3ZDJA

Ancestral (enca) beta-lactamase class a
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
263
Chain Sequence
MHPQTLEQIKESESQLSGRVGMVELDLASGRTLSYRADERFPMMSTFKVLLCGAVLARVDAGLEQLDRRIHYRQQDLVEYSPVTEKHLADGMTVAELCAAAITMSDNTAANLLLATIGGPAGLTAFLRNIGDNVTRLDRWETELNEALPGDERDTTTPAAMAATLRKLLTGEILSAASRQQLITWMVADKVAGPLLRSVLPAGWFIADKTGAGERGSRGIIAVLGPDGKPSRIVVIYLTETQASMDERNQQIAEIGAALIEHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENCA BETA-LACTAMASE
publication title Hyperstability and Substrate Promiscuity in Laboratory Resurrections of Precambrian Beta-Lactamases.
pubmed doi rcsb
source organism Synthetic construct
total genus 91
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3zdjA00
4O7DA 3VFFA 1XP4A 1XA7A 3CG5A 3UPOA 1BT5A 1JWZA 3WS2A 1G68A 3ZHHA 5CTMA 3WS4A 5A92A 1LI0A 1U60A 4B4ZA 3UE3A 3S1YA 3ZCZA 4OQ0A 1E4DA 1PWCA 1S6RA 2WGWB 3P98A 4KQOA 4OKPA 4U3TA 4PM7A 4LV2A 4S2NC 5EVID 2V1ZA 5EOEA 5M18A 4N1HA 4S2LA 5DF7A 3UE1A 1K56A 3BYDA 2ZLYA 4WELA 4JKTA 5FQMA 1Q2PA 1Q2QA 4GN2A 3HLEA 4IEDA 4DDYA 4KZ5A 3QNBA 1N9BA 3MZDA 2Y2MA 3N8RA 3ZFZA 5M1AA 4S2PA 4CJNA 1DY6A 2EXAA 4MBKA 2H5SA 4BL3A 2J9OA 1FCMA 1LHYA 4DKIA 1FCOA 3MZFA 1HZOA 1IYPA 2EX8A 4Q8IA 1BSGA 3IQAA 3BM6A 3PBQA 4IBXA 2ZM0A 4RYEA 2WUQA 4HBUA 4OONA 4P87A 3AGFA 5I94A 3LEZA 1K57C 1EWZA 2DCFA 2ZD8A 5A91A 1BLPA 1K4FA 4PPRA 2WZZA 1LI9A 4LV3A 2HDSA 3Q82A 4GB7A 2I72A 4JXSA 4RX2A 4RX3A 5EPHA 4P0MA 1NYMA 1C3BA 4S2IA 1KVLA 3WWXA 3VSKA 5FQIA 5HL1A 5GL9A 4GD8A 4OQGA 3PTEA 2IWCA 4DF6A 3GQZA 2Q9MA 4UA9A 5E2HA 3EQUA 3ZG7B 2JCHA 4UA7A 1IELA 3LY4A 3SH7A 2XDMA 4MNRA 5HAIA 2WAEA 3AGEA 1IYSA 4IVKA 1SKFA 3ZG5A 5JYPA 4EBNA 1JTDA 2EFUA 4DRTA 1BZAA 3O88A 5EUAA 1YLPA 2HPBA 3C7UA 3GSGA 2HP6A 4KZ9A 2WKHA 3A3IA 1K6RA 4R3BA 4DE3A 4DXCA 3UDFA 4KQQA 2HDRA 4PM6A 1I5QA 2Y2HA 1GHIA 1NZUA 4LV0A 3BECA 1RGZA 4N9LA 4KZ7A 1J9MA 3M6HA 4YFMA 3ZNYA 2OLUA 3PBRA 1OMEA 5M19A 3BFFA 4KZ8A 3Q7VB 5DTKA 3C4OA 5KZHA 3NBLA 4JF4A 4Z9QA 3W8KA 4PM8A 3RXWA 3VP4A 5F1FA 1K4EA 5CEBA 3BFCA 2QPNA 1MBLA 1L2SA 3UNWA 4U0TA 3CJMA 3UE0A 3WS0A 5F1GA 3ZNTA 4WZ5A 4UAAA 5EVIC 5TR7A 3G30A 5AQAA 1I2SA 3G4PA 1BLHA 1XA1A 4JBFA 4JF5A 5FATA 3G2ZA 2ZC6B 4LV1A 5DVAA 1XPBA 3GMWA 2WGIA 1KDSA 4ID4A 1JVJA 3G31A 2Y2IA 2ZJ9A 3HREA 4HEFA 4WEKA 1XKZA 5CHMA 3NDEA 1W5DA 2DNSA 2FFFB 4KQRA 1K57A 4WM9A 4DE0A 3IT9A 4BD0A 1CEFA 1HVBA 2R9XA 3RXXA 4FCFA 3ZG9B 2ZQ9A 3ZVWA 2WYXA 5A90A 2V20A 1ZG6A 2Y2LA 3Q7VA 1PWDA 5CHUA 3LO7A 4HBTA 5EVLA 4BL2A 1TDGA 1TVFA 5FAPA 4JXGA 4OP8A 5FI6A 1JWVA 4OP5A 4OOMA 4X55A 2P9VA 2WZXA 2H10A 2ZM8A 3PBTA 1VM1A 5EVIB 5GHXA 3QHYA 1RGYA 1IKGA 1CK3A 2ZQCA 3FV7A 5A93A 1DJCA 1MWRA 3WS1A 3W4QA 3HLCA 2UWXA 2ZQAA 2PU4A 3GTCA 1ES5A 3DWZA 1BULA 4PMAA 4S2JA 2HP9A 2Y2JA 2QMIA 1M6KA 3HLBA 3HUNA 3A3EA 4BQMA 2EX9A 5FSRA 1LL5A 1KGGA 2HP5A 1ZC2A 2Y4AA 4DDSA 4EQIA 4WMCD 1BTLA 4KZ4A 2XEPA 2IWBA 4LCMA 4K0WA 2X71A 4IBRA 3MFDA 4R1GA 4NK3A 2RL3A 2VGJA 5U47A 1ES3A 2J8YA 1XX2A 5E2EA 4BD1A 3FKVA 4KZ6A 4NETA 4KZ3A 5FDHA 2XLNA 3RJUA 1BLSA 1NXYA 2ZQ8A 3FKWA 5FA7A 4JLFA 4ZAMA 1PZPA 1GHMA 3MKFA 3BRMA 3D4FA 4OVDA 5CXWA 4E3IA 1YLWA 5EVIA 1IYQA 1YMXA 5GLBA 2GDNA 3IXDA 3SH8A 5HAQA 1EROA 1XXMA 3LY3A 5FQQA 4EUZA 1YLJA 3MKEA 2WAFA 2E8IA 3NI9A 3Q07A 1G6AA 3MBZA 1YLYA 4FSFA 2WGWA 4X6TA 5AQ7A 3B3XA 1K55C 4GNUA 4RA7A 5EOOA 5AQBA 1H8ZA 1PWGA 2OLVA 2RCXA 1L0EA 2XD1A 2Y2OA 2J7VA 4MBFA 3IWOA 1FCNA 5GLDA 1W8YA 1YLTA 3E2LA 3IWIA 3MZEA 4GZBA 5HARA 3UDXA 2XF3A 3OCLA 3G32A 5GLAA 4JF6A 4OQHA 1HD8A 1K54C 2V2FF 5J8XA 3IXGA 4EWFA 1CI9A 5E2GA 3IH8A 3MXRA 4OQIA 4XUXA 2A49A 3ZG8B 1BLCA 4X69A 1ERQA 2H0YA 3HLWA 3PAGA 3ISGA 4WYYA 3ITBA 5CTNA 3GR2A 3UPPA 2WGVA 3OC2A 3IXHA 1W8QA 2IWDA 3SS5A 3QNCA 3VSLA 4OLDA 3C5AA 3HL9A 4N92A 4PM9A 1W7FA 5E2FA 2JBFA 1DJBA 2XGNA 2PBYA 4OPRA 1N4OA 1WE4A 3G2YA 1RCJA 1XGIA 4S2KA 2C5WB 1ERMA 5GHZA 2HDQA 1H8YA 1E3UA 4E3JA 3G35A 2PU2A 2EXBA 4S2NA 3M6BA 5BOHA 2FFYA 3IHAA 3OZHA 1MWUA 3C4PA 1IEMA 4LCLA 4E3KA 5TGFA 4KENB 3UDIA 3V50A 5F82A 4N9KA 5G18A 3NIAA 3TOIA 1YMSA 5GHYA 1Z6FA 3UO9A 3PBSA 1VQQA 3VFHA 4OH0A 1SCWA 3BFGA 4H8RA 4KG5A 4X53A 1MPLA 2JC7A 3VP2A 1L0FA 4E3NA 4M3KA 4DE2A 4EBPA 3A3FA 1K25A 2EX6A 1QMEA 3BLSA 4JPMA 5DTSA 2Y55A 5JYOA 1ES2A 5HW3A 5AQ9A 4GDBA 3IHBA 4N1XA 2Y91A 3NCKA 5GLCA 3HLGA 2ZQDA 3Q81A 1JTGA 5CHJA 4RVAA 3HLDA 3V3SA 4QY6A 1K6SA 5DF9A 3OPHA 2EFXA 4X68A 1K55A 2ZC3B 3Q1FA 4X56A 4R3JA 4U0XA 4OOLA 2B5RA 1S0WA 1PYYA 2Y2GA 4R4RA 1ZKJA 2C6WB 4OPQA 3N6IA 1YT4A 4DE1A 2OSUA 2ZQ7A 3MXSA 5D3OA 5FI2A 4B88A 3SS4A 1GCEA 3BFDA 4ZBEA 2VGKA 1NRFA 3E2KA 3V5MA 1K38A 2XD5A 1WYBA 3EQVA 4Y0OA 1K56D 2Z2LB 3S4XA 4DXBA 3M2JA 1M40A 1FSYA 3IF6C 3IWQA 3PAEA 1NZOA 1ES4A 3VOZA 3I7JA 3ZG0A 2G2WA 1CEGA 4A5RA 4C6YA 4QB8A 1FOFA 1LL9A 1I2WA 2WKIA 4BENA 3IXBA 4GKUA 4QHCA 2HDUA 4UA6A 4QU3A 4Y7PA 4WZ4A 4ZJ1A 1PIOA 4GOGA 4WBGA 5FASA 4HESA 3OCNA 4K0XA 5TFQA 2Y2KA 1FQGA 2P74A 3FWLA 4E3MA 3IF5A 4PM5A 3NC8A 4BLMA 3M2KA 4R23A 4XUZA 3WS5A 2X02A 1KVMA 1ONHA 2X01A 1IYOA 4MEZA 1NYYA 2XH9A 3DW0A 1YQSA 3VOYA 4KZAA 2QZ6A 2Y2QA 4GD6A 1KDWA 3S22A 2CC1A 2XFTA 3IF6B 4P85A 3UN7A 3TSGA 4WMCA 3G34A 4WZ5C 2XFSA 4QJGA 2Y2PA 4OPYA 1W79A 4FH2A 4E6XA 3TG9A 4ZDXA 4WEJA 5FAQA 4R0QA 1KE4A 1KGFA 2G2UA 5HX9A 4E6WA 3CMZA 1TEMA 1ALQA 3C7VA 5CRFA 4ZTKA 1ONGA 2Q9NA 2Y2NA 3A3JA 3OPPA 4KZBA 2WADA 1L0GA 3UY6A 1MWTA 1FR1A 1H5XA 3WRZA 3ZDJA 3V39A 3VMAA 3AGDA 2ZC4B 2OV5A 3W4PA 3ZVTA 2ZM2A 1DJAA 1KE3A 3ITAA 5FQ9A 2Y59A 5IHVA 1GA0A 3GVBA 1ESIA 4MLLA 4OOYA 4K91A 2ZC5B 2WK0A 1PZOA 1E3UD 4KG2A 3N4IA 3ZGAB 4OPZA 3OPRA 4XXRA 1MXOA 1WYCA 3CZDA 2JE5A 3BFEA 4S2MA 5CEDA 2J9PA 4JXVA 5CGWA 3IF6A 3O87A 3NY4A 3LCEA 3IH9A 3DTMA 1TDLA 4D2OA 1MKIA 4GDNA 3W4OA 5DF8A 2A3UA 3VP0A 4E3LA 3BLMA 3SH9A 4EV4A 2R9WA 3P09A 1SHVA 4BJPA 1KGEA 2ZC7A 1SDNA 5CGXA 2XR0A 5DTTA 1NY0A 3PBOA 4F94A 3SOIA 2ZMAA 5F83A 1YLZA 2XQZA 4L0LA 1FR6A 1O07A 1GA9A 1NJ4A 1PI4A 5EECA 3UPNA 2DRWA 1JWPA 1AXBA 1PW8A 2P9VB 3OPLA 3WRTA 5KSCA 1HTZA 2WKEA 4EBLA 3A3DA 3O86A 1PW1A 3HUMA 3HUOA 2Z2MB 1ESUA 3DWKA 3Q7ZA 4Y0UA 3VP3A 3O3VA 4B4XA 3GRJA 3BEBA 3N7WA 1E25A 4JXWA 1SDEA 1O7EA 4IVIA 5KSHA 3HVFA 4QD4A 3N8SA 1Y54A 3SS3A 2BLSA 1ZG4A 3N8LA 4P6BA 4E3OA 1CI8A 1KE0A 1XGJA 4FD8A 4LENA 5L2FA 1MY8A 4KG6A 4OLGA 1EI5A 5FQJA 4CPKA 4ZJ2A 1IKIA 5KMWA 1RP5A 1K54A 4YINA 4Y0TA 4C75A 4QY5A 4R4SA 4C3QA 4FH4A 3JYIA 1FSWA 5CERA 5EE8A 3PBNA 5FAOA 1BUEA 5FQKA 3FZCA 2H0TA 2BG1A 1LLBA 3V3RA 1L0DA 4UHUA 1QMFA 5FI7A 5HAPA 5CGSA 4MBHA 1MWSA 5E43A 5HFOA 3FYZA 3HBRA 5CECA 1YM1A 3HLFA 4S2OA 3GV9A 1GHPA 3NDGA 4ZJ3A 1PI5A 3VP1A 2XK1A 2EX2A
chains in the Genus database with same CATH superfamily
2ZMVA 5CTMA 3WS4A 3CUEA 1LI0A 3S1YA 3ZCZA 3T1SA 1PWCA 4EERA 4LV2A 3MQOA 5EOEA 5M18A 1LSVA 1K56A 4EUVA 1Q2QA 4DDYA 3MQ0A 3QNBA 3B47A 5M1AA 4Z1WA 2EXAA 3KYQA 4BL3A 3ZYTA 3LGOA 2BTFP 1BSGA 3JVUA 3RH8B 3PBQA 4HP4A 4RYEA 2Q0OA 2Z6CA 1YKDA 3T4KA 4GB7A 4RX2A 3MR0A 4S2IA 2JKTI 5GL9A 3IX4A 2Y8HA 3H82A 3ZG7B 5HDCA 3L7HA 1IYSA 1SKFA 2K31A 4LRXC 1JTDA 2QKPA 2EFUA 1DP6A 5J7EA 4HQAA 2J3TD 2GZAA 5DKLA 1YLPA 3BWLA 3GSGA 4KZ9A 3A3IA 4R3BA 4KQQA 4LV0A 4KZ7A 4YFMA 2I9VA 1XFQA 3S7PA 4F3LB 5AJGA 3W8KA 4PM8A 3RXWA 1K4EA 5CEBA 4CLCC 5HPIA 1MBLA 3F1PB 2DMWA 2VX8A 4U0TA 3BJNA 3WS0A 1CJFA 4UAAA 1Y28A 1XA1A 4JBFA 2WGIA 3G31A 4WEKA 5CHMA 2LB9A 3NDEA 1OTBA 2DNSA 2FFFB 5IS1A 2PDRA 2V0UA 4BD0A 1VB6A 1HVBA 3RXXA 4GHIB 1S66L 5A90A 1P97A 3LICA 5TBMB 3Q7VA 4BL2A 3MFXA 4X55A 4B93A 2ZQCA 1MWRA 2ZQAA 1F98A 3GTCA 4S2JA 2HP9A 2QMIA 4BQMA 1F9IA 4ARZA 5EV0A 4ZRRA 4LCMA 4K0WA 4IBRA 4R1GA 2W3GA 2RL3A 5TJJA 1ES3A 4KZ6A 4NETA 1NXYA 5FA7A 3QP2A 1GHMA 3SZTA 5HD5A 3T4SA 4EUZA 3MKEA 2WAFA 4FSFA 1YLYA 2PT7A 4GNUA 4RA7A 5AQBA 1PNEA 1XJ2A 4MBFA 4DJ3A 3LI8A 4QWOA 3OCLA 1OPXA 3NOPC 3W2ZA 1HD8A 3LEQA 5EVEA 3IH8A 4XUXA 2A49A 3ZG8B 4X69A 4WYYA 5CTNA 3OC2A 2KLIA 3O5YA 3C5AA 3TE8A 4L9FA 3CWFA 4OPRA 1WE4A 1RCJA 4I3JA 1XGIA 2M7UA 1ERMA 1E3UA 2PU2A 1Z09A 3IHAA 2YKHA 4KENB 3L9KA 4L9GA 3V50A 4O01A 4N9KA 2HZ5A 1UWPX 1SCWA 2JC7A 1L0FA 4LFUA 4EBPA 3DAVA 2IA2A 1OTEA 1YPRA 2GX5A 1K25A 5HW3A 5AQ9A 5F5YA 3IHBA 2Y91A 4Q0HA 3UB5P 3HLGA 3HLDA 3P01A 4F3LA 2ZC3B 3Q1FA 4X56A 1PYYA 4OPQA 3F1PA 1YT4A 4IJGA 3IX3A 2OSUA 1W63M 3BFDA 2V0WA 1XJ6A 2VGKA 1NRFA 1K38A 4Y0OA 3MF0A 1K56D 2Z2LB 3EOIA 3IF6C 3IBRA 1ES4A 2G2WA 4A5RA 1Y4OA 1N9OA 4QB8A 1LL9A 1OT6A 1H0MA 3IXBA 4R38A 4QU3A 4GHIA 5AVFA 4XUZA 4R23A 4XT2A 2X01A 1IYOA 1NYYA 3DW0A 1YSPA 2Y2QA 2P04A 1KDWA 3K3DA 4E6XA 3LI9A 4ZDXA 5FEFA 2INWA 4R0QA 4Y3IA 2G7UA 1SZVA 2O9BA 3OPPA 1OTAA 1L0GA 1TS8A 1MWTA 2O0YA 3WRZA 5LBRA 1KE3A 5IHVA 3GVBA 4MLLA 3N4IA 2PR6A 3BFEA 3IF6A 3NY4A 1GSWA 4D2OA 2HV1A 2A3UA 4E3LA 3BLMA 2R9WA 3BY9A 3P09A 2VV6A 2V1AA 3A0VA 5CGXA 5DTTA 4EEPA 2M7VA 1YLZA 2PD8A 1YSQA 1S1YA 3ZQ5A 4KUKA 3UPNA 2DRWA 1JWPA 1PW8A 5KSCA 1HTZA 2WKEA 1PW1A 1VEUB 2FH5A 3Q7ZA 3VP3A 3BEBA 3CAXA 3N7WA 1E25A 4GS9A 1XJ4A 5KSHA 3HVFA 1F2KA 3N8SA 1OJ5A 3LIFA 1EI5A 5FQJA 1RP5A 4YINA 4C75A 4R4SA 3JYIA 1YAXA 5FAOA 4MBHA 1MWSA 5CECA 3BY8A 1UWNX 4DN0A 3NDGA 1PFLA 1T1BA 3UMEA 3T50A 4KUOA 2XSSA 3CG5A 4CLCD 2NUTC 3UPOA 1BT5A 1G68A 1U60A 5AVEA 4B4ZA 3UE3A 4D60A 2WGWB 1NRJA 4S2NC 3H82B 5G4ZA 4NXFA 4GN2A 3F1OB 4O0PA 4YWZA 1N9BA 3CPTB 4S2PA 1DY6A 4CLCE 2H5SA 4DKIA 1FCOA 1HZOA 1H8MA 3EGDC 3CLOA 5I94A 4HBUA 4OONA 3LEZA 4ETZA 2DCFA 2WZZA 1CQAA 2YKFA 1NYMA 2PBDP 4OQGA 3PTEA 2W1RA 3BQAA 4DF6A 4E04A 2OAP1 5E2HA 4HJ6A 3EQUA 3G6OA 3T4JA 4HIAA 4UA7A 4HJ4A 2CMNA 3SH7A 3LY4A 2XDMA 4IVKA 5JYPA 2L1MA 3LYXA 2WKHA 3RTYA 1K6RA 4AFIA 1I5QA 2Y2HA 3HJIA 4N9LA 4ETXA 1J9MA 2OLUA 1OMEA 4KZ8A 2L4RA 3Q7VB 3C4OA 5KZHA 3NBLA 4JF4A 3VP4A 3PR6A 3CJMA 3OBFA 1LSWA 3ZNTA 3G30A 1I2SA 4BMWA 4Y15A 5FATA 2ZC6B 4RQ9A 3MSHA 4ID4A 3HREA 2ZJ9A 1XKZA 1W5DA 4KQRA 3LR3A 2R9XA 3MS6A 2ZQ9A 5IU1A 4MDZA 4NEED 4CLCB 1TDGA 5FI6A 1JWVA 4OP5A 4H6JA 2ZM8A 5HPFA 3TW8A 1CK3A 1JNUA 1VEUA 1IFQA 5A93A 3WS1A 3W4QA 1ES5A 3DWZA 4PMAA 5L09A 3HUNA 3HLBA 3A3EA 1D06A 3OLOA 1LL5A 1ZC2A 1BTLA 2IWBA 3PXPA 3NOUC 1XX2A 4JGOA 2XLNA 4MCWA 1N9LA 3LUQA 1PZPA 5HWVA 3BRMA 4X1LA 4OVDA 4EETB 5DKKA 1YLWA 1IYQA 2GDNA 2PHYA 1EROA 2QYBA 4X6TA 4HP9A 2WGWA 3T1XA 1FCNA 5HARA 1YLTA 3IWIA 3UDXA 3F1OA 2XF3A 2ACGA 3G32A 4JF6A 3CPTA 1DRMA 1K54C 2V2FF 4YOFA 3KX0X 4OQIA 3V67A 4BBUA 3PAGA 3ISGA 3ITBA 3GR2A 5DJUA 3KYZA 3SS5A 4OLDA 4P6ZM 5E2FA 1DJBA 2XGNA 1N4OA 3EEAA 5HDSA 5BOHA 2V8CA 1S67L 3C4PA 1IEMA 2VZWA 4E3KA 4EESA 1S4SA 2ZMFA 4GLQA 5G18A 1YMSA 1FIKA 1VQQA 3VFHA 4OH0A 1D1JA 4X53A 2PR5A 4K08A 4DE2A 2ZL1B 3T4TA 2EX6A 2Y55A 4N1XA 1ACFA 2EA9A 1K6SA 4GCZA 4QY6A 3OPHA 4I3AA 1DP8A 4OOLA 3LR5A 1S0WA 4XT2B 4R4RA 2W3FA 2Y79A 2C6WB 5FI2A 5HSQA 4ZBEA 3KSHA 2XD5A 3EQVA 4MN7A 5MC7A 4DXBA 1M40A 2E8JA 3PAEA 1NZOA 3I7JA 2NUPC 3E4PA 5L8MA 4Y5FA 3NHQA 1I2WA 2Z6DA 3GDIA 3KSIA 2HDUA 4QHCA 4UA6A 4Y7PA 4MMNA 1PIOA 4WBGA 5TFQA 5G4YA 4R70A 2Y2KA 1FQGA 4CLCA 4IUHA 3C38A 4BLMA 4IUKA 2XH9A 2QZ6A 4GD6A 3S7OA 2ZOHA 3S22A 3IF6B 3UN7A 4WMCA 4WZ5C 2XFSA 4QJGA 2KOIA 3TG9A 3QP6A 4WEJA 4E6WA 3D3OA 3CMZA 4Q0JA 1ONGA 4KZBA 2WADA 3UY6A 1H5XA 3ZDJA 3V39A 3AGDA 2ZC4B 2OV5A 2Y59A 5CX7A 1GA0A 2ZBBA 4K91A 1PZOA 4LLOB 4B9OA 4KG2A 1MXOA 1WYCA 1SKOA 2J9PA 1VHMA 2JKGA 2B02A 5FL3A 5CGWA 4GS9B 2GNXA 3LCEA 5A8BA 1TDLA 2QJ7A 1MKIA 3R7WB 5DF8A 2QJ5A 3PBOA 2ZMAA 4EQ1A 2XQZA 4L0LA 1FR6A 1NJ4A 5EECA 3QP5A 5HD3A 1AXBA 1BYWA 2P9VB 3OPLA 2K7SA 3WRTA 4FUWA 3O86A 3HUOA 3T1QB 2XA7S 3GRJA 4JXWA 4IVIA 1Y54A 2BLSA 1ZG4A 1CI8A 1XGJA 3T4OA 4LENA 4KG6A 4OLGA 1IKIA 5KMWA 5HZHA 1FSWA 1OT9A 2H0TA 1LLBA 1L0DA 4HNBA 5E43A 2ZL1A 2VKSA 4S2OA 3HLFA 4PKYA 4ZJ3A 3VP1A 2EX2A 1XP4A 4WN5A 3UB6A 3WS2A 3ZHHA 4OQ0A 3FPVA 2QWSA 1S6RA 4U3TA 2EWWA 4PM7A 4WF0A 1G28A 4N1HA 4S2LA 3T12B 3BYDA 4IEDA 2OWHA 2J3TC 3MZDA 3N8RA 3ZFZA 3UMDA 1S1ZA 3IX8A 2J9OA 1FCMA 1LHYA 1IYPA 2EX8A 3IQAA 3BM6A 4IBXA 2WUQA 3AGFA 1XJ3A 1EWZA 1BLPA 1K4FA 4PPRA 1LI9A 5IT5A 3CITA 2I72A 4JXSA 5EPHA 3VSKA 5FQIA 5HL1A 1MC0A 4GD8A 1TD5A 2IWCA 3S7NA 2Q9MA 4UA9A 5HL6A 4HJ3A 5F68A 2PAVP 1IELA 4LPZA 4MNRA 2WAEA 3AGEA 3ZG5A 1BZAA 5EUAA 3C7UA 2HP6A 3VE3A 3UDFA 2L0WA 4PM6A 1RGZA 3P7NA 2W0NA 5HWTA 5DTKA 3ICYA 4Z9QA 3C30A 4H6JB 4CQHA 4FTXA 3BFCA 2QPNA 3TRCA 1F5MA 3MMHA 3UNWA 3IBJA 3UE0A 5F1GA 5EVIC 3LIAA 5TR7A 5AQAA 5J3WA 3G2ZA 4LV1A 2FZ0A 2OOLA 3GMWA 1KDSA 1JVJA 2Y2IA 2OAQ1 2V1BA 3R7WA 4WM9A 4DE0A 2VJWA 3IT9A 1CEFA 3ZG9B 2W1TA 4MN5A 3QP4A 2Y2LA 5EVLA 1TVFA 4ME4A 5C5KA 4OP8A 4BBVA 4OOMA 2P9VA 4EU0A 3PBTA 2VEAA 5GHXA 1IKGA 3FV7A 4UQIS 1TS6A 1XFNA 4X1MA 3HLCA 1DP9A 2UWXA 2W27A 1BULA 4Q0IA 2PYRA 3KYEA 2Y2JA 1M6KA 3KSGA 5FSRA 2B95A 2Y4AA 4EQIA 4DDSA 4WMCD 4KZ4A 2X71A 4M4XA 1TS7A 2VGJA 4Y13A 2J8YA 5E2EA 4BD1A 3FKVA 5FDHA 1STZA 3RJUA 4JLFA 4ZAMA 2LB5A 3MKFA 3D4FA 5CXWA 5EVIA 2VV7A 2W3HA 2VGLS 3SH8A 5HAQA 5K5BA 3LY3A 1YLJA 3C2WA 3Q07A 3OOVA 1G6AA 3MBZA 2JKRM 3K3CA 5AQ7A 3B3XA 5EOOA 4Y17A 2OLVA 2V9AA 2RCXA 2HF6A 1G6OA 5GLDA 3E2LA 3HJKA 3EGXC 2KDKA 1P9RA 1ODVA 5J8XA 2H28A 2VK3A 5E2GA 3MXRA 5F6AA 1BLCA 4WL9A 1ERQA 4EWFA 3UPPA 2WGVA 3IS2B 1OJGA 3NECA 4Y2FA 2P7JA 4S2KA 2C5WB 5GHZA 3QP8A 1H8YA 4E3JA 3G35A 4S2NA 5DFXA 3M6BA 3CUEC 4DMZA 1MWUA 1CF0A 4LCLA 3HCYA 3UDIA 3TOIA 4I39A 5GHYA 3UO9A 1GSXA 4UEYA 3BFGA 4KG5A 1MPLA 4M3KA 4GJ4A 5DTSA 4IHQA 1ES2A 2VA0A 3QP1A 4LGWA 5GLCA 2ZQDA 1JTGA 3H9WA 3V3SA 2EFXA 4FOFA 4X68A 4R3JA 4U0XA 2B5RA 1WA9A 2Y2GA 4G3WA 3N6IA 2ZQ7A 5D3OA 1GCEA 3RFBA 1WYBA 1FSYA 3VOZA 4C6YA 2JKFA 1HLUP 1FOFA 4BENA 2A24B 4GKUA 4WZ4A 4BWIA 4HESA 4K0XA 3NJAA 4L9EA 4O8GA 3IF5A 3NC8A 2X02A 1KVMA 3S7QA 4MEZA 1YQSA 3GECA 1SKOB 2JKTM 4R3AA 2CC1A 4P85A 3G34A 1MKMA 1W79A 5FAQA 1KGFA 3C7VA 1ALQA 1X0OA 2XA7M 2A2LA 1VETB 2W3EA 3W4PA 3ZVTA 2ZM2A 1DJAA 3ITAA 1W63Q 4OOYA 2WKPA 4OPZA 2PRFA 3OPRA 4XXRA 2JE5A 4S2MA 3O87A 3T1RA 4GDNA 3W4OA 3VP0A 4EV4A 1KGEA 2ZC7A 4WLAA 1SDNA 5DFYA 2XR0A 4F94A 3SOIA 1LSXA 2JN7A 3SW1A 4G3KA 1O07A 3B33A 3IS2A 3A3DA 4HHDA 3HUMA 2Z2MB 3C8CA 1ESUA 2P08A 2VLGA 4ESPA 3LIDA 1SDEA 3CI6A 3SS3A 4NXGA 3N8LA 4P6BA 4E3OA 1KE0A 4FD8A 5L2FA 1MY8A 3FC7A 4ZJ2A 1K54A 4Y0TA 4C3QA 5EE8A 1BUEA 5FQKA 4UHUA 5FI7A 5CGSA 5HFOA 3B42A 3GV9A 1GHPA 3DTEA 2XROA 1PI5A 4JGQA 5EM1A 4O7DA 3VFFA 1XA7A 2B18A 2WKQA 1JWZA 5A92A 1E4DA 3P98A 2W3DA 5EVID 4KQOA 4OKPA 2V1ZA 3A0SA 5DF7A 2V8FA 2OWJA 3UE1A 1P0ZA 4WELA 2ZLYA 4JKTA 5FQMA 3PYPA 1Q2PA 4PAUA 3HLEA 4KZ5A 4I5SA 1K0KA 3U4LP 2Y2MA 3E0YA 4CJNA 5J4EA 4GW9A 4MBKA 2JHEA 1S4RA 3MZFA 1V9ZA 4Q8IA 1OTIA 1N9NA 2R78A 2ZM0A 4P87A 4DJ2A 1K57C 2ZD8A 5A91A 2A24A 4LV3A 2HDSA 3Q82A 1NLZA 4RX3A 2BASA 4P0MA 4EXOA 1C3BA 1KVLA 3WWXA 2GJ3A 2AVXA 3GQZA 2JCHA 1G5UA 1T18A 3T4QA 5HAIA 4EBNA 4DRTA 4EW7A 3DTKA 3O88A 2HPBA 4DE3A 1J3WA 1T1AA 4DXCA 4UQIM 3UE6A 2HDRA 3VOLA 3LFVA 1GHIA 1NZUA 3BECA 2W1TB 3M6HA 3ZNYA 1VETA 1PRQA 3PBRA 2UV0E 5M19A 3BFFA 1AWIA 1ZHHB 1KOUA 2HGVA 5EFWA 5F1FA 1L2SA 3JPUA 4PHTA 4WZ5A 4NG2A 3G4PA 1BLHA 4JF5A 5DVAA 1XPBA 5L07A 4HEFA 2VGLM 2KX6A 1K57A 4FCFA 1MZUA 3ZVWA 2WYXA 2J80A 2V20A 1ZG6A 1PWDA 5CHUA 3LO7A 4HBTA 5FAPA 4JXGA 3FG8A 2VV8A 3F1NB 2WZXA 2H10A 3H7WB 1VM1A 5EVIB 3QHYA 1RGYA 3MXQA 4HOIA 3VV4A 2O99A 1DJCA 4P6ZS 2PU4A 4I3IA 2EX9A 1P9WA 1KGGA 2HP5A 2XEPA 3ULFA 3LIBA 3MFDA 4NK3A 5U47A 4KZ3A 1V9YA 3NULA 4LRYC 5TBMA 1BLSA 2ZQ8A 3FKWA 3KO6A 1T19A 4E3IA 3A0RA 1YMXA 5GLBA 4HY8A 3IXDA 5EM0A 1OTDA 1XXMA 5FQQA 4NXEA 3NI9A 2E8IA 4HH2A 1K55C 1H8ZA 1PWGA 1L0EA 2MJ6A 2XD1A 2Y2OA 4II7A 2J7VA 3CHWP 3IWOA 1W8YA 4GZBA 3MZEA 3FPWA 2PD7A 5GLAA 4OQHA 4HI4A 3E4QA 5FEGA 3E98A 1H3QA 3IXGA 1CI9A 3DBAA 3HLWA 2H0YA 2XRNA 3D72A 2D01A 3IXHA 1W8QA 2IWDA 3QNCA 3VSLA 3HL9A 4N92A 4PM9A 1T1CA 1W7FA 2JBFA 1FILA 3DTIA 5I5LA 3TJZC 2PBYA 3EEHA 3G2YA 2HDQA 2ZOIA 2K2NA 2WKRA 2EXBA 2M1CA 2FFYA 3OZHA 5TGFA 5F82A 1A0KA 2EWVA 3NIAA 1Z6FA 5KIZA 3PBSA 3UB8A 4H8RA 4E3NA 3VP2A 2D02A 5F69A 4JGRA 4BBTA 3A3FA 3BLSA 1QMEA 4JPMA 1LL8A 5JYOA 4GDBA 4LRZE 3NCKA 4X25A 1NWZA 1L3LA 3Q81A 5CHJA 4RVAA 4NXBA 5FDSA 3LR0A 5DF9A 1K55A 1ZKJA 3U2AA 3MQQA 4DE1A 1ZTUA 3MXSA 4B88A 3SS4A 3E2KA 3V5MA 3S4XA 3M2JA 3IWQA 2HJ9C 3ZG0A 3VE4A 4HH3A 1CEGA 5HWWA 2WKIA 1UGUA 4PKYG 4ZJ1A 4GOGA 5FASA 4MN6A 3OCNA 3UB9A 5HDDA 2QHKA 2P74A 3FWLA 4E3MA 4PM5A 3M2KA 3WS5A 1ONHA 3BQ8A 3F1NA 2O9CA 3R4KA 3H7WA 3VOYA 4KZAA 1LT0A 2XFTA 3TSGA 2Y2PA 3MJQA 4OPYA 4FH2A 1IOUA 4JGPA 1KE4A 2O9AA 2G2UA 3PHYA 5HX9A 1TEMA 5CRFA 4ZTKA 3T4LA 2Q9NA 3UB7A 2Y2NA 3A3JA 3K2NA 1FR1A 3VMAA 1GSVA 1NLYA 2HJEA 5FQ9A 2J3WA 1ESIA 2ZC5B 2WK0A 4I38A 2JKRI 1E3UD 3ZGAB 4YNRA 3CZDA 5L10A 5CEDA 1TS0A 4JXVA 3IH9A 3DTMA 3SH9A 1SHVA 4BJPA 4G3VA 3LIEA 5DJTA 1NY0A 3NOTC 4NKPA 5F83A 3KSFA 3JVVA 4EEUA 1GA9A 1PI4A 3LR4A 1EW0A 4EBLA 1D7EA 1TF1A 3DWKA 4Y0UA 4B4XA 3O3VA 4KQDA 1O7EA 4QD4A 4R6LA 4ARZB 4CPKA 3BW6A 4QY5A 3E4OA 4FH4A 4WUJA 5CERA 3PBNA 3D9YA 3FZCA 3V3RA 2BG1A 5HAPA 1QMFA 3EWKA 4QPRA 3FYZA 3HBRA 1YM1A 2PYPA 2XK1A
chains in the Genus database with same CATH topology
4O7DA 3VFFA 1XP4A 1XA7A 3CG5A 3UPOA 1BT5A 1JWZA 3WS2A 1G68A 3ZHHA 5CTMA 3WS4A 5A92A 1LI0A 1U60A 4B4ZA 3UE3A 3S1YA 3ZCZA 4OQ0A 1E4DA 1PWCA 1S6RA 2WGWB 3P98A 4KQOA 4OKPA 4U3TA 4PM7A 4LV2A 4S2NC 5EVID 2V1ZA 5EOEA 5M18A 4N1HA 4S2LA 5DF7A 3UE1A 1K56A 3BYDA 2ZLYA 4WELA 4JKTA 5FQMA 1Q2PA 1Q2QA 4GN2A 3HLEA 4IEDA 4DDYA 4KZ5A 3QNBA 1N9BA 3MZDA 2Y2MA 3N8RA 3ZFZA 5M1AA 4S2PA 4CJNA 1DY6A 2EXAA 4MBKA 2H5SA 4BL3A 2J9OA 1FCMA 1LHYA 4DKIA 1FCOA 3MZFA 1HZOA 1IYPA 2EX8A 4Q8IA 1BSGA 3IQAA 3BM6A 3PBQA 4IBXA 2ZM0A 4RYEA 2WUQA 4HBUA 4OONA 4P87A 3AGFA 5I94A 3LEZA 1K57C 1EWZA 2DCFA 2ZD8A 5A91A 1BLPA 1K4FA 4PPRA 2WZZA 1LI9A 4LV3A 2HDSA 3Q82A 4GB7A 2I72A 4JXSA 4RX2A 4RX3A 5EPHA 4P0MA 1NYMA 1C3BA 4S2IA 1KVLA 3WWXA 3VSKA 5FQIA 5HL1A 5GL9A 4GD8A 4OQGA 3PTEA 2IWCA 4DF6A 3GQZA 2Q9MA 4UA9A 5E2HA 3EQUA 3ZG7B 2JCHA 4UA7A 1IELA 3LY4A 3SH7A 2XDMA 4MNRA 5HAIA 2WAEA 3AGEA 1IYSA 4IVKA 1SKFA 3ZG5A 5JYPA 4EBNA 1JTDA 2EFUA 4DRTA 1BZAA 3O88A 5EUAA 1YLPA 2HPBA 3C7UA 3GSGA 2HP6A 4KZ9A 2WKHA 3A3IA 1K6RA 4R3BA 4DE3A 4DXCA 3UDFA 4KQQA 2HDRA 4PM6A 1I5QA 2Y2HA 1GHIA 1NZUA 4LV0A 3BECA 1RGZA 4N9LA 4KZ7A 1J9MA 3M6HA 4YFMA 3ZNYA 2OLUA 3PBRA 1OMEA 5M19A 3BFFA 4KZ8A 3Q7VB 5DTKA 3C4OA 5KZHA 3NBLA 4JF4A 4Z9QA 3W8KA 4PM8A 3RXWA 3VP4A 5F1FA 1K4EA 5CEBA 3BFCA 2QPNA 1MBLA 1L2SA 3UNWA 4U0TA 3CJMA 3UE0A 3WS0A 5F1GA 3ZNTA 4WZ5A 4UAAA 5EVIC 5TR7A 3G30A 5AQAA 1I2SA 3G4PA 1BLHA 1XA1A 4JBFA 4JF5A 5FATA 3G2ZA 2ZC6B 4LV1A 5DVAA 1XPBA 3GMWA 2WGIA 1KDSA 4ID4A 1JVJA 3G31A 2Y2IA 2ZJ9A 3HREA 4HEFA 4WEKA 1XKZA 5CHMA 3NDEA 1W5DA 2DNSA 2FFFB 4KQRA 1K57A 4WM9A 4DE0A 3IT9A 4BD0A 1CEFA 1HVBA 2R9XA 3RXXA 4FCFA 3ZG9B 2ZQ9A 3ZVWA 2WYXA 5A90A 2V20A 1ZG6A 2Y2LA 3Q7VA 1PWDA 5CHUA 3LO7A 4HBTA 5EVLA 4BL2A 1TDGA 1TVFA 5FAPA 4JXGA 4OP8A 5FI6A 1JWVA 4OP5A 4OOMA 4X55A 2P9VA 2WZXA 2H10A 2ZM8A 3PBTA 1VM1A 5EVIB 5GHXA 3QHYA 1RGYA 1IKGA 1CK3A 2ZQCA 3FV7A 5A93A 1DJCA 1MWRA 3WS1A 3W4QA 3HLCA 2UWXA 2ZQAA 2PU4A 3GTCA 1ES5A 3DWZA 1BULA 4PMAA 4S2JA 2HP9A 2Y2JA 2QMIA 1M6KA 3HLBA 3HUNA 3A3EA 4BQMA 2EX9A 5FSRA 1LL5A 1KGGA 2HP5A 1ZC2A 2Y4AA 4DDSA 4EQIA 4WMCD 1BTLA 4KZ4A 2XEPA 2IWBA 4LCMA 4K0WA 2X71A 4IBRA 3MFDA 4R1GA 4NK3A 2RL3A 2VGJA 5U47A 1ES3A 2J8YA 1XX2A 5E2EA 4BD1A 3FKVA 4KZ6A 4NETA 4KZ3A 5FDHA 2XLNA 3RJUA 1BLSA 1NXYA 2ZQ8A 3FKWA 5FA7A 4JLFA 4ZAMA 1PZPA 1GHMA 3MKFA 3BRMA 3D4FA 4OVDA 5CXWA 4E3IA 1YLWA 5EVIA 1IYQA 1YMXA 5GLBA 2GDNA 3IXDA 3SH8A 5HAQA 1EROA 1XXMA 3LY3A 5FQQA 4EUZA 1YLJA 3MKEA 2WAFA 2E8IA 3NI9A 3Q07A 1G6AA 3MBZA 1YLYA 4FSFA 2WGWA 4X6TA 5AQ7A 3B3XA 1K55C 4GNUA 4RA7A 5EOOA 5AQBA 1H8ZA 1PWGA 2OLVA 2RCXA 1L0EA 2XD1A 2Y2OA 2J7VA 4MBFA 3IWOA 1FCNA 5GLDA 1W8YA 1YLTA 3E2LA 3IWIA 3MZEA 4GZBA 5HARA 3UDXA 2XF3A 3OCLA 3G32A 5GLAA 4JF6A 4OQHA 1HD8A 1K54C 2V2FF 5J8XA 3IXGA 4EWFA 1CI9A 5E2GA 3IH8A 3MXRA 4OQIA 4XUXA 2A49A 3ZG8B 1BLCA 4X69A 1ERQA 2H0YA 3HLWA 3PAGA 3ISGA 4WYYA 3ITBA 5CTNA 3GR2A 3UPPA 2WGVA 3OC2A 3IXHA 1W8QA 2IWDA 3SS5A 3QNCA 3VSLA 4OLDA 3C5AA 3HL9A 4N92A 4PM9A 1W7FA 5E2FA 2JBFA 1DJBA 2XGNA 2PBYA 4OPRA 1N4OA 1WE4A 3G2YA 1RCJA 1XGIA 4S2KA 2C5WB 1ERMA 5GHZA 2HDQA 1H8YA 1E3UA 4E3JA 3G35A 2PU2A 2EXBA 4S2NA 3M6BA 5BOHA 2FFYA 3IHAA 3OZHA 1MWUA 3C4PA 1IEMA 4LCLA 4E3KA 5TGFA 4KENB 3UDIA 3V50A 5F82A 4N9KA 5G18A 3NIAA 3TOIA 1YMSA 5GHYA 1Z6FA 3UO9A 3PBSA 1VQQA 3VFHA 4OH0A 1SCWA 3BFGA 4H8RA 4KG5A 4X53A 1MPLA 2JC7A 3VP2A 1L0FA 4E3NA 4M3KA 4DE2A 4EBPA 3A3FA 1K25A 2EX6A 1QMEA 3BLSA 4JPMA 5DTSA 2Y55A 5JYOA 1ES2A 5HW3A 5AQ9A 4GDBA 3IHBA 4N1XA 2Y91A 3NCKA 5GLCA 3HLGA 2ZQDA 3Q81A 1JTGA 5CHJA 4RVAA 3HLDA 3V3SA 4QY6A 1K6SA 5DF9A 3OPHA 2EFXA 4X68A 1K55A 2ZC3B 3Q1FA 4X56A 4R3JA 4U0XA 4OOLA 2B5RA 1S0WA 1PYYA 2Y2GA 4R4RA 1ZKJA 2C6WB 4OPQA 3N6IA 1YT4A 4DE1A 2OSUA 2ZQ7A 3MXSA 5D3OA 5FI2A 4B88A 3SS4A 1GCEA 3BFDA 4ZBEA 2VGKA 1NRFA 3E2KA 3V5MA 1K38A 2XD5A 1WYBA 3EQVA 4Y0OA 1K56D 2Z2LB 3S4XA 4DXBA 3M2JA 1M40A 1FSYA 3IF6C 3IWQA 3PAEA 1NZOA 1ES4A 3VOZA 3I7JA 3ZG0A 2G2WA 1CEGA 4A5RA 4C6YA 4QB8A 1FOFA 1LL9A 1I2WA 2WKIA 4BENA 3IXBA 4GKUA 4QHCA 2HDUA 4UA6A 4QU3A 4Y7PA 4WZ4A 4ZJ1A 1PIOA 4GOGA 4WBGA 5FASA 4HESA 3OCNA 4K0XA 5TFQA 2Y2KA 1FQGA 2P74A 3FWLA 4E3MA 3IF5A 4PM5A 3NC8A 4BLMA 3M2KA 4R23A 4XUZA 3WS5A 2X02A 1KVMA 1ONHA 2X01A 1IYOA 4MEZA 1NYYA 2XH9A 3DW0A 1YQSA 3VOYA 4KZAA 2QZ6A 2Y2QA 4GD6A 1KDWA 3S22A 2CC1A 2XFTA 3IF6B 4P85A 3UN7A 3TSGA 4WMCA 3G34A 4WZ5C 2XFSA 4QJGA 2Y2PA 4OPYA 1W79A 4FH2A 4E6XA 3TG9A 4ZDXA 4WEJA 5FAQA 4R0QA 1KE4A 1KGFA 2G2UA 5HX9A 4E6WA 3CMZA 1TEMA 1ALQA 3C7VA 5CRFA 4ZTKA 1ONGA 2Q9NA 2Y2NA 3A3JA 3OPPA 4KZBA 2WADA 1L0GA 3UY6A 1MWTA 1FR1A 1H5XA 3WRZA 3ZDJA 3V39A 3VMAA 3AGDA 2ZC4B 2OV5A 3W4PA 3ZVTA 2ZM2A 1DJAA 1KE3A 3ITAA 5FQ9A 2Y59A 5IHVA 1GA0A 3GVBA 1ESIA 4MLLA 4OOYA 4K91A 2ZC5B 2WK0A 1PZOA 1E3UD 4KG2A 3N4IA 3ZGAB 4OPZA 3OPRA 4XXRA 1MXOA 1WYCA 3CZDA 2JE5A 3BFEA 4S2MA 5CEDA 2J9PA 4JXVA 5CGWA 3IF6A 3O87A 3NY4A 3LCEA 3IH9A 3DTMA 1TDLA 4D2OA 1MKIA 4GDNA 3W4OA 5DF8A 2A3UA 3VP0A 4E3LA 3BLMA 3SH9A 4EV4A 2R9WA 3P09A 1SHVA 4BJPA 1KGEA 2ZC7A 1SDNA 5CGXA 2XR0A 5DTTA 1NY0A 3PBOA 4F94A 3SOIA 2ZMAA 5F83A 1YLZA 2XQZA 4L0LA 1FR6A 1O07A 1GA9A 1NJ4A 1PI4A 5EECA 3UPNA 2DRWA 1JWPA 1AXBA 1PW8A 2P9VB 3OPLA 3WRTA 5KSCA 1HTZA 2WKEA 4EBLA 3A3DA 3O86A 1PW1A 3HUMA 3HUOA 2Z2MB 1ESUA 3DWKA 3Q7ZA 4Y0UA 3VP3A 3O3VA 4B4XA 3GRJA 3BEBA 3N7WA 1E25A 4JXWA 1SDEA 1O7EA 4IVIA 5KSHA 3HVFA 4QD4A 3N8SA 1Y54A 3SS3A 2BLSA 1ZG4A 3N8LA 4P6BA 4E3OA 1CI8A 1KE0A 1XGJA 4FD8A 4LENA 5L2FA 1MY8A 4KG6A 4OLGA 1EI5A 5FQJA 4CPKA 4ZJ2A 1IKIA 5KMWA 1RP5A 1K54A 4YINA 4Y0TA 4C75A 4QY5A 4R4SA 4C3QA 4FH4A 3JYIA 1FSWA 5CERA 5EE8A 3PBNA 5FAOA 1BUEA 5FQKA 3FZCA 2H0TA 2BG1A 1LLBA 3V3RA 1L0DA 4UHUA 1QMFA 5FI7A 5HAPA 5CGSA 4MBHA 1MWSA 5E43A 5HFOA 3FYZA 3HBRA 5CECA 1YM1A 3HLFA 4S2OA 3GV9A 1GHPA 3NDGA 4ZJ3A 1PI5A 3VP1A 2XK1A 2EX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7D A;  3VFF A;  1XP4 A;  1XA7 A;  3CG5 A;  3UPO A;  1BT5 A;  1JWZ A;  3WS2 A;  1G68 A;  3ZHH A;  5CTM A;  3WS4 A;  5A92 A;  1LI0 A;  1U60 A;  4B4Z A;  3UE3 A;  3S1Y A;  3ZCZ A;  4OQ0 A;  1E4D A;  1PWC A;  1S6R A;  2WGW B;  3P98 A;  4KQO A;  4OKP A;  4U3T A;  4PM7 A;  4LV2 A;  4S2N C;  5EVI D;  2V1Z A;  5EOE A;  5M18 A;  4N1H A;  4S2L A;  5DF7 A;  3UE1 A;  1K56 A;  3BYD A;  2ZLY A;  4WEL A;  4JKT A;  5FQM A;  1Q2P A;  1Q2Q A;  4GN2 A;  3HLE A;  4IED A;  4DDY A;  4KZ5 A;  3QNB A;  1N9B A;  3MZD A;  2Y2M A;  3N8R A;  3ZFZ A;  5M1A A;  4S2P A;  4CJN A;  1DY6 A;  2EXA A;  4MBK A;  2H5S A;  4BL3 A;  2J9O A;  1FCM A;  1LHY A;  4DKI A;  1FCO A;  3MZF A;  1HZO A;  1IYP A;  2EX8 A;  4Q8I A;  1BSG A;  3IQA A;  3BM6 A;  3PBQ A;  4IBX A;  2ZM0 A;  4RYE A;  2WUQ A;  4HBU A;  4OON A;  4P87 A;  3AGF A;  5I94 A;  3LEZ A;  1K57 C;  1EWZ A;  2DCF A;  2ZD8 A;  5A91 A;  1BLP A;  1K4F A;  4PPR A;  2WZZ A;  1LI9 A;  4LV3 A;  2HDS A;  3Q82 A;  4GB7 A;  2I72 A;  4JXS A;  4RX2 A;  4RX3 A;  5EPH A;  4P0M A;  1NYM A;  1C3B A;  4S2I A;  1KVL A;  3WWX A;  3VSK A;  5FQI A;  5HL1 A;  5GL9 A;  4GD8 A;  4OQG A;  3PTE A;  2IWC A;  4DF6 A;  3GQZ A;  2Q9M A;  4UA9 A;  5E2H A;  3EQU A;  3ZG7 B;  2JCH A;  4UA7 A;  1IEL A;  3LY4 A;  3SH7 A;  2XDM A;  4MNR A;  5HAI A;  2WAE A;  3AGE A;  1IYS A;  4IVK A;  1SKF A;  3ZG5 A;  5JYP A;  4EBN A;  1JTD A;  2EFU A;  4DRT A;  1BZA A;  3O88 A;  5EUA A;  1YLP A;  2HPB A;  3C7U A;  3GSG A;  2HP6 A;  4KZ9 A;  2WKH A;  3A3I A;  1K6R A;  4R3B A;  4DE3 A;  4DXC A;  3UDF A;  4KQQ A;  2HDR A;  4PM6 A;  1I5Q A;  2Y2H A;  1GHI A;  1NZU A;  4LV0 A;  3BEC A;  1RGZ A;  4N9L A;  4KZ7 A;  1J9M A;  3M6H A;  4YFM A;  3ZNY A;  2OLU A;  3PBR A;  1OME A;  5M19 A;  3BFF A;  4KZ8 A;  3Q7V B;  5DTK A;  3C4O A;  5KZH A;  3NBL A;  4JF4 A;  4Z9Q A;  3W8K A;  4PM8 A;  3RXW A;  3VP4 A;  5F1F A;  1K4E A;  5CEB A;  3BFC A;  2QPN A;  1MBL A;  1L2S A;  3UNW A;  4U0T A;  3CJM A;  3UE0 A;  3WS0 A;  5F1G A;  3ZNT A;  4WZ5 A;  4UAA A;  5EVI C;  5TR7 A;  3G30 A;  5AQA A;  1I2S A;  3G4P A;  1BLH A;  1XA1 A;  4JBF A;  4JF5 A;  5FAT A;  3G2Z A;  2ZC6 B;  4LV1 A;  5DVA A;  1XPB A;  3GMW A;  2WGI A;  1KDS A;  4ID4 A;  1JVJ A;  3G31 A;  2Y2I A;  2ZJ9 A;  3HRE A;  4HEF A;  4WEK A;  1XKZ A;  5CHM A;  3NDE A;  1W5D A;  2DNS A;  2FFF B;  4KQR A;  1K57 A;  4WM9 A;  4DE0 A;  3IT9 A;  4BD0 A;  1CEF A;  1HVB A;  2R9X A;  3RXX A;  4FCF A;  3ZG9 B;  2ZQ9 A;  3ZVW A;  2WYX A;  5A90 A;  2V20 A;  1ZG6 A;  2Y2L A;  3Q7V A;  1PWD A;  5CHU A;  3LO7 A;  4HBT A;  5EVL A;  4BL2 A;  1TDG A;  1TVF A;  5FAP A;  4JXG A;  4OP8 A;  5FI6 A;  1JWV A;  4OP5 A;  4OOM A;  4X55 A;  2P9V A;  2WZX A;  2H10 A;  2ZM8 A;  3PBT A;  1VM1 A;  5EVI B;  5GHX A;  3QHY A;  1RGY A;  1IKG A;  1CK3 A;  2ZQC A;  3FV7 A;  5A93 A;  1DJC A;  1MWR A;  3WS1 A;  3W4Q A;  3HLC A;  2UWX A;  2ZQA A;  2PU4 A;  3GTC A;  1ES5 A;  3DWZ A;  1BUL A;  4PMA A;  4S2J A;  2HP9 A;  2Y2J A;  2QMI A;  1M6K A;  3HLB A;  3HUN A;  3A3E A;  4BQM A;  2EX9 A;  5FSR A;  1LL5 A;  1KGG A;  2HP5 A;  1ZC2 A;  2Y4A A;  4DDS A;  4EQI A;  4WMC D;  1BTL A;  4KZ4 A;  2XEP A;  2IWB A;  4LCM A;  4K0W A;  2X71 A;  4IBR A;  3MFD A;  4R1G A;  4NK3 A;  2RL3 A;  2VGJ A;  5U47 A;  1ES3 A;  2J8Y A;  1XX2 A;  5E2E A;  4BD1 A;  3FKV A;  4KZ6 A;  4NET A;  4KZ3 A;  5FDH A;  2XLN A;  3RJU A;  1BLS A;  1NXY A;  2ZQ8 A;  3FKW A;  5FA7 A;  4JLF A;  4ZAM A;  1PZP A;  1GHM A;  3MKF A;  3BRM A;  3D4F A;  4OVD A;  5CXW A;  4E3I A;  1YLW A;  5EVI A;  1IYQ A;  1YMX A;  5GLB A;  2GDN A;  3IXD A;  3SH8 A;  5HAQ A;  1ERO A;  1XXM A;  3LY3 A;  5FQQ A;  4EUZ A;  1YLJ A;  3MKE A;  2WAF A;  2E8I A;  3NI9 A;  3Q07 A;  1G6A A;  3MBZ A;  1YLY A;  4FSF A;  2WGW A;  4X6T A;  5AQ7 A;  3B3X A;  1K55 C;  4GNU A;  4RA7 A;  5EOO A;  5AQB A;  1H8Z A;  1PWG A;  2OLV A;  2RCX A;  1L0E A;  2XD1 A;  2Y2O A;  2J7V A;  4MBF A;  3IWO A;  1FCN A;  5GLD A;  1W8Y A;  1YLT A;  3E2L A;  3IWI A;  3MZE A;  4GZB A;  5HAR A;  3UDX A;  2XF3 A;  3OCL A;  3G32 A;  5GLA A;  4JF6 A;  4OQH A;  1HD8 A;  1K54 C;  2V2F F;  5J8X A;  3IXG A;  4EWF A;  1CI9 A;  5E2G A;  3IH8 A;  3MXR A;  4OQI A;  4XUX A;  2A49 A;  3ZG8 B;  1BLC A;  4X69 A;  1ERQ A;  2H0Y A;  3HLW A;  3PAG A;  3ISG A;  4WYY A;  3ITB A;  5CTN A;  3GR2 A;  3UPP A;  2WGV A;  3OC2 A;  3IXH A;  1W8Q A;  2IWD A;  3SS5 A;  3QNC A;  3VSL A;  4OLD A;  3C5A A;  3HL9 A;  4N92 A;  4PM9 A;  1W7F A;  5E2F A;  2JBF A;  1DJB A;  2XGN A;  2PBY A;  4OPR A;  1N4O A;  1WE4 A;  3G2Y A;  1RCJ A;  1XGI A;  4S2K A;  2C5W B;  1ERM A;  5GHZ A;  2HDQ A;  1H8Y A;  1E3U A;  4E3J A;  3G35 A;  2PU2 A;  2EXB A;  4S2N A;  3M6B A;  5BOH A;  2FFY A;  3IHA A;  3OZH A;  1MWU A;  3C4P A;  1IEM A;  4LCL A;  4E3K A;  5TGF A;  4KEN B;  3UDI A;  3V50 A;  5F82 A;  4N9K A;  5G18 A;  3NIA A;  3TOI A;  1YMS A;  5GHY A;  1Z6F A;  3UO9 A;  3PBS A;  1VQQ A;  3VFH A;  4OH0 A;  1SCW A;  3BFG A;  4H8R A;  4KG5 A;  4X53 A;  1MPL A;  2JC7 A;  3VP2 A;  1L0F A;  4E3N A;  4M3K A;  4DE2 A;  4EBP A;  3A3F A;  1K25 A;  2EX6 A;  1QME A;  3BLS A;  4JPM A;  5DTS A;  2Y55 A;  5JYO A;  1ES2 A;  5HW3 A;  5AQ9 A;  4GDB A;  3IHB A;  4N1X A;  2Y91 A;  3NCK A;  5GLC A;  3HLG A;  2ZQD A;  3Q81 A;  1JTG A;  5CHJ A;  4RVA A;  3HLD A;  3V3S A;  4QY6 A;  1K6S A;  5DF9 A;  3OPH A;  2EFX A;  4X68 A;  1K55 A;  2ZC3 B;  3Q1F A;  4X56 A;  4R3J A;  4U0X A;  4OOL A;  2B5R A;  1S0W A;  1PYY A;  2Y2G A;  4R4R A;  1ZKJ A;  2C6W B;  4OPQ A;  3N6I A;  1YT4 A;  4DE1 A;  2OSU A;  2ZQ7 A;  3MXS A;  5D3O A;  5FI2 A;  4B88 A;  3SS4 A;  1GCE A;  3BFD A;  4ZBE A;  2VGK A;  1NRF A;  3E2K A;  3V5M A;  1K38 A;  2XD5 A;  1WYB A;  3EQV A;  4Y0O A;  1K56 D;  2Z2L B;  3S4X A;  4DXB A;  3M2J A;  1M40 A;  1FSY A;  3IF6 C;  3IWQ A;  3PAE A;  1NZO A;  1ES4 A;  3VOZ A;  3I7J A;  3ZG0 A;  2G2W A;  1CEG A;  4A5R A;  4C6Y A;  4QB8 A;  1FOF A;  1LL9 A;  1I2W A;  2WKI A;  4BEN A;  3IXB A;  4GKU A;  4QHC A;  2HDU A;  4UA6 A;  4QU3 A;  4Y7P A;  4WZ4 A;  4ZJ1 A;  1PIO A;  4GOG A;  4WBG A;  5FAS A;  4HES A;  3OCN A;  4K0X A;  5TFQ A;  2Y2K A;  1FQG A;  2P74 A;  3FWL A;  4E3M A;  3IF5 A;  4PM5 A;  3NC8 A;  4BLM A;  3M2K A;  4R23 A;  4XUZ A;  3WS5 A;  2X02 A;  1KVM A;  1ONH A;  2X01 A;  1IYO A;  4MEZ A;  1NYY A;  2XH9 A;  3DW0 A;  1YQS A;  3VOY A;  4KZA A;  2QZ6 A;  2Y2Q A;  4GD6 A;  1KDW A;  3S22 A;  2CC1 A;  2XFT A;  3IF6 B;  4P85 A;  3UN7 A;  3TSG A;  4WMC A;  3G34 A;  4WZ5 C;  2XFS A;  4QJG A;  2Y2P A;  4OPY A;  1W79 A;  4FH2 A;  4E6X A;  3TG9 A;  4ZDX A;  4WEJ A;  5FAQ A;  4R0Q A;  1KE4 A;  1KGF A;  2G2U A;  5HX9 A;  4E6W A;  3CMZ A;  1TEM A;  1ALQ A;  3C7V A;  5CRF A;  4ZTK A;  1ONG A;  2Q9N A;  2Y2N A;  3A3J A;  3OPP A;  4KZB A;  2WAD A;  1L0G A;  3UY6 A;  1MWT A;  1FR1 A;  1H5X A;  3WRZ A;  3ZDJ A;  3V39 A;  3VMA A;  3AGD A;  2ZC4 B;  2OV5 A;  3W4P A;  3ZVT A;  2ZM2 A;  1DJA A;  1KE3 A;  3ITA A;  5FQ9 A;  2Y59 A;  5IHV A;  1GA0 A;  3GVB A;  1ESI A;  4MLL A;  4OOY A;  4K91 A;  2ZC5 B;  2WK0 A;  1PZO A;  1E3U D;  4KG2 A;  3N4I A;  3ZGA B;  4OPZ A;  3OPR A;  4XXR A;  1MXO A;  1WYC A;  3CZD A;  2JE5 A;  3BFE A;  4S2M A;  5CED A;  2J9P A;  4JXV A;  5CGW A;  3IF6 A;  3O87 A;  3NY4 A;  3LCE A;  3IH9 A;  3DTM A;  1TDL A;  4D2O A;  1MKI A;  4GDN A;  3W4O A;  5DF8 A;  2A3U A;  3VP0 A;  4E3L A;  3BLM A;  3SH9 A;  4EV4 A;  2R9W A;  3P09 A;  1SHV A;  4BJP A;  1KGE A;  2ZC7 A;  1SDN A;  5CGX A;  2XR0 A;  5DTT A;  1NY0 A;  3PBO A;  4F94 A;  3SOI A;  2ZMA A;  5F83 A;  1YLZ A;  2XQZ A;  4L0L A;  1FR6 A;  1O07 A;  1GA9 A;  1NJ4 A;  1PI4 A;  5EEC A;  3UPN A;  2DRW A;  1JWP A;  1AXB A;  1PW8 A;  2P9V B;  3OPL A;  3WRT A;  5KSC A;  1HTZ A;  2WKE A;  4EBL A;  3A3D A;  3O86 A;  1PW1 A;  3HUM A;  3HUO A;  2Z2M B;  1ESU A;  3DWK A;  3Q7Z A;  4Y0U A;  3VP3 A;  3O3V A;  4B4X A;  3GRJ A;  3BEB A;  3N7W A;  1E25 A;  4JXW A;  1SDE A;  1O7E A;  4IVI A;  5KSH A;  3HVF A;  4QD4 A;  3N8S A;  1Y54 A;  3SS3 A;  2BLS A;  1ZG4 A;  3N8L A;  4P6B A;  4E3O A;  1CI8 A;  1KE0 A;  1XGJ A;  4FD8 A;  4LEN A;  5L2F A;  1MY8 A;  4KG6 A;  4OLG A;  1EI5 A;  5FQJ A;  4CPK A;  4ZJ2 A;  1IKI A;  5KMW A;  1RP5 A;  1K54 A;  4YIN A;  4Y0T A;  4C75 A;  4QY5 A;  4R4S A;  4C3Q A;  4FH4 A;  3JYI A;  1FSW A;  5CER A;  5EE8 A;  3PBN A;  5FAO A;  1BUE A;  5FQK A;  3FZC A;  2H0T A;  2BG1 A;  1LLB A;  3V3R A;  1L0D A;  4UHU A;  1QMF A;  5FI7 A;  5HAP A;  5CGS A;  4MBH A;  1MWS A;  5E43 A;  5HFO A;  3FYZ A;  3HBR A;  5CEC A;  1YM1 A;  3HLF A;  4S2O A;  3GV9 A;  1GHP A;  3NDG A;  4ZJ3 A;  1PI5 A;  3VP1 A;  2XK1 A;  2EX2 A; 
#chains in the Genus database with same CATH topology
 2ZMV A;  5CTM A;  3WS4 A;  3CUE A;  1LI0 A;  3S1Y A;  3ZCZ A;  3T1S A;  1PWC A;  4EER A;  4LV2 A;  3MQO A;  5EOE A;  5M18 A;  1LSV A;  1K56 A;  4EUV A;  1Q2Q A;  4DDY A;  3MQ0 A;  3QNB A;  3B47 A;  5M1A A;  4Z1W A;  2EXA A;  3KYQ A;  4BL3 A;  3ZYT A;  3LGO A;  2BTF P;  1BSG A;  3JVU A;  3RH8 B;  3PBQ A;  4HP4 A;  4RYE A;  2Q0O A;  2Z6C A;  1YKD A;  3T4K A;  4GB7 A;  4RX2 A;  3MR0 A;  4S2I A;  2JKT I;  5GL9 A;  3IX4 A;  2Y8H A;  3H82 A;  3ZG7 B;  5HDC A;  3L7H A;  1IYS A;  1SKF A;  2K31 A;  4LRX C;  1JTD A;  2QKP A;  2EFU A;  1DP6 A;  5J7E A;  4HQA A;  2J3T D;  2GZA A;  5DKL A;  1YLP A;  3BWL A;  3GSG A;  4KZ9 A;  3A3I A;  4R3B A;  4KQQ A;  4LV0 A;  4KZ7 A;  4YFM A;  2I9V A;  1XFQ A;  3S7P A;  4F3L B;  5AJG A;  3W8K A;  4PM8 A;  3RXW A;  1K4E A;  5CEB A;  4CLC C;  5HPI A;  1MBL A;  3F1P B;  2DMW A;  2VX8 A;  4U0T A;  3BJN A;  3WS0 A;  1CJF A;  4UAA A;  1Y28 A;  1XA1 A;  4JBF A;  2WGI A;  3G31 A;  4WEK A;  5CHM A;  2LB9 A;  3NDE A;  1OTB A;  2DNS A;  2FFF B;  5IS1 A;  2PDR A;  2V0U A;  4BD0 A;  1VB6 A;  1HVB A;  3RXX A;  4GHI B;  1S66 L;  5A90 A;  1P97 A;  3LIC A;  5TBM B;  3Q7V A;  4BL2 A;  3MFX A;  4X55 A;  4B93 A;  2ZQC A;  1MWR A;  2ZQA A;  1F98 A;  3GTC A;  4S2J A;  2HP9 A;  2QMI A;  4BQM A;  1F9I A;  4ARZ A;  5EV0 A;  4ZRR A;  4LCM A;  4K0W A;  4IBR A;  4R1G A;  2W3G A;  2RL3 A;  5TJJ A;  1ES3 A;  4KZ6 A;  4NET A;  1NXY A;  5FA7 A;  3QP2 A;  1GHM A;  3SZT A;  5HD5 A;  3T4S A;  4EUZ A;  3MKE A;  2WAF A;  4FSF A;  1YLY A;  2PT7 A;  4GNU A;  4RA7 A;  5AQB A;  1PNE A;  1XJ2 A;  4MBF A;  4DJ3 A;  3LI8 A;  4QWO A;  3OCL A;  1OPX A;  3NOP C;  3W2Z A;  1HD8 A;  3LEQ A;  5EVE A;  3IH8 A;  4XUX A;  2A49 A;  3ZG8 B;  4X69 A;  4WYY A;  5CTN A;  3OC2 A;  2KLI A;  3O5Y A;  3C5A A;  3TE8 A;  4L9F A;  3CWF A;  4OPR A;  1WE4 A;  1RCJ A;  4I3J A;  1XGI A;  2M7U A;  1ERM A;  1E3U A;  2PU2 A;  1Z09 A;  3IHA A;  2YKH A;  4KEN B;  3L9K A;  4L9G A;  3V50 A;  4O01 A;  4N9K A;  2HZ5 A;  1UWP X;  1SCW A;  2JC7 A;  1L0F A;  4LFU A;  4EBP A;  3DAV A;  2IA2 A;  1OTE A;  1YPR A;  2GX5 A;  1K25 A;  5HW3 A;  5AQ9 A;  5F5Y A;  3IHB A;  2Y91 A;  4Q0H A;  3UB5 P;  3HLG A;  3HLD A;  3P01 A;  4F3L A;  2ZC3 B;  3Q1F A;  4X56 A;  1PYY A;  4OPQ A;  3F1P A;  1YT4 A;  4IJG A;  3IX3 A;  2OSU A;  1W63 M;  3BFD A;  2V0W A;  1XJ6 A;  2VGK A;  1NRF A;  1K38 A;  4Y0O A;  3MF0 A;  1K56 D;  2Z2L B;  3EOI A;  3IF6 C;  3IBR A;  1ES4 A;  2G2W A;  4A5R A;  1Y4O A;  1N9O A;  4QB8 A;  1LL9 A;  1OT6 A;  1H0M A;  3IXB A;  4R38 A;  4QU3 A;  4GHI A;  5AVF A;  4XUZ A;  4R23 A;  4XT2 A;  2X01 A;  1IYO A;  1NYY A;  3DW0 A;  1YSP A;  2Y2Q A;  2P04 A;  1KDW A;  3K3D A;  4E6X A;  3LI9 A;  4ZDX A;  5FEF A;  2INW A;  4R0Q A;  4Y3I A;  2G7U A;  1SZV A;  2O9B A;  3OPP A;  1OTA A;  1L0G A;  1TS8 A;  1MWT A;  2O0Y A;  3WRZ A;  5LBR A;  1KE3 A;  5IHV A;  3GVB A;  4MLL A;  3N4I A;  2PR6 A;  3BFE A;  3IF6 A;  3NY4 A;  1GSW A;  4D2O A;  2HV1 A;  2A3U A;  4E3L A;  3BLM A;  2R9W A;  3BY9 A;  3P09 A;  2VV6 A;  2V1A A;  3A0V A;  5CGX A;  5DTT A;  4EEP A;  2M7V A;  1YLZ A;  2PD8 A;  1YSQ A;  1S1Y A;  3ZQ5 A;  4KUK A;  3UPN A;  2DRW A;  1JWP A;  1PW8 A;  5KSC A;  1HTZ A;  2WKE A;  1PW1 A;  1VEU B;  2FH5 A;  3Q7Z A;  3VP3 A;  3BEB A;  3CAX A;  3N7W A;  1E25 A;  4GS9 A;  1XJ4 A;  5KSH A;  3HVF A;  1F2K A;  3N8S A;  1OJ5 A;  3LIF A;  1EI5 A;  5FQJ A;  1RP5 A;  4YIN A;  4C75 A;  4R4S A;  3JYI A;  1YAX A;  5FAO A;  4MBH A;  1MWS A;  5CEC A;  3BY8 A;  1UWN X;  4DN0 A;  3NDG A;  1PFL A;  1T1B A;  3UME A;  3T50 A;  4KUO A;  2XSS A;  3CG5 A;  4CLC D;  2NUT C;  3UPO A;  1BT5 A;  1G68 A;  1U60 A;  5AVE A;  4B4Z A;  3UE3 A;  4D60 A;  2WGW B;  1NRJ A;  4S2N C;  3H82 B;  5G4Z A;  4NXF A;  4GN2 A;  3F1O B;  4O0P A;  4YWZ A;  1N9B A;  3CPT B;  4S2P A;  1DY6 A;  4CLC E;  2H5S A;  4DKI A;  1FCO A;  1HZO A;  1H8M A;  3EGD C;  3CLO A;  5I94 A;  4HBU A;  4OON A;  3LEZ A;  4ETZ A;  2DCF A;  2WZZ A;  1CQA A;  2YKF A;  1NYM A;  2PBD P;  4OQG A;  3PTE A;  2W1R A;  3BQA A;  4DF6 A;  4E04 A;  2OAP 1;  5E2H A;  4HJ6 A;  3EQU A;  3G6O A;  3T4J A;  4HIA A;  4UA7 A;  4HJ4 A;  2CMN A;  3SH7 A;  3LY4 A;  2XDM A;  4IVK A;  5JYP A;  2L1M A;  3LYX A;  2WKH A;  3RTY A;  1K6R A;  4AFI A;  1I5Q A;  2Y2H A;  3HJI A;  4N9L A;  4ETX A;  1J9M A;  2OLU A;  1OME A;  4KZ8 A;  2L4R A;  3Q7V B;  3C4O A;  5KZH A;  3NBL A;  4JF4 A;  3VP4 A;  3PR6 A;  3CJM A;  3OBF A;  1LSW A;  3ZNT A;  3G30 A;  1I2S A;  4BMW A;  4Y15 A;  5FAT A;  2ZC6 B;  4RQ9 A;  3MSH A;  4ID4 A;  3HRE A;  2ZJ9 A;  1XKZ A;  1W5D A;  4KQR A;  3LR3 A;  2R9X A;  3MS6 A;  2ZQ9 A;  5IU1 A;  4MDZ A;  4NEE D;  4CLC B;  1TDG A;  5FI6 A;  1JWV A;  4OP5 A;  4H6J A;  2ZM8 A;  5HPF A;  3TW8 A;  1CK3 A;  1JNU A;  1VEU A;  1IFQ A;  5A93 A;  3WS1 A;  3W4Q A;  1ES5 A;  3DWZ A;  4PMA A;  5L09 A;  3HUN A;  3HLB A;  3A3E A;  1D06 A;  3OLO A;  1LL5 A;  1ZC2 A;  1BTL A;  2IWB A;  3PXP A;  3NOU C;  1XX2 A;  4JGO A;  2XLN A;  4MCW A;  1N9L A;  3LUQ A;  1PZP A;  5HWV A;  3BRM A;  4X1L A;  4OVD A;  4EET B;  5DKK A;  1YLW A;  1IYQ A;  2GDN A;  2PHY A;  1ERO A;  2QYB A;  4X6T A;  4HP9 A;  2WGW A;  3T1X A;  1FCN A;  5HAR A;  1YLT A;  3IWI A;  3UDX A;  3F1O A;  2XF3 A;  2ACG A;  3G32 A;  4JF6 A;  3CPT A;  1DRM A;  1K54 C;  2V2F F;  4YOF A;  3KX0 X;  4OQI A;  3V67 A;  4BBU A;  3PAG A;  3ISG A;  3ITB A;  3GR2 A;  5DJU A;  3KYZ A;  3SS5 A;  4OLD A;  4P6Z M;  5E2F A;  1DJB A;  2XGN A;  1N4O A;  3EEA A;  5HDS A;  5BOH A;  2V8C A;  1S67 L;  3C4P A;  1IEM A;  2VZW A;  4E3K A;  4EES A;  1S4S A;  2ZMF A;  4GLQ A;  5G18 A;  1YMS A;  1FIK A;  1VQQ A;  3VFH A;  4OH0 A;  1D1J A;  4X53 A;  2PR5 A;  4K08 A;  4DE2 A;  2ZL1 B;  3T4T A;  2EX6 A;  2Y55 A;  4N1X A;  1ACF A;  2EA9 A;  1K6S A;  4GCZ A;  4QY6 A;  3OPH A;  4I3A A;  1DP8 A;  4OOL A;  3LR5 A;  1S0W A;  4XT2 B;  4R4R A;  2W3F A;  2Y79 A;  2C6W B;  5FI2 A;  5HSQ A;  4ZBE A;  3KSH A;  2XD5 A;  3EQV A;  4MN7 A;  5MC7 A;  4DXB A;  1M40 A;  2E8J A;  3PAE A;  1NZO A;  3I7J A;  2NUP C;  3E4P A;  5L8M A;  4Y5F A;  3NHQ A;  1I2W A;  2Z6D A;  3GDI A;  3KSI A;  2HDU A;  4QHC A;  4UA6 A;  4Y7P A;  4MMN A;  1PIO A;  4WBG A;  5TFQ A;  5G4Y A;  4R70 A;  2Y2K A;  1FQG A;  4CLC A;  4IUH A;  3C38 A;  4BLM A;  4IUK A;  2XH9 A;  2QZ6 A;  4GD6 A;  3S7O A;  2ZOH A;  3S22 A;  3IF6 B;  3UN7 A;  4WMC A;  4WZ5 C;  2XFS A;  4QJG A;  2KOI A;  3TG9 A;  3QP6 A;  4WEJ A;  4E6W A;  3D3O A;  3CMZ A;  4Q0J A;  1ONG A;  4KZB A;  2WAD A;  3UY6 A;  1H5X A;  3ZDJ A;  3V39 A;  3AGD A;  2ZC4 B;  2OV5 A;  2Y59 A;  5CX7 A;  1GA0 A;  2ZBB A;  4K91 A;  1PZO A;  4LLO B;  4B9O A;  4KG2 A;  1MXO A;  1WYC A;  1SKO A;  2J9P A;  1VHM A;  2JKG A;  2B02 A;  5FL3 A;  5CGW A;  4GS9 B;  2GNX A;  3LCE A;  5A8B A;  1TDL A;  2QJ7 A;  1MKI A;  3R7W B;  5DF8 A;  2QJ5 A;  3PBO A;  2ZMA A;  4EQ1 A;  2XQZ A;  4L0L A;  1FR6 A;  1NJ4 A;  5EEC A;  3QP5 A;  5HD3 A;  1AXB A;  1BYW A;  2P9V B;  3OPL A;  2K7S A;  3WRT A;  4FUW A;  3O86 A;  3HUO A;  3T1Q B;  2XA7 S;  3GRJ A;  4JXW A;  4IVI A;  1Y54 A;  2BLS A;  1ZG4 A;  1CI8 A;  1XGJ A;  3T4O A;  4LEN A;  4KG6 A;  4OLG A;  1IKI A;  5KMW A;  5HZH A;  1FSW A;  1OT9 A;  2H0T A;  1LLB A;  1L0D A;  4HNB A;  5E43 A;  2ZL1 A;  2VKS A;  4S2O A;  3HLF A;  4PKY A;  4ZJ3 A;  3VP1 A;  2EX2 A;  1XP4 A;  4WN5 A;  3UB6 A;  3WS2 A;  3ZHH A;  4OQ0 A;  3FPV A;  2QWS A;  1S6R A;  4U3T A;  2EWW A;  4PM7 A;  4WF0 A;  1G28 A;  4N1H A;  4S2L A;  3T12 B;  3BYD A;  4IED A;  2OWH A;  2J3T C;  3MZD A;  3N8R A;  3ZFZ A;  3UMD A;  1S1Z A;  3IX8 A;  2J9O A;  1FCM A;  1LHY A;  1IYP A;  2EX8 A;  3IQA A;  3BM6 A;  4IBX A;  2WUQ A;  3AGF A;  1XJ3 A;  1EWZ A;  1BLP A;  1K4F A;  4PPR A;  1LI9 A;  5IT5 A;  3CIT A;  2I72 A;  4JXS A;  5EPH A;  3VSK A;  5FQI A;  5HL1 A;  1MC0 A;  4GD8 A;  1TD5 A;  2IWC A;  3S7N A;  2Q9M A;  4UA9 A;  5HL6 A;  4HJ3 A;  5F68 A;  2PAV P;  1IEL A;  4LPZ A;  4MNR A;  2WAE A;  3AGE A;  3ZG5 A;  1BZA A;  5EUA A;  3C7U A;  2HP6 A;  3VE3 A;  3UDF A;  2L0W A;  4PM6 A;  1RGZ A;  3P7N A;  2W0N A;  5HWT A;  5DTK A;  3ICY A;  4Z9Q A;  3C30 A;  4H6J B;  4CQH A;  4FTX A;  3BFC A;  2QPN A;  3TRC A;  1F5M A;  3MMH A;  3UNW A;  3IBJ A;  3UE0 A;  5F1G A;  5EVI C;  3LIA A;  5TR7 A;  5AQA A;  5J3W A;  3G2Z A;  4LV1 A;  2FZ0 A;  2OOL A;  3GMW A;  1KDS A;  1JVJ A;  2Y2I A;  2OAQ 1;  2V1B A;  3R7W A;  4WM9 A;  4DE0 A;  2VJW A;  3IT9 A;  1CEF A;  3ZG9 B;  2W1T A;  4MN5 A;  3QP4 A;  2Y2L A;  5EVL A;  1TVF A;  4ME4 A;  5C5K A;  4OP8 A;  4BBV A;  4OOM A;  2P9V A;  4EU0 A;  3PBT A;  2VEA A;  5GHX A;  1IKG A;  3FV7 A;  4UQI S;  1TS6 A;  1XFN A;  4X1M A;  3HLC A;  1DP9 A;  2UWX A;  2W27 A;  1BUL A;  4Q0I A;  2PYR A;  3KYE A;  2Y2J A;  1M6K A;  3KSG A;  5FSR A;  2B95 A;  2Y4A A;  4EQI A;  4DDS A;  4WMC D;  4KZ4 A;  2X71 A;  4M4X A;  1TS7 A;  2VGJ A;  4Y13 A;  2J8Y A;  5E2E A;  4BD1 A;  3FKV A;  5FDH A;  1STZ A;  3RJU A;  4JLF A;  4ZAM A;  2LB5 A;  3MKF A;  3D4F A;  5CXW A;  5EVI A;  2VV7 A;  2W3H A;  2VGL S;  3SH8 A;  5HAQ A;  5K5B A;  3LY3 A;  1YLJ A;  3C2W A;  3Q07 A;  3OOV A;  1G6A A;  3MBZ A;  2JKR M;  3K3C A;  5AQ7 A;  3B3X A;  5EOO A;  4Y17 A;  2OLV A;  2V9A A;  2RCX A;  2HF6 A;  1G6O A;  5GLD A;  3E2L A;  3HJK A;  3EGX C;  2KDK A;  1P9R A;  1ODV A;  5J8X A;  2H28 A;  2VK3 A;  5E2G A;  3MXR A;  5F6A A;  1BLC A;  4WL9 A;  1ERQ A;  4EWF A;  3UPP A;  2WGV A;  3IS2 B;  1OJG A;  3NEC A;  4Y2F A;  2P7J A;  4S2K A;  2C5W B;  5GHZ A;  3QP8 A;  1H8Y A;  4E3J A;  3G35 A;  4S2N A;  5DFX A;  3M6B A;  3CUE C;  4DMZ A;  1MWU A;  1CF0 A;  4LCL A;  3HCY A;  3UDI A;  3TOI A;  4I39 A;  5GHY A;  3UO9 A;  1GSX A;  4UEY A;  3BFG A;  4KG5 A;  1MPL A;  4M3K A;  4GJ4 A;  5DTS A;  4IHQ A;  1ES2 A;  2VA0 A;  3QP1 A;  4LGW A;  5GLC A;  2ZQD A;  1JTG A;  3H9W A;  3V3S A;  2EFX A;  4FOF A;  4X68 A;  4R3J A;  4U0X A;  2B5R A;  1WA9 A;  2Y2G A;  4G3W A;  3N6I A;  2ZQ7 A;  5D3O A;  1GCE A;  3RFB A;  1WYB A;  1FSY A;  3VOZ A;  4C6Y A;  2JKF A;  1HLU P;  1FOF A;  4BEN A;  2A24 B;  4GKU A;  4WZ4 A;  4BWI A;  4HES A;  4K0X A;  3NJA A;  4L9E A;  4O8G A;  3IF5 A;  3NC8 A;  2X02 A;  1KVM A;  3S7Q A;  4MEZ A;  1YQS A;  3GEC A;  1SKO B;  2JKT M;  4R3A A;  2CC1 A;  4P85 A;  3G34 A;  1MKM A;  1W79 A;  5FAQ A;  1KGF A;  3C7V A;  1ALQ A;  1X0O A;  2XA7 M;  2A2L A;  1VET B;  2W3E A;  3W4P A;  3ZVT A;  2ZM2 A;  1DJA A;  3ITA A;  1W63 Q;  4OOY A;  2WKP A;  4OPZ A;  2PRF A;  3OPR A;  4XXR A;  2JE5 A;  4S2M A;  3O87 A;  3T1R A;  4GDN A;  3W4O A;  3VP0 A;  4EV4 A;  1KGE A;  2ZC7 A;  4WLA A;  1SDN A;  5DFY A;  2XR0 A;  4F94 A;  3SOI A;  1LSX A;  2JN7 A;  3SW1 A;  4G3K A;  1O07 A;  3B33 A;  3IS2 A;  3A3D A;  4HHD A;  3HUM A;  2Z2M B;  3C8C A;  1ESU A;  2P08 A;  2VLG A;  4ESP A;  3LID A;  1SDE A;  3CI6 A;  3SS3 A;  4NXG A;  3N8L A;  4P6B A;  4E3O A;  1KE0 A;  4FD8 A;  5L2F A;  1MY8 A;  3FC7 A;  4ZJ2 A;  1K54 A;  4Y0T A;  4C3Q A;  5EE8 A;  1BUE A;  5FQK A;  4UHU A;  5FI7 A;  5CGS A;  5HFO A;  3B42 A;  3GV9 A;  1GHP A;  3DTE A;  2XRO A;  1PI5 A;  4JGQ A;  5EM1 A;  4O7D A;  3VFF A;  1XA7 A;  2B18 A;  2WKQ A;  1JWZ A;  5A92 A;  1E4D A;  3P98 A;  2W3D A;  5EVI D;  4KQO A;  4OKP A;  2V1Z A;  3A0S A;  5DF7 A;  2V8F A;  2OWJ A;  3UE1 A;  1P0Z A;  4WEL A;  2ZLY A;  4JKT A;  5FQM A;  3PYP A;  1Q2P A;  4PAU A;  3HLE A;  4KZ5 A;  4I5S A;  1K0K A;  3U4L P;  2Y2M A;  3E0Y A;  4CJN A;  5J4E A;  4GW9 A;  4MBK A;  2JHE A;  1S4R A;  3MZF A;  1V9Z A;  4Q8I A;  1OTI A;  1N9N A;  2R78 A;  2ZM0 A;  4P87 A;  4DJ2 A;  1K57 C;  2ZD8 A;  5A91 A;  2A24 A;  4LV3 A;  2HDS A;  3Q82 A;  1NLZ A;  4RX3 A;  2BAS A;  4P0M A;  4EXO A;  1C3B A;  1KVL A;  3WWX A;  2GJ3 A;  2AVX A;  3GQZ A;  2JCH A;  1G5U A;  1T18 A;  3T4Q A;  5HAI A;  4EBN A;  4DRT A;  4EW7 A;  3DTK A;  3O88 A;  2HPB A;  4DE3 A;  1J3W A;  1T1A A;  4DXC A;  4UQI M;  3UE6 A;  2HDR A;  3VOL A;  3LFV A;  1GHI A;  1NZU A;  3BEC A;  2W1T B;  3M6H A;  3ZNY A;  1VET A;  1PRQ A;  3PBR A;  2UV0 E;  5M19 A;  3BFF A;  1AWI A;  1ZHH B;  1KOU A;  2HGV A;  5EFW A;  5F1F A;  1L2S A;  3JPU A;  4PHT A;  4WZ5 A;  4NG2 A;  3G4P A;  1BLH A;  4JF5 A;  5DVA A;  1XPB A;  5L07 A;  4HEF A;  2VGL M;  2KX6 A;  1K57 A;  4FCF A;  1MZU A;  3ZVW A;  2WYX A;  2J80 A;  2V20 A;  1ZG6 A;  1PWD A;  5CHU A;  3LO7 A;  4HBT A;  5FAP A;  4JXG A;  3FG8 A;  2VV8 A;  3F1N B;  2WZX A;  2H10 A;  3H7W B;  1VM1 A;  5EVI B;  3QHY A;  1RGY A;  3MXQ A;  4HOI A;  3VV4 A;  2O99 A;  1DJC A;  4P6Z S;  2PU4 A;  4I3I A;  2EX9 A;  1P9W A;  1KGG A;  2HP5 A;  2XEP A;  3ULF A;  3LIB A;  3MFD A;  4NK3 A;  5U47 A;  4KZ3 A;  1V9Y A;  3NUL A;  4LRY C;  5TBM A;  1BLS A;  2ZQ8 A;  3FKW A;  3KO6 A;  1T19 A;  4E3I A;  3A0R A;  1YMX A;  5GLB A;  4HY8 A;  3IXD A;  5EM0 A;  1OTD A;  1XXM A;  5FQQ A;  4NXE A;  3NI9 A;  2E8I A;  4HH2 A;  1K55 C;  1H8Z A;  1PWG A;  1L0E A;  2MJ6 A;  2XD1 A;  2Y2O A;  4II7 A;  2J7V A;  3CHW P;  3IWO A;  1W8Y A;  4GZB A;  3MZE A;  3FPW A;  2PD7 A;  5GLA A;  4OQH A;  4HI4 A;  3E4Q A;  5FEG A;  3E98 A;  1H3Q A;  3IXG A;  1CI9 A;  3DBA A;  3HLW A;  2H0Y A;  2XRN A;  3D72 A;  2D01 A;  3IXH A;  1W8Q A;  2IWD A;  3QNC A;  3VSL A;  3HL9 A;  4N92 A;  4PM9 A;  1T1C A;  1W7F A;  2JBF A;  1FIL A;  3DTI A;  5I5L A;  3TJZ C;  2PBY A;  3EEH A;  3G2Y A;  2HDQ A;  2ZOI A;  2K2N A;  2WKR A;  2EXB A;  2M1C A;  2FFY A;  3OZH A;  5TGF A;  5F82 A;  1A0K A;  2EWV A;  3NIA A;  1Z6F A;  5KIZ A;  3PBS A;  3UB8 A;  4H8R A;  4E3N A;  3VP2 A;  2D02 A;  5F69 A;  4JGR A;  4BBT A;  3A3F A;  3BLS A;  1QME A;  4JPM A;  1LL8 A;  5JYO A;  4GDB A;  4LRZ E;  3NCK A;  4X25 A;  1NWZ A;  1L3L A;  3Q81 A;  5CHJ A;  4RVA A;  4NXB A;  5FDS A;  3LR0 A;  5DF9 A;  1K55 A;  1ZKJ A;  3U2A A;  3MQQ A;  4DE1 A;  1ZTU A;  3MXS A;  4B88 A;  3SS4 A;  3E2K A;  3V5M A;  3S4X A;  3M2J A;  3IWQ A;  2HJ9 C;  3ZG0 A;  3VE4 A;  4HH3 A;  1CEG A;  5HWW A;  2WKI A;  1UGU A;  4PKY G;  4ZJ1 A;  4GOG A;  5FAS A;  4MN6 A;  3OCN A;  3UB9 A;  5HDD A;  2QHK A;  2P74 A;  3FWL A;  4E3M A;  4PM5 A;  3M2K A;  3WS5 A;  1ONH A;  3BQ8 A;  3F1N A;  2O9C A;  3R4K A;  3H7W A;  3VOY A;  4KZA A;  1LT0 A;  2XFT A;  3TSG A;  2Y2P A;  3MJQ A;  4OPY A;  4FH2 A;  1IOU A;  4JGP A;  1KE4 A;  2O9A A;  2G2U A;  3PHY A;  5HX9 A;  1TEM A;  5CRF A;  4ZTK A;  3T4L A;  2Q9N A;  3UB7 A;  2Y2N A;  3A3J A;  3K2N A;  1FR1 A;  3VMA A;  1GSV A;  1NLY A;  2HJE A;  5FQ9 A;  2J3W A;  1ESI A;  2ZC5 B;  2WK0 A;  4I38 A;  2JKR I;  1E3U D;  3ZGA B;  4YNR A;  3CZD A;  5L10 A;  5CED A;  1TS0 A;  4JXV A;  3IH9 A;  3DTM A;  3SH9 A;  1SHV A;  4BJP A;  4G3V A;  3LIE A;  5DJT A;  1NY0 A;  3NOT C;  4NKP A;  5F83 A;  3KSF A;  3JVV A;  4EEU A;  1GA9 A;  1PI4 A;  3LR4 A;  1EW0 A;  4EBL A;  1D7E A;  1TF1 A;  3DWK A;  4Y0U A;  4B4X A;  3O3V A;  4KQD A;  1O7E A;  4QD4 A;  4R6L A;  4ARZ B;  4CPK A;  3BW6 A;  4QY5 A;  3E4O A;  4FH4 A;  4WUJ A;  5CER A;  3PBN A;  3D9Y A;  3FZC A;  3V3R A;  2BG1 A;  5HAP A;  1QMF A;  3EWK A;  4QPR A;  3FYZ A;  3HBR A;  1YM1 A;  2PYP A;  2XK1 A; 
#chains in the Genus database with same CATH homology
 4O7D A;  3VFF A;  1XP4 A;  1XA7 A;  3CG5 A;  3UPO A;  1BT5 A;  1JWZ A;  3WS2 A;  1G68 A;  3ZHH A;  5CTM A;  3WS4 A;  5A92 A;  1LI0 A;  1U60 A;  4B4Z A;  3UE3 A;  3S1Y A;  3ZCZ A;  4OQ0 A;  1E4D A;  1PWC A;  1S6R A;  2WGW B;  3P98 A;  4KQO A;  4OKP A;  4U3T A;  4PM7 A;  4LV2 A;  4S2N C;  5EVI D;  2V1Z A;  5EOE A;  5M18 A;  4N1H A;  4S2L A;  5DF7 A;  3UE1 A;  1K56 A;  3BYD A;  2ZLY A;  4WEL A;  4JKT A;  5FQM A;  1Q2P A;  1Q2Q A;  4GN2 A;  3HLE A;  4IED A;  4DDY A;  4KZ5 A;  3QNB A;  1N9B A;  3MZD A;  2Y2M A;  3N8R A;  3ZFZ A;  5M1A A;  4S2P A;  4CJN A;  1DY6 A;  2EXA A;  4MBK A;  2H5S A;  4BL3 A;  2J9O A;  1FCM A;  1LHY A;  4DKI A;  1FCO A;  3MZF A;  1HZO A;  1IYP A;  2EX8 A;  4Q8I A;  1BSG A;  3IQA A;  3BM6 A;  3PBQ A;  4IBX A;  2ZM0 A;  4RYE A;  2WUQ A;  4HBU A;  4OON A;  4P87 A;  3AGF A;  5I94 A;  3LEZ A;  1K57 C;  1EWZ A;  2DCF A;  2ZD8 A;  5A91 A;  1BLP A;  1K4F A;  4PPR A;  2WZZ A;  1LI9 A;  4LV3 A;  2HDS A;  3Q82 A;  4GB7 A;  2I72 A;  4JXS A;  4RX2 A;  4RX3 A;  5EPH A;  4P0M A;  1NYM A;  1C3B A;  4S2I A;  1KVL A;  3WWX A;  3VSK A;  5FQI A;  5HL1 A;  5GL9 A;  4GD8 A;  4OQG A;  3PTE A;  2IWC A;  4DF6 A;  3GQZ A;  2Q9M A;  4UA9 A;  5E2H A;  3EQU A;  3ZG7 B;  2JCH A;  4UA7 A;  1IEL A;  3LY4 A;  3SH7 A;  2XDM A;  4MNR A;  5HAI A;  2WAE A;  3AGE A;  1IYS A;  4IVK A;  1SKF A;  3ZG5 A;  5JYP A;  4EBN A;  1JTD A;  2EFU A;  4DRT A;  1BZA A;  3O88 A;  5EUA A;  1YLP A;  2HPB A;  3C7U A;  3GSG A;  2HP6 A;  4KZ9 A;  2WKH A;  3A3I A;  1K6R A;  4R3B A;  4DE3 A;  4DXC A;  3UDF A;  4KQQ A;  2HDR A;  4PM6 A;  1I5Q A;  2Y2H A;  1GHI A;  1NZU A;  4LV0 A;  3BEC A;  1RGZ A;  4N9L A;  4KZ7 A;  1J9M A;  3M6H A;  4YFM A;  3ZNY A;  2OLU A;  3PBR A;  1OME A;  5M19 A;  3BFF A;  4KZ8 A;  3Q7V B;  5DTK A;  3C4O A;  5KZH A;  3NBL A;  4JF4 A;  4Z9Q A;  3W8K A;  4PM8 A;  3RXW A;  3VP4 A;  5F1F A;  1K4E A;  5CEB A;  3BFC A;  2QPN A;  1MBL A;  1L2S A;  3UNW A;  4U0T A;  3CJM A;  3UE0 A;  3WS0 A;  5F1G A;  3ZNT A;  4WZ5 A;  4UAA A;  5EVI C;  5TR7 A;  3G30 A;  5AQA A;  1I2S A;  3G4P A;  1BLH A;  1XA1 A;  4JBF A;  4JF5 A;  5FAT A;  3G2Z A;  2ZC6 B;  4LV1 A;  5DVA A;  1XPB A;  3GMW A;  2WGI A;  1KDS A;  4ID4 A;  1JVJ A;  3G31 A;  2Y2I A;  2ZJ9 A;  3HRE A;  4HEF A;  4WEK A;  1XKZ A;  5CHM A;  3NDE A;  1W5D A;  2DNS A;  2FFF B;  4KQR A;  1K57 A;  4WM9 A;  4DE0 A;  3IT9 A;  4BD0 A;  1CEF A;  1HVB A;  2R9X A;  3RXX A;  4FCF A;  3ZG9 B;  2ZQ9 A;  3ZVW A;  2WYX A;  5A90 A;  2V20 A;  1ZG6 A;  2Y2L A;  3Q7V A;  1PWD A;  5CHU A;  3LO7 A;  4HBT A;  5EVL A;  4BL2 A;  1TDG A;  1TVF A;  5FAP A;  4JXG A;  4OP8 A;  5FI6 A;  1JWV A;  4OP5 A;  4OOM A;  4X55 A;  2P9V A;  2WZX A;  2H10 A;  2ZM8 A;  3PBT A;  1VM1 A;  5EVI B;  5GHX A;  3QHY A;  1RGY A;  1IKG A;  1CK3 A;  2ZQC A;  3FV7 A;  5A93 A;  1DJC A;  1MWR A;  3WS1 A;  3W4Q A;  3HLC A;  2UWX A;  2ZQA A;  2PU4 A;  3GTC A;  1ES5 A;  3DWZ A;  1BUL A;  4PMA A;  4S2J A;  2HP9 A;  2Y2J A;  2QMI A;  1M6K A;  3HLB A;  3HUN A;  3A3E A;  4BQM A;  2EX9 A;  5FSR A;  1LL5 A;  1KGG A;  2HP5 A;  1ZC2 A;  2Y4A A;  4DDS A;  4EQI A;  4WMC D;  1BTL A;  4KZ4 A;  2XEP A;  2IWB A;  4LCM A;  4K0W A;  2X71 A;  4IBR A;  3MFD A;  4R1G A;  4NK3 A;  2RL3 A;  2VGJ A;  5U47 A;  1ES3 A;  2J8Y A;  1XX2 A;  5E2E A;  4BD1 A;  3FKV A;  4KZ6 A;  4NET A;  4KZ3 A;  5FDH A;  2XLN A;  3RJU A;  1BLS A;  1NXY A;  2ZQ8 A;  3FKW A;  5FA7 A;  4JLF A;  4ZAM A;  1PZP A;  1GHM A;  3MKF A;  3BRM A;  3D4F A;  4OVD A;  5CXW A;  4E3I A;  1YLW A;  5EVI A;  1IYQ A;  1YMX A;  5GLB A;  2GDN A;  3IXD A;  3SH8 A;  5HAQ A;  1ERO A;  1XXM A;  3LY3 A;  5FQQ A;  4EUZ A;  1YLJ A;  3MKE A;  2WAF A;  2E8I A;  3NI9 A;  3Q07 A;  1G6A A;  3MBZ A;  1YLY A;  4FSF A;  2WGW A;  4X6T A;  5AQ7 A;  3B3X A;  1K55 C;  4GNU A;  4RA7 A;  5EOO A;  5AQB A;  1H8Z A;  1PWG A;  2OLV A;  2RCX A;  1L0E A;  2XD1 A;  2Y2O A;  2J7V A;  4MBF A;  3IWO A;  1FCN A;  5GLD A;  1W8Y A;  1YLT A;  3E2L A;  3IWI A;  3MZE A;  4GZB A;  5HAR A;  3UDX A;  2XF3 A;  3OCL A;  3G32 A;  5GLA A;  4JF6 A;  4OQH A;  1HD8 A;  1K54 C;  2V2F F;  5J8X A;  3IXG A;  4EWF A;  1CI9 A;  5E2G A;  3IH8 A;  3MXR A;  4OQI A;  4XUX A;  2A49 A;  3ZG8 B;  1BLC A;  4X69 A;  1ERQ A;  2H0Y A;  3HLW A;  3PAG A;  3ISG A;  4WYY A;  3ITB A;  5CTN A;  3GR2 A;  3UPP A;  2WGV A;  3OC2 A;  3IXH A;  1W8Q A;  2IWD A;  3SS5 A;  3QNC A;  3VSL A;  4OLD A;  3C5A A;  3HL9 A;  4N92 A;  4PM9 A;  1W7F A;  5E2F A;  2JBF A;  1DJB A;  2XGN A;  2PBY A;  4OPR A;  1N4O A;  1WE4 A;  3G2Y A;  1RCJ A;  1XGI A;  4S2K A;  2C5W B;  1ERM A;  5GHZ A;  2HDQ A;  1H8Y A;  1E3U A;  4E3J A;  3G35 A;  2PU2 A;  2EXB A;  4S2N A;  3M6B A;  5BOH A;  2FFY A;  3IHA A;  3OZH A;  1MWU A;  3C4P A;  1IEM A;  4LCL A;  4E3K A;  5TGF A;  4KEN B;  3UDI A;  3V50 A;  5F82 A;  4N9K A;  5G18 A;  3NIA A;  3TOI A;  1YMS A;  5GHY A;  1Z6F A;  3UO9 A;  3PBS A;  1VQQ A;  3VFH A;  4OH0 A;  1SCW A;  3BFG A;  4H8R A;  4KG5 A;  4X53 A;  1MPL A;  2JC7 A;  3VP2 A;  1L0F A;  4E3N A;  4M3K A;  4DE2 A;  4EBP A;  3A3F A;  1K25 A;  2EX6 A;  1QME A;  3BLS A;  4JPM A;  5DTS A;  2Y55 A;  5JYO A;  1ES2 A;  5HW3 A;  5AQ9 A;  4GDB A;  3IHB A;  4N1X A;  2Y91 A;  3NCK A;  5GLC A;  3HLG A;  2ZQD A;  3Q81 A;  1JTG A;  5CHJ A;  4RVA A;  3HLD A;  3V3S A;  4QY6 A;  1K6S A;  5DF9 A;  3OPH A;  2EFX A;  4X68 A;  1K55 A;  2ZC3 B;  3Q1F A;  4X56 A;  4R3J A;  4U0X A;  4OOL A;  2B5R A;  1S0W A;  1PYY A;  2Y2G A;  4R4R A;  1ZKJ A;  2C6W B;  4OPQ A;  3N6I A;  1YT4 A;  4DE1 A;  2OSU A;  2ZQ7 A;  3MXS A;  5D3O A;  5FI2 A;  4B88 A;  3SS4 A;  1GCE A;  3BFD A;  4ZBE A;  2VGK A;  1NRF A;  3E2K A;  3V5M A;  1K38 A;  2XD5 A;  1WYB A;  3EQV A;  4Y0O A;  1K56 D;  2Z2L B;  3S4X A;  4DXB A;  3M2J A;  1M40 A;  1FSY A;  3IF6 C;  3IWQ A;  3PAE A;  1NZO A;  1ES4 A;  3VOZ A;  3I7J A;  3ZG0 A;  2G2W A;  1CEG A;  4A5R A;  4C6Y A;  4QB8 A;  1FOF A;  1LL9 A;  1I2W A;  2WKI A;  4BEN A;  3IXB A;  4GKU A;  4QHC A;  2HDU A;  4UA6 A;  4QU3 A;  4Y7P A;  4WZ4 A;  4ZJ1 A;  1PIO A;  4GOG A;  4WBG A;  5FAS A;  4HES A;  3OCN A;  4K0X A;  5TFQ A;  2Y2K A;  1FQG A;  2P74 A;  3FWL A;  4E3M A;  3IF5 A;  4PM5 A;  3NC8 A;  4BLM A;  3M2K A;  4R23 A;  4XUZ A;  3WS5 A;  2X02 A;  1KVM A;  1ONH A;  2X01 A;  1IYO A;  4MEZ A;  1NYY A;  2XH9 A;  3DW0 A;  1YQS A;  3VOY A;  4KZA A;  2QZ6 A;  2Y2Q A;  4GD6 A;  1KDW A;  3S22 A;  2CC1 A;  2XFT A;  3IF6 B;  4P85 A;  3UN7 A;  3TSG A;  4WMC A;  3G34 A;  4WZ5 C;  2XFS A;  4QJG A;  2Y2P A;  4OPY A;  1W79 A;  4FH2 A;  4E6X A;  3TG9 A;  4ZDX A;  4WEJ A;  5FAQ A;  4R0Q A;  1KE4 A;  1KGF A;  2G2U A;  5HX9 A;  4E6W A;  3CMZ A;  1TEM A;  1ALQ A;  3C7V A;  5CRF A;  4ZTK A;  1ONG A;  2Q9N A;  2Y2N A;  3A3J A;  3OPP A;  4KZB A;  2WAD A;  1L0G A;  3UY6 A;  1MWT A;  1FR1 A;  1H5X A;  3WRZ A;  3ZDJ A;  3V39 A;  3VMA A;  3AGD A;  2ZC4 B;  2OV5 A;  3W4P A;  3ZVT A;  2ZM2 A;  1DJA A;  1KE3 A;  3ITA A;  5FQ9 A;  2Y59 A;  5IHV A;  1GA0 A;  3GVB A;  1ESI A;  4MLL A;  4OOY A;  4K91 A;  2ZC5 B;  2WK0 A;  1PZO A;  1E3U D;  4KG2 A;  3N4I A;  3ZGA B;  4OPZ A;  3OPR A;  4XXR A;  1MXO A;  1WYC A;  3CZD A;  2JE5 A;  3BFE A;  4S2M A;  5CED A;  2J9P A;  4JXV A;  5CGW A;  3IF6 A;  3O87 A;  3NY4 A;  3LCE A;  3IH9 A;  3DTM A;  1TDL A;  4D2O A;  1MKI A;  4GDN A;  3W4O A;  5DF8 A;  2A3U A;  3VP0 A;  4E3L A;  3BLM A;  3SH9 A;  4EV4 A;  2R9W A;  3P09 A;  1SHV A;  4BJP A;  1KGE A;  2ZC7 A;  1SDN A;  5CGX A;  2XR0 A;  5DTT A;  1NY0 A;  3PBO A;  4F94 A;  3SOI A;  2ZMA A;  5F83 A;  1YLZ A;  2XQZ A;  4L0L A;  1FR6 A;  1O07 A;  1GA9 A;  1NJ4 A;  1PI4 A;  5EEC A;  3UPN A;  2DRW A;  1JWP A;  1AXB A;  1PW8 A;  2P9V B;  3OPL A;  3WRT A;  5KSC A;  1HTZ A;  2WKE A;  4EBL A;  3A3D A;  3O86 A;  1PW1 A;  3HUM A;  3HUO A;  2Z2M B;  1ESU A;  3DWK A;  3Q7Z A;  4Y0U A;  3VP3 A;  3O3V A;  4B4X A;  3GRJ A;  3BEB A;  3N7W A;  1E25 A;  4JXW A;  1SDE A;  1O7E A;  4IVI A;  5KSH A;  3HVF A;  4QD4 A;  3N8S A;  1Y54 A;  3SS3 A;  2BLS A;  1ZG4 A;  3N8L A;  4P6B A;  4E3O A;  1CI8 A;  1KE0 A;  1XGJ A;  4FD8 A;  4LEN A;  5L2F A;  1MY8 A;  4KG6 A;  4OLG A;  1EI5 A;  5FQJ A;  4CPK A;  4ZJ2 A;  1IKI A;  5KMW A;  1RP5 A;  1K54 A;  4YIN A;  4Y0T A;  4C75 A;  4QY5 A;  4R4S A;  4C3Q A;  4FH4 A;  3JYI A;  1FSW A;  5CER A;  5EE8 A;  3PBN A;  5FAO A;  1BUE A;  5FQK A;  3FZC A;  2H0T A;  2BG1 A;  1LLB A;  3V3R A;  1L0D A;  4UHU A;  1QMF A;  5FI7 A;  5HAP A;  5CGS A;  4MBH A;  1MWS A;  5E43 A;  5HFO A;  3FYZ A;  3HBR A;  5CEC A;  1YM1 A;  3HLF A;  4S2O A;  3GV9 A;  1GHP A;  3NDG A;  4ZJ3 A;  1PI5 A;  3VP1 A;  2XK1 A;  2EX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...