2HDQA 4UA6A 3G2ZA 1IKGA 3ZNTA 4ZJ2A 2L1MA 3PXPA 5A92A 1OTDA 5FAOA 2HPBA 4DDYA 2MJ6A 2WGIA 3K3DA 4HEFA 4EUZA 3CJMA 1DJAA 3C8CA 3GSGA 2XROA 3A0RA 2XDMA 4Y0TA 1K25A 5A91A 4I5SA 5A90A 4CPKA 4GHIB 4RX3A 2A49A 4HIAA 4ESPA 2L4RA 3AGFA 2H10A 4JGPA 4JBFA 1ONGA 3O86A 2A3UA 3IBRA 2Y55A 1RP5A 4MDZA 2Y2PA 4LCMA 1XJ3A 3S7QA 1NRFA 1E3UA 1LI9A 3OPPA 5KSHA 3DW0A 2PBDP 4WLAA 1W63Q 4KQQA 3JPUA 1H8YA 3BFFA 2FFYA 1NZOA 1UGUA 1ES2A 1ZTUA 5EVIC 4X56A 3N8LA 1L0EA 2HDSA 3D3OA 2I72A 4UA9A 3UB5P 2JBFA 1FR6A 5EVLA 1C3BA 2ZC5B 1XJ4A 2Z6CA 4X25A 4DDSA 4S2NA 1FCOA 3FKWA 4DMZA 4PM6A 1K54C 3ZNYA 3MBZA 1BUEA 5EV0A 4AFIA 4Y7PA 2DMWA 2QYBA 3E2KA 2WGVA 1OT6A 2WAFA 3KSGA 1YMSA 2H0TA 1YMXA 2ZQAA 1FSYA 3IWOA 5L09A 1T1CA 1P97A 3PYPA 3FKVA 2X02A 1DP8A 1K55A 2ZQ8A 2P08A 4UHUA 1XA1A 4F3LB 2PR6A 4JF4A 3O3VA 3QNCA 3PBRA 3H82B 4PM8A 4I39A 4WELA 5TBMB 4PAUA 3N6IA 3S4XA 3QP1A 5DVAA 5DF9A 4BJPA 5DTSA 4MN7A 3EOIA 1BLSA 2WZZA 1LSWA 2V1BA 1OJGA 1FR1A 4Y17A 2Y2HA 3E2LA 5BOHA 1YKDA 3IF6C 2XF3A 3G6OA 4QY5A 1JTGA 3ZQ5A 1XPBA 1I5QA 1KE0A 5FQJA 2WKIA 3BQ8A 1M6KA 1MKIA 1ESUA 4NXBA 1ODVA 1BT5A 3UE6A 4I3AA 2O0YA 4DN0A 3M2KA 1ES4A 1PZOA 3CHWP 3OPLA 3MXSA 3WRTA 2M7VA 3HLDA 1TDLA 2X71A 5AJGA 5IT5A 5FDHA 5FEFA 4GKUA 4OP5A 5EE8A 3IX3A 3BRMA 2Q9MA 5DF8A 2JCHA 3V3RA 5FI7A 3O88A 4JF6A 4P0MA 1J3WA 3FYZA 3T1QB 5CHUA 4Q0HA 2VEAA 4LLOB 3HLEA 3QP2A 2OLUA 4FOFA 4LENA 1EW0A 2IWDA 1DJBA 3O5YA 5TFQA 2JHEA 4JGQA 4PHTA 3BY9A 5GLBA 2HJ9C 3MQQA 1VETB 1NRJA 1GA9A 3F1NB 1IELA 4E6WA 3F1NA 5FL3A 3PAEA 1X0OA 3N8RA 4L0LA 4CLCC 1S4SA 4IVKA 2XLNA 3T4TA 5CEBA 3CLOA 2JN7A 1H8MA 3E4PA 4XXRA 1CQAA 2VLGA 4E3KA 5KSCA 3MKEA 1DP6A 4P6ZS 3BFCA 5HWTA 2XEPA 2WKRA 2ZM8A 2HV1A 3NULA 4K0XA 4Y0OA 1WYCA 1VM1A 4ZJ1A 3GMWA 2PT7A 5L2FA 4OONA 4DE0A 5TR7A 4DE1A 5FAQA 4BENA 5FATA 2PAVP 1MXOA 4Y15A 2WYXA 1W8QA 2Z2LB 3CZDA 3UE3A 4NEED 1LI0A 2P04A 2P74A 4P87A 2ZL1B 4CJNA 3NC8A 1KVLA 1PI4A 3MQ0A 3MFXA 2WKHA 4NETA 1TEMA 1LL8A 1MPLA 1SKOB 3QP6A 2VGLM 1JWZA 1XKZA 4DRTA 2CC1A 1OT9A 1K57A 4L9FA 2C6WB 3V50A 2EFXA 3WS2A 1CI8A 4U3TA 1YLPA 3V5MA 5M18A 1JTDA 3ZVWA 3SS5A 1YLYA 5HDCA 3W4QA 4CLCD 1PRQA 4EV4A 1OMEA 3V39A 4OLGA 5G4YA 1IYQA 2EX9A 1ACFA 4O7DA 1GCEA 4BL3A 3VFHA 3S1YA 1ES5A 2P7JA 4IHQA 3I7JA 3CAXA 3LR4A 2YKHA 4GOGA 1HD8A 2EX8A 4R3AA 2R78A 3VE3A 5FASA 4ID4A 5EUAA 2BTFP 3NDEA 1YSQA 5A8BA 4FUWA 2WUQA 4QD4A 4BBTA 4X53A 4ZTKA 5FQQA 4H6JA 5HD3A 3RTYA 1AXBA 2DCFA 3T4KA 5DTTA 4Q0IA 2OLVA 5HDSA 2HDRA 2QJ5A 2YKFA 5CEDA 1SCWA 4JXWA 3VP3A 4GD8A 2B02A 2Z2MB 5DTKA 4PM9A 2GZAA 4WYYA 3MXRA 1NZUA 3LY3A 5FAPA 1L0FA 4QWOA 1NY0A 3FWLA 2HDUA 4MBKA 4HJ3A 2W27A 4R6LA 1CI9A 5HL6A 2Y2QA 4HY8A 2HP6A 4S2LA 3LFVA 4N1HA 3P01A 5EFWA 5HPIA 4O01A 3HL9A 2ZMFA 4BMWA 5FQMA 3UDXA 1ONHA 3G32A 2ZD8A 1MKMA 1LLBA 3UY6A 3F1PB 2E8JA 3F1PA 2WAEA 4OKPA 4K08A 4Y0UA 3IWIA 3Q7VB 5EM1A 2PU4A 2D02A 2D01A 4BBUA 2V9AA 2EWWA 2Y2OA 3H7WA 3LCEA 3RXXA 4GCZA 4KZ8A 1MY8A 4OOMA 1KE4A 4S2JA 2OWHA 4B9OA 2QHKA 1G68A 4G3WA 4O0PA 2GX5A 2W1TB 1KVMA 2W1TA 1L0DA 3UMEA 3MKFA 4EBPA 3ZDJA 4RA7A 4S2IA 4P6BA 5HAIA 4OQ0A 3S7OA 4JF5A 3OCNA 5IHVA 4KUOA 2JC7A 2V1AA 3R7WB 3R7WA 5HAQA 3LIEA 4E3NA 1XA7A 1LSVA 2VKSA 2WGWB 1IYPA 5FSRA 4K91A 5DJUA 5CHJA 4UQIS 4HQAA 4WEKA 1K0KA 1U60A 2XGNA 4GB7A 1PWGA 2VA0A 1PNEA 2W3GA 2VV8A 2XFTA 4EESA 1E25A 4DKIA 1BLHA 4HI4A 3RJUA 5E2GA 4OPRA 1YM1A 4IUHA 1QMFA 3UE0A 1N9BA 1JWPA 2W3EA 2OOLA 1V9ZA 3TSGA 4EERA 5MC7A 3NECA 3HLCA 1G5UA 4HJ4A 2Y4AA 4D2OA 1UWNX 4DXBA 5EM0A 5DFXA 4R4SA 4F94A 3HUNA 3W2ZA 3RXWA 2PR5A 5AQ9A 4PM5A 5AQBA 4NKPA 4PMAA 3G30A 1K56A 4KQDA 1CF0A 1YT4A 3IBJA 1H8ZA 1W5DA 1SDEA
chains in the Genus database with same CATH topology
4N9KA 1BSGA 1I2SA 4N1XA 2RCXA 2ZJ9A 4GKUA 2ZM0A 3PAGA 3SH9A 4OP5A 4R4RA 5EE8A 4E3IA 1RGYA 1PI5A 3JYIA 5GLAA 4GN2A 1W79A 3BRMA 4N92A 2Q9MA 5DF8A 2JCHA 4WEJA 3V3RA 3WS5A 1XP4A 2EX2A 3GRJA 5FI7A 3ZCZA 1EI5A 4S2NC 1IEMA 3C7UA 3O88A 4JF6A 4P0MA 2ZC3B 4FCFA 2EXAA 2ZQ9A 1CK3A 5AQ7A 3FYZA 5DF7A 3BYDA 5CHUA 4KQOA 4KZ4A 5FI6A 5HARA 3IXGA 2E8IA 3UDIA 4YINA 1XGIA 3HLEA 2ZC4B 2OLUA 5HL1A 3ITAA 3BFEA 2J7VA 1KE3A 4LENA 5GHZA 1G6AA 3G35A 3ZFZA 1K6RA 4XUXA 3ITBA 3IXHA 1J9MA 2IWDA 1DJBA 5TFQA 1FOFA 2Y2KA 4WZ5A 4ZAMA 5FQ9A 4OQHA 1K55C 5GLBA 4S2MA 1WYBA 3BLMA 3OC2A 1ZKJA 2OV5A 4R3BA 1GA9A 3VP1A 4GD6A 1IELA 3M2JA 4E6WA 4C75A 3PAEA 3GQZA 1L0GA 4BL2A 3N8RA 4L0LA 1XXMA 4FH4A 1ERQA 3FV7A 3GTCA 5E2FA 1MWTA 4IVKA 2XLNA 4LV1A 5CEBA 4X69A 5EECA 3IXDA 3MFDA 5M1AA 4DE2A 1CEGA 4XXRA 4E3KA 1NJ4A 5KSCA 3VOYA 4FH2A 4JXVA 3MKEA 2RL3A 3BFCA 2P9VA 2Y2IA 3NY4A 3HLGA 3ZHHA 2BLSA 2XEPA 3LY4A 3ZG8B 2WZXA 2ZM8A 3LO7A 4S2OA 1HVBA 1MWRA 4K0XA 4MBHA 1PW8A 4Y0OA 5E43A 1WYCA 3BECA 1VM1A 5FQKA 3GR2A 4R1GA 4HBTA 4ZJ1A 3Q7ZA 4IEDA 1BLCA 1PZPA 3MZFA 2X01A 4MNRA 1W7FA 3GMWA 5L2FA 4OONA 3V3SA 5HW3A 3VP4A 2XD1A 3NI9A 4DE0A 5TR7A 4DE1A 5FAQA 2DNSA 5CXWA 1HTZA 5F1FA 5CGSA 3ZG5A 4BENA 5FATA 3EQUA 4OH0A 1MXOA 3HBRA 3WRZA 4B88A 1RGZA 2WYXA 5CGXA 1W8QA 1TDGA 2QPNA 4OPQA 4OOYA 2Z2LB 5G18A 3CZDA 5HAPA 4WMCA 4QB8A 3UE3A 1LI0A 3HLFA 3G34A 5HFOA 3UE1A 4P87A 2P74A 3MZEA 4KG6A 2WKEA 1SHVA 4UA7A 4E3MA 4CJNA 1BLPA 2Y2LA 3C5AA 3NC8A 5EVID 1KVLA 4UAAA 2R9XA 3SH8A 3WS1A 4OQIA 1GHPA 1PI4A 2J9PA 4S2KA 2XQZA 3A3JA 4KG2A 3PBTA 1BTLA 3S22A 2WKHA 4KZBA 4LCLA 4NETA 1TEMA 1MPLA 2JE5A 2QMIA 2ZQCA 4OLDA 4KZ6A 1JWZA 1LL9A 1XKZA 2Q9NA 4DRTA 2CC1A 3IF5A 1MWUA 1IKIA 1NYYA 2H5SA 4X68A 3O87A 3QHYA 3Q82A 1K57A 3CMZA 1YLTA 3DWKA 1MBLA 1GA0A 2C6WB 1ERMA 4HBUA 3DTMA 5KZHA 3P09A 4GDNA 4KZ7A 1GHIA 1MWSA 1KDWA 4KZ9A 4LV2A 4KQRA 2EFXA 4RX2A 4JPMA 3V50A 3WS2A 1CI8A 5GLCA 3N4IA 1RCJA 4GDBA 4U3TA 3UDFA 1YLPA 4R0QA 3V5MA 4MLLA 5M18A 1JTDA 1VQQA 3ZVWA 3SS5A 1ZG4A 1ZG6A 1YLYA 5TGFA 3TG9A 1KDSA 3W4QA 1ESIA 2EX6A 1I2WA 3SS4A 3HREA 1GHMA 3Q07A 1FCNA 1FSWA 3A3EA 5GHXA 3VSLA 4WZ5C 4EV4A 1OMEA 3IHAA 4OPYA 3V39A 4OLGA 4E3LA 4FSFA 5D3OA 4C3QA 3WWXA 3A3DA 3LEZA 5CECA 1M40A 5EOOA 3Q7VA 1IYQA 2J9OA 4MBFA 3Q81A 5FA7A 2EX9A 1LHYA 2ZQDA 4O7DA 3P98A 1GCEA 1NXYA 4E3JA 2VGJA 4BL3A 4K0WA 3VFHA 1S6RA 5GHYA 5CTMA 4NK3A 3VP2A 3IH9A 3C4PA 3IWQA 3NCKA 2HP9A 3S1YA 4HESA 1ES5A 3W4OA 4BQMA 3I7JA 3CG5A 4LV0A 4R23A 5F1GA 3PBOA 5FQIA 2ZMAA 5EVIA 4BLMA 3UO9A 3AGDA 4H8RA 4GOGA 1HD8A 1WE4A 4QY6A 5AQAA 2EX8A 1JWVA 4LV3A 4EQIA 4OOLA 2Y2MA 5FASA 4WM9A 2Y59A 5E2EA 3HUOA 2ZC6B 3C7VA 4ID4A 2PBYA 4JKTA 4WZ4A 1PW1A 2P9VB 5EUAA 3UPOA 5CRFA 3NDEA 3Q1FA 2ZC7A 3MZDA 2V1ZA 3OPRA 3SS3A 1CEFA 1E3UD 1K54A 1K56D 5I94A 1YLWA 1DY6A 1QMEA 2WUQA 3EQVA 4QD4A 2V20A 3M6BA 5F82A 5E2HA 3VP0A 2C5WB 1Y54A 2XH9A 5KMWA 1N4OA 2XFSA 1O07A 4X53A 4ZTKA 1ALQA 5FQQA 2WGWA 2UWXA 3HVFA 3A3IA 4WBGA 1AXBA 2DCFA 1XX2A 3G4PA 4U0XA 5DTTA 1EROA 3QNBA 2Y2GA 2OLVA 2HDRA 2HDQA 3PTEA 4UA6A 2IWCA 3G2ZA 1IKGA 3ZNTA 1SDNA 4ZJ2A 1YQSA 1TVFA 5A92A 3OCLA 5CEDA 1K6SA 5FAOA 2HPBA 1SCWA 4DDYA 3ZG0A 2WK0A 2ZM2A 2WGIA 4JXWA 4ZDXA 3VP3A 4GD8A 2EXBA 4HEFA 4EUZA 2Z2MB 5DTKA 3CJMA 1DJAA 3GSGA 3IQAA 4PM9A 4EWFA 3IH8A 5M19A 4WYYA 3MXRA 3HUMA 3G2YA 4JLFA 4OVDA 1NZUA 2XDMA 3LY3A 3NDGA 1K4EA 5FAPA 1K57C 2EFUA 1L0FA 4Y0TA 5FI2A 1NY0A 3FWLA 2HDUA 4MBKA 1ES3A 3BFDA 1PWDA 1K25A 1H5XA 5A91A 4GNUA 1CI9A 5A90A 2BG1A 2ZQ7A 4CPKA 3BM6A 4RX3A 4ZBEA 4KENB 2H0YA 2Y2QA 4DE3A 2A49A 2HP6A 3IF6B 4N1HA 4S2LA 3IF6A 4E3OA 3AGFA 2H10A 3ISGA 4KZ5A 4JBFA 1ONGA 3O86A 2A3UA 3HL9A 5EOEA 3ZVTA 3UPPA 2Y55A 1RP5A 3OPHA 2DRWA 3OZHA 3VSKA 3G31A 1BZAA 3IT9A 5FQMA 2Y2PA 1PWCA 3UDXA 2FFFB 4LCMA 4RYEA 2PU2A 3ZG9B 3NBLA 1NRFA 5GL9A 5EPHA 1E3UA 1ONHA 3G32A 3HLWA 1LI9A 3BLSA 4JXSA 5F83A 3OPPA 4KG5A 5KSHA 3DW0A 2ZD8A 5JYOA 1LLBA 3UY6A 3IHBA 4IBRA 1XGJA 2WAEA 1L2SA 4OKPA 4Y0UA 3IWIA 2XK1A 1SKFA 3GV9A 1FQGA 3Q7VB 4KQQA 1H8YA 2PU4A 2FFYA 3BFFA 2IWBA 1NZOA 3WS4A 4BD1A 1YLZA 5CTNA 1ES2A 2Y2OA 5EVIC 1O7EA 3SOIA 4X56A 3N8LA 4BD0A 1L0EA 3LCEA 3RXXA 2HDSA 4OPZA 2I72A 2WADA 4UA9A 4KZ8A 2JBFA 2VGKA 1FR6A 1MY8A 4OOMA 4U0TA 1KE4A 1KGGA 5EVLA 3C4OA 4S2JA 3ZG7B 1IYOA 3DWZA 4Q8IA 3NIAA 3UN7A 2QZ6A 3PBNA 4RVAA 4Z9QA 5EVIB 3UNWA 1C3BA 2ZC5B 3ZGAB 2XD5A 4WMCD 4QHCA 4E6XA 1IYSA 1ZC2A 4DDSA 4S2NA 1FCOA 2ZLYA 1G68A 3FKWA 4KZ3A 4PM6A 1K54C 1KVMA 4QU3A 3ZNYA 3MBZA 1L0DA 2Y91A 3MKFA 4R3JA 4EBPA 3ZDJA 3PBQA 5J8XA 3PBSA 4RA7A 3W8KA 1BUEA 4S2IA 4KZAA 4P6BA 4Y7PA 5HAIA 1Q2QA 1Z6FA 3E2KA 2WGVA 2Y2JA 3B3XA 2WAFA 4OQ0A 1K38A 4IBXA 3OCNA 1YMSA 2H0TA 4JF5A 1YMXA 4DXCA 5IHVA 3HLBA 1K4FA 1YLJA 2ZQAA 5A93A 2JC7A 1FSYA 3IWOA 2G2UA 2HP5A 3FKVA 2X02A 1K55A 4OP8A 5HAQA 2Y2NA 2ZQ8A 4E3NA 4P85A 1XA7A 2G2WA 2WGWB 2V2FF 1W8YA 1IYPA 4UHUA 1XA1A 4K91A 5FSRA 3BFGA 4DF6A 3FZCA 4JF4A 5CHJA 3O3VA 5JYPA 3QNCA 4GZBA 3PBRA 4PM8A 4EBLA 4WELA 4WEKA 3W4PA 4OQGA 1KGEA 1S0WA 3N6IA 1U60A 2XGNA 4GB7A 3S4XA 2XR0A 4XUZA 1PWGA 5U47A 1PIOA 3BEBA 5DVAA 2XFTA 4ZJ3A 4B4XA 5DF9A 2B5RA 3VMAA 4QJGA 4BJPA 3IXBA 1E25A 4DKIA 1HZOA 2R9WA 5DTSA 3M6HA 1NYMA 1BLSA 2WZZA 4X6TA 1BLHA 3RJUA 4B4ZA 1DJCA 5E2GA 1FR1A 2J8YA 4OPRA 3VOZA 1YM1A 2Y2HA 3E2LA 4MEZA 3TOIA 5BOHA 3VFFA 1QMFA 3UE0A 3IF6C 1N9BA 2XF3A 4M3KA 5CGWA 4QY5A 1JWPA 4JXGA 1KGFA 1JTGA 4EBNA 3D4FA 3TSGA 3N7WA 1BULA 1XPBA 1I5QA 2GDNA 3WS0A 1E4DA 3A3FA 1KE0A 5FQJA 1EWZA 3HLCA 2WKIA 4A5RA 2OSUA 1M6KA 2Y4AA 1JVJA 1MKIA 1ESUA 1Q2PA 4D2OA 4N9LA 4DXBA 1BT5A 1PYYA 4R4SA 3SH7A 4PM7A 4S2PA 4F94A 3HUNA 4IVIA 3RXWA 4YFMA 4C6YA 3UPNA 1LL5A 3M2KA 1ES4A 5CHMA 5AQ9A 5HX9A 5CERA 3N8SA 4PM5A 1PZOA 5AQBA 5GLDA 4PMAA 3G30A 3OPLA 4FD8A 3MXSA 1K56A 4X55A 3WRTA 1YT4A 1FCMA 1H8ZA 1TDLA 3HLDA 2X71A 1W5DA 1SDEA 3GVBA 3AGEA 4PPRA 5FDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N9K A;  1BSG A;  1I2S A;  4N1X A;  2RCX A;  2ZJ9 A;  4GKU A;  2ZM0 A;  3PAG A;  3SH9 A;  4OP5 A;  4R4R A;  5EE8 A;  4E3I A;  1RGY A;  1PI5 A;  3JYI A;  5GLA A;  4GN2 A;  1W79 A;  3BRM A;  4N92 A;  2Q9M A;  5DF8 A;  2JCH A;  4WEJ A;  3V3R A;  3WS5 A;  1XP4 A;  2EX2 A;  3GRJ A;  5FI7 A;  3ZCZ A;  1EI5 A;  4S2N C;  1IEM A;  3C7U A;  3O88 A;  4JF6 A;  4P0M A;  2ZC3 B;  4FCF A;  2EXA A;  2ZQ9 A;  1CK3 A;  5AQ7 A;  3FYZ A;  5DF7 A;  3BYD A;  5CHU A;  4KQO A;  4KZ4 A;  5FI6 A;  5HAR A;  3IXG A;  2E8I A;  3UDI A;  4YIN A;  1XGI A;  3HLE A;  2ZC4 B;  2OLU A;  5HL1 A;  3ITA A;  3BFE A;  2J7V A;  1KE3 A;  4LEN A;  5GHZ A;  1G6A A;  3G35 A;  3ZFZ A;  1K6R A;  4XUX A;  3ITB A;  3IXH A;  1J9M A;  2IWD A;  1DJB A;  5TFQ A;  1FOF A;  2Y2K A;  4WZ5 A;  4ZAM A;  5FQ9 A;  4OQH A;  1K55 C;  5GLB A;  4S2M A;  1WYB A;  3BLM A;  3OC2 A;  1ZKJ A;  2OV5 A;  4R3B A;  1GA9 A;  3VP1 A;  4GD6 A;  1IEL A;  3M2J A;  4E6W A;  4C75 A;  3PAE A;  3GQZ A;  1L0G A;  4BL2 A;  3N8R A;  4L0L A;  1XXM A;  4FH4 A;  1ERQ A;  3FV7 A;  3GTC A;  5E2F A;  1MWT A;  4IVK A;  2XLN A;  4LV1 A;  5CEB A;  4X69 A;  5EEC A;  3IXD A;  3MFD A;  5M1A A;  4DE2 A;  1CEG A;  4XXR A;  4E3K A;  1NJ4 A;  5KSC A;  3VOY A;  4FH2 A;  4JXV A;  3MKE A;  2RL3 A;  3BFC A;  2P9V A;  2Y2I A;  3NY4 A;  3HLG A;  3ZHH A;  2BLS A;  2XEP A;  3LY4 A;  3ZG8 B;  2WZX A;  2ZM8 A;  3LO7 A;  4S2O A;  1HVB A;  1MWR A;  4K0X A;  4MBH A;  1PW8 A;  4Y0O A;  5E43 A;  1WYC A;  3BEC A;  1VM1 A;  5FQK A;  3GR2 A;  4R1G A;  4HBT A;  4ZJ1 A;  3Q7Z A;  4IED A;  1BLC A;  1PZP A;  3MZF A;  2X01 A;  4MNR A;  1W7F A;  3GMW A;  5L2F A;  4OON A;  3V3S A;  5HW3 A;  3VP4 A;  2XD1 A;  3NI9 A;  4DE0 A;  5TR7 A;  4DE1 A;  5FAQ A;  2DNS A;  5CXW A;  1HTZ A;  5F1F A;  5CGS A;  3ZG5 A;  4BEN A;  5FAT A;  3EQU A;  4OH0 A;  1MXO A;  3HBR A;  3WRZ A;  4B88 A;  1RGZ A;  2WYX A;  5CGX A;  1W8Q A;  1TDG A;  2QPN A;  4OPQ A;  4OOY A;  2Z2L B;  5G18 A;  3CZD A;  5HAP A;  4WMC A;  4QB8 A;  3UE3 A;  1LI0 A;  3HLF A;  3G34 A;  5HFO A;  3UE1 A;  4P87 A;  2P74 A;  3MZE A;  4KG6 A;  2WKE A;  1SHV A;  4UA7 A;  4E3M A;  4CJN A;  1BLP A;  2Y2L A;  3C5A A;  3NC8 A;  5EVI D;  1KVL A;  4UAA A;  2R9X A;  3SH8 A;  3WS1 A;  4OQI A;  1GHP A;  1PI4 A;  2J9P A;  4S2K A;  2XQZ A;  3A3J A;  4KG2 A;  3PBT A;  1BTL A;  3S22 A;  2WKH A;  4KZB A;  4LCL A;  4NET A;  1TEM A;  1MPL A;  2JE5 A;  2QMI A;  2ZQC A;  4OLD A;  4KZ6 A;  1JWZ A;  1LL9 A;  1XKZ A;  2Q9N A;  4DRT A;  2CC1 A;  3IF5 A;  1MWU A;  1IKI A;  1NYY A;  2H5S A;  4X68 A;  3O87 A;  3QHY A;  3Q82 A;  1K57 A;  3CMZ A;  1YLT A;  3DWK A;  1MBL A;  1GA0 A;  2C6W B;  1ERM A;  4HBU A;  3DTM A;  5KZH A;  3P09 A;  4GDN A;  4KZ7 A;  1GHI A;  1MWS A;  1KDW A;  4KZ9 A;  4LV2 A;  4KQR A;  2EFX A;  4RX2 A;  4JPM A;  3V50 A;  3WS2 A;  1CI8 A;  5GLC A;  3N4I A;  1RCJ A;  4GDB A;  4U3T A;  3UDF A;  1YLP A;  4R0Q A;  3V5M A;  4MLL A;  5M18 A;  1JTD A;  1VQQ A;  3ZVW A;  3SS5 A;  1ZG4 A;  1ZG6 A;  1YLY A;  5TGF A;  3TG9 A;  1KDS A;  3W4Q A;  1ESI A;  2EX6 A;  1I2W A;  3SS4 A;  3HRE A;  1GHM A;  3Q07 A;  1FCN A;  1FSW A;  3A3E A;  5GHX A;  3VSL A;  4WZ5 C;  4EV4 A;  1OME A;  3IHA A;  4OPY A;  3V39 A;  4OLG A;  4E3L A;  4FSF A;  5D3O A;  4C3Q A;  3WWX A;  3A3D A;  3LEZ A;  5CEC A;  1M40 A;  5EOO A;  3Q7V A;  1IYQ A;  2J9O A;  4MBF A;  3Q81 A;  5FA7 A;  2EX9 A;  1LHY A;  2ZQD A;  4O7D A;  3P98 A;  1GCE A;  1NXY A;  4E3J A;  2VGJ A;  4BL3 A;  4K0W A;  3VFH A;  1S6R A;  5GHY A;  5CTM A;  4NK3 A;  3VP2 A;  3IH9 A;  3C4P A;  3IWQ A;  3NCK A;  2HP9 A;  3S1Y A;  4HES A;  1ES5 A;  3W4O A;  4BQM A;  3I7J A;  3CG5 A;  4LV0 A;  4R23 A;  5F1G A;  3PBO A;  5FQI A;  2ZMA A;  5EVI A;  4BLM A;  3UO9 A;  3AGD A;  4H8R A;  4GOG A;  1HD8 A;  1WE4 A;  4QY6 A;  5AQA A;  2EX8 A;  1JWV A;  4LV3 A;  4EQI A;  4OOL A;  2Y2M A;  5FAS A;  4WM9 A;  2Y59 A;  5E2E A;  3HUO A;  2ZC6 B;  3C7V A;  4ID4 A;  2PBY A;  4JKT A;  4WZ4 A;  1PW1 A;  2P9V B;  5EUA A;  3UPO A;  5CRF A;  3NDE A;  3Q1F A;  2ZC7 A;  3MZD A;  2V1Z A;  3OPR A;  3SS3 A;  1CEF A;  1E3U D;  1K54 A;  1K56 D;  5I94 A;  1YLW A;  1DY6 A;  1QME A;  2WUQ A;  3EQV A;  4QD4 A;  2V20 A;  3M6B A;  5F82 A;  5E2H A;  3VP0 A;  2C5W B;  1Y54 A;  2XH9 A;  5KMW A;  1N4O A;  2XFS A;  1O07 A;  4X53 A;  4ZTK A;  1ALQ A;  5FQQ A;  2WGW A;  2UWX A;  3HVF A;  3A3I A;  4WBG A;  1AXB A;  2DCF A;  1XX2 A;  3G4P A;  4U0X A;  5DTT A;  1ERO A;  3QNB A;  2Y2G A;  2OLV A;  2HDR A;  2HDQ A;  3PTE A;  4UA6 A;  2IWC A;  3G2Z A;  1IKG A;  3ZNT A;  1SDN A;  4ZJ2 A;  1YQS A;  1TVF A;  5A92 A;  3OCL A;  5CED A;  1K6S A;  5FAO A;  2HPB A;  1SCW A;  4DDY A;  3ZG0 A;  2WK0 A;  2ZM2 A;  2WGI A;  4JXW A;  4ZDX A;  3VP3 A;  4GD8 A;  2EXB A;  4HEF A;  4EUZ A;  2Z2M B;  5DTK A;  3CJM A;  1DJA A;  3GSG A;  3IQA A;  4PM9 A;  4EWF A;  3IH8 A;  5M19 A;  4WYY A;  3MXR A;  3HUM A;  3G2Y A;  4JLF A;  4OVD A;  1NZU A;  2XDM A;  3LY3 A;  3NDG A;  1K4E A;  5FAP A;  1K57 C;  2EFU A;  1L0F A;  4Y0T A;  5FI2 A;  1NY0 A;  3FWL A;  2HDU A;  4MBK A;  1ES3 A;  3BFD A;  1PWD A;  1K25 A;  1H5X A;  5A91 A;  4GNU A;  1CI9 A;  5A90 A;  2BG1 A;  2ZQ7 A;  4CPK A;  3BM6 A;  4RX3 A;  4ZBE A;  4KEN B;  2H0Y A;  2Y2Q A;  4DE3 A;  2A49 A;  2HP6 A;  3IF6 B;  4N1H A;  4S2L A;  3IF6 A;  4E3O A;  3AGF A;  2H10 A;  3ISG A;  4KZ5 A;  4JBF A;  1ONG A;  3O86 A;  2A3U A;  3HL9 A;  5EOE A;  3ZVT A;  3UPP A;  2Y55 A;  1RP5 A;  3OPH A;  2DRW A;  3OZH A;  3VSK A;  3G31 A;  1BZA A;  3IT9 A;  5FQM A;  2Y2P A;  1PWC A;  3UDX A;  2FFF B;  4LCM A;  4RYE A;  2PU2 A;  3ZG9 B;  3NBL A;  1NRF A;  5GL9 A;  5EPH A;  1E3U A;  1ONH A;  3G32 A;  3HLW A;  1LI9 A;  3BLS A;  4JXS A;  5F83 A;  3OPP A;  4KG5 A;  5KSH A;  3DW0 A;  2ZD8 A;  5JYO A;  1LLB A;  3UY6 A;  3IHB A;  4IBR A;  1XGJ A;  2WAE A;  1L2S A;  4OKP A;  4Y0U A;  3IWI A;  2XK1 A;  1SKF A;  3GV9 A;  1FQG A;  3Q7V B;  4KQQ A;  1H8Y A;  2PU4 A;  2FFY A;  3BFF A;  2IWB A;  1NZO A;  3WS4 A;  4BD1 A;  1YLZ A;  5CTN A;  1ES2 A;  2Y2O A;  5EVI C;  1O7E A;  3SOI A;  4X56 A;  3N8L A;  4BD0 A;  1L0E A;  3LCE A;  3RXX A;  2HDS A;  4OPZ A;  2I72 A;  2WAD A;  4UA9 A;  4KZ8 A;  2JBF A;  2VGK A;  1FR6 A;  1MY8 A;  4OOM A;  4U0T A;  1KE4 A;  1KGG A;  5EVL A;  3C4O A;  4S2J A;  3ZG7 B;  1IYO A;  3DWZ A;  4Q8I A;  3NIA A;  3UN7 A;  2QZ6 A;  3PBN A;  4RVA A;  4Z9Q A;  5EVI B;  3UNW A;  1C3B A;  2ZC5 B;  3ZGA B;  2XD5 A;  4WMC D;  4QHC A;  4E6X A;  1IYS A;  1ZC2 A;  4DDS A;  4S2N A;  1FCO A;  2ZLY A;  1G68 A;  3FKW A;  4KZ3 A;  4PM6 A;  1K54 C;  1KVM A;  4QU3 A;  3ZNY A;  3MBZ A;  1L0D A;  2Y91 A;  3MKF A;  4R3J A;  4EBP A;  3ZDJ A;  3PBQ A;  5J8X A;  3PBS A;  4RA7 A;  3W8K A;  1BUE A;  4S2I A;  4KZA A;  4P6B A;  4Y7P A;  5HAI A;  1Q2Q A;  1Z6F A;  3E2K A;  2WGV A;  2Y2J A;  3B3X A;  2WAF A;  4OQ0 A;  1K38 A;  4IBX A;  3OCN A;  1YMS A;  2H0T A;  4JF5 A;  1YMX A;  4DXC A;  5IHV A;  3HLB A;  1K4F A;  1YLJ A;  2ZQA A;  5A93 A;  2JC7 A;  1FSY A;  3IWO A;  2G2U A;  2HP5 A;  3FKV A;  2X02 A;  1K55 A;  4OP8 A;  5HAQ A;  2Y2N A;  2ZQ8 A;  4E3N A;  4P85 A;  1XA7 A;  2G2W A;  2WGW B;  2V2F F;  1W8Y A;  1IYP A;  4UHU A;  1XA1 A;  4K91 A;  5FSR A;  3BFG A;  4DF6 A;  3FZC A;  4JF4 A;  5CHJ A;  3O3V A;  5JYP A;  3QNC A;  4GZB A;  3PBR A;  4PM8 A;  4EBL A;  4WEL A;  4WEK A;  3W4P A;  4OQG A;  1KGE A;  1S0W A;  3N6I A;  1U60 A;  2XGN A;  4GB7 A;  3S4X A;  2XR0 A;  4XUZ A;  1PWG A;  5U47 A;  1PIO A;  3BEB A;  5DVA A;  2XFT A;  4ZJ3 A;  4B4X A;  5DF9 A;  2B5R A;  3VMA A;  4QJG A;  4BJP A;  3IXB A;  1E25 A;  4DKI A;  1HZO A;  2R9W A;  5DTS A;  3M6H A;  1NYM A;  1BLS A;  2WZZ A;  4X6T A;  1BLH A;  3RJU A;  4B4Z A;  1DJC A;  5E2G A;  1FR1 A;  2J8Y A;  4OPR A;  3VOZ A;  1YM1 A;  2Y2H A;  3E2L A;  4MEZ A;  3TOI A;  5BOH A;  3VFF A;  1QMF A;  3UE0 A;  3IF6 C;  1N9B A;  2XF3 A;  4M3K A;  5CGW A;  4QY5 A;  1JWP A;  4JXG A;  1KGF A;  1JTG A;  4EBN A;  3D4F A;  3TSG A;  3N7W A;  1BUL A;  1XPB A;  1I5Q A;  2GDN A;  3WS0 A;  1E4D A;  3A3F A;  1KE0 A;  5FQJ A;  1EWZ A;  3HLC A;  2WKI A;  4A5R A;  2OSU A;  1M6K A;  2Y4A A;  1JVJ A;  1MKI A;  1ESU A;  1Q2P A;  4D2O A;  4N9L A;  4DXB A;  1BT5 A;  1PYY A;  4R4S A;  3SH7 A;  4PM7 A;  4S2P A;  4F94 A;  3HUN A;  4IVI A;  3RXW A;  4YFM A;  4C6Y A;  3UPN A;  1LL5 A;  3M2K A;  1ES4 A;  5CHM A;  5AQ9 A;  5HX9 A;  5CER A;  3N8S A;  4PM5 A;  1PZO A;  5AQB A;  5GLD A;  4PMA A;  3G30 A;  3OPL A;  4FD8 A;  3MXS A;  1K56 A;  4X55 A;  3WRT A;  1YT4 A;  1FCM A;  1H8Z A;  1TDL A;  3HLD A;  2X71 A;  1W5D A;  1SDE A;  3GVB A;  3AGE A;  4PPR A;  5FDH A; 
#chains in the Genus database with same CATH topology
 3TRC A;  2ZM0 A;  2J80 A;  3LI8 A;  1RGY A;  2WKQ A;  1H3Q A;  4NXF A;  4WEJ A;  4HNB A;  1XP4 A;  2EX2 A;  3WS5 A;  3C38 A;  1EI5 A;  3C7U A;  3E4Q A;  4IJG A;  2EXA A;  2ZQ9 A;  1CK3 A;  2A24 A;  3BYD A;  2XA7 S;  4KZ4 A;  3LUQ A;  3UDI A;  1KE3 A;  3IS2 A;  5IU1 A;  5GHZ A;  3DBA A;  1G6A A;  3G35 A;  1FIL A;  1K6R A;  3H9W A;  3L9K A;  2K7S A;  2M7U A;  4WZ5 A;  5FQ9 A;  4S2M A;  1WYB A;  3BLM A;  2V0U A;  5HSQ A;  2OV5 A;  4R3B A;  4GD6 A;  4HP4 A;  3B42 A;  1L0G A;  3GQZ A;  1XXM A;  4FH4 A;  1ERQ A;  3FV7 A;  3GTC A;  3ICY A;  1MWT A;  2W3D A;  5EEC A;  5M1A A;  2OAQ 1;  3T4L A;  1JNU A;  3VOY A;  4FH2 A;  2RL3 A;  2P9V A;  3B33 A;  3NY4 A;  2V8C A;  3HLG A;  1GSW A;  3LY4 A;  3ZG8 B;  1MWR A;  4HH3 A;  1PW8 A;  3BEC A;  3LIC A;  4R1G A;  4JGO A;  4IED A;  2X01 A;  4MNR A;  1N9L A;  3V3S A;  5HW3 A;  3VP4 A;  5CXW A;  4OH0 A;  4O8G A;  1S1Z A;  3WRZ A;  4B88 A;  2WKP A;  4L9G A;  5G4Z A;  1TDG A;  4OPQ A;  3HCY A;  1Y28 A;  5IS1 A;  3MZE A;  3RH8 B;  2B95 A;  3C30 A;  5EVI D;  4OQI A;  2J9P A;  2PYP A;  2XQZ A;  3PBT A;  1VHM A;  3S22 A;  4LCL A;  3LR0 A;  2ZQC A;  3PR6 A;  4KZ6 A;  1LL9 A;  2QWS A;  4QPR A;  1MWU A;  1NYY A;  2H5S A;  3Q82 A;  3C2W A;  3CMZ A;  1YLT A;  5KZH A;  1ERM A;  2Y79 A;  3P09 A;  4GDN A;  2ZOH A;  1MWS A;  4KZ9 A;  4LV2 A;  3NOU C;  3FPW A;  5GLC A;  3LIA A;  4GDB A;  4R0Q A;  1ZG6 A;  4GW9 A;  3QP8 A;  3ULF A;  2EX6 A;  3A3E A;  5GHX A;  3VSL A;  2M1C A;  4WF0 A;  4E3L A;  3A3D A;  3LEZ A;  5EOO A;  3Q81 A;  3MS6 A;  1NXY A;  2VGJ A;  5CTM A;  3VP2 A;  4HH2 A;  1OTB A;  4HES A;  3T4J A;  2Y8H A;  5EVI A;  5J3W A;  2KLI A;  4BWI A;  5F68 A;  1WE4 A;  5DKK A;  4QY6 A;  2J3T C;  5AQA A;  1JWV A;  1T18 A;  2Y2M A;  2Y59 A;  1DP9 A;  3C7V A;  4LGW A;  4BBV A;  2AVX A;  1GSV A;  4EU0 A;  5CRF A;  3T4S A;  2V1Z A;  1SZV A;  1F5M A;  3SS3 A;  1CEF A;  1D1J A;  2ZBB A;  1OTA A;  1K54 A;  2V8F A;  1DY6 A;  1QME A;  2O9C A;  3EQV A;  1Y54 A;  2JKR M;  1N4O A;  1O07 A;  3MXQ A;  3HVF A;  3A3I A;  4U0X A;  1W63 M;  4I38 A;  1YQS A;  1T1A A;  2KOI A;  3OCL A;  5EVE A;  2OAP 1;  2WK0 A;  2ZM2 A;  3T1S A;  3F1O A;  2JKG A;  3IQA A;  4EWF A;  3R4K A;  3IH8 A;  3G2Y A;  3L7H A;  4JLF A;  4OVD A;  1WA9 A;  2EFU A;  5FI2 A;  3LR5 A;  1ES3 A;  4LPZ A;  4ZRR A;  3LYX A;  1XFN A;  3KX0 X;  2BG1 A;  2ZQ7 A;  3MJQ A;  4KEN B;  2H0Y A;  3IF6 B;  1UWP X;  3IF6 A;  4E3O A;  4Y5F A;  3A0V A;  3ISG A;  5EOE A;  4M4X A;  3CUE C;  3DTE A;  5DFY A;  2DRW A;  3G31 A;  1BZA A;  3IT9 A;  3FPV A;  2VX8 A;  3NBL A;  4JXS A;  3KO6 A;  4KG5 A;  2PD8 A;  5TJJ A;  3LI9 A;  3GDI A;  4WUJ A;  1L2S A;  2XK1 A;  2PD7 A;  3WS4 A;  5CTN A;  3KYE A;  1O7E A;  3SOI A;  4BD0 A;  4XT2 A;  4OPZ A;  4II7 A;  2WAD A;  2VGK A;  4U0T A;  4EQ1 A;  1KGG A;  3C4O A;  2UV0 E;  3MSH A;  3ZGA B;  2XD5 A;  4WMC D;  4E6X A;  1IYS A;  2W1R A;  1ZC2 A;  5L8M A;  1MZU A;  4CLC E;  2B18 A;  1FIK A;  5CX7 A;  4UQI M;  4KZ3 A;  4QU3 A;  2Y91 A;  4R3J A;  2NUT C;  3PBQ A;  3W8K A;  4KZA A;  4EEP A;  1Q2Q A;  1PFL A;  3CPT B;  3B3X A;  3CPT A;  4GS9 A;  1TF1 A;  1YLJ A;  3CIT A;  2W3F A;  2HP5 A;  4OP8 A;  2Y2N A;  2PHY A;  4WN5 A;  4P85 A;  3JVU A;  2G2W A;  4H6J B;  2V2F F;  1W8Y A;  3FZC A;  4PKY A;  2ZMV A;  2EA9 A;  2JKT M;  5AVF A;  4CLC B;  4CLC A;  1STZ A;  4OQG A;  3PHY A;  2XR0 A;  3BEB A;  4KUK A;  4ZJ3 A;  1TS6 A;  4B4X A;  4ETZ A;  2B5R A;  2R9W A;  3V67 A;  4X6T A;  4LFU A;  4B4Z A;  2J8Y A;  3VOZ A;  2INW A;  3TOI A;  3VFF A;  4YOF A;  2VZW A;  4M3K A;  5CGW A;  1KGF A;  3D4F A;  3N7W A;  5I5L A;  2GDN A;  1E4D A;  1EWZ A;  4A5R A;  2OSU A;  1JVJ A;  1TS8 A;  3EGX C;  3E4O A;  1PYY A;  4PM7 A;  3K3C A;  4IVI A;  3SZT A;  4YFM A;  5HDD A;  4C6Y A;  5HX9 A;  5CHM A;  5LBR A;  2XA7 M;  1YPR A;  4I3J A;  4X55 A;  4DE2 A;  3AGE A;  4ARZ A;  1P0Z A;  4N9K A;  1I2S A;  5F5Y A;  5AVE A;  2RCX A;  2ZJ9 A;  4E3I A;  3SH9 A;  3JYI A;  5GLA A;  3MR0 A;  1W79 A;  3H7W B;  4N92 A;  5DJT A;  1OJ5 A;  3GRJ A;  4S2N C;  2ZC3 B;  1P9W A;  3B47 A;  4EUV A;  5HAR A;  5FI6 A;  4KQO A;  3IXG A;  2E8I A;  3A0S A;  4YIN A;  5HL1 A;  3VV4 A;  3ITA A;  3BFE A;  2J7V A;  3IXH A;  2HZ5 A;  1J9M A;  1FOF A;  4FTX A;  2K31 A;  1TS0 A;  3FG8 A;  1K55 C;  4MMN A;  4RQ9 A;  1ZKJ A;  3LR3 A;  3M2J A;  2V0W A;  4C75 A;  5E2F A;  4LV1 A;  4D60 A;  1P9R A;  3MFD A;  1CEG A;  2H28 A;  1NJ4 A;  2Y2I A;  3DAV A;  3T12 B;  1MC0 A;  3LO7 A;  5E43 A;  1HVB A;  4MBH A;  4HBT A;  3BW6 A;  1BLC A;  3MZF A;  1IOU A;  3UB6 A;  2ACG A;  2XD1 A;  4G3K A;  4HP9 A;  3NOT C;  2DNS A;  1OTI A;  1HTZ A;  5F1F A;  5CGS A;  2VV6 A;  4JGR A;  5L07 A;  1H0M A;  3IX8 A;  5CGX A;  2QPN A;  5G18 A;  1HLU P;  5HFO A;  5J7E A;  2WKE A;  1SHV A;  4E3M A;  3SH8 A;  2Y2L A;  3C5A A;  3WS1 A;  4UAA A;  2CMN A;  1GHP A;  4KG2 A;  3VOL A;  4KZB A;  2JE5 A;  1DRM A;  2QMI A;  4OLD A;  3JVV A;  2Q9N A;  3IF5 A;  4GHI A;  1IKI A;  3NJA A;  3QHY A;  4HBU A;  1GHI A;  4RX2 A;  1KDW A;  4KQR A;  3TE8 A;  4JPM A;  5C5K A;  2PRF A;  4UEY A;  3EWK A;  4I3I A;  5TGF A;  1F9I A;  1GHM A;  2O99 A;  1FSW A;  2A24 B;  3T4O A;  3IHA A;  4OPY A;  5D3O A;  4C3Q A;  3IS2 B;  1M40 A;  4MBF A;  5FA7 A;  1LHY A;  1KOU A;  4DJ3 A;  3P98 A;  4P6Z M;  3HJI A;  1S6R A;  1N9N A;  4NK3 A;  3NCK A;  2HP9 A;  4L9E A;  3W4O A;  2FZ0 A;  4BQM A;  5F1G A;  2G7U A;  2ZMA A;  4HJ6 A;  1A0K A;  4H8R A;  4Y13 A;  2VK3 A;  3CI6 A;  4NXG A;  3EEH A;  4LV3 A;  2Q0O A;  3HUO A;  4JKT A;  4WZ4 A;  1S4R A;  2P9V B;  3UPO A;  2EWV A;  3MF0 A;  3MZD A;  1F2K A;  3OPR A;  3EGD C;  5I94 A;  2BAS A;  3M6B A;  2C5W B;  4EXO A;  3KYZ A;  2XFS A;  3QP5 A;  1ALQ A;  4G3V A;  1XX2 A;  3G4P A;  1ERO A;  4F3L A;  1CJF A;  4MN5 A;  3PTE A;  2IWC A;  1SDN A;  1OTE A;  3CWF A;  3H82 A;  1TVF A;  4IUK A;  1K6S A;  5TBM A;  3ZG0 A;  4CQH A;  2OWJ A;  4B93 A;  2EXB A;  3TW8 A;  5M19 A;  3HUM A;  4EEU A;  3NDG A;  1K4E A;  1K57 C;  2VJW A;  4Z1W A;  3BFD A;  1PWD A;  4LRX C;  1H5X A;  4GNU A;  3RFB A;  3EEA A;  4EET B;  3BM6 A;  3S7P A;  4ZBE A;  5DKL A;  4DE3 A;  1VB6 A;  4KZ5 A;  3ZVT A;  3UPP A;  1NLZ A;  3OPH A;  3U2A A;  3LGO A;  3OZH A;  3MMH A;  3VSK A;  3T4Q A;  1XFQ A;  3LID A;  1PWC A;  2FFF B;  2GNX A;  4RYE A;  2PU2 A;  3ZG9 B;  2FH5 A;  2JKR I;  5GL9 A;  5EPH A;  3HLW A;  4EW7 A;  5F83 A;  3BLS A;  3NOP C;  1L3L A;  5L10 A;  5JYO A;  3P7N A;  3IHB A;  3FC7 A;  4IBR A;  1XGJ A;  4ME4 A;  2LB9 A;  1SKF A;  3GV9 A;  1BYW A;  1FQG A;  2IWB A;  4BD1 A;  4DJ2 A;  1YLZ A;  3KSH A;  3QP4 A;  3BY8 A;  1AWI A;  3DTK A;  3ZG7 B;  1IYO A;  3DWZ A;  4Q8I A;  3NIA A;  3UN7 A;  2QZ6 A;  3PBN A;  4RVA A;  4Z9Q A;  5EVI B;  3UNW A;  4QHC A;  4R70 A;  2O9A A;  2ZLY A;  5J8X A;  3PBS A;  1Z6F A;  1VET A;  2Y2J A;  1K38 A;  4IBX A;  4DXC A;  3HLB A;  1K4F A;  3BQA A;  4Y2F A;  5A93 A;  3E98 A;  2G2U A;  4MCW A;  1T1B A;  1D06 A;  3BFG A;  3MQO A;  4DF6 A;  4Y3I A;  5JYP A;  4GZB A;  3KYQ A;  4EBL A;  3W4P A;  2XRN A;  1KGE A;  1S0W A;  4YNR A;  4XUZ A;  1TD5 A;  5U47 A;  1PIO A;  3UB7 A;  3F1O B;  4QJG A;  3VMA A;  3IXB A;  3ZYT A;  3D9Y A;  1HZO A;  3M6H A;  2LB5 A;  1NYM A;  1YSP A;  3TJZ C;  1DJC A;  2W0N A;  2L0W A;  3BWL A;  4MEZ A;  1ZHH B;  4X1M A;  4YWZ A;  2JKF A;  4JXG A;  2ZOI A;  4EBN A;  1F98 A;  1BUL A;  3WS0 A;  3OOV A;  3A3F A;  1Q2P A;  2ZL1 A;  4N9L A;  1S66 L;  3SH7 A;  4S2P A;  3NHQ A;  1Y4O A;  4WL9 A;  3UPN A;  1LL5 A;  5CER A;  1SKO A;  3N8S A;  3LEQ A;  5GLD A;  1V9Y A;  4FD8 A;  1FCM A;  2J3T D;  3ZHH A;  3GVB A;  4PPR A;  2JKT I;  4ZDX A;  1BSG A;  4N1X A;  3E0Y A;  3PAG A;  4R4R A;  1PI5 A;  2K2N A;  4GN2 A;  2HJE A;  5K5B A;  4XT2 B;  3ZCZ A;  1IEM A;  4FCF A;  5AQ7 A;  5DF7 A;  5FEG A;  2J3W A;  1XGI A;  4HOI A;  1XJ6 A;  2ZC4 B;  3KSF A;  4PKY G;  3ZFZ A;  4XUX A;  3ITB A;  5KIZ A;  1NWZ A;  2Y2K A;  4ZAM A;  4OQH A;  3T50 A;  4NXE A;  3OC2 A;  5HD5 A;  1Z09 A;  3VP1 A;  4GS9 B;  3U4L P;  3HJK A;  4BL2 A;  4R38 A;  4X69 A;  4GJ4 A;  3IXD A;  1NLY A;  1LT0 A;  2XSS A;  4JXV A;  3D72 A;  5HPF A;  2W3H A;  2BLS A;  2IA2 A;  2WZX A;  4S2O A;  3LIB A;  5FQK A;  3OLO A;  3GR2 A;  2HGV A;  2PYR A;  3Q7Z A;  5FDS A;  2NUP C;  1PZP A;  3UMD A;  2VV7 A;  1W7F A;  3K2N A;  1GSX A;  3NI9 A;  3ZG5 A;  4X1L A;  3EQU A;  3HBR A;  1RGZ A;  1G28 A;  1XJ2 A;  4OOY A;  3SW1 A;  3BJN A;  5HAP A;  4WMC A;  4QB8 A;  3HLF A;  3G34 A;  3UE1 A;  1S1Y A;  4KG6 A;  1S67 L;  4UA7 A;  1BLP A;  1N9O A;  4NG2 A;  1D7E A;  2R9X A;  4HHD A;  4S2K A;  3A3J A;  1BTL A;  1VEU B;  1G6O A;  1VEU A;  2HF6 A;  3T1R A;  1LSX A;  4X68 A;  1IFQ A;  3O87 A;  2KDK A;  3IX4 A;  3DWK A;  3DTI A;  1MBL A;  4ARZ B;  1GA0 A;  2I9V A;  3S7N A;  3DTM A;  4ETX A;  4KZ7 A;  3VE4 A;  3N4I A;  1RCJ A;  3UDF A;  2GJ3 A;  4MLL A;  1VQQ A;  1ZG4 A;  3TG9 A;  4LRY C;  1KDS A;  3T1X A;  1ESI A;  5F69 A;  4LRZ E;  3SS4 A;  1I2W A;  3HRE A;  3Q07 A;  1FCN A;  3CUE A;  2VGL S;  1OPX A;  4WZ5 C;  2O9B A;  4FSF A;  5J4E A;  3WWX A;  1T19 A;  5CEC A;  3Q7V A;  2J9O A;  4Q0J A;  2ZQD A;  4E04 A;  4E3J A;  5HZH A;  4K0W A;  2A2L A;  5GHY A;  3IH9 A;  3C4P A;  3IWQ A;  3UB9 A;  2QKP A;  3KSI A;  1YAX A;  4R23 A;  3CG5 A;  4LV0 A;  2PDR A;  3PBO A;  4MN6 A;  5FQI A;  4BLM A;  3UO9 A;  3AGD A;  3LIF A;  2KX6 A;  1TS7 A;  4EQI A;  4OOL A;  4WM9 A;  5E2E A;  2ZC6 B;  2PBY A;  2Z6D A;  1PW1 A;  3Q1F A;  3OBF A;  2ZC7 A;  5F6A A;  2QJ7 A;  1E3U D;  3UB8 A;  5HWV A;  1K56 D;  1YLW A;  5F82 A;  3VP0 A;  2V20 A;  5E2H A;  2XH9 A;  4GLQ A;  5KMW A;  2WGW A;  2UWX A;  4WBG A;  3GEC A;  3QNB A;  2Y2G A;  5HWW A;  2HDQ A;  4UA6 A;  3G2Z A;  1IKG A;  3ZNT A;  4ZJ2 A;  2L1M A;  3PXP A;  5A92 A;  1OTD A;  5FAO A;  2HPB A;  4DDY A;  2MJ6 A;  2WGI A;  3K3D A;  4HEF A;  4EUZ A;  3CJM A;  1DJA A;  3C8C A;  3GSG A;  2XRO A;  3A0R A;  2XDM A;  4Y0T A;  1K25 A;  5A91 A;  4I5S A;  5A90 A;  4CPK A;  4GHI B;  4RX3 A;  2A49 A;  4HIA A;  4ESP A;  2L4R A;  3AGF A;  2H10 A;  4JGP A;  4JBF A;  1ONG A;  3O86 A;  2A3U A;  3IBR A;  2Y55 A;  1RP5 A;  4MDZ A;  2Y2P A;  4LCM A;  1XJ3 A;  3S7Q A;  1NRF A;  1E3U A;  1LI9 A;  3OPP A;  5KSH A;  3DW0 A;  2PBD P;  4WLA A;  1W63 Q;  4KQQ A;  3JPU A;  1H8Y A;  3BFF A;  2FFY A;  1NZO A;  1UGU A;  1ES2 A;  1ZTU A;  5EVI C;  4X56 A;  3N8L A;  1L0E A;  2HDS A;  3D3O A;  2I72 A;  4UA9 A;  3UB5 P;  2JBF A;  1FR6 A;  5EVL A;  1C3B A;  2ZC5 B;  1XJ4 A;  2Z6C A;  4X25 A;  4DDS A;  4S2N A;  1FCO A;  3FKW A;  4DMZ A;  4PM6 A;  1K54 C;  3ZNY A;  3MBZ A;  1BUE A;  5EV0 A;  4AFI A;  4Y7P A;  2DMW A;  2QYB A;  3E2K A;  2WGV A;  1OT6 A;  2WAF A;  3KSG A;  1YMS A;  2H0T A;  1YMX A;  2ZQA A;  1FSY A;  3IWO A;  5L09 A;  1T1C A;  1P97 A;  3PYP A;  3FKV A;  2X02 A;  1DP8 A;  1K55 A;  2ZQ8 A;  2P08 A;  4UHU A;  1XA1 A;  4F3L B;  2PR6 A;  4JF4 A;  3O3V A;  3QNC A;  3PBR A;  3H82 B;  4PM8 A;  4I39 A;  4WEL A;  5TBM B;  4PAU A;  3N6I A;  3S4X A;  3QP1 A;  5DVA A;  5DF9 A;  4BJP A;  5DTS A;  4MN7 A;  3EOI A;  1BLS A;  2WZZ A;  1LSW A;  2V1B A;  1OJG A;  1FR1 A;  4Y17 A;  2Y2H A;  3E2L A;  5BOH A;  1YKD A;  3IF6 C;  2XF3 A;  3G6O A;  4QY5 A;  1JTG A;  3ZQ5 A;  1XPB A;  1I5Q A;  1KE0 A;  5FQJ A;  2WKI A;  3BQ8 A;  1M6K A;  1MKI A;  1ESU A;  4NXB A;  1ODV A;  1BT5 A;  3UE6 A;  4I3A A;  2O0Y A;  4DN0 A;  3M2K A;  1ES4 A;  1PZO A;  3CHW P;  3OPL A;  3MXS A;  3WRT A;  2M7V A;  3HLD A;  1TDL A;  2X71 A;  5AJG A;  5IT5 A;  5FDH A;  5FEF A;  4GKU A;  4OP5 A;  5EE8 A;  3IX3 A;  3BRM A;  2Q9M A;  5DF8 A;  2JCH A;  3V3R A;  5FI7 A;  3O88 A;  4JF6 A;  4P0M A;  1J3W A;  3FYZ A;  3T1Q B;  5CHU A;  4Q0H A;  2VEA A;  4LLO B;  3HLE A;  3QP2 A;  2OLU A;  4FOF A;  4LEN A;  1EW0 A;  2IWD A;  1DJB A;  3O5Y A;  5TFQ A;  2JHE A;  4JGQ A;  4PHT A;  3BY9 A;  5GLB A;  2HJ9 C;  3MQQ A;  1VET B;  1NRJ A;  1GA9 A;  3F1N B;  1IEL A;  4E6W A;  3F1N A;  5FL3 A;  3PAE A;  1X0O A;  3N8R A;  4L0L A;  4CLC C;  1S4S A;  4IVK A;  2XLN A;  3T4T A;  5CEB A;  3CLO A;  2JN7 A;  1H8M A;  3E4P A;  4XXR A;  1CQA A;  2VLG A;  4E3K A;  5KSC A;  3MKE A;  1DP6 A;  4P6Z S;  3BFC A;  5HWT A;  2XEP A;  2WKR A;  2ZM8 A;  2HV1 A;  3NUL A;  4K0X A;  4Y0O A;  1WYC A;  1VM1 A;  4ZJ1 A;  3GMW A;  2PT7 A;  5L2F A;  4OON A;  4DE0 A;  5TR7 A;  4DE1 A;  5FAQ A;  4BEN A;  5FAT A;  2PAV P;  1MXO A;  4Y15 A;  2WYX A;  1W8Q A;  2Z2L B;  3CZD A;  3UE3 A;  4NEE D;  1LI0 A;  2P04 A;  2P74 A;  4P87 A;  2ZL1 B;  4CJN A;  3NC8 A;  1KVL A;  1PI4 A;  3MQ0 A;  3MFX A;  2WKH A;  4NET A;  1TEM A;  1LL8 A;  1MPL A;  1SKO B;  3QP6 A;  2VGL M;  1JWZ A;  1XKZ A;  4DRT A;  2CC1 A;  1OT9 A;  1K57 A;  4L9F A;  2C6W B;  3V50 A;  2EFX A;  3WS2 A;  1CI8 A;  4U3T A;  1YLP A;  3V5M A;  5M18 A;  1JTD A;  3ZVW A;  3SS5 A;  1YLY A;  5HDC A;  3W4Q A;  4CLC D;  1PRQ A;  4EV4 A;  1OME A;  3V39 A;  4OLG A;  5G4Y A;  1IYQ A;  2EX9 A;  1ACF A;  4O7D A;  1GCE A;  4BL3 A;  3VFH A;  3S1Y A;  1ES5 A;  2P7J A;  4IHQ A;  3I7J A;  3CAX A;  3LR4 A;  2YKH A;  4GOG A;  1HD8 A;  2EX8 A;  4R3A A;  2R78 A;  3VE3 A;  5FAS A;  4ID4 A;  5EUA A;  2BTF P;  3NDE A;  1YSQ A;  5A8B A;  4FUW A;  2WUQ A;  4QD4 A;  4BBT A;  4X53 A;  4ZTK A;  5FQQ A;  4H6J A;  5HD3 A;  3RTY A;  1AXB A;  2DCF A;  3T4K A;  5DTT A;  4Q0I A;  2OLV A;  5HDS A;  2HDR A;  2QJ5 A;  2YKF A;  5CED A;  1SCW A;  4JXW A;  3VP3 A;  4GD8 A;  2B02 A;  2Z2M B;  5DTK A;  4PM9 A;  2GZA A;  4WYY A;  3MXR A;  1NZU A;  3LY3 A;  5FAP A;  1L0F A;  4QWO A;  1NY0 A;  3FWL A;  2HDU A;  4MBK A;  4HJ3 A;  2W27 A;  4R6L A;  1CI9 A;  5HL6 A;  2Y2Q A;  4HY8 A;  2HP6 A;  4S2L A;  3LFV A;  4N1H A;  3P01 A;  5EFW A;  5HPI A;  4O01 A;  3HL9 A;  2ZMF A;  4BMW A;  5FQM A;  3UDX A;  1ONH A;  3G32 A;  2ZD8 A;  1MKM A;  1LLB A;  3UY6 A;  3F1P B;  2E8J A;  3F1P A;  2WAE A;  4OKP A;  4K08 A;  4Y0U A;  3IWI A;  3Q7V B;  5EM1 A;  2PU4 A;  2D02 A;  2D01 A;  4BBU A;  2V9A A;  2EWW A;  2Y2O A;  3H7W A;  3LCE A;  3RXX A;  4GCZ A;  4KZ8 A;  1MY8 A;  4OOM A;  1KE4 A;  4S2J A;  2OWH A;  4B9O A;  2QHK A;  1G68 A;  4G3W A;  4O0P A;  2GX5 A;  2W1T B;  1KVM A;  2W1T A;  1L0D A;  3UME A;  3MKF A;  4EBP A;  3ZDJ A;  4RA7 A;  4S2I A;  4P6B A;  5HAI A;  4OQ0 A;  3S7O A;  4JF5 A;  3OCN A;  5IHV A;  4KUO A;  2JC7 A;  2V1A A;  3R7W B;  3R7W A;  5HAQ A;  3LIE A;  4E3N A;  1XA7 A;  1LSV A;  2VKS A;  2WGW B;  1IYP A;  5FSR A;  4K91 A;  5DJU A;  5CHJ A;  4UQI S;  4HQA A;  4WEK A;  1K0K A;  1U60 A;  2XGN A;  4GB7 A;  1PWG A;  2VA0 A;  1PNE A;  2W3G A;  2VV8 A;  2XFT A;  4EES A;  1E25 A;  4DKI A;  1BLH A;  4HI4 A;  3RJU A;  5E2G A;  4OPR A;  1YM1 A;  4IUH A;  1QMF A;  3UE0 A;  1N9B A;  1JWP A;  2W3E A;  2OOL A;  1V9Z A;  3TSG A;  4EER A;  5MC7 A;  3NEC A;  3HLC A;  1G5U A;  4HJ4 A;  2Y4A A;  4D2O A;  1UWN X;  4DXB A;  5EM0 A;  5DFX A;  4R4S A;  4F94 A;  3HUN A;  3W2Z A;  3RXW A;  2PR5 A;  5AQ9 A;  4PM5 A;  5AQB A;  4NKP A;  4PMA A;  3G30 A;  1K56 A;  4KQD A;  1CF0 A;  1YT4 A;  3IBJ A;  1H8Z A;  1W5D A;  1SDE A; 
#chains in the Genus database with same CATH homology
 4N9K A;  1BSG A;  1I2S A;  4N1X A;  2RCX A;  2ZJ9 A;  4GKU A;  2ZM0 A;  3PAG A;  3SH9 A;  4OP5 A;  4R4R A;  5EE8 A;  4E3I A;  1RGY A;  1PI5 A;  3JYI A;  5GLA A;  4GN2 A;  1W79 A;  3BRM A;  4N92 A;  2Q9M A;  5DF8 A;  2JCH A;  4WEJ A;  3V3R A;  3WS5 A;  1XP4 A;  2EX2 A;  3GRJ A;  5FI7 A;  3ZCZ A;  1EI5 A;  4S2N C;  1IEM A;  3C7U A;  3O88 A;  4JF6 A;  4P0M A;  2ZC3 B;  4FCF A;  2EXA A;  2ZQ9 A;  1CK3 A;  5AQ7 A;  3FYZ A;  5DF7 A;  3BYD A;  5CHU A;  4KQO A;  4KZ4 A;  5FI6 A;  5HAR A;  3IXG A;  2E8I A;  3UDI A;  4YIN A;  1XGI A;  3HLE A;  2ZC4 B;  2OLU A;  5HL1 A;  3ITA A;  3BFE A;  2J7V A;  1KE3 A;  4LEN A;  5GHZ A;  1G6A A;  3G35 A;  3ZFZ A;  1K6R A;  4XUX A;  3ITB A;  3IXH A;  1J9M A;  2IWD A;  1DJB A;  5TFQ A;  1FOF A;  2Y2K A;  4WZ5 A;  4ZAM A;  5FQ9 A;  4OQH A;  1K55 C;  5GLB A;  4S2M A;  1WYB A;  3BLM A;  3OC2 A;  1ZKJ A;  2OV5 A;  4R3B A;  1GA9 A;  3VP1 A;  4GD6 A;  1IEL A;  3M2J A;  4E6W A;  4C75 A;  3PAE A;  3GQZ A;  1L0G A;  4BL2 A;  3N8R A;  4L0L A;  1XXM A;  4FH4 A;  1ERQ A;  3FV7 A;  3GTC A;  5E2F A;  1MWT A;  4IVK A;  2XLN A;  4LV1 A;  5CEB A;  4X69 A;  5EEC A;  3IXD A;  3MFD A;  5M1A A;  4DE2 A;  1CEG A;  4XXR A;  4E3K A;  1NJ4 A;  5KSC A;  3VOY A;  4FH2 A;  4JXV A;  3MKE A;  2RL3 A;  3BFC A;  2P9V A;  2Y2I A;  3NY4 A;  3HLG A;  3ZHH A;  2BLS A;  2XEP A;  3LY4 A;  3ZG8 B;  2WZX A;  2ZM8 A;  3LO7 A;  4S2O A;  1HVB A;  1MWR A;  4K0X A;  4MBH A;  1PW8 A;  4Y0O A;  5E43 A;  1WYC A;  3BEC A;  1VM1 A;  5FQK A;  3GR2 A;  4R1G A;  4HBT A;  4ZJ1 A;  3Q7Z A;  4IED A;  1BLC A;  1PZP A;  3MZF A;  2X01 A;  4MNR A;  1W7F A;  3GMW A;  5L2F A;  4OON A;  3V3S A;  5HW3 A;  3VP4 A;  2XD1 A;  3NI9 A;  4DE0 A;  5TR7 A;  4DE1 A;  5FAQ A;  2DNS A;  5CXW A;  1HTZ A;  5F1F A;  5CGS A;  3ZG5 A;  4BEN A;  5FAT A;  3EQU A;  4OH0 A;  1MXO A;  3HBR A;  3WRZ A;  4B88 A;  1RGZ A;  2WYX A;  5CGX A;  1W8Q A;  1TDG A;  2QPN A;  4OPQ A;  4OOY A;  2Z2L B;  5G18 A;  3CZD A;  5HAP A;  4WMC A;  4QB8 A;  3UE3 A;  1LI0 A;  3HLF A;  3G34 A;  5HFO A;  3UE1 A;  4P87 A;  2P74 A;  3MZE A;  4KG6 A;  2WKE A;  1SHV A;  4UA7 A;  4E3M A;  4CJN A;  1BLP A;  2Y2L A;  3C5A A;  3NC8 A;  5EVI D;  1KVL A;  4UAA A;  2R9X A;  3SH8 A;  3WS1 A;  4OQI A;  1GHP A;  1PI4 A;  2J9P A;  4S2K A;  2XQZ A;  3A3J A;  4KG2 A;  3PBT A;  1BTL A;  3S22 A;  2WKH A;  4KZB A;  4LCL A;  4NET A;  1TEM A;  1MPL A;  2JE5 A;  2QMI A;  2ZQC A;  4OLD A;  4KZ6 A;  1JWZ A;  1LL9 A;  1XKZ A;  2Q9N A;  4DRT A;  2CC1 A;  3IF5 A;  1MWU A;  1IKI A;  1NYY A;  2H5S A;  4X68 A;  3O87 A;  3QHY A;  3Q82 A;  1K57 A;  3CMZ A;  1YLT A;  3DWK A;  1MBL A;  1GA0 A;  2C6W B;  1ERM A;  4HBU A;  3DTM A;  5KZH A;  3P09 A;  4GDN A;  4KZ7 A;  1GHI A;  1MWS A;  1KDW A;  4KZ9 A;  4LV2 A;  4KQR A;  2EFX A;  4RX2 A;  4JPM A;  3V50 A;  3WS2 A;  1CI8 A;  5GLC A;  3N4I A;  1RCJ A;  4GDB A;  4U3T A;  3UDF A;  1YLP A;  4R0Q A;  3V5M A;  4MLL A;  5M18 A;  1JTD A;  1VQQ A;  3ZVW A;  3SS5 A;  1ZG4 A;  1ZG6 A;  1YLY A;  5TGF A;  3TG9 A;  1KDS A;  3W4Q A;  1ESI A;  2EX6 A;  1I2W A;  3SS4 A;  3HRE A;  1GHM A;  3Q07 A;  1FCN A;  1FSW A;  3A3E A;  5GHX A;  3VSL A;  4WZ5 C;  4EV4 A;  1OME A;  3IHA A;  4OPY A;  3V39 A;  4OLG A;  4E3L A;  4FSF A;  5D3O A;  4C3Q A;  3WWX A;  3A3D A;  3LEZ A;  5CEC A;  1M40 A;  5EOO A;  3Q7V A;  1IYQ A;  2J9O A;  4MBF A;  3Q81 A;  5FA7 A;  2EX9 A;  1LHY A;  2ZQD A;  4O7D A;  3P98 A;  1GCE A;  1NXY A;  4E3J A;  2VGJ A;  4BL3 A;  4K0W A;  3VFH A;  1S6R A;  5GHY A;  5CTM A;  4NK3 A;  3VP2 A;  3IH9 A;  3C4P A;  3IWQ A;  3NCK A;  2HP9 A;  3S1Y A;  4HES A;  1ES5 A;  3W4O A;  4BQM A;  3I7J A;  3CG5 A;  4LV0 A;  4R23 A;  5F1G A;  3PBO A;  5FQI A;  2ZMA A;  5EVI A;  4BLM A;  3UO9 A;  3AGD A;  4H8R A;  4GOG A;  1HD8 A;  1WE4 A;  4QY6 A;  5AQA A;  2EX8 A;  1JWV A;  4LV3 A;  4EQI A;  4OOL A;  2Y2M A;  5FAS A;  4WM9 A;  2Y59 A;  5E2E A;  3HUO A;  2ZC6 B;  3C7V A;  4ID4 A;  2PBY A;  4JKT A;  4WZ4 A;  1PW1 A;  2P9V B;  5EUA A;  3UPO A;  5CRF A;  3NDE A;  3Q1F A;  2ZC7 A;  3MZD A;  2V1Z A;  3OPR A;  3SS3 A;  1CEF A;  1E3U D;  1K54 A;  1K56 D;  5I94 A;  1YLW A;  1DY6 A;  1QME A;  2WUQ A;  3EQV A;  4QD4 A;  2V20 A;  3M6B A;  5F82 A;  5E2H A;  3VP0 A;  2C5W B;  1Y54 A;  2XH9 A;  5KMW A;  1N4O A;  2XFS A;  1O07 A;  4X53 A;  4ZTK A;  1ALQ A;  5FQQ A;  2WGW A;  2UWX A;  3HVF A;  3A3I A;  4WBG A;  1AXB A;  2DCF A;  1XX2 A;  3G4P A;  4U0X A;  5DTT A;  1ERO A;  3QNB A;  2Y2G A;  2OLV A;  2HDR A;  2HDQ A;  3PTE A;  4UA6 A;  2IWC A;  3G2Z A;  1IKG A;  3ZNT A;  1SDN A;  4ZJ2 A;  1YQS A;  1TVF A;  5A92 A;  3OCL A;  5CED A;  1K6S A;  5FAO A;  2HPB A;  1SCW A;  4DDY A;  3ZG0 A;  2WK0 A;  2ZM2 A;  2WGI A;  4JXW A;  4ZDX A;  3VP3 A;  4GD8 A;  2EXB A;  4HEF A;  4EUZ A;  2Z2M B;  5DTK A;  3CJM A;  1DJA A;  3GSG A;  3IQA A;  4PM9 A;  4EWF A;  3IH8 A;  5M19 A;  4WYY A;  3MXR A;  3HUM A;  3G2Y A;  4JLF A;  4OVD A;  1NZU A;  2XDM A;  3LY3 A;  3NDG A;  1K4E A;  5FAP A;  1K57 C;  2EFU A;  1L0F A;  4Y0T A;  5FI2 A;  1NY0 A;  3FWL A;  2HDU A;  4MBK A;  1ES3 A;  3BFD A;  1PWD A;  1K25 A;  1H5X A;  5A91 A;  4GNU A;  1CI9 A;  5A90 A;  2BG1 A;  2ZQ7 A;  4CPK A;  3BM6 A;  4RX3 A;  4ZBE A;  4KEN B;  2H0Y A;  2Y2Q A;  4DE3 A;  2A49 A;  2HP6 A;  3IF6 B;  4N1H A;  4S2L A;  3IF6 A;  4E3O A;  3AGF A;  2H10 A;  3ISG A;  4KZ5 A;  4JBF A;  1ONG A;  3O86 A;  2A3U A;  3HL9 A;  5EOE A;  3ZVT A;  3UPP A;  2Y55 A;  1RP5 A;  3OPH A;  2DRW A;  3OZH A;  3VSK A;  3G31 A;  1BZA A;  3IT9 A;  5FQM A;  2Y2P A;  1PWC A;  3UDX A;  2FFF B;  4LCM A;  4RYE A;  2PU2 A;  3ZG9 B;  3NBL A;  1NRF A;  5GL9 A;  5EPH A;  1E3U A;  1ONH A;  3G32 A;  3HLW A;  1LI9 A;  3BLS A;  4JXS A;  5F83 A;  3OPP A;  4KG5 A;  5KSH A;  3DW0 A;  2ZD8 A;  5JYO A;  1LLB A;  3UY6 A;  3IHB A;  4IBR A;  1XGJ A;  2WAE A;  1L2S A;  4OKP A;  4Y0U A;  3IWI A;  2XK1 A;  1SKF A;  3GV9 A;  1FQG A;  3Q7V B;  4KQQ A;  1H8Y A;  2PU4 A;  2FFY A;  3BFF A;  2IWB A;  1NZO A;  3WS4 A;  4BD1 A;  1YLZ A;  5CTN A;  1ES2 A;  2Y2O A;  5EVI C;  1O7E A;  3SOI A;  4X56 A;  3N8L A;  4BD0 A;  1L0E A;  3LCE A;  3RXX A;  2HDS A;  4OPZ A;  2I72 A;  2WAD A;  4UA9 A;  4KZ8 A;  2JBF A;  2VGK A;  1FR6 A;  1MY8 A;  4OOM A;  4U0T A;  1KE4 A;  1KGG A;  5EVL A;  3C4O A;  4S2J A;  3ZG7 B;  1IYO A;  3DWZ A;  4Q8I A;  3NIA A;  3UN7 A;  2QZ6 A;  3PBN A;  4RVA A;  4Z9Q A;  5EVI B;  3UNW A;  1C3B A;  2ZC5 B;  3ZGA B;  2XD5 A;  4WMC D;  4QHC A;  4E6X A;  1IYS A;  1ZC2 A;  4DDS A;  4S2N A;  1FCO A;  2ZLY A;  1G68 A;  3FKW A;  4KZ3 A;  4PM6 A;  1K54 C;  1KVM A;  4QU3 A;  3ZNY A;  3MBZ A;  1L0D A;  2Y91 A;  3MKF A;  4R3J A;  4EBP A;  3ZDJ A;  3PBQ A;  5J8X A;  3PBS A;  4RA7 A;  3W8K A;  1BUE A;  4S2I A;  4KZA A;  4P6B A;  4Y7P A;  5HAI A;  1Q2Q A;  1Z6F A;  3E2K A;  2WGV A;  2Y2J A;  3B3X A;  2WAF A;  4OQ0 A;  1K38 A;  4IBX A;  3OCN A;  1YMS A;  2H0T A;  4JF5 A;  1YMX A;  4DXC A;  5IHV A;  3HLB A;  1K4F A;  1YLJ A;  2ZQA A;  5A93 A;  2JC7 A;  1FSY A;  3IWO A;  2G2U A;  2HP5 A;  3FKV A;  2X02 A;  1K55 A;  4OP8 A;  5HAQ A;  2Y2N A;  2ZQ8 A;  4E3N A;  4P85 A;  1XA7 A;  2G2W A;  2WGW B;  2V2F F;  1W8Y A;  1IYP A;  4UHU A;  1XA1 A;  4K91 A;  5FSR A;  3BFG A;  4DF6 A;  3FZC A;  4JF4 A;  5CHJ A;  3O3V A;  5JYP A;  3QNC A;  4GZB A;  3PBR A;  4PM8 A;  4EBL A;  4WEL A;  4WEK A;  3W4P A;  4OQG A;  1KGE A;  1S0W A;  3N6I A;  1U60 A;  2XGN A;  4GB7 A;  3S4X A;  2XR0 A;  4XUZ A;  1PWG A;  5U47 A;  1PIO A;  3BEB A;  5DVA A;  2XFT A;  4ZJ3 A;  4B4X A;  5DF9 A;  2B5R A;  3VMA A;  4QJG A;  4BJP A;  3IXB A;  1E25 A;  4DKI A;  1HZO A;  2R9W A;  5DTS A;  3M6H A;  1NYM A;  1BLS A;  2WZZ A;  4X6T A;  1BLH A;  3RJU A;  4B4Z A;  1DJC A;  5E2G A;  1FR1 A;  2J8Y A;  4OPR A;  3VOZ A;  1YM1 A;  2Y2H A;  3E2L A;  4MEZ A;  3TOI A;  5BOH A;  3VFF A;  1QMF A;  3UE0 A;  3IF6 C;  1N9B A;  2XF3 A;  4M3K A;  5CGW A;  4QY5 A;  1JWP A;  4JXG A;  1KGF A;  1JTG A;  4EBN A;  3D4F A;  3TSG A;  3N7W A;  1BUL A;  1XPB A;  1I5Q A;  2GDN A;  3WS0 A;  1E4D A;  3A3F A;  1KE0 A;  5FQJ A;  1EWZ A;  3HLC A;  2WKI A;  4A5R A;  2OSU A;  1M6K A;  2Y4A A;  1JVJ A;  1MKI A;  1ESU A;  1Q2P A;  4D2O A;  4N9L A;  4DXB A;  1BT5 A;  1PYY A;  4R4S A;  3SH7 A;  4PM7 A;  4S2P A;  4F94 A;  3HUN A;  4IVI A;  3RXW A;  4YFM A;  4C6Y A;  3UPN A;  1LL5 A;  3M2K A;  1ES4 A;  5CHM A;  5AQ9 A;  5HX9 A;  5CER A;  3N8S A;  4PM5 A;  1PZO A;  5AQB A;  5GLD A;  4PMA A;  3G30 A;  3OPL A;  4FD8 A;  3MXS A;  1K56 A;  4X55 A;  3WRT A;  1YT4 A;  1FCM A;  1H8Z A;  1TDL A;  3HLD A;  2X71 A;  1W5D A;  1SDE A;  3GVB A;  3AGE A;  4PPR A;  5FDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...