4E6WA

Clbp in complex with 3-aminophenyl boronic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
335
structure length
329
Chain Sequence
b'ERLSTLIHQRMQEAKVPALSVSVTIKGVRQRFVYGVADVASQKANTLDTVYELGSMSKAFTGLVVQILIQEGRLRQGDDIITYLPEMRLNYQGKPASLTVADFLYHTSGLPFSTLARLEAVAQQLRNENLLFAPGAKFSYASANYDVLGAVIENVTGKTFTEVIAERLTQPLGMSATVAVKGDEIIVNKASGYKLGFGKPVLFHAPLARNHVPAAYIHSTLPDMEIWIDAWLHRKALPATLREAMSNSWRGNSDVPLAADNRILYASGWFIDQNQGPYISHGGQNPNFSSCIALRPDQQIGIVALANMNSNLILQLCADIDNYLRIGKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ClbP peptidase
publication title The NRP peptidase ClbP as a target for the inhibition of genotoxicity, cell proliferation and tumorogenesis mediated by pks-harboring bacteria
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 98
structure length 329
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4e6wA00
1RGZA 1BSGA 1YMXA 4WM9A 4E6XA 3S4XA 2UWXA 5HAQA 4JF4A 2Z2LB 5FI6A 3ZCZA 4HBUA 3IF6B 2WUQA 4ZAMA 1ZG6A 1JTGA 4X53A 5AQBA 3FYZA 3W8KA 1ONGA 3PTEA 4E3JA 2ZQAA 4QU3A 5FQJA 1CEGA 1FSYA 3BFCA 3ITBA 3UDFA 5M19A 2ZLYA 3CG5A 3FZCA 3HLBA 4PM9A 3IWOA 1MPLA 5CHMA 5FQMA 1BTLA 4S2OA 5KSHA 1PWCA 1SKFA 2HP9A 2WAEA 3Q7VB 3GR2A 1K38A 3IHBA 4JBFA 1GA0A 4XUXA 1K55C 1WYCA 4GKUA 4E6WA 2WZZA 4WMCA 3CZDA 4NETA 5I94A 3UE0A 3BRMA 3GMWA 4QY5A 3O88A 3DWZA 1IYPA 1MWRA 3BFGA 1KDSA 1VM1A 2Z2MB 1DY6A 3LEZA 5L2FA 2Y59A 5FI2A 3WS0A 5CHJA 1I2SA 4UHUA 3UN7A 4XUZA 2XFTA 2EXBA 1H8YA 4KQOA 3TSGA 5A90A 3A3DA 3FV7A 3GV9A 4H8RA 3HLEA 4OQ0A 5CGSA 3WS4A 1RGYA 3MKEA 1O07A 3WS2A 3C4OA 4Z9QA 4ZTKA 1GCEA 5FQ9A 5GLCA 4BJPA 1L2SA 5F82A 4MNRA 3P09A 1JWZA 3ZNTA 4KENB 3A3JA 1FQGA 1K56A 3HUNA 1SHVA 1BT5A 2OLUA 4YINA 3UPPA 5EECA 1L0EA 3D4FA 4WEKA 3SH9A 4E3LA 3G2YA 3Q81A 1XPBA 3VP2A 4ID4A 4LV0A 4NK3A 3SOIA 3UPOA 1FR6A 3FKWA 1HD8A 4OPQA 1RCJA 3V3SA 1GA9A 4ZBEA 1BLCA 4RYEA 3WRTA 1Q2QA 4DXCA 5F1FA 2XR0A 1JVJA 3N7WA 4JXWA 4FSFA 4LV3A 1KGFA 1YLYA 3HUOA 2R9XA 5GLDA 4ZJ3A 1WE4A 3ZG9B 3DTMA 1K6RA 1PIOA 4EV4A 1ERMA 2J8YA 1BULA 5GLAA 1JTDA 4JXVA 4DE3A 4X68A 4FD8A 1KE0A 1H5XA 3LCEA 4R1GA 3LO7A 1L0GA 3Q07A 3VFFA 3E2LA 3IF6C 1PYYA 1BZAA 3OCLA 2C6WB 4OKPA 1C3BA 2PU4A 1LI9A 1PI4A 2DNSA 3N4IA 2ZQ7A 3G30A 3NDGA 4CJNA 1K56D 1U60A 4GDNA 2ZM0A 1KGEA 1BLSA 5FDHA 4Q8IA 1I5QA 3M2KA 5E2FA 3BFEA 4BQMA 1ES5A 3UDIA 1QMFA 3BLSA 3UPNA 2HPBA 1PW8A 2J9OA 4WZ4A 4B4ZA 5EVID 3Q7ZA 5DTTA 3VOZA 2DRWA 2V20A 2XGNA 2Y2JA 1TDLA 1MWSA 4OQHA 3M6BA 5D3OA 3BFDA 2IWCA 4B88A 4N9LA 3WRZA 4BLMA 1PWGA 5E43A 1ESUA 1BLHA 2IWBA 1YLPA 5EPHA 1E3UD 2GDNA 1M40A 4MBFA 4N92A 5KMWA 4HESA 2JC7A 4ZDXA 4QD4A 3N6IA 2WGWB 5EUAA 1SDNA 3HLGA 5CERA 3PAEA 4S2MA 5FI7A 1XGJA 1ES2A 3UE1A 1K55A 4XXRA 4U3TA 1FR1A 3IQAA 3C5AA 4OLDA 1NRFA 2WKEA 1LL5A 2HP5A 4O7DA 4WYYA 4R4SA 1FCNA 4GNUA 3G34A 4KZ3A 1CEFA 2ZC5B 1NJ4A 3PBSA 4U0XA 1ALQA 3NCKA 1EWZA 3UDXA 3IF5A 2EX8A 5FQIA 5G18A 4LCLA 3MFDA 3S1YA 4QJGA 4UA6A 4UA9A 1TEMA 4OOLA 2VGKA 3V50A 3RJUA 4S2PA 1N9BA 3V3RA 1LL9A 4LV2A 3O3VA 4OOMA 4PM7A 3N8SA 3VP4A 3UO9A 2V2FF 3MZDA 3SS3A 3IXDA 3IWQA 4OONA 2WADA 4R4RA 4WELA 5FSRA 3ZGAB 1K25A 3ITAA 4EUZA 5U47A 4RA7A 4OVDA 1L0FA 3PBRA 4X69A 4IVKA 4FH4A 4GD8A 4F94A 4DKIA 1I2WA 5CECA 1S6RA 4HBTA 2RL3A 3AGFA 4P6BA 5E2HA 3VFHA 3ZDJA 5KZHA 2H5SA 5JYPA 3HLDA 3GSGA 3NC8A 5J8XA 2WKHA 3HREA 3P98A 2ZQ9A 5HFOA 3HBRA 4GB7A 4X56A 4KZ7A 2PBYA 4GD6A 4DXBA 1K57C 1CI9A 1E25A 4EQIA 3IXHA 3HLWA 3IT9A 1MKIA 2EFXA 2A49A 2XH9A 1GHPA 4LENA 1NYYA 3NIAA 3IF6A 5GLBA 4S2JA 2XLNA 3BECA 3S22A 3V5MA 2EXAA 1YLJA 4A5RA 1YQSA 4BL3A 4C3QA 5BOHA 4KZ9A 2WZXA 1Y54A 2J7VA 2JBFA 3G35A 3O87A 3QNBA 3VOYA 3WWXA 1RP5A 1Q2PA 3Q82A 4PM8A 1EI5A 2OLVA 2QZ6A 3I7JA 1EROA 4OP8A 5JYOA 1K54C 2WKIA 4R3JA 3Q7VA 3WS1A 4E3MA 4WMCD 3HLCA 2X71A 1SDEA 4JF5A 2HP6A 3PBTA 1LLBA 3SH7A 3VSLA 2ZC7A 1LHYA 4DE0A 3ZVTA 4QY6A 5FQKA 3OZHA 2XD5A 5TFQA 2A3UA 4S2NC 2ZM2A 1W8YA 2IWDA 2I72A 4GOGA 3VP0A 2J9PA 3E2KA 2X01A 4R3BA 4BD1A 3G4PA 5FATA 3BFFA 5AQ7A 1NZUA 4UAAA 5CXWA 3IXGA 2WK0A 1H8ZA 1GHMA 3MKFA 2Y2NA 3O86A 5DTKA 3UNWA 4S2KA 4X6TA 5HARA 4GDBA 3ZG7B 2P74A 5HAPA 1VQQA 1KE4A 1YLWA 4BD0A 4DDYA 4OLGA 3MXRA 2EX9A 2VGJA 2Y2QA 3MXSA 2G2WA 4FCFA 1OMEA 3TG9A 2XK1A 2Y2IA 4KQQA 2XD1A 2Y2OA 3A3IA 4BL2A 4N1XA 5TGFA 1LI0A 2B5RA 2CC1A 4GN2A 2FFYA 1TDGA 4OP5A 1FSWA 5HAIA 3HL9A 3OPPA 4FH2A 3PBOA 4PM5A 3B3XA 3G32A 4QHCA 2EX2A 5CRFA 5EVIC 3UY6A 4KG2A 1MWTA 3SS5A 3IHAA 1IKGA 1XKZA 2HDUA 4JPMA 2Y2GA 1N4OA 3IXBA 1XA7A 4WEJA 3IH8A 5DF9A 5FA7A 3EQUA 1AXBA 4OQGA 4E3IA 3ISGA 5CTMA 4OPYA 4D2OA 4YFMA 3OC2A 4L0LA 1ES4A 3CJMA 2BLSA 4JXSA 4DF6A 3Q1FA 3GQZA 3PAGA 3LY3A 1FCOA 4GZBA 4RX3A 1O7EA 1L0DA 2X02A 4DRTA 1XGIA 4WZ5C 5EVLA 3EQVA 3QNCA 4Y0UA 2QMIA 2HDRA 3BYDA 5A93A 4KZAA 1PW1A 1K57A 3C4PA 4IBRA 4KZ4A 4M3KA 4MLLA 5FASA 3NDEA 4E3KA 2H10A 1MY8A 5TR7A 1FOFA 4K0XA 3MBZA 5GHZA 3M2JA 1KVMA 1HVBA 2ZQ8A 3C7VA 3MZEA 5FAPA 5A92A 1KDWA 1PZPA 4EBPA 1K4FA 4MEZA 1ESIA 1NXYA 5EE8A 3GVBA 3PBQA 2Y2MA 3N8LA 3HUMA 1K6SA 1HZOA 1XP4A 3LY4A 3RXXA 3A3EA 1TVFA 3DW0A 1MXOA 1NYMA 3N8RA 4OH0A 4KZ6A 3C7UA 1K54A 2ZM8A 3W4PA 4C75A 1W7FA 5AQAA 4DE1A 5HL1A 5EVIB 5M18A 5CGWA 4N9KA 5HW3A 2E8IA 2C5WB 1PI5A 3FKVA 5GHYA 3ZFZA 2WGWA 2ZC3B 3OPRA 1XX2A 4KZBA 4ZJ1A 3SS4A 2XQZA 2Y91A 5CEDA 1CI8A 5CHUA 1YLTA 1MBLA 4S2NA 1IYSA 2Y2PA 3VSKA 2V1ZA 1IKIA 4R0QA 1G68A 2XF3A 2P9VB 4P87A 3IWIA 3UE3A 2WGIA 3OPHA 3HLFA 5M1AA 3W4OA 2RCXA 4HEFA 1BUEA 3VP3A 2H0YA 3DWKA 3HVFA 1GHIA 1NY0A 1KVLA 3QHYA 1DJCA 4RX2A 2WYXA 1KGGA 3AGDA 1XXMA 1BLPA 5DTSA 5E2EA 2Q9MA 1YT4A 4JKTA 5AQ9A 5F83A 5FAOA 3VMAA 4BENA 1ZG4A 5KSCA 4KG6A 4JF6A 4JXGA 4E3NA 1KE3A 2JE5A 4KZ5A 4EBLA 4B4XA 3NY4A 3W4QA 4UA7A 4ZJ2A 3TOIA 2HDQA 1ES3A 4OOYA 3ZHHA 3ZG5A 2PU2A 5HX9A 1IYOA 2Y2KA 3CMZA 4P85A 4X55A 5DF8A 2FFFB 1QMEA 4U0TA 4WBGA 2G2UA 4K0WA 4C6YA 4EWFA 2WGVA 3JYIA 1M6KA 4KG5A 5EOOA 1IELA 4PMAA 3FWLA 1JWPA 5DVAA 4MBKA 5CGXA 5EVIA 1ZKJA 5CEBA 2Y2LA 4LV1A 5F1GA 2ZD8A 3BM6A 4PPRA 5IHVA 4OQIA 3AGEA 3V39A 1J9MA 4IBXA 1WYBA 4OPRA 5GL9A 1E4DA 1XA1A 1W8QA 2XEPA 3M6HA 3NBLA 3OCNA 5FQQA 2BG1A 2QPNA 3ZVWA 3OPLA 1E3UA 4N1HA 3A3FA 4DDSA 4Y0OA 2P9VA 2ZC6B 1ZC2A 1SCWA 1ONHA 5DF7A 3MZFA 1S0WA 1FCMA 4JLFA 3GRJA 4QB8A 5CTNA 5A91A 2XFSA 2EFUA 4WZ5A 2Q9NA 4RVAA 2ZJ9A 1W5DA 1YMSA 3G2ZA 4KZ8A 5FAQA 1HTZA 2ZMAA 2JCHA 3VP1A 2ZQDA 4K91A 2HDSA 1ERQA 3IH9A 3SH8A 2XDMA 4EBNA 1IEMA 1CK3A 4Y7PA 2R9WA 4S2IA 1YLZA 1DJBA 3RXWA 4Y0TA 4P0MA 2OV5A 3NI9A 3BLMA 2Y4AA 5EOEA 3GTCA 2EX6A 4R23A 2Y2HA 1W79A 1G6AA 2OSUA 1Z6FA 2ZQCA 4KQRA 1MWUA 3ZG0A 1K4EA 1IYQA 5GHXA 3ZG8B 2Y55A 2DCFA 3G31A 4S2LA 1PWDA 1DJAA 4IEDA 1PZOA 4DE2A 4CPKA 5E2GA 2H0TA 2ZC4B 4LCMA 4OPZA 4MBHA 4E3OA 3PBNA 1NZOA 2WAFA 3WS5A 1YM1A 3ZNYA 1JWVA 4IVIA 3BEBA 4PM6A
chains in the Genus database with same CATH superfamily
4CLCD 5HDDA 2J3TD 3S4XA 2UWXA 4JF4A 3EEAA 2Z2LB 4HBUA 2YKFA 4ZAMA 1ZG6A 4KUKA 4BBTA 2ZQAA 1EW0A 1CEGA 1FSYA 3ITBA 3FPVA 1MPLA 3KYZA 2WAEA 2HP9A 3GR2A 1GA0A 1OTEA 3UE6A 3F1OA 1K55C 1WYCA 3P7NA 4E6WA 2WZZA 4WMCA 4NETA 3DTEA 2OAQ1 2VLGA 2Y59A 5FI2A 3H9WA 1I2SA 2EXBA 2QJ5A 4KQOA 1NLZA 3FV7A 3HLEA 4HH2A 4BJPA 3L9KA 4GJ4A 1JWZA 1K56A 2ACGA 1SHVA 4YINA 5EECA 1L0EA 2W1TB 3OOVA 3G2YA 4LV0A 4NK3A 3UPOA 3D72A 3VE4A 4ZBEA 4RYEA 1JVJA 4FSFA 2FH5A 1OTAA 2L1MA 4UEYA 5GLDA 1PIOA 4EV4A 2J8YA 5GLAA 3BY8A 3Q07A 3VFFA 3IF6C 1PYYA 1LI9A 2DNSA 3N4IA 4CJNA 4GDNA 1KGEA 4Q8IA 1I5QA 5HDSA 3BFEA 3UDIA 3UPNA 3EOIA 3UB5P 2V20A 5HL6A 1MWSA 2IWCA 5KIZA 2PAVP 3NJAA 1ESUA 4EXOA 1YLPA 5EPHA 3HJIA 2GDNA 5KMWA 4HESA 4R3AA 3EGXC 1FR1A 3IQAA 4G3WA 1CEFA 4ETZA 4U0XA 3OBFA 3NCKA 2J3TC 4NXGA 3C30A 1P0ZA 3S1YA 4UA6A 4EETB 3RJUA 4S2PA 1N9BA 4LV2A 4PM7A 3N8SA 3UO9A 3MZDA 2ZL1B 4R4RA 4Y2FA 4NKPA 5L07A 3O5YA 4H6JB 3G6OA 1L0FA 3PBRA 4Y13A 1I2WA 1S6RA 3VFHA 1ODVA 3MQQA 3NC8A 5HFOA 2ZQ9A 4I5SA 1E25A 1MKIA 2EFXA 2A49A 3NIAA 4GHIB 2W27A 1YLJA 4WLAA 1YQSA 4BL3A 5HWVA 2HGVA 1Y54A 2J7VA 3VOYA 3O87A 3OLOA 2M7UA 1OJGA 3WWXA 1Q2PA 1EI5A 1JNUA 2OLVA 2QZ6A 1EROA 4OP8A 1K54C 2WKIA 3H7WA 3Q7VA 1S4SA 4WMCD 3QP4A 5HZHA 3PBTA 4DE0A 3ZVTA 4QY6A 3T4SA 2XD5A 2A3UA 2PYRA 1W8YA 4L9FA 4B9OA 2Z6CA 5FEGA 2XA7M 1XFNA 2Y2NA 3O86A 5DTKA 2YKHA 5HARA 2LB5A 1YLWA 4DDYA 2G2WA 3TG9A 4NG2A 4FUWA 1PNEA 4N1XA 4O01A 4OP5A 2CC1A 1OTBA 1TDGA 4PM5A 4FH2A 2JKRI 2EX2A 3FC7A 4HIAA 4KG2A 3SS5A 3IHAA 2HDUA 1N4OA 1XA7A 5HPFA 3IH8A 1DP8A 3PXPA 3BJNA 4L9GA 1PRQA 5CTMA 4OPYA 4YFMA 1ES4A 4F3LB 3Q1FA 3BW6A 4QWOA 2W3GA 2HDRA 1PW1A 3C4PA 4IBRA 4KZ4A 4LFUA 4MLLA 4E3KA 3CAXA 5AVFA 1MY8A 5HSQA 1KVMA 2ZQ8A 5A92A 3KSGA 1PZPA 1K4FA 1P97A 3LY4A 1NYMA 4ESPA 3CPTB 4KZ6A 4C75A 4DE1A 1W7FA 4EERA 3T12B 1XX2A 4O8GA 5CHUA 1YLTA 2V1AA 3T1XA 1IYSA 5J3WA 3IWIA 5FL3A 3UE3A 2WGIA 1CF0A 2WKQA 3VP3A 2H0YA 3QHYA 4HJ6A 1KGGA 3AGDA 5DTSA 1BLPA 2W3HA 4JKTA 1YT4A 3A0RA 5AQ9A 1K0KA 5FAOA 4BENA 3F1NA 4KG6A 4LRYC 4B93A 4EBLA 3U2AA 1NRJA 4UA7A 3TOIA 1ES3A 4OOYA 2G2UA 4C6YA 2W0NA 3CPTA 4KG5A 1S1YA 5DVAA 5CEBA 2ZOIA 4UQIM 4HP4A 3FG8A 4PKYG 3NBLA 3RH8B 1BYWA 2QPNA 1N9NA 3LIFA 1ZC2A 1ONHA 3MZFA 4CLCA 2EFUA 1YKDA 4WZ5A 1ZHHB 4RVAA 1W5DA 1YMSA 5A8BA 2XA7S 3CITA 3CUEA 3IH9A 2XDMA 1IEMA 2R9WA 4S2IA 1DJBA 4P0MA 2OV5A 1S4RA 3BLMA 4L9EA 5EOEA 5HPIA 1G6AA 1Z6FA 4KQRA 1DP6A 1ZTUA 2Y55A 3G31A 1PWDA 1DJAA 4XT2B 2ZC4B 1NZOA 3BY9A 3R4KA 1DP9A 1YM1A 4MMNA 2VJWA 4PM6A 1YSPA 3ZQ5A 4WM9A 1TS8A 5HAQA 3RTYA 2WUQA 3V67A 2VGLM 4X53A 3FYZA 3W8KA 3PTEA 4P6ZM 5M19A 3FZCA 4PM9A 5CHMA 2K31A 4XUXA 4BBUA 1F98A 3UE0A 4QY5A 4WN5A 3O88A 3CWFA 1IYPA 3LEZA 5L2FA 1DY6A 5CHJA 1H8YA 3A3DA 3GV9A 5I5LA 5DKLA 1GCEA 5F82A 4WF0A 3ZNTA 4KENB 3HUNA 1BT5A 2OLUA 2VV6A 3SH9A 4E3LA 5TBMB 3Q81A 2PDRA 1FR6A 3QP6A 3V3SA 1GA9A 4LGWA 3T1RA 4BMWA 5IS1A 2H28A 1Q2QA 1LL8A 2XR0A 1UWNX 3KSFA 2NUTC 4M4XA 4LV3A 1KGFA 3HUOA 4ZJ3A 1H8MA 2VZWA 1BULA 1XJ4A 1KE0A 3LCEA 4R1GA 1P9WA 3OCLA 2C6WB 2A24B 1PI4A 3L7HA 3G30A 4UQIS 3NDGA 2ZM0A 3EEHA 3E4OA 1TS7A 1QMFA 2HPBA 1PW8A 2J9OA 4WZ4A 4B4ZA 5HWTA 5DTTA 2P04A 2Y2JA 3M6BA 3SZTA 1BLHA 2KLIA 2IWBA 4JGOA 1M40A 5F68A 3QP2A 4QD4A 3N6IA 3HLGA 3UE1A 3PAEA 1T18A 5FI7A 4XXRA 3C5AA 1NRFA 4GLQA 4GNUA 3G34A 4PHTA 1EWZA 3UDXA 3IF5A 5FQIA 4HJ4A 2D02A 3V50A 5CEDA 3O3VA 3IX8A 1VETB 4WELA 3ZGAB 2KOIA 1F5MA 2PR6A 4MDZA 4OVDA 1UGUA 3SW1A 4F94A 1GSVA 2VGLS 4DKIA 4MN7A 4HBTA 2ZOHA 3T50A 2RL3A 4I3JA 3ZDJA 5KZHA 4P6ZS 3LUQA 3RFBA 2WKHA 2MJ6A 3P98A 3HBRA 4X56A 4IUKA 3GECA 3HLWA 3IT9A 4Y17A 4KUOA 3TW8A 1GHPA 4GCZA 4HOIA 5GLBA 4S2JA 3BECA 3V5MA 2EXAA 2WZXA 2JBFA 5DJTA 3VE3A 4JGPA 4PM8A 4YNRA 5JYOA 3WS1A 1SZVA 3HLCA 4JF5A 4YOFA 2HP6A 3SH7A 1T1CA 5FQKA 5TFQA 2W3FA 4NXEA 2V9AA 2I72A 3KYQA 3E2KA 1SKOB 3G4PA 1NZUA 4UAAA 5CXWA 1A0KA 3LICA 4X6TA 3ZG7B 2P74A 3UB6A 1KE4A 4BD0A 4QPRA 1WA9A 1XJ6A 2P7JA 3MXSA 2W1TA 3A3IA 5TGFA 2B5RA 4GN2A 3DBAA 3B3XA 1L3LA 3LIEA 4JPMA 4LRZE 2EWVA 4WEJA 5FA7A 3EQUA 1AXBA 4OQGA 4E3IA 3ISGA 4D2OA 4Q0IA 3OC2A 5HD5A 1ACFA 3CJMA 2BLSA 4JXSA 3PAGA 4O0PA 4RX3A 4CLCC 3ZYTA 4DRTA 4ETXA 1XGIA 4WZ5C 5EVLA 3F1PB 3EQVA 4FOFA 1K57A 4M3KA 4ME4A 3NDEA 3CUEC 2H10A 4DMZA 4G3KA 4K0XA 3C7VA 3TRCA 4MEZA 5K5BA 3CI6A 1HZOA 3QP1A 1XP4A 3DW0A 2ZM8A 5L8MA 5EVIB 2C5WB 5GHYA 3FKVA 4X1LA 3CLOA 3NECA 3A0VA 4ZJ1A 3W2ZA 4S2NA 2Y2PA 4Y5FA 1IKIA 1G68A 2XF3A 2HV1A 4Y3IA 4YWZA 3HLFA 3W4OA 4HEFA 1BUEA 4RX2A 3DWKA 3HVFA 1GHIA 1KVLA 1DJCA 2V0WA 4BLMA 2Q9MA 5KSCA 1ZG4A 3EGDC 4E3NA 1G28A 2ZL1A 4Q0JA 5F5YA 2V1BA 3NY4A 3W4QA 5IT5A 3MSHA 3ZG5A 1IYOA 4X55A 1QMEA 4H6JA 4BBVA 2OWJA 4EWFA 2WGVA 4DJ3A 4MBKA 5CGXA 5EVIA 2JHEA 2Y2LA 4PPRA 5IHVA 4OQIA 3AGEA 3T1QB 2HJEA 1WYBA 5GL9A 1TD5A 2M1CA 5EM1A 3ICYA 5FQQA 1E3UA 4N1HA 3A3FA 1S0WA 4QB8A 5A91A 4GHIA 2XFSA 1H3QA 5AJGA 3E0YA 2ZJ9A 4R38A 2ZMAA 1OTIA 1TS0A 3VP1A 1OT9A 3SH8A 2Z6DA 5FEFA 4EBNA 1CK3A 3LIBA 3NI9A 2ZBBA 5J4EA 1W79A 1HLUP 2ZQCA 5LBRA 4IUHA 1IYQA 5GHXA 4GS9B 2DCFA 4S2LA 4DE2A 5E2GA 3K3DA 1P9RA 4LCMA 1W63M 3WS5A 1JWVA 1BSGA 4EU0A 5FI6A 3ZCZA 3KSHA 4EESA 3UB8A 3DTIA 1CQAA 3IF6B 3MQOA 3UB9A 1JTGA 5G4YA 5AQBA 2VA0A 1ONGA 4E3JA 2WKRA 3UDFA 2ZLYA 1BTLA 5KSHA 1SKFA 1K38A 3T4LA 4F3LA 5I94A 4NXBA 3GMWA 5CX7A 3BFGA 1KDSA 1VM1A 1T19A 3WS0A 4UHUA 4XUZA 2XFTA 2JKFA 3TSGA 4KQDA 5HDCA 5A90A 4H8RA 5CGSA 3NOUC 3WS4A 3WS2A 3MKEA 3C4OA 4LLOB 4Z9QA 4ZTKA 5FQ9A 5GLCA 3T4JA 1L2SA 3A3JA 3LI9A 3UPPA 3NULA 3SOIA 3FKWA 3LR4A 3WRTA 2O9AA 4I38A 5F1FA 4JXWA 3HCYA 1OPXA 1YLYA 2R9XA 1WE4A 1S1ZA 3IS2B 1LSWA 1F9IA 1JTDA 4JXVA 2XROA 4DE3A 4FD8A 1H5XA 4I3AA 4WUJA 3E2LA 5DFXA 1BZAA 4OKPA 1C3BA 3DAVA 1LSXA 2HJ9C 3IBRA 3IBJA 1U60A 3KYEA 3M2KA 4Y15A 4BQMA 1ES5A 4R70A 3B47A 2JN7A 2B95A 5EVID 3NHQA 3LIDA 1TDLA 4OQHA 5D3OA 1IFQA 3WRZA 2UV0E 1PWGA 2FZ0A 5IU1A 5EV0A 1E3UD 4N92A 4NEED 4LPZA 2WGWB 3IS2A 5EUAA 1SDNA 3BQAA 5CERA 4S2MA 1XGJA 1ES2A 4Q0HA 4OLDA 1XJ2A 2WKEA 4O7DA 4R4SA 1LT0A 2JKRM 1XFQA 3PBSA 1ALQA 5TJJA 3VOLA 4LCLA 4UA9A 3BWLA 2VGKA 3VP4A 3V3RA 1LL9A 5HD3A 3SS3A 3IXDA 5FSRA 2WADA 1K25A 3JVVA 1CJFA 4RA7A 1V9ZA 1X0OA 2HZ5A 4X69A 4IVKA 4XT2A 4DN0A 4GD8A 2A2LA 3AGFA 4P6BA 5E2HA 2H5SA 3MR0A 5JYPA 5J8XA 4GB7A 4KZ7A 4ZRRA 1K57C 3H82B 1VEUB 1N9OA 4LENA 1NYYA 4A5RA 2XLNA 3S22A 4C3QA 4KZ9A 3G35A 5C5KA 1TF1A 2QKPA 5DJUA 5EFWA 3I7JA 1YSQA 2EA9A 3E98A 4R3JA 4E3MA 3LEQA 4MN6A 2X71A 1SDEA 1LLBA 2ZC7A 3NOTC 2W3EA 4S2NC 2ZM2A 3R7WB 2O9CA 2IWDA 4GOGA 4BD1A 3MQ0A 3BFFA 3IXGA 2WK0A 2B02A 5HAPA 2BTFP 1VQQA 1D1JA 4OLGA 2VGJA 2Y2QA 4FCFA 1OMEA 1S67L 5TBMA 1NLYA 2QJ7A 5MC7A 5DFYA 2XD1A 2Y2OA 4BL2A 5G4ZA 2FFYA 1AWIA 3D9YA 1FSWA 3HL9A 3OPPA 5CRFA 5EVIC 1XJ3A 2O99A 2PD7A 5DF9A 3C38A 1D06A 2KX6A 1J3WA 1Y4OA 1OT6A 3GQZA 3LY3A 1FCOA 3ULFA 4GZBA 1L0DA 2A24A 4Y0UA 2IA2A 2QMIA 3BYDA 4KZAA 5TR7A 1FOFA 3MBZA 2EWWA 3UB7A 3M2JA 1HVBA 3MZEA 5FAPA 4EBPA 5EE8A 3GVBA 2Y2MA 3N8LA 3HUMA 1K6SA 3A3EA 3GDIA 4OH0A 3W4PA 5CGWA 2E8IA 3OPRA 4KZBA 2XQZA 2Y91A 1CI8A 2M7VA 1MBLA 1OTDA 2XRNA 3VSKA 2V1ZA 4R0QA 2P9VB 1OJ5A 3OPHA 5EM0A 5M1AA 3HJKA 2W1RA 1LSVA 4RQ9A 4EEUA 2O9BA 2PRFA 2WYXA 3VMAA 2PHYA 1KE3A 3PHYA 4KZ5A 3B42A 2VKSA 2W3DA 1VETA 5EVEA 2BASA 4PAUA 2HDQA 3ZHHA 5HX9A 2Y2KA 3CMZA 5DF8A 2FFFB 3VV4A 4K0WA 4AFIA 2J80A 1IELA 4PMAA 5EOOA 3T4KA 1FIKA 2J3WA 3IX4A 4LV1A 5F1GA 2VX8A 1J9MA 4IBXA 4OPRA 3M6HA 2XEPA 2L0WA 1PFLA 2QYBA 3ZVWA 3OPLA 4DDSA 3QP8A 2P9VA 1W63Q 5CTNA 3GRJA 2KDKA 3C2WA 4KZ8A 3G2ZA 5F69A 2JCHA 2I9VA 2OOLA 4K91A 1YAXA 1V9YA 4EEPA 2Y4AA 3GTCA 2EX6A 4R23A 2QWSA 4I3IA 1SKOA 3ZG8B 1MKMA 4IEDA 1PZOA 4IJGA 4JGQA 2H0TA 4E3OA 3PBNA 4EQ1A 3ZNYA 4IVIA 3BEBA 3MJQA 1RGZA 4E6XA 1YMXA 3PYPA 3NOPC 3MXQA 2ZMFA 2ZMVA 4LRXC 3S7OA 4MCWA 2AVXA 2QHKA 4QU3A 5FQJA 3BFCA 2GX5A 3CG5A 3HLBA 3IWOA 2JKTI 3LR3A 5FQMA 4S2OA 3H7WB 1PWCA 3Q7VB 2VV8A 3IHBA 4JBFA 4GKUA 3CZDA 3K3CA 3BRMA 3DWZA 1MWRA 2Z2MB 3F1PA 4PKYA 3UN7A 5DKKA 4OQ0A 5FASA 1RGYA 1TS6A 1O07A 3E4PA 2K2NA 4MNRA 5AVEA 3P09A 2PD8A 3C8CA 3U4LP 4HI4A 1FQGA 3D4FA 4WEKA 2K7SA 1XPBA 3VP2A 4ID4A 1HD8A 4OPQA 1RCJA 2Q0OA 1BLCA 4DXCA 3N7WA 3ZG9B 3DTMA 1K6RA 3D3OA 3T4TA 2OAP1 1ERMA 3LGOA 1UWPX 1T1AA 2GNXA 4X68A 3LO7A 1L0GA 2PU4A 1IOUA 3S7QA 2ZQ7A 1K56D 1BLSA 5FDHA 5E2FA 3BLSA 4GW9A 3UMDA 3Q7ZA 3VOZA 2DRWA 2XGNA 1Y28A 3BFDA 4B88A 4N9LA 4E04A 5E43A 3EWKA 4MBFA 2JC7A 3JVUA 4ZDXA 1K55A 4U3TA 1LL5A 2HP5A 4WYYA 1FCNA 1S66L 4KZ3A 3MFXA 2ZC5B 1NJ4A 4DJ2A 1VHMA 2EX8A 5G18A 4QJGA 3MFDA 2JKGA 4HNBA 1TEMA 4OOLA 1D7EA 3F1NB 4OOMA 2OWHA 2GZAA 2V2FF 3MS6A 2V8FA 4I39A 2GJ3A 3IWQA 4OONA 3ITAA 4EUZA 5U47A 2NUPC 1YPRA 4GS9A 1NWZA 4FH4A 3TE8A 5CECA 4G3VA 3LYXA 3UMEA 3HLDA 3GSGA 3HREA 4HP9A 2PBYA 3CHWP 4GD6A 4DXBA 2R78A 1CI9A 4EQIA 3IXHA 4HQAA 1G6OA 4X1MA 2XH9A 2VV7A 3IF6A 4HY8A 4CLCB 2VK3A 2L4RA 5BOHA 3QNBA 2JKTM 4HHDA 5F6AA 1RP5A 3Q82A 3S7PA 3FPWA 4MN5A 4EW7A 1GSXA 3TJZC 2O0YA 3A0SA 3VSLA 1LHYA 3OZHA 4CQHA 3VP0A 2J9PA 2X01A 4R3BA 5FATA 5AQ7A 1H8ZA 1GHMA 2CMNA 3MKFA 3UNWA 4S2KA 4GDBA 3MXRA 1N9LA 2EX9A 2XK1A 2Y2IA 4D60A 4KQQA 1LI0A 3K2NA 2XSSA 5HAIA 3PBOA 3G32A 4QHCA 1DRMA 3PR6A 4R6LA 3UY6A 4Z1WA 1MWTA 3KSIA 1IKGA 1XKZA 2Y2GA 2V8CA 3IXBA 1F2KA 4L0LA 5J7EA 4DF6A 1H0MA 4II7A 4ARZB 1O7EA 3B33A 2X02A 2V0UA 2VEAA 3LI8A 3QNCA 5A93A 3IX3A 5GHZA 2B18A 2Y8HA 3E4QA 2DMWA 1KDWA 1ESIA 1NXYA 3PBQA 3RXXA 1GSWA 1TVFA 1MXOA 5FDSA 3N8RA 3C7UA 1K54A 5M18A 5HL1A 5AQAA 3LR5A 2PR5A 4N9KA 3DTKA 5HW3A 3ZFZA 1PI5A 2WGWA 2ZC3B 3SS4A 2G7UA 3BQ8A 3QP5A 3KX0X 4ARZA 4P87A 4HJ3A 2INWA 2RCXA 4K08A 1FILA 1NY0A 5F83A 1XXMA 5E2EA 3LFVA 4JF6A 1T1BA 4JXGA 2JE5A 4B4XA 4EUVA 4ZJ2A 2PU2A 4P85A 4U0TA 4WBGA 3JPUA 3JYIA 1M6KA 5HWWA 5L09A 3FWLA 2PYPA 1JWPA 1KOUA 1ZKJA 2ZD8A 2WKPA 3BM6A 1Z09A 1MZUA 4IHQA 3V39A 2HF6A 1E4DA 4X25A 1XA1A 4BWIA 1W8QA 4WL9A 1G5UA 3OCNA 2BG1A 4Y0OA 3H82A 2ZC6B 1VEUA 4FTXA 1SCWA 3T4QA 5DF7A 2D01A 1FCMA 4JLFA 1VB6A 2Q9NA 3P01A 5FAQA 2Y79A 1HTZA 3KO6A 2PBDP 2E8JA 2ZQDA 3LR0A 3MMHA 2HDSA 1ERQA 2PT7A 1STZA 4Y7PA 1YLZA 3RXWA 3S7NA 4Y0TA 2P08A 2Y2HA 3T4OA 3R7WA 2OSUA 3MF0A 3LIAA 3F1OB 1MWUA 3ZG0A 1K4EA 4HH3A 5L10A 4CPKA 4CLCE 1MC0A 4NXFA 4OPZA 4MBHA 2WAFA 2LB9A 3T1SA 4JGRA
chains in the Genus database with same CATH topology
1RGZA 1BSGA 1YMXA 4WM9A 4E6XA 3S4XA 2UWXA 5HAQA 4JF4A 2Z2LB 5FI6A 3ZCZA 4HBUA 3IF6B 2WUQA 4ZAMA 1ZG6A 1JTGA 4X53A 5AQBA 3FYZA 3W8KA 1ONGA 3PTEA 4E3JA 2ZQAA 4QU3A 5FQJA 1CEGA 1FSYA 3BFCA 3ITBA 3UDFA 5M19A 2ZLYA 3CG5A 3FZCA 3HLBA 4PM9A 3IWOA 1MPLA 5CHMA 5FQMA 1BTLA 4S2OA 5KSHA 1PWCA 1SKFA 2HP9A 2WAEA 3Q7VB 3GR2A 1K38A 3IHBA 4JBFA 1GA0A 4XUXA 1K55C 1WYCA 4GKUA 4E6WA 2WZZA 4WMCA 3CZDA 4NETA 5I94A 3UE0A 3BRMA 3GMWA 4QY5A 3O88A 3DWZA 1IYPA 1MWRA 3BFGA 1KDSA 1VM1A 2Z2MB 1DY6A 3LEZA 5L2FA 2Y59A 5FI2A 3WS0A 5CHJA 1I2SA 4UHUA 3UN7A 4XUZA 2XFTA 2EXBA 1H8YA 4KQOA 3TSGA 5A90A 3A3DA 3FV7A 3GV9A 4H8RA 3HLEA 4OQ0A 5CGSA 3WS4A 1RGYA 3MKEA 1O07A 3WS2A 3C4OA 4Z9QA 4ZTKA 1GCEA 5FQ9A 5GLCA 4BJPA 1L2SA 5F82A 4MNRA 3P09A 1JWZA 3ZNTA 4KENB 3A3JA 1FQGA 1K56A 3HUNA 1SHVA 1BT5A 2OLUA 4YINA 3UPPA 5EECA 1L0EA 3D4FA 4WEKA 3SH9A 4E3LA 3G2YA 3Q81A 1XPBA 3VP2A 4ID4A 4LV0A 4NK3A 3SOIA 3UPOA 1FR6A 3FKWA 1HD8A 4OPQA 1RCJA 3V3SA 1GA9A 4ZBEA 1BLCA 4RYEA 3WRTA 1Q2QA 4DXCA 5F1FA 2XR0A 1JVJA 3N7WA 4JXWA 4FSFA 4LV3A 1KGFA 1YLYA 3HUOA 2R9XA 5GLDA 4ZJ3A 1WE4A 3ZG9B 3DTMA 1K6RA 1PIOA 4EV4A 1ERMA 2J8YA 1BULA 5GLAA 1JTDA 4JXVA 4DE3A 4X68A 4FD8A 1KE0A 1H5XA 3LCEA 4R1GA 3LO7A 1L0GA 3Q07A 3VFFA 3E2LA 3IF6C 1PYYA 1BZAA 3OCLA 2C6WB 4OKPA 1C3BA 2PU4A 1LI9A 1PI4A 2DNSA 3N4IA 2ZQ7A 3G30A 3NDGA 4CJNA 1K56D 1U60A 4GDNA 2ZM0A 1KGEA 1BLSA 5FDHA 4Q8IA 1I5QA 3M2KA 5E2FA 3BFEA 4BQMA 1ES5A 3UDIA 1QMFA 3BLSA 3UPNA 2HPBA 1PW8A 2J9OA 4WZ4A 4B4ZA 5EVID 3Q7ZA 5DTTA 3VOZA 2DRWA 2V20A 2XGNA 2Y2JA 1TDLA 1MWSA 4OQHA 3M6BA 5D3OA 3BFDA 2IWCA 4B88A 4N9LA 3WRZA 4BLMA 1PWGA 5E43A 1ESUA 1BLHA 2IWBA 1YLPA 5EPHA 1E3UD 2GDNA 1M40A 4MBFA 4N92A 5KMWA 4HESA 2JC7A 4ZDXA 4QD4A 3N6IA 2WGWB 5EUAA 1SDNA 3HLGA 5CERA 3PAEA 4S2MA 5FI7A 1XGJA 1ES2A 3UE1A 1K55A 4XXRA 4U3TA 1FR1A 3IQAA 3C5AA 4OLDA 1NRFA 2WKEA 1LL5A 2HP5A 4O7DA 4WYYA 4R4SA 1FCNA 4GNUA 3G34A 4KZ3A 1CEFA 2ZC5B 1NJ4A 3PBSA 4U0XA 1ALQA 3NCKA 1EWZA 3UDXA 3IF5A 2EX8A 5FQIA 5G18A 4LCLA 3MFDA 3S1YA 4QJGA 4UA6A 4UA9A 1TEMA 4OOLA 2VGKA 3V50A 3RJUA 4S2PA 1N9BA 3V3RA 1LL9A 4LV2A 3O3VA 4OOMA 4PM7A 3N8SA 3VP4A 3UO9A 2V2FF 3MZDA 3SS3A 3IXDA 3IWQA 4OONA 2WADA 4R4RA 4WELA 5FSRA 3ZGAB 1K25A 3ITAA 4EUZA 5U47A 4RA7A 4OVDA 1L0FA 3PBRA 4X69A 4IVKA 4FH4A 4GD8A 4F94A 4DKIA 1I2WA 5CECA 1S6RA 4HBTA 2RL3A 3AGFA 4P6BA 5E2HA 3VFHA 3ZDJA 5KZHA 2H5SA 5JYPA 3HLDA 3GSGA 3NC8A 5J8XA 2WKHA 3HREA 3P98A 2ZQ9A 5HFOA 3HBRA 4GB7A 4X56A 4KZ7A 2PBYA 4GD6A 4DXBA 1K57C 1CI9A 1E25A 4EQIA 3IXHA 3HLWA 3IT9A 1MKIA 2EFXA 2A49A 2XH9A 1GHPA 4LENA 1NYYA 3NIAA 3IF6A 5GLBA 4S2JA 2XLNA 3BECA 3S22A 3V5MA 2EXAA 1YLJA 4A5RA 1YQSA 4BL3A 4C3QA 5BOHA 4KZ9A 2WZXA 1Y54A 2J7VA 2JBFA 3G35A 3O87A 3QNBA 3VOYA 3WWXA 1RP5A 1Q2PA 3Q82A 4PM8A 1EI5A 2OLVA 2QZ6A 3I7JA 1EROA 4OP8A 5JYOA 1K54C 2WKIA 4R3JA 3Q7VA 3WS1A 4E3MA 4WMCD 3HLCA 2X71A 1SDEA 4JF5A 2HP6A 3PBTA 1LLBA 3SH7A 3VSLA 2ZC7A 1LHYA 4DE0A 3ZVTA 4QY6A 5FQKA 3OZHA 2XD5A 5TFQA 2A3UA 4S2NC 2ZM2A 1W8YA 2IWDA 2I72A 4GOGA 3VP0A 2J9PA 3E2KA 2X01A 4R3BA 4BD1A 3G4PA 5FATA 3BFFA 5AQ7A 1NZUA 4UAAA 5CXWA 3IXGA 2WK0A 1H8ZA 1GHMA 3MKFA 2Y2NA 3O86A 5DTKA 3UNWA 4S2KA 4X6TA 5HARA 4GDBA 3ZG7B 2P74A 5HAPA 1VQQA 1KE4A 1YLWA 4BD0A 4DDYA 4OLGA 3MXRA 2EX9A 2VGJA 2Y2QA 3MXSA 2G2WA 4FCFA 1OMEA 3TG9A 2XK1A 2Y2IA 4KQQA 2XD1A 2Y2OA 3A3IA 4BL2A 4N1XA 5TGFA 1LI0A 2B5RA 2CC1A 4GN2A 2FFYA 1TDGA 4OP5A 1FSWA 5HAIA 3HL9A 3OPPA 4FH2A 3PBOA 4PM5A 3B3XA 3G32A 4QHCA 2EX2A 5CRFA 5EVIC 3UY6A 4KG2A 1MWTA 3SS5A 3IHAA 1IKGA 1XKZA 2HDUA 4JPMA 2Y2GA 1N4OA 3IXBA 1XA7A 4WEJA 3IH8A 5DF9A 5FA7A 3EQUA 1AXBA 4OQGA 4E3IA 3ISGA 5CTMA 4OPYA 4D2OA 4YFMA 3OC2A 4L0LA 1ES4A 3CJMA 2BLSA 4JXSA 4DF6A 3Q1FA 3GQZA 3PAGA 3LY3A 1FCOA 4GZBA 4RX3A 1O7EA 1L0DA 2X02A 4DRTA 1XGIA 4WZ5C 5EVLA 3EQVA 3QNCA 4Y0UA 2QMIA 2HDRA 3BYDA 5A93A 4KZAA 1PW1A 1K57A 3C4PA 4IBRA 4KZ4A 4M3KA 4MLLA 5FASA 3NDEA 4E3KA 2H10A 1MY8A 5TR7A 1FOFA 4K0XA 3MBZA 5GHZA 3M2JA 1KVMA 1HVBA 2ZQ8A 3C7VA 3MZEA 5FAPA 5A92A 1KDWA 1PZPA 4EBPA 1K4FA 4MEZA 1ESIA 1NXYA 5EE8A 3GVBA 3PBQA 2Y2MA 3N8LA 3HUMA 1K6SA 1HZOA 1XP4A 3LY4A 3RXXA 3A3EA 1TVFA 3DW0A 1MXOA 1NYMA 3N8RA 4OH0A 4KZ6A 3C7UA 1K54A 2ZM8A 3W4PA 4C75A 1W7FA 5AQAA 4DE1A 5HL1A 5EVIB 5M18A 5CGWA 4N9KA 5HW3A 2E8IA 2C5WB 1PI5A 3FKVA 5GHYA 3ZFZA 2WGWA 2ZC3B 3OPRA 1XX2A 4KZBA 4ZJ1A 3SS4A 2XQZA 2Y91A 5CEDA 1CI8A 5CHUA 1YLTA 1MBLA 4S2NA 1IYSA 2Y2PA 3VSKA 2V1ZA 1IKIA 4R0QA 1G68A 2XF3A 2P9VB 4P87A 3IWIA 3UE3A 2WGIA 3OPHA 3HLFA 5M1AA 3W4OA 2RCXA 4HEFA 1BUEA 3VP3A 2H0YA 3DWKA 3HVFA 1GHIA 1NY0A 1KVLA 3QHYA 1DJCA 4RX2A 2WYXA 1KGGA 3AGDA 1XXMA 1BLPA 5DTSA 5E2EA 2Q9MA 1YT4A 4JKTA 5AQ9A 5F83A 5FAOA 3VMAA 4BENA 1ZG4A 5KSCA 4KG6A 4JF6A 4JXGA 4E3NA 1KE3A 2JE5A 4KZ5A 4EBLA 4B4XA 3NY4A 3W4QA 4UA7A 4ZJ2A 3TOIA 2HDQA 1ES3A 4OOYA 3ZHHA 3ZG5A 2PU2A 5HX9A 1IYOA 2Y2KA 3CMZA 4P85A 4X55A 5DF8A 2FFFB 1QMEA 4U0TA 4WBGA 2G2UA 4K0WA 4C6YA 4EWFA 2WGVA 3JYIA 1M6KA 4KG5A 5EOOA 1IELA 4PMAA 3FWLA 1JWPA 5DVAA 4MBKA 5CGXA 5EVIA 1ZKJA 5CEBA 2Y2LA 4LV1A 5F1GA 2ZD8A 3BM6A 4PPRA 5IHVA 4OQIA 3AGEA 3V39A 1J9MA 4IBXA 1WYBA 4OPRA 5GL9A 1E4DA 1XA1A 1W8QA 2XEPA 3M6HA 3NBLA 3OCNA 5FQQA 2BG1A 2QPNA 3ZVWA 3OPLA 1E3UA 4N1HA 3A3FA 4DDSA 4Y0OA 2P9VA 2ZC6B 1ZC2A 1SCWA 1ONHA 5DF7A 3MZFA 1S0WA 1FCMA 4JLFA 3GRJA 4QB8A 5CTNA 5A91A 2XFSA 2EFUA 4WZ5A 2Q9NA 4RVAA 2ZJ9A 1W5DA 1YMSA 3G2ZA 4KZ8A 5FAQA 1HTZA 2ZMAA 2JCHA 3VP1A 2ZQDA 4K91A 2HDSA 1ERQA 3IH9A 3SH8A 2XDMA 4EBNA 1IEMA 1CK3A 4Y7PA 2R9WA 4S2IA 1YLZA 1DJBA 3RXWA 4Y0TA 4P0MA 2OV5A 3NI9A 3BLMA 2Y4AA 5EOEA 3GTCA 2EX6A 4R23A 2Y2HA 1W79A 1G6AA 2OSUA 1Z6FA 2ZQCA 4KQRA 1MWUA 3ZG0A 1K4EA 1IYQA 5GHXA 3ZG8B 2Y55A 2DCFA 3G31A 4S2LA 1PWDA 1DJAA 4IEDA 1PZOA 4DE2A 4CPKA 5E2GA 2H0TA 2ZC4B 4LCMA 4OPZA 4MBHA 4E3OA 3PBNA 1NZOA 2WAFA 3WS5A 1YM1A 3ZNYA 1JWVA 4IVIA 3BEBA 4PM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGZ A;  1BSG A;  1YMX A;  4WM9 A;  4E6X A;  3S4X A;  2UWX A;  5HAQ A;  4JF4 A;  2Z2L B;  5FI6 A;  3ZCZ A;  4HBU A;  3IF6 B;  2WUQ A;  4ZAM A;  1ZG6 A;  1JTG A;  4X53 A;  5AQB A;  3FYZ A;  3W8K A;  1ONG A;  3PTE A;  4E3J A;  2ZQA A;  4QU3 A;  5FQJ A;  1CEG A;  1FSY A;  3BFC A;  3ITB A;  3UDF A;  5M19 A;  2ZLY A;  3CG5 A;  3FZC A;  3HLB A;  4PM9 A;  3IWO A;  1MPL A;  5CHM A;  5FQM A;  1BTL A;  4S2O A;  5KSH A;  1PWC A;  1SKF A;  2HP9 A;  2WAE A;  3Q7V B;  3GR2 A;  1K38 A;  3IHB A;  4JBF A;  1GA0 A;  4XUX A;  1K55 C;  1WYC A;  4GKU A;  4E6W A;  2WZZ A;  4WMC A;  3CZD A;  4NET A;  5I94 A;  3UE0 A;  3BRM A;  3GMW A;  4QY5 A;  3O88 A;  3DWZ A;  1IYP A;  1MWR A;  3BFG A;  1KDS A;  1VM1 A;  2Z2M B;  1DY6 A;  3LEZ A;  5L2F A;  2Y59 A;  5FI2 A;  3WS0 A;  5CHJ A;  1I2S A;  4UHU A;  3UN7 A;  4XUZ A;  2XFT A;  2EXB A;  1H8Y A;  4KQO A;  3TSG A;  5A90 A;  3A3D A;  3FV7 A;  3GV9 A;  4H8R A;  3HLE A;  4OQ0 A;  5CGS A;  3WS4 A;  1RGY A;  3MKE A;  1O07 A;  3WS2 A;  3C4O A;  4Z9Q A;  4ZTK A;  1GCE A;  5FQ9 A;  5GLC A;  4BJP A;  1L2S A;  5F82 A;  4MNR A;  3P09 A;  1JWZ A;  3ZNT A;  4KEN B;  3A3J A;  1FQG A;  1K56 A;  3HUN A;  1SHV A;  1BT5 A;  2OLU A;  4YIN A;  3UPP A;  5EEC A;  1L0E A;  3D4F A;  4WEK A;  3SH9 A;  4E3L A;  3G2Y A;  3Q81 A;  1XPB A;  3VP2 A;  4ID4 A;  4LV0 A;  4NK3 A;  3SOI A;  3UPO A;  1FR6 A;  3FKW A;  1HD8 A;  4OPQ A;  1RCJ A;  3V3S A;  1GA9 A;  4ZBE A;  1BLC A;  4RYE A;  3WRT A;  1Q2Q A;  4DXC A;  5F1F A;  2XR0 A;  1JVJ A;  3N7W A;  4JXW A;  4FSF A;  4LV3 A;  1KGF A;  1YLY A;  3HUO A;  2R9X A;  5GLD A;  4ZJ3 A;  1WE4 A;  3ZG9 B;  3DTM A;  1K6R A;  1PIO A;  4EV4 A;  1ERM A;  2J8Y A;  1BUL A;  5GLA A;  1JTD A;  4JXV A;  4DE3 A;  4X68 A;  4FD8 A;  1KE0 A;  1H5X A;  3LCE A;  4R1G A;  3LO7 A;  1L0G A;  3Q07 A;  3VFF A;  3E2L A;  3IF6 C;  1PYY A;  1BZA A;  3OCL A;  2C6W B;  4OKP A;  1C3B A;  2PU4 A;  1LI9 A;  1PI4 A;  2DNS A;  3N4I A;  2ZQ7 A;  3G30 A;  3NDG A;  4CJN A;  1K56 D;  1U60 A;  4GDN A;  2ZM0 A;  1KGE A;  1BLS A;  5FDH A;  4Q8I A;  1I5Q A;  3M2K A;  5E2F A;  3BFE A;  4BQM A;  1ES5 A;  3UDI A;  1QMF A;  3BLS A;  3UPN A;  2HPB A;  1PW8 A;  2J9O A;  4WZ4 A;  4B4Z A;  5EVI D;  3Q7Z A;  5DTT A;  3VOZ A;  2DRW A;  2V20 A;  2XGN A;  2Y2J A;  1TDL A;  1MWS A;  4OQH A;  3M6B A;  5D3O A;  3BFD A;  2IWC A;  4B88 A;  4N9L A;  3WRZ A;  4BLM A;  1PWG A;  5E43 A;  1ESU A;  1BLH A;  2IWB A;  1YLP A;  5EPH A;  1E3U D;  2GDN A;  1M40 A;  4MBF A;  4N92 A;  5KMW A;  4HES A;  2JC7 A;  4ZDX A;  4QD4 A;  3N6I A;  2WGW B;  5EUA A;  1SDN A;  3HLG A;  5CER A;  3PAE A;  4S2M A;  5FI7 A;  1XGJ A;  1ES2 A;  3UE1 A;  1K55 A;  4XXR A;  4U3T A;  1FR1 A;  3IQA A;  3C5A A;  4OLD A;  1NRF A;  2WKE A;  1LL5 A;  2HP5 A;  4O7D A;  4WYY A;  4R4S A;  1FCN A;  4GNU A;  3G34 A;  4KZ3 A;  1CEF A;  2ZC5 B;  1NJ4 A;  3PBS A;  4U0X A;  1ALQ A;  3NCK A;  1EWZ A;  3UDX A;  3IF5 A;  2EX8 A;  5FQI A;  5G18 A;  4LCL A;  3MFD A;  3S1Y A;  4QJG A;  4UA6 A;  4UA9 A;  1TEM A;  4OOL A;  2VGK A;  3V50 A;  3RJU A;  4S2P A;  1N9B A;  3V3R A;  1LL9 A;  4LV2 A;  3O3V A;  4OOM A;  4PM7 A;  3N8S A;  3VP4 A;  3UO9 A;  2V2F F;  3MZD A;  3SS3 A;  3IXD A;  3IWQ A;  4OON A;  2WAD A;  4R4R A;  4WEL A;  5FSR A;  3ZGA B;  1K25 A;  3ITA A;  4EUZ A;  5U47 A;  4RA7 A;  4OVD A;  1L0F A;  3PBR A;  4X69 A;  4IVK A;  4FH4 A;  4GD8 A;  4F94 A;  4DKI A;  1I2W A;  5CEC A;  1S6R A;  4HBT A;  2RL3 A;  3AGF A;  4P6B A;  5E2H A;  3VFH A;  3ZDJ A;  5KZH A;  2H5S A;  5JYP A;  3HLD A;  3GSG A;  3NC8 A;  5J8X A;  2WKH A;  3HRE A;  3P98 A;  2ZQ9 A;  5HFO A;  3HBR A;  4GB7 A;  4X56 A;  4KZ7 A;  2PBY A;  4GD6 A;  4DXB A;  1K57 C;  1CI9 A;  1E25 A;  4EQI A;  3IXH A;  3HLW A;  3IT9 A;  1MKI A;  2EFX A;  2A49 A;  2XH9 A;  1GHP A;  4LEN A;  1NYY A;  3NIA A;  3IF6 A;  5GLB A;  4S2J A;  2XLN A;  3BEC A;  3S22 A;  3V5M A;  2EXA A;  1YLJ A;  4A5R A;  1YQS A;  4BL3 A;  4C3Q A;  5BOH A;  4KZ9 A;  2WZX A;  1Y54 A;  2J7V A;  2JBF A;  3G35 A;  3O87 A;  3QNB A;  3VOY A;  3WWX A;  1RP5 A;  1Q2P A;  3Q82 A;  4PM8 A;  1EI5 A;  2OLV A;  2QZ6 A;  3I7J A;  1ERO A;  4OP8 A;  5JYO A;  1K54 C;  2WKI A;  4R3J A;  3Q7V A;  3WS1 A;  4E3M A;  4WMC D;  3HLC A;  2X71 A;  1SDE A;  4JF5 A;  2HP6 A;  3PBT A;  1LLB A;  3SH7 A;  3VSL A;  2ZC7 A;  1LHY A;  4DE0 A;  3ZVT A;  4QY6 A;  5FQK A;  3OZH A;  2XD5 A;  5TFQ A;  2A3U A;  4S2N C;  2ZM2 A;  1W8Y A;  2IWD A;  2I72 A;  4GOG A;  3VP0 A;  2J9P A;  3E2K A;  2X01 A;  4R3B A;  4BD1 A;  3G4P A;  5FAT A;  3BFF A;  5AQ7 A;  1NZU A;  4UAA A;  5CXW A;  3IXG A;  2WK0 A;  1H8Z A;  1GHM A;  3MKF A;  2Y2N A;  3O86 A;  5DTK A;  3UNW A;  4S2K A;  4X6T A;  5HAR A;  4GDB A;  3ZG7 B;  2P74 A;  5HAP A;  1VQQ A;  1KE4 A;  1YLW A;  4BD0 A;  4DDY A;  4OLG A;  3MXR A;  2EX9 A;  2VGJ A;  2Y2Q A;  3MXS A;  2G2W A;  4FCF A;  1OME A;  3TG9 A;  2XK1 A;  2Y2I A;  4KQQ A;  2XD1 A;  2Y2O A;  3A3I A;  4BL2 A;  4N1X A;  5TGF A;  1LI0 A;  2B5R A;  2CC1 A;  4GN2 A;  2FFY A;  1TDG A;  4OP5 A;  1FSW A;  5HAI A;  3HL9 A;  3OPP A;  4FH2 A;  3PBO A;  4PM5 A;  3B3X A;  3G32 A;  4QHC A;  2EX2 A;  5CRF A;  5EVI C;  3UY6 A;  4KG2 A;  1MWT A;  3SS5 A;  3IHA A;  1IKG A;  1XKZ A;  2HDU A;  4JPM A;  2Y2G A;  1N4O A;  3IXB A;  1XA7 A;  4WEJ A;  3IH8 A;  5DF9 A;  5FA7 A;  3EQU A;  1AXB A;  4OQG A;  4E3I A;  3ISG A;  5CTM A;  4OPY A;  4D2O A;  4YFM A;  3OC2 A;  4L0L A;  1ES4 A;  3CJM A;  2BLS A;  4JXS A;  4DF6 A;  3Q1F A;  3GQZ A;  3PAG A;  3LY3 A;  1FCO A;  4GZB A;  4RX3 A;  1O7E A;  1L0D A;  2X02 A;  4DRT A;  1XGI A;  4WZ5 C;  5EVL A;  3EQV A;  3QNC A;  4Y0U A;  2QMI A;  2HDR A;  3BYD A;  5A93 A;  4KZA A;  1PW1 A;  1K57 A;  3C4P A;  4IBR A;  4KZ4 A;  4M3K A;  4MLL A;  5FAS A;  3NDE A;  4E3K A;  2H10 A;  1MY8 A;  5TR7 A;  1FOF A;  4K0X A;  3MBZ A;  5GHZ A;  3M2J A;  1KVM A;  1HVB A;  2ZQ8 A;  3C7V A;  3MZE A;  5FAP A;  5A92 A;  1KDW A;  1PZP A;  4EBP A;  1K4F A;  4MEZ A;  1ESI A;  1NXY A;  5EE8 A;  3GVB A;  3PBQ A;  2Y2M A;  3N8L A;  3HUM A;  1K6S A;  1HZO A;  1XP4 A;  3LY4 A;  3RXX A;  3A3E A;  1TVF A;  3DW0 A;  1MXO A;  1NYM A;  3N8R A;  4OH0 A;  4KZ6 A;  3C7U A;  1K54 A;  2ZM8 A;  3W4P A;  4C75 A;  1W7F A;  5AQA A;  4DE1 A;  5HL1 A;  5EVI B;  5M18 A;  5CGW A;  4N9K A;  5HW3 A;  2E8I A;  2C5W B;  1PI5 A;  3FKV A;  5GHY A;  3ZFZ A;  2WGW A;  2ZC3 B;  3OPR A;  1XX2 A;  4KZB A;  4ZJ1 A;  3SS4 A;  2XQZ A;  2Y91 A;  5CED A;  1CI8 A;  5CHU A;  1YLT A;  1MBL A;  4S2N A;  1IYS A;  2Y2P A;  3VSK A;  2V1Z A;  1IKI A;  4R0Q A;  1G68 A;  2XF3 A;  2P9V B;  4P87 A;  3IWI A;  3UE3 A;  2WGI A;  3OPH A;  3HLF A;  5M1A A;  3W4O A;  2RCX A;  4HEF A;  1BUE A;  3VP3 A;  2H0Y A;  3DWK A;  3HVF A;  1GHI A;  1NY0 A;  1KVL A;  3QHY A;  1DJC A;  4RX2 A;  2WYX A;  1KGG A;  3AGD A;  1XXM A;  1BLP A;  5DTS A;  5E2E A;  2Q9M A;  1YT4 A;  4JKT A;  5AQ9 A;  5F83 A;  5FAO A;  3VMA A;  4BEN A;  1ZG4 A;  5KSC A;  4KG6 A;  4JF6 A;  4JXG A;  4E3N A;  1KE3 A;  2JE5 A;  4KZ5 A;  4EBL A;  4B4X A;  3NY4 A;  3W4Q A;  4UA7 A;  4ZJ2 A;  3TOI A;  2HDQ A;  1ES3 A;  4OOY A;  3ZHH A;  3ZG5 A;  2PU2 A;  5HX9 A;  1IYO A;  2Y2K A;  3CMZ A;  4P85 A;  4X55 A;  5DF8 A;  2FFF B;  1QME A;  4U0T A;  4WBG A;  2G2U A;  4K0W A;  4C6Y A;  4EWF A;  2WGV A;  3JYI A;  1M6K A;  4KG5 A;  5EOO A;  1IEL A;  4PMA A;  3FWL A;  1JWP A;  5DVA A;  4MBK A;  5CGX A;  5EVI A;  1ZKJ A;  5CEB A;  2Y2L A;  4LV1 A;  5F1G A;  2ZD8 A;  3BM6 A;  4PPR A;  5IHV A;  4OQI A;  3AGE A;  3V39 A;  1J9M A;  4IBX A;  1WYB A;  4OPR A;  5GL9 A;  1E4D A;  1XA1 A;  1W8Q A;  2XEP A;  3M6H A;  3NBL A;  3OCN A;  5FQQ A;  2BG1 A;  2QPN A;  3ZVW A;  3OPL A;  1E3U A;  4N1H A;  3A3F A;  4DDS A;  4Y0O A;  2P9V A;  2ZC6 B;  1ZC2 A;  1SCW A;  1ONH A;  5DF7 A;  3MZF A;  1S0W A;  1FCM A;  4JLF A;  3GRJ A;  4QB8 A;  5CTN A;  5A91 A;  2XFS A;  2EFU A;  4WZ5 A;  2Q9N A;  4RVA A;  2ZJ9 A;  1W5D A;  1YMS A;  3G2Z A;  4KZ8 A;  5FAQ A;  1HTZ A;  2ZMA A;  2JCH A;  3VP1 A;  2ZQD A;  4K91 A;  2HDS A;  1ERQ A;  3IH9 A;  3SH8 A;  2XDM A;  4EBN A;  1IEM A;  1CK3 A;  4Y7P A;  2R9W A;  4S2I A;  1YLZ A;  1DJB A;  3RXW A;  4Y0T A;  4P0M A;  2OV5 A;  3NI9 A;  3BLM A;  2Y4A A;  5EOE A;  3GTC A;  2EX6 A;  4R23 A;  2Y2H A;  1W79 A;  1G6A A;  2OSU A;  1Z6F A;  2ZQC A;  4KQR A;  1MWU A;  3ZG0 A;  1K4E A;  1IYQ A;  5GHX A;  3ZG8 B;  2Y55 A;  2DCF A;  3G31 A;  4S2L A;  1PWD A;  1DJA A;  4IED A;  1PZO A;  4DE2 A;  4CPK A;  5E2G A;  2H0T A;  2ZC4 B;  4LCM A;  4OPZ A;  4MBH A;  4E3O A;  3PBN A;  1NZO A;  2WAF A;  3WS5 A;  1YM1 A;  3ZNY A;  1JWV A;  4IVI A;  3BEB A;  4PM6 A; 
#chains in the Genus database with same CATH topology
 4CLC D;  5HDD A;  2J3T D;  3S4X A;  2UWX A;  4JF4 A;  3EEA A;  2Z2L B;  4HBU A;  2YKF A;  4ZAM A;  1ZG6 A;  4KUK A;  4BBT A;  2ZQA A;  1EW0 A;  1CEG A;  1FSY A;  3ITB A;  3FPV A;  1MPL A;  3KYZ A;  2WAE A;  2HP9 A;  3GR2 A;  1GA0 A;  1OTE A;  3UE6 A;  3F1O A;  1K55 C;  1WYC A;  3P7N A;  4E6W A;  2WZZ A;  4WMC A;  4NET A;  3DTE A;  2OAQ 1;  2VLG A;  2Y59 A;  5FI2 A;  3H9W A;  1I2S A;  2EXB A;  2QJ5 A;  4KQO A;  1NLZ A;  3FV7 A;  3HLE A;  4HH2 A;  4BJP A;  3L9K A;  4GJ4 A;  1JWZ A;  1K56 A;  2ACG A;  1SHV A;  4YIN A;  5EEC A;  1L0E A;  2W1T B;  3OOV A;  3G2Y A;  4LV0 A;  4NK3 A;  3UPO A;  3D72 A;  3VE4 A;  4ZBE A;  4RYE A;  1JVJ A;  4FSF A;  2FH5 A;  1OTA A;  2L1M A;  4UEY A;  5GLD A;  1PIO A;  4EV4 A;  2J8Y A;  5GLA A;  3BY8 A;  3Q07 A;  3VFF A;  3IF6 C;  1PYY A;  1LI9 A;  2DNS A;  3N4I A;  4CJN A;  4GDN A;  1KGE A;  4Q8I A;  1I5Q A;  5HDS A;  3BFE A;  3UDI A;  3UPN A;  3EOI A;  3UB5 P;  2V20 A;  5HL6 A;  1MWS A;  2IWC A;  5KIZ A;  2PAV P;  3NJA A;  1ESU A;  4EXO A;  1YLP A;  5EPH A;  3HJI A;  2GDN A;  5KMW A;  4HES A;  4R3A A;  3EGX C;  1FR1 A;  3IQA A;  4G3W A;  1CEF A;  4ETZ A;  4U0X A;  3OBF A;  3NCK A;  2J3T C;  4NXG A;  3C30 A;  1P0Z A;  3S1Y A;  4UA6 A;  4EET B;  3RJU A;  4S2P A;  1N9B A;  4LV2 A;  4PM7 A;  3N8S A;  3UO9 A;  3MZD A;  2ZL1 B;  4R4R A;  4Y2F A;  4NKP A;  5L07 A;  3O5Y A;  4H6J B;  3G6O A;  1L0F A;  3PBR A;  4Y13 A;  1I2W A;  1S6R A;  3VFH A;  1ODV A;  3MQQ A;  3NC8 A;  5HFO A;  2ZQ9 A;  4I5S A;  1E25 A;  1MKI A;  2EFX A;  2A49 A;  3NIA A;  4GHI B;  2W27 A;  1YLJ A;  4WLA A;  1YQS A;  4BL3 A;  5HWV A;  2HGV A;  1Y54 A;  2J7V A;  3VOY A;  3O87 A;  3OLO A;  2M7U A;  1OJG A;  3WWX A;  1Q2P A;  1EI5 A;  1JNU A;  2OLV A;  2QZ6 A;  1ERO A;  4OP8 A;  1K54 C;  2WKI A;  3H7W A;  3Q7V A;  1S4S A;  4WMC D;  3QP4 A;  5HZH A;  3PBT A;  4DE0 A;  3ZVT A;  4QY6 A;  3T4S A;  2XD5 A;  2A3U A;  2PYR A;  1W8Y A;  4L9F A;  4B9O A;  2Z6C A;  5FEG A;  2XA7 M;  1XFN A;  2Y2N A;  3O86 A;  5DTK A;  2YKH A;  5HAR A;  2LB5 A;  1YLW A;  4DDY A;  2G2W A;  3TG9 A;  4NG2 A;  4FUW A;  1PNE A;  4N1X A;  4O01 A;  4OP5 A;  2CC1 A;  1OTB A;  1TDG A;  4PM5 A;  4FH2 A;  2JKR I;  2EX2 A;  3FC7 A;  4HIA A;  4KG2 A;  3SS5 A;  3IHA A;  2HDU A;  1N4O A;  1XA7 A;  5HPF A;  3IH8 A;  1DP8 A;  3PXP A;  3BJN A;  4L9G A;  1PRQ A;  5CTM A;  4OPY A;  4YFM A;  1ES4 A;  4F3L B;  3Q1F A;  3BW6 A;  4QWO A;  2W3G A;  2HDR A;  1PW1 A;  3C4P A;  4IBR A;  4KZ4 A;  4LFU A;  4MLL A;  4E3K A;  3CAX A;  5AVF A;  1MY8 A;  5HSQ A;  1KVM A;  2ZQ8 A;  5A92 A;  3KSG A;  1PZP A;  1K4F A;  1P97 A;  3LY4 A;  1NYM A;  4ESP A;  3CPT B;  4KZ6 A;  4C75 A;  4DE1 A;  1W7F A;  4EER A;  3T12 B;  1XX2 A;  4O8G A;  5CHU A;  1YLT A;  2V1A A;  3T1X A;  1IYS A;  5J3W A;  3IWI A;  5FL3 A;  3UE3 A;  2WGI A;  1CF0 A;  2WKQ A;  3VP3 A;  2H0Y A;  3QHY A;  4HJ6 A;  1KGG A;  3AGD A;  5DTS A;  1BLP A;  2W3H A;  4JKT A;  1YT4 A;  3A0R A;  5AQ9 A;  1K0K A;  5FAO A;  4BEN A;  3F1N A;  4KG6 A;  4LRY C;  4B93 A;  4EBL A;  3U2A A;  1NRJ A;  4UA7 A;  3TOI A;  1ES3 A;  4OOY A;  2G2U A;  4C6Y A;  2W0N A;  3CPT A;  4KG5 A;  1S1Y A;  5DVA A;  5CEB A;  2ZOI A;  4UQI M;  4HP4 A;  3FG8 A;  4PKY G;  3NBL A;  3RH8 B;  1BYW A;  2QPN A;  1N9N A;  3LIF A;  1ZC2 A;  1ONH A;  3MZF A;  4CLC A;  2EFU A;  1YKD A;  4WZ5 A;  1ZHH B;  4RVA A;  1W5D A;  1YMS A;  5A8B A;  2XA7 S;  3CIT A;  3CUE A;  3IH9 A;  2XDM A;  1IEM A;  2R9W A;  4S2I A;  1DJB A;  4P0M A;  2OV5 A;  1S4R A;  3BLM A;  4L9E A;  5EOE A;  5HPI A;  1G6A A;  1Z6F A;  4KQR A;  1DP6 A;  1ZTU A;  2Y55 A;  3G31 A;  1PWD A;  1DJA A;  4XT2 B;  2ZC4 B;  1NZO A;  3BY9 A;  3R4K A;  1DP9 A;  1YM1 A;  4MMN A;  2VJW A;  4PM6 A;  1YSP A;  3ZQ5 A;  4WM9 A;  1TS8 A;  5HAQ A;  3RTY A;  2WUQ A;  3V67 A;  2VGL M;  4X53 A;  3FYZ A;  3W8K A;  3PTE A;  4P6Z M;  5M19 A;  3FZC A;  4PM9 A;  5CHM A;  2K31 A;  4XUX A;  4BBU A;  1F98 A;  3UE0 A;  4QY5 A;  4WN5 A;  3O88 A;  3CWF A;  1IYP A;  3LEZ A;  5L2F A;  1DY6 A;  5CHJ A;  1H8Y A;  3A3D A;  3GV9 A;  5I5L A;  5DKL A;  1GCE A;  5F82 A;  4WF0 A;  3ZNT A;  4KEN B;  3HUN A;  1BT5 A;  2OLU A;  2VV6 A;  3SH9 A;  4E3L A;  5TBM B;  3Q81 A;  2PDR A;  1FR6 A;  3QP6 A;  3V3S A;  1GA9 A;  4LGW A;  3T1R A;  4BMW A;  5IS1 A;  2H28 A;  1Q2Q A;  1LL8 A;  2XR0 A;  1UWN X;  3KSF A;  2NUT C;  4M4X A;  4LV3 A;  1KGF A;  3HUO A;  4ZJ3 A;  1H8M A;  2VZW A;  1BUL A;  1XJ4 A;  1KE0 A;  3LCE A;  4R1G A;  1P9W A;  3OCL A;  2C6W B;  2A24 B;  1PI4 A;  3L7H A;  3G30 A;  4UQI S;  3NDG A;  2ZM0 A;  3EEH A;  3E4O A;  1TS7 A;  1QMF A;  2HPB A;  1PW8 A;  2J9O A;  4WZ4 A;  4B4Z A;  5HWT A;  5DTT A;  2P04 A;  2Y2J A;  3M6B A;  3SZT A;  1BLH A;  2KLI A;  2IWB A;  4JGO A;  1M40 A;  5F68 A;  3QP2 A;  4QD4 A;  3N6I A;  3HLG A;  3UE1 A;  3PAE A;  1T18 A;  5FI7 A;  4XXR A;  3C5A A;  1NRF A;  4GLQ A;  4GNU A;  3G34 A;  4PHT A;  1EWZ A;  3UDX A;  3IF5 A;  5FQI A;  4HJ4 A;  2D02 A;  3V50 A;  5CED A;  3O3V A;  3IX8 A;  1VET B;  4WEL A;  3ZGA B;  2KOI A;  1F5M A;  2PR6 A;  4MDZ A;  4OVD A;  1UGU A;  3SW1 A;  4F94 A;  1GSV A;  2VGL S;  4DKI A;  4MN7 A;  4HBT A;  2ZOH A;  3T50 A;  2RL3 A;  4I3J A;  3ZDJ A;  5KZH A;  4P6Z S;  3LUQ A;  3RFB A;  2WKH A;  2MJ6 A;  3P98 A;  3HBR A;  4X56 A;  4IUK A;  3GEC A;  3HLW A;  3IT9 A;  4Y17 A;  4KUO A;  3TW8 A;  1GHP A;  4GCZ A;  4HOI A;  5GLB A;  4S2J A;  3BEC A;  3V5M A;  2EXA A;  2WZX A;  2JBF A;  5DJT A;  3VE3 A;  4JGP A;  4PM8 A;  4YNR A;  5JYO A;  3WS1 A;  1SZV A;  3HLC A;  4JF5 A;  4YOF A;  2HP6 A;  3SH7 A;  1T1C A;  5FQK A;  5TFQ A;  2W3F A;  4NXE A;  2V9A A;  2I72 A;  3KYQ A;  3E2K A;  1SKO B;  3G4P A;  1NZU A;  4UAA A;  5CXW A;  1A0K A;  3LIC A;  4X6T A;  3ZG7 B;  2P74 A;  3UB6 A;  1KE4 A;  4BD0 A;  4QPR A;  1WA9 A;  1XJ6 A;  2P7J A;  3MXS A;  2W1T A;  3A3I A;  5TGF A;  2B5R A;  4GN2 A;  3DBA A;  3B3X A;  1L3L A;  3LIE A;  4JPM A;  4LRZ E;  2EWV A;  4WEJ A;  5FA7 A;  3EQU A;  1AXB A;  4OQG A;  4E3I A;  3ISG A;  4D2O A;  4Q0I A;  3OC2 A;  5HD5 A;  1ACF A;  3CJM A;  2BLS A;  4JXS A;  3PAG A;  4O0P A;  4RX3 A;  4CLC C;  3ZYT A;  4DRT A;  4ETX A;  1XGI A;  4WZ5 C;  5EVL A;  3F1P B;  3EQV A;  4FOF A;  1K57 A;  4M3K A;  4ME4 A;  3NDE A;  3CUE C;  2H10 A;  4DMZ A;  4G3K A;  4K0X A;  3C7V A;  3TRC A;  4MEZ A;  5K5B A;  3CI6 A;  1HZO A;  3QP1 A;  1XP4 A;  3DW0 A;  2ZM8 A;  5L8M A;  5EVI B;  2C5W B;  5GHY A;  3FKV A;  4X1L A;  3CLO A;  3NEC A;  3A0V A;  4ZJ1 A;  3W2Z A;  4S2N A;  2Y2P A;  4Y5F A;  1IKI A;  1G68 A;  2XF3 A;  2HV1 A;  4Y3I A;  4YWZ A;  3HLF A;  3W4O A;  4HEF A;  1BUE A;  4RX2 A;  3DWK A;  3HVF A;  1GHI A;  1KVL A;  1DJC A;  2V0W A;  4BLM A;  2Q9M A;  5KSC A;  1ZG4 A;  3EGD C;  4E3N A;  1G28 A;  2ZL1 A;  4Q0J A;  5F5Y A;  2V1B A;  3NY4 A;  3W4Q A;  5IT5 A;  3MSH A;  3ZG5 A;  1IYO A;  4X55 A;  1QME A;  4H6J A;  4BBV A;  2OWJ A;  4EWF A;  2WGV A;  4DJ3 A;  4MBK A;  5CGX A;  5EVI A;  2JHE A;  2Y2L A;  4PPR A;  5IHV A;  4OQI A;  3AGE A;  3T1Q B;  2HJE A;  1WYB A;  5GL9 A;  1TD5 A;  2M1C A;  5EM1 A;  3ICY A;  5FQQ A;  1E3U A;  4N1H A;  3A3F A;  1S0W A;  4QB8 A;  5A91 A;  4GHI A;  2XFS A;  1H3Q A;  5AJG A;  3E0Y A;  2ZJ9 A;  4R38 A;  2ZMA A;  1OTI A;  1TS0 A;  3VP1 A;  1OT9 A;  3SH8 A;  2Z6D A;  5FEF A;  4EBN A;  1CK3 A;  3LIB A;  3NI9 A;  2ZBB A;  5J4E A;  1W79 A;  1HLU P;  2ZQC A;  5LBR A;  4IUH A;  1IYQ A;  5GHX A;  4GS9 B;  2DCF A;  4S2L A;  4DE2 A;  5E2G A;  3K3D A;  1P9R A;  4LCM A;  1W63 M;  3WS5 A;  1JWV A;  1BSG A;  4EU0 A;  5FI6 A;  3ZCZ A;  3KSH A;  4EES A;  3UB8 A;  3DTI A;  1CQA A;  3IF6 B;  3MQO A;  3UB9 A;  1JTG A;  5G4Y A;  5AQB A;  2VA0 A;  1ONG A;  4E3J A;  2WKR A;  3UDF A;  2ZLY A;  1BTL A;  5KSH A;  1SKF A;  1K38 A;  3T4L A;  4F3L A;  5I94 A;  4NXB A;  3GMW A;  5CX7 A;  3BFG A;  1KDS A;  1VM1 A;  1T19 A;  3WS0 A;  4UHU A;  4XUZ A;  2XFT A;  2JKF A;  3TSG A;  4KQD A;  5HDC A;  5A90 A;  4H8R A;  5CGS A;  3NOU C;  3WS4 A;  3WS2 A;  3MKE A;  3C4O A;  4LLO B;  4Z9Q A;  4ZTK A;  5FQ9 A;  5GLC A;  3T4J A;  1L2S A;  3A3J A;  3LI9 A;  3UPP A;  3NUL A;  3SOI A;  3FKW A;  3LR4 A;  3WRT A;  2O9A A;  4I38 A;  5F1F A;  4JXW A;  3HCY A;  1OPX A;  1YLY A;  2R9X A;  1WE4 A;  1S1Z A;  3IS2 B;  1LSW A;  1F9I A;  1JTD A;  4JXV A;  2XRO A;  4DE3 A;  4FD8 A;  1H5X A;  4I3A A;  4WUJ A;  3E2L A;  5DFX A;  1BZA A;  4OKP A;  1C3B A;  3DAV A;  1LSX A;  2HJ9 C;  3IBR A;  3IBJ A;  1U60 A;  3KYE A;  3M2K A;  4Y15 A;  4BQM A;  1ES5 A;  4R70 A;  3B47 A;  2JN7 A;  2B95 A;  5EVI D;  3NHQ A;  3LID A;  1TDL A;  4OQH A;  5D3O A;  1IFQ A;  3WRZ A;  2UV0 E;  1PWG A;  2FZ0 A;  5IU1 A;  5EV0 A;  1E3U D;  4N92 A;  4NEE D;  4LPZ A;  2WGW B;  3IS2 A;  5EUA A;  1SDN A;  3BQA A;  5CER A;  4S2M A;  1XGJ A;  1ES2 A;  4Q0H A;  4OLD A;  1XJ2 A;  2WKE A;  4O7D A;  4R4S A;  1LT0 A;  2JKR M;  1XFQ A;  3PBS A;  1ALQ A;  5TJJ A;  3VOL A;  4LCL A;  4UA9 A;  3BWL A;  2VGK A;  3VP4 A;  3V3R A;  1LL9 A;  5HD3 A;  3SS3 A;  3IXD A;  5FSR A;  2WAD A;  1K25 A;  3JVV A;  1CJF A;  4RA7 A;  1V9Z A;  1X0O A;  2HZ5 A;  4X69 A;  4IVK A;  4XT2 A;  4DN0 A;  4GD8 A;  2A2L A;  3AGF A;  4P6B A;  5E2H A;  2H5S A;  3MR0 A;  5JYP A;  5J8X A;  4GB7 A;  4KZ7 A;  4ZRR A;  1K57 C;  3H82 B;  1VEU B;  1N9O A;  4LEN A;  1NYY A;  4A5R A;  2XLN A;  3S22 A;  4C3Q A;  4KZ9 A;  3G35 A;  5C5K A;  1TF1 A;  2QKP A;  5DJU A;  5EFW A;  3I7J A;  1YSQ A;  2EA9 A;  3E98 A;  4R3J A;  4E3M A;  3LEQ A;  4MN6 A;  2X71 A;  1SDE A;  1LLB A;  2ZC7 A;  3NOT C;  2W3E A;  4S2N C;  2ZM2 A;  3R7W B;  2O9C A;  2IWD A;  4GOG A;  4BD1 A;  3MQ0 A;  3BFF A;  3IXG A;  2WK0 A;  2B02 A;  5HAP A;  2BTF P;  1VQQ A;  1D1J A;  4OLG A;  2VGJ A;  2Y2Q A;  4FCF A;  1OME A;  1S67 L;  5TBM A;  1NLY A;  2QJ7 A;  5MC7 A;  5DFY A;  2XD1 A;  2Y2O A;  4BL2 A;  5G4Z A;  2FFY A;  1AWI A;  3D9Y A;  1FSW A;  3HL9 A;  3OPP A;  5CRF A;  5EVI C;  1XJ3 A;  2O99 A;  2PD7 A;  5DF9 A;  3C38 A;  1D06 A;  2KX6 A;  1J3W A;  1Y4O A;  1OT6 A;  3GQZ A;  3LY3 A;  1FCO A;  3ULF A;  4GZB A;  1L0D A;  2A24 A;  4Y0U A;  2IA2 A;  2QMI A;  3BYD A;  4KZA A;  5TR7 A;  1FOF A;  3MBZ A;  2EWW A;  3UB7 A;  3M2J A;  1HVB A;  3MZE A;  5FAP A;  4EBP A;  5EE8 A;  3GVB A;  2Y2M A;  3N8L A;  3HUM A;  1K6S A;  3A3E A;  3GDI A;  4OH0 A;  3W4P A;  5CGW A;  2E8I A;  3OPR A;  4KZB A;  2XQZ A;  2Y91 A;  1CI8 A;  2M7V A;  1MBL A;  1OTD A;  2XRN A;  3VSK A;  2V1Z A;  4R0Q A;  2P9V B;  1OJ5 A;  3OPH A;  5EM0 A;  5M1A A;  3HJK A;  2W1R A;  1LSV A;  4RQ9 A;  4EEU A;  2O9B A;  2PRF A;  2WYX A;  3VMA A;  2PHY A;  1KE3 A;  3PHY A;  4KZ5 A;  3B42 A;  2VKS A;  2W3D A;  1VET A;  5EVE A;  2BAS A;  4PAU A;  2HDQ A;  3ZHH A;  5HX9 A;  2Y2K A;  3CMZ A;  5DF8 A;  2FFF B;  3VV4 A;  4K0W A;  4AFI A;  2J80 A;  1IEL A;  4PMA A;  5EOO A;  3T4K A;  1FIK A;  2J3W A;  3IX4 A;  4LV1 A;  5F1G A;  2VX8 A;  1J9M A;  4IBX A;  4OPR A;  3M6H A;  2XEP A;  2L0W A;  1PFL A;  2QYB A;  3ZVW A;  3OPL A;  4DDS A;  3QP8 A;  2P9V A;  1W63 Q;  5CTN A;  3GRJ A;  2KDK A;  3C2W A;  4KZ8 A;  3G2Z A;  5F69 A;  2JCH A;  2I9V A;  2OOL A;  4K91 A;  1YAX A;  1V9Y A;  4EEP A;  2Y4A A;  3GTC A;  2EX6 A;  4R23 A;  2QWS A;  4I3I A;  1SKO A;  3ZG8 B;  1MKM A;  4IED A;  1PZO A;  4IJG A;  4JGQ A;  2H0T A;  4E3O A;  3PBN A;  4EQ1 A;  3ZNY A;  4IVI A;  3BEB A;  3MJQ A;  1RGZ A;  4E6X A;  1YMX A;  3PYP A;  3NOP C;  3MXQ A;  2ZMF A;  2ZMV A;  4LRX C;  3S7O A;  4MCW A;  2AVX A;  2QHK A;  4QU3 A;  5FQJ A;  3BFC A;  2GX5 A;  3CG5 A;  3HLB A;  3IWO A;  2JKT I;  3LR3 A;  5FQM A;  4S2O A;  3H7W B;  1PWC A;  3Q7V B;  2VV8 A;  3IHB A;  4JBF A;  4GKU A;  3CZD A;  3K3C A;  3BRM A;  3DWZ A;  1MWR A;  2Z2M B;  3F1P A;  4PKY A;  3UN7 A;  5DKK A;  4OQ0 A;  5FAS A;  1RGY A;  1TS6 A;  1O07 A;  3E4P A;  2K2N A;  4MNR A;  5AVE A;  3P09 A;  2PD8 A;  3C8C A;  3U4L P;  4HI4 A;  1FQG A;  3D4F A;  4WEK A;  2K7S A;  1XPB A;  3VP2 A;  4ID4 A;  1HD8 A;  4OPQ A;  1RCJ A;  2Q0O A;  1BLC A;  4DXC A;  3N7W A;  3ZG9 B;  3DTM A;  1K6R A;  3D3O A;  3T4T A;  2OAP 1;  1ERM A;  3LGO A;  1UWP X;  1T1A A;  2GNX A;  4X68 A;  3LO7 A;  1L0G A;  2PU4 A;  1IOU A;  3S7Q A;  2ZQ7 A;  1K56 D;  1BLS A;  5FDH A;  5E2F A;  3BLS A;  4GW9 A;  3UMD A;  3Q7Z A;  3VOZ A;  2DRW A;  2XGN A;  1Y28 A;  3BFD A;  4B88 A;  4N9L A;  4E04 A;  5E43 A;  3EWK A;  4MBF A;  2JC7 A;  3JVU A;  4ZDX A;  1K55 A;  4U3T A;  1LL5 A;  2HP5 A;  4WYY A;  1FCN A;  1S66 L;  4KZ3 A;  3MFX A;  2ZC5 B;  1NJ4 A;  4DJ2 A;  1VHM A;  2EX8 A;  5G18 A;  4QJG A;  3MFD A;  2JKG A;  4HNB A;  1TEM A;  4OOL A;  1D7E A;  3F1N B;  4OOM A;  2OWH A;  2GZA A;  2V2F F;  3MS6 A;  2V8F A;  4I39 A;  2GJ3 A;  3IWQ A;  4OON A;  3ITA A;  4EUZ A;  5U47 A;  2NUP C;  1YPR A;  4GS9 A;  1NWZ A;  4FH4 A;  3TE8 A;  5CEC A;  4G3V A;  3LYX A;  3UME A;  3HLD A;  3GSG A;  3HRE A;  4HP9 A;  2PBY A;  3CHW P;  4GD6 A;  4DXB A;  2R78 A;  1CI9 A;  4EQI A;  3IXH A;  4HQA A;  1G6O A;  4X1M A;  2XH9 A;  2VV7 A;  3IF6 A;  4HY8 A;  4CLC B;  2VK3 A;  2L4R A;  5BOH A;  3QNB A;  2JKT M;  4HHD A;  5F6A A;  1RP5 A;  3Q82 A;  3S7P A;  3FPW A;  4MN5 A;  4EW7 A;  1GSX A;  3TJZ C;  2O0Y A;  3A0S A;  3VSL A;  1LHY A;  3OZH A;  4CQH A;  3VP0 A;  2J9P A;  2X01 A;  4R3B A;  5FAT A;  5AQ7 A;  1H8Z A;  1GHM A;  2CMN A;  3MKF A;  3UNW A;  4S2K A;  4GDB A;  3MXR A;  1N9L A;  2EX9 A;  2XK1 A;  2Y2I A;  4D60 A;  4KQQ A;  1LI0 A;  3K2N A;  2XSS A;  5HAI A;  3PBO A;  3G32 A;  4QHC A;  1DRM A;  3PR6 A;  4R6L A;  3UY6 A;  4Z1W A;  1MWT A;  3KSI A;  1IKG A;  1XKZ A;  2Y2G A;  2V8C A;  3IXB A;  1F2K A;  4L0L A;  5J7E A;  4DF6 A;  1H0M A;  4II7 A;  4ARZ B;  1O7E A;  3B33 A;  2X02 A;  2V0U A;  2VEA A;  3LI8 A;  3QNC A;  5A93 A;  3IX3 A;  5GHZ A;  2B18 A;  2Y8H A;  3E4Q A;  2DMW A;  1KDW A;  1ESI A;  1NXY A;  3PBQ A;  3RXX A;  1GSW A;  1TVF A;  1MXO A;  5FDS A;  3N8R A;  3C7U A;  1K54 A;  5M18 A;  5HL1 A;  5AQA A;  3LR5 A;  2PR5 A;  4N9K A;  3DTK A;  5HW3 A;  3ZFZ A;  1PI5 A;  2WGW A;  2ZC3 B;  3SS4 A;  2G7U A;  3BQ8 A;  3QP5 A;  3KX0 X;  4ARZ A;  4P87 A;  4HJ3 A;  2INW A;  2RCX A;  4K08 A;  1FIL A;  1NY0 A;  5F83 A;  1XXM A;  5E2E A;  3LFV A;  4JF6 A;  1T1B A;  4JXG A;  2JE5 A;  4B4X A;  4EUV A;  4ZJ2 A;  2PU2 A;  4P85 A;  4U0T A;  4WBG A;  3JPU A;  3JYI A;  1M6K A;  5HWW A;  5L09 A;  3FWL A;  2PYP A;  1JWP A;  1KOU A;  1ZKJ A;  2ZD8 A;  2WKP A;  3BM6 A;  1Z09 A;  1MZU A;  4IHQ A;  3V39 A;  2HF6 A;  1E4D A;  4X25 A;  1XA1 A;  4BWI A;  1W8Q A;  4WL9 A;  1G5U A;  3OCN A;  2BG1 A;  4Y0O A;  3H82 A;  2ZC6 B;  1VEU A;  4FTX A;  1SCW A;  3T4Q A;  5DF7 A;  2D01 A;  1FCM A;  4JLF A;  1VB6 A;  2Q9N A;  3P01 A;  5FAQ A;  2Y79 A;  1HTZ A;  3KO6 A;  2PBD P;  2E8J A;  2ZQD A;  3LR0 A;  3MMH A;  2HDS A;  1ERQ A;  2PT7 A;  1STZ A;  4Y7P A;  1YLZ A;  3RXW A;  3S7N A;  4Y0T A;  2P08 A;  2Y2H A;  3T4O A;  3R7W A;  2OSU A;  3MF0 A;  3LIA A;  3F1O B;  1MWU A;  3ZG0 A;  1K4E A;  4HH3 A;  5L10 A;  4CPK A;  4CLC E;  1MC0 A;  4NXF A;  4OPZ A;  4MBH A;  2WAF A;  2LB9 A;  3T1S A;  4JGR A; 
#chains in the Genus database with same CATH homology
 1RGZ A;  1BSG A;  1YMX A;  4WM9 A;  4E6X A;  3S4X A;  2UWX A;  5HAQ A;  4JF4 A;  2Z2L B;  5FI6 A;  3ZCZ A;  4HBU A;  3IF6 B;  2WUQ A;  4ZAM A;  1ZG6 A;  1JTG A;  4X53 A;  5AQB A;  3FYZ A;  3W8K A;  1ONG A;  3PTE A;  4E3J A;  2ZQA A;  4QU3 A;  5FQJ A;  1CEG A;  1FSY A;  3BFC A;  3ITB A;  3UDF A;  5M19 A;  2ZLY A;  3CG5 A;  3FZC A;  3HLB A;  4PM9 A;  3IWO A;  1MPL A;  5CHM A;  5FQM A;  1BTL A;  4S2O A;  5KSH A;  1PWC A;  1SKF A;  2HP9 A;  2WAE A;  3Q7V B;  3GR2 A;  1K38 A;  3IHB A;  4JBF A;  1GA0 A;  4XUX A;  1K55 C;  1WYC A;  4GKU A;  4E6W A;  2WZZ A;  4WMC A;  3CZD A;  4NET A;  5I94 A;  3UE0 A;  3BRM A;  3GMW A;  4QY5 A;  3O88 A;  3DWZ A;  1IYP A;  1MWR A;  3BFG A;  1KDS A;  1VM1 A;  2Z2M B;  1DY6 A;  3LEZ A;  5L2F A;  2Y59 A;  5FI2 A;  3WS0 A;  5CHJ A;  1I2S A;  4UHU A;  3UN7 A;  4XUZ A;  2XFT A;  2EXB A;  1H8Y A;  4KQO A;  3TSG A;  5A90 A;  3A3D A;  3FV7 A;  3GV9 A;  4H8R A;  3HLE A;  4OQ0 A;  5CGS A;  3WS4 A;  1RGY A;  3MKE A;  1O07 A;  3WS2 A;  3C4O A;  4Z9Q A;  4ZTK A;  1GCE A;  5FQ9 A;  5GLC A;  4BJP A;  1L2S A;  5F82 A;  4MNR A;  3P09 A;  1JWZ A;  3ZNT A;  4KEN B;  3A3J A;  1FQG A;  1K56 A;  3HUN A;  1SHV A;  1BT5 A;  2OLU A;  4YIN A;  3UPP A;  5EEC A;  1L0E A;  3D4F A;  4WEK A;  3SH9 A;  4E3L A;  3G2Y A;  3Q81 A;  1XPB A;  3VP2 A;  4ID4 A;  4LV0 A;  4NK3 A;  3SOI A;  3UPO A;  1FR6 A;  3FKW A;  1HD8 A;  4OPQ A;  1RCJ A;  3V3S A;  1GA9 A;  4ZBE A;  1BLC A;  4RYE A;  3WRT A;  1Q2Q A;  4DXC A;  5F1F A;  2XR0 A;  1JVJ A;  3N7W A;  4JXW A;  4FSF A;  4LV3 A;  1KGF A;  1YLY A;  3HUO A;  2R9X A;  5GLD A;  4ZJ3 A;  1WE4 A;  3ZG9 B;  3DTM A;  1K6R A;  1PIO A;  4EV4 A;  1ERM A;  2J8Y A;  1BUL A;  5GLA A;  1JTD A;  4JXV A;  4DE3 A;  4X68 A;  4FD8 A;  1KE0 A;  1H5X A;  3LCE A;  4R1G A;  3LO7 A;  1L0G A;  3Q07 A;  3VFF A;  3E2L A;  3IF6 C;  1PYY A;  1BZA A;  3OCL A;  2C6W B;  4OKP A;  1C3B A;  2PU4 A;  1LI9 A;  1PI4 A;  2DNS A;  3N4I A;  2ZQ7 A;  3G30 A;  3NDG A;  4CJN A;  1K56 D;  1U60 A;  4GDN A;  2ZM0 A;  1KGE A;  1BLS A;  5FDH A;  4Q8I A;  1I5Q A;  3M2K A;  5E2F A;  3BFE A;  4BQM A;  1ES5 A;  3UDI A;  1QMF A;  3BLS A;  3UPN A;  2HPB A;  1PW8 A;  2J9O A;  4WZ4 A;  4B4Z A;  5EVI D;  3Q7Z A;  5DTT A;  3VOZ A;  2DRW A;  2V20 A;  2XGN A;  2Y2J A;  1TDL A;  1MWS A;  4OQH A;  3M6B A;  5D3O A;  3BFD A;  2IWC A;  4B88 A;  4N9L A;  3WRZ A;  4BLM A;  1PWG A;  5E43 A;  1ESU A;  1BLH A;  2IWB A;  1YLP A;  5EPH A;  1E3U D;  2GDN A;  1M40 A;  4MBF A;  4N92 A;  5KMW A;  4HES A;  2JC7 A;  4ZDX A;  4QD4 A;  3N6I A;  2WGW B;  5EUA A;  1SDN A;  3HLG A;  5CER A;  3PAE A;  4S2M A;  5FI7 A;  1XGJ A;  1ES2 A;  3UE1 A;  1K55 A;  4XXR A;  4U3T A;  1FR1 A;  3IQA A;  3C5A A;  4OLD A;  1NRF A;  2WKE A;  1LL5 A;  2HP5 A;  4O7D A;  4WYY A;  4R4S A;  1FCN A;  4GNU A;  3G34 A;  4KZ3 A;  1CEF A;  2ZC5 B;  1NJ4 A;  3PBS A;  4U0X A;  1ALQ A;  3NCK A;  1EWZ A;  3UDX A;  3IF5 A;  2EX8 A;  5FQI A;  5G18 A;  4LCL A;  3MFD A;  3S1Y A;  4QJG A;  4UA6 A;  4UA9 A;  1TEM A;  4OOL A;  2VGK A;  3V50 A;  3RJU A;  4S2P A;  1N9B A;  3V3R A;  1LL9 A;  4LV2 A;  3O3V A;  4OOM A;  4PM7 A;  3N8S A;  3VP4 A;  3UO9 A;  2V2F F;  3MZD A;  3SS3 A;  3IXD A;  3IWQ A;  4OON A;  2WAD A;  4R4R A;  4WEL A;  5FSR A;  3ZGA B;  1K25 A;  3ITA A;  4EUZ A;  5U47 A;  4RA7 A;  4OVD A;  1L0F A;  3PBR A;  4X69 A;  4IVK A;  4FH4 A;  4GD8 A;  4F94 A;  4DKI A;  1I2W A;  5CEC A;  1S6R A;  4HBT A;  2RL3 A;  3AGF A;  4P6B A;  5E2H A;  3VFH A;  3ZDJ A;  5KZH A;  2H5S A;  5JYP A;  3HLD A;  3GSG A;  3NC8 A;  5J8X A;  2WKH A;  3HRE A;  3P98 A;  2ZQ9 A;  5HFO A;  3HBR A;  4GB7 A;  4X56 A;  4KZ7 A;  2PBY A;  4GD6 A;  4DXB A;  1K57 C;  1CI9 A;  1E25 A;  4EQI A;  3IXH A;  3HLW A;  3IT9 A;  1MKI A;  2EFX A;  2A49 A;  2XH9 A;  1GHP A;  4LEN A;  1NYY A;  3NIA A;  3IF6 A;  5GLB A;  4S2J A;  2XLN A;  3BEC A;  3S22 A;  3V5M A;  2EXA A;  1YLJ A;  4A5R A;  1YQS A;  4BL3 A;  4C3Q A;  5BOH A;  4KZ9 A;  2WZX A;  1Y54 A;  2J7V A;  2JBF A;  3G35 A;  3O87 A;  3QNB A;  3VOY A;  3WWX A;  1RP5 A;  1Q2P A;  3Q82 A;  4PM8 A;  1EI5 A;  2OLV A;  2QZ6 A;  3I7J A;  1ERO A;  4OP8 A;  5JYO A;  1K54 C;  2WKI A;  4R3J A;  3Q7V A;  3WS1 A;  4E3M A;  4WMC D;  3HLC A;  2X71 A;  1SDE A;  4JF5 A;  2HP6 A;  3PBT A;  1LLB A;  3SH7 A;  3VSL A;  2ZC7 A;  1LHY A;  4DE0 A;  3ZVT A;  4QY6 A;  5FQK A;  3OZH A;  2XD5 A;  5TFQ A;  2A3U A;  4S2N C;  2ZM2 A;  1W8Y A;  2IWD A;  2I72 A;  4GOG A;  3VP0 A;  2J9P A;  3E2K A;  2X01 A;  4R3B A;  4BD1 A;  3G4P A;  5FAT A;  3BFF A;  5AQ7 A;  1NZU A;  4UAA A;  5CXW A;  3IXG A;  2WK0 A;  1H8Z A;  1GHM A;  3MKF A;  2Y2N A;  3O86 A;  5DTK A;  3UNW A;  4S2K A;  4X6T A;  5HAR A;  4GDB A;  3ZG7 B;  2P74 A;  5HAP A;  1VQQ A;  1KE4 A;  1YLW A;  4BD0 A;  4DDY A;  4OLG A;  3MXR A;  2EX9 A;  2VGJ A;  2Y2Q A;  3MXS A;  2G2W A;  4FCF A;  1OME A;  3TG9 A;  2XK1 A;  2Y2I A;  4KQQ A;  2XD1 A;  2Y2O A;  3A3I A;  4BL2 A;  4N1X A;  5TGF A;  1LI0 A;  2B5R A;  2CC1 A;  4GN2 A;  2FFY A;  1TDG A;  4OP5 A;  1FSW A;  5HAI A;  3HL9 A;  3OPP A;  4FH2 A;  3PBO A;  4PM5 A;  3B3X A;  3G32 A;  4QHC A;  2EX2 A;  5CRF A;  5EVI C;  3UY6 A;  4KG2 A;  1MWT A;  3SS5 A;  3IHA A;  1IKG A;  1XKZ A;  2HDU A;  4JPM A;  2Y2G A;  1N4O A;  3IXB A;  1XA7 A;  4WEJ A;  3IH8 A;  5DF9 A;  5FA7 A;  3EQU A;  1AXB A;  4OQG A;  4E3I A;  3ISG A;  5CTM A;  4OPY A;  4D2O A;  4YFM A;  3OC2 A;  4L0L A;  1ES4 A;  3CJM A;  2BLS A;  4JXS A;  4DF6 A;  3Q1F A;  3GQZ A;  3PAG A;  3LY3 A;  1FCO A;  4GZB A;  4RX3 A;  1O7E A;  1L0D A;  2X02 A;  4DRT A;  1XGI A;  4WZ5 C;  5EVL A;  3EQV A;  3QNC A;  4Y0U A;  2QMI A;  2HDR A;  3BYD A;  5A93 A;  4KZA A;  1PW1 A;  1K57 A;  3C4P A;  4IBR A;  4KZ4 A;  4M3K A;  4MLL A;  5FAS A;  3NDE A;  4E3K A;  2H10 A;  1MY8 A;  5TR7 A;  1FOF A;  4K0X A;  3MBZ A;  5GHZ A;  3M2J A;  1KVM A;  1HVB A;  2ZQ8 A;  3C7V A;  3MZE A;  5FAP A;  5A92 A;  1KDW A;  1PZP A;  4EBP A;  1K4F A;  4MEZ A;  1ESI A;  1NXY A;  5EE8 A;  3GVB A;  3PBQ A;  2Y2M A;  3N8L A;  3HUM A;  1K6S A;  1HZO A;  1XP4 A;  3LY4 A;  3RXX A;  3A3E A;  1TVF A;  3DW0 A;  1MXO A;  1NYM A;  3N8R A;  4OH0 A;  4KZ6 A;  3C7U A;  1K54 A;  2ZM8 A;  3W4P A;  4C75 A;  1W7F A;  5AQA A;  4DE1 A;  5HL1 A;  5EVI B;  5M18 A;  5CGW A;  4N9K A;  5HW3 A;  2E8I A;  2C5W B;  1PI5 A;  3FKV A;  5GHY A;  3ZFZ A;  2WGW A;  2ZC3 B;  3OPR A;  1XX2 A;  4KZB A;  4ZJ1 A;  3SS4 A;  2XQZ A;  2Y91 A;  5CED A;  1CI8 A;  5CHU A;  1YLT A;  1MBL A;  4S2N A;  1IYS A;  2Y2P A;  3VSK A;  2V1Z A;  1IKI A;  4R0Q A;  1G68 A;  2XF3 A;  2P9V B;  4P87 A;  3IWI A;  3UE3 A;  2WGI A;  3OPH A;  3HLF A;  5M1A A;  3W4O A;  2RCX A;  4HEF A;  1BUE A;  3VP3 A;  2H0Y A;  3DWK A;  3HVF A;  1GHI A;  1NY0 A;  1KVL A;  3QHY A;  1DJC A;  4RX2 A;  2WYX A;  1KGG A;  3AGD A;  1XXM A;  1BLP A;  5DTS A;  5E2E A;  2Q9M A;  1YT4 A;  4JKT A;  5AQ9 A;  5F83 A;  5FAO A;  3VMA A;  4BEN A;  1ZG4 A;  5KSC A;  4KG6 A;  4JF6 A;  4JXG A;  4E3N A;  1KE3 A;  2JE5 A;  4KZ5 A;  4EBL A;  4B4X A;  3NY4 A;  3W4Q A;  4UA7 A;  4ZJ2 A;  3TOI A;  2HDQ A;  1ES3 A;  4OOY A;  3ZHH A;  3ZG5 A;  2PU2 A;  5HX9 A;  1IYO A;  2Y2K A;  3CMZ A;  4P85 A;  4X55 A;  5DF8 A;  2FFF B;  1QME A;  4U0T A;  4WBG A;  2G2U A;  4K0W A;  4C6Y A;  4EWF A;  2WGV A;  3JYI A;  1M6K A;  4KG5 A;  5EOO A;  1IEL A;  4PMA A;  3FWL A;  1JWP A;  5DVA A;  4MBK A;  5CGX A;  5EVI A;  1ZKJ A;  5CEB A;  2Y2L A;  4LV1 A;  5F1G A;  2ZD8 A;  3BM6 A;  4PPR A;  5IHV A;  4OQI A;  3AGE A;  3V39 A;  1J9M A;  4IBX A;  1WYB A;  4OPR A;  5GL9 A;  1E4D A;  1XA1 A;  1W8Q A;  2XEP A;  3M6H A;  3NBL A;  3OCN A;  5FQQ A;  2BG1 A;  2QPN A;  3ZVW A;  3OPL A;  1E3U A;  4N1H A;  3A3F A;  4DDS A;  4Y0O A;  2P9V A;  2ZC6 B;  1ZC2 A;  1SCW A;  1ONH A;  5DF7 A;  3MZF A;  1S0W A;  1FCM A;  4JLF A;  3GRJ A;  4QB8 A;  5CTN A;  5A91 A;  2XFS A;  2EFU A;  4WZ5 A;  2Q9N A;  4RVA A;  2ZJ9 A;  1W5D A;  1YMS A;  3G2Z A;  4KZ8 A;  5FAQ A;  1HTZ A;  2ZMA A;  2JCH A;  3VP1 A;  2ZQD A;  4K91 A;  2HDS A;  1ERQ A;  3IH9 A;  3SH8 A;  2XDM A;  4EBN A;  1IEM A;  1CK3 A;  4Y7P A;  2R9W A;  4S2I A;  1YLZ A;  1DJB A;  3RXW A;  4Y0T A;  4P0M A;  2OV5 A;  3NI9 A;  3BLM A;  2Y4A A;  5EOE A;  3GTC A;  2EX6 A;  4R23 A;  2Y2H A;  1W79 A;  1G6A A;  2OSU A;  1Z6F A;  2ZQC A;  4KQR A;  1MWU A;  3ZG0 A;  1K4E A;  1IYQ A;  5GHX A;  3ZG8 B;  2Y55 A;  2DCF A;  3G31 A;  4S2L A;  1PWD A;  1DJA A;  4IED A;  1PZO A;  4DE2 A;  4CPK A;  5E2G A;  2H0T A;  2ZC4 B;  4LCM A;  4OPZ A;  4MBH A;  4E3O A;  3PBN A;  1NZO A;  2WAF A;  3WS5 A;  1YM1 A;  3ZNY A;  1JWV A;  4IVI A;  3BEB A;  4PM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...