1UGUA

Crystal structure of pyp e46q mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Structure of photoactive yellow protein (PYP) E46Q mutant at 1.2 A resolution suggests how Glu46 controls the spectroscopic and kinetic characteristics of PYP.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 35
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1uguA00
4HJ6A 2Z6CA 4PKYA 2I9VA 2OWHA 3F1NB 2L1MA 5HWVA 2HV1A 3B33A 1XJ6A 3E4QA 3BY8A 3T50A 4EEPA 4HP9A 1X0OA 2VV7A 1F98A 3H9WA 1OTIA 2D01A 3CAXA 3A0RA 5TBMB 3LI8A 5J4EA 4HIAA 4R3AA 2QJ7A 2A24A 2L0WA 4BBTA 3IBRA 3H7WB 3G6OA 1V9ZA 2WKRA 3IS2A 3UE6A 2PR5A 3NOUC 5I5LA 2PD7A 1XJ4A 3K3CA 4KUKA 4RQ9A 2VV6A 3ZQ5A 4GCZA 5F5YA 1DRMA 2B02A 4WF0A 4KQDA 3FC7A 1TS8A 4GS9B 2VV8A 2EA9A 5F69A 4BBUA 2P7JA 2ZOIA 3KX0X 1XJ3A 3C8CA 1OTBA 4F3LA 3NHQA 3H82B 5DKKA 4EQ1A 2ZBBA 3PHYA 4LRXC 4XT2A 3MR0A 1T19A 1NWZA 5HD5A 4EETB 4R38A 3VOLA 4LRYC 1S66L 4DJ3A 4NXBA 3F1NA 2INWA 1OJ5A 1DP9A 3NJAA 4I39A 4JGRA 1S4SA 1TS0A 4EXOA 3UB7A 1LT0A 2VLGA 1D7EA 4K08A 1Y28A 3RH8B 3H7WA 1UGUA 5F68A 3A0SA 5HSQA 2QHKA 1P97A 2BASA 5DKLA 1OT9A 3NOTC 2JN7A 4HHDA 1MZUA 4EERA 3NOPC 1F9IA 3ICYA 1N9NA 1XJ2A 1UWPX 4JGQA 4GS9A 5HZHA 2L4RA 2QJ5A 3D72A 4NXEA 4I38A 1DP8A 3C2WA 4LLOB 3H82A 1P0ZA 3GECA 2D02A 2QKPA 1N9OA 4WUJA 4R70A 5J7EA 4E04A 2WKPA 1GSXA 1TS7A 5HDSA 4HH3A 3UMEA 5IU1A 4KUOA 3OLOA 4JGOA 2ZOHA 3LI9A 2M1CA 3ULFA 4NXGA 2A24B 3CLOA 4H6JB 4I3IA 4GHIB 1T1AA 3F1PA 1OTDA 5HWTA 4JGPA 2K7SA 3PYPA 1S67L 1LL8A 3F1OB 3LYXA 1BYWA 2PD8A 3BWLA 2JHEA 3UB6A 3GDIA 2V0UA 5G4ZA 5HDDA 1S4RA 4MN5A 2PYPA 1OTEA 2CMNA 3LIEA 1XFNA 5DJUA 2PDRA 2V0WA 1S1YA 2V1BA 5TBMA 1T18A 4R6LA 3EWKA 5G4YA 5J3WA 2YKFA 1XFQA 2OOLA 4HH2A 4F3LB 3MXQA 3UB8A 3MQQA 2PHYA 2GJ3A 1G28A 4XT2B 5DJTA 3FG8A 3LIAA 1ODVA 3E4PA 4EESA 4M4XA 3VE3A 3LICA 4I3AA 1S1ZA 2PR6A 3P7NA 3UB9A 3A0VA 3HJIA 4HJ3A 2WKQA 5A8BA 1WA9A 4HOIA 1T1CA 5F6AA 4EW7A 4I3JA 4L9EA 2J80A 4MN6A 4HJ4A 4H6JA 2V9AA 3EEHA 1V9YA 1N9LA 1LSWA 3SW1A 4B9OA 2W0NA 4GHIA 1GSWA 1T1BA 2KX6A 4WL9A 1D06A 3F1OA 5IS1A 3LUQA 5HD3A 2VEAA 4HNBA 4YWZA 4I5SA 4HP4A 4PKYG 4LRZE 2OWJA 3MFXA 3RTYA 3MJQA 3UMDA 4EEUA 3LIFA 1TS6A 2W27A 2KDKA 2V1AA 1OJGA 3IS2B 4BBVA 4WLAA 4HI4A 3K3DA 5HWWA 1OTAA 1LSVA 5KIZA 1DP6A 4NXFA 2YKHA 3E4OA 5AVEA 1JNUA 3VE4A 5AVFA 1GSVA 4L9FA 4GW9A 2R78A 3MQOA 4WN5A 5HDCA 3LIBA 5EFWA 1EW0A 4DJ2A 1UWNX 4HQAA 3HJKA 2H28A 2PYRA 3CWFA 4L9GA 1OT6A 3LIDA 1KOUA 3F1PB 1LSXA 2Z6DA 4HY8A 1VB6A 2QWSA 3BY9A 4LPZA
chains in the Genus database with same CATH superfamily
1A0KA 4LV3A 3BLMA 3C4OA 3MXSA 2OWHA 2EX2A 3VP4A 2L1MA 3OZHA 5CGXA 2XD5A 3T4OA 2WGIA 5CECA 3E4QA 4WEJA 3BY8A 3CG5A 1O7EA 2ZJ9A 4GDBA 4EEPA 4HP9A 1X0OA 4E3KA 3H9WA 2D01A 3LI8A 5J4EA 4R3AA 2Y55A 4KZ7A 4B4XA 3LGOA 5E2FA 2C6WB 3T4TA 4E3OA 4IVIA 3BRMA 3IF6B 2PD7A 4EU0A 3OC2A 1CK3A 1PWDA 3TG9A 5HL6A 4OLDA 2E8JA 1SCWA 4Q0HA 2HP9A 2VV6A 4KG6A 2B02A 3IBJA 3T1XA 4FSFA 3O88A 3IH9A 1SDNA 3KYZA 3FC7A 1TS8A 2VV8A 3S4XA 1WYCA 3VV4A 4BBUA 2P7JA 4FCFA 4EBNA 3KX0X 1XJ3A 2PU2A 5GLDA 3NDEA 4F3LA 2O9CA 1VETA 3NHQA 3H82B 2JBFA 4UA6A 4EQ1A 1PW1A 3VMAA 5HD5A 4WMCD 1STZA 3WS1A 1C3BA 3P98A 1S66L 4IUKA 2Q9MA 2HF6A 1F5MA 1H3QA 4N92A 1I2SA 2I72A 3F1NA 3LEZA 2Y2OA 5TGFA 1VQQA 3VSLA 1MWSA 4HESA 1GCEA 2J3TC 2ZQCA 4LV1A 2JCHA 2FFYA 1PI5A 3IQAA 1JWPA 1NZOA 3HUMA 4MN7A 3NULA 1MWTA 1BULA 3T1SA 2NUPC 1Y28A 5FI7A 1UGUA 1YMSA 1NLZA 4FUWA 2WGWA 3WWXA 2QHKA 1P97A 5G18A 5AQ7A 2X01A 3O3VA 5FDSA 3NOPC 2DRWA 2H5SA 4P0MA 2DCFA 3PBTA 2HDUA 3ICYA 3CUEA 3PBNA 1UWPX 4R3JA 3OCNA 2L4RA 4P6ZM 2OAQ1 1W8QA 2W3FA 3GV9A 3R7WB 3UDFA 1IELA 3BLSA 4K0WA 4LLOB 3IHAA 1P0ZA 3GECA 4G3KA 4UA9A 2D02A 2QKPA 3C7VA 1N9OA 4KQRA 4DKIA 2XLNA 1BLSA 4EQIA 3VP0A 1GSXA 1TS7A 4E3IA 1J9MA 3S7QA 4X1LA 3IX8A 5F1FA 2W3DA 2ZOHA 2WKHA 5JYPA 3LI9A 5CGSA 2XROA 3PBQA 1ESUA 1ES4A 4YOFA 1TDGA 2GX5A 2WAFA 4QY6A 5EVLA 2JE5A 2VZWA 3F1PA 4O0PA 5F83A 4JGPA 4E3LA 2K7SA 4KQQA 1W63Q 4UAAA 3KSIA 1ESIA 4RX2A 3MZDA 2JHEA 3ZG5A 4GKUA 2XQZA 3UB6A 1G68A 4E6XA 4BD1A 1ALQA 1ERQA 1S4RA 2HP5A 2PYPA 2CMNA 3LIEA 1XFNA 5DJUA 4EBPA 3ITAA 2ZQ9A 2V0WA 4LGWA 2JKTM 3V3SA 3R4KA 1S0WA 4QB8A 2NUTC 2P9VB 4F3LB 3MXQA 4DDSA 4YINA 2PHYA 2Y59A 2GJ3A 5L8MA 1M40A 1LHYA 3L9KA 3UE1A 5DJTA 4S2PA 4IJGA 3VE3A 3G32A 3LICA 4R23A 1W8YA 3N4IA 4N1HA 2HDRA 3P7NA 4Y0UA 3KSGA 3WS5A 4YFMA 3GRJA 4NETA 3UB9A 3CHWP 4HJ3A 4Q0JA 1NY0A 2HDQA 4S2MA 3A3FA 1BLPA 5CHJA 3FPVA 3FPWA 5FASA 4DMZA 3PBRA 4EW7A 1PRQA 1FCNA 1PWCA 4L9EA 1H0MA 3S1YA 4DXBA 4IHQA 4GJ4A 2PBYA 2ZL1A 3DAVA 5L10A 3FV7A 2W0NA 3EGXC 2KX6A 1D06A 2WGWB 3UB5P 3F1OA 5IS1A 4PM5A 3PTEA 4I5SA 4HP4A 3CPTA 3TSGA 2LB5A 2OWJA 2H0YA 3IXDA 4EEUA 2GZAA 3Q7VA 4FTXA 4LCMA 4OPYA 2KDKA 1YKDA 3IS2B 2ACGA 2XA7M 3HLFA 3HUNA 1ES2A 2Y2LA 2ZM0A 4PPRA 4DE2A 3K3DA 5HWWA 1LSVA 5KIZA 2PRFA 5CHUA 3KSHA 3T4JA 5IHVA 2H10A 1W79A 2YKHA 3Q1FA 3ISGA 5AVEA 4OQGA 2ZD8A 5FATA 3MBZA 1LL9A 2BG1A 5AVFA 4KZ9A 4L9FA 5AQAA 3ZG9B 5AQ9A 3IH8A 4WN5A 4FD8A 5EFWA 4C6YA 1HZOA 2O9BA 1G6AA 2UV0E 2IWBA 3HJKA 2XD1A 3SOIA 5F82A 2WAEA 5CHMA 4UEYA 1OT6A 1KOUA 4OH0A 3N8RA 1XGJA 2R9WA 3F1PB 5FA7A 4BD0A 2Z6DA 3BFFA 3IXHA 4HJ6A 3CITA 3QP1A 4UA7A 3ITBA 1L2SA 4P87A 2VKSA 3LR3A 1XJ6A 3DWKA 3PBSA 3M2JA 1XP4A 2EX9A 3P09A 4IBRA 5CEBA 3CAXA 1SZVA 3LO7A 1JWVA 1K55C 1P9WA 3AGFA 2QJ7A 2A24A 4BBTA 5GL9A 3T1QB 1V9ZA 3UE6A 2OSUA 2XF3A 5I5LA 1XJ4A 4NKPA 2QMIA 3K3CA 4CLCB 4JKTA 4KUKA 4EV4A 4RQ9A 3A3EA 1SKOA 1PW8A 5EVEA 5KSHA 3U4LP 3TW8A 3TE8A 3N6IA 1MC0A 3I7JA 1TD5A 5KZHA 3ZNYA 4Z9QA 3HLCA 1NRFA 3UDIA 2ZQ8A 5D3OA 3HREA 5HL1A 3VOYA 4EBLA 2KOIA 3C5AA 5EVIA 4FH2A 1NJ4A 3EQVA 1N4OA 4MCWA 2ZL1B 5FQJA 1HVBA 1KE4A 2VGKA 4Y0OA 1NWZA 2ZC3B 2J3TD 3B3XA 1ES3A 2ZMFA 3A3DA 3VOLA 3T4QA 3UPOA 4NXBA 3V5MA 5M18A 2INWA 2WGVA 3WS4A 4I39A 2WK0A 2JKRM 3UN7A 4JLFA 4YNRA 1I5QA 1GA0A 3UB7A 1LI9A 2VJWA 4JXSA 4X6TA 1BUEA 4ID4A 3OPLA 3NY4A 1E3UA 3FWLA 4R3BA 3H7WA 1NYYA 5TJJA 5C5KA 1VM1A 1K25A 3OOVA 4ETZA 3S7OA 3GTCA 3CZDA 1K4FA 2XEPA 3ZVWA 2W1TA 1OT9A 2Y91A 4DF6A 1GHPA 2JN7A 1ZG4A 5KSCA 1MZUA 4NK3A 2VA0A 1L0GA 5L07A 1G5UA 2Q9NA 3QNBA 3BQAA 3BFEA 4XXRA 4JGQA 4GS9A 5HZHA 4C75A 2QJ5A 4P6ZS 5CGWA 3ZG8B 4NXEA 1K6SA 1TF1A 1CI9A 1DP8A 5J8XA 4OQIA 3TOIA 3W4OA 1W7FA 2ZM8A 5BOHA 4WUJA 2IWCA 4CQHA 4OOLA 5J7EA 2WKPA 3DTKA 1MKMA 4ARZB 1PZOA 5HDSA 3UMEA 3L7HA 4PM8A 5IU1A 3NI9A 3W4PA 4KUOA 1YLPA 3B42A 2PT7A 2G2UA 1ZG6A 3TJZC 1TDLA 1RGZA 3AGDA 5HFOA 3ULFA 1KDSA 2A24B 2Z2MB 3LR4A 4I3IA 4S2NC 2HP6A 4GHIB 2DNSA 1ERMA 1T1AA 4BJPA 3EOIA 2FZ0A 2OV5A 1S67L 1XGIA 4MDZA 1LL8A 1F2KA 2PD8A 3BWLA 1W5DA 2PBDP 4F94A 4BL2A 2OLUA 3GDIA 2AVXA 3BECA 3OPPA 5HDDA 1XA1A 1MKIA 2ZLYA 4Y13A 2WKEA 5FQQA 2W3GA 2V1BA 5CTMA 1OMEA 5TBMA 1FSWA 2GDNA 3BYDA 2XFSA 1QMFA 2W1RA 3LY4A 2V1ZA 2OOLA 4GOGA 3UB8A 2JKFA 3MQQA 3ZCZA 4PM6A 3NBLA 1BT5A 2PU4A 5HAIA 5EVID 4RYEA 5FDHA 5CXWA 3FKVA 1YLYA 2Y2IA 1IYPA 1CEGA 1ODVA 3E4PA 3S7NA 5FQIA 4M4XA 4UHUA 1WYBA 3G2ZA 4I3AA 2W3HA 4D60A 4GZBA 4IVKA 4OLGA 4R1GA 1XX2A 4U0TA 4GLQA 3ZG7B 3V50A 2GNXA 1WA9A 4L0LA 4HOIA 3T4SA 3T4LA 3QP5A 3PR6A 4HEFA 1L0EA 4KG2A 2E8IA 5FAPA 4HJ4A 4H6JA 2V9AA 4O01A 1PYYA 3ZFZA 2W3EA 4Y2FA 1PNEA 1LSWA 4B9OA 5L09A 1E3UD 1GSWA 4Y0TA 5K5BA 3MKFA 3OPRA 1CEFA 1H8YA 3U2AA 1CQAA 5HAPA 3BJNA 3MQ0A 3ZGAB 5DTSA 2VX8A 4HNBA 4YWZA 4LV0A 4PKYG 2EX6A 4ESPA 3IF5A 3MMHA 1FSYA 3IF6C 5M19A 5FL3A 3EQUA 1FOFA 3RFBA 4BBVA 3VOZA 4WLAA 3N8LA 1NLYA 3NECA 4KZ6A 2Y2HA 2QYBA 4IUHA 1MWUA 2WZXA 1ZHHB 2Y2GA 5FAOA 3QP4A 1FCOA 4Q8IA 4JF6A 3E4OA 2EXAA 4MEZA 2M7UA 3D9YA 4RVAA 3O87A 4E3NA 2KLIA 1IYSA 4GW9A 1H5XA 3MQOA 4WM9A 4K0XA 5EE8A 4DJ2A 4B93A 1UWNX 1VETB 1Z09A 4JXVA 4EUZA 3EGDC 3CWFA 4L9GA 3JVUA 5DTTA 2XDMA 1O07A 1VB6A 2QWSA 5HAQA 5E2EA 5AJGA 4JF5A 4Y3IA 2Z6CA 2I9VA 3F1NB 5GHZA 1GA9A 4S2NA 2Q0OA 2HV1A 3B33A 5CRFA 4B4ZA 3SZTA 4S2KA 4X25A 3CI6A 1XPBA 5TBMB 3A0RA 2B95A 2A2LA 4ME4A 1NXYA 1QMEA 4XUZA 1DJCA 3HVFA 1Y54A 5GHYA 3IBRA 1M6KA 1K57C 3G6OA 1NZUA 5HARA 2PR5A 1ONGA 2BLSA 2EFXA 2Y2JA 3NOUC 1NRJA 2XFTA 4BWIA 3LEQA 1K56D 3KYEA 1IKGA 3S7PA 1IYQA 5DF8A 1PZPA 4XUXA 1P9RA 2JKRI 3CMZA 2ZM2A 2ZQ7A 4MNRA 4OOMA 4KQDA 3SH8A 5A93A 4NG2A 5F69A 3Q81A 2MJ6A 2ZOIA 4ZTKA 2C5WB 4LCLA 2ZC5B 2PAVP 1OTBA 3PAGA 1BLCA 4ZDXA 5FI6A 4CPKA 4MMNA 5DF7A 2ZBBA 4LRXC 3DTIA 4XT2A 5E2GA 5GLBA 1ACFA 1YT4A 3QP6A 1JWZA 2P08A 1I2WA 4R38A 4UQIM 4DJ3A 1XKZA 1MXOA 4ZRRA 1Q2QA 2IA2A 5L2FA 3HLWA 2Y2MA 5HPFA 3OPHA 3IHBA 1DP9A 3D3OA 3NJAA 5EM0A 5FI2A 4JGRA 1S4SA 1FR1A 3QP2A 2EFUA 3QHYA 2O0YA 1TS0A 4EXOA 1LT0A 2BTFP 2Y2PA 1YPRA 1RP5A 4X56A 2B5RA 4OQ0A 5CX7A 4H8RA 4NEED 3G35A 2P74A 2Z2LB 5HPIA 4CLCE 5HSQA 5GLCA 5DKLA 1ZTUA 3NOTC 4P6BA 4EERA 3MZEA 3T4KA 4JXWA 2ZC4B 5TFQA 3W8KA 3JYIA 1KDWA 1F9IA 3BFGA 1N9NA 3VFHA 1XJ2A 5EV0A 3QP8A 1ES5A 1ZC2A 4QU3A 3BEBA 5HW3A 1MPLA 5GHXA 3MKEA 4DN0A 4OP5A 2XK1A 5DFYA 3H82A 2G2WA 1EROA 4DXCA 1CI8A 4KG5A 5JYOA 5FQKA 3QNCA 3Q7ZA 4E3MA 2HDSA 4K91A 4QWOA 4Y15A 2J7VA 1U60A 5MC7A 3E2LA 4MLLA 2P04A 4N9LA 4FH4A 3OLOA 3P01A 2M1CA 5DFXA 4BMWA 4NXGA 2CC1A 3MZFA 1SDEA 2WYXA 3CLOA 4OPZA 1KGFA 3BFCA 3GSGA 3NC8A 2UWXA 2J3WA 2VK3A 1OTDA 5DVAA 4GDNA 2X71A 4ETXA 1RGYA 1YSQA 3PYPA 4KQOA 1Y4OA 3F1OB 1BYWA 4B88A 3CUEC 1DJAA 3CPTB 2XSSA 1K57A 1MY8A 5EUAA 1OTEA 3Q7VB 2Y8HA 2PDRA 3KO6A 4O8GA 2QPNA 3EEAA 5CTNA 5FAQA 4Y17A 2WUQA 1BZAA 2WZZA 3V67A 1T18A 4KZ3A 4R6LA 4N9KA 4RA7A 3ZNTA 2YKFA 2EX8A 4HH2A 3ZHHA 4Y5FA 1BLHA 4KZAA 1G28A 2HZ5A 2K31A 4U3TA 4XT2B 4BL3A 2RCXA 3LIAA 2FFFB 4EESA 3G31A 1EI5A 3GQZA 4R4RA 3KYQA 2A49A 3E2KA 1S1ZA 3V3RA 3MFDA 3RJUA 4JPMA 2HJEA 1MWRA 1LLBA 1K38A 3HJIA 2WKQA 5A92A 5F6AA 4I3JA 4ZBEA 5E43A 2ZMVA 3NDGA 4QY5A 4WBGA 1IFQA 5A91A 3MF0A 3SW1A 2M7VA 5A90A 3IWQA 4S2LA 1HD8A 2JKTI 2XGNA 2B18A 4OONA 3LUQA 4GB7A 1RCJA 5HD3A 3M6HA 3FZCA 5I94A 4LRZE 1YLZA 3MFXA 1YLTA 2VGLM 3RTYA 3MJQA 3LIFA 2W27A 4CJNA 3BFDA 2V1AA 3FKWA 4CLCC 1OJGA 4ZJ2A 2QZ6A 4E6WA 5M1AA 1JVJA 4LENA 4R4SA 3UNWA 2P9VA 1ONHA 4D2OA 1L0DA 4R0QA 3ZDJA 1CF0A 1HTZA 1SKOB 1K55A 4X68A 4NXFA 5HX9A 1H8ZA 1YLJA 3OCLA 1KE0A 1YLWA 4GD6A 3VE4A 1GSVA 1KVLA 1J3WA 2R78A 1DJBA 3MXRA 5EVIB 4II7A 4HQAA 5DF9A 3DBAA 2H28A 3RXWA 3IXBA 3W4QA 3BW6A 3VFFA 1K56A 4GD8A 4OP8A 3LIDA 3O86A 5F1GA 3ZVTA 3WRZA 3N8SA 3UE3A 2V20A 4HY8A 1BTLA 4LPZA 1NYMA 1Q2PA 4PKYA 1FILA 2J9PA 5HWVA 4KZ5A 3HL9A 4MBFA 4HBTA 1K54C 4QPRA 2V2FF 3T12B 4DDYA 4OPQA 1K6RA 3T50A 3HBRA 3SS3A 5EECA 1SHVA 3S22A 2VV7A 5EOEA 1F98A 3UPNA 3VP2A 2O9AA 1OTIA 5EPHA 4HIAA 4MBKA 3NIAA 2L0WA 3C38A 1YQSA 4OVDA 3BM6A 3H7WB 3N7WA 3Q07A 2WKRA 2WKIA 3IS2A 3A3IA 3HCYA 4ZJ3A 5DTKA 1VEUA 1GHMA 2W1TB 3MS6A 3A3JA 2Y2KA 3HUOA 3LFVA 4E3JA 2J8YA 3DTMA 3ZQ5A 4JF4A 2O99A 3BQ8A 4GCZA 5F5YA 2ZC7A 1DRMA 3DWZA 1PWGA 1TVFA 3IWIA 4WF0A 5EOOA 3FYZA 3VP3A 4GS9B 1ZKJA 2EA9A 2XA7S 2HJ9C 2RL3A 3AGEA 1DY6A 1EWZA 4EWFA 2IWDA 3C8CA 3GR2A 3DTEA 4KZ4A 2VGJA 3G30A 5DKKA 4OPRA 4X53A 2Y2NA 3PHYA 4DE0A 3MR0A 1T19A 3SS4A 2ZMAA 5CEDA 4EETB 1E4DA 1OPXA 5LBRA 4OKPA 4UQIS 4WEKA 4LRYC 3HLBA 3PXPA 3O5YA 5FEGA 3JVVA 1JTGA 1IOUA 1PFLA 1OJ5A 1YAXA 3WS0A 4M3KA 3DW0A 1FR6A 4ZAMA 2Y4AA 4ZJ1A 1YM1A 2Y79A 2VLGA 1D1JA 3SH7A 4IBXA 1FIKA 1D7EA 4K08A 2A3UA 3RH8B 3B47A 5F68A 3A0SA 3ZG0A 4CLCA 4WZ5C 3UE0A 4WELA 2DMWA 4GNUA 2BASA 3Q82A 3M2KA 4P85A 4Y7PA 3VSKA 4HHDA 2XH9A 5FEFA 4PMAA 4PAUA 5EVIC 3T1RA 4PM7A 1SKFA 1YMXA 1LL5A 3IX4A 1PI4A 3LR5A 1IKIA 1HLUP 3D72A 4U0XA 3WRTA 2OLVA 3UY6A 4I38A 3GMWA 3VP1A 3PBOA 3C2WA 2WADA 1XA7A 3WS2A 1N9BA 1TEMA 3M6BA 1KGGA 4BLMA 5FSRA 4R70A 4E04A 2FH5A 1AXBA 1YSPA 4HH3A 4QJGA 2OAP1 4X55A 5AQBA 2ZC6B 1W63M 5FQ9A 3G34A 4JGOA 3LCEA 2XRNA 2K2NA 3SS5A 4N1XA 2XR0A 1XXMA 4H6JB 3TRCA 4DE3A 2J9OA 1K54A 4KENB 4A5RA 2Y2QA 4DE1A 5HWTA 4Q0IA 3LR0A 1VEUB 2HGVA 4LV2A 3IX3A 3LYXA 3V39A 1LI0A 4DRTA 2V0UA 5G4ZA 3D4FA 3NCKA 4LFUA 4MN5A 1L0FA 3OBFA 3K2NA 4S2JA 1S1YA 3KSFA 4S2IA 3HLEA 3EWKA 4S2OA 5G4YA 5J3WA 4FOFA 2ZQAA 1XFQA 2HPBA 3UO9A 4MBHA 3HLGA 4G3VA 4QD4A 3HLDA 2X02A 2EXBA 3IF6A 4BENA 4RX3A 3FG8A 3JPUA 4OOYA 4WZ4A 1FQGA 3C7UA 4HBUA 4GN2A 2PR6A 4KZ8A 2V8CA 4ARZA 3SH9A 4JBFA 3A0VA 5A8BA 3C30A 5E2HA 1T1CA 4KZBA 4EUVA 1K0KA 1JTDA 4WYYA 2H0TA 2J80A 1L3LA 4MN6A 3IT9A 3EEHA 1KVMA 5TR7A 1V9YA 1WE4A 1N9LA 4IEDA 2ZQDA 4WMCA 4GHIA 1T1BA 1K4EA 4WL9A 3E98A 5FQMA 3W2ZA 4CLCD 2VEAA 1GHIA 4O7DA 1KE3A 2VGLS 1MBLA 2EWVA 3UMDA 3ZYTA 1TS6A 3PAEA 5KMWA 5U47A 4WZ5A 2R9XA 2JC7A 1IEMA 4X1MA 1FCMA 4AFIA 3CJMA 4HI4A 4Z1WA 4OQHA 3G2YA 3UDXA 5IT5A 1PIOA 1OTAA 3C4PA 4PM9A 1CJFA 3MSHA 4PHTA 1DP6A 4JXGA 3RXXA 2LB9A 3IXGA 5EM1A 3LY3A 1H8MA 1BSGA 1Z6FA 4G3WA 3E0YA 4C3QA 1G6OA 1JNUA 4BQMA 2JKGA 1VHMA 3UPPA 1KGEA 5HDCA 3LIBA 1EW0A 4X69A 5CERA 2G7UA 3G4PA 1E25A 1AWIA 1IYOA 2PYRA 5GLAA 3IWOA 2V8FA 4QHCA 3R7WA 3GVBA 1LSXA 1S6RA 2EWWA 3BY9A
chains in the Genus database with same CATH topology
5AJGA 4Y3IA 4HJ6A 3CITA 2Z6CA 4PKYA 2I9VA 2OWHA 3F1NB 2VKSA 2L1MA 5HWVA 2HV1A 3LR3A 3T4OA 3B33A 1XJ6A 4QPRA 3E4QA 4WEJA 3BY8A 3PBSA 3T50A 3CI6A 4EEPA 4HP9A 1X0OA 2VV7A 1F98A 2O9AA 1OTIA 2D01A 3CAXA 3A0RA 3H9WA 5TBMB 3LI8A 5J4EA 4HIAA 2A2LA 1P9WA 4ME4A 4R3AA 2QJ7A 2A24A 2L0WA 3C38A 4BBTA 3IBRA 3H7WB 3T4TA 3G6OA 1V9ZA 2WKRA 3IS2A 3UE6A 2PR5A 3HCYA 3NOUC 5I5LA 2PD7A 1XJ4A 4EU0A 4NKPA 3K3CA 3OC2A 4CLCB 5HL6A 1NRJA 4KUKA 4BWIA 4RQ9A 2W1TB 3LFVA 4Q0HA 2VV6A 3ZQ5A 2O99A 3BQ8A 4GCZA 5F5YA 1DRMA 3S7PA 5KSHA 2B02A 3TW8A 3TE8A 3IBJA 1MC0A 1P9RA 1TD5A 4FSFA 2JKRI 4WF0A 3KYZA 4OOMA 4KQDA 3FC7A 1TS8A 4GS9B 2VV8A 2EA9A 3VV4A 5F69A 2XA7S 2HJ9C 4BBUA 2MJ6A 2P7JA 2ZOIA 3KX0X 1XJ3A 3C8CA 2KOIA 1OTBA 4F3LA 2O9CA 3NHQA 3H82B 4MMNA 3EQVA 5DKKA 4MCWA 4EQ1A 2ZBBA 3PHYA 4LRXC 4XT2A 3MR0A 1T19A 1NWZA 2J3TD 5HD5A 4EETB 1STZA 1OPXA 2P08A 2ZMFA 5LBRA 4UQIS 4R38A 4UQIM 4WEKA 3VOLA 4LRYC 1S66L 4IUKA 4DJ3A 3PXPA 2HF6A 1F5MA 3O5YA 1H3QA 3T4QA 3JVVA 4NXBA 4ZRRA 2IA2A 3F1NA 2INWA 5HPFA 1IOUA 1OJ5A 1DP9A 1YAXA 3D3OA 3NJAA 4I39A 4JGRA 2J3TC 1S4SA 2JKRM 2O0YA 4YNRA 1TS0A 4EXOA 3UB7A 1LT0A 2Y79A 2VLGA 2VJWA 4MN7A 2NUPC 1D7EA 4K08A 1Y28A 3RH8B 3H7WA 1UGUA 3B47A 5CX7A 5TJJA 4NEED 1NLZA 5C5KA 3OOVA 4ETZA 5F68A 3A0SA 3S7OA 5HPIA 4CLCA 4CLCE 4WELA 2DMWA 5HSQA 2QHKA 1P97A 2BASA 5DKLA 2W1TA 1ZTUA 1OT9A 3NOTC 2JN7A 4HHDA 1MZUA 4EERA 3T4KA 2VA0A 4PAUA 3NOPC 3PBTA 1F9IA 3BQAA 3ICYA 1N9NA 3CUEA 3LR5A 1XJ2A 3PBNA 1UWPX 4JGQA 4GS9A 5HZHA 3OCNA 2L4RA 2QJ5A 4P6ZS 3D72A 4P6ZM 2OAQ1 2W3FA 4NXEA 1TF1A 3R7WB 4I38A 1DP8A 4DN0A 3PBOA 3C2WA 4LLOB 5DFYA 3H82A 1P0ZA 3GECA 4G3KA 2D02A 2QKPA 1N9OA 4WUJA 4CQHA 4OOLA 4R70A 5J7EA 4E04A 2WKPA 2FH5A 1GSXA 1TS7A 1MKMA 4ARZB 1YSPA 5HDSA 4HH3A 3UMEA 2OAP1 5IU1A 5MC7A 2P04A 3S7QA 1W63M 4KUOA 3OLOA 4JGOA 2W3DA 2ZOHA 2XRNA 3B42A 2PT7A 3LI9A 2K2NA 3P01A 2M1CA 5DFXA 3TJZC 3ULFA 4NXGA 4BMWA 2XROA 2A24B 3CLOA 3PBQA 4H6JB 3TRCA 3LR4A 4I3IA 4YOFA 2GX5A 4GHIB 1T1AA 2J3WA 2VZWA 3F1PA 1OTDA 4O0PA 4BJPA 3EOIA 5HWTA 4Q0IA 4JGPA 2FZ0A 3LR0A 4ETXA 1YSQA 2HGVA 1W63Q 2K7SA 1S67L 3PYPA 4KQOA 4MDZA 3KSIA 1LL8A 3F1OB 3LYXA 1BYWA 2PD8A 3BWLA 2JHEA 3UB6A 3CUEC 3GDIA 2XSSA 2V0UA 5G4ZA 5HDDA 1S4RA 4MN5A 2PYPA 1OTEA 2CMNA 3LIEA 1XFNA 2Y8HA 2PDRA 3KO6A 5DJUA 3OBFA 4O8GA 3EEAA 3K2NA 2W3GA 2V0WA 2JKTM 1S1YA 3R4KA 3KSFA 2V1BA 3V67A 5TBMA 1T18A 4R6LA 3EWKA 5G4YA 5J3WA 2NUTC 4FOFA 2YKFA 2W1RA 1XFQA 2OOLA 4HH2A 4F3LB 3MXQA 3UB8A 3MQQA 2PHYA 4G3VA 4Y5FA 2GJ3A 5L8MA 1G28A 2K31A 4XT2B 5DJTA 3FG8A 3LIAA 1ODVA 3E4PA 3S7NA 4EESA 4M4XA 3KYQA 4IJGA 3VE3A 3LICA 4I3AA 1S1ZA 2PR6A 2W3HA 3P7NA 3KSGA 2HJEA 3UB9A 4ARZA 4Q0JA 3A0VA 3HJIA 4HJ3A 2WKQA 5A8BA 4GLQA 2GNXA 1WA9A 3C30A 4L0LA 3FPVA 4HOIA 1T1CA 3FPWA 4DMZA 5F6AA 3PBRA 3T4SA 4EUVA 4EW7A 3T4LA 3PR6A 4I3JA 2ZMVA 4L9EA 4IHQA 2J80A 4GJ4A 1IFQA 4MN6A 4HJ4A 4H6JA 2V9AA 4O01A 2W3EA 4Y2FA 3EEHA 3MF0A 1V9YA 1N9LA 1LSWA 3SW1A 4B9OA 2W0NA 4GHIA 2M7VA 1GSWA 1T1BA 3EGXC 2KX6A 4WL9A 3E98A 5K5BA 1D06A 2JKTI 3U2AA 2B18A 3F1OA 5IS1A 3LUQA 3BJNA 3W2ZA 3MQ0A 4CLCD 5HD3A 2VEAA 2VX8A 4HNBA 4YWZA 4I5SA 4HP4A 4PKYG 4LRZE 2LB5A 2OWJA 3MFXA 2VGLS 3MMHA 2VGLM 2EWVA 3RTYA 3MJQA 3UMDA 4EEUA 2GZAA 3ZYTA 3LIFA 1TS6A 5FL3A 3EQUA 2W27A 2KDKA 1YKDA 4CLCC 2V1AA 1OJGA 3IS2B 2XA7M 3RFBA 4AFIA 4BBVA 4WLAA 1NLYA 4HI4A 4Z1WA 5IT5A 3K3DA 5HWWA 1OTAA 1LSVA 5KIZA 2QYBA 3KSHA 4PHTA 3T4JA 4IUHA 1DP6A 4NXFA 1ZHHB 2LB9A 2YKHA 1H8MA 3E4OA 3E0YA 4G3WA 5AVEA 3OCLA 1G6OA 2M7UA 1JNUA 1VHMA 3VE4A 5AVFA 2KLIA 1GSVA 4L9FA 4GW9A 2R78A 3MQOA 4WN5A 5HDCA 3LIBA 5EFWA 1EW0A 2G7UA 4II7A 2O9BA 4DJ2A 4B93A 1UWNX 4HQAA 5DF9A 3HJKA 3DBAA 2H28A 2PYRA 3EGDC 3CWFA 3BW6A 4L9GA 3JVUA 1OT6A 3LIDA 4UEYA 1KOUA 3R7WA 3F1PB 3UE3A 1LSXA 2EWWA 2Z6DA 4HY8A 1VB6A 2QWSA 3BY9A 4LPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJ6 A;  2Z6C A;  4PKY A;  2I9V A;  2OWH A;  3F1N B;  2L1M A;  5HWV A;  2HV1 A;  3B33 A;  1XJ6 A;  3E4Q A;  3BY8 A;  3T50 A;  4EEP A;  4HP9 A;  1X0O A;  2VV7 A;  1F98 A;  3H9W A;  1OTI A;  2D01 A;  3CAX A;  3A0R A;  5TBM B;  3LI8 A;  5J4E A;  4HIA A;  4R3A A;  2QJ7 A;  2A24 A;  2L0W A;  4BBT A;  3IBR A;  3H7W B;  3G6O A;  1V9Z A;  2WKR A;  3IS2 A;  3UE6 A;  2PR5 A;  3NOU C;  5I5L A;  2PD7 A;  1XJ4 A;  3K3C A;  4KUK A;  4RQ9 A;  2VV6 A;  3ZQ5 A;  4GCZ A;  5F5Y A;  1DRM A;  2B02 A;  4WF0 A;  4KQD A;  3FC7 A;  1TS8 A;  4GS9 B;  2VV8 A;  2EA9 A;  5F69 A;  4BBU A;  2P7J A;  2ZOI A;  3KX0 X;  1XJ3 A;  3C8C A;  1OTB A;  4F3L A;  3NHQ A;  3H82 B;  5DKK A;  4EQ1 A;  2ZBB A;  3PHY A;  4LRX C;  4XT2 A;  3MR0 A;  1T19 A;  1NWZ A;  5HD5 A;  4EET B;  4R38 A;  3VOL A;  4LRY C;  1S66 L;  4DJ3 A;  4NXB A;  3F1N A;  2INW A;  1OJ5 A;  1DP9 A;  3NJA A;  4I39 A;  4JGR A;  1S4S A;  1TS0 A;  4EXO A;  3UB7 A;  1LT0 A;  2VLG A;  1D7E A;  4K08 A;  1Y28 A;  3RH8 B;  3H7W A;  1UGU A;  5F68 A;  3A0S A;  5HSQ A;  2QHK A;  1P97 A;  2BAS A;  5DKL A;  1OT9 A;  3NOT C;  2JN7 A;  4HHD A;  1MZU A;  4EER A;  3NOP C;  1F9I A;  3ICY A;  1N9N A;  1XJ2 A;  1UWP X;  4JGQ A;  4GS9 A;  5HZH A;  2L4R A;  2QJ5 A;  3D72 A;  4NXE A;  4I38 A;  1DP8 A;  3C2W A;  4LLO B;  3H82 A;  1P0Z A;  3GEC A;  2D02 A;  2QKP A;  1N9O A;  4WUJ A;  4R70 A;  5J7E A;  4E04 A;  2WKP A;  1GSX A;  1TS7 A;  5HDS A;  4HH3 A;  3UME A;  5IU1 A;  4KUO A;  3OLO A;  4JGO A;  2ZOH A;  3LI9 A;  2M1C A;  3ULF A;  4NXG A;  2A24 B;  3CLO A;  4H6J B;  4I3I A;  4GHI B;  1T1A A;  3F1P A;  1OTD A;  5HWT A;  4JGP A;  2K7S A;  3PYP A;  1S67 L;  1LL8 A;  3F1O B;  3LYX A;  1BYW A;  2PD8 A;  3BWL A;  2JHE A;  3UB6 A;  3GDI A;  2V0U A;  5G4Z A;  5HDD A;  1S4R A;  4MN5 A;  2PYP A;  1OTE A;  2CMN A;  3LIE A;  1XFN A;  5DJU A;  2PDR A;  2V0W A;  1S1Y A;  2V1B A;  5TBM A;  1T18 A;  4R6L A;  3EWK A;  5G4Y A;  5J3W A;  2YKF A;  1XFQ A;  2OOL A;  4HH2 A;  4F3L B;  3MXQ A;  3UB8 A;  3MQQ A;  2PHY A;  2GJ3 A;  1G28 A;  4XT2 B;  5DJT A;  3FG8 A;  3LIA A;  1ODV A;  3E4P A;  4EES A;  4M4X A;  3VE3 A;  3LIC A;  4I3A A;  1S1Z A;  2PR6 A;  3P7N A;  3UB9 A;  3A0V A;  3HJI A;  4HJ3 A;  2WKQ A;  5A8B A;  1WA9 A;  4HOI A;  1T1C A;  5F6A A;  4EW7 A;  4I3J A;  4L9E A;  2J80 A;  4MN6 A;  4HJ4 A;  4H6J A;  2V9A A;  3EEH A;  1V9Y A;  1N9L A;  1LSW A;  3SW1 A;  4B9O A;  2W0N A;  4GHI A;  1GSW A;  1T1B A;  2KX6 A;  4WL9 A;  1D06 A;  3F1O A;  5IS1 A;  3LUQ A;  5HD3 A;  2VEA A;  4HNB A;  4YWZ A;  4I5S A;  4HP4 A;  4PKY G;  4LRZ E;  2OWJ A;  3MFX A;  3RTY A;  3MJQ A;  3UMD A;  4EEU A;  3LIF A;  1TS6 A;  2W27 A;  2KDK A;  2V1A A;  1OJG A;  3IS2 B;  4BBV A;  4WLA A;  4HI4 A;  3K3D A;  5HWW A;  1OTA A;  1LSV A;  5KIZ A;  1DP6 A;  4NXF A;  2YKH A;  3E4O A;  5AVE A;  1JNU A;  3VE4 A;  5AVF A;  1GSV A;  4L9F A;  4GW9 A;  2R78 A;  3MQO A;  4WN5 A;  5HDC A;  3LIB A;  5EFW A;  1EW0 A;  4DJ2 A;  1UWN X;  4HQA A;  3HJK A;  2H28 A;  2PYR A;  3CWF A;  4L9G A;  1OT6 A;  3LID A;  1KOU A;  3F1P B;  1LSX A;  2Z6D A;  4HY8 A;  1VB6 A;  2QWS A;  3BY9 A;  4LPZ A; 
#chains in the Genus database with same CATH topology
 1A0K A;  4LV3 A;  3BLM A;  3C4O A;  3MXS A;  2OWH A;  2EX2 A;  3VP4 A;  2L1M A;  3OZH A;  5CGX A;  2XD5 A;  3T4O A;  2WGI A;  5CEC A;  3E4Q A;  4WEJ A;  3BY8 A;  3CG5 A;  1O7E A;  2ZJ9 A;  4GDB A;  4EEP A;  4HP9 A;  1X0O A;  4E3K A;  3H9W A;  2D01 A;  3LI8 A;  5J4E A;  4R3A A;  2Y55 A;  4KZ7 A;  4B4X A;  3LGO A;  5E2F A;  2C6W B;  3T4T A;  4E3O A;  4IVI A;  3BRM A;  3IF6 B;  2PD7 A;  4EU0 A;  3OC2 A;  1CK3 A;  1PWD A;  3TG9 A;  5HL6 A;  4OLD A;  2E8J A;  1SCW A;  4Q0H A;  2HP9 A;  2VV6 A;  4KG6 A;  2B02 A;  3IBJ A;  3T1X A;  4FSF A;  3O88 A;  3IH9 A;  1SDN A;  3KYZ A;  3FC7 A;  1TS8 A;  2VV8 A;  3S4X A;  1WYC A;  3VV4 A;  4BBU A;  2P7J A;  4FCF A;  4EBN A;  3KX0 X;  1XJ3 A;  2PU2 A;  5GLD A;  3NDE A;  4F3L A;  2O9C A;  1VET A;  3NHQ A;  3H82 B;  2JBF A;  4UA6 A;  4EQ1 A;  1PW1 A;  3VMA A;  5HD5 A;  4WMC D;  1STZ A;  3WS1 A;  1C3B A;  3P98 A;  1S66 L;  4IUK A;  2Q9M A;  2HF6 A;  1F5M A;  1H3Q A;  4N92 A;  1I2S A;  2I72 A;  3F1N A;  3LEZ A;  2Y2O A;  5TGF A;  1VQQ A;  3VSL A;  1MWS A;  4HES A;  1GCE A;  2J3T C;  2ZQC A;  4LV1 A;  2JCH A;  2FFY A;  1PI5 A;  3IQA A;  1JWP A;  1NZO A;  3HUM A;  4MN7 A;  3NUL A;  1MWT A;  1BUL A;  3T1S A;  2NUP C;  1Y28 A;  5FI7 A;  1UGU A;  1YMS A;  1NLZ A;  4FUW A;  2WGW A;  3WWX A;  2QHK A;  1P97 A;  5G18 A;  5AQ7 A;  2X01 A;  3O3V A;  5FDS A;  3NOP C;  2DRW A;  2H5S A;  4P0M A;  2DCF A;  3PBT A;  2HDU A;  3ICY A;  3CUE A;  3PBN A;  1UWP X;  4R3J A;  3OCN A;  2L4R A;  4P6Z M;  2OAQ 1;  1W8Q A;  2W3F A;  3GV9 A;  3R7W B;  3UDF A;  1IEL A;  3BLS A;  4K0W A;  4LLO B;  3IHA A;  1P0Z A;  3GEC A;  4G3K A;  4UA9 A;  2D02 A;  2QKP A;  3C7V A;  1N9O A;  4KQR A;  4DKI A;  2XLN A;  1BLS A;  4EQI A;  3VP0 A;  1GSX A;  1TS7 A;  4E3I A;  1J9M A;  3S7Q A;  4X1L A;  3IX8 A;  5F1F A;  2W3D A;  2ZOH A;  2WKH A;  5JYP A;  3LI9 A;  5CGS A;  2XRO A;  3PBQ A;  1ESU A;  1ES4 A;  4YOF A;  1TDG A;  2GX5 A;  2WAF A;  4QY6 A;  5EVL A;  2JE5 A;  2VZW A;  3F1P A;  4O0P A;  5F83 A;  4JGP A;  4E3L A;  2K7S A;  4KQQ A;  1W63 Q;  4UAA A;  3KSI A;  1ESI A;  4RX2 A;  3MZD A;  2JHE A;  3ZG5 A;  4GKU A;  2XQZ A;  3UB6 A;  1G68 A;  4E6X A;  4BD1 A;  1ALQ A;  1ERQ A;  1S4R A;  2HP5 A;  2PYP A;  2CMN A;  3LIE A;  1XFN A;  5DJU A;  4EBP A;  3ITA A;  2ZQ9 A;  2V0W A;  4LGW A;  2JKT M;  3V3S A;  3R4K A;  1S0W A;  4QB8 A;  2NUT C;  2P9V B;  4F3L B;  3MXQ A;  4DDS A;  4YIN A;  2PHY A;  2Y59 A;  2GJ3 A;  5L8M A;  1M40 A;  1LHY A;  3L9K A;  3UE1 A;  5DJT A;  4S2P A;  4IJG A;  3VE3 A;  3G32 A;  3LIC A;  4R23 A;  1W8Y A;  3N4I A;  4N1H A;  2HDR A;  3P7N A;  4Y0U A;  3KSG A;  3WS5 A;  4YFM A;  3GRJ A;  4NET A;  3UB9 A;  3CHW P;  4HJ3 A;  4Q0J A;  1NY0 A;  2HDQ A;  4S2M A;  3A3F A;  1BLP A;  5CHJ A;  3FPV A;  3FPW A;  5FAS A;  4DMZ A;  3PBR A;  4EW7 A;  1PRQ A;  1FCN A;  1PWC A;  4L9E A;  1H0M A;  3S1Y A;  4DXB A;  4IHQ A;  4GJ4 A;  2PBY A;  2ZL1 A;  3DAV A;  5L10 A;  3FV7 A;  2W0N A;  3EGX C;  2KX6 A;  1D06 A;  2WGW B;  3UB5 P;  3F1O A;  5IS1 A;  4PM5 A;  3PTE A;  4I5S A;  4HP4 A;  3CPT A;  3TSG A;  2LB5 A;  2OWJ A;  2H0Y A;  3IXD A;  4EEU A;  2GZA A;  3Q7V A;  4FTX A;  4LCM A;  4OPY A;  2KDK A;  1YKD A;  3IS2 B;  2ACG A;  2XA7 M;  3HLF A;  3HUN A;  1ES2 A;  2Y2L A;  2ZM0 A;  4PPR A;  4DE2 A;  3K3D A;  5HWW A;  1LSV A;  5KIZ A;  2PRF A;  5CHU A;  3KSH A;  3T4J A;  5IHV A;  2H10 A;  1W79 A;  2YKH A;  3Q1F A;  3ISG A;  5AVE A;  4OQG A;  2ZD8 A;  5FAT A;  3MBZ A;  1LL9 A;  2BG1 A;  5AVF A;  4KZ9 A;  4L9F A;  5AQA A;  3ZG9 B;  5AQ9 A;  3IH8 A;  4WN5 A;  4FD8 A;  5EFW A;  4C6Y A;  1HZO A;  2O9B A;  1G6A A;  2UV0 E;  2IWB A;  3HJK A;  2XD1 A;  3SOI A;  5F82 A;  2WAE A;  5CHM A;  4UEY A;  1OT6 A;  1KOU A;  4OH0 A;  3N8R A;  1XGJ A;  2R9W A;  3F1P B;  5FA7 A;  4BD0 A;  2Z6D A;  3BFF A;  3IXH A;  4HJ6 A;  3CIT A;  3QP1 A;  4UA7 A;  3ITB A;  1L2S A;  4P87 A;  2VKS A;  3LR3 A;  1XJ6 A;  3DWK A;  3PBS A;  3M2J A;  1XP4 A;  2EX9 A;  3P09 A;  4IBR A;  5CEB A;  3CAX A;  1SZV A;  3LO7 A;  1JWV A;  1K55 C;  1P9W A;  3AGF A;  2QJ7 A;  2A24 A;  4BBT A;  5GL9 A;  3T1Q B;  1V9Z A;  3UE6 A;  2OSU A;  2XF3 A;  5I5L A;  1XJ4 A;  4NKP A;  2QMI A;  3K3C A;  4CLC B;  4JKT A;  4KUK A;  4EV4 A;  4RQ9 A;  3A3E A;  1SKO A;  1PW8 A;  5EVE A;  5KSH A;  3U4L P;  3TW8 A;  3TE8 A;  3N6I A;  1MC0 A;  3I7J A;  1TD5 A;  5KZH A;  3ZNY A;  4Z9Q A;  3HLC A;  1NRF A;  3UDI A;  2ZQ8 A;  5D3O A;  3HRE A;  5HL1 A;  3VOY A;  4EBL A;  2KOI A;  3C5A A;  5EVI A;  4FH2 A;  1NJ4 A;  3EQV A;  1N4O A;  4MCW A;  2ZL1 B;  5FQJ A;  1HVB A;  1KE4 A;  2VGK A;  4Y0O A;  1NWZ A;  2ZC3 B;  2J3T D;  3B3X A;  1ES3 A;  2ZMF A;  3A3D A;  3VOL A;  3T4Q A;  3UPO A;  4NXB A;  3V5M A;  5M18 A;  2INW A;  2WGV A;  3WS4 A;  4I39 A;  2WK0 A;  2JKR M;  3UN7 A;  4JLF A;  4YNR A;  1I5Q A;  1GA0 A;  3UB7 A;  1LI9 A;  2VJW A;  4JXS A;  4X6T A;  1BUE A;  4ID4 A;  3OPL A;  3NY4 A;  1E3U A;  3FWL A;  4R3B A;  3H7W A;  1NYY A;  5TJJ A;  5C5K A;  1VM1 A;  1K25 A;  3OOV A;  4ETZ A;  3S7O A;  3GTC A;  3CZD A;  1K4F A;  2XEP A;  3ZVW A;  2W1T A;  1OT9 A;  2Y91 A;  4DF6 A;  1GHP A;  2JN7 A;  1ZG4 A;  5KSC A;  1MZU A;  4NK3 A;  2VA0 A;  1L0G A;  5L07 A;  1G5U A;  2Q9N A;  3QNB A;  3BQA A;  3BFE A;  4XXR A;  4JGQ A;  4GS9 A;  5HZH A;  4C75 A;  2QJ5 A;  4P6Z S;  5CGW A;  3ZG8 B;  4NXE A;  1K6S A;  1TF1 A;  1CI9 A;  1DP8 A;  5J8X A;  4OQI A;  3TOI A;  3W4O A;  1W7F A;  2ZM8 A;  5BOH A;  4WUJ A;  2IWC A;  4CQH A;  4OOL A;  5J7E A;  2WKP A;  3DTK A;  1MKM A;  4ARZ B;  1PZO A;  5HDS A;  3UME A;  3L7H A;  4PM8 A;  5IU1 A;  3NI9 A;  3W4P A;  4KUO A;  1YLP A;  3B42 A;  2PT7 A;  2G2U A;  1ZG6 A;  3TJZ C;  1TDL A;  1RGZ A;  3AGD A;  5HFO A;  3ULF A;  1KDS A;  2A24 B;  2Z2M B;  3LR4 A;  4I3I A;  4S2N C;  2HP6 A;  4GHI B;  2DNS A;  1ERM A;  1T1A A;  4BJP A;  3EOI A;  2FZ0 A;  2OV5 A;  1S67 L;  1XGI A;  4MDZ A;  1LL8 A;  1F2K A;  2PD8 A;  3BWL A;  1W5D A;  2PBD P;  4F94 A;  4BL2 A;  2OLU A;  3GDI A;  2AVX A;  3BEC A;  3OPP A;  5HDD A;  1XA1 A;  1MKI A;  2ZLY A;  4Y13 A;  2WKE A;  5FQQ A;  2W3G A;  2V1B A;  5CTM A;  1OME A;  5TBM A;  1FSW A;  2GDN A;  3BYD A;  2XFS A;  1QMF A;  2W1R A;  3LY4 A;  2V1Z A;  2OOL A;  4GOG A;  3UB8 A;  2JKF A;  3MQQ A;  3ZCZ A;  4PM6 A;  3NBL A;  1BT5 A;  2PU4 A;  5HAI A;  5EVI D;  4RYE A;  5FDH A;  5CXW A;  3FKV A;  1YLY A;  2Y2I A;  1IYP A;  1CEG A;  1ODV A;  3E4P A;  3S7N A;  5FQI A;  4M4X A;  4UHU A;  1WYB A;  3G2Z A;  4I3A A;  2W3H A;  4D60 A;  4GZB A;  4IVK A;  4OLG A;  4R1G A;  1XX2 A;  4U0T A;  4GLQ A;  3ZG7 B;  3V50 A;  2GNX A;  1WA9 A;  4L0L A;  4HOI A;  3T4S A;  3T4L A;  3QP5 A;  3PR6 A;  4HEF A;  1L0E A;  4KG2 A;  2E8I A;  5FAP A;  4HJ4 A;  4H6J A;  2V9A A;  4O01 A;  1PYY A;  3ZFZ A;  2W3E A;  4Y2F A;  1PNE A;  1LSW A;  4B9O A;  5L09 A;  1E3U D;  1GSW A;  4Y0T A;  5K5B A;  3MKF A;  3OPR A;  1CEF A;  1H8Y A;  3U2A A;  1CQA A;  5HAP A;  3BJN A;  3MQ0 A;  3ZGA B;  5DTS A;  2VX8 A;  4HNB A;  4YWZ A;  4LV0 A;  4PKY G;  2EX6 A;  4ESP A;  3IF5 A;  3MMH A;  1FSY A;  3IF6 C;  5M19 A;  5FL3 A;  3EQU A;  1FOF A;  3RFB A;  4BBV A;  3VOZ A;  4WLA A;  3N8L A;  1NLY A;  3NEC A;  4KZ6 A;  2Y2H A;  2QYB A;  4IUH A;  1MWU A;  2WZX A;  1ZHH B;  2Y2G A;  5FAO A;  3QP4 A;  1FCO A;  4Q8I A;  4JF6 A;  3E4O A;  2EXA A;  4MEZ A;  2M7U A;  3D9Y A;  4RVA A;  3O87 A;  4E3N A;  2KLI A;  1IYS A;  4GW9 A;  1H5X A;  3MQO A;  4WM9 A;  4K0X A;  5EE8 A;  4DJ2 A;  4B93 A;  1UWN X;  1VET B;  1Z09 A;  4JXV A;  4EUZ A;  3EGD C;  3CWF A;  4L9G A;  3JVU A;  5DTT A;  2XDM A;  1O07 A;  1VB6 A;  2QWS A;  5HAQ A;  5E2E A;  5AJG A;  4JF5 A;  4Y3I A;  2Z6C A;  2I9V A;  3F1N B;  5GHZ A;  1GA9 A;  4S2N A;  2Q0O A;  2HV1 A;  3B33 A;  5CRF A;  4B4Z A;  3SZT A;  4S2K A;  4X25 A;  3CI6 A;  1XPB A;  5TBM B;  3A0R A;  2B95 A;  2A2L A;  4ME4 A;  1NXY A;  1QME A;  4XUZ A;  1DJC A;  3HVF A;  1Y54 A;  5GHY A;  3IBR A;  1M6K A;  1K57 C;  3G6O A;  1NZU A;  5HAR A;  2PR5 A;  1ONG A;  2BLS A;  2EFX A;  2Y2J A;  3NOU C;  1NRJ A;  2XFT A;  4BWI A;  3LEQ A;  1K56 D;  3KYE A;  1IKG A;  3S7P A;  1IYQ A;  5DF8 A;  1PZP A;  4XUX A;  1P9R A;  2JKR I;  3CMZ A;  2ZM2 A;  2ZQ7 A;  4MNR A;  4OOM A;  4KQD A;  3SH8 A;  5A93 A;  4NG2 A;  5F69 A;  3Q81 A;  2MJ6 A;  2ZOI A;  4ZTK A;  2C5W B;  4LCL A;  2ZC5 B;  2PAV P;  1OTB A;  3PAG A;  1BLC A;  4ZDX A;  5FI6 A;  4CPK A;  4MMN A;  5DF7 A;  2ZBB A;  4LRX C;  3DTI A;  4XT2 A;  5E2G A;  5GLB A;  1ACF A;  1YT4 A;  3QP6 A;  1JWZ A;  2P08 A;  1I2W A;  4R38 A;  4UQI M;  4DJ3 A;  1XKZ A;  1MXO A;  4ZRR A;  1Q2Q A;  2IA2 A;  5L2F A;  3HLW A;  2Y2M A;  5HPF A;  3OPH A;  3IHB A;  1DP9 A;  3D3O A;  3NJA A;  5EM0 A;  5FI2 A;  4JGR A;  1S4S A;  1FR1 A;  3QP2 A;  2EFU A;  3QHY A;  2O0Y A;  1TS0 A;  4EXO A;  1LT0 A;  2BTF P;  2Y2P A;  1YPR A;  1RP5 A;  4X56 A;  2B5R A;  4OQ0 A;  5CX7 A;  4H8R A;  4NEE D;  3G35 A;  2P74 A;  2Z2L B;  5HPI A;  4CLC E;  5HSQ A;  5GLC A;  5DKL A;  1ZTU A;  3NOT C;  4P6B A;  4EER A;  3MZE A;  3T4K A;  4JXW A;  2ZC4 B;  5TFQ A;  3W8K A;  3JYI A;  1KDW A;  1F9I A;  3BFG A;  1N9N A;  3VFH A;  1XJ2 A;  5EV0 A;  3QP8 A;  1ES5 A;  1ZC2 A;  4QU3 A;  3BEB A;  5HW3 A;  1MPL A;  5GHX A;  3MKE A;  4DN0 A;  4OP5 A;  2XK1 A;  5DFY A;  3H82 A;  2G2W A;  1ERO A;  4DXC A;  1CI8 A;  4KG5 A;  5JYO A;  5FQK A;  3QNC A;  3Q7Z A;  4E3M A;  2HDS A;  4K91 A;  4QWO A;  4Y15 A;  2J7V A;  1U60 A;  5MC7 A;  3E2L A;  4MLL A;  2P04 A;  4N9L A;  4FH4 A;  3OLO A;  3P01 A;  2M1C A;  5DFX A;  4BMW A;  4NXG A;  2CC1 A;  3MZF A;  1SDE A;  2WYX A;  3CLO A;  4OPZ A;  1KGF A;  3BFC A;  3GSG A;  3NC8 A;  2UWX A;  2J3W A;  2VK3 A;  1OTD A;  5DVA A;  4GDN A;  2X71 A;  4ETX A;  1RGY A;  1YSQ A;  3PYP A;  4KQO A;  1Y4O A;  3F1O B;  1BYW A;  4B88 A;  3CUE C;  1DJA A;  3CPT B;  2XSS A;  1K57 A;  1MY8 A;  5EUA A;  1OTE A;  3Q7V B;  2Y8H A;  2PDR A;  3KO6 A;  4O8G A;  2QPN A;  3EEA A;  5CTN A;  5FAQ A;  4Y17 A;  2WUQ A;  1BZA A;  2WZZ A;  3V67 A;  1T18 A;  4KZ3 A;  4R6L A;  4N9K A;  4RA7 A;  3ZNT A;  2YKF A;  2EX8 A;  4HH2 A;  3ZHH A;  4Y5F A;  1BLH A;  4KZA A;  1G28 A;  2HZ5 A;  2K31 A;  4U3T A;  4XT2 B;  4BL3 A;  2RCX A;  3LIA A;  2FFF B;  4EES A;  3G31 A;  1EI5 A;  3GQZ A;  4R4R A;  3KYQ A;  2A49 A;  3E2K A;  1S1Z A;  3V3R A;  3MFD A;  3RJU A;  4JPM A;  2HJE A;  1MWR A;  1LLB A;  1K38 A;  3HJI A;  2WKQ A;  5A92 A;  5F6A A;  4I3J A;  4ZBE A;  5E43 A;  2ZMV A;  3NDG A;  4QY5 A;  4WBG A;  1IFQ A;  5A91 A;  3MF0 A;  3SW1 A;  2M7V A;  5A90 A;  3IWQ A;  4S2L A;  1HD8 A;  2JKT I;  2XGN A;  2B18 A;  4OON A;  3LUQ A;  4GB7 A;  1RCJ A;  5HD3 A;  3M6H A;  3FZC A;  5I94 A;  4LRZ E;  1YLZ A;  3MFX A;  1YLT A;  2VGL M;  3RTY A;  3MJQ A;  3LIF A;  2W27 A;  4CJN A;  3BFD A;  2V1A A;  3FKW A;  4CLC C;  1OJG A;  4ZJ2 A;  2QZ6 A;  4E6W A;  5M1A A;  1JVJ A;  4LEN A;  4R4S A;  3UNW A;  2P9V A;  1ONH A;  4D2O A;  1L0D A;  4R0Q A;  3ZDJ A;  1CF0 A;  1HTZ A;  1SKO B;  1K55 A;  4X68 A;  4NXF A;  5HX9 A;  1H8Z A;  1YLJ A;  3OCL A;  1KE0 A;  1YLW A;  4GD6 A;  3VE4 A;  1GSV A;  1KVL A;  1J3W A;  2R78 A;  1DJB A;  3MXR A;  5EVI B;  4II7 A;  4HQA A;  5DF9 A;  3DBA A;  2H28 A;  3RXW A;  3IXB A;  3W4Q A;  3BW6 A;  3VFF A;  1K56 A;  4GD8 A;  4OP8 A;  3LID A;  3O86 A;  5F1G A;  3ZVT A;  3WRZ A;  3N8S A;  3UE3 A;  2V20 A;  4HY8 A;  1BTL A;  4LPZ A;  1NYM A;  1Q2P A;  4PKY A;  1FIL A;  2J9P A;  5HWV A;  4KZ5 A;  3HL9 A;  4MBF A;  4HBT A;  1K54 C;  4QPR A;  2V2F F;  3T12 B;  4DDY A;  4OPQ A;  1K6R A;  3T50 A;  3HBR A;  3SS3 A;  5EEC A;  1SHV A;  3S22 A;  2VV7 A;  5EOE A;  1F98 A;  3UPN A;  3VP2 A;  2O9A A;  1OTI A;  5EPH A;  4HIA A;  4MBK A;  3NIA A;  2L0W A;  3C38 A;  1YQS A;  4OVD A;  3BM6 A;  3H7W B;  3N7W A;  3Q07 A;  2WKR A;  2WKI A;  3IS2 A;  3A3I A;  3HCY A;  4ZJ3 A;  5DTK A;  1VEU A;  1GHM A;  2W1T B;  3MS6 A;  3A3J A;  2Y2K A;  3HUO A;  3LFV A;  4E3J A;  2J8Y A;  3DTM A;  3ZQ5 A;  4JF4 A;  2O99 A;  3BQ8 A;  4GCZ A;  5F5Y A;  2ZC7 A;  1DRM A;  3DWZ A;  1PWG A;  1TVF A;  3IWI A;  4WF0 A;  5EOO A;  3FYZ A;  3VP3 A;  4GS9 B;  1ZKJ A;  2EA9 A;  2XA7 S;  2HJ9 C;  2RL3 A;  3AGE A;  1DY6 A;  1EWZ A;  4EWF A;  2IWD A;  3C8C A;  3GR2 A;  3DTE A;  4KZ4 A;  2VGJ A;  3G30 A;  5DKK A;  4OPR A;  4X53 A;  2Y2N A;  3PHY A;  4DE0 A;  3MR0 A;  1T19 A;  3SS4 A;  2ZMA A;  5CED A;  4EET B;  1E4D A;  1OPX A;  5LBR A;  4OKP A;  4UQI S;  4WEK A;  4LRY C;  3HLB A;  3PXP A;  3O5Y A;  5FEG A;  3JVV A;  1JTG A;  1IOU A;  1PFL A;  1OJ5 A;  1YAX A;  3WS0 A;  4M3K A;  3DW0 A;  1FR6 A;  4ZAM A;  2Y4A A;  4ZJ1 A;  1YM1 A;  2Y79 A;  2VLG A;  1D1J A;  3SH7 A;  4IBX A;  1FIK A;  1D7E A;  4K08 A;  2A3U A;  3RH8 B;  3B47 A;  5F68 A;  3A0S A;  3ZG0 A;  4CLC A;  4WZ5 C;  3UE0 A;  4WEL A;  2DMW A;  4GNU A;  2BAS A;  3Q82 A;  3M2K A;  4P85 A;  4Y7P A;  3VSK A;  4HHD A;  2XH9 A;  5FEF A;  4PMA A;  4PAU A;  5EVI C;  3T1R A;  4PM7 A;  1SKF A;  1YMX A;  1LL5 A;  3IX4 A;  1PI4 A;  3LR5 A;  1IKI A;  1HLU P;  3D72 A;  4U0X A;  3WRT A;  2OLV A;  3UY6 A;  4I38 A;  3GMW A;  3VP1 A;  3PBO A;  3C2W A;  2WAD A;  1XA7 A;  3WS2 A;  1N9B A;  1TEM A;  3M6B A;  1KGG A;  4BLM A;  5FSR A;  4R70 A;  4E04 A;  2FH5 A;  1AXB A;  1YSP A;  4HH3 A;  4QJG A;  2OAP 1;  4X55 A;  5AQB A;  2ZC6 B;  1W63 M;  5FQ9 A;  3G34 A;  4JGO A;  3LCE A;  2XRN A;  2K2N A;  3SS5 A;  4N1X A;  2XR0 A;  1XXM A;  4H6J B;  3TRC A;  4DE3 A;  2J9O A;  1K54 A;  4KEN B;  4A5R A;  2Y2Q A;  4DE1 A;  5HWT A;  4Q0I A;  3LR0 A;  1VEU B;  2HGV A;  4LV2 A;  3IX3 A;  3LYX A;  3V39 A;  1LI0 A;  4DRT A;  2V0U A;  5G4Z A;  3D4F A;  3NCK A;  4LFU A;  4MN5 A;  1L0F A;  3OBF A;  3K2N A;  4S2J A;  1S1Y A;  3KSF A;  4S2I A;  3HLE A;  3EWK A;  4S2O A;  5G4Y A;  5J3W A;  4FOF A;  2ZQA A;  1XFQ A;  2HPB A;  3UO9 A;  4MBH A;  3HLG A;  4G3V A;  4QD4 A;  3HLD A;  2X02 A;  2EXB A;  3IF6 A;  4BEN A;  4RX3 A;  3FG8 A;  3JPU A;  4OOY A;  4WZ4 A;  1FQG A;  3C7U A;  4HBU A;  4GN2 A;  2PR6 A;  4KZ8 A;  2V8C A;  4ARZ A;  3SH9 A;  4JBF A;  3A0V A;  5A8B A;  3C30 A;  5E2H A;  1T1C A;  4KZB A;  4EUV A;  1K0K A;  1JTD A;  4WYY A;  2H0T A;  2J80 A;  1L3L A;  4MN6 A;  3IT9 A;  3EEH A;  1KVM A;  5TR7 A;  1V9Y A;  1WE4 A;  1N9L A;  4IED A;  2ZQD A;  4WMC A;  4GHI A;  1T1B A;  1K4E A;  4WL9 A;  3E98 A;  5FQM A;  3W2Z A;  4CLC D;  2VEA A;  1GHI A;  4O7D A;  1KE3 A;  2VGL S;  1MBL A;  2EWV A;  3UMD A;  3ZYT A;  1TS6 A;  3PAE A;  5KMW A;  5U47 A;  4WZ5 A;  2R9X A;  2JC7 A;  1IEM A;  4X1M A;  1FCM A;  4AFI A;  3CJM A;  4HI4 A;  4Z1W A;  4OQH A;  3G2Y A;  3UDX A;  5IT5 A;  1PIO A;  1OTA A;  3C4P A;  4PM9 A;  1CJF A;  3MSH A;  4PHT A;  1DP6 A;  4JXG A;  3RXX A;  2LB9 A;  3IXG A;  5EM1 A;  3LY3 A;  1H8M A;  1BSG A;  1Z6F A;  4G3W A;  3E0Y A;  4C3Q A;  1G6O A;  1JNU A;  4BQM A;  2JKG A;  1VHM A;  3UPP A;  1KGE A;  5HDC A;  3LIB A;  1EW0 A;  4X69 A;  5CER A;  2G7U A;  3G4P A;  1E25 A;  1AWI A;  1IYO A;  2PYR A;  5GLA A;  3IWO A;  2V8F A;  4QHC A;  3R7W A;  3GVB A;  1LSX A;  1S6R A;  2EWW A;  3BY9 A; 
#chains in the Genus database with same CATH homology
 5AJG A;  4Y3I A;  4HJ6 A;  3CIT A;  2Z6C A;  4PKY A;  2I9V A;  2OWH A;  3F1N B;  2VKS A;  2L1M A;  5HWV A;  2HV1 A;  3LR3 A;  3T4O A;  3B33 A;  1XJ6 A;  4QPR A;  3E4Q A;  4WEJ A;  3BY8 A;  3PBS A;  3T50 A;  3CI6 A;  4EEP A;  4HP9 A;  1X0O A;  2VV7 A;  1F98 A;  2O9A A;  1OTI A;  2D01 A;  3CAX A;  3A0R A;  3H9W A;  5TBM B;  3LI8 A;  5J4E A;  4HIA A;  2A2L A;  1P9W A;  4ME4 A;  4R3A A;  2QJ7 A;  2A24 A;  2L0W A;  3C38 A;  4BBT A;  3IBR A;  3H7W B;  3T4T A;  3G6O A;  1V9Z A;  2WKR A;  3IS2 A;  3UE6 A;  2PR5 A;  3HCY A;  3NOU C;  5I5L A;  2PD7 A;  1XJ4 A;  4EU0 A;  4NKP A;  3K3C A;  3OC2 A;  4CLC B;  5HL6 A;  1NRJ A;  4KUK A;  4BWI A;  4RQ9 A;  2W1T B;  3LFV A;  4Q0H A;  2VV6 A;  3ZQ5 A;  2O99 A;  3BQ8 A;  4GCZ A;  5F5Y A;  1DRM A;  3S7P A;  5KSH A;  2B02 A;  3TW8 A;  3TE8 A;  3IBJ A;  1MC0 A;  1P9R A;  1TD5 A;  4FSF A;  2JKR I;  4WF0 A;  3KYZ A;  4OOM A;  4KQD A;  3FC7 A;  1TS8 A;  4GS9 B;  2VV8 A;  2EA9 A;  3VV4 A;  5F69 A;  2XA7 S;  2HJ9 C;  4BBU A;  2MJ6 A;  2P7J A;  2ZOI A;  3KX0 X;  1XJ3 A;  3C8C A;  2KOI A;  1OTB A;  4F3L A;  2O9C A;  3NHQ A;  3H82 B;  4MMN A;  3EQV A;  5DKK A;  4MCW A;  4EQ1 A;  2ZBB A;  3PHY A;  4LRX C;  4XT2 A;  3MR0 A;  1T19 A;  1NWZ A;  2J3T D;  5HD5 A;  4EET B;  1STZ A;  1OPX A;  2P08 A;  2ZMF A;  5LBR A;  4UQI S;  4R38 A;  4UQI M;  4WEK A;  3VOL A;  4LRY C;  1S66 L;  4IUK A;  4DJ3 A;  3PXP A;  2HF6 A;  1F5M A;  3O5Y A;  1H3Q A;  3T4Q A;  3JVV A;  4NXB A;  4ZRR A;  2IA2 A;  3F1N A;  2INW A;  5HPF A;  1IOU A;  1OJ5 A;  1DP9 A;  1YAX A;  3D3O A;  3NJA A;  4I39 A;  4JGR A;  2J3T C;  1S4S A;  2JKR M;  2O0Y A;  4YNR A;  1TS0 A;  4EXO A;  3UB7 A;  1LT0 A;  2Y79 A;  2VLG A;  2VJW A;  4MN7 A;  2NUP C;  1D7E A;  4K08 A;  1Y28 A;  3RH8 B;  3H7W A;  1UGU A;  3B47 A;  5CX7 A;  5TJJ A;  4NEE D;  1NLZ A;  5C5K A;  3OOV A;  4ETZ A;  5F68 A;  3A0S A;  3S7O A;  5HPI A;  4CLC A;  4CLC E;  4WEL A;  2DMW A;  5HSQ A;  2QHK A;  1P97 A;  2BAS A;  5DKL A;  2W1T A;  1ZTU A;  1OT9 A;  3NOT C;  2JN7 A;  4HHD A;  1MZU A;  4EER A;  3T4K A;  2VA0 A;  4PAU A;  3NOP C;  3PBT A;  1F9I A;  3BQA A;  3ICY A;  1N9N A;  3CUE A;  3LR5 A;  1XJ2 A;  3PBN A;  1UWP X;  4JGQ A;  4GS9 A;  5HZH A;  3OCN A;  2L4R A;  2QJ5 A;  4P6Z S;  3D72 A;  4P6Z M;  2OAQ 1;  2W3F A;  4NXE A;  1TF1 A;  3R7W B;  4I38 A;  1DP8 A;  4DN0 A;  3PBO A;  3C2W A;  4LLO B;  5DFY A;  3H82 A;  1P0Z A;  3GEC A;  4G3K A;  2D02 A;  2QKP A;  1N9O A;  4WUJ A;  4CQH A;  4OOL A;  4R70 A;  5J7E A;  4E04 A;  2WKP A;  2FH5 A;  1GSX A;  1TS7 A;  1MKM A;  4ARZ B;  1YSP A;  5HDS A;  4HH3 A;  3UME A;  2OAP 1;  5IU1 A;  5MC7 A;  2P04 A;  3S7Q A;  1W63 M;  4KUO A;  3OLO A;  4JGO A;  2W3D A;  2ZOH A;  2XRN A;  3B42 A;  2PT7 A;  3LI9 A;  2K2N A;  3P01 A;  2M1C A;  5DFX A;  3TJZ C;  3ULF A;  4NXG A;  4BMW A;  2XRO A;  2A24 B;  3CLO A;  3PBQ A;  4H6J B;  3TRC A;  3LR4 A;  4I3I A;  4YOF A;  2GX5 A;  4GHI B;  1T1A A;  2J3W A;  2VZW A;  3F1P A;  1OTD A;  4O0P A;  4BJP A;  3EOI A;  5HWT A;  4Q0I A;  4JGP A;  2FZ0 A;  3LR0 A;  4ETX A;  1YSQ A;  2HGV A;  1W63 Q;  2K7S A;  1S67 L;  3PYP A;  4KQO A;  4MDZ A;  3KSI A;  1LL8 A;  3F1O B;  3LYX A;  1BYW A;  2PD8 A;  3BWL A;  2JHE A;  3UB6 A;  3CUE C;  3GDI A;  2XSS A;  2V0U A;  5G4Z A;  5HDD A;  1S4R A;  4MN5 A;  2PYP A;  1OTE A;  2CMN A;  3LIE A;  1XFN A;  2Y8H A;  2PDR A;  3KO6 A;  5DJU A;  3OBF A;  4O8G A;  3EEA A;  3K2N A;  2W3G A;  2V0W A;  2JKT M;  1S1Y A;  3R4K A;  3KSF A;  2V1B A;  3V67 A;  5TBM A;  1T18 A;  4R6L A;  3EWK A;  5G4Y A;  5J3W A;  2NUT C;  4FOF A;  2YKF A;  2W1R A;  1XFQ A;  2OOL A;  4HH2 A;  4F3L B;  3MXQ A;  3UB8 A;  3MQQ A;  2PHY A;  4G3V A;  4Y5F A;  2GJ3 A;  5L8M A;  1G28 A;  2K31 A;  4XT2 B;  5DJT A;  3FG8 A;  3LIA A;  1ODV A;  3E4P A;  3S7N A;  4EES A;  4M4X A;  3KYQ A;  4IJG A;  3VE3 A;  3LIC A;  4I3A A;  1S1Z A;  2PR6 A;  2W3H A;  3P7N A;  3KSG A;  2HJE A;  3UB9 A;  4ARZ A;  4Q0J A;  3A0V A;  3HJI A;  4HJ3 A;  2WKQ A;  5A8B A;  4GLQ A;  2GNX A;  1WA9 A;  3C30 A;  4L0L A;  3FPV A;  4HOI A;  1T1C A;  3FPW A;  4DMZ A;  5F6A A;  3PBR A;  3T4S A;  4EUV A;  4EW7 A;  3T4L A;  3PR6 A;  4I3J A;  2ZMV A;  4L9E A;  4IHQ A;  2J80 A;  4GJ4 A;  1IFQ A;  4MN6 A;  4HJ4 A;  4H6J A;  2V9A A;  4O01 A;  2W3E A;  4Y2F A;  3EEH A;  3MF0 A;  1V9Y A;  1N9L A;  1LSW A;  3SW1 A;  4B9O A;  2W0N A;  4GHI A;  2M7V A;  1GSW A;  1T1B A;  3EGX C;  2KX6 A;  4WL9 A;  3E98 A;  5K5B A;  1D06 A;  2JKT I;  3U2A A;  2B18 A;  3F1O A;  5IS1 A;  3LUQ A;  3BJN A;  3W2Z A;  3MQ0 A;  4CLC D;  5HD3 A;  2VEA A;  2VX8 A;  4HNB A;  4YWZ A;  4I5S A;  4HP4 A;  4PKY G;  4LRZ E;  2LB5 A;  2OWJ A;  3MFX A;  2VGL S;  3MMH A;  2VGL M;  2EWV A;  3RTY A;  3MJQ A;  3UMD A;  4EEU A;  2GZA A;  3ZYT A;  3LIF A;  1TS6 A;  5FL3 A;  3EQU A;  2W27 A;  2KDK A;  1YKD A;  4CLC C;  2V1A A;  1OJG A;  3IS2 B;  2XA7 M;  3RFB A;  4AFI A;  4BBV A;  4WLA A;  1NLY A;  4HI4 A;  4Z1W A;  5IT5 A;  3K3D A;  5HWW A;  1OTA A;  1LSV A;  5KIZ A;  2QYB A;  3KSH A;  4PHT A;  3T4J A;  4IUH A;  1DP6 A;  4NXF A;  1ZHH B;  2LB9 A;  2YKH A;  1H8M A;  3E4O A;  3E0Y A;  4G3W A;  5AVE A;  3OCL A;  1G6O A;  2M7U A;  1JNU A;  1VHM A;  3VE4 A;  5AVF A;  2KLI A;  1GSV A;  4L9F A;  4GW9 A;  2R78 A;  3MQO A;  4WN5 A;  5HDC A;  3LIB A;  5EFW A;  1EW0 A;  2G7U A;  4II7 A;  2O9B A;  4DJ2 A;  4B93 A;  1UWN X;  4HQA A;  5DF9 A;  3HJK A;  3DBA A;  2H28 A;  2PYR A;  3EGD C;  3CWF A;  3BW6 A;  4L9G A;  3JVU A;  1OT6 A;  3LID A;  4UEY A;  1KOU A;  3R7W A;  3F1P B;  3UE3 A;  1LSX A;  2EWW A;  2Z6D A;  4HY8 A;  1VB6 A;  2QWS A;  3BY9 A;  4LPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...