3ZDJA

Ancestral (enca) beta-lactamase class a
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
263
Chain Sequence
MHPQTLEQIKESESQLSGRVGMVELDLASGRTLSYRADERFPMMSTFKVLLCGAVLARVDAGLEQLDRRIHYRQQDLVEYSPVTEKHLADGMTVAELCAAAITMSDNTAANLLLATIGGPAGLTAFLRNIGDNVTRLDRWETELNEALPGDERDTTTPAAMAATLRKLLTGEILSAASRQQLITWMVADKVAGPLLRSVLPAGWFIADKTGAGERGSRGIIAVLGPDGKPSRIVVIYLTETQASMDERNQQIAEIGAALIEHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENCA BETA-LACTAMASE
publication title Hyperstability and Substrate Promiscuity in Laboratory Resurrections of Precambrian Beta-Lactamases.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 91
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3zdjA00
3ZNTA 2ZC4B 4KQOA 5F1GA 4PM7A 4B88A 4QU3A 3N8RA 2WAFA 4OVDA 5FQIA 2HP6A 3E2LA 1HTZA 1XX2A 3HBRA 4GD6A 3WS4A 4OPRA 5FQJA 1BULA 3DTMA 4E6XA 4JF5A 4M3KA 2B5RA 1EWZA 1ZC2A 4UHUA 4X56A 1EI5A 1NJ4A 1SKFA 2XF3A 3IHAA 3M2KA 4NK3A 3VFFA 3VP4A 1G6AA 3VMAA 4S2JA 3W4QA 3HLCA 4R4RA 3N8SA 3ZVTA 1PYYA 2Y2HA 3IXBA 3UY6A 4HESA 2RCXA 3IXHA 4OLDA 1K55A 1IYSA 1M6KA 3OPPA 5BOHA 4WBGA 4Y0TA 1K57A 3BFGA 3WWXA 2WZZA 3W4OA 1MWRA 3D4FA 5AQBA 4KG6A 2JCHA 2ZM0A 3PBSA 3CJMA 3UDXA 5A90A 3CMZA 4E3KA 2H5SA 3SS4A 5E2EA 5I94A 2ZC6B 5GLDA 2C6WB 4R23A 3HLDA 5GLCA 1KDSA 3C5AA 2Y2MA 2H0TA 3WS0A 3MXRA 4PM5A 4BL2A 3ZFZA 5KSCA 2Y2KA 3S4XA 3BEBA 4ZTKA 3ITBA 4UA7A 5EOOA 2ZM2A 3ITAA 4EUZA 5FATA 1YLYA 1M40A 3G32A 2WUQA 4C3QA 3TSGA 4H8RA 1GHPA 1I2WA 3HUOA 4FCFA 4JBFA 1LL5A 3LEZA 3N8LA 2J8YA 2ZQCA 3V39A 1GHMA 2V20A 3C7UA 4HBUA 4DXCA 4UA6A 5F1FA 2J9OA 1JVJA 5U47A 5CECA 3HVFA 1XXMA 3MKFA 1MWSA 2ZJ9A 2EX8A 3O87A 1IYOA 2FFFB 2Y2OA 2Y2NA 5CGXA 5EPHA 5E2HA 1ZKJA 1HVBA 1ES4A 1OMEA 1BLHA 2ZQ8A 3ZVWA 4DE0A 4R0QA 3HLGA 3HREA 3BECA 4KZ5A 2Y4AA 1PI5A 1FCNA 3UO9A 4QY5A 5A92A 3V3SA 4KZ9A 3C4OA 5DTSA 5CEBA 3OPLA 4Y0UA 1S6RA 1FQGA 1YLWA 5CHMA 1U60A 1W8QA 3I7JA 5KMWA 3CZDA 4B4XA 3Q7VA 1K56D 4OPZA 1CEGA 4P85A 4QB8A 1VQQA 3PBOA 5DF7A 3GV9A 5HAQA 4K0WA 4LV2A 1LLBA 4R4SA 1Q2PA 5EE8A 3JYIA 3FKWA 1JWVA 1FR1A 4P87A 4PMAA 1KDWA 4P6BA 4HBTA 2OSUA 2C5WB 3ZG0A 1NYYA 3PBRA 2XLNA 2QMIA 4WEJA 4CPKA 1NRFA 1ESUA 2QPNA 4GDBA 1ZG6A 1KGFA 3O86A 3IF6A 3G4PA 2HDSA 1K55C 3GR2A 3Q7ZA 5FA7A 1ES3A 1LL9A 1ERMA 3UPPA 4GNUA 2ZC3B 3A3DA 1K57C 3UE1A 2HDQA 3VP0A 3ZDJA 4OOMA 1QMFA 3NDEA 2PBYA 1BT5A 1PWDA 4MBFA 4RX3A 1K6SA 1NYMA 2DRWA 3PBQA 3P98A 4R3BA 3S22A 4BENA 1L2SA 4S2NA 2OLUA 5IHVA 4DE3A 3C4PA 3G2YA 3WRTA 4RX2A 3NIAA 3MKEA 4JXSA 1ONGA 4S2LA 4XXRA 4IBRA 5FAPA 2P9VA 4EBLA 3OPHA 4OP5A 4R3JA 5TR7A 5CGSA 4A5RA 2WKEA 3ZG9B 4OLGA 3Q81A 3G2ZA 2BG1A 1HD8A 4GB7A 3M2JA 5EVIA 2G2UA 2XK1A 2OV5A 3VFHA 2ZM8A 5GHYA 3W8KA 2Y91A 3VSLA 4KQRA 1KE0A 1PWGA 4EBPA 1SDNA 1JWZA 1H5XA 1MBLA 2EFXA 5EECA 3N7WA 2WGVA 4FH4A 3GTCA 5FQMA 1XA7A 2JE5A 4WMCA 2Y2IA 1Z6FA 4U3TA 4WZ4A 5AQAA 5FI6A 4GDNA 1L0FA 3UDIA 4NETA 4EV4A 3SH9A 4IEDA 3HLBA 3IF5A 3IWOA 1XKZA 5HX9A 5JYPA 5FI7A 1PIOA 1WYCA 2ZQAA 2EX9A 3OZHA 2X02A 5A93A 3G31A 2E8IA 2IWCA 3PAGA 4N92A 3WS1A 1KE4A 2GDNA 2P74A 5GHZA 4ZJ1A 1K54A 2ZC5B 2HDRA 1E3UA 2Y2JA 4MBKA 5GHXA 3A3EA 2Z2LB 4K91A 3IWIA 2XFTA 3C7VA 1WYBA 1CK3A 4OKPA 3SS3A 3QNCA 3IT9A 3G34A 1K38A 3MZEA 1L0GA 4BD1A 1IKGA 4E3JA 3HL9A 1PI4A 1Q2QA 1IEMA 5G18A 4P0MA 3UE3A 4BLMA 1ONHA 3Q07A 3EQUA 1TVFA 4QHCA 3MXSA 1YT4A 1XP4A 5CEDA 1FCOA 3IF6C 4IVIA 1G68A 3E2KA 5FQ9A 4HEFA 1ESIA 3Q82A 4E3OA 1SHVA 3MBZA 1SCWA 3BM6A 1IYPA 1FOFA 3LCEA 4KZ4A 1CI9A 1SDEA 2XGNA 5FDHA 3UE0A 4DDYA 1YLTA 4GKUA 5GL9A 2Z2MB 3GMWA 3NI9A 4RA7A 3P09A 3BFFA 2R9XA 1KGEA 3OCNA 4WZ5A 4S2NC 3O88A 5M19A 2WGWA 3PBNA 2PU2A 1KE3A 1MKIA 4XUZA 3PTEA 3LY3A 2IWBA 4LV0A 4KQQA 5FAQA 3MZDA 5HW3A 3VP3A 4E3IA 4GZBA 5CHUA 3HLWA 4EWFA 4QY6A 5EVLA 4OQGA 2WKIA 2WZXA 1RGZA 3IWQA 4Y0OA 3A3FA 3UN7A 1IELA 4OONA 3ZNYA 4U0XA 4O7DA 5CRFA 3WRZA 1E25A 3HUMA 5HL1A 2Y55A 4X53A 1GCEA 4MBHA 5J8XA 1Y54A 5FSRA 3IXDA 1ZG4A 2J9PA 1O07A 2XD1A 1LI9A 2VGJA 3TG9A 4LV3A 4GOGA 4PM9A 4KZ7A 4DE1A 1L0DA 3PAEA 1MPLA 2XEPA 4BL3A 2HP9A 2XDMA 1XA1A 4EBNA 3A3JA 2Y2LA 3GSGA 4GN2A 4N1HA 1S0WA 3G35A 3GQZA 3OCLA 5AQ7A 1PZPA 1BLPA 3LY4A 3QHYA 3UNWA 3SOIA 4KZAA 1K6RA 4ZJ3A 1HZOA 1DJAA 4U0TA 4X6TA 2FFYA 4S2MA 1TDGA 4KG5A 5E43A 3ISGA 1K54C 1BSGA 5D3OA 5F82A 5EUAA 5DVAA 3EQVA 2G2WA 2ZQ9A 4S2IA 4OPYA 3V50A 1IYQA 3VP1A 1N9BA 3UPNA 3GVBA 3FYZA 3B3XA 2A49A 3IF6B 4KZ6A 2RL3A 4OP8A 1MWTA 5TFQA 3UDFA 2JC7A 4S2OA 3QNBA 1K56A 3PBTA 2Q9MA 3BLSA 2HP5A 4LCMA 1LI0A 1TDLA 4OQ0A 3MZFA 1K4EA 2XD5A 4ZJ2A 2ZQ7A 2R9WA 4PPRA 5DTKA 5KZHA 1IKIA 4UA9A 3RXXA 4PM8A 1BTLA 3BRMA 1RGYA 2ZD8A 1H8ZA 3LO7A 3S1YA 5HAPA 3ZG8B 1RP5A 4E3MA 4LENA 1ES5A 3IH8A 5CGWA 1DJCA 1W8YA 5L2FA 1BLCA 3HLEA 4LV1A 5M1AA 2DCFA 4KZBA 2X71A 3NC8A 3DWKA 3IXGA 4Q8IA 5FASA 1NZUA 5CTNA 1JTGA 4ZAMA 3SH8A 4ZBEA 4X68A 1YLJA 2WK0A 1XGJA 1GA9A 5DF8A 1DY6A 2ZC7A 4JKTA 5JYOA 5F83A 2HPBA 5FQKA 4DRTA 4N9KA 4OOYA 1NY0A 2WYXA 3FWLA 5E2FA 2H0YA 1YLZA 2V1ZA 2BLSA 2IWDA 1W7FA 1FSYA 3VOYA 1JTDA 3G30A 2ZLYA 2PU4A 3CG5A 4XUXA 1KVLA 3SS5A 4JF4A 4IBXA 2XH9A 1CEFA 4MLLA 2JBFA 1W5DA 2X01A 1NZOA 3BFEA 1QMEA 3NCKA 1FCMA 4YFMA 4N9LA 3HLFA 4KENB 3ZHHA 3NDGA 1LHYA 2Q9NA 3IQAA 3O3VA 4JXWA 3V3RA 1YLPA 1YMSA 2Y59A 4EQIA 4WELA 4F94A 1CI8A 1EROA 3BFDA 2V2FF 3FV7A 4MNRA 3M6BA 3A3IA 5A91A 5CERA 4GD8A 1E4DA 4KG2A 4R1GA 4QJGA 4L0LA 3NY4A 4JF6A 1AXBA 5EOEA 4IVKA 4X55A 4S2PA 5FQQA 4FH2A 5HARA 3FKVA 1K25A 1K4FA 3VOZA 2A3UA 1ERQA 2VGKA 3ZG7B 4E3LA 5DF9A 1H8YA 2QZ6A 2HDUA 5FI2A 3N6IA 3DW0A 3FZCA 3AGFA 1TEMA 5EVIC 3SH7A 1PWCA 1DJBA 5CHJA 2XQZA 4FSFA 5M18A 3M6HA 4DXBA 3DWZA 1ES2A 2WGWB 3ZCZA 2DNSA 3AGEA 4ID4A 3BFCA 4OPQA 4BD0A 1O7EA 2EFUA 4JXGA 4Y7PA 3MFDA 4OOLA 5KSHA 3OPRA 5AQ9A 4RVAA 4WM9A 1BLSA 1GHIA 3HUNA 3TOIA 3IHBA 2CC1A 3Q7VB 1FSWA 1MY8A 1WE4A 1XGIA 5CTMA 2UWXA 3ZGAB 3ZG5A 4KZ3A 3W4PA 4OH0A 4WYYA 3WS5A 4DDSA 3GRJA 4YINA 3Q1FA 1YMXA 2H10A 1PW1A 4JXVA 5EVID 4MEZA 4BJPA 4DE2A 3NBLA 2XFSA 3IH9A 4E6WA 5FAOA 2EXAA 4BQMA 4JPMA 5DTTA 4X69A 1I2SA 5GLAA 1RCJA 4OQIA 3UPOA 1ALQA 4UAAA 2WKHA 5GLBA 1W79A 1N4OA 5CXWA 1BZAA 3RXWA 4N1XA 3VP2A 4CJNA 2WADA 3AGDA 4WMCD 4E3NA 1KVMA 1GA0A 4S2KA 3WS2A 4D2OA 1VM1A 1YQSA 2WGIA 3OC2A 2EX2A 1PZOA 1KGGA 4WEKA 4C75A 4ZDXA 5E2GA 4B4ZA 2EXBA 4OQHA 2XR0A 5HFOA 2WAEA 4QD4A 3VSKA 4FD8A 1C3BA 1MWUA 2Y2GA 3N4IA 3BYDA 4RYEA 2ZMAA 4KZ8A 4PM6A 1YM1A 2ZQDA 1XPBA 1E3UD 1I5QA 2Y2PA 2EX6A 1MXOA 2I72A 2P9VB 2J7VA 4JLFA 4DKIA 1J9MA 5HAIA 5TGFA 1JWPA 1NXYA 2OLVA 3BLMA 4WZ5C 1L0EA 4K0XA 4C6YA 1PW8A 4LCLA 3RJUA 4DF6A 3V5MA 4Z9QA 1FR6A 5EVIB 1BUEA 2Y2QA
chains in the Genus database with same CATH superfamily
3ZNTA 1DP8A 3NOTC 2PD7A 5F1GA 4QU3A 2WAFA 1XX2A 4OPRA 4DJ2A 4KUKA 4JF5A 1XJ3A 3M2KA 1SKFA 3IHAA 3VFFA 5DFXA 1G6AA 4HJ3A 2A2LA 2RCXA 1K55A 3LICA 3LR0A 4FOFA 1V9YA 1K57A 4EUVA 2WZZA 3CJMA 3CMZA 4E3KA 3SS4A 5G4ZA 2C6WB 5GLCA 2H0TA 4ZTKA 3ITBA 2ZM2A 1YLYA 3G32A 3TSGA 1DRMA 1GHPA 1I2WA 4JBFA 1N9OA 1LL5A 4HBUA 1S1YA 2EX8A 1H3QA 3O87A 1IYOA 2Y2NA 5E2HA 1ES4A 2ZQ8A 4R0QA 2L0WA 5F68A 3HREA 3BECA 4KZ5A 2Y4AA 1PI5A 1FCNA 3S7PA 5A92A 2PR6A 4Y0UA 1W8QA 3I7JA 4B4XA 3Q7VA 4OPZA 1CEGA 2AVXA 1VQQA 3RH8B 4K0WA 3F1NB 3MR0A 4MN7A 1Q2PA 4CQHA 3FKWA 4F3LB 1FR1A 4IUHA 4HBTA 2OSUA 2C5WB 3PBRA 3OLOA 4WEJA 4EU0A 1ZG6A 3O86A 2HDSA 3GR2A 4L9FA 2FZ0A 1LL9A 2UV0E 2ZC3B 3UE1A 1VEUB 4RX3A 1NYMA 1T19A 4DE3A 4RX2A 1ONGA 5FAPA 2P9VA 2INWA 4R3JA 5CGSA 4A5RA 4OLGA 3Q81A 3G2ZA 4WUJA 5HPFA 2W1TB 2ZM8A 4KQRA 1PWGA 5DFYA 1SDNA 5EECA 2WGVA 3IBRA 4FH4A 5FQMA 1XA7A 2J3WA 4NKPA 5FI6A 4E04A 3SH9A 3IF5A 3IWOA 5HX9A 5HPIA 2EX9A 3UE6A 4HI4A 4HP9A 2V1AA 1KE4A 2GDNA 2Y2JA 5CX7A 2XFTA 3OBFA 1OTDA 2A24B 3C8CA 1CK3A 4OKPA 2PD8A 1L0GA 1IKGA 4MMNA 4BLMA 3UE3A 5HWWA 4JGPA 1YT4A 3DBAA 5CEDA 3IF6C 4IVIA 3E2KA 2L4RA 2ACGA 4HEFA 3T4LA 4O8GA 3BM6A 3IS2A 4MN5A 3UB8A 3UE0A 3T1RA 3BWLA 2R9XA 1KGEA 5EM0A 1FILA 4WZ5A 2WGWA 4MDZA 4XUZA 1F98A 4LV0A 4KQQA 5FAQA 3MZDA 5HW3A 1G28A 2QHKA 4GZBA 2QKPA 3HLWA 4K08A 2WKIA 2WZXA 1RGZA 5L8MA 3IWQA 3UN7A 4U0XA 5C5KA 3WRZA 3CHWP 5HL1A 4EXOA 4X53A 1GCEA 5J8XA 2EWWA 2VGJA 3TG9A 4KZ7A 3PAEA 4M4XA 4G3VA 2HP9A 3PYPA 2D01A 4HQAA 4N1HA 5AQ7A 3UNWA 2QWSA 3T4JA 1K6RA 3H82B 4U0TA 5E43A 1OTIA 1BSGA 3MQ0A 5F82A 5F5YA 5DVAA 4GW9A 2G2WA 3V50A 3VP1A 1IYQA 3UPNA 3IF6B 5TFQA 2Y8HA 3PBTA 4LCMA 2JN7A 4R6LA 4ZJ2A 2R9WA 1BYWA 4PKYA 3RXXA 1G5UA 1TS6A 4NXGA 2ZL1A 2JKGA 3QP4A 3LO7A 2VV6A 2E8JA 4LENA 1ES5A 3LIDA 1DJCA 3KSHA 1W8YA 3GDIA 4LV1A 1OJGA 4ARZB 3DWKA 4Q8IA 1JTGA 2HF6A 4QPRA 4X68A 1GSXA 3BW6A 2NUPC 1XFNA 2ZC7A 2O0YA 3K3DA 3TRCA 4GLQA 1NY0A 3KSIA 2IWDA 1FSYA 3VOYA 3MF0A 3SS5A 3UB5P 1MKMA 2XROA 1H8MA 1N9NA 4N9LA 4KENB 2Z6CA 4WELA 4BBVA 3FV7A 5A91A 4I38A 1E4DA 4KG2A 5IT5A 4JF6A 4XT2B 1D1JA 1ERQA 5A8BA 2I9VA 2QZ6A 5FI2A 3N6IA 1DP6A 3SH7A 3O5YA 1DJBA 4BWIA 5KIZA 3ZCZA 4ID4A 2MJ6A 2XRNA 1O7EA 3T1QB 4HJ4A 4NXBA 2V8FA 4RVAA 1BLSA 3HUNA 2CC1A 1MY8A 5CTMA 1UWNX 3S7NA 4WYYA 3WS5A 5MC7A 2XFSA 3IH9A 4BQMA 1UWPX 4JPMA 4X69A 1RCJA 5GLBA 2WKHA 1VB6A 5CXWA 1BZAA 3RXWA 1X0OA 3NJAA 2WADA 4WMCD 4E3NA 1VHMA 3WS2A 3P01A 4R3AA 4NXFA 4HY8A 4ZDXA 1T1CA 4WEKA 2LB5A 5E2GA 4B4ZA 4MCWA 2KX6A 1MWUA 4RYEA 2ZMAA 4KZ8A 2ZQDA 1E3UD 3CITA 4JLFA 4DKIA 5TBMB 1JWPA 3BLMA 1YPRA 4DF6A 3V5MA 2FH5A 4Z9QA 1SKOA 4MBFA 3LR5A 4PM7A 4OVDA 2W3HA 1HTZA 1CF0A 2BTFP 1ZC2A 3VP4A 3HLCA 3FPWA 1UGUA 1PYYA 3IXBA 1M6KA 3OPPA 2ZOIA 3BFGA 4CLCD 4KG6A 2WKQA 2JCHA 3PBSA 5A90A 4R23A 3HLDA 3MXRA 1OJ5A 4UEYA 2V0WA 3BEBA 4UA7A 1Y4OA 4EUZA 4I39A 5FDSA 3DAVA 3HUOA 4FCFA 2HZ5A 3N8LA 2ZQCA 4DXCA 1SZVA 3LEQA 1JVJA 3HVFA 3CUEC 3MKFA 2ZJ9A 3F1OA 2FFFB 2Y2OA 3PHYA 5EPHA 4ESPA 1ZKJA 4R70A 5HWTA 1OMEA 3UO9A 4IJGA 3A0SA 3C4OA 4Y17A 3IX4A 5DTSA 1FQGA 1U60A 4DN0A 2H28A 5DF7A 4R4SA 4WLAA 3JYIA 3SZTA 1JWVA 2HJEA 4PMAA 1XJ6A 1NYYA 2QMIA 1ESUA 3ZQ5A 1L3LA 1K55C 3LR4A 4GNUA 1K57C 3H7WB 3LYXA 3KSFA 3VP0A 3ZDJA 3MQQA 1T1AA 2KOIA 1K6SA 3LIBA 3P98A 1L2SA 4WF0A 2O9CA 3GECA 3WRTA 3OPHA 5TR7A 2BG1A 1HD8A 5EVIA 2G2UA 3OOVA 3R4KA 5GHYA 2Y91A 3LI8A 1H5XA 3N7WA 5L09A 4KUOA 3U2AA 3MS6A 4GS9A 4NETA 1XKZA 3E4PA 1J3WA 2X02A 4ETXA 3VE3A 3WS1A 4X25A 5GHZA 4ZJ1A 1K54A 1A0KA 2HDRA 4HNBA 2Z2LB 2M7UA 3CPTB 3IT9A 4HP4A 1XFQA 3NOPC 3LIEA 4P6ZS 4QHCA 1XP4A 5FQ9A 3Q82A 4EEPA 1SCWA 1IYPA 3LCEA 1SDEA 5FDHA 2Z2MB 4X1LA 5HSQA 1TS8A 2CMNA 1P9WA 3O88A 2OAP1 3FC7A 2WKPA 3PTEA 3LY3A 2HGVA 3VP3A 4E3IA 4EWFA 3L7HA 5L10A 3V67A 4Y0OA 3L9KA 2VZWA 4O7DA 3DTKA 3KO6A 3HUMA 3W2ZA 5FSRA 3IXDA 4II7A 3F1NA 4ETZA 4PM9A 2VA0A 4DE1A 4F3LA 2W3FA 2XEPA 4BL3A 1OTEA 1VETB 2VJWA 4EBNA 3A3JA 4GN2A 1S0WA 3G35A 3G6OA 3NULA 3OCLA 1ODVA 3SOIA 4KZAA 5EVEA 5D3OA 5EUAA 3RFBA 3RTYA 1N9BA 2M1CA 2VX8A 3GVBA 3B3XA 3FPVA 2XSSA 2RL3A 4YWZA 3NHQA 3UDFA 2JC7A 1N9LA 4S2OA 5TJJA 1K56A 5J4EA 3KYQA 2XA7S 1LI0A 1TDLA 1D06A 3MZFA 2ZQ7A 3F1PB 4PPRA 4L9EA 2P04A 5KZHA 1IKIA 4UA9A 3BRMA 1STZA 4D60A 1F9IA 5HAPA 4E3MA 3IH8A 3R7WB 5EFWA 2HV1A 2JKRI 3HLEA 5M1AA 2X71A 3MFXA 3K3CA 3MMHA 5EM1A 4ZAMA 3SH8A 1P9RA 1YLJA 2WK0A 3CI6A 1DY6A 4JKTA 3EEHA 3EWKA 2PRFA 2L1MA 3IX8A 4Q0HA 4DRTA 3FWLA 2WYXA 5E2FA 2H0YA 2A24A 2V1ZA 4LFUA 3D72A 2KDKA 3G30A 2ZLYA 3HJKA 4JF4A 1CEFA 5AJGA 1W5DA 3BFEA 4JGQA 1QMEA 1FCMA 3HLFA 3C38A 1YLPA 3BFDA 3A3IA 5CERA 1IFQA 2V1BA 4QJGA 4L0LA 2PT7A 1AXBA 5FQQA 3LIFA 1K25A 3IS2B 2HDUA 3E98A 3FZCA 3JVVA 3AGFA 3HCYA 5CHJA 2D02A 3M6HA 4DXBA 3DWZA 1ES2A 2WGWB 4ME4A 3BFCA 4OPQA 3T4QA 1K0KA 1T1BA 1P0ZA 4OOLA 5KSHA 4LPZA 3IHBA 1FSWA 1WE4A 1XGIA 2JKRM 2ZOHA 3VOLA 4DDSA 3H82A 4DE2A 5FAOA 3E4QA 2GX5A 3ICYA 5GLAA 3UPOA 1ALQA 3VP2A 1IOUA 1GA0A 4LGWA 4D2OA 1YQSA 3LUQA 2WGIA 1V9ZA 1KGGA 5HD5A 2XR0A 5HFOA 4H6JA 3B33A 2GZAA 3VSKA 4FD8A 4PM6A 2Y2PA 1PW8A 1MZUA 1ZHHB 2Y2QA 4CLCC 2ZC4B 4KQOA 1AWIA 3QP2A 5FQIA 3E2LA 3WS4A 3B42A 4X56A 3UMEA 3LR3A 2XF3A 1NJ4A 4NK3A 3W4QA 4LRYC 3UY6A 2K31A 5BOHA 4WBGA 4Y0TA 3WWXA 3W4OA 2KLIA 3D4FA 2ZM0A 3UDXA 2H5SA 1LL8A 3QP6A 1EW0A 3K2NA 1KDSA 2Y2MA 1Z09A 4PM5A 4GCZA 4EETB 2PBDP 3S4XA 3EOIA 5FL3A 4XT2A 3V39A 3LEZA 2J8YA 2V20A 3C7UA 2VGLM 5CECA 1XXMA 5CGXA 1HVBA 4DMZA 1WA9A 4CLCB 5CEBA 3OPLA 1S6RA 3TW8A 5KMWA 2JKTM 3CWFA 4P85A 4QB8A 3SW1A 4EESA 3GV9A 4HIAA 5HAQA 4G3KA 5EE8A 1OTAA 2XLNA 4CPKA 2QPNA 3BY8A 1KGFA 3Q7ZA 5FA7A 1LSWA 2GJ3A 2PBYA 1BT5A 2DRWA 3PBQA 3S22A 4R3BA 4S2NA 2OLUA 2NUTC 3C4PA 4EBLA 3MKEA 4XXRA 4S2LA 4GJ4A 3UB7A 1OT9A 2WKEA 1HLUP 4WN5A 2XK1A 3VFHA 3W8KA 3VSLA 1JWZA 3GTCA 2JE5A 2Y2IA 1Z6FA 4U3TA 4WZ4A 4GDNA 1L0FA 3UDIA 4EV4A 3T1SA 4I3AA 1XJ2A 4Y13A 5FI7A 3T4OA 1WYCA 3IBJA 2B02A 3G31A 4N92A 1S67L 2ZC5B 4MBKA 5GHXA 1WYBA 3TE8A 2J80A 3QNCA 5HL6A 3G34A 1K38A 1Q2QA 4EW7A 1IEMA 5G18A 4P0MA 1ONHA 3Q07A 1G6OA 4BMWA 2OOLA 1G68A 4Z1WA 3MXQA 3ZYTA 4LRZE 3C2WA 4KZ4A 1CI9A 1YLTA 3GMWA 4RA7A 3OCNA 3PBNA 4HJ6A 2PU2A 1KE3A 1MKIA 5CHUA 4QY6A 1TF1A 4OQGA 3A3FA 4OONA 3ZNYA 2PDRA 5CRFA 4MBHA 1Y54A 1ZG4A 1O07A 1LI9A 4HOIA 2PYPA 3CLOA 3GSGA 2Y2LA 2P08A 3GQZA 1BLPA 5J7EA 1HZOA 1DJAA 4X6TA 4S2MA 1TDGA 3EGDC 1S4RA 3H7WA 4PKYG 1K54C 2VGLS 2EWVA 4S2IA 4OPYA 2K2NA 2M7VA 4GHIA 4KZ6A 2PR5A 4OP8A 1MWTA 4R38A 3QNBA 3S7QA 3BLSA 3KYEA 4WL9A 1OT6A 4OQ0A 4EEUA 1K4EA 2XD5A 1YSPA 1BTLA 1S1ZA 2DMWA 1TS0A 1RGYA 4BBTA 1GSWA 5AVEA 5L2FA 3A0VA 1PFLA 4KZBA 4AFIA 3UB6A 3IXGA 1NZUA 1GA9A 5DF8A 4FUWA 1F5MA 5F83A 4GS9B 3VE4A 3KYZA 4OOYA 5DJTA 3CPTA 1YLZA 4XUXA 1KVLA 4IBXA 2XH9A 1NZOA 1CQAA 3NCKA 3ULFA 3ZHHA 3NDGA 3O3VA 4F94A 1CI8A 1EROA 4MNRA 3M6BA 5FEGA 4GD8A 4R1GA 5L07A 1NLZA 3T1XA 4S2PA 4FH2A 5HARA 1K4FA 3IX3A 4Y3IA 3VOZA 3ZG7B 2VGKA 3P7NA 4E3LA 5DF9A 1H8YA 2Y79A 3DW0A 1TEMA 1PWCA 2XQZA 2O99A 2G7UA 2DNSA 3AGEA 4BD0A 3MQOA 1CJFA 5HDDA 4JXGA 4YNRA 3MFDA 2V0UA 3D3OA 3OPRA 5AQ9A 2OAQ1 1GHIA 5AVFA 3Q7VB 2UWXA 5HWVA 3ZGAB 1VETA 3ZG5A 4KZ3A 3W4PA 4OH0A 3GRJA 3Q1FA 3E0YA 1PW1A 4JXVA 5EVID 4MEZA 5F6AA 5K5BA 1S66L 1D7EA 1TS7A 4E6WA 1VEUA 1NRJA 2VK3A 4UAAA 1H0MA 4L9GA 4CJNA 1KVMA 1PNEA 2P7JA 3OC2A 2J3TC 1PZOA 1PRQA 2HJ9C 1C3BA 2Y2GA 3N4IA 2W1TA 2VV7A 1XPBA 3A0RA 3F1PA 2EX6A 1MXOA 2I72A 2P9VB 2J7VA 3BJNA 1ACFA 4Q0IA 1J9MA 1JNUA 1NXYA 4WZ5C 5DKLA 4K0XA 1LSVA 2BASA 4LCLA 3RJUA 5HZHA 1KOUA 4PAUA 1BUEA 3R7WA 2PYRA 4B88A 3N8RA 2HP6A 3HBRA 4GD6A 5FQJA 1BULA 3DTMA 4E6XA 5IS1A 4M3KA 2B5RA 1EWZA 5HD3A 4UHUA 1EI5A 3VMAA 4S2JA 4R4RA 3N8SA 3ZVTA 4I5SA 2Y2HA 4HESA 3IXHA 5J3WA 4OLDA 3MJQA 1IYSA 2GNXA 4JGRA 1ZTUA 4NEED 5I5LA 1MWRA 5AQBA 3JVUA 5F69A 4NXEA 5E2EA 5I94A 2QJ5A 2VEAA 2ZC6B 5GLDA 2B18A 3C5AA 3WS0A 4BL2A 3ZFZA 5KSCA 4MN6A 2Y2KA 2W1RA 5EOOA 1YKDA 3ITAA 5FATA 1M40A 4C3QA 2WUQA 4HH2A 4H8RA 4I3IA 2JKFA 1GHMA 5F1FA 4UA6A 2J9OA 5U47A 2YKHA 1MWSA 3VV4A 3LI9A 1OPXA 1BLHA 3ZVWA 4DE0A 1LT0A 3C30A 4UQIM 2ZMVA 3HLGA 1F2KA 3UB9A 4QY5A 3V3SA 4KZ9A 5CHMA 1YLWA 3H9WA 3CZDA 1K56D 5DJUA 3PBOA 4LV2A 1XJ4A 1LLBA 4DJ3A 5G4YA 4P87A 1KDWA 2VV8A 4P6BA 2K7SA 3ZG0A 2WKRA 1NRFA 4GDBA 3IF6A 3G4PA 1ES3A 1ERMA 3UPPA 3A3DA 2HDQA 1NLYA 3BQAA 2Z6DA 4OOMA 1QMFA 3NDEA 4NG2A 1PWDA 4IUKA 4O0PA 4BENA 5IHVA 3G2YA 3NIAA 4JXSA 4IBRA 4OP5A 3ZG9B 4H6JB 4GB7A 2JKTI 3M2JA 2J3TD 2OV5A 4ARZA 3NOUC 1KE0A 3LIAA 4EBPA 3PR6A 2EFXA 1MBLA 2ZL1B 2V8CA 4WMCA 5AQAA 1T18A 1LSXA 4IEDA 3T12B 5JYPA 1PIOA 2OWHA 2R78A 2ZQAA 3OZHA 2W3GA 5A93A 2E8IA 4Q0JA 2IWCA 3PAGA 2P74A 1E3UA 3A3EA 4K91A 3IWIA 4EERA 3C7VA 3SS3A 3MZEA 4BD1A 4E3JA 3HL9A 1PI4A 3CAXA 3EQUA 1TVFA 3MXSA 1W63M 4BBUA 3T4KA 4ZRRA 4Y15A 1FCOA 1ESIA 4E3OA 1SHVA 3MBZA 5EV0A 1NWZA 1FOFA 4O01A 2XGNA 4LLOB 4DDYA 4GKUA 5GL9A 3D9YA 3NI9A 2IA2A 3P09A 3BFFA 2VKSA 4S2NC 4LRXC 5M19A 5DKKA 2IWBA 3S7OA 4CLCA 5IU1A 5EVLA 1MC0A 1IELA 1E25A 2EA9A 2Y55A 1YAXA 3KX0X 2J9PA 3QP8A 2O9AA 3DTIA 2XD1A 4HH3A 4LV3A 4GOGA 4YOFA 4JGOA 1L0DA 1MPLA 3LFVA 2XDMA 1XA1A 2OWJA 1PZPA 3LY4A 3QHYA 2W3EA 4ZJ3A 2V9AA 3FG8A 2FFYA 4KG5A 3ISGA 4G3WA 2PAVP 5FEFA 1DP9A 4X1MA 3EQVA 2ZQ9A 3FYZA 2A49A 3TJZC 4B93A 2VLGA 4Y5FA 4UQIS 1P97A 2Q9MA 3DTEA 5TBMA 2HP5A 2JHEA 3EEAA 5HDCA 2W0NA 5DTKA 4PM8A 4P6ZM 1SKOB 2ZD8A 1H8ZA 3S1YA 3MSHA 3ZG8B 1RP5A 3T50A 5CGWA 4EQ1A 1BLCA 2PHYA 2W3DA 2DCFA 3NC8A 3QP1A 5FASA 5CTNA 1OTBA 2QJ7A 4ZBEA 1XGJA 5JYOA 3QP5A 5LBRA 2HPBA 5FQKA 4N9KA 1YSQA 4RQ9A 2BLSA 1W7FA 1GSVA 1JTDA 2PU4A 3CG5A 2O9BA 3EGXC 4B9OA 4MLLA 4Y2FA 2JBFA 2X01A 4YFMA 1LHYA 2Q9NA 3IQAA 4JXWA 3V3RA 1YMSA 2Y59A 4EQIA 1Y28A 2V2FF 3B47A 3NY4A 5EOEA 4IVKA 4X55A 2B95A 1TD5A 3FKVA 3KSGA 2QYBA 2A3UA 2Q0OA 3LGOA 3F1OB 5EVIC 4FSFA 5M18A 1S4SA 3T4SA 2EFUA 4Y7PA 4FTXA 3UMDA 4WM9A 2XA7M 3T4TA 4HHDA 2YKFA 3TOIA 4I3JA 3JPUA 4YINA 3BQ8A 1YMXA 2H10A 4PHTA 4BJPA 4CLCE 3NBLA 2EXAA 5DTTA 2LB9A 1I2SA 4OQIA 1W79A 1N4OA 3U4LP 2ZMFA 4N1XA 4IHQA 3AGDA 3E4OA 4S2KA 2W27A 1VM1A 2EX2A 3BY9A 4C75A 1FIKA 2EXBA 3CUEA 3PXPA 4OQHA 2WAEA 1W63Q 4QD4A 2ZBBA 3BYDA 4GHIB 5HDSA 1YM1A 1I5QA 3NECA 5HAIA 5TGFA 4KQDA 2OLVA 1L0EA 4C6YA 3HJIA 4QWOA 1FR6A 5EVIB 3HLBA
chains in the Genus database with same CATH topology
3ZNTA 2ZC4B 4KQOA 5F1GA 4PM7A 4B88A 4QU3A 3N8RA 2WAFA 4OVDA 5FQIA 2HP6A 3E2LA 1HTZA 1XX2A 3HBRA 4GD6A 3WS4A 4OPRA 5FQJA 1BULA 3DTMA 4E6XA 4JF5A 4M3KA 2B5RA 1EWZA 1ZC2A 4UHUA 4X56A 1EI5A 1NJ4A 1SKFA 2XF3A 3IHAA 3M2KA 4NK3A 3VFFA 3VP4A 1G6AA 3VMAA 4S2JA 3W4QA 3HLCA 4R4RA 3N8SA 3ZVTA 1PYYA 2Y2HA 3IXBA 3UY6A 4HESA 2RCXA 3IXHA 4OLDA 1K55A 1IYSA 1M6KA 3OPPA 5BOHA 4WBGA 4Y0TA 1K57A 3BFGA 3WWXA 2WZZA 3W4OA 1MWRA 3D4FA 5AQBA 4KG6A 2JCHA 2ZM0A 3PBSA 3CJMA 3UDXA 5A90A 3CMZA 4E3KA 2H5SA 3SS4A 5E2EA 5I94A 2ZC6B 5GLDA 2C6WB 4R23A 3HLDA 5GLCA 1KDSA 3C5AA 2Y2MA 2H0TA 3WS0A 3MXRA 4PM5A 4BL2A 3ZFZA 5KSCA 2Y2KA 3S4XA 3BEBA 4ZTKA 3ITBA 4UA7A 5EOOA 2ZM2A 3ITAA 4EUZA 5FATA 1YLYA 1M40A 3G32A 2WUQA 4C3QA 3TSGA 4H8RA 1GHPA 1I2WA 3HUOA 4FCFA 4JBFA 1LL5A 3LEZA 3N8LA 2J8YA 2ZQCA 3V39A 1GHMA 2V20A 3C7UA 4HBUA 4DXCA 4UA6A 5F1FA 2J9OA 1JVJA 5U47A 5CECA 3HVFA 1XXMA 3MKFA 1MWSA 2ZJ9A 2EX8A 3O87A 1IYOA 2FFFB 2Y2OA 2Y2NA 5CGXA 5EPHA 5E2HA 1ZKJA 1HVBA 1ES4A 1OMEA 1BLHA 2ZQ8A 3ZVWA 4DE0A 4R0QA 3HLGA 3HREA 3BECA 4KZ5A 2Y4AA 1PI5A 1FCNA 3UO9A 4QY5A 5A92A 3V3SA 4KZ9A 3C4OA 5DTSA 5CEBA 3OPLA 4Y0UA 1S6RA 1FQGA 1YLWA 5CHMA 1U60A 1W8QA 3I7JA 5KMWA 3CZDA 4B4XA 3Q7VA 1K56D 4OPZA 1CEGA 4P85A 4QB8A 1VQQA 3PBOA 5DF7A 3GV9A 5HAQA 4K0WA 4LV2A 1LLBA 4R4SA 1Q2PA 5EE8A 3JYIA 3FKWA 1JWVA 1FR1A 4P87A 4PMAA 1KDWA 4P6BA 4HBTA 2OSUA 2C5WB 3ZG0A 1NYYA 3PBRA 2XLNA 2QMIA 4WEJA 4CPKA 1NRFA 1ESUA 2QPNA 4GDBA 1ZG6A 1KGFA 3O86A 3IF6A 3G4PA 2HDSA 1K55C 3GR2A 3Q7ZA 5FA7A 1ES3A 1LL9A 1ERMA 3UPPA 4GNUA 2ZC3B 3A3DA 1K57C 3UE1A 2HDQA 3VP0A 3ZDJA 4OOMA 1QMFA 3NDEA 2PBYA 1BT5A 1PWDA 4MBFA 4RX3A 1K6SA 1NYMA 2DRWA 3PBQA 3P98A 4R3BA 3S22A 4BENA 1L2SA 4S2NA 2OLUA 5IHVA 4DE3A 3C4PA 3G2YA 3WRTA 4RX2A 3NIAA 3MKEA 4JXSA 1ONGA 4S2LA 4XXRA 4IBRA 5FAPA 2P9VA 4EBLA 3OPHA 4OP5A 4R3JA 5TR7A 5CGSA 4A5RA 2WKEA 3ZG9B 4OLGA 3Q81A 3G2ZA 2BG1A 1HD8A 4GB7A 3M2JA 5EVIA 2G2UA 2XK1A 2OV5A 3VFHA 2ZM8A 5GHYA 3W8KA 2Y91A 3VSLA 4KQRA 1KE0A 1PWGA 4EBPA 1SDNA 1JWZA 1H5XA 1MBLA 2EFXA 5EECA 3N7WA 2WGVA 4FH4A 3GTCA 5FQMA 1XA7A 2JE5A 4WMCA 2Y2IA 1Z6FA 4U3TA 4WZ4A 5AQAA 5FI6A 4GDNA 1L0FA 3UDIA 4NETA 4EV4A 3SH9A 4IEDA 3HLBA 3IF5A 3IWOA 1XKZA 5HX9A 5JYPA 5FI7A 1PIOA 1WYCA 2ZQAA 2EX9A 3OZHA 2X02A 5A93A 3G31A 2E8IA 2IWCA 3PAGA 4N92A 3WS1A 1KE4A 2GDNA 2P74A 5GHZA 4ZJ1A 1K54A 2ZC5B 2HDRA 1E3UA 2Y2JA 4MBKA 5GHXA 3A3EA 2Z2LB 4K91A 3IWIA 2XFTA 3C7VA 1WYBA 1CK3A 4OKPA 3SS3A 3QNCA 3IT9A 3G34A 1K38A 3MZEA 1L0GA 4BD1A 1IKGA 4E3JA 3HL9A 1PI4A 1Q2QA 1IEMA 5G18A 4P0MA 3UE3A 4BLMA 1ONHA 3Q07A 3EQUA 1TVFA 4QHCA 3MXSA 1YT4A 1XP4A 5CEDA 1FCOA 3IF6C 4IVIA 1G68A 3E2KA 5FQ9A 4HEFA 1ESIA 3Q82A 4E3OA 1SHVA 3MBZA 1SCWA 3BM6A 1IYPA 1FOFA 3LCEA 4KZ4A 1CI9A 1SDEA 2XGNA 5FDHA 3UE0A 4DDYA 1YLTA 4GKUA 5GL9A 2Z2MB 3GMWA 3NI9A 4RA7A 3P09A 3BFFA 2R9XA 1KGEA 3OCNA 4WZ5A 4S2NC 3O88A 5M19A 2WGWA 3PBNA 2PU2A 1KE3A 1MKIA 4XUZA 3PTEA 3LY3A 2IWBA 4LV0A 4KQQA 5FAQA 3MZDA 5HW3A 3VP3A 4E3IA 4GZBA 5CHUA 3HLWA 4EWFA 4QY6A 5EVLA 4OQGA 2WKIA 2WZXA 1RGZA 3IWQA 4Y0OA 3A3FA 3UN7A 1IELA 4OONA 3ZNYA 4U0XA 4O7DA 5CRFA 3WRZA 1E25A 3HUMA 5HL1A 2Y55A 4X53A 1GCEA 4MBHA 5J8XA 1Y54A 5FSRA 3IXDA 1ZG4A 2J9PA 1O07A 2XD1A 1LI9A 2VGJA 3TG9A 4LV3A 4GOGA 4PM9A 4KZ7A 4DE1A 1L0DA 3PAEA 1MPLA 2XEPA 4BL3A 2HP9A 2XDMA 1XA1A 4EBNA 3A3JA 2Y2LA 3GSGA 4GN2A 4N1HA 1S0WA 3G35A 3GQZA 3OCLA 5AQ7A 1PZPA 1BLPA 3LY4A 3QHYA 3UNWA 3SOIA 4KZAA 1K6RA 4ZJ3A 1HZOA 1DJAA 4U0TA 4X6TA 2FFYA 4S2MA 1TDGA 4KG5A 5E43A 3ISGA 1K54C 1BSGA 5D3OA 5F82A 5EUAA 5DVAA 3EQVA 2G2WA 2ZQ9A 4S2IA 4OPYA 3V50A 1IYQA 3VP1A 1N9BA 3UPNA 3GVBA 3FYZA 3B3XA 2A49A 3IF6B 4KZ6A 2RL3A 4OP8A 1MWTA 5TFQA 3UDFA 2JC7A 4S2OA 3QNBA 1K56A 3PBTA 2Q9MA 3BLSA 2HP5A 4LCMA 1LI0A 1TDLA 4OQ0A 3MZFA 1K4EA 2XD5A 4ZJ2A 2ZQ7A 2R9WA 4PPRA 5DTKA 5KZHA 1IKIA 4UA9A 3RXXA 4PM8A 1BTLA 3BRMA 1RGYA 2ZD8A 1H8ZA 3LO7A 3S1YA 5HAPA 3ZG8B 1RP5A 4E3MA 4LENA 1ES5A 3IH8A 5CGWA 1DJCA 1W8YA 5L2FA 1BLCA 3HLEA 4LV1A 5M1AA 2DCFA 4KZBA 2X71A 3NC8A 3DWKA 3IXGA 4Q8IA 5FASA 1NZUA 5CTNA 1JTGA 4ZAMA 3SH8A 4ZBEA 4X68A 1YLJA 2WK0A 1XGJA 1GA9A 5DF8A 1DY6A 2ZC7A 4JKTA 5JYOA 5F83A 2HPBA 5FQKA 4DRTA 4N9KA 4OOYA 1NY0A 2WYXA 3FWLA 5E2FA 2H0YA 1YLZA 2V1ZA 2BLSA 2IWDA 1W7FA 1FSYA 3VOYA 1JTDA 3G30A 2ZLYA 2PU4A 3CG5A 4XUXA 1KVLA 3SS5A 4JF4A 4IBXA 2XH9A 1CEFA 4MLLA 2JBFA 1W5DA 2X01A 1NZOA 3BFEA 1QMEA 3NCKA 1FCMA 4YFMA 4N9LA 3HLFA 4KENB 3ZHHA 3NDGA 1LHYA 2Q9NA 3IQAA 3O3VA 4JXWA 3V3RA 1YLPA 1YMSA 2Y59A 4EQIA 4WELA 4F94A 1CI8A 1EROA 3BFDA 2V2FF 3FV7A 4MNRA 3M6BA 3A3IA 5A91A 5CERA 4GD8A 1E4DA 4KG2A 4R1GA 4QJGA 4L0LA 3NY4A 4JF6A 1AXBA 5EOEA 4IVKA 4X55A 4S2PA 5FQQA 4FH2A 5HARA 3FKVA 1K25A 1K4FA 3VOZA 2A3UA 1ERQA 2VGKA 3ZG7B 4E3LA 5DF9A 1H8YA 2QZ6A 2HDUA 5FI2A 3N6IA 3DW0A 3FZCA 3AGFA 1TEMA 5EVIC 3SH7A 1PWCA 1DJBA 5CHJA 2XQZA 4FSFA 5M18A 3M6HA 4DXBA 3DWZA 1ES2A 2WGWB 3ZCZA 2DNSA 3AGEA 4ID4A 3BFCA 4OPQA 4BD0A 1O7EA 2EFUA 4JXGA 4Y7PA 3MFDA 4OOLA 5KSHA 3OPRA 5AQ9A 4RVAA 4WM9A 1BLSA 1GHIA 3HUNA 3TOIA 3IHBA 2CC1A 3Q7VB 1FSWA 1MY8A 1WE4A 1XGIA 5CTMA 2UWXA 3ZGAB 3ZG5A 4KZ3A 3W4PA 4OH0A 4WYYA 3WS5A 4DDSA 3GRJA 4YINA 3Q1FA 1YMXA 2H10A 1PW1A 4JXVA 5EVID 4MEZA 4BJPA 4DE2A 3NBLA 2XFSA 3IH9A 4E6WA 5FAOA 2EXAA 4BQMA 4JPMA 5DTTA 4X69A 1I2SA 5GLAA 1RCJA 4OQIA 3UPOA 1ALQA 4UAAA 2WKHA 5GLBA 1W79A 1N4OA 5CXWA 1BZAA 3RXWA 4N1XA 3VP2A 4CJNA 2WADA 3AGDA 4WMCD 4E3NA 1KVMA 1GA0A 4S2KA 3WS2A 4D2OA 1VM1A 1YQSA 2WGIA 3OC2A 2EX2A 1PZOA 1KGGA 4WEKA 4C75A 4ZDXA 5E2GA 4B4ZA 2EXBA 4OQHA 2XR0A 5HFOA 2WAEA 4QD4A 3VSKA 4FD8A 1C3BA 1MWUA 2Y2GA 3N4IA 3BYDA 4RYEA 2ZMAA 4KZ8A 4PM6A 1YM1A 2ZQDA 1XPBA 1E3UD 1I5QA 2Y2PA 2EX6A 1MXOA 2I72A 2P9VB 2J7VA 4JLFA 4DKIA 1J9MA 5HAIA 5TGFA 1JWPA 1NXYA 2OLVA 3BLMA 4WZ5C 1L0EA 4K0XA 4C6YA 1PW8A 4LCLA 3RJUA 4DF6A 3V5MA 4Z9QA 1FR6A 5EVIB 1BUEA 2Y2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNT A;  2ZC4 B;  4KQO A;  5F1G A;  4PM7 A;  4B88 A;  4QU3 A;  3N8R A;  2WAF A;  4OVD A;  5FQI A;  2HP6 A;  3E2L A;  1HTZ A;  1XX2 A;  3HBR A;  4GD6 A;  3WS4 A;  4OPR A;  5FQJ A;  1BUL A;  3DTM A;  4E6X A;  4JF5 A;  4M3K A;  2B5R A;  1EWZ A;  1ZC2 A;  4UHU A;  4X56 A;  1EI5 A;  1NJ4 A;  1SKF A;  2XF3 A;  3IHA A;  3M2K A;  4NK3 A;  3VFF A;  3VP4 A;  1G6A A;  3VMA A;  4S2J A;  3W4Q A;  3HLC A;  4R4R A;  3N8S A;  3ZVT A;  1PYY A;  2Y2H A;  3IXB A;  3UY6 A;  4HES A;  2RCX A;  3IXH A;  4OLD A;  1K55 A;  1IYS A;  1M6K A;  3OPP A;  5BOH A;  4WBG A;  4Y0T A;  1K57 A;  3BFG A;  3WWX A;  2WZZ A;  3W4O A;  1MWR A;  3D4F A;  5AQB A;  4KG6 A;  2JCH A;  2ZM0 A;  3PBS A;  3CJM A;  3UDX A;  5A90 A;  3CMZ A;  4E3K A;  2H5S A;  3SS4 A;  5E2E A;  5I94 A;  2ZC6 B;  5GLD A;  2C6W B;  4R23 A;  3HLD A;  5GLC A;  1KDS A;  3C5A A;  2Y2M A;  2H0T A;  3WS0 A;  3MXR A;  4PM5 A;  4BL2 A;  3ZFZ A;  5KSC A;  2Y2K A;  3S4X A;  3BEB A;  4ZTK A;  3ITB A;  4UA7 A;  5EOO A;  2ZM2 A;  3ITA A;  4EUZ A;  5FAT A;  1YLY A;  1M40 A;  3G32 A;  2WUQ A;  4C3Q A;  3TSG A;  4H8R A;  1GHP A;  1I2W A;  3HUO A;  4FCF A;  4JBF A;  1LL5 A;  3LEZ A;  3N8L A;  2J8Y A;  2ZQC A;  3V39 A;  1GHM A;  2V20 A;  3C7U A;  4HBU A;  4DXC A;  4UA6 A;  5F1F A;  2J9O A;  1JVJ A;  5U47 A;  5CEC A;  3HVF A;  1XXM A;  3MKF A;  1MWS A;  2ZJ9 A;  2EX8 A;  3O87 A;  1IYO A;  2FFF B;  2Y2O A;  2Y2N A;  5CGX A;  5EPH A;  5E2H A;  1ZKJ A;  1HVB A;  1ES4 A;  1OME A;  1BLH A;  2ZQ8 A;  3ZVW A;  4DE0 A;  4R0Q A;  3HLG A;  3HRE A;  3BEC A;  4KZ5 A;  2Y4A A;  1PI5 A;  1FCN A;  3UO9 A;  4QY5 A;  5A92 A;  3V3S A;  4KZ9 A;  3C4O A;  5DTS A;  5CEB A;  3OPL A;  4Y0U A;  1S6R A;  1FQG A;  1YLW A;  5CHM A;  1U60 A;  1W8Q A;  3I7J A;  5KMW A;  3CZD A;  4B4X A;  3Q7V A;  1K56 D;  4OPZ A;  1CEG A;  4P85 A;  4QB8 A;  1VQQ A;  3PBO A;  5DF7 A;  3GV9 A;  5HAQ A;  4K0W A;  4LV2 A;  1LLB A;  4R4S A;  1Q2P A;  5EE8 A;  3JYI A;  3FKW A;  1JWV A;  1FR1 A;  4P87 A;  4PMA A;  1KDW A;  4P6B A;  4HBT A;  2OSU A;  2C5W B;  3ZG0 A;  1NYY A;  3PBR A;  2XLN A;  2QMI A;  4WEJ A;  4CPK A;  1NRF A;  1ESU A;  2QPN A;  4GDB A;  1ZG6 A;  1KGF A;  3O86 A;  3IF6 A;  3G4P A;  2HDS A;  1K55 C;  3GR2 A;  3Q7Z A;  5FA7 A;  1ES3 A;  1LL9 A;  1ERM A;  3UPP A;  4GNU A;  2ZC3 B;  3A3D A;  1K57 C;  3UE1 A;  2HDQ A;  3VP0 A;  3ZDJ A;  4OOM A;  1QMF A;  3NDE A;  2PBY A;  1BT5 A;  1PWD A;  4MBF A;  4RX3 A;  1K6S A;  1NYM A;  2DRW A;  3PBQ A;  3P98 A;  4R3B A;  3S22 A;  4BEN A;  1L2S A;  4S2N A;  2OLU A;  5IHV A;  4DE3 A;  3C4P A;  3G2Y A;  3WRT A;  4RX2 A;  3NIA A;  3MKE A;  4JXS A;  1ONG A;  4S2L A;  4XXR A;  4IBR A;  5FAP A;  2P9V A;  4EBL A;  3OPH A;  4OP5 A;  4R3J A;  5TR7 A;  5CGS A;  4A5R A;  2WKE A;  3ZG9 B;  4OLG A;  3Q81 A;  3G2Z A;  2BG1 A;  1HD8 A;  4GB7 A;  3M2J A;  5EVI A;  2G2U A;  2XK1 A;  2OV5 A;  3VFH A;  2ZM8 A;  5GHY A;  3W8K A;  2Y91 A;  3VSL A;  4KQR A;  1KE0 A;  1PWG A;  4EBP A;  1SDN A;  1JWZ A;  1H5X A;  1MBL A;  2EFX A;  5EEC A;  3N7W A;  2WGV A;  4FH4 A;  3GTC A;  5FQM A;  1XA7 A;  2JE5 A;  4WMC A;  2Y2I A;  1Z6F A;  4U3T A;  4WZ4 A;  5AQA A;  5FI6 A;  4GDN A;  1L0F A;  3UDI A;  4NET A;  4EV4 A;  3SH9 A;  4IED A;  3HLB A;  3IF5 A;  3IWO A;  1XKZ A;  5HX9 A;  5JYP A;  5FI7 A;  1PIO A;  1WYC A;  2ZQA A;  2EX9 A;  3OZH A;  2X02 A;  5A93 A;  3G31 A;  2E8I A;  2IWC A;  3PAG A;  4N92 A;  3WS1 A;  1KE4 A;  2GDN A;  2P74 A;  5GHZ A;  4ZJ1 A;  1K54 A;  2ZC5 B;  2HDR A;  1E3U A;  2Y2J A;  4MBK A;  5GHX A;  3A3E A;  2Z2L B;  4K91 A;  3IWI A;  2XFT A;  3C7V A;  1WYB A;  1CK3 A;  4OKP A;  3SS3 A;  3QNC A;  3IT9 A;  3G34 A;  1K38 A;  3MZE A;  1L0G A;  4BD1 A;  1IKG A;  4E3J A;  3HL9 A;  1PI4 A;  1Q2Q A;  1IEM A;  5G18 A;  4P0M A;  3UE3 A;  4BLM A;  1ONH A;  3Q07 A;  3EQU A;  1TVF A;  4QHC A;  3MXS A;  1YT4 A;  1XP4 A;  5CED A;  1FCO A;  3IF6 C;  4IVI A;  1G68 A;  3E2K A;  5FQ9 A;  4HEF A;  1ESI A;  3Q82 A;  4E3O A;  1SHV A;  3MBZ A;  1SCW A;  3BM6 A;  1IYP A;  1FOF A;  3LCE A;  4KZ4 A;  1CI9 A;  1SDE A;  2XGN A;  5FDH A;  3UE0 A;  4DDY A;  1YLT A;  4GKU A;  5GL9 A;  2Z2M B;  3GMW A;  3NI9 A;  4RA7 A;  3P09 A;  3BFF A;  2R9X A;  1KGE A;  3OCN A;  4WZ5 A;  4S2N C;  3O88 A;  5M19 A;  2WGW A;  3PBN A;  2PU2 A;  1KE3 A;  1MKI A;  4XUZ A;  3PTE A;  3LY3 A;  2IWB A;  4LV0 A;  4KQQ A;  5FAQ A;  3MZD A;  5HW3 A;  3VP3 A;  4E3I A;  4GZB A;  5CHU A;  3HLW A;  4EWF A;  4QY6 A;  5EVL A;  4OQG A;  2WKI A;  2WZX A;  1RGZ A;  3IWQ A;  4Y0O A;  3A3F A;  3UN7 A;  1IEL A;  4OON A;  3ZNY A;  4U0X A;  4O7D A;  5CRF A;  3WRZ A;  1E25 A;  3HUM A;  5HL1 A;  2Y55 A;  4X53 A;  1GCE A;  4MBH A;  5J8X A;  1Y54 A;  5FSR A;  3IXD A;  1ZG4 A;  2J9P A;  1O07 A;  2XD1 A;  1LI9 A;  2VGJ A;  3TG9 A;  4LV3 A;  4GOG A;  4PM9 A;  4KZ7 A;  4DE1 A;  1L0D A;  3PAE A;  1MPL A;  2XEP A;  4BL3 A;  2HP9 A;  2XDM A;  1XA1 A;  4EBN A;  3A3J A;  2Y2L A;  3GSG A;  4GN2 A;  4N1H A;  1S0W A;  3G35 A;  3GQZ A;  3OCL A;  5AQ7 A;  1PZP A;  1BLP A;  3LY4 A;  3QHY A;  3UNW A;  3SOI A;  4KZA A;  1K6R A;  4ZJ3 A;  1HZO A;  1DJA A;  4U0T A;  4X6T A;  2FFY A;  4S2M A;  1TDG A;  4KG5 A;  5E43 A;  3ISG A;  1K54 C;  1BSG A;  5D3O A;  5F82 A;  5EUA A;  5DVA A;  3EQV A;  2G2W A;  2ZQ9 A;  4S2I A;  4OPY A;  3V50 A;  1IYQ A;  3VP1 A;  1N9B A;  3UPN A;  3GVB A;  3FYZ A;  3B3X A;  2A49 A;  3IF6 B;  4KZ6 A;  2RL3 A;  4OP8 A;  1MWT A;  5TFQ A;  3UDF A;  2JC7 A;  4S2O A;  3QNB A;  1K56 A;  3PBT A;  2Q9M A;  3BLS A;  2HP5 A;  4LCM A;  1LI0 A;  1TDL A;  4OQ0 A;  3MZF A;  1K4E A;  2XD5 A;  4ZJ2 A;  2ZQ7 A;  2R9W A;  4PPR A;  5DTK A;  5KZH A;  1IKI A;  4UA9 A;  3RXX A;  4PM8 A;  1BTL A;  3BRM A;  1RGY A;  2ZD8 A;  1H8Z A;  3LO7 A;  3S1Y A;  5HAP A;  3ZG8 B;  1RP5 A;  4E3M A;  4LEN A;  1ES5 A;  3IH8 A;  5CGW A;  1DJC A;  1W8Y A;  5L2F A;  1BLC A;  3HLE A;  4LV1 A;  5M1A A;  2DCF A;  4KZB A;  2X71 A;  3NC8 A;  3DWK A;  3IXG A;  4Q8I A;  5FAS A;  1NZU A;  5CTN A;  1JTG A;  4ZAM A;  3SH8 A;  4ZBE A;  4X68 A;  1YLJ A;  2WK0 A;  1XGJ A;  1GA9 A;  5DF8 A;  1DY6 A;  2ZC7 A;  4JKT A;  5JYO A;  5F83 A;  2HPB A;  5FQK A;  4DRT A;  4N9K A;  4OOY A;  1NY0 A;  2WYX A;  3FWL A;  5E2F A;  2H0Y A;  1YLZ A;  2V1Z A;  2BLS A;  2IWD A;  1W7F A;  1FSY A;  3VOY A;  1JTD A;  3G30 A;  2ZLY A;  2PU4 A;  3CG5 A;  4XUX A;  1KVL A;  3SS5 A;  4JF4 A;  4IBX A;  2XH9 A;  1CEF A;  4MLL A;  2JBF A;  1W5D A;  2X01 A;  1NZO A;  3BFE A;  1QME A;  3NCK A;  1FCM A;  4YFM A;  4N9L A;  3HLF A;  4KEN B;  3ZHH A;  3NDG A;  1LHY A;  2Q9N A;  3IQA A;  3O3V A;  4JXW A;  3V3R A;  1YLP A;  1YMS A;  2Y59 A;  4EQI A;  4WEL A;  4F94 A;  1CI8 A;  1ERO A;  3BFD A;  2V2F F;  3FV7 A;  4MNR A;  3M6B A;  3A3I A;  5A91 A;  5CER A;  4GD8 A;  1E4D A;  4KG2 A;  4R1G A;  4QJG A;  4L0L A;  3NY4 A;  4JF6 A;  1AXB A;  5EOE A;  4IVK A;  4X55 A;  4S2P A;  5FQQ A;  4FH2 A;  5HAR A;  3FKV A;  1K25 A;  1K4F A;  3VOZ A;  2A3U A;  1ERQ A;  2VGK A;  3ZG7 B;  4E3L A;  5DF9 A;  1H8Y A;  2QZ6 A;  2HDU A;  5FI2 A;  3N6I A;  3DW0 A;  3FZC A;  3AGF A;  1TEM A;  5EVI C;  3SH7 A;  1PWC A;  1DJB A;  5CHJ A;  2XQZ A;  4FSF A;  5M18 A;  3M6H A;  4DXB A;  3DWZ A;  1ES2 A;  2WGW B;  3ZCZ A;  2DNS A;  3AGE A;  4ID4 A;  3BFC A;  4OPQ A;  4BD0 A;  1O7E A;  2EFU A;  4JXG A;  4Y7P A;  3MFD A;  4OOL A;  5KSH A;  3OPR A;  5AQ9 A;  4RVA A;  4WM9 A;  1BLS A;  1GHI A;  3HUN A;  3TOI A;  3IHB A;  2CC1 A;  3Q7V B;  1FSW A;  1MY8 A;  1WE4 A;  1XGI A;  5CTM A;  2UWX A;  3ZGA B;  3ZG5 A;  4KZ3 A;  3W4P A;  4OH0 A;  4WYY A;  3WS5 A;  4DDS A;  3GRJ A;  4YIN A;  3Q1F A;  1YMX A;  2H10 A;  1PW1 A;  4JXV A;  5EVI D;  4MEZ A;  4BJP A;  4DE2 A;  3NBL A;  2XFS A;  3IH9 A;  4E6W A;  5FAO A;  2EXA A;  4BQM A;  4JPM A;  5DTT A;  4X69 A;  1I2S A;  5GLA A;  1RCJ A;  4OQI A;  3UPO A;  1ALQ A;  4UAA A;  2WKH A;  5GLB A;  1W79 A;  1N4O A;  5CXW A;  1BZA A;  3RXW A;  4N1X A;  3VP2 A;  4CJN A;  2WAD A;  3AGD A;  4WMC D;  4E3N A;  1KVM A;  1GA0 A;  4S2K A;  3WS2 A;  4D2O A;  1VM1 A;  1YQS A;  2WGI A;  3OC2 A;  2EX2 A;  1PZO A;  1KGG A;  4WEK A;  4C75 A;  4ZDX A;  5E2G A;  4B4Z A;  2EXB A;  4OQH A;  2XR0 A;  5HFO A;  2WAE A;  4QD4 A;  3VSK A;  4FD8 A;  1C3B A;  1MWU A;  2Y2G A;  3N4I A;  3BYD A;  4RYE A;  2ZMA A;  4KZ8 A;  4PM6 A;  1YM1 A;  2ZQD A;  1XPB A;  1E3U D;  1I5Q A;  2Y2P A;  2EX6 A;  1MXO A;  2I72 A;  2P9V B;  2J7V A;  4JLF A;  4DKI A;  1J9M A;  5HAI A;  5TGF A;  1JWP A;  1NXY A;  2OLV A;  3BLM A;  4WZ5 C;  1L0E A;  4K0X A;  4C6Y A;  1PW8 A;  4LCL A;  3RJU A;  4DF6 A;  3V5M A;  4Z9Q A;  1FR6 A;  5EVI B;  1BUE A;  2Y2Q A; 
#chains in the Genus database with same CATH topology
 3ZNT A;  1DP8 A;  3NOT C;  2PD7 A;  5F1G A;  4QU3 A;  2WAF A;  1XX2 A;  4OPR A;  4DJ2 A;  4KUK A;  4JF5 A;  1XJ3 A;  3M2K A;  1SKF A;  3IHA A;  3VFF A;  5DFX A;  1G6A A;  4HJ3 A;  2A2L A;  2RCX A;  1K55 A;  3LIC A;  3LR0 A;  4FOF A;  1V9Y A;  1K57 A;  4EUV A;  2WZZ A;  3CJM A;  3CMZ A;  4E3K A;  3SS4 A;  5G4Z A;  2C6W B;  5GLC A;  2H0T A;  4ZTK A;  3ITB A;  2ZM2 A;  1YLY A;  3G32 A;  3TSG A;  1DRM A;  1GHP A;  1I2W A;  4JBF A;  1N9O A;  1LL5 A;  4HBU A;  1S1Y A;  2EX8 A;  1H3Q A;  3O87 A;  1IYO A;  2Y2N A;  5E2H A;  1ES4 A;  2ZQ8 A;  4R0Q A;  2L0W A;  5F68 A;  3HRE A;  3BEC A;  4KZ5 A;  2Y4A A;  1PI5 A;  1FCN A;  3S7P A;  5A92 A;  2PR6 A;  4Y0U A;  1W8Q A;  3I7J A;  4B4X A;  3Q7V A;  4OPZ A;  1CEG A;  2AVX A;  1VQQ A;  3RH8 B;  4K0W A;  3F1N B;  3MR0 A;  4MN7 A;  1Q2P A;  4CQH A;  3FKW A;  4F3L B;  1FR1 A;  4IUH A;  4HBT A;  2OSU A;  2C5W B;  3PBR A;  3OLO A;  4WEJ A;  4EU0 A;  1ZG6 A;  3O86 A;  2HDS A;  3GR2 A;  4L9F A;  2FZ0 A;  1LL9 A;  2UV0 E;  2ZC3 B;  3UE1 A;  1VEU B;  4RX3 A;  1NYM A;  1T19 A;  4DE3 A;  4RX2 A;  1ONG A;  5FAP A;  2P9V A;  2INW A;  4R3J A;  5CGS A;  4A5R A;  4OLG A;  3Q81 A;  3G2Z A;  4WUJ A;  5HPF A;  2W1T B;  2ZM8 A;  4KQR A;  1PWG A;  5DFY A;  1SDN A;  5EEC A;  2WGV A;  3IBR A;  4FH4 A;  5FQM A;  1XA7 A;  2J3W A;  4NKP A;  5FI6 A;  4E04 A;  3SH9 A;  3IF5 A;  3IWO A;  5HX9 A;  5HPI A;  2EX9 A;  3UE6 A;  4HI4 A;  4HP9 A;  2V1A A;  1KE4 A;  2GDN A;  2Y2J A;  5CX7 A;  2XFT A;  3OBF A;  1OTD A;  2A24 B;  3C8C A;  1CK3 A;  4OKP A;  2PD8 A;  1L0G A;  1IKG A;  4MMN A;  4BLM A;  3UE3 A;  5HWW A;  4JGP A;  1YT4 A;  3DBA A;  5CED A;  3IF6 C;  4IVI A;  3E2K A;  2L4R A;  2ACG A;  4HEF A;  3T4L A;  4O8G A;  3BM6 A;  3IS2 A;  4MN5 A;  3UB8 A;  3UE0 A;  3T1R A;  3BWL A;  2R9X A;  1KGE A;  5EM0 A;  1FIL A;  4WZ5 A;  2WGW A;  4MDZ A;  4XUZ A;  1F98 A;  4LV0 A;  4KQQ A;  5FAQ A;  3MZD A;  5HW3 A;  1G28 A;  2QHK A;  4GZB A;  2QKP A;  3HLW A;  4K08 A;  2WKI A;  2WZX A;  1RGZ A;  5L8M A;  3IWQ A;  3UN7 A;  4U0X A;  5C5K A;  3WRZ A;  3CHW P;  5HL1 A;  4EXO A;  4X53 A;  1GCE A;  5J8X A;  2EWW A;  2VGJ A;  3TG9 A;  4KZ7 A;  3PAE A;  4M4X A;  4G3V A;  2HP9 A;  3PYP A;  2D01 A;  4HQA A;  4N1H A;  5AQ7 A;  3UNW A;  2QWS A;  3T4J A;  1K6R A;  3H82 B;  4U0T A;  5E43 A;  1OTI A;  1BSG A;  3MQ0 A;  5F82 A;  5F5Y A;  5DVA A;  4GW9 A;  2G2W A;  3V50 A;  3VP1 A;  1IYQ A;  3UPN A;  3IF6 B;  5TFQ A;  2Y8H A;  3PBT A;  4LCM A;  2JN7 A;  4R6L A;  4ZJ2 A;  2R9W A;  1BYW A;  4PKY A;  3RXX A;  1G5U A;  1TS6 A;  4NXG A;  2ZL1 A;  2JKG A;  3QP4 A;  3LO7 A;  2VV6 A;  2E8J A;  4LEN A;  1ES5 A;  3LID A;  1DJC A;  3KSH A;  1W8Y A;  3GDI A;  4LV1 A;  1OJG A;  4ARZ B;  3DWK A;  4Q8I A;  1JTG A;  2HF6 A;  4QPR A;  4X68 A;  1GSX A;  3BW6 A;  2NUP C;  1XFN A;  2ZC7 A;  2O0Y A;  3K3D A;  3TRC A;  4GLQ A;  1NY0 A;  3KSI A;  2IWD A;  1FSY A;  3VOY A;  3MF0 A;  3SS5 A;  3UB5 P;  1MKM A;  2XRO A;  1H8M A;  1N9N A;  4N9L A;  4KEN B;  2Z6C A;  4WEL A;  4BBV A;  3FV7 A;  5A91 A;  4I38 A;  1E4D A;  4KG2 A;  5IT5 A;  4JF6 A;  4XT2 B;  1D1J A;  1ERQ A;  5A8B A;  2I9V A;  2QZ6 A;  5FI2 A;  3N6I A;  1DP6 A;  3SH7 A;  3O5Y A;  1DJB A;  4BWI A;  5KIZ A;  3ZCZ A;  4ID4 A;  2MJ6 A;  2XRN A;  1O7E A;  3T1Q B;  4HJ4 A;  4NXB A;  2V8F A;  4RVA A;  1BLS A;  3HUN A;  2CC1 A;  1MY8 A;  5CTM A;  1UWN X;  3S7N A;  4WYY A;  3WS5 A;  5MC7 A;  2XFS A;  3IH9 A;  4BQM A;  1UWP X;  4JPM A;  4X69 A;  1RCJ A;  5GLB A;  2WKH A;  1VB6 A;  5CXW A;  1BZA A;  3RXW A;  1X0O A;  3NJA A;  2WAD A;  4WMC D;  4E3N A;  1VHM A;  3WS2 A;  3P01 A;  4R3A A;  4NXF A;  4HY8 A;  4ZDX A;  1T1C A;  4WEK A;  2LB5 A;  5E2G A;  4B4Z A;  4MCW A;  2KX6 A;  1MWU A;  4RYE A;  2ZMA A;  4KZ8 A;  2ZQD A;  1E3U D;  3CIT A;  4JLF A;  4DKI A;  5TBM B;  1JWP A;  3BLM A;  1YPR A;  4DF6 A;  3V5M A;  2FH5 A;  4Z9Q A;  1SKO A;  4MBF A;  3LR5 A;  4PM7 A;  4OVD A;  2W3H A;  1HTZ A;  1CF0 A;  2BTF P;  1ZC2 A;  3VP4 A;  3HLC A;  3FPW A;  1UGU A;  1PYY A;  3IXB A;  1M6K A;  3OPP A;  2ZOI A;  3BFG A;  4CLC D;  4KG6 A;  2WKQ A;  2JCH A;  3PBS A;  5A90 A;  4R23 A;  3HLD A;  3MXR A;  1OJ5 A;  4UEY A;  2V0W A;  3BEB A;  4UA7 A;  1Y4O A;  4EUZ A;  4I39 A;  5FDS A;  3DAV A;  3HUO A;  4FCF A;  2HZ5 A;  3N8L A;  2ZQC A;  4DXC A;  1SZV A;  3LEQ A;  1JVJ A;  3HVF A;  3CUE C;  3MKF A;  2ZJ9 A;  3F1O A;  2FFF B;  2Y2O A;  3PHY A;  5EPH A;  4ESP A;  1ZKJ A;  4R70 A;  5HWT A;  1OME A;  3UO9 A;  4IJG A;  3A0S A;  3C4O A;  4Y17 A;  3IX4 A;  5DTS A;  1FQG A;  1U60 A;  4DN0 A;  2H28 A;  5DF7 A;  4R4S A;  4WLA A;  3JYI A;  3SZT A;  1JWV A;  2HJE A;  4PMA A;  1XJ6 A;  1NYY A;  2QMI A;  1ESU A;  3ZQ5 A;  1L3L A;  1K55 C;  3LR4 A;  4GNU A;  1K57 C;  3H7W B;  3LYX A;  3KSF A;  3VP0 A;  3ZDJ A;  3MQQ A;  1T1A A;  2KOI A;  1K6S A;  3LIB A;  3P98 A;  1L2S A;  4WF0 A;  2O9C A;  3GEC A;  3WRT A;  3OPH A;  5TR7 A;  2BG1 A;  1HD8 A;  5EVI A;  2G2U A;  3OOV A;  3R4K A;  5GHY A;  2Y91 A;  3LI8 A;  1H5X A;  3N7W A;  5L09 A;  4KUO A;  3U2A A;  3MS6 A;  4GS9 A;  4NET A;  1XKZ A;  3E4P A;  1J3W A;  2X02 A;  4ETX A;  3VE3 A;  3WS1 A;  4X25 A;  5GHZ A;  4ZJ1 A;  1K54 A;  1A0K A;  2HDR A;  4HNB A;  2Z2L B;  2M7U A;  3CPT B;  3IT9 A;  4HP4 A;  1XFQ A;  3NOP C;  3LIE A;  4P6Z S;  4QHC A;  1XP4 A;  5FQ9 A;  3Q82 A;  4EEP A;  1SCW A;  1IYP A;  3LCE A;  1SDE A;  5FDH A;  2Z2M B;  4X1L A;  5HSQ A;  1TS8 A;  2CMN A;  1P9W A;  3O88 A;  2OAP 1;  3FC7 A;  2WKP A;  3PTE A;  3LY3 A;  2HGV A;  3VP3 A;  4E3I A;  4EWF A;  3L7H A;  5L10 A;  3V67 A;  4Y0O A;  3L9K A;  2VZW A;  4O7D A;  3DTK A;  3KO6 A;  3HUM A;  3W2Z A;  5FSR A;  3IXD A;  4II7 A;  3F1N A;  4ETZ A;  4PM9 A;  2VA0 A;  4DE1 A;  4F3L A;  2W3F A;  2XEP A;  4BL3 A;  1OTE A;  1VET B;  2VJW A;  4EBN A;  3A3J A;  4GN2 A;  1S0W A;  3G35 A;  3G6O A;  3NUL A;  3OCL A;  1ODV A;  3SOI A;  4KZA A;  5EVE A;  5D3O A;  5EUA A;  3RFB A;  3RTY A;  1N9B A;  2M1C A;  2VX8 A;  3GVB A;  3B3X A;  3FPV A;  2XSS A;  2RL3 A;  4YWZ A;  3NHQ A;  3UDF A;  2JC7 A;  1N9L A;  4S2O A;  5TJJ A;  1K56 A;  5J4E A;  3KYQ A;  2XA7 S;  1LI0 A;  1TDL A;  1D06 A;  3MZF A;  2ZQ7 A;  3F1P B;  4PPR A;  4L9E A;  2P04 A;  5KZH A;  1IKI A;  4UA9 A;  3BRM A;  1STZ A;  4D60 A;  1F9I A;  5HAP A;  4E3M A;  3IH8 A;  3R7W B;  5EFW A;  2HV1 A;  2JKR I;  3HLE A;  5M1A A;  2X71 A;  3MFX A;  3K3C A;  3MMH A;  5EM1 A;  4ZAM A;  3SH8 A;  1P9R A;  1YLJ A;  2WK0 A;  3CI6 A;  1DY6 A;  4JKT A;  3EEH A;  3EWK A;  2PRF A;  2L1M A;  3IX8 A;  4Q0H A;  4DRT A;  3FWL A;  2WYX A;  5E2F A;  2H0Y A;  2A24 A;  2V1Z A;  4LFU A;  3D72 A;  2KDK A;  3G30 A;  2ZLY A;  3HJK A;  4JF4 A;  1CEF A;  5AJG A;  1W5D A;  3BFE A;  4JGQ A;  1QME A;  1FCM A;  3HLF A;  3C38 A;  1YLP A;  3BFD A;  3A3I A;  5CER A;  1IFQ A;  2V1B A;  4QJG A;  4L0L A;  2PT7 A;  1AXB A;  5FQQ A;  3LIF A;  1K25 A;  3IS2 B;  2HDU A;  3E98 A;  3FZC A;  3JVV A;  3AGF A;  3HCY A;  5CHJ A;  2D02 A;  3M6H A;  4DXB A;  3DWZ A;  1ES2 A;  2WGW B;  4ME4 A;  3BFC A;  4OPQ A;  3T4Q A;  1K0K A;  1T1B A;  1P0Z A;  4OOL A;  5KSH A;  4LPZ A;  3IHB A;  1FSW A;  1WE4 A;  1XGI A;  2JKR M;  2ZOH A;  3VOL A;  4DDS A;  3H82 A;  4DE2 A;  5FAO A;  3E4Q A;  2GX5 A;  3ICY A;  5GLA A;  3UPO A;  1ALQ A;  3VP2 A;  1IOU A;  1GA0 A;  4LGW A;  4D2O A;  1YQS A;  3LUQ A;  2WGI A;  1V9Z A;  1KGG A;  5HD5 A;  2XR0 A;  5HFO A;  4H6J A;  3B33 A;  2GZA A;  3VSK A;  4FD8 A;  4PM6 A;  2Y2P A;  1PW8 A;  1MZU A;  1ZHH B;  2Y2Q A;  4CLC C;  2ZC4 B;  4KQO A;  1AWI A;  3QP2 A;  5FQI A;  3E2L A;  3WS4 A;  3B42 A;  4X56 A;  3UME A;  3LR3 A;  2XF3 A;  1NJ4 A;  4NK3 A;  3W4Q A;  4LRY C;  3UY6 A;  2K31 A;  5BOH A;  4WBG A;  4Y0T A;  3WWX A;  3W4O A;  2KLI A;  3D4F A;  2ZM0 A;  3UDX A;  2H5S A;  1LL8 A;  3QP6 A;  1EW0 A;  3K2N A;  1KDS A;  2Y2M A;  1Z09 A;  4PM5 A;  4GCZ A;  4EET B;  2PBD P;  3S4X A;  3EOI A;  5FL3 A;  4XT2 A;  3V39 A;  3LEZ A;  2J8Y A;  2V20 A;  3C7U A;  2VGL M;  5CEC A;  1XXM A;  5CGX A;  1HVB A;  4DMZ A;  1WA9 A;  4CLC B;  5CEB A;  3OPL A;  1S6R A;  3TW8 A;  5KMW A;  2JKT M;  3CWF A;  4P85 A;  4QB8 A;  3SW1 A;  4EES A;  3GV9 A;  4HIA A;  5HAQ A;  4G3K A;  5EE8 A;  1OTA A;  2XLN A;  4CPK A;  2QPN A;  3BY8 A;  1KGF A;  3Q7Z A;  5FA7 A;  1LSW A;  2GJ3 A;  2PBY A;  1BT5 A;  2DRW A;  3PBQ A;  3S22 A;  4R3B A;  4S2N A;  2OLU A;  2NUT C;  3C4P A;  4EBL A;  3MKE A;  4XXR A;  4S2L A;  4GJ4 A;  3UB7 A;  1OT9 A;  2WKE A;  1HLU P;  4WN5 A;  2XK1 A;  3VFH A;  3W8K A;  3VSL A;  1JWZ A;  3GTC A;  2JE5 A;  2Y2I A;  1Z6F A;  4U3T A;  4WZ4 A;  4GDN A;  1L0F A;  3UDI A;  4EV4 A;  3T1S A;  4I3A A;  1XJ2 A;  4Y13 A;  5FI7 A;  3T4O A;  1WYC A;  3IBJ A;  2B02 A;  3G31 A;  4N92 A;  1S67 L;  2ZC5 B;  4MBK A;  5GHX A;  1WYB A;  3TE8 A;  2J80 A;  3QNC A;  5HL6 A;  3G34 A;  1K38 A;  1Q2Q A;  4EW7 A;  1IEM A;  5G18 A;  4P0M A;  1ONH A;  3Q07 A;  1G6O A;  4BMW A;  2OOL A;  1G68 A;  4Z1W A;  3MXQ A;  3ZYT A;  4LRZ E;  3C2W A;  4KZ4 A;  1CI9 A;  1YLT A;  3GMW A;  4RA7 A;  3OCN A;  3PBN A;  4HJ6 A;  2PU2 A;  1KE3 A;  1MKI A;  5CHU A;  4QY6 A;  1TF1 A;  4OQG A;  3A3F A;  4OON A;  3ZNY A;  2PDR A;  5CRF A;  4MBH A;  1Y54 A;  1ZG4 A;  1O07 A;  1LI9 A;  4HOI A;  2PYP A;  3CLO A;  3GSG A;  2Y2L A;  2P08 A;  3GQZ A;  1BLP A;  5J7E A;  1HZO A;  1DJA A;  4X6T A;  4S2M A;  1TDG A;  3EGD C;  1S4R A;  3H7W A;  4PKY G;  1K54 C;  2VGL S;  2EWV A;  4S2I A;  4OPY A;  2K2N A;  2M7V A;  4GHI A;  4KZ6 A;  2PR5 A;  4OP8 A;  1MWT A;  4R38 A;  3QNB A;  3S7Q A;  3BLS A;  3KYE A;  4WL9 A;  1OT6 A;  4OQ0 A;  4EEU A;  1K4E A;  2XD5 A;  1YSP A;  1BTL A;  1S1Z A;  2DMW A;  1TS0 A;  1RGY A;  4BBT A;  1GSW A;  5AVE A;  5L2F A;  3A0V A;  1PFL A;  4KZB A;  4AFI A;  3UB6 A;  3IXG A;  1NZU A;  1GA9 A;  5DF8 A;  4FUW A;  1F5M A;  5F83 A;  4GS9 B;  3VE4 A;  3KYZ A;  4OOY A;  5DJT A;  3CPT A;  1YLZ A;  4XUX A;  1KVL A;  4IBX A;  2XH9 A;  1NZO A;  1CQA A;  3NCK A;  3ULF A;  3ZHH A;  3NDG A;  3O3V A;  4F94 A;  1CI8 A;  1ERO A;  4MNR A;  3M6B A;  5FEG A;  4GD8 A;  4R1G A;  5L07 A;  1NLZ A;  3T1X A;  4S2P A;  4FH2 A;  5HAR A;  1K4F A;  3IX3 A;  4Y3I A;  3VOZ A;  3ZG7 B;  2VGK A;  3P7N A;  4E3L A;  5DF9 A;  1H8Y A;  2Y79 A;  3DW0 A;  1TEM A;  1PWC A;  2XQZ A;  2O99 A;  2G7U A;  2DNS A;  3AGE A;  4BD0 A;  3MQO A;  1CJF A;  5HDD A;  4JXG A;  4YNR A;  3MFD A;  2V0U A;  3D3O A;  3OPR A;  5AQ9 A;  2OAQ 1;  1GHI A;  5AVF A;  3Q7V B;  2UWX A;  5HWV A;  3ZGA B;  1VET A;  3ZG5 A;  4KZ3 A;  3W4P A;  4OH0 A;  3GRJ A;  3Q1F A;  3E0Y A;  1PW1 A;  4JXV A;  5EVI D;  4MEZ A;  5F6A A;  5K5B A;  1S66 L;  1D7E A;  1TS7 A;  4E6W A;  1VEU A;  1NRJ A;  2VK3 A;  4UAA A;  1H0M A;  4L9G A;  4CJN A;  1KVM A;  1PNE A;  2P7J A;  3OC2 A;  2J3T C;  1PZO A;  1PRQ A;  2HJ9 C;  1C3B A;  2Y2G A;  3N4I A;  2W1T A;  2VV7 A;  1XPB A;  3A0R A;  3F1P A;  2EX6 A;  1MXO A;  2I72 A;  2P9V B;  2J7V A;  3BJN A;  1ACF A;  4Q0I A;  1J9M A;  1JNU A;  1NXY A;  4WZ5 C;  5DKL A;  4K0X A;  1LSV A;  2BAS A;  4LCL A;  3RJU A;  5HZH A;  1KOU A;  4PAU A;  1BUE A;  3R7W A;  2PYR A;  4B88 A;  3N8R A;  2HP6 A;  3HBR A;  4GD6 A;  5FQJ A;  1BUL A;  3DTM A;  4E6X A;  5IS1 A;  4M3K A;  2B5R A;  1EWZ A;  5HD3 A;  4UHU A;  1EI5 A;  3VMA A;  4S2J A;  4R4R A;  3N8S A;  3ZVT A;  4I5S A;  2Y2H A;  4HES A;  3IXH A;  5J3W A;  4OLD A;  3MJQ A;  1IYS A;  2GNX A;  4JGR A;  1ZTU A;  4NEE D;  5I5L A;  1MWR A;  5AQB A;  3JVU A;  5F69 A;  4NXE A;  5E2E A;  5I94 A;  2QJ5 A;  2VEA A;  2ZC6 B;  5GLD A;  2B18 A;  3C5A A;  3WS0 A;  4BL2 A;  3ZFZ A;  5KSC A;  4MN6 A;  2Y2K A;  2W1R A;  5EOO A;  1YKD A;  3ITA A;  5FAT A;  1M40 A;  4C3Q A;  2WUQ A;  4HH2 A;  4H8R A;  4I3I A;  2JKF A;  1GHM A;  5F1F A;  4UA6 A;  2J9O A;  5U47 A;  2YKH A;  1MWS A;  3VV4 A;  3LI9 A;  1OPX A;  1BLH A;  3ZVW A;  4DE0 A;  1LT0 A;  3C30 A;  4UQI M;  2ZMV A;  3HLG A;  1F2K A;  3UB9 A;  4QY5 A;  3V3S A;  4KZ9 A;  5CHM A;  1YLW A;  3H9W A;  3CZD A;  1K56 D;  5DJU A;  3PBO A;  4LV2 A;  1XJ4 A;  1LLB A;  4DJ3 A;  5G4Y A;  4P87 A;  1KDW A;  2VV8 A;  4P6B A;  2K7S A;  3ZG0 A;  2WKR A;  1NRF A;  4GDB A;  3IF6 A;  3G4P A;  1ES3 A;  1ERM A;  3UPP A;  3A3D A;  2HDQ A;  1NLY A;  3BQA A;  2Z6D A;  4OOM A;  1QMF A;  3NDE A;  4NG2 A;  1PWD A;  4IUK A;  4O0P A;  4BEN A;  5IHV A;  3G2Y A;  3NIA A;  4JXS A;  4IBR A;  4OP5 A;  3ZG9 B;  4H6J B;  4GB7 A;  2JKT I;  3M2J A;  2J3T D;  2OV5 A;  4ARZ A;  3NOU C;  1KE0 A;  3LIA A;  4EBP A;  3PR6 A;  2EFX A;  1MBL A;  2ZL1 B;  2V8C A;  4WMC A;  5AQA A;  1T18 A;  1LSX A;  4IED A;  3T12 B;  5JYP A;  1PIO A;  2OWH A;  2R78 A;  2ZQA A;  3OZH A;  2W3G A;  5A93 A;  2E8I A;  4Q0J A;  2IWC A;  3PAG A;  2P74 A;  1E3U A;  3A3E A;  4K91 A;  3IWI A;  4EER A;  3C7V A;  3SS3 A;  3MZE A;  4BD1 A;  4E3J A;  3HL9 A;  1PI4 A;  3CAX A;  3EQU A;  1TVF A;  3MXS A;  1W63 M;  4BBU A;  3T4K A;  4ZRR A;  4Y15 A;  1FCO A;  1ESI A;  4E3O A;  1SHV A;  3MBZ A;  5EV0 A;  1NWZ A;  1FOF A;  4O01 A;  2XGN A;  4LLO B;  4DDY A;  4GKU A;  5GL9 A;  3D9Y A;  3NI9 A;  2IA2 A;  3P09 A;  3BFF A;  2VKS A;  4S2N C;  4LRX C;  5M19 A;  5DKK A;  2IWB A;  3S7O A;  4CLC A;  5IU1 A;  5EVL A;  1MC0 A;  1IEL A;  1E25 A;  2EA9 A;  2Y55 A;  1YAX A;  3KX0 X;  2J9P A;  3QP8 A;  2O9A A;  3DTI A;  2XD1 A;  4HH3 A;  4LV3 A;  4GOG A;  4YOF A;  4JGO A;  1L0D A;  1MPL A;  3LFV A;  2XDM A;  1XA1 A;  2OWJ A;  1PZP A;  3LY4 A;  3QHY A;  2W3E A;  4ZJ3 A;  2V9A A;  3FG8 A;  2FFY A;  4KG5 A;  3ISG A;  4G3W A;  2PAV P;  5FEF A;  1DP9 A;  4X1M A;  3EQV A;  2ZQ9 A;  3FYZ A;  2A49 A;  3TJZ C;  4B93 A;  2VLG A;  4Y5F A;  4UQI S;  1P97 A;  2Q9M A;  3DTE A;  5TBM A;  2HP5 A;  2JHE A;  3EEA A;  5HDC A;  2W0N A;  5DTK A;  4PM8 A;  4P6Z M;  1SKO B;  2ZD8 A;  1H8Z A;  3S1Y A;  3MSH A;  3ZG8 B;  1RP5 A;  3T50 A;  5CGW A;  4EQ1 A;  1BLC A;  2PHY A;  2W3D A;  2DCF A;  3NC8 A;  3QP1 A;  5FAS A;  5CTN A;  1OTB A;  2QJ7 A;  4ZBE A;  1XGJ A;  5JYO A;  3QP5 A;  5LBR A;  2HPB A;  5FQK A;  4N9K A;  1YSQ A;  4RQ9 A;  2BLS A;  1W7F A;  1GSV A;  1JTD A;  2PU4 A;  3CG5 A;  2O9B A;  3EGX C;  4B9O A;  4MLL A;  4Y2F A;  2JBF A;  2X01 A;  4YFM A;  1LHY A;  2Q9N A;  3IQA A;  4JXW A;  3V3R A;  1YMS A;  2Y59 A;  4EQI A;  1Y28 A;  2V2F F;  3B47 A;  3NY4 A;  5EOE A;  4IVK A;  4X55 A;  2B95 A;  1TD5 A;  3FKV A;  3KSG A;  2QYB A;  2A3U A;  2Q0O A;  3LGO A;  3F1O B;  5EVI C;  4FSF A;  5M18 A;  1S4S A;  3T4S A;  2EFU A;  4Y7P A;  4FTX A;  3UMD A;  4WM9 A;  2XA7 M;  3T4T A;  4HHD A;  2YKF A;  3TOI A;  4I3J A;  3JPU A;  4YIN A;  3BQ8 A;  1YMX A;  2H10 A;  4PHT A;  4BJP A;  4CLC E;  3NBL A;  2EXA A;  5DTT A;  2LB9 A;  1I2S A;  4OQI A;  1W79 A;  1N4O A;  3U4L P;  2ZMF A;  4N1X A;  4IHQ A;  3AGD A;  3E4O A;  4S2K A;  2W27 A;  1VM1 A;  2EX2 A;  3BY9 A;  4C75 A;  1FIK A;  2EXB A;  3CUE A;  3PXP A;  4OQH A;  2WAE A;  1W63 Q;  4QD4 A;  2ZBB A;  3BYD A;  4GHI B;  5HDS A;  1YM1 A;  1I5Q A;  3NEC A;  5HAI A;  5TGF A;  4KQD A;  2OLV A;  1L0E A;  4C6Y A;  3HJI A;  4QWO A;  1FR6 A;  5EVI B;  3HLB A; 
#chains in the Genus database with same CATH homology
 3ZNT A;  2ZC4 B;  4KQO A;  5F1G A;  4PM7 A;  4B88 A;  4QU3 A;  3N8R A;  2WAF A;  4OVD A;  5FQI A;  2HP6 A;  3E2L A;  1HTZ A;  1XX2 A;  3HBR A;  4GD6 A;  3WS4 A;  4OPR A;  5FQJ A;  1BUL A;  3DTM A;  4E6X A;  4JF5 A;  4M3K A;  2B5R A;  1EWZ A;  1ZC2 A;  4UHU A;  4X56 A;  1EI5 A;  1NJ4 A;  1SKF A;  2XF3 A;  3IHA A;  3M2K A;  4NK3 A;  3VFF A;  3VP4 A;  1G6A A;  3VMA A;  4S2J A;  3W4Q A;  3HLC A;  4R4R A;  3N8S A;  3ZVT A;  1PYY A;  2Y2H A;  3IXB A;  3UY6 A;  4HES A;  2RCX A;  3IXH A;  4OLD A;  1K55 A;  1IYS A;  1M6K A;  3OPP A;  5BOH A;  4WBG A;  4Y0T A;  1K57 A;  3BFG A;  3WWX A;  2WZZ A;  3W4O A;  1MWR A;  3D4F A;  5AQB A;  4KG6 A;  2JCH A;  2ZM0 A;  3PBS A;  3CJM A;  3UDX A;  5A90 A;  3CMZ A;  4E3K A;  2H5S A;  3SS4 A;  5E2E A;  5I94 A;  2ZC6 B;  5GLD A;  2C6W B;  4R23 A;  3HLD A;  5GLC A;  1KDS A;  3C5A A;  2Y2M A;  2H0T A;  3WS0 A;  3MXR A;  4PM5 A;  4BL2 A;  3ZFZ A;  5KSC A;  2Y2K A;  3S4X A;  3BEB A;  4ZTK A;  3ITB A;  4UA7 A;  5EOO A;  2ZM2 A;  3ITA A;  4EUZ A;  5FAT A;  1YLY A;  1M40 A;  3G32 A;  2WUQ A;  4C3Q A;  3TSG A;  4H8R A;  1GHP A;  1I2W A;  3HUO A;  4FCF A;  4JBF A;  1LL5 A;  3LEZ A;  3N8L A;  2J8Y A;  2ZQC A;  3V39 A;  1GHM A;  2V20 A;  3C7U A;  4HBU A;  4DXC A;  4UA6 A;  5F1F A;  2J9O A;  1JVJ A;  5U47 A;  5CEC A;  3HVF A;  1XXM A;  3MKF A;  1MWS A;  2ZJ9 A;  2EX8 A;  3O87 A;  1IYO A;  2FFF B;  2Y2O A;  2Y2N A;  5CGX A;  5EPH A;  5E2H A;  1ZKJ A;  1HVB A;  1ES4 A;  1OME A;  1BLH A;  2ZQ8 A;  3ZVW A;  4DE0 A;  4R0Q A;  3HLG A;  3HRE A;  3BEC A;  4KZ5 A;  2Y4A A;  1PI5 A;  1FCN A;  3UO9 A;  4QY5 A;  5A92 A;  3V3S A;  4KZ9 A;  3C4O A;  5DTS A;  5CEB A;  3OPL A;  4Y0U A;  1S6R A;  1FQG A;  1YLW A;  5CHM A;  1U60 A;  1W8Q A;  3I7J A;  5KMW A;  3CZD A;  4B4X A;  3Q7V A;  1K56 D;  4OPZ A;  1CEG A;  4P85 A;  4QB8 A;  1VQQ A;  3PBO A;  5DF7 A;  3GV9 A;  5HAQ A;  4K0W A;  4LV2 A;  1LLB A;  4R4S A;  1Q2P A;  5EE8 A;  3JYI A;  3FKW A;  1JWV A;  1FR1 A;  4P87 A;  4PMA A;  1KDW A;  4P6B A;  4HBT A;  2OSU A;  2C5W B;  3ZG0 A;  1NYY A;  3PBR A;  2XLN A;  2QMI A;  4WEJ A;  4CPK A;  1NRF A;  1ESU A;  2QPN A;  4GDB A;  1ZG6 A;  1KGF A;  3O86 A;  3IF6 A;  3G4P A;  2HDS A;  1K55 C;  3GR2 A;  3Q7Z A;  5FA7 A;  1ES3 A;  1LL9 A;  1ERM A;  3UPP A;  4GNU A;  2ZC3 B;  3A3D A;  1K57 C;  3UE1 A;  2HDQ A;  3VP0 A;  3ZDJ A;  4OOM A;  1QMF A;  3NDE A;  2PBY A;  1BT5 A;  1PWD A;  4MBF A;  4RX3 A;  1K6S A;  1NYM A;  2DRW A;  3PBQ A;  3P98 A;  4R3B A;  3S22 A;  4BEN A;  1L2S A;  4S2N A;  2OLU A;  5IHV A;  4DE3 A;  3C4P A;  3G2Y A;  3WRT A;  4RX2 A;  3NIA A;  3MKE A;  4JXS A;  1ONG A;  4S2L A;  4XXR A;  4IBR A;  5FAP A;  2P9V A;  4EBL A;  3OPH A;  4OP5 A;  4R3J A;  5TR7 A;  5CGS A;  4A5R A;  2WKE A;  3ZG9 B;  4OLG A;  3Q81 A;  3G2Z A;  2BG1 A;  1HD8 A;  4GB7 A;  3M2J A;  5EVI A;  2G2U A;  2XK1 A;  2OV5 A;  3VFH A;  2ZM8 A;  5GHY A;  3W8K A;  2Y91 A;  3VSL A;  4KQR A;  1KE0 A;  1PWG A;  4EBP A;  1SDN A;  1JWZ A;  1H5X A;  1MBL A;  2EFX A;  5EEC A;  3N7W A;  2WGV A;  4FH4 A;  3GTC A;  5FQM A;  1XA7 A;  2JE5 A;  4WMC A;  2Y2I A;  1Z6F A;  4U3T A;  4WZ4 A;  5AQA A;  5FI6 A;  4GDN A;  1L0F A;  3UDI A;  4NET A;  4EV4 A;  3SH9 A;  4IED A;  3HLB A;  3IF5 A;  3IWO A;  1XKZ A;  5HX9 A;  5JYP A;  5FI7 A;  1PIO A;  1WYC A;  2ZQA A;  2EX9 A;  3OZH A;  2X02 A;  5A93 A;  3G31 A;  2E8I A;  2IWC A;  3PAG A;  4N92 A;  3WS1 A;  1KE4 A;  2GDN A;  2P74 A;  5GHZ A;  4ZJ1 A;  1K54 A;  2ZC5 B;  2HDR A;  1E3U A;  2Y2J A;  4MBK A;  5GHX A;  3A3E A;  2Z2L B;  4K91 A;  3IWI A;  2XFT A;  3C7V A;  1WYB A;  1CK3 A;  4OKP A;  3SS3 A;  3QNC A;  3IT9 A;  3G34 A;  1K38 A;  3MZE A;  1L0G A;  4BD1 A;  1IKG A;  4E3J A;  3HL9 A;  1PI4 A;  1Q2Q A;  1IEM A;  5G18 A;  4P0M A;  3UE3 A;  4BLM A;  1ONH A;  3Q07 A;  3EQU A;  1TVF A;  4QHC A;  3MXS A;  1YT4 A;  1XP4 A;  5CED A;  1FCO A;  3IF6 C;  4IVI A;  1G68 A;  3E2K A;  5FQ9 A;  4HEF A;  1ESI A;  3Q82 A;  4E3O A;  1SHV A;  3MBZ A;  1SCW A;  3BM6 A;  1IYP A;  1FOF A;  3LCE A;  4KZ4 A;  1CI9 A;  1SDE A;  2XGN A;  5FDH A;  3UE0 A;  4DDY A;  1YLT A;  4GKU A;  5GL9 A;  2Z2M B;  3GMW A;  3NI9 A;  4RA7 A;  3P09 A;  3BFF A;  2R9X A;  1KGE A;  3OCN A;  4WZ5 A;  4S2N C;  3O88 A;  5M19 A;  2WGW A;  3PBN A;  2PU2 A;  1KE3 A;  1MKI A;  4XUZ A;  3PTE A;  3LY3 A;  2IWB A;  4LV0 A;  4KQQ A;  5FAQ A;  3MZD A;  5HW3 A;  3VP3 A;  4E3I A;  4GZB A;  5CHU A;  3HLW A;  4EWF A;  4QY6 A;  5EVL A;  4OQG A;  2WKI A;  2WZX A;  1RGZ A;  3IWQ A;  4Y0O A;  3A3F A;  3UN7 A;  1IEL A;  4OON A;  3ZNY A;  4U0X A;  4O7D A;  5CRF A;  3WRZ A;  1E25 A;  3HUM A;  5HL1 A;  2Y55 A;  4X53 A;  1GCE A;  4MBH A;  5J8X A;  1Y54 A;  5FSR A;  3IXD A;  1ZG4 A;  2J9P A;  1O07 A;  2XD1 A;  1LI9 A;  2VGJ A;  3TG9 A;  4LV3 A;  4GOG A;  4PM9 A;  4KZ7 A;  4DE1 A;  1L0D A;  3PAE A;  1MPL A;  2XEP A;  4BL3 A;  2HP9 A;  2XDM A;  1XA1 A;  4EBN A;  3A3J A;  2Y2L A;  3GSG A;  4GN2 A;  4N1H A;  1S0W A;  3G35 A;  3GQZ A;  3OCL A;  5AQ7 A;  1PZP A;  1BLP A;  3LY4 A;  3QHY A;  3UNW A;  3SOI A;  4KZA A;  1K6R A;  4ZJ3 A;  1HZO A;  1DJA A;  4U0T A;  4X6T A;  2FFY A;  4S2M A;  1TDG A;  4KG5 A;  5E43 A;  3ISG A;  1K54 C;  1BSG A;  5D3O A;  5F82 A;  5EUA A;  5DVA A;  3EQV A;  2G2W A;  2ZQ9 A;  4S2I A;  4OPY A;  3V50 A;  1IYQ A;  3VP1 A;  1N9B A;  3UPN A;  3GVB A;  3FYZ A;  3B3X A;  2A49 A;  3IF6 B;  4KZ6 A;  2RL3 A;  4OP8 A;  1MWT A;  5TFQ A;  3UDF A;  2JC7 A;  4S2O A;  3QNB A;  1K56 A;  3PBT A;  2Q9M A;  3BLS A;  2HP5 A;  4LCM A;  1LI0 A;  1TDL A;  4OQ0 A;  3MZF A;  1K4E A;  2XD5 A;  4ZJ2 A;  2ZQ7 A;  2R9W A;  4PPR A;  5DTK A;  5KZH A;  1IKI A;  4UA9 A;  3RXX A;  4PM8 A;  1BTL A;  3BRM A;  1RGY A;  2ZD8 A;  1H8Z A;  3LO7 A;  3S1Y A;  5HAP A;  3ZG8 B;  1RP5 A;  4E3M A;  4LEN A;  1ES5 A;  3IH8 A;  5CGW A;  1DJC A;  1W8Y A;  5L2F A;  1BLC A;  3HLE A;  4LV1 A;  5M1A A;  2DCF A;  4KZB A;  2X71 A;  3NC8 A;  3DWK A;  3IXG A;  4Q8I A;  5FAS A;  1NZU A;  5CTN A;  1JTG A;  4ZAM A;  3SH8 A;  4ZBE A;  4X68 A;  1YLJ A;  2WK0 A;  1XGJ A;  1GA9 A;  5DF8 A;  1DY6 A;  2ZC7 A;  4JKT A;  5JYO A;  5F83 A;  2HPB A;  5FQK A;  4DRT A;  4N9K A;  4OOY A;  1NY0 A;  2WYX A;  3FWL A;  5E2F A;  2H0Y A;  1YLZ A;  2V1Z A;  2BLS A;  2IWD A;  1W7F A;  1FSY A;  3VOY A;  1JTD A;  3G30 A;  2ZLY A;  2PU4 A;  3CG5 A;  4XUX A;  1KVL A;  3SS5 A;  4JF4 A;  4IBX A;  2XH9 A;  1CEF A;  4MLL A;  2JBF A;  1W5D A;  2X01 A;  1NZO A;  3BFE A;  1QME A;  3NCK A;  1FCM A;  4YFM A;  4N9L A;  3HLF A;  4KEN B;  3ZHH A;  3NDG A;  1LHY A;  2Q9N A;  3IQA A;  3O3V A;  4JXW A;  3V3R A;  1YLP A;  1YMS A;  2Y59 A;  4EQI A;  4WEL A;  4F94 A;  1CI8 A;  1ERO A;  3BFD A;  2V2F F;  3FV7 A;  4MNR A;  3M6B A;  3A3I A;  5A91 A;  5CER A;  4GD8 A;  1E4D A;  4KG2 A;  4R1G A;  4QJG A;  4L0L A;  3NY4 A;  4JF6 A;  1AXB A;  5EOE A;  4IVK A;  4X55 A;  4S2P A;  5FQQ A;  4FH2 A;  5HAR A;  3FKV A;  1K25 A;  1K4F A;  3VOZ A;  2A3U A;  1ERQ A;  2VGK A;  3ZG7 B;  4E3L A;  5DF9 A;  1H8Y A;  2QZ6 A;  2HDU A;  5FI2 A;  3N6I A;  3DW0 A;  3FZC A;  3AGF A;  1TEM A;  5EVI C;  3SH7 A;  1PWC A;  1DJB A;  5CHJ A;  2XQZ A;  4FSF A;  5M18 A;  3M6H A;  4DXB A;  3DWZ A;  1ES2 A;  2WGW B;  3ZCZ A;  2DNS A;  3AGE A;  4ID4 A;  3BFC A;  4OPQ A;  4BD0 A;  1O7E A;  2EFU A;  4JXG A;  4Y7P A;  3MFD A;  4OOL A;  5KSH A;  3OPR A;  5AQ9 A;  4RVA A;  4WM9 A;  1BLS A;  1GHI A;  3HUN A;  3TOI A;  3IHB A;  2CC1 A;  3Q7V B;  1FSW A;  1MY8 A;  1WE4 A;  1XGI A;  5CTM A;  2UWX A;  3ZGA B;  3ZG5 A;  4KZ3 A;  3W4P A;  4OH0 A;  4WYY A;  3WS5 A;  4DDS A;  3GRJ A;  4YIN A;  3Q1F A;  1YMX A;  2H10 A;  1PW1 A;  4JXV A;  5EVI D;  4MEZ A;  4BJP A;  4DE2 A;  3NBL A;  2XFS A;  3IH9 A;  4E6W A;  5FAO A;  2EXA A;  4BQM A;  4JPM A;  5DTT A;  4X69 A;  1I2S A;  5GLA A;  1RCJ A;  4OQI A;  3UPO A;  1ALQ A;  4UAA A;  2WKH A;  5GLB A;  1W79 A;  1N4O A;  5CXW A;  1BZA A;  3RXW A;  4N1X A;  3VP2 A;  4CJN A;  2WAD A;  3AGD A;  4WMC D;  4E3N A;  1KVM A;  1GA0 A;  4S2K A;  3WS2 A;  4D2O A;  1VM1 A;  1YQS A;  2WGI A;  3OC2 A;  2EX2 A;  1PZO A;  1KGG A;  4WEK A;  4C75 A;  4ZDX A;  5E2G A;  4B4Z A;  2EXB A;  4OQH A;  2XR0 A;  5HFO A;  2WAE A;  4QD4 A;  3VSK A;  4FD8 A;  1C3B A;  1MWU A;  2Y2G A;  3N4I A;  3BYD A;  4RYE A;  2ZMA A;  4KZ8 A;  4PM6 A;  1YM1 A;  2ZQD A;  1XPB A;  1E3U D;  1I5Q A;  2Y2P A;  2EX6 A;  1MXO A;  2I72 A;  2P9V B;  2J7V A;  4JLF A;  4DKI A;  1J9M A;  5HAI A;  5TGF A;  1JWP A;  1NXY A;  2OLV A;  3BLM A;  4WZ5 C;  1L0E A;  4K0X A;  4C6Y A;  1PW8 A;  4LCL A;  3RJU A;  4DF6 A;  3V5M A;  4Z9Q A;  1FR6 A;  5EVI B;  1BUE A;  2Y2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...