4E6WA

Clbp in complex with 3-aminophenyl boronic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
335
structure length
329
Chain Sequence
ERLSTLIHQRMQEAKVPALSVSVTIKGVRQRFVYGVADVASQKANTLDTVYELGSMSKAFTGLVVQILIQEGRLRQGDDIITYLPEMRLNYQGKPASLTVADFLYHTSGLPFSTLARLEAVAQQLRNENLLFAPGAKFSYASANYDVLGAVIENVTGKTFTEVIAERLTQPLGMSATVAVKGDEIIVNKASGYKLGFGKPVLFHAPLARNHVPAAYIHSTLPDMEIWIDAWLHRKALPATLREAMSNSWRGNSDVPLAADNRILYASGWFIDQNQGPYISHGGQNPNFSSCIALRPDQQIGIVALANMNSNLILQLCADIDNYLRIGKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ClbP peptidase
publication title The NRP peptidase ClbP as a target for the inhibition of genotoxicity, cell proliferation and tumorogenesis mediated by pks-harboring bacteria
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 98
structure length 329
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4e6wA00
4R1GA 1YLJA 4H8RA 2FFYA 1FCOA 4NETA 4UA6A 5U47A 4MBFA 4UA9A 2OLVA 3UPNA 2V1ZA 3ZNYA 1MWTA 3NY4A 4QU3A 4K0XA 5CHMA 3CJMA 3C4PA 1K54C 3IHAA 3Q81A 4OH0A 2BG1A 1IELA 2WKEA 4OPRA 1I2SA 5CRFA 1N9BA 3WS1A 4OQIA 4EBNA 2R9XA 3ZDJA 4C3QA 4B4XA 2XDMA 3OPLA 5HAQA 3RXWA 2JE5A 4QHCA 4S2KA 1FR6A 4HBUA 4MBHA 4X68A 1MPLA 3EQVA 4N1XA 2Y2IA 1L2SA 4WMCA 3HLFA 3MZFA 3S1YA 4WYYA 4S2NA 3VMAA 2J9PA 1ES5A 4PM6A 3PBOA 4GDBA 5KMWA 2WZZA 2XD1A 3G32A 5A91A 2C6WB 5M1AA 5EVIC 3OPPA 4X6TA 4P87A 5DF7A 1K57C 1SKFA 1XA1A 1FSYA 1IKGA 1ZG4A 2ZC3B 2Z2LB 1NZUA 1PZPA 3N8SA 3MKEA 4KZBA 4OPZA 4R0QA 1JWVA 4FSFA 4EQIA 2EX2A 3VOZA 4DDSA 3VSLA 3IF6B 2XD5A 3FKWA 5M18A 3Q7VA 3HLDA 3A3IA 3CZDA 1FQGA 5EPHA 3UNWA 4WEKA 1PWDA 3G4PA 3DW0A 3GV9A 3N8LA 4U0XA 5E2HA 1CK3A 1KE0A 3IF5A 2ZC4B 3M6BA 4MBKA 4QY6A 1KE4A 3HLBA 1IYSA 3IXDA 2G2WA 3FV7A 3OCNA 3MZDA 4N1HA 3EQUA 4WEJA 4GKUA 2B5RA 3LY3A 4KZ3A 3NDGA 2OSUA 3IWQA 3UDFA 1PWCA 2XFTA 2ZQCA 3UE1A 1EROA 4KQOA 5AQAA 2EXAA 2Y2OA 1K4EA 1J9MA 4OKPA 1YLPA 3M2KA 3E2KA 3VP1A 3PBRA 1SCWA 3DWZA 3OPHA 2JCHA 1Q2QA 5GLCA 2Y2KA 3HLGA 1LLBA 3ITAA 1O7EA 4OQ0A 3ZG8B 5F82A 3SH7A 1FSWA 4JF6A 3N4IA 5F1FA 4OLGA 3BLMA 3AGFA 3BYDA 4JLFA 4R3JA 1NYMA 3CMZA 4BL2A 5FI6A 4HBTA 1G68A 4CPKA 1BUEA 3UPOA 4UHUA 1PI5A 4B4ZA 3GRJA 1YLYA 5A90A 1GCEA 1K55A 4U0TA 5GLAA 4BL3A 4E6WA 5CHUA 2EX6A 3D4FA 5EVIB 4S2PA 4WZ5C 1EI5A 4X55A 1PIOA 3PTEA 1HVBA 5HFOA 1YMSA 4XXRA 4JXSA 3TSGA 1WYCA 3OC2A 2FFFB 2PU4A 4OVDA 5JYPA 4S2OA 2Y2JA 2Y2NA 2Y4AA 4JXWA 1BLCA 5DTKA 5EVLA 1ZG6A 1H8ZA 2VGKA 2C5WB 3VSKA 1U60A 2HP6A 2P9VB 2ZC7A 4ZJ2A 4N9LA 3WS4A 1GHIA 2ZLYA 4RX2A 1FOFA 2ZQDA 4OPYA 2ZJ9A 1ERMA 4ZAMA 4C75A 4GB7A 4RA7A 5FQKA 5DF9A 1FCNA 1LI9A 1NY0A 3QNBA 5HAPA 3BLSA 1K56A 3BFFA 5CECA 1LL5A 4Z9QA 1ES2A 3LO7A 5GL9A 2IWBA 3WWXA 1L0EA 3HLWA 4PM7A 5M19A 3N6IA 5CGSA 1MKIA 1ES4A 3UO9A 3E2LA 3DWKA 1SHVA 2HPBA 5KSHA 3UDIA 4QJGA 1L0DA 5E2GA 3V5MA 2ZM0A 1XKZA 1YLTA 1PWGA 3CG5A 1W8QA 1QMFA 3G31A 3IF6A 5GLDA 3P09A 2EX9A 3IHBA 1H5XA 1PW1A 3M6HA 4HESA 1ALQA 4JXVA 5DTSA 3GR2A 3SS5A 3MBZA 4KZ8A 4KZ9A 5AQ7A 5E2EA 2Y2QA 4OP5A 4P0MA 5EUAA 1NJ4A 1JTDA 3W8KA 5GHYA 1K4FA 4Y0TA 5HW3A 2RCXA 1FCMA 1NRFA 1W8YA 2WAEA 5EOOA 3UDXA 1K6SA 4OOYA 1H8YA 1TDLA 2P74A 2PU2A 3ZNTA 3A3JA 5FDHA 5FASA 3NCKA 1KDWA 1M40A 3BM6A 5HARA 2H0YA 3OPRA 2EX8A 2WGVA 4X53A 4LV3A 4O7DA 3HUOA 1BTLA 3FZCA 5F83A 5JYOA 3IH8A 1XGJA 2H10A 3HL9A 3TG9A 5IHVA 1K54A 1HZOA 4LV1A 3VP4A 3ZGAB 3IXBA 1K25A 2ZQ8A 4YINA 2XEPA 1JWPA 2WAFA 1VM1A 1MBLA 1PYYA 4LENA 3G30A 2E8IA 4R23A 2UWXA 4QD4A 3ZCZA 1N4OA 2A49A 2IWCA 5CHJA 3UN7A 3VP2A 5CEBA 4OP8A 1GHMA 1YM1A 3IT9A 4FH4A 4IEDA 2HP9A 1ES3A 5HAIA 3VFFA 2Q9NA 1YT4A 4N9KA 4EBLA 3OZHA 2CC1A 3BFCA 4KZAA 1W79A 1GA0A 1E4DA 4GOGA 1IYQA 2Z2MB 3V3RA 4QY5A 4E6XA 2R9WA 2ZQ7A 1I5QA 4R4RA 3G35A 4D2OA 3MXSA 2PBYA 1ESUA 4EWFA 3BFDA 2WADA 3P98A 1DJCA 4E3KA 5EVIA 4S2LA 2GDNA 4KG5A 1WE4A 2OV5A 4DXCA 4ZJ1A 1QMEA 4IVKA 3QHYA 3ZFZA 5KZHA 2WKIA 4N92A 4YFMA 1TEMA 2X01A 4PM8A 1TVFA 3PBSA 2H5SA 2XGNA 2P9VA 1W7FA 3B3XA 3VP3A 4CJNA 4KENB 4E3IA 4GD8A 5FQ9A 3C5AA 2ZM8A 1Y54A 1ONGA 2XQZA 3M2JA 4OONA 3C7VA 3GVBA 4UAAA 3A3DA 4ID4A 4ZTKA 2ZC5B 1NXYA 1DJBA 4EV4A 1XA7A 5I94A 4JBFA 3O88A 1O07A 3LCEA 5HX9A 4BD0A 3N8RA 4DXBA 1BULA 1K56D 4P85A 4IBRA 5E43A 2XF3A 3HVFA 3HUNA 3UY6A 3MZEA 3LY4A 4XUXA 2XLNA 1SDNA 4E3MA 1VQQA 4KZ6A 3IWIA 2V2FF 4R4SA 1NYYA 2WZXA 4DKIA 3RXXA 4K91A 1RCJA 3GQZA 1YQSA 4BLMA 3N7WA 3O3VA 5EECA 4Y0UA 5FA7A 1HD8A 3I7JA 1LHYA 4DDYA 3W4OA 4HEFA 4LV0A 1MXOA 3W4PA 4GZBA 4X69A 3WRZA 2Y2GA 3G2ZA 2A3UA 2ZM2A 2HP5A 4GN2A 5DTTA 4Q8IA 4WELA 2JBFA 2ZD8A 1G6AA 1RP5A 3BEBA 4JXGA 1XXMA 3FWLA 1RGZA 4GD6A 4OOMA 1ESIA 3SS3A 4KZ4A 1CI9A 3UPPA 2WGWB 4BD1A 4M3KA 3C7UA 3SH9A 3ZVWA 4A5RA 1IYOA 4E3OA 4JF5A 5GHXA 3Q7ZA 1EWZA 2H0TA 2G2UA 3Q82A 3MXRA 2XK1A 2V20A 2ZMAA 1PW8A 4S2JA 2ZC6B 5CGXA 5FAQA 2WGIA 4GDNA 2ZQAA 5DVAA 3AGDA 4WZ5A 1KGFA 2EFXA 5TGFA 2Y2MA 1BT5A 3W4QA 4S2MA 2I72A 4LV2A 4P6BA 3ZG7B 1I2WA 4PPRA 4OOLA 4E3LA 1KVMA 3V50A 1XGIA 4OLDA 2Y2PA 3O86A 1W5DA 3NC8A 5A93A 5FAOA 1WYBA 1ONHA 5FATA 1ERQA 3Q07A 4OPQA 5CXWA 5G18A 3S22A 1LL9A 4S2NC 3FKVA 2QMIA 2XR0A 3C4OA 3A3FA 4JF4A 5AQBA 3V39A 5EOEA 1NZOA 5AQ9A 2JC7A 4C6YA 4DE3A 5F1GA 1Z6FA 5D3OA 3ZVTA 1KGGA 4BJPA 4IBXA 4L0LA 3SH8A 1BLPA 1SDEA 3BRMA 4WBGA 4NK3A 3AGEA 4RYEA 1KVLA 3NIAA 2OLUA 1YLZA 1AXBA 1ZC2A 3DTMA 1IYPA 5EVID 2WYXA 1KDSA 1RGYA 1E25A 5FI7A 3JYIA 1E3UD 1MWSA 3TOIA 4QB8A 3HBRA 4FCFA 3SS4A 3V3SA 4FD8A 1K6RA 4PM5A 2HDRA 2VGJA 1HTZA 2Y2LA 5CTMA 5FSRA 4PM9A 4KQRA 4U3TA 4KG2A 5FQQA 3BECA 1TDGA 1KGEA 2Y91A 1XP4A 5FAPA 2ZQ9A 3ITBA 3ZHHA 5FI2A 3QNCA 4KG6A 3WS0A 5BOHA 5EE8A 4K0WA 4RX3A 1BLSA 4X56A 4LCMA 1BZAA 3G34A 3WS5A 5KSCA 4ZJ3A 3IXHA 4ZDXA 3LEZA 1XX2A 5J8XA 4UA7A 4Y7PA 5GLBA 4EBPA 4IVIA 2WK0A 3VP0A 1K57A 1BSGA 1E3UA 2X71A 1MWUA 1YMXA 4LCLA 2Q9MA 5CERA 2J8YA 3HUMA 4EUZA 2DRWA 2Y55A 3O87A 1XPBA 1L0GA 1JTGA 3GSGA 4DE2A 3WRTA 4MEZA 3SOIA 4FH2A 1Q2PA 4B88A 2WGWA 1KE3A 4XUZA 2BLSA 1BLHA 1ZKJA 4E3JA 1C3BA 2WKHA 3PBNA 1K55C 3G2YA 5GHZA 3Q1FA 4ZBEA 2EFUA 1IKIA 1IEMA 4MLLA 1FR1A 2HDSA 4PMAA 4DF6A 3UE0A 3HLEA 5CTNA 1MY8A 2XH9A 1L0FA 2RL3A 3IXGA 4F94A 4OQGA 2DNSA 5CEDA 2XFSA 2QZ6A 5TR7A 3IWOA 1CI8A 1MWRA 4WZ4A 5DF8A 4KZ5A 3ISGA 1DJAA 3Q7VB 5TFQA 3WS2A 3OCLA 3A3EA 4DE0A 1JVJA 4S2IA 4MNRA 4BENA 3ZG0A 3PAEA 5HL1A 1CEFA 3UE3A 5E2FA 1DY6A 4KZ7A 3VFHA 1M6KA 1OMEA 3HLCA 3PBTA 3ZG9B 3MKFA 5FQMA 3HREA 2Y2HA 2HDQA 2WUQA 3NDEA 1GA9A 4JKTA 2QPNA 3RJUA 4GNUA 1PZOA 3NI9A 3ZG5A 5FQIA 2EXBA 3BFGA 2J7VA 5CGWA 5L2FA 2Y59A 4Y0OA 1S0WA 2DCFA 3IF6C 4R3BA 1S6RA 1YLWA 1K38A 4DE1A 5FQJA 4OQHA 1PI4A 3IH9A 2X02A 3GTCA 3NBLA 3BFEA 2HDUA 3PAGA 3PBQA 4KQQA 3GMWA 3MFDA 4JPMA 3S4XA 1CEGA 1JWZA 4E3NA 3FYZA 2IWDA 4RVAA 4DRTA 5A92A 1LI0A 4WM9A 4BQMA 4WMCD 2J9OA 3VOYA 3IQAA 1GHPA
chains in the Genus database with same CATH superfamily
4R1GA 2QHKA 4MBFA 4Y3IA 4G3VA 4K0XA 3IHAA 3Q81A 4GW9A 4OQIA 4EBNA 2R9XA 4Y5FA 4B4XA 4BWIA 2XDMA 4HJ6A 2JE5A 1FR6A 5A8BA 4BBTA 3T4SA 5HD3A 1MPLA 3T4OA 4N1XA 3HLFA 3LIAA 4WYYA 1HLUP 4I3IA 1ES5A 3LUQA 4GDBA 3LR5A 5A91A 4UQIS 5M1AA 4X6TA 1FSYA 1IKGA 1ZG4A 2EWVA 2KDKA 4R0QA 3N8SA 1JWVA 4FSFA 2K7SA 2ZMFA 4YWZA 5M18A 3EGXC 3HLDA 3UNWA 3G4PA 3GV9A 3N8LA 5F6AA 3IF5A 1YSQA 4QY6A 4R6LA 1KE4A 4CLCB 1IYSA 3EQUA 3NDGA 3KYEA 1PWCA 4GS9A 4ZRRA 2B02A 2EXAA 1K4EA 3M2KA 2K2NA 2JCHA 5F5YA 4Q0IA 1O7EA 3SH7A 2LB5A 4L9GA 4UQIM 4PHTA 4JGOA 3BLMA 3AGFA 4JLFA 1G6OA 3E4PA 1LSXA 1G68A 1TS7A 4XT2B 3UPOA 3LIBA 1OJGA 3DTKA 2W1RA 2KOIA 2OWJA 5A90A 1K55A 4U0TA 4ARZA 4BL3A 3LIEA 1EI5A 1YMSA 1WYCA 3PHYA 4S2OA 1ZG6A 1U60A 4HNBA 2P9VB 4N9LA 1FOFA 1OT6A 4ZAMA 4DMZA 1N9OA 5FQKA 1K56A 4HY8A 5CECA 1ES2A 2Z6CA 3LEQA 2K31A 3HLWA 5K5BA 3UMEA 3E2LA 3C8CA 1SHVA 2PDRA 5E2GA 3CPTA 3MSHA 1P9RA 4ME4A 3IHBA 3M6HA 2L0WA 5EM0A 1S4SA 5E2EA 4P0MA 4ETZA 1NJ4A 1JTDA 1K4FA 2W3HA 4IJGA 1NRFA 2WAEA 1K6SA 1UWNX 4Y17A 4CQHA 4OOYA 1H8YA 5FDHA 3NCKA 1GSXA 4II7A 3S7PA 2HJ9C 5L09A 1BTLA 3FZCA 3TG9A 4HHDA 3IXBA 1K25A 2ZQ8A 2XEPA 5HDDA 2L1MA 2WAFA 3OBFA 4LENA 3G30A 1N4OA 2IWCA 3OZHA 2CC1A 4KZAA 2Z2MB 3C2WA 5HL6A 2J3TC 4D2OA 4R4RA 2PBYA 3P98A 2WADA 1DJCA 5EVIA 2XROA 2GDNA 4ZJ1A 5G4ZA 2WKIA 1ZTUA 4Y15A 5HSQA 4PM8A 2XGNA 3DBAA 3B3XA 2JKFA 3BW6A 4E3IA 1PFLA 5FQ9A 3PYPA 3GVBA 4UAAA 3A3DA 4ID4A 2D02A 1T1BA 2ZC5B 4EV4A 3QP4A 3O88A 1O07A 5HX9A 4BD0A 3LI8A 4P85A 4XUXA 1SDNA 2V2FF 2WZXA 3IX3A 3LR0A 4DKIA 3RXXA 1RCJA 4BLMA 3F1PB 3N7WA 3O3VA 3W4OA 4LV0A 1MXOA 3T1SA 4X69A 3WRZA 2ZM2A 1VEUB 2JBFA 3BEBA 4GD6A 4OOMA 4G3WA 2BTFP 4CLCD 5TBMA 1F5MA 4M3KA 2PYPA 3ZVWA 4EU0A 1K0KA 3HJIA 4WF0A 3Q7ZA 2H0TA 4BBVA 4YOFA 2OWHA 2GJ3A 5FAQA 2WGIA 1DP9A 4LRZE 4WZ5A 1BT5A 3W4QA 2W3GA 4S2MA 3ZG7B 4LV2A 3TJZC 3LGOA 3NC8A 5FAOA 4ESPA 5FATA 1ERQA 2XA7S 2QMIA 3L7HA 4LGWA 2B95A 1Z6FA 1KGGA 2ZOIA 3BRMA 4NK3A 3NIAA 2OLUA 1YLZA 1AXBA 3JVVA 3DTMA 1IYPA 4K08A 2EA9A 3QP5A 4GHIA 3S7OA 1HTZA 2VGJA 5MC7A 4U3TA 4CLCE 3BECA 1TDGA 2ZQ9A 2I9VA 4KG6A 3WS0A 4RX3A 4MCWA 1TS6A 4Y7PA 1K57A 3KSIA 4QWOA 2X71A 1MWUA 1YMXA 1GSVA 5J4EA 4EUZA 3A0VA 3WRTA 4MEZA 3DTEA 4I3JA 3H9WA 5GHZA 3O5YA 2HDSA 3LI9A 4Z1WA 2VV6A 4HJ3A 1CI8A 3T4TA 1MWRA 1DJAA 3WS2A 5TFQA 5KIZA 3A3EA 2JKRI 3H7WA 4BENA 3VFHA 2PR6A 1OMEA 3HREA 2HDQA 2PRFA 1VHMA 4GS9B 2JN7A 4GNUA 3UB6A 2GNXA 3IX4A 3C38A 2M1CA 1DP6A 4I3AA 2LB9A 3CI6A 2OAQ1 3QP8A 3GTCA 3BFEA 3PAGA 4CLCC 3PBQA 4I5SA 3ULFA 4E04A 2PT7A 3S4XA 1JWZA 1UGUA 3FYZA 4WN5A 2IWDA 5HPFA 1LI0A 3NOPC 2O99A 1XFQA 5HWVA 2FFYA 1FCOA 4ARZB 2OLVA 3QP6A 4GLQA 4QU3A 1V9YA 1K54C 4OH0A 2BG1A 1IELA 5CRFA 1N9BA 3ZDJA 1T19A 3S7QA 4MBHA 2Y2IA 1L2SA 2DMWA 5AJGA 3CLOA 2WKRA 3DAVA 5J7EA 5KMWA 2XD1A 4L9EA 2C6WB 2V0UA 1K57C 1SKFA 2Z2LB 1NZUA 4OPZA 3MKEA 3VOZA 3VSLA 4DJ3A 2XD5A 3FKWA 3A3IA 1PWDA 1KE0A 3A0SA 1D1JA 3MFXA 3IXDA 3MZDA 4N1HA 4GKUA 4KZ3A 2OSUA 1XFNA 2ZQCA 5F68A 1Y4OA 4KQOA 5AQAA 2O0YA 3BY9A 1J9MA 4OKPA 3PBRA 3OPHA 4NG2A 5GLCA 1LLBA 3BQAA 4LRXC 4OQ0A 2VV7A 5F1FA 4OLGA 3QP2A 2VA0A 3CMZA 4L9FA 4BL2A 4CPKA 3D9YA 4HH2A 1BUEA 1G28A 3UMDA 1PI5A 3T50A 2VX8A 3GRJA 4B4ZA 4ETXA 5GLAA 2EX6A 5FEGA 3D4FA 5EVIB 5HFOA 1EW0A 3OOVA 4XXRA 2FFFB 2PU4A 3UB8A 5TR7A 2Y2NA 4JXWA 1BLCA 5EVEA 2ZC7A 4BBUA 3WS4A 2ZLYA 2Q0OA 4OPYA 1JNUA 4C75A 4RA7A 5DF9A 1FCNA 5HAPA 3BLSA 2W1TA 5GL9A 3IS2A 1D7EA 1F98A 3DWKA 2HPBA 3UDIA 1L0DA 4WLAA 2ZM0A 3T4JA 3IF6A 1PW1A 1KOUA 2YKHA 5EUAA 4X1LA 1NRJA 4Y0TA 5HW3A 1FCMA 2RCXA 1W8YA 4HIAA 3UDXA 3R4KA 5TBMB 5FASA 1M40A 3OPRA 2EX8A 1XGJA 2H10A 1VM1A 5HWWA 2E8IA 4R23A 2UWXA 4QD4A 3IT9A 1YM1A 4R38A 5HAIA 2HP9A 1ES3A 1YT4A 1W79A 1GA0A 1E4DA 4GOGA 4E6XA 4G3KA 2ZQ7A 3V67A 3G35A 3BY8A 3VE4A 4EWFA 3VE3A 3TW8A 4S2LA 2OV5A 4DXCA 1QMEA 5KZHA 3QHYA 3L9KA 1OTAA 4N92A 1TEMA 1Z09A 3PBSA 4CJNA 3VP3A 2ZM8A 3KYQA 1ONGA 3M2JA 4GHIB 4OONA 4B93A 2P04A 4GJ4A 5DFYA 5I94A 3LCEA 3N8RA 4P6ZS 4DXBA 1K56D 5E43A 2XF3A 3HVFA 4EUVA 3LY4A 5DKKA 2XLNA 4E3MA 2KX6A 1S66L 3LFVA 4X25A 1YQSA 5EECA 3MF0A 3T12B 4Y0UA 1HD8A 3I7JA 1LHYA 4JGPA 2YKFA 4IUHA 2O9AA 2A3UA 2HP5A 5DTTA 2ZD8A 4JXGA 3SS3A 1CI9A 4BD1A 3C7UA 1NLZA 1EWZA 3Q82A 5IT5A 3MXRA 2XK1A 3EWKA 4MN6A 4S2JA 2ZQAA 3KO6A 2VKSA 3AGDA 1KGFA 3MS6A 2Y2MA 2EWWA 3EOIA 5L10A 4PPRA 1KVMA 1CJFA 3V50A 4OLDA 3H7WB 5A93A 1WYBA 3Q07A 5CXWA 2ACGA 4LRYC 1LL9A 2V9AA 3C4OA 3A3FA 4JF4A 2NUTC 1NZOA 1N9LA 5AQ9A 4DE3A 4H6JB 3ZVTA 5D3OA 1OTIA 2HZ5A 3SH8A 1BLPA 2O9CA 4RYEA 1KVLA 1ZC2A 5EVID 5I5LA 1RGYA 3K2NA 1E25A 1E3UD 2W3EA 5F69A 3SS4A 3V3SA 1X0OA 2HDRA 4PM9A 3BJNA 4KQRA 2GX5A 2Y91A 3ITBA 3ZHHA 4EEUA 3UE6A 2E8JA 5EE8A 3H82A 4FUWA 4LCMA 4X56A 3G34A 5KSCA 3K3DA 4O8GA 5GLBA 2WKPA 1IFQA 4EBPA 3KYZA 1E3UA 1TD5A 4JGQA 1Q2PA 3ZYTA 2WGWA 4XUZA 2A2LA 1BLHA 1ZKJA 3KSFA 1C3BA 3PBNA 1K55C 2EFUA 1IKIA 1IEMA 4PMAA 1FR1A 3HLEA 1MY8A 2INWA 4F94A 2RL3A 4OQGA 4NEED 5CEDA 2XFSA 4WZ4A 4KZ5A 3E4OA 4MNRA 3NHQA 1CEFA 4LFUA 2KLIA 4KZ7A 3HLCA 4KQDA 2JKTI 2WUQA 3NDEA 3RJUA 5CGWA 2HGVA 2Y59A 1S1YA 1S6RA 4PKYG 2ZOHA 5FEFA 4KQQA 1CEGA 4RVAA 4DRTA 4BQMA 2J9OA 1GHPA 3S7NA 3LR4A 5U47A 3T1QB 3ZNYA 4PAUA 3NY4A 3CJMA 1I2SA 3UB5P 3WS1A 3B33A 4C3QA 3OPLA 5HAQA 3BQ8A 1XJ2A 1NLYA 2W27A 3RXWA 4HBUA 1T18A 4X68A 3EQVA 3VMAA 4S2NA 1OTEA 2W1TB 2J9PA 4B9OA 3T4LA 4PM6A 3IS2B 3PBOA 2WZZA 3G32A 4KUOA 5EVIC 4P87A 5DF7A 1XA1A 4IUKA 2ZC3B 1S4RA 4EQIA 4KZBA 3IF6B 4R3AA 5C5KA 2XA7M 1FQGA 5EPHA 4WEKA 3U4LP 3VOLA 3DW0A 5E2HA 1CK3A 5L07A 4HOIA 2ZC4B 3M6BA 3ZQ5A 3HLBA 2G2WA 3OCNA 4WEJA 2HV1A 5EM1A 2B5RA 3IWQA 1TS8A 2V0WA 1EROA 3NULA 4IHQA 2Y2OA 1YLPA 4BMWA 1AWIA 2Y2KA 3HLGA 3ITAA 5EV0A 4FTXA 2Y8HA 3N4IA 2QYBA 3BYDA 4DN0A 3F1OB 4HBTA 4Q0HA 4Y13A 5EFWA 4UHUA 3MQQA 1YLYA 1GCEA 3UB9A 4H6JA 5CHUA 4S2PA 4WZ5C 1J3WA 3HCYA 1PIOA 3PTEA 1HVBA 4JXSA 3OC2A 5JYPA 1CQAA 2Y2JA 2Y4AA 1H8ZA 2C5WB 2HP6A 4ZJ2A 1GHIA 4RX2A 2O9BA 1ACFA 1LT0A 2ZJ9A 1ERMA 4GB7A 1LI9A 2ZMVA 3QNBA 4UEYA 3CWFA 1LL5A 3WWXA 3IBJA 2Y79A 1XJ4A 4PM7A 4MN5A 1NWZA 1MKIA 3UO9A 1SZVA 2HF6A 2UV0E 4QJGA 3T4KA 3V5MA 3KSGA 1PWGA 3CG5A 1QMFA 3G31A 3P09A 2EX9A 5DTSA 3GR2A 3MBZA 2V8CA 4KZ8A 5AQ7A 2M7VA 4OP5A 1H0MA 5GHYA 5EOOA 2PBDP 1TDLA 2P74A 2PU2A 5AVFA 3A3JA 3ZNTA 4EERA 2FZ0A 1W63M 4LV3A 1TF1A 3HUOA 5F83A 5JYOA 3HL9A 4MN7A 4LV1A 3VP4A 3ZGAB 2QKPA 5DJTA 3EGDC 3ZCZA 4EEPA 5CHJA 1W63Q 1OJ5A 5CEBA 4NXGA 4OP8A 3VFFA 3C30A 2Q9NA 2W3FA 1S1ZA 4EETB 1LL8A 3LICA 3BFCA 1IYQA 2R9WA 1ESUA 4E3KA 3OLOA 1WE4A 4IVKA 3ZFZA 2NUPC 2X01A 2PYRA 2V8FA 2H5SA 1W7FA 5HZHA 4KENB 4GD8A 2XQZA 4WL9A 2PD8A 3C7VA 4AFIA 1SKOA 1P0ZA 2ZBBA 1XA7A 4EXOA 1BULA 4IBRA 2ZL1A 1F9IA 3P7NA 3IWIA 3H82B 3NOTC 4R4SA 1NYYA 1T1AA 4K91A 5FA7A 4GCZA 4DDYA 5DFXA 3G2ZA 4GN2A 2Z6DA 4WELA 2M7UA 1RP5A 1XXMA 3FWLA 3CUEA 1ESIA 4KZ4A 3GECA 3UPPA 2WGWB 3T1XA 2G2UA 1MKMA 5AVEA 2V1BA 2V20A 1PW8A 4F3LA 1I2WA 1FILA 5HDSA 4HP9A 3LYXA 2Y2PA 5G18A 3S22A 3FKVA 2XR0A 3V39A 5AQBA 1PRQA 3FPVA 2JC7A 5F1GA 4IBXA 2VJWA 1SDEA 4WBGA 2WYXA 3F1NA 3RH8B 5FI7A 3JYIA 3TOIA 1S67L 2AVXA 3HBRA 4FCFA 2J3WA 4FD8A 3IX8A 4PM5A 2Y2LA 5FSRA 4KG2A 3F1OA 5FQQA 2FH5A 5FAPA 3QNCA 2J3TD 5BOHA 4K0WA 1XJ3A 4EW7A 5DKLA 3B42A 2H28A 3WS5A 4ZJ3A 4ZDXA 3LIFA 1P97A 4IVIA 2WK0A 3VP0A 4LCLA 2PAVP 2Q9MA 3MJQA 2G7UA 4R70A 3O87A 1XPBA 1DRMA 3IBRA 1L0GA 5HDCA 3SOIA 4FH2A 4JGRA 3U2AA 4B88A 3FG8A 4E3JA 4EQ1A 4MLLA 4YNRA 4DF6A 3UE0A 2XH9A 1STZA 2DNSA 2JKGA 2QZ6A 3R7WB 5DF8A 3ICYA 2CMNA 3ISGA 3MMHA 1PNEA 1JVJA 5CX7A 3ZG0A 3CUEC 3EEAA 3UE3A 5E2FA 1OT9A 1DY6A 2WKQA 3PBTA 2Y2HA 5LBRA 1GA9A 2QPNA 1PZOA 1VB6A 3NI9A 2VK3A 5FQIA 3ZG5A 3W2ZA 1S0WA 3IF6C 4Q0JA 1YLWA 1K38A 3IH9A 1VETA 3NBLA 2IA2A 4P6ZM 4E3NA 3LR3A 4WMCD 4EESA 3VOYA 2OAP1 3IQAA 1YLJA 3QP1A 4H8RA 4NETA 3K3CA 4UA6A 2P08A 4UA9A 3UPNA 2V1ZA 1MWTA 5CHMA 3MXQA 3C4PA 3HJKA 5HPIA 2WKEA 4OPRA 3PR6A 2PR5A 4RQ9A 4QHCA 4S2KA 1N9NA 2A24A 4WMCA 3MZFA 3S1YA 3KX0X 5HD5A 3NECA 3OPPA 2QWSA 2V1AA 4LLOB 2QJ7A 1PZPA 2EX2A 4DDSA 4NXBA 3Q7VA 3CZDA 4QPRA 3PXPA 4U0XA 1YPRA 3CITA 4MBKA 5IS1A 3FV7A 3P01A 2VLGA 1H3QA 3LY3A 3UDFA 2PHYA 2XFTA 2XSSA 3RFBA 2JKTM 1YAXA 3UE1A 1MC0A 3MQOA 3E2KA 3VP1A 1SCWA 3DWZA 1ODVA 1Q2QA 2R78A 2P7JA 4I39A 4WUJA 3ZG8B 5F82A 3CHWP 3E4QA 1YSPA 1YKDA 1FSWA 4JF6A 3KSHA 1OPXA 4R3JA 2D01A 1NYMA 5FI6A 1UWPX 5DJUA 5L8MA 5FL3A 4E6WA 4HJ4A 3MR0A 4X55A 2JHEA 3TSGA 4MMNA 4OVDA 5DTKA 5EVLA 3VSKA 2VGKA 4HH3A 2ZQDA 1ZHHB 1NY0A 5IU1A 1SKOB 3BFFA 4Z9QA 3LO7A 2IWBA 1L0EA 5M19A 3N6IA 5CGSA 1ES4A 2ZL1B 5KSHA 5HWTA 1XKZA 1YLTA 1W8QA 5GLDA 2PD7A 1H5XA 4HESA 1ALQA 4JXVA 3SS5A 4PKYA 4KZ9A 2Y2QA 4CLCA 1OTBA 3W8KA 5TJJA 1WA9A 1KDWA 2HJEA 3BM6A 5HARA 2VV8A 2H0YA 4X53A 2WGVA 1GSWA 4O7DA 3IH8A 3BWLA 3D3OA 1K54A 1HZOA 1CF0A 5IHVA 1P9WA 4YINA 1JWPA 3R7WA 4F3LB 1MBLA 1PYYA 4NXEA 2A49A 3E98A 3UN7A 3VP2A 3G6OA 1GHMA 4IEDA 4FH4A 2JKRM 4N9KA 4EBLA 3NJAA 2B18A 4M4XA 4XT2A 3E0YA 3V3RA 4QY5A 2VGLS 1I5QA 4FOFA 3VV4A 3MXSA 3BFDA 1BYWA 4KG5A 3GDIA 3SW1A 4DJ2A 3FPWA 4YFMA 3F1NB 1TVFA 2P9VA 3C5AA 1Y54A 5J3WA 1FIKA 4O01A 4ZTKA 1NXYA 1DJBA 2GZAA 3FC7A 3TRCA 4JBFA 2BASA 3HUNA 3UY6A 3MZEA 1V9ZA 4KUKA 1VQQA 4KZ6A 3GQZA 3B47A 4HQAA 1MZUA 4LPZA 4HEFA 3W4PA 4GZBA 2VGLM 2Y2GA 4O0PA 2L4RA 4Q8IA 3EEHA 1G6AA 1RGZA 3SH9A 4A5RA 1IYOA 3NOUC 4E3OA 4JF5A 5GHXA 2QJ5A 4Y2FA 3DTIA 3JVUA 2ZMAA 5CGXA 2ZC6B 4GDNA 3D72A 5DVAA 1L3LA 2W3DA 2EFXA 4X1MA 5TGFA 2I72A 4P6BA 4OOLA 4E3LA 1XGIA 3O86A 1W5DA 4HP4A 1ONHA 4OPQA 4S2NC 2J80A 3TE8A 5EOEA 2MJ6A 4C6YA 4BJPA 3SZTA 4L0LA 3T1RA 3AGEA 1KDSA 1MWSA 4QB8A 2VEAA 1VETB 1Y28A 1G5UA 2VZWA 1IOUA 1K6RA 5CTMA 4I38A 5G4YA 1TS0A 1KGEA 2W0NA 1XP4A 5FI2A 3T4QA 3MQ0A 1BLSA 1BZAA 3CPTB 3IXHA 3F1PA 3LEZA 1XX2A 5J8XA 4UA7A 4NKPA 5FDSA 1BSGA 1DP8A 5CERA 2J8YA 3CAXA 3HUMA 1T1CA 2DRWA 1LSWA 2Y55A 1A0KA 1VEUA 1JTGA 3GSGA 4DE2A 1D06A 2A24B 1KE3A 2BLSA 2WKHA 2OOLA 3G2YA 3Q1FA 1XJ6A 4ZBEA 5CTNA 4D60A 3IXGA 1L0FA 4MDZA 1OTDA 3IWOA 3Q7VB 3JPUA 3OCLA 4DE0A 4S2IA 3PAEA 5HL1A 1M6KA 2XRNA 3A0RA 3ZG9B 3MKFA 5FQMA 3UB7A 4JKTA 1LSVA 2EXBA 3BFGA 2J7VA 5L2FA 4Y0OA 2DCFA 4R3BA 4DE1A 5FQJA 4OQHA 1PI4A 2X02A 1F2KA 3LIDA 2HDUA 4HI4A 3RTYA 3GMWA 3MFDA 4JPMA 4NXFA 5A92A 4WM9A 1H8MA
chains in the Genus database with same CATH topology
4R1GA 1YLJA 4H8RA 2FFYA 1FCOA 4NETA 4UA6A 5U47A 4MBFA 4UA9A 2OLVA 3UPNA 2V1ZA 3ZNYA 1MWTA 3NY4A 4QU3A 4K0XA 5CHMA 3CJMA 3C4PA 1K54C 3IHAA 3Q81A 4OH0A 2BG1A 1IELA 2WKEA 4OPRA 1I2SA 5CRFA 1N9BA 3WS1A 4OQIA 4EBNA 2R9XA 3ZDJA 4C3QA 4B4XA 2XDMA 3OPLA 5HAQA 3RXWA 2JE5A 4QHCA 4S2KA 1FR6A 4HBUA 4MBHA 4X68A 1MPLA 3EQVA 4N1XA 2Y2IA 1L2SA 4WMCA 3HLFA 3MZFA 3S1YA 4WYYA 4S2NA 3VMAA 2J9PA 1ES5A 4PM6A 3PBOA 4GDBA 5KMWA 2WZZA 2XD1A 3G32A 5A91A 2C6WB 5M1AA 5EVIC 3OPPA 4X6TA 4P87A 5DF7A 1K57C 1SKFA 1XA1A 1FSYA 1IKGA 1ZG4A 2ZC3B 2Z2LB 1NZUA 1PZPA 3N8SA 3MKEA 4KZBA 4OPZA 4R0QA 1JWVA 4FSFA 4EQIA 2EX2A 3VOZA 4DDSA 3VSLA 3IF6B 2XD5A 3FKWA 5M18A 3Q7VA 3HLDA 3A3IA 3CZDA 1FQGA 5EPHA 3UNWA 4WEKA 1PWDA 3G4PA 3DW0A 3GV9A 3N8LA 4U0XA 5E2HA 1CK3A 1KE0A 3IF5A 2ZC4B 3M6BA 4MBKA 4QY6A 1KE4A 3HLBA 1IYSA 3IXDA 2G2WA 3FV7A 3OCNA 3MZDA 4N1HA 3EQUA 4WEJA 4GKUA 2B5RA 3LY3A 4KZ3A 3NDGA 2OSUA 3IWQA 3UDFA 1PWCA 2XFTA 2ZQCA 3UE1A 1EROA 4KQOA 5AQAA 2EXAA 2Y2OA 1K4EA 1J9MA 4OKPA 1YLPA 3M2KA 3E2KA 3VP1A 3PBRA 1SCWA 3DWZA 3OPHA 2JCHA 1Q2QA 5GLCA 2Y2KA 3HLGA 1LLBA 3ITAA 1O7EA 4OQ0A 3ZG8B 5F82A 3SH7A 1FSWA 4JF6A 3N4IA 5F1FA 4OLGA 3BLMA 3AGFA 3BYDA 4JLFA 4R3JA 1NYMA 3CMZA 4BL2A 5FI6A 4HBTA 1G68A 4CPKA 1BUEA 3UPOA 4UHUA 1PI5A 4B4ZA 3GRJA 1YLYA 5A90A 1GCEA 1K55A 4U0TA 5GLAA 4BL3A 4E6WA 5CHUA 2EX6A 3D4FA 5EVIB 4S2PA 4WZ5C 1EI5A 4X55A 1PIOA 3PTEA 1HVBA 5HFOA 1YMSA 4XXRA 4JXSA 3TSGA 1WYCA 3OC2A 2FFFB 2PU4A 4OVDA 5JYPA 4S2OA 2Y2JA 2Y2NA 2Y4AA 4JXWA 1BLCA 5DTKA 5EVLA 1ZG6A 1H8ZA 2VGKA 2C5WB 3VSKA 1U60A 2HP6A 2P9VB 2ZC7A 4ZJ2A 4N9LA 3WS4A 1GHIA 2ZLYA 4RX2A 1FOFA 2ZQDA 4OPYA 2ZJ9A 1ERMA 4ZAMA 4C75A 4GB7A 4RA7A 5FQKA 5DF9A 1FCNA 1LI9A 1NY0A 3QNBA 5HAPA 3BLSA 1K56A 3BFFA 5CECA 1LL5A 4Z9QA 1ES2A 3LO7A 5GL9A 2IWBA 3WWXA 1L0EA 3HLWA 4PM7A 5M19A 3N6IA 5CGSA 1MKIA 1ES4A 3UO9A 3E2LA 3DWKA 1SHVA 2HPBA 5KSHA 3UDIA 4QJGA 1L0DA 5E2GA 3V5MA 2ZM0A 1XKZA 1YLTA 1PWGA 3CG5A 1W8QA 1QMFA 3G31A 3IF6A 5GLDA 3P09A 2EX9A 3IHBA 1H5XA 1PW1A 3M6HA 4HESA 1ALQA 4JXVA 5DTSA 3GR2A 3SS5A 3MBZA 4KZ8A 4KZ9A 5AQ7A 5E2EA 2Y2QA 4OP5A 4P0MA 5EUAA 1NJ4A 1JTDA 3W8KA 5GHYA 1K4FA 4Y0TA 5HW3A 2RCXA 1FCMA 1NRFA 1W8YA 2WAEA 5EOOA 3UDXA 1K6SA 4OOYA 1H8YA 1TDLA 2P74A 2PU2A 3ZNTA 3A3JA 5FDHA 5FASA 3NCKA 1KDWA 1M40A 3BM6A 5HARA 2H0YA 3OPRA 2EX8A 2WGVA 4X53A 4LV3A 4O7DA 3HUOA 1BTLA 3FZCA 5F83A 5JYOA 3IH8A 1XGJA 2H10A 3HL9A 3TG9A 5IHVA 1K54A 1HZOA 4LV1A 3VP4A 3ZGAB 3IXBA 1K25A 2ZQ8A 4YINA 2XEPA 1JWPA 2WAFA 1VM1A 1MBLA 1PYYA 4LENA 3G30A 2E8IA 4R23A 2UWXA 4QD4A 3ZCZA 1N4OA 2A49A 2IWCA 5CHJA 3UN7A 3VP2A 5CEBA 4OP8A 1GHMA 1YM1A 3IT9A 4FH4A 4IEDA 2HP9A 1ES3A 5HAIA 3VFFA 2Q9NA 1YT4A 4N9KA 4EBLA 3OZHA 2CC1A 3BFCA 4KZAA 1W79A 1GA0A 1E4DA 4GOGA 1IYQA 2Z2MB 3V3RA 4QY5A 4E6XA 2R9WA 2ZQ7A 1I5QA 4R4RA 3G35A 4D2OA 3MXSA 2PBYA 1ESUA 4EWFA 3BFDA 2WADA 3P98A 1DJCA 4E3KA 5EVIA 4S2LA 2GDNA 4KG5A 1WE4A 2OV5A 4DXCA 4ZJ1A 1QMEA 4IVKA 3QHYA 3ZFZA 5KZHA 2WKIA 4N92A 4YFMA 1TEMA 2X01A 4PM8A 1TVFA 3PBSA 2H5SA 2XGNA 2P9VA 1W7FA 3B3XA 3VP3A 4CJNA 4KENB 4E3IA 4GD8A 5FQ9A 3C5AA 2ZM8A 1Y54A 1ONGA 2XQZA 3M2JA 4OONA 3C7VA 3GVBA 4UAAA 3A3DA 4ID4A 4ZTKA 2ZC5B 1NXYA 1DJBA 4EV4A 1XA7A 5I94A 4JBFA 3O88A 1O07A 3LCEA 5HX9A 4BD0A 3N8RA 4DXBA 1BULA 1K56D 4P85A 4IBRA 5E43A 2XF3A 3HVFA 3HUNA 3UY6A 3MZEA 3LY4A 4XUXA 2XLNA 1SDNA 4E3MA 1VQQA 4KZ6A 3IWIA 2V2FF 4R4SA 1NYYA 2WZXA 4DKIA 3RXXA 4K91A 1RCJA 3GQZA 1YQSA 4BLMA 3N7WA 3O3VA 5EECA 4Y0UA 5FA7A 1HD8A 3I7JA 1LHYA 4DDYA 3W4OA 4HEFA 4LV0A 1MXOA 3W4PA 4GZBA 4X69A 3WRZA 2Y2GA 3G2ZA 2A3UA 2ZM2A 2HP5A 4GN2A 5DTTA 4Q8IA 4WELA 2JBFA 2ZD8A 1G6AA 1RP5A 3BEBA 4JXGA 1XXMA 3FWLA 1RGZA 4GD6A 4OOMA 1ESIA 3SS3A 4KZ4A 1CI9A 3UPPA 2WGWB 4BD1A 4M3KA 3C7UA 3SH9A 3ZVWA 4A5RA 1IYOA 4E3OA 4JF5A 5GHXA 3Q7ZA 1EWZA 2H0TA 2G2UA 3Q82A 3MXRA 2XK1A 2V20A 2ZMAA 1PW8A 4S2JA 2ZC6B 5CGXA 5FAQA 2WGIA 4GDNA 2ZQAA 5DVAA 3AGDA 4WZ5A 1KGFA 2EFXA 5TGFA 2Y2MA 1BT5A 3W4QA 4S2MA 2I72A 4LV2A 4P6BA 3ZG7B 1I2WA 4PPRA 4OOLA 4E3LA 1KVMA 3V50A 1XGIA 4OLDA 2Y2PA 3O86A 1W5DA 3NC8A 5A93A 5FAOA 1WYBA 1ONHA 5FATA 1ERQA 3Q07A 4OPQA 5CXWA 5G18A 3S22A 1LL9A 4S2NC 3FKVA 2QMIA 2XR0A 3C4OA 3A3FA 4JF4A 5AQBA 3V39A 5EOEA 1NZOA 5AQ9A 2JC7A 4C6YA 4DE3A 5F1GA 1Z6FA 5D3OA 3ZVTA 1KGGA 4BJPA 4IBXA 4L0LA 3SH8A 1BLPA 1SDEA 3BRMA 4WBGA 4NK3A 3AGEA 4RYEA 1KVLA 3NIAA 2OLUA 1YLZA 1AXBA 1ZC2A 3DTMA 1IYPA 5EVID 2WYXA 1KDSA 1RGYA 1E25A 5FI7A 3JYIA 1E3UD 1MWSA 3TOIA 4QB8A 3HBRA 4FCFA 3SS4A 3V3SA 4FD8A 1K6RA 4PM5A 2HDRA 2VGJA 1HTZA 2Y2LA 5CTMA 5FSRA 4PM9A 4KQRA 4U3TA 4KG2A 5FQQA 3BECA 1TDGA 1KGEA 2Y91A 1XP4A 5FAPA 2ZQ9A 3ITBA 3ZHHA 5FI2A 3QNCA 4KG6A 3WS0A 5BOHA 5EE8A 4K0WA 4RX3A 1BLSA 4X56A 4LCMA 1BZAA 3G34A 3WS5A 5KSCA 4ZJ3A 3IXHA 4ZDXA 3LEZA 1XX2A 5J8XA 4UA7A 4Y7PA 5GLBA 4EBPA 4IVIA 2WK0A 3VP0A 1K57A 1BSGA 1E3UA 2X71A 1MWUA 1YMXA 4LCLA 2Q9MA 5CERA 2J8YA 3HUMA 4EUZA 2DRWA 2Y55A 3O87A 1XPBA 1L0GA 1JTGA 3GSGA 4DE2A 3WRTA 4MEZA 3SOIA 4FH2A 1Q2PA 4B88A 2WGWA 1KE3A 4XUZA 2BLSA 1BLHA 1ZKJA 4E3JA 1C3BA 2WKHA 3PBNA 1K55C 3G2YA 5GHZA 3Q1FA 4ZBEA 2EFUA 1IKIA 1IEMA 4MLLA 1FR1A 2HDSA 4PMAA 4DF6A 3UE0A 3HLEA 5CTNA 1MY8A 2XH9A 1L0FA 2RL3A 3IXGA 4F94A 4OQGA 2DNSA 5CEDA 2XFSA 2QZ6A 5TR7A 3IWOA 1CI8A 1MWRA 4WZ4A 5DF8A 4KZ5A 3ISGA 1DJAA 3Q7VB 5TFQA 3WS2A 3OCLA 3A3EA 4DE0A 1JVJA 4S2IA 4MNRA 4BENA 3ZG0A 3PAEA 5HL1A 1CEFA 3UE3A 5E2FA 1DY6A 4KZ7A 3VFHA 1M6KA 1OMEA 3HLCA 3PBTA 3ZG9B 3MKFA 5FQMA 3HREA 2Y2HA 2HDQA 2WUQA 3NDEA 1GA9A 4JKTA 2QPNA 3RJUA 4GNUA 1PZOA 3NI9A 3ZG5A 5FQIA 2EXBA 3BFGA 2J7VA 5CGWA 5L2FA 2Y59A 4Y0OA 1S0WA 2DCFA 3IF6C 4R3BA 1S6RA 1YLWA 1K38A 4DE1A 5FQJA 4OQHA 1PI4A 3IH9A 2X02A 3GTCA 3NBLA 3BFEA 2HDUA 3PAGA 3PBQA 4KQQA 3GMWA 3MFDA 4JPMA 3S4XA 1CEGA 1JWZA 4E3NA 3FYZA 2IWDA 4RVAA 4DRTA 5A92A 1LI0A 4WM9A 4BQMA 4WMCD 2J9OA 3VOYA 3IQAA 1GHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R1G A;  1YLJ A;  4H8R A;  2FFY A;  1FCO A;  4NET A;  4UA6 A;  5U47 A;  4MBF A;  4UA9 A;  2OLV A;  3UPN A;  2V1Z A;  3ZNY A;  1MWT A;  3NY4 A;  4QU3 A;  4K0X A;  5CHM A;  3CJM A;  3C4P A;  1K54 C;  3IHA A;  3Q81 A;  4OH0 A;  2BG1 A;  1IEL A;  2WKE A;  4OPR A;  1I2S A;  5CRF A;  1N9B A;  3WS1 A;  4OQI A;  4EBN A;  2R9X A;  3ZDJ A;  4C3Q A;  4B4X A;  2XDM A;  3OPL A;  5HAQ A;  3RXW A;  2JE5 A;  4QHC A;  4S2K A;  1FR6 A;  4HBU A;  4MBH A;  4X68 A;  1MPL A;  3EQV A;  4N1X A;  2Y2I A;  1L2S A;  4WMC A;  3HLF A;  3MZF A;  3S1Y A;  4WYY A;  4S2N A;  3VMA A;  2J9P A;  1ES5 A;  4PM6 A;  3PBO A;  4GDB A;  5KMW A;  2WZZ A;  2XD1 A;  3G32 A;  5A91 A;  2C6W B;  5M1A A;  5EVI C;  3OPP A;  4X6T A;  4P87 A;  5DF7 A;  1K57 C;  1SKF A;  1XA1 A;  1FSY A;  1IKG A;  1ZG4 A;  2ZC3 B;  2Z2L B;  1NZU A;  1PZP A;  3N8S A;  3MKE A;  4KZB A;  4OPZ A;  4R0Q A;  1JWV A;  4FSF A;  4EQI A;  2EX2 A;  3VOZ A;  4DDS A;  3VSL A;  3IF6 B;  2XD5 A;  3FKW A;  5M18 A;  3Q7V A;  3HLD A;  3A3I A;  3CZD A;  1FQG A;  5EPH A;  3UNW A;  4WEK A;  1PWD A;  3G4P A;  3DW0 A;  3GV9 A;  3N8L A;  4U0X A;  5E2H A;  1CK3 A;  1KE0 A;  3IF5 A;  2ZC4 B;  3M6B A;  4MBK A;  4QY6 A;  1KE4 A;  3HLB A;  1IYS A;  3IXD A;  2G2W A;  3FV7 A;  3OCN A;  3MZD A;  4N1H A;  3EQU A;  4WEJ A;  4GKU A;  2B5R A;  3LY3 A;  4KZ3 A;  3NDG A;  2OSU A;  3IWQ A;  3UDF A;  1PWC A;  2XFT A;  2ZQC A;  3UE1 A;  1ERO A;  4KQO A;  5AQA A;  2EXA A;  2Y2O A;  1K4E A;  1J9M A;  4OKP A;  1YLP A;  3M2K A;  3E2K A;  3VP1 A;  3PBR A;  1SCW A;  3DWZ A;  3OPH A;  2JCH A;  1Q2Q A;  5GLC A;  2Y2K A;  3HLG A;  1LLB A;  3ITA A;  1O7E A;  4OQ0 A;  3ZG8 B;  5F82 A;  3SH7 A;  1FSW A;  4JF6 A;  3N4I A;  5F1F A;  4OLG A;  3BLM A;  3AGF A;  3BYD A;  4JLF A;  4R3J A;  1NYM A;  3CMZ A;  4BL2 A;  5FI6 A;  4HBT A;  1G68 A;  4CPK A;  1BUE A;  3UPO A;  4UHU A;  1PI5 A;  4B4Z A;  3GRJ A;  1YLY A;  5A90 A;  1GCE A;  1K55 A;  4U0T A;  5GLA A;  4BL3 A;  4E6W A;  5CHU A;  2EX6 A;  3D4F A;  5EVI B;  4S2P A;  4WZ5 C;  1EI5 A;  4X55 A;  1PIO A;  3PTE A;  1HVB A;  5HFO A;  1YMS A;  4XXR A;  4JXS A;  3TSG A;  1WYC A;  3OC2 A;  2FFF B;  2PU4 A;  4OVD A;  5JYP A;  4S2O A;  2Y2J A;  2Y2N A;  2Y4A A;  4JXW A;  1BLC A;  5DTK A;  5EVL A;  1ZG6 A;  1H8Z A;  2VGK A;  2C5W B;  3VSK A;  1U60 A;  2HP6 A;  2P9V B;  2ZC7 A;  4ZJ2 A;  4N9L A;  3WS4 A;  1GHI A;  2ZLY A;  4RX2 A;  1FOF A;  2ZQD A;  4OPY A;  2ZJ9 A;  1ERM A;  4ZAM A;  4C75 A;  4GB7 A;  4RA7 A;  5FQK A;  5DF9 A;  1FCN A;  1LI9 A;  1NY0 A;  3QNB A;  5HAP A;  3BLS A;  1K56 A;  3BFF A;  5CEC A;  1LL5 A;  4Z9Q A;  1ES2 A;  3LO7 A;  5GL9 A;  2IWB A;  3WWX A;  1L0E A;  3HLW A;  4PM7 A;  5M19 A;  3N6I A;  5CGS A;  1MKI A;  1ES4 A;  3UO9 A;  3E2L A;  3DWK A;  1SHV A;  2HPB A;  5KSH A;  3UDI A;  4QJG A;  1L0D A;  5E2G A;  3V5M A;  2ZM0 A;  1XKZ A;  1YLT A;  1PWG A;  3CG5 A;  1W8Q A;  1QMF A;  3G31 A;  3IF6 A;  5GLD A;  3P09 A;  2EX9 A;  3IHB A;  1H5X A;  1PW1 A;  3M6H A;  4HES A;  1ALQ A;  4JXV A;  5DTS A;  3GR2 A;  3SS5 A;  3MBZ A;  4KZ8 A;  4KZ9 A;  5AQ7 A;  5E2E A;  2Y2Q A;  4OP5 A;  4P0M A;  5EUA A;  1NJ4 A;  1JTD A;  3W8K A;  5GHY A;  1K4F A;  4Y0T A;  5HW3 A;  2RCX A;  1FCM A;  1NRF A;  1W8Y A;  2WAE A;  5EOO A;  3UDX A;  1K6S A;  4OOY A;  1H8Y A;  1TDL A;  2P74 A;  2PU2 A;  3ZNT A;  3A3J A;  5FDH A;  5FAS A;  3NCK A;  1KDW A;  1M40 A;  3BM6 A;  5HAR A;  2H0Y A;  3OPR A;  2EX8 A;  2WGV A;  4X53 A;  4LV3 A;  4O7D A;  3HUO A;  1BTL A;  3FZC A;  5F83 A;  5JYO A;  3IH8 A;  1XGJ A;  2H10 A;  3HL9 A;  3TG9 A;  5IHV A;  1K54 A;  1HZO A;  4LV1 A;  3VP4 A;  3ZGA B;  3IXB A;  1K25 A;  2ZQ8 A;  4YIN A;  2XEP A;  1JWP A;  2WAF A;  1VM1 A;  1MBL A;  1PYY A;  4LEN A;  3G30 A;  2E8I A;  4R23 A;  2UWX A;  4QD4 A;  3ZCZ A;  1N4O A;  2A49 A;  2IWC A;  5CHJ A;  3UN7 A;  3VP2 A;  5CEB A;  4OP8 A;  1GHM A;  1YM1 A;  3IT9 A;  4FH4 A;  4IED A;  2HP9 A;  1ES3 A;  5HAI A;  3VFF A;  2Q9N A;  1YT4 A;  4N9K A;  4EBL A;  3OZH A;  2CC1 A;  3BFC A;  4KZA A;  1W79 A;  1GA0 A;  1E4D A;  4GOG A;  1IYQ A;  2Z2M B;  3V3R A;  4QY5 A;  4E6X A;  2R9W A;  2ZQ7 A;  1I5Q A;  4R4R A;  3G35 A;  4D2O A;  3MXS A;  2PBY A;  1ESU A;  4EWF A;  3BFD A;  2WAD A;  3P98 A;  1DJC A;  4E3K A;  5EVI A;  4S2L A;  2GDN A;  4KG5 A;  1WE4 A;  2OV5 A;  4DXC A;  4ZJ1 A;  1QME A;  4IVK A;  3QHY A;  3ZFZ A;  5KZH A;  2WKI A;  4N92 A;  4YFM A;  1TEM A;  2X01 A;  4PM8 A;  1TVF A;  3PBS A;  2H5S A;  2XGN A;  2P9V A;  1W7F A;  3B3X A;  3VP3 A;  4CJN A;  4KEN B;  4E3I A;  4GD8 A;  5FQ9 A;  3C5A A;  2ZM8 A;  1Y54 A;  1ONG A;  2XQZ A;  3M2J A;  4OON A;  3C7V A;  3GVB A;  4UAA A;  3A3D A;  4ID4 A;  4ZTK A;  2ZC5 B;  1NXY A;  1DJB A;  4EV4 A;  1XA7 A;  5I94 A;  4JBF A;  3O88 A;  1O07 A;  3LCE A;  5HX9 A;  4BD0 A;  3N8R A;  4DXB A;  1BUL A;  1K56 D;  4P85 A;  4IBR A;  5E43 A;  2XF3 A;  3HVF A;  3HUN A;  3UY6 A;  3MZE A;  3LY4 A;  4XUX A;  2XLN A;  1SDN A;  4E3M A;  1VQQ A;  4KZ6 A;  3IWI A;  2V2F F;  4R4S A;  1NYY A;  2WZX A;  4DKI A;  3RXX A;  4K91 A;  1RCJ A;  3GQZ A;  1YQS A;  4BLM A;  3N7W A;  3O3V A;  5EEC A;  4Y0U A;  5FA7 A;  1HD8 A;  3I7J A;  1LHY A;  4DDY A;  3W4O A;  4HEF A;  4LV0 A;  1MXO A;  3W4P A;  4GZB A;  4X69 A;  3WRZ A;  2Y2G A;  3G2Z A;  2A3U A;  2ZM2 A;  2HP5 A;  4GN2 A;  5DTT A;  4Q8I A;  4WEL A;  2JBF A;  2ZD8 A;  1G6A A;  1RP5 A;  3BEB A;  4JXG A;  1XXM A;  3FWL A;  1RGZ A;  4GD6 A;  4OOM A;  1ESI A;  3SS3 A;  4KZ4 A;  1CI9 A;  3UPP A;  2WGW B;  4BD1 A;  4M3K A;  3C7U A;  3SH9 A;  3ZVW A;  4A5R A;  1IYO A;  4E3O A;  4JF5 A;  5GHX A;  3Q7Z A;  1EWZ A;  2H0T A;  2G2U A;  3Q82 A;  3MXR A;  2XK1 A;  2V20 A;  2ZMA A;  1PW8 A;  4S2J A;  2ZC6 B;  5CGX A;  5FAQ A;  2WGI A;  4GDN A;  2ZQA A;  5DVA A;  3AGD A;  4WZ5 A;  1KGF A;  2EFX A;  5TGF A;  2Y2M A;  1BT5 A;  3W4Q A;  4S2M A;  2I72 A;  4LV2 A;  4P6B A;  3ZG7 B;  1I2W A;  4PPR A;  4OOL A;  4E3L A;  1KVM A;  3V50 A;  1XGI A;  4OLD A;  2Y2P A;  3O86 A;  1W5D A;  3NC8 A;  5A93 A;  5FAO A;  1WYB A;  1ONH A;  5FAT A;  1ERQ A;  3Q07 A;  4OPQ A;  5CXW A;  5G18 A;  3S22 A;  1LL9 A;  4S2N C;  3FKV A;  2QMI A;  2XR0 A;  3C4O A;  3A3F A;  4JF4 A;  5AQB A;  3V39 A;  5EOE A;  1NZO A;  5AQ9 A;  2JC7 A;  4C6Y A;  4DE3 A;  5F1G A;  1Z6F A;  5D3O A;  3ZVT A;  1KGG A;  4BJP A;  4IBX A;  4L0L A;  3SH8 A;  1BLP A;  1SDE A;  3BRM A;  4WBG A;  4NK3 A;  3AGE A;  4RYE A;  1KVL A;  3NIA A;  2OLU A;  1YLZ A;  1AXB A;  1ZC2 A;  3DTM A;  1IYP A;  5EVI D;  2WYX A;  1KDS A;  1RGY A;  1E25 A;  5FI7 A;  3JYI A;  1E3U D;  1MWS A;  3TOI A;  4QB8 A;  3HBR A;  4FCF A;  3SS4 A;  3V3S A;  4FD8 A;  1K6R A;  4PM5 A;  2HDR A;  2VGJ A;  1HTZ A;  2Y2L A;  5CTM A;  5FSR A;  4PM9 A;  4KQR A;  4U3T A;  4KG2 A;  5FQQ A;  3BEC A;  1TDG A;  1KGE A;  2Y91 A;  1XP4 A;  5FAP A;  2ZQ9 A;  3ITB A;  3ZHH A;  5FI2 A;  3QNC A;  4KG6 A;  3WS0 A;  5BOH A;  5EE8 A;  4K0W A;  4RX3 A;  1BLS A;  4X56 A;  4LCM A;  1BZA A;  3G34 A;  3WS5 A;  5KSC A;  4ZJ3 A;  3IXH A;  4ZDX A;  3LEZ A;  1XX2 A;  5J8X A;  4UA7 A;  4Y7P A;  5GLB A;  4EBP A;  4IVI A;  2WK0 A;  3VP0 A;  1K57 A;  1BSG A;  1E3U A;  2X71 A;  1MWU A;  1YMX A;  4LCL A;  2Q9M A;  5CER A;  2J8Y A;  3HUM A;  4EUZ A;  2DRW A;  2Y55 A;  3O87 A;  1XPB A;  1L0G A;  1JTG A;  3GSG A;  4DE2 A;  3WRT A;  4MEZ A;  3SOI A;  4FH2 A;  1Q2P A;  4B88 A;  2WGW A;  1KE3 A;  4XUZ A;  2BLS A;  1BLH A;  1ZKJ A;  4E3J A;  1C3B A;  2WKH A;  3PBN A;  1K55 C;  3G2Y A;  5GHZ A;  3Q1F A;  4ZBE A;  2EFU A;  1IKI A;  1IEM A;  4MLL A;  1FR1 A;  2HDS A;  4PMA A;  4DF6 A;  3UE0 A;  3HLE A;  5CTN A;  1MY8 A;  2XH9 A;  1L0F A;  2RL3 A;  3IXG A;  4F94 A;  4OQG A;  2DNS A;  5CED A;  2XFS A;  2QZ6 A;  5TR7 A;  3IWO A;  1CI8 A;  1MWR A;  4WZ4 A;  5DF8 A;  4KZ5 A;  3ISG A;  1DJA A;  3Q7V B;  5TFQ A;  3WS2 A;  3OCL A;  3A3E A;  4DE0 A;  1JVJ A;  4S2I A;  4MNR A;  4BEN A;  3ZG0 A;  3PAE A;  5HL1 A;  1CEF A;  3UE3 A;  5E2F A;  1DY6 A;  4KZ7 A;  3VFH A;  1M6K A;  1OME A;  3HLC A;  3PBT A;  3ZG9 B;  3MKF A;  5FQM A;  3HRE A;  2Y2H A;  2HDQ A;  2WUQ A;  3NDE A;  1GA9 A;  4JKT A;  2QPN A;  3RJU A;  4GNU A;  1PZO A;  3NI9 A;  3ZG5 A;  5FQI A;  2EXB A;  3BFG A;  2J7V A;  5CGW A;  5L2F A;  2Y59 A;  4Y0O A;  1S0W A;  2DCF A;  3IF6 C;  4R3B A;  1S6R A;  1YLW A;  1K38 A;  4DE1 A;  5FQJ A;  4OQH A;  1PI4 A;  3IH9 A;  2X02 A;  3GTC A;  3NBL A;  3BFE A;  2HDU A;  3PAG A;  3PBQ A;  4KQQ A;  3GMW A;  3MFD A;  4JPM A;  3S4X A;  1CEG A;  1JWZ A;  4E3N A;  3FYZ A;  2IWD A;  4RVA A;  4DRT A;  5A92 A;  1LI0 A;  4WM9 A;  4BQM A;  4WMC D;  2J9O A;  3VOY A;  3IQA A;  1GHP A; 
#chains in the Genus database with same CATH topology
 4R1G A;  2QHK A;  4MBF A;  4Y3I A;  4G3V A;  4K0X A;  3IHA A;  3Q81 A;  4GW9 A;  4OQI A;  4EBN A;  2R9X A;  4Y5F A;  4B4X A;  4BWI A;  2XDM A;  4HJ6 A;  2JE5 A;  1FR6 A;  5A8B A;  4BBT A;  3T4S A;  5HD3 A;  1MPL A;  3T4O A;  4N1X A;  3HLF A;  3LIA A;  4WYY A;  1HLU P;  4I3I A;  1ES5 A;  3LUQ A;  4GDB A;  3LR5 A;  5A91 A;  4UQI S;  5M1A A;  4X6T A;  1FSY A;  1IKG A;  1ZG4 A;  2EWV A;  2KDK A;  4R0Q A;  3N8S A;  1JWV A;  4FSF A;  2K7S A;  2ZMF A;  4YWZ A;  5M18 A;  3EGX C;  3HLD A;  3UNW A;  3G4P A;  3GV9 A;  3N8L A;  5F6A A;  3IF5 A;  1YSQ A;  4QY6 A;  4R6L A;  1KE4 A;  4CLC B;  1IYS A;  3EQU A;  3NDG A;  3KYE A;  1PWC A;  4GS9 A;  4ZRR A;  2B02 A;  2EXA A;  1K4E A;  3M2K A;  2K2N A;  2JCH A;  5F5Y A;  4Q0I A;  1O7E A;  3SH7 A;  2LB5 A;  4L9G A;  4UQI M;  4PHT A;  4JGO A;  3BLM A;  3AGF A;  4JLF A;  1G6O A;  3E4P A;  1LSX A;  1G68 A;  1TS7 A;  4XT2 B;  3UPO A;  3LIB A;  1OJG A;  3DTK A;  2W1R A;  2KOI A;  2OWJ A;  5A90 A;  1K55 A;  4U0T A;  4ARZ A;  4BL3 A;  3LIE A;  1EI5 A;  1YMS A;  1WYC A;  3PHY A;  4S2O A;  1ZG6 A;  1U60 A;  4HNB A;  2P9V B;  4N9L A;  1FOF A;  1OT6 A;  4ZAM A;  4DMZ A;  1N9O A;  5FQK A;  1K56 A;  4HY8 A;  5CEC A;  1ES2 A;  2Z6C A;  3LEQ A;  2K31 A;  3HLW A;  5K5B A;  3UME A;  3E2L A;  3C8C A;  1SHV A;  2PDR A;  5E2G A;  3CPT A;  3MSH A;  1P9R A;  4ME4 A;  3IHB A;  3M6H A;  2L0W A;  5EM0 A;  1S4S A;  5E2E A;  4P0M A;  4ETZ A;  1NJ4 A;  1JTD A;  1K4F A;  2W3H A;  4IJG A;  1NRF A;  2WAE A;  1K6S A;  1UWN X;  4Y17 A;  4CQH A;  4OOY A;  1H8Y A;  5FDH A;  3NCK A;  1GSX A;  4II7 A;  3S7P A;  2HJ9 C;  5L09 A;  1BTL A;  3FZC A;  3TG9 A;  4HHD A;  3IXB A;  1K25 A;  2ZQ8 A;  2XEP A;  5HDD A;  2L1M A;  2WAF A;  3OBF A;  4LEN A;  3G30 A;  1N4O A;  2IWC A;  3OZH A;  2CC1 A;  4KZA A;  2Z2M B;  3C2W A;  5HL6 A;  2J3T C;  4D2O A;  4R4R A;  2PBY A;  3P98 A;  2WAD A;  1DJC A;  5EVI A;  2XRO A;  2GDN A;  4ZJ1 A;  5G4Z A;  2WKI A;  1ZTU A;  4Y15 A;  5HSQ A;  4PM8 A;  2XGN A;  3DBA A;  3B3X A;  2JKF A;  3BW6 A;  4E3I A;  1PFL A;  5FQ9 A;  3PYP A;  3GVB A;  4UAA A;  3A3D A;  4ID4 A;  2D02 A;  1T1B A;  2ZC5 B;  4EV4 A;  3QP4 A;  3O88 A;  1O07 A;  5HX9 A;  4BD0 A;  3LI8 A;  4P85 A;  4XUX A;  1SDN A;  2V2F F;  2WZX A;  3IX3 A;  3LR0 A;  4DKI A;  3RXX A;  1RCJ A;  4BLM A;  3F1P B;  3N7W A;  3O3V A;  3W4O A;  4LV0 A;  1MXO A;  3T1S A;  4X69 A;  3WRZ A;  2ZM2 A;  1VEU B;  2JBF A;  3BEB A;  4GD6 A;  4OOM A;  4G3W A;  2BTF P;  4CLC D;  5TBM A;  1F5M A;  4M3K A;  2PYP A;  3ZVW A;  4EU0 A;  1K0K A;  3HJI A;  4WF0 A;  3Q7Z A;  2H0T A;  4BBV A;  4YOF A;  2OWH A;  2GJ3 A;  5FAQ A;  2WGI A;  1DP9 A;  4LRZ E;  4WZ5 A;  1BT5 A;  3W4Q A;  2W3G A;  4S2M A;  3ZG7 B;  4LV2 A;  3TJZ C;  3LGO A;  3NC8 A;  5FAO A;  4ESP A;  5FAT A;  1ERQ A;  2XA7 S;  2QMI A;  3L7H A;  4LGW A;  2B95 A;  1Z6F A;  1KGG A;  2ZOI A;  3BRM A;  4NK3 A;  3NIA A;  2OLU A;  1YLZ A;  1AXB A;  3JVV A;  3DTM A;  1IYP A;  4K08 A;  2EA9 A;  3QP5 A;  4GHI A;  3S7O A;  1HTZ A;  2VGJ A;  5MC7 A;  4U3T A;  4CLC E;  3BEC A;  1TDG A;  2ZQ9 A;  2I9V A;  4KG6 A;  3WS0 A;  4RX3 A;  4MCW A;  1TS6 A;  4Y7P A;  1K57 A;  3KSI A;  4QWO A;  2X71 A;  1MWU A;  1YMX A;  1GSV A;  5J4E A;  4EUZ A;  3A0V A;  3WRT A;  4MEZ A;  3DTE A;  4I3J A;  3H9W A;  5GHZ A;  3O5Y A;  2HDS A;  3LI9 A;  4Z1W A;  2VV6 A;  4HJ3 A;  1CI8 A;  3T4T A;  1MWR A;  1DJA A;  3WS2 A;  5TFQ A;  5KIZ A;  3A3E A;  2JKR I;  3H7W A;  4BEN A;  3VFH A;  2PR6 A;  1OME A;  3HRE A;  2HDQ A;  2PRF A;  1VHM A;  4GS9 B;  2JN7 A;  4GNU A;  3UB6 A;  2GNX A;  3IX4 A;  3C38 A;  2M1C A;  1DP6 A;  4I3A A;  2LB9 A;  3CI6 A;  2OAQ 1;  3QP8 A;  3GTC A;  3BFE A;  3PAG A;  4CLC C;  3PBQ A;  4I5S A;  3ULF A;  4E04 A;  2PT7 A;  3S4X A;  1JWZ A;  1UGU A;  3FYZ A;  4WN5 A;  2IWD A;  5HPF A;  1LI0 A;  3NOP C;  2O99 A;  1XFQ A;  5HWV A;  2FFY A;  1FCO A;  4ARZ B;  2OLV A;  3QP6 A;  4GLQ A;  4QU3 A;  1V9Y A;  1K54 C;  4OH0 A;  2BG1 A;  1IEL A;  5CRF A;  1N9B A;  3ZDJ A;  1T19 A;  3S7Q A;  4MBH A;  2Y2I A;  1L2S A;  2DMW A;  5AJG A;  3CLO A;  2WKR A;  3DAV A;  5J7E A;  5KMW A;  2XD1 A;  4L9E A;  2C6W B;  2V0U A;  1K57 C;  1SKF A;  2Z2L B;  1NZU A;  4OPZ A;  3MKE A;  3VOZ A;  3VSL A;  4DJ3 A;  2XD5 A;  3FKW A;  3A3I A;  1PWD A;  1KE0 A;  3A0S A;  1D1J A;  3MFX A;  3IXD A;  3MZD A;  4N1H A;  4GKU A;  4KZ3 A;  2OSU A;  1XFN A;  2ZQC A;  5F68 A;  1Y4O A;  4KQO A;  5AQA A;  2O0Y A;  3BY9 A;  1J9M A;  4OKP A;  3PBR A;  3OPH A;  4NG2 A;  5GLC A;  1LLB A;  3BQA A;  4LRX C;  4OQ0 A;  2VV7 A;  5F1F A;  4OLG A;  3QP2 A;  2VA0 A;  3CMZ A;  4L9F A;  4BL2 A;  4CPK A;  3D9Y A;  4HH2 A;  1BUE A;  1G28 A;  3UMD A;  1PI5 A;  3T50 A;  2VX8 A;  3GRJ A;  4B4Z A;  4ETX A;  5GLA A;  2EX6 A;  5FEG A;  3D4F A;  5EVI B;  5HFO A;  1EW0 A;  3OOV A;  4XXR A;  2FFF B;  2PU4 A;  3UB8 A;  5TR7 A;  2Y2N A;  4JXW A;  1BLC A;  5EVE A;  2ZC7 A;  4BBU A;  3WS4 A;  2ZLY A;  2Q0O A;  4OPY A;  1JNU A;  4C75 A;  4RA7 A;  5DF9 A;  1FCN A;  5HAP A;  3BLS A;  2W1T A;  5GL9 A;  3IS2 A;  1D7E A;  1F98 A;  3DWK A;  2HPB A;  3UDI A;  1L0D A;  4WLA A;  2ZM0 A;  3T4J A;  3IF6 A;  1PW1 A;  1KOU A;  2YKH A;  5EUA A;  4X1L A;  1NRJ A;  4Y0T A;  5HW3 A;  1FCM A;  2RCX A;  1W8Y A;  4HIA A;  3UDX A;  3R4K A;  5TBM B;  5FAS A;  1M40 A;  3OPR A;  2EX8 A;  1XGJ A;  2H10 A;  1VM1 A;  5HWW A;  2E8I A;  4R23 A;  2UWX A;  4QD4 A;  3IT9 A;  1YM1 A;  4R38 A;  5HAI A;  2HP9 A;  1ES3 A;  1YT4 A;  1W79 A;  1GA0 A;  1E4D A;  4GOG A;  4E6X A;  4G3K A;  2ZQ7 A;  3V67 A;  3G35 A;  3BY8 A;  3VE4 A;  4EWF A;  3VE3 A;  3TW8 A;  4S2L A;  2OV5 A;  4DXC A;  1QME A;  5KZH A;  3QHY A;  3L9K A;  1OTA A;  4N92 A;  1TEM A;  1Z09 A;  3PBS A;  4CJN A;  3VP3 A;  2ZM8 A;  3KYQ A;  1ONG A;  3M2J A;  4GHI B;  4OON A;  4B93 A;  2P04 A;  4GJ4 A;  5DFY A;  5I94 A;  3LCE A;  3N8R A;  4P6Z S;  4DXB A;  1K56 D;  5E43 A;  2XF3 A;  3HVF A;  4EUV A;  3LY4 A;  5DKK A;  2XLN A;  4E3M A;  2KX6 A;  1S66 L;  3LFV A;  4X25 A;  1YQS A;  5EEC A;  3MF0 A;  3T12 B;  4Y0U A;  1HD8 A;  3I7J A;  1LHY A;  4JGP A;  2YKF A;  4IUH A;  2O9A A;  2A3U A;  2HP5 A;  5DTT A;  2ZD8 A;  4JXG A;  3SS3 A;  1CI9 A;  4BD1 A;  3C7U A;  1NLZ A;  1EWZ A;  3Q82 A;  5IT5 A;  3MXR A;  2XK1 A;  3EWK A;  4MN6 A;  4S2J A;  2ZQA A;  3KO6 A;  2VKS A;  3AGD A;  1KGF A;  3MS6 A;  2Y2M A;  2EWW A;  3EOI A;  5L10 A;  4PPR A;  1KVM A;  1CJF A;  3V50 A;  4OLD A;  3H7W B;  5A93 A;  1WYB A;  3Q07 A;  5CXW A;  2ACG A;  4LRY C;  1LL9 A;  2V9A A;  3C4O A;  3A3F A;  4JF4 A;  2NUT C;  1NZO A;  1N9L A;  5AQ9 A;  4DE3 A;  4H6J B;  3ZVT A;  5D3O A;  1OTI A;  2HZ5 A;  3SH8 A;  1BLP A;  2O9C A;  4RYE A;  1KVL A;  1ZC2 A;  5EVI D;  5I5L A;  1RGY A;  3K2N A;  1E25 A;  1E3U D;  2W3E A;  5F69 A;  3SS4 A;  3V3S A;  1X0O A;  2HDR A;  4PM9 A;  3BJN A;  4KQR A;  2GX5 A;  2Y91 A;  3ITB A;  3ZHH A;  4EEU A;  3UE6 A;  2E8J A;  5EE8 A;  3H82 A;  4FUW A;  4LCM A;  4X56 A;  3G34 A;  5KSC A;  3K3D A;  4O8G A;  5GLB A;  2WKP A;  1IFQ A;  4EBP A;  3KYZ A;  1E3U A;  1TD5 A;  4JGQ A;  1Q2P A;  3ZYT A;  2WGW A;  4XUZ A;  2A2L A;  1BLH A;  1ZKJ A;  3KSF A;  1C3B A;  3PBN A;  1K55 C;  2EFU A;  1IKI A;  1IEM A;  4PMA A;  1FR1 A;  3HLE A;  1MY8 A;  2INW A;  4F94 A;  2RL3 A;  4OQG A;  4NEE D;  5CED A;  2XFS A;  4WZ4 A;  4KZ5 A;  3E4O A;  4MNR A;  3NHQ A;  1CEF A;  4LFU A;  2KLI A;  4KZ7 A;  3HLC A;  4KQD A;  2JKT I;  2WUQ A;  3NDE A;  3RJU A;  5CGW A;  2HGV A;  2Y59 A;  1S1Y A;  1S6R A;  4PKY G;  2ZOH A;  5FEF A;  4KQQ A;  1CEG A;  4RVA A;  4DRT A;  4BQM A;  2J9O A;  1GHP A;  3S7N A;  3LR4 A;  5U47 A;  3T1Q B;  3ZNY A;  4PAU A;  3NY4 A;  3CJM A;  1I2S A;  3UB5 P;  3WS1 A;  3B33 A;  4C3Q A;  3OPL A;  5HAQ A;  3BQ8 A;  1XJ2 A;  1NLY A;  2W27 A;  3RXW A;  4HBU A;  1T18 A;  4X68 A;  3EQV A;  3VMA A;  4S2N A;  1OTE A;  2W1T B;  2J9P A;  4B9O A;  3T4L A;  4PM6 A;  3IS2 B;  3PBO A;  2WZZ A;  3G32 A;  4KUO A;  5EVI C;  4P87 A;  5DF7 A;  1XA1 A;  4IUK A;  2ZC3 B;  1S4R A;  4EQI A;  4KZB A;  3IF6 B;  4R3A A;  5C5K A;  2XA7 M;  1FQG A;  5EPH A;  4WEK A;  3U4L P;  3VOL A;  3DW0 A;  5E2H A;  1CK3 A;  5L07 A;  4HOI A;  2ZC4 B;  3M6B A;  3ZQ5 A;  3HLB A;  2G2W A;  3OCN A;  4WEJ A;  2HV1 A;  5EM1 A;  2B5R A;  3IWQ A;  1TS8 A;  2V0W A;  1ERO A;  3NUL A;  4IHQ A;  2Y2O A;  1YLP A;  4BMW A;  1AWI A;  2Y2K A;  3HLG A;  3ITA A;  5EV0 A;  4FTX A;  2Y8H A;  3N4I A;  2QYB A;  3BYD A;  4DN0 A;  3F1O B;  4HBT A;  4Q0H A;  4Y13 A;  5EFW A;  4UHU A;  3MQQ A;  1YLY A;  1GCE A;  3UB9 A;  4H6J A;  5CHU A;  4S2P A;  4WZ5 C;  1J3W A;  3HCY A;  1PIO A;  3PTE A;  1HVB A;  4JXS A;  3OC2 A;  5JYP A;  1CQA A;  2Y2J A;  2Y4A A;  1H8Z A;  2C5W B;  2HP6 A;  4ZJ2 A;  1GHI A;  4RX2 A;  2O9B A;  1ACF A;  1LT0 A;  2ZJ9 A;  1ERM A;  4GB7 A;  1LI9 A;  2ZMV A;  3QNB A;  4UEY A;  3CWF A;  1LL5 A;  3WWX A;  3IBJ A;  2Y79 A;  1XJ4 A;  4PM7 A;  4MN5 A;  1NWZ A;  1MKI A;  3UO9 A;  1SZV A;  2HF6 A;  2UV0 E;  4QJG A;  3T4K A;  3V5M A;  3KSG A;  1PWG A;  3CG5 A;  1QMF A;  3G31 A;  3P09 A;  2EX9 A;  5DTS A;  3GR2 A;  3MBZ A;  2V8C A;  4KZ8 A;  5AQ7 A;  2M7V A;  4OP5 A;  1H0M A;  5GHY A;  5EOO A;  2PBD P;  1TDL A;  2P74 A;  2PU2 A;  5AVF A;  3A3J A;  3ZNT A;  4EER A;  2FZ0 A;  1W63 M;  4LV3 A;  1TF1 A;  3HUO A;  5F83 A;  5JYO A;  3HL9 A;  4MN7 A;  4LV1 A;  3VP4 A;  3ZGA B;  2QKP A;  5DJT A;  3EGD C;  3ZCZ A;  4EEP A;  5CHJ A;  1W63 Q;  1OJ5 A;  5CEB A;  4NXG A;  4OP8 A;  3VFF A;  3C30 A;  2Q9N A;  2W3F A;  1S1Z A;  4EET B;  1LL8 A;  3LIC A;  3BFC A;  1IYQ A;  2R9W A;  1ESU A;  4E3K A;  3OLO A;  1WE4 A;  4IVK A;  3ZFZ A;  2NUP C;  2X01 A;  2PYR A;  2V8F A;  2H5S A;  1W7F A;  5HZH A;  4KEN B;  4GD8 A;  2XQZ A;  4WL9 A;  2PD8 A;  3C7V A;  4AFI A;  1SKO A;  1P0Z A;  2ZBB A;  1XA7 A;  4EXO A;  1BUL A;  4IBR A;  2ZL1 A;  1F9I A;  3P7N A;  3IWI A;  3H82 B;  3NOT C;  4R4S A;  1NYY A;  1T1A A;  4K91 A;  5FA7 A;  4GCZ A;  4DDY A;  5DFX A;  3G2Z A;  4GN2 A;  2Z6D A;  4WEL A;  2M7U A;  1RP5 A;  1XXM A;  3FWL A;  3CUE A;  1ESI A;  4KZ4 A;  3GEC A;  3UPP A;  2WGW B;  3T1X A;  2G2U A;  1MKM A;  5AVE A;  2V1B A;  2V20 A;  1PW8 A;  4F3L A;  1I2W A;  1FIL A;  5HDS A;  4HP9 A;  3LYX A;  2Y2P A;  5G18 A;  3S22 A;  3FKV A;  2XR0 A;  3V39 A;  5AQB A;  1PRQ A;  3FPV A;  2JC7 A;  5F1G A;  4IBX A;  2VJW A;  1SDE A;  4WBG A;  2WYX A;  3F1N A;  3RH8 B;  5FI7 A;  3JYI A;  3TOI A;  1S67 L;  2AVX A;  3HBR A;  4FCF A;  2J3W A;  4FD8 A;  3IX8 A;  4PM5 A;  2Y2L A;  5FSR A;  4KG2 A;  3F1O A;  5FQQ A;  2FH5 A;  5FAP A;  3QNC A;  2J3T D;  5BOH A;  4K0W A;  1XJ3 A;  4EW7 A;  5DKL A;  3B42 A;  2H28 A;  3WS5 A;  4ZJ3 A;  4ZDX A;  3LIF A;  1P97 A;  4IVI A;  2WK0 A;  3VP0 A;  4LCL A;  2PAV P;  2Q9M A;  3MJQ A;  2G7U A;  4R70 A;  3O87 A;  1XPB A;  1DRM A;  3IBR A;  1L0G A;  5HDC A;  3SOI A;  4FH2 A;  4JGR A;  3U2A A;  4B88 A;  3FG8 A;  4E3J A;  4EQ1 A;  4MLL A;  4YNR A;  4DF6 A;  3UE0 A;  2XH9 A;  1STZ A;  2DNS A;  2JKG A;  2QZ6 A;  3R7W B;  5DF8 A;  3ICY A;  2CMN A;  3ISG A;  3MMH A;  1PNE A;  1JVJ A;  5CX7 A;  3ZG0 A;  3CUE C;  3EEA A;  3UE3 A;  5E2F A;  1OT9 A;  1DY6 A;  2WKQ A;  3PBT A;  2Y2H A;  5LBR A;  1GA9 A;  2QPN A;  1PZO A;  1VB6 A;  3NI9 A;  2VK3 A;  5FQI A;  3ZG5 A;  3W2Z A;  1S0W A;  3IF6 C;  4Q0J A;  1YLW A;  1K38 A;  3IH9 A;  1VET A;  3NBL A;  2IA2 A;  4P6Z M;  4E3N A;  3LR3 A;  4WMC D;  4EES A;  3VOY A;  2OAP 1;  3IQA A;  1YLJ A;  3QP1 A;  4H8R A;  4NET A;  3K3C A;  4UA6 A;  2P08 A;  4UA9 A;  3UPN A;  2V1Z A;  1MWT A;  5CHM A;  3MXQ A;  3C4P A;  3HJK A;  5HPI A;  2WKE A;  4OPR A;  3PR6 A;  2PR5 A;  4RQ9 A;  4QHC A;  4S2K A;  1N9N A;  2A24 A;  4WMC A;  3MZF A;  3S1Y A;  3KX0 X;  5HD5 A;  3NEC A;  3OPP A;  2QWS A;  2V1A A;  4LLO B;  2QJ7 A;  1PZP A;  2EX2 A;  4DDS A;  4NXB A;  3Q7V A;  3CZD A;  4QPR A;  3PXP A;  4U0X A;  1YPR A;  3CIT A;  4MBK A;  5IS1 A;  3FV7 A;  3P01 A;  2VLG A;  1H3Q A;  3LY3 A;  3UDF A;  2PHY A;  2XFT A;  2XSS A;  3RFB A;  2JKT M;  1YAX A;  3UE1 A;  1MC0 A;  3MQO A;  3E2K A;  3VP1 A;  1SCW A;  3DWZ A;  1ODV A;  1Q2Q A;  2R78 A;  2P7J A;  4I39 A;  4WUJ A;  3ZG8 B;  5F82 A;  3CHW P;  3E4Q A;  1YSP A;  1YKD A;  1FSW A;  4JF6 A;  3KSH A;  1OPX A;  4R3J A;  2D01 A;  1NYM A;  5FI6 A;  1UWP X;  5DJU A;  5L8M A;  5FL3 A;  4E6W A;  4HJ4 A;  3MR0 A;  4X55 A;  2JHE A;  3TSG A;  4MMN A;  4OVD A;  5DTK A;  5EVL A;  3VSK A;  2VGK A;  4HH3 A;  2ZQD A;  1ZHH B;  1NY0 A;  5IU1 A;  1SKO B;  3BFF A;  4Z9Q A;  3LO7 A;  2IWB A;  1L0E A;  5M19 A;  3N6I A;  5CGS A;  1ES4 A;  2ZL1 B;  5KSH A;  5HWT A;  1XKZ A;  1YLT A;  1W8Q A;  5GLD A;  2PD7 A;  1H5X A;  4HES A;  1ALQ A;  4JXV A;  3SS5 A;  4PKY A;  4KZ9 A;  2Y2Q A;  4CLC A;  1OTB A;  3W8K A;  5TJJ A;  1WA9 A;  1KDW A;  2HJE A;  3BM6 A;  5HAR A;  2VV8 A;  2H0Y A;  4X53 A;  2WGV A;  1GSW A;  4O7D A;  3IH8 A;  3BWL A;  3D3O A;  1K54 A;  1HZO A;  1CF0 A;  5IHV A;  1P9W A;  4YIN A;  1JWP A;  3R7W A;  4F3L B;  1MBL A;  1PYY A;  4NXE A;  2A49 A;  3E98 A;  3UN7 A;  3VP2 A;  3G6O A;  1GHM A;  4IED A;  4FH4 A;  2JKR M;  4N9K A;  4EBL A;  3NJA A;  2B18 A;  4M4X A;  4XT2 A;  3E0Y A;  3V3R A;  4QY5 A;  2VGL S;  1I5Q A;  4FOF A;  3VV4 A;  3MXS A;  3BFD A;  1BYW A;  4KG5 A;  3GDI A;  3SW1 A;  4DJ2 A;  3FPW A;  4YFM A;  3F1N B;  1TVF A;  2P9V A;  3C5A A;  1Y54 A;  5J3W A;  1FIK A;  4O01 A;  4ZTK A;  1NXY A;  1DJB A;  2GZA A;  3FC7 A;  3TRC A;  4JBF A;  2BAS A;  3HUN A;  3UY6 A;  3MZE A;  1V9Z A;  4KUK A;  1VQQ A;  4KZ6 A;  3GQZ A;  3B47 A;  4HQA A;  1MZU A;  4LPZ A;  4HEF A;  3W4P A;  4GZB A;  2VGL M;  2Y2G A;  4O0P A;  2L4R A;  4Q8I A;  3EEH A;  1G6A A;  1RGZ A;  3SH9 A;  4A5R A;  1IYO A;  3NOU C;  4E3O A;  4JF5 A;  5GHX A;  2QJ5 A;  4Y2F A;  3DTI A;  3JVU A;  2ZMA A;  5CGX A;  2ZC6 B;  4GDN A;  3D72 A;  5DVA A;  1L3L A;  2W3D A;  2EFX A;  4X1M A;  5TGF A;  2I72 A;  4P6B A;  4OOL A;  4E3L A;  1XGI A;  3O86 A;  1W5D A;  4HP4 A;  1ONH A;  4OPQ A;  4S2N C;  2J80 A;  3TE8 A;  5EOE A;  2MJ6 A;  4C6Y A;  4BJP A;  3SZT A;  4L0L A;  3T1R A;  3AGE A;  1KDS A;  1MWS A;  4QB8 A;  2VEA A;  1VET B;  1Y28 A;  1G5U A;  2VZW A;  1IOU A;  1K6R A;  5CTM A;  4I38 A;  5G4Y A;  1TS0 A;  1KGE A;  2W0N A;  1XP4 A;  5FI2 A;  3T4Q A;  3MQ0 A;  1BLS A;  1BZA A;  3CPT B;  3IXH A;  3F1P A;  3LEZ A;  1XX2 A;  5J8X A;  4UA7 A;  4NKP A;  5FDS A;  1BSG A;  1DP8 A;  5CER A;  2J8Y A;  3CAX A;  3HUM A;  1T1C A;  2DRW A;  1LSW A;  2Y55 A;  1A0K A;  1VEU A;  1JTG A;  3GSG A;  4DE2 A;  1D06 A;  2A24 B;  1KE3 A;  2BLS A;  2WKH A;  2OOL A;  3G2Y A;  3Q1F A;  1XJ6 A;  4ZBE A;  5CTN A;  4D60 A;  3IXG A;  1L0F A;  4MDZ A;  1OTD A;  3IWO A;  3Q7V B;  3JPU A;  3OCL A;  4DE0 A;  4S2I A;  3PAE A;  5HL1 A;  1M6K A;  2XRN A;  3A0R A;  3ZG9 B;  3MKF A;  5FQM A;  3UB7 A;  4JKT A;  1LSV A;  2EXB A;  3BFG A;  2J7V A;  5L2F A;  4Y0O A;  2DCF A;  4R3B A;  4DE1 A;  5FQJ A;  4OQH A;  1PI4 A;  2X02 A;  1F2K A;  3LID A;  2HDU A;  4HI4 A;  3RTY A;  3GMW A;  3MFD A;  4JPM A;  4NXF A;  5A92 A;  4WM9 A;  1H8M A; 
#chains in the Genus database with same CATH homology
 4R1G A;  1YLJ A;  4H8R A;  2FFY A;  1FCO A;  4NET A;  4UA6 A;  5U47 A;  4MBF A;  4UA9 A;  2OLV A;  3UPN A;  2V1Z A;  3ZNY A;  1MWT A;  3NY4 A;  4QU3 A;  4K0X A;  5CHM A;  3CJM A;  3C4P A;  1K54 C;  3IHA A;  3Q81 A;  4OH0 A;  2BG1 A;  1IEL A;  2WKE A;  4OPR A;  1I2S A;  5CRF A;  1N9B A;  3WS1 A;  4OQI A;  4EBN A;  2R9X A;  3ZDJ A;  4C3Q A;  4B4X A;  2XDM A;  3OPL A;  5HAQ A;  3RXW A;  2JE5 A;  4QHC A;  4S2K A;  1FR6 A;  4HBU A;  4MBH A;  4X68 A;  1MPL A;  3EQV A;  4N1X A;  2Y2I A;  1L2S A;  4WMC A;  3HLF A;  3MZF A;  3S1Y A;  4WYY A;  4S2N A;  3VMA A;  2J9P A;  1ES5 A;  4PM6 A;  3PBO A;  4GDB A;  5KMW A;  2WZZ A;  2XD1 A;  3G32 A;  5A91 A;  2C6W B;  5M1A A;  5EVI C;  3OPP A;  4X6T A;  4P87 A;  5DF7 A;  1K57 C;  1SKF A;  1XA1 A;  1FSY A;  1IKG A;  1ZG4 A;  2ZC3 B;  2Z2L B;  1NZU A;  1PZP A;  3N8S A;  3MKE A;  4KZB A;  4OPZ A;  4R0Q A;  1JWV A;  4FSF A;  4EQI A;  2EX2 A;  3VOZ A;  4DDS A;  3VSL A;  3IF6 B;  2XD5 A;  3FKW A;  5M18 A;  3Q7V A;  3HLD A;  3A3I A;  3CZD A;  1FQG A;  5EPH A;  3UNW A;  4WEK A;  1PWD A;  3G4P A;  3DW0 A;  3GV9 A;  3N8L A;  4U0X A;  5E2H A;  1CK3 A;  1KE0 A;  3IF5 A;  2ZC4 B;  3M6B A;  4MBK A;  4QY6 A;  1KE4 A;  3HLB A;  1IYS A;  3IXD A;  2G2W A;  3FV7 A;  3OCN A;  3MZD A;  4N1H A;  3EQU A;  4WEJ A;  4GKU A;  2B5R A;  3LY3 A;  4KZ3 A;  3NDG A;  2OSU A;  3IWQ A;  3UDF A;  1PWC A;  2XFT A;  2ZQC A;  3UE1 A;  1ERO A;  4KQO A;  5AQA A;  2EXA A;  2Y2O A;  1K4E A;  1J9M A;  4OKP A;  1YLP A;  3M2K A;  3E2K A;  3VP1 A;  3PBR A;  1SCW A;  3DWZ A;  3OPH A;  2JCH A;  1Q2Q A;  5GLC A;  2Y2K A;  3HLG A;  1LLB A;  3ITA A;  1O7E A;  4OQ0 A;  3ZG8 B;  5F82 A;  3SH7 A;  1FSW A;  4JF6 A;  3N4I A;  5F1F A;  4OLG A;  3BLM A;  3AGF A;  3BYD A;  4JLF A;  4R3J A;  1NYM A;  3CMZ A;  4BL2 A;  5FI6 A;  4HBT A;  1G68 A;  4CPK A;  1BUE A;  3UPO A;  4UHU A;  1PI5 A;  4B4Z A;  3GRJ A;  1YLY A;  5A90 A;  1GCE A;  1K55 A;  4U0T A;  5GLA A;  4BL3 A;  4E6W A;  5CHU A;  2EX6 A;  3D4F A;  5EVI B;  4S2P A;  4WZ5 C;  1EI5 A;  4X55 A;  1PIO A;  3PTE A;  1HVB A;  5HFO A;  1YMS A;  4XXR A;  4JXS A;  3TSG A;  1WYC A;  3OC2 A;  2FFF B;  2PU4 A;  4OVD A;  5JYP A;  4S2O A;  2Y2J A;  2Y2N A;  2Y4A A;  4JXW A;  1BLC A;  5DTK A;  5EVL A;  1ZG6 A;  1H8Z A;  2VGK A;  2C5W B;  3VSK A;  1U60 A;  2HP6 A;  2P9V B;  2ZC7 A;  4ZJ2 A;  4N9L A;  3WS4 A;  1GHI A;  2ZLY A;  4RX2 A;  1FOF A;  2ZQD A;  4OPY A;  2ZJ9 A;  1ERM A;  4ZAM A;  4C75 A;  4GB7 A;  4RA7 A;  5FQK A;  5DF9 A;  1FCN A;  1LI9 A;  1NY0 A;  3QNB A;  5HAP A;  3BLS A;  1K56 A;  3BFF A;  5CEC A;  1LL5 A;  4Z9Q A;  1ES2 A;  3LO7 A;  5GL9 A;  2IWB A;  3WWX A;  1L0E A;  3HLW A;  4PM7 A;  5M19 A;  3N6I A;  5CGS A;  1MKI A;  1ES4 A;  3UO9 A;  3E2L A;  3DWK A;  1SHV A;  2HPB A;  5KSH A;  3UDI A;  4QJG A;  1L0D A;  5E2G A;  3V5M A;  2ZM0 A;  1XKZ A;  1YLT A;  1PWG A;  3CG5 A;  1W8Q A;  1QMF A;  3G31 A;  3IF6 A;  5GLD A;  3P09 A;  2EX9 A;  3IHB A;  1H5X A;  1PW1 A;  3M6H A;  4HES A;  1ALQ A;  4JXV A;  5DTS A;  3GR2 A;  3SS5 A;  3MBZ A;  4KZ8 A;  4KZ9 A;  5AQ7 A;  5E2E A;  2Y2Q A;  4OP5 A;  4P0M A;  5EUA A;  1NJ4 A;  1JTD A;  3W8K A;  5GHY A;  1K4F A;  4Y0T A;  5HW3 A;  2RCX A;  1FCM A;  1NRF A;  1W8Y A;  2WAE A;  5EOO A;  3UDX A;  1K6S A;  4OOY A;  1H8Y A;  1TDL A;  2P74 A;  2PU2 A;  3ZNT A;  3A3J A;  5FDH A;  5FAS A;  3NCK A;  1KDW A;  1M40 A;  3BM6 A;  5HAR A;  2H0Y A;  3OPR A;  2EX8 A;  2WGV A;  4X53 A;  4LV3 A;  4O7D A;  3HUO A;  1BTL A;  3FZC A;  5F83 A;  5JYO A;  3IH8 A;  1XGJ A;  2H10 A;  3HL9 A;  3TG9 A;  5IHV A;  1K54 A;  1HZO A;  4LV1 A;  3VP4 A;  3ZGA B;  3IXB A;  1K25 A;  2ZQ8 A;  4YIN A;  2XEP A;  1JWP A;  2WAF A;  1VM1 A;  1MBL A;  1PYY A;  4LEN A;  3G30 A;  2E8I A;  4R23 A;  2UWX A;  4QD4 A;  3ZCZ A;  1N4O A;  2A49 A;  2IWC A;  5CHJ A;  3UN7 A;  3VP2 A;  5CEB A;  4OP8 A;  1GHM A;  1YM1 A;  3IT9 A;  4FH4 A;  4IED A;  2HP9 A;  1ES3 A;  5HAI A;  3VFF A;  2Q9N A;  1YT4 A;  4N9K A;  4EBL A;  3OZH A;  2CC1 A;  3BFC A;  4KZA A;  1W79 A;  1GA0 A;  1E4D A;  4GOG A;  1IYQ A;  2Z2M B;  3V3R A;  4QY5 A;  4E6X A;  2R9W A;  2ZQ7 A;  1I5Q A;  4R4R A;  3G35 A;  4D2O A;  3MXS A;  2PBY A;  1ESU A;  4EWF A;  3BFD A;  2WAD A;  3P98 A;  1DJC A;  4E3K A;  5EVI A;  4S2L A;  2GDN A;  4KG5 A;  1WE4 A;  2OV5 A;  4DXC A;  4ZJ1 A;  1QME A;  4IVK A;  3QHY A;  3ZFZ A;  5KZH A;  2WKI A;  4N92 A;  4YFM A;  1TEM A;  2X01 A;  4PM8 A;  1TVF A;  3PBS A;  2H5S A;  2XGN A;  2P9V A;  1W7F A;  3B3X A;  3VP3 A;  4CJN A;  4KEN B;  4E3I A;  4GD8 A;  5FQ9 A;  3C5A A;  2ZM8 A;  1Y54 A;  1ONG A;  2XQZ A;  3M2J A;  4OON A;  3C7V A;  3GVB A;  4UAA A;  3A3D A;  4ID4 A;  4ZTK A;  2ZC5 B;  1NXY A;  1DJB A;  4EV4 A;  1XA7 A;  5I94 A;  4JBF A;  3O88 A;  1O07 A;  3LCE A;  5HX9 A;  4BD0 A;  3N8R A;  4DXB A;  1BUL A;  1K56 D;  4P85 A;  4IBR A;  5E43 A;  2XF3 A;  3HVF A;  3HUN A;  3UY6 A;  3MZE A;  3LY4 A;  4XUX A;  2XLN A;  1SDN A;  4E3M A;  1VQQ A;  4KZ6 A;  3IWI A;  2V2F F;  4R4S A;  1NYY A;  2WZX A;  4DKI A;  3RXX A;  4K91 A;  1RCJ A;  3GQZ A;  1YQS A;  4BLM A;  3N7W A;  3O3V A;  5EEC A;  4Y0U A;  5FA7 A;  1HD8 A;  3I7J A;  1LHY A;  4DDY A;  3W4O A;  4HEF A;  4LV0 A;  1MXO A;  3W4P A;  4GZB A;  4X69 A;  3WRZ A;  2Y2G A;  3G2Z A;  2A3U A;  2ZM2 A;  2HP5 A;  4GN2 A;  5DTT A;  4Q8I A;  4WEL A;  2JBF A;  2ZD8 A;  1G6A A;  1RP5 A;  3BEB A;  4JXG A;  1XXM A;  3FWL A;  1RGZ A;  4GD6 A;  4OOM A;  1ESI A;  3SS3 A;  4KZ4 A;  1CI9 A;  3UPP A;  2WGW B;  4BD1 A;  4M3K A;  3C7U A;  3SH9 A;  3ZVW A;  4A5R A;  1IYO A;  4E3O A;  4JF5 A;  5GHX A;  3Q7Z A;  1EWZ A;  2H0T A;  2G2U A;  3Q82 A;  3MXR A;  2XK1 A;  2V20 A;  2ZMA A;  1PW8 A;  4S2J A;  2ZC6 B;  5CGX A;  5FAQ A;  2WGI A;  4GDN A;  2ZQA A;  5DVA A;  3AGD A;  4WZ5 A;  1KGF A;  2EFX A;  5TGF A;  2Y2M A;  1BT5 A;  3W4Q A;  4S2M A;  2I72 A;  4LV2 A;  4P6B A;  3ZG7 B;  1I2W A;  4PPR A;  4OOL A;  4E3L A;  1KVM A;  3V50 A;  1XGI A;  4OLD A;  2Y2P A;  3O86 A;  1W5D A;  3NC8 A;  5A93 A;  5FAO A;  1WYB A;  1ONH A;  5FAT A;  1ERQ A;  3Q07 A;  4OPQ A;  5CXW A;  5G18 A;  3S22 A;  1LL9 A;  4S2N C;  3FKV A;  2QMI A;  2XR0 A;  3C4O A;  3A3F A;  4JF4 A;  5AQB A;  3V39 A;  5EOE A;  1NZO A;  5AQ9 A;  2JC7 A;  4C6Y A;  4DE3 A;  5F1G A;  1Z6F A;  5D3O A;  3ZVT A;  1KGG A;  4BJP A;  4IBX A;  4L0L A;  3SH8 A;  1BLP A;  1SDE A;  3BRM A;  4WBG A;  4NK3 A;  3AGE A;  4RYE A;  1KVL A;  3NIA A;  2OLU A;  1YLZ A;  1AXB A;  1ZC2 A;  3DTM A;  1IYP A;  5EVI D;  2WYX A;  1KDS A;  1RGY A;  1E25 A;  5FI7 A;  3JYI A;  1E3U D;  1MWS A;  3TOI A;  4QB8 A;  3HBR A;  4FCF A;  3SS4 A;  3V3S A;  4FD8 A;  1K6R A;  4PM5 A;  2HDR A;  2VGJ A;  1HTZ A;  2Y2L A;  5CTM A;  5FSR A;  4PM9 A;  4KQR A;  4U3T A;  4KG2 A;  5FQQ A;  3BEC A;  1TDG A;  1KGE A;  2Y91 A;  1XP4 A;  5FAP A;  2ZQ9 A;  3ITB A;  3ZHH A;  5FI2 A;  3QNC A;  4KG6 A;  3WS0 A;  5BOH A;  5EE8 A;  4K0W A;  4RX3 A;  1BLS A;  4X56 A;  4LCM A;  1BZA A;  3G34 A;  3WS5 A;  5KSC A;  4ZJ3 A;  3IXH A;  4ZDX A;  3LEZ A;  1XX2 A;  5J8X A;  4UA7 A;  4Y7P A;  5GLB A;  4EBP A;  4IVI A;  2WK0 A;  3VP0 A;  1K57 A;  1BSG A;  1E3U A;  2X71 A;  1MWU A;  1YMX A;  4LCL A;  2Q9M A;  5CER A;  2J8Y A;  3HUM A;  4EUZ A;  2DRW A;  2Y55 A;  3O87 A;  1XPB A;  1L0G A;  1JTG A;  3GSG A;  4DE2 A;  3WRT A;  4MEZ A;  3SOI A;  4FH2 A;  1Q2P A;  4B88 A;  2WGW A;  1KE3 A;  4XUZ A;  2BLS A;  1BLH A;  1ZKJ A;  4E3J A;  1C3B A;  2WKH A;  3PBN A;  1K55 C;  3G2Y A;  5GHZ A;  3Q1F A;  4ZBE A;  2EFU A;  1IKI A;  1IEM A;  4MLL A;  1FR1 A;  2HDS A;  4PMA A;  4DF6 A;  3UE0 A;  3HLE A;  5CTN A;  1MY8 A;  2XH9 A;  1L0F A;  2RL3 A;  3IXG A;  4F94 A;  4OQG A;  2DNS A;  5CED A;  2XFS A;  2QZ6 A;  5TR7 A;  3IWO A;  1CI8 A;  1MWR A;  4WZ4 A;  5DF8 A;  4KZ5 A;  3ISG A;  1DJA A;  3Q7V B;  5TFQ A;  3WS2 A;  3OCL A;  3A3E A;  4DE0 A;  1JVJ A;  4S2I A;  4MNR A;  4BEN A;  3ZG0 A;  3PAE A;  5HL1 A;  1CEF A;  3UE3 A;  5E2F A;  1DY6 A;  4KZ7 A;  3VFH A;  1M6K A;  1OME A;  3HLC A;  3PBT A;  3ZG9 B;  3MKF A;  5FQM A;  3HRE A;  2Y2H A;  2HDQ A;  2WUQ A;  3NDE A;  1GA9 A;  4JKT A;  2QPN A;  3RJU A;  4GNU A;  1PZO A;  3NI9 A;  3ZG5 A;  5FQI A;  2EXB A;  3BFG A;  2J7V A;  5CGW A;  5L2F A;  2Y59 A;  4Y0O A;  1S0W A;  2DCF A;  3IF6 C;  4R3B A;  1S6R A;  1YLW A;  1K38 A;  4DE1 A;  5FQJ A;  4OQH A;  1PI4 A;  3IH9 A;  2X02 A;  3GTC A;  3NBL A;  3BFE A;  2HDU A;  3PAG A;  3PBQ A;  4KQQ A;  3GMW A;  3MFD A;  4JPM A;  3S4X A;  1CEG A;  1JWZ A;  4E3N A;  3FYZ A;  2IWD A;  4RVA A;  4DRT A;  5A92 A;  1LI0 A;  4WM9 A;  4BQM A;  4WMC D;  2J9O A;  3VOY A;  3IQA A;  1GHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...