1UGUA

Crystal structure of pyp e46q mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Structure of photoactive yellow protein (PYP) E46Q mutant at 1.2 A resolution suggests how Glu46 controls the spectroscopic and kinetic characteristics of PYP.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photosynthesis
total genus 35
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1uguA00
3UB8A 3ZQ5A 3H7WA 4I5SA 3LUQA 2KX6A 2QKPA 2KDKA 2D02A 1UWPX 3RTYA 1LSWA 4I3AA 4I3IA 1UGUA 4F3LB 1N9OA 4HY8A 1S66L 4GHIA 1KOUA 3BY9A 4GCZA 5DKKA 3UMEA 2VV8A 1WA9A 3H82A 3RH8B 4KQDA 4JGRA 3CLOA 1XFNA 1T1BA 3UMDA 1NWZA 1V9YA 1X0OA 4GS9A 5F68A 2I9VA 3F1NA 5F5YA 5AVFA 3P7NA 1ODVA 3F1PA 1GSVA 2A24A 3UB9A 4I3JA 4HQAA 3A0RA 1S1YA 1VB6A 3MXQA 3ICYA 5HD5A 4HIAA 1LL8A 5HD3A 2JN7A 1OTBA 3LIAA 1GSWA 2PR5A 1TS8A 4JGQA 3C8CA 4LRYC 1T19A 2PD7A 2V1AA 4L9EA 5HDSA 4EXOA 3PYPA 1OTDA 3HJKA 4NXBA 3E4OA 2L0WA 4BBVA 3KX0X 1DP9A 3HJIA 5TBMB 1N9LA 1LSXA 3D72A 3UB6A 4HNBA 2EA9A 2OWJA 1T18A 5KIZA 4PKYG 1XJ6A 1S4RA 4HH2A 2BASA 1XFQA 1TS7A 4F3LA 3UE6A 3C2WA 5AVEA 1OTEA 5A8BA 4R3AA 3NOTC 3BWLA 4NXFA 5IS1A 2WKQA 4HP9A 3F1OB 4H6JB 1P0ZA 1EW0A 4EQ1A 4EETB 4NXGA 2R78A 5HZHA 4WLAA 3PHYA 3LI9A 1Y28A 3LIDA 5HWWA 2PDRA 4M4XA 4EEUA 2P7JA 4KUKA 4I38A 2CMNA 5EFWA 4LLOB 2VEAA 1T1CA 2V9AA 4L9FA 4BBTA 3IS2B 4B9OA 2OOLA 4LRZE 4WF0A 3VOLA 4NXEA 4MN5A 1T1AA 3ULFA 3B33A 2WKRA 1S1ZA 5HWVA 3NOPC 2ZOHA 5J4EA 1DP8A 3NHQA 3FC7A 5DJTA 3LYXA 3EEHA 4R70A 4MN6A 3G6OA 3K3CA 2D01A 5I5LA 3NJAA 1G28A 4DJ2A 3K3DA 1GSXA 3GDIA 2QWSA 5J3WA 5J7EA 2GJ3A 4R6LA 5TBMA 2V1BA 2W27A 3CWFA 4K08A 5HDDA 2OWHA 4HJ3A 3A0VA 2Z6DA 1F9IA 5F6AA 3UB7A 2V0UA 2YKFA 1TS0A 1LT0A 4HJ6A 3MQQA 1LSVA 4WN5A 2M1CA 3BY8A 4HI4A 4LPZA 2YKHA 4XT2B 1UWNX 3CAXA 1OJGA 1D7EA 4E04A 2HV1A 2L4RA 3H7WB 4RQ9A 3A0SA 2Z6CA 3MR0A 5HSQA 2ZBBA 3E4QA 4KUOA 5IU1A 1OJ5A 1OTIA 3T50A 3F1OA 4EEPA 1JNUA 3E4PA 4WUJA 4H6JA 3LIFA 1D06A 1F98A 3VE4A 1TS6A 2VV6A 3OLOA 2B02A 1OTAA 3MFXA 4EERA 3SW1A 3LI8A 5DJUA 3GECA 4HJ4A 4YWZA 4GHIB 1V9ZA 3NOUC 1S67L 3FG8A 2VV7A 2QJ7A 1XJ3A 4GW9A 1DRMA 3H82B 3IS2A 4JGPA 2INWA 2PR6A 1OT6A 1BYWA 4WL9A 2JHEA 3VE3A 1MZUA 2L1MA 5G4ZA 3LICA 4GS9B 5G4YA 3F1NB 3H9WA 2PYRA 4LRXC 4HOIA 2ZOIA 4L9GA 3LIEA 2QJ5A 1P97A 2PHYA 4HHDA 5F69A 2PYPA 3F1PB 2A24B 2H28A 3LIBA 2W0NA 1XJ4A 1OT9A 2V0WA 1XJ2A 4HH3A 4BBUA 1N9NA 4EESA 2J80A 1DP6A 3EWKA 5HDCA 3MJQA 2WKPA 4EW7A 1S4SA 4I39A 2QHKA 4JGOA 5HWTA 4HP4A 3IBRA 3MQOA 4PKYA 4DJ3A 2VLGA 2PD8A 4R38A 4XT2A 5DKLA 2K7SA
chains in the Genus database with same CATH superfamily
1XKZA 4ARZB 5EVEA 4G3KA 4B88A 3HLDA 2HP5A 5FQIA 3JVUA 3Q82A 4U3TA 2JKTI 3FV7A 2KDKA 5KZHA 4JXWA 1UWPX 1CJFA 4QD4A 5J8XA 1MY8A 3MF0A 1PI5A 4DXBA 4DRTA 4ZDXA 3ZNTA 5FAPA 2VGKA 2JKFA 4GCZA 5DKKA 3UMEA 1K54A 5EOEA 2XSSA 4BLMA 4BQMA 4RYEA 1YMXA 3JVVA 2HZ5A 2OLVA 4OVDA 3C4PA 1NLZA 3ZCZA 1FR6A 1E3UD 4DMZA 4BWIA 5AQ9A 1WYCA 1FILA 2HP9A 2XDMA 1IYQA 5DVAA 3MFDA 5HX9A 3F1PA 1GSVA 1PI4A 3A0RA 3WS4A 1L0EA 2JKGA 3QP5A 3DWKA 3ISGA 4O0PA 2UV0E 1LL8A 2WAFA 5HD3A 5CHMA 3LIAA 4CLCC 4OH0A 2PR5A 4ZJ1A 4UQIM 5M1AA 3C8CA 3V67A 1T19A 1M40A 5L2FA 3SOIA 3TW8A 3QNBA 1KE0A 2V1AA 3QHYA 4ZJ2A 2PBDP 2JKRI 1FSYA 3M2JA 4DXCA 3N4IA 3E4OA 1IKIA 3MZFA 4ARZA 1XA7A 3KX0X 1YPRA 3HLBA 5TBMB 1N9LA 4PM8A 1L0DA 2EA9A 2OWJA 3UN7A 1XJ6A 4X68A 2IWCA 4HH2A 4GKUA 4BD1A 1XFQA 1JTGA 4LV1A 5EM0A 4BL3A 4JLFA 2Y8HA 1K55C 3IF5A 3UE6A 1ES2A 1ESUA 3C2WA 4KZ3A 4N1HA 5CECA 4R0QA 1WE4A 1G6OA 3BWLA 4R4RA 3IWQA 3PXPA 2HDUA 3W4PA 2WZXA 4JXGA 2HJ9C 3IWOA 1CQAA 2ZC6B 3HVFA 2LB9A 5HWWA 3MBZA 3BFFA 4HBUA 4M4XA 2E8IA 1FQGA 1L3LA 2CMNA 2Y55A 4WELA 4JF4A 2EX6A 1O07A 3VP3A 4UEYA 2VEAA 3IF6C 5M18A 2H0TA 2W3HA 4WEJA 3IS2B 1N4OA 3U4LP 4LRZE 1T1AA 4Y15A 2ZQDA 1BT5A 3JYIA 1BULA 1VQQA 1O7EA 1LI0A 3G35A 3CUEA 4P6ZS 4HBTA 3BFCA 4MN6A 3BFDA 3WS1A 3G6OA 5JYPA 4N9KA 4IUKA 5I5LA 4X69A 1K38A 3K3DA 1E3UA 5HPFA 3TOIA 5FDHA 5J3WA 3V3SA 4R6LA 3T4LA 5TBMA 4R23A 3CWFA 4K08A 5K5BA 1F9IA 4E6WA 2PT7A 1YM1A 3O5YA 4Q0JA 1CI9A 3DAVA 1HVBA 5HW3A 4E6XA 4PM9A 3ZYTA 4P0MA 4DE2A 2M1CA 3BY8A 2XQZA 3N8SA 5LBRA 3SZTA 3CAXA 1NJ4A 4MBHA 1D7EA 2BG1A 3OZHA 4PMAA 2HV1A 2L4RA 3IXBA 3MR0A 1CI8A 1YLZA 3PBTA 2Y2MA 4HESA 4WUJA 3IT9A 3IHBA 3KSGA 5E2EA 5AQ7A 3DTIA 2FH5A 1TS6A 3CPTB 2VV6A 1NRFA 2VX8A 3A3FA 1F2KA 5AQBA 1LLBA 5FEFA 3SW1A 4DDSA 2JKTM 5HL1A 4YWZA 1U60A 2V20A 3MS6A 2ZL1B 3NOUC 3Q81A 1S67L 3FG8A 4GOGA 2X01A 2QJ7A 4KG2A 1BLSA 4LCMA 3T1SA 4GW9A 4RX3A 4ZBEA 3IS2A 3HL9A 3ZNYA 3CHWP 1OT6A 4JPMA 4WL9A 3T4SA 1S0WA 2EXAA 1ESIA 5CGWA 4PM7A 2B5RA 3C5AA 3UNWA 4EWFA 2PU4A 1LI9A 3FKVA 2X02A 3H9WA 4FOFA 3Q07A 4IUHA 4HOIA 1K56D 2OLUA 3LIEA 5E2GA 4XUZA 4E3LA 2H28A 4KG5A 3T1QB 4S2LA 1OT9A 2WK0A 3QP8A 5HAIA 3CZDA 3UPPA 2VJWA 3IH9A 1N9NA 4LFUA 3W8KA 2J80A 3EWKA 1CK3A 3QP4A 5HDCA 3NULA 3N7WA 4EW7A 1TDLA 4I39A 3SS5A 3G30A 4MNRA 3CMZA 3GSGA 4HP4A 5HWTA 3UB5P 1YKDA 3QP2A 3ZG7B 1ES4A 3NIAA 1Y4OA 3HUMA 4NG2A 3C30A 3UDIA 1K57C 5HAPA 5DTTA 4S2OA 4N92A 2JKRM 2WGWB 1LHYA 2WZZA 3IQAA 1ES3A 4I5SA 2EFXA 3BLSA 5FAQA 4K0WA 4GDBA 2HDSA 1BSGA 1I2WA 3CPTA 4GJ4A 1RCJA 4FTXA 1Y54A 4I3IA 4DE3A 1UGUA 3G2YA 4F3LB 3BW6A 4MLLA 4HY8A 3W4OA 2ZL1A 3BY9A 3M2KA 4CPKA 3GMWA 2HF6A 4CLCB 3CLOA 2ZM2A 3GV9A 1T1BA 4JKTA 5FSRA 1NWZA 3FPWA 2IA2A 3UPOA 5EUAA 1CEGA 3S7QA 3LO7A 3VP1A 4M3KA 1YSQA 5AVFA 3P7NA 2G2UA 4KZ5A 1L2SA 3UDFA 2BLSA 2ACGA 4I3JA 1C3BA 4HQAA 4WBGA 1VEUB 1KE3A 1VB6A 2WAEA 4P6BA 3MXQA 5HD5A 3V3RA 5IT5A 2XF3A 2HDQA 2EX8A 4QU3A 1GSWA 3FPVA 1TD5A 4Y5FA 2ZD8A 3Q7VB 5EV0A 1F5MA 4Z1WA 4DKIA 3PBOA 2EXBA 1OPXA 2CC1A 3VFFA 1SHVA 4G3WA 3PYPA 1MBLA 4BL2A 1NRJA 1PZOA 4H8RA 4BBVA 4D2OA 4R1GA 4E3IA 1K56A 5FATA 3HJIA 3VP2A 3D72A 2PAVP 2A49A 3ZG5A 1T18A 3PBQA 4PKYG 2WGWA 4LV3A 2WUQA 3C7VA 1S4RA 3OOVA 4OQHA 2ZQ8A 5TJJA 2BASA 1BLHA 2AVXA 3UE0A 2M7VA 3IF6B 4FUWA 2OSUA 4KZ8A 3KYZA 1K25A 4F3LA 3ZHHA 3LY3A 4D60A 2K2NA 5A8BA 4MMNA 4OLDA 1RGZA 2WKEA 4WMCD 4NXFA 3MKFA 3F1OB 1IYSA 4Y3IA 4PAUA 4EQ1A 4CLCA 4EETB 1YLTA 2VZWA 4OOLA 2R78A 5A90A 1ONHA 3IH8A 2BTFP 3PHYA 3LI9A 4BD0A 5CEDA 2VGLM 4KQOA 4IVIA 1HTZA 2VK3A 4II7A 2P7JA 2JC7A 3GTCA 4I38A 5EFWA 2Y2IA 3LGOA 4U0XA 3T12B 3VSLA 2EWVA 3VFHA 4L9FA 3WS2A 2EWWA 4UHUA 3B3XA 1VEUA 1G68A 2V2FF 4BJPA 5GHYA 1RP5A 4N1XA 3ULFA 1IOUA 1PWDA 2WKRA 1I2SA 1DP8A 4EQIA 3BFEA 3LY4A 2P04A 1K55A 4Y0OA 3Q7VA 2WADA 3LYXA 3EQUA 1NYMA 2J7VA 3NJAA 1J3WA 1G28A 3G34A 1FOFA 4EUVA 2G7UA 4OQGA 1SKOB 2Y2GA 4NEED 5J7EA 2GJ3A 2VKSA 3T4JA 4OLGA 3BYDA 1XXMA 4DF6A 3T4OA 2WGIA 2E8JA 2Z6DA 1AWIA 3HBRA 3TG9A 1PYYA 2V0UA 3NY4A 2YKFA 1TS0A 4YFMA 2XFTA 3IXHA 5MC7A 2O9CA 4HJ6A 1VETB 2WYXA 4IHQA 1XX2A 5EE8A 1LSVA 3IF6A 4C3QA 1W7FA 2IWDA 5DTKA 3UO9A 3EQVA 1SZVA 3BQAA 1H0MA 1H8ZA 5F1GA 3O3VA 1VHMA 3E4QA 5TFQA 4EBNA 3F1OA 4K91A 2W1TB 4S2MA 3WS5A 2RL3A 4Q8IA 2DCFA 4LENA 3KSFA 1KVMA 3MSHA 2ZM0A 1YLWA 2B02A 1OTAA 3MFXA 1IYOA 4GLQA 2GNXA 1TVFA 4O7DA 2XEPA 3ZFZA 4UA7A 3AGDA 3D9YA 3FYZA 4QB8A 1YSPA 5EM1A 1JTDA 3M6HA 2PR6A 2Y91A 2H0YA 4R3BA 2JHEA 3GQZA 3VV4A 5KSHA 1MZUA 4E3KA 4WMCA 2JBFA 3V50A 2O9BA 3A3IA 4X1MA 4IVKA 2PYRA 1FCNA 2PBYA 2ZQCA 4LRXC 4EU0A 1SKFA 3A3DA 3A3JA 5EPHA 4QY6A 4KG6A 2XH9A 2ZQAA 2PHYA 4HHDA 5F69A 2QZ6A 1PFLA 3ZDJA 2O0YA 3VP0A 5HPIA 4ETXA 2W0NA 1YLPA 1SKOA 2V0WA 4OPZA 4O01A 4HH3A 4BBUA 4EESA 2RCXA 2XA7S 1KGFA 5GHZA 3V5MA 4WZ5C 1GHMA 3IBRA 5F1FA 4CJNA 1MWUA 1VETA 4ESPA 1ERQA 3WWXA 2VLGA 2QMIA 2M7UA 2PRFA 4R38A 2B95A 4KQRA 4KZAA 1W63Q 3PBSA 3UE1A 5DKLA 4JBFA 1AXBA 3UB8A 4LCLA 5AQAA 5GLAA 4ZJ3A 2W1RA 3ZQ5A 1IEMA 1TEMA 4GDNA 3R7WB 2V1ZA 3L9KA 2W1TA 4MEZA 1DJCA 1MWRA 1BLCA 4EBPA 2QKPA 1ZG6A 3T4KA 5F82A 2XR0A 2D02A 2ZC5B 4YNRA 2Y2OA 2HDRA 5D3OA 1OMEA 1LSWA 4I3AA 4PHTA 4OOMA 1N9OA 2R9WA 2I72A 2O99A 1S66L 4X56A 1KOUA 2PU2A 2C6WB 2VV8A 1WA9A 4KENB 1N9BA 3C38A 4OPQA 2H5SA 1MC0A 5GLDA 5CRFA 4KQDA 4Y2FA 3UY6A 5FI2A 1LL9A 2P74A 4KZBA 4IEDA 4N9LA 1XFNA 3BFGA 4A5RA 4DE0A 4JF5A 3QP6A 3E98A 2C5WB 3UMDA 1V9YA 4CQHA 2P08A 4G3VA 1SCWA 1W63M 1K57A 3NECA 3VSKA 1KDWA 1E25A 1NLYA 4X1LA 3OPRA 1E4DA 5L07A 3ICYA 4HIAA 2GDNA 2J3TC 1PWCA 3LR5A 3PBNA 4L0LA 1NY0A 4GD8A 5E2HA 1TS8A 4MDZA 3IX3A 3QP1A 1STZA 1XPBA 3NBLA 1H8MA 1MPLA 2VA0A 5DF8A 5E43A 4IBRA 4OKPA 4P87A 1YAXA 4MBKA 4PPRA 4L9EA 1FR1A 2Y2JA 1K0KA 1W79A 4GB7A 2J3WA 4EXOA 3BEBA 2GX5A 4NXBA 4CLCD 3IX4A 4UQIS 4ZAMA 4OP5A 1H8YA 3UB6A 3O86A 2ZC4B 3R7WA 1BZAA 2QPNA 1IELA 3O88A 4EUZA 5CTNA 1PRQA 3HLWA 5DF9A 1PW8A 5HARA 3HLEA 1TS7A 1L0FA 1Z09A 3PTEA 4LV2A 3E2LA 3EEAA 4F94A 1OTEA 5FDSA 4R3AA 3NOTC 2MJ6A 2ZQ7A 5EOOA 5FQQA 3SH7A 2WKQA 2A3UA 1K4EA 1D1JA 3BECA 1P0ZA 3HREA 1EW0A 2Z2MB 2R9XA 3FWLA 3MKEA 5I94A 4NXGA 1PNEA 4WLAA 2GZAA 3DBAA 5G18A 2OAP1 4S2KA 2PDRA 4CLCE 5FI6A 4IJGA 4EEUA 4KUKA 1HZOA 5A93A 3W4QA 1J9MA 1ZKJA 2A2LA 2X71A 2KOIA 4LLOB 5CGXA 2B18A 3HLCA 2V9AA 4UA9A 5CERA 4B9OA 3TSGA 3LR3A 2OAQ1 3BM6A 4WF0A 4IBXA 4P6ZM 1PIOA 4WM9A 5HFOA 4PM6A 3WRZA 3B33A 3MXSA 4KZ9A 1CEFA 2G2WA 2ZOHA 5J4EA 4BENA 4OPRA 3NHQA 1ES5A 3TE8A 5DJTA 3DTMA 1ACFA 1KGEA 3NCKA 2ZC7A 2WKHA 4R70A 3IX8A 5CTMA 5CX7A 1JVJA 3K3CA 2D01A 3P01A 2H10A 3RXXA 4B4ZA 4DJ2A 2EX9A 4QPRA 1GSXA 3MQ0A 3GDIA 5FEGA 1TF1A 3HUOA 3MXRA 4O8GA 5EECA 4EBLA 4MN7A 1BLPA 2W27A 1YLYA 4S2IA 2ZJ9A 3S7NA 2FFFB 5BOHA 3UE3A 1K4FA 4S2NC 1Q2PA 3RFBA 1FCMA 4X55A 3DTKA 3LCEA 2LB5A 1G6AA 1SDNA 5A91A 1IYPA 2W3DA 4WN5A 3LR0A 1K6SA 3TJZC 4WYYA 4LPZA 1GHIA 4XT2B 3SS4A 1A0KA 1UWNX 1OJGA 1DJAA 1M6KA 3VOZA 3FKWA 3I7JA 3H7WB 4DE1A 3A0SA 2DNSA 2ZBBA 4KUOA 5IU1A 1OJ5A 1OTIA 3T50A 2NUPC 4Y13A 3E4PA 2EX2A 2HJEA 3S22A 1XA1A 3LIFA 5EVIB 5TR7A 1F98A 3S7PA 3NDEA 2WGVA 3U2AA 4Y0UA 3T4QA 4YOFA 4X25A 1EI5A 3OLOA 3K2NA 3G32A 3EGXC 3HLGA 3LI8A 5HL6A 3BJNA 3D4FA 4GHIB 1V9ZA 2VV7A 1GA0A 2V8CA 2ZM8A 1XJ3A 3LR4A 3ZG8B 3ZVTA 3H82B 3RXWA 3R4KA 2ZQ9A 3IHAA 1BYWA 2ZMVA 5CEBA 4Q0IA 4U0TA 3S4XA 3DTEA 3LICA 4GS9B 3AGEA 5G4YA 3ZVWA 3F1NB 1KDSA 2J8YA 1W8YA 2ZOIA 4DN0A 4K0XA 4ETZA 1NZUA 1P97A 2W3FA 2PYPA 2Z2LB 2NUTC 2A24B 1KVLA 3MZDA 3ITAA 3LIBA 5DFXA 3NC8A 4P85A 5FA7A 5DFYA 1K54C 3VP4A 4WZ4A 4GD6A 1DP6A 2WKPA 3ZG0A 1S4SA 5HAQA 5KMWA 4JGOA 3WRTA 2HGVA 4C75A 3MQOA 5A92A 3LFVA 4PKYA 4R4SA 1GCEA 4DJ3A 2J3TD 2PD8A 2XD1A 3CJMA 4XT2A 1IKGA 1H5XA 3S1YA 3BLMA 3C7UA 1YLJA 3H7WA 3CG5A 4Y0TA 4FH4A 3CI6A 2Y59A 1FCOA 3EGDC 5E2FA 3LUQA 2KX6A 3T1RA 5EVIA 5EVLA 2FZ0A 3T1XA 2Y2NA 4Q0HA 4YINA 5L8MA 1JWPA 1IFQA 3RTYA 4ZRRA 4MBFA 1EWZA 2VGJA 1JWVA 3D3OA 4GNUA 1VM1A 4QHCA 4UAAA 4GHIA 3HCYA 3Q1FA 2XK1A 3BQ8A 1Z6FA 4FD8A 1P9RA 3H82A 3RH8B 3HUNA 1NYYA 4FH2A 4Z9QA 4JGRA 4WZ5A 4OOYA 3S7OA 2Y2QA 3MMHA 1X0OA 4GS9A 1G5UA 5F68A 2I9VA 3F1NA 3MZEA 5F5YA 1MKMA 2ZC3B 3LEZA 5EVIC 1YT4A 3G4PA 1KE4A 3PAGA 1ODVA 5FQJA 3E0YA 2ZMAA 3ITBA 2A24A 3UB9A 5FQKA 2W3EA 1S1YA 5L10A 4X53A 1S6RA 3JPUA 5GL9A 3IXDA 5FI7A 4HEFA 1GHPA 2JN7A 1OTBA 1ZG4A 4ID4A 4NETA 3EOIA 4C6YA 4JGQA 3LEQA 4ZTKA 4BMWA 2XLNA 4LRYC 3GRJA 1ALQA 1ZTUA 1PZPA 1LL5A 5GHXA 2PD7A 4FCFA 3AGFA 2P9VB 1SDEA 5HDSA 1HLUP 1H3QA 4E3MA 1OTDA 3HJKA 2XFSA 2L0WA 1BUEA 3G2ZA 4RA7A 3VMAA 1DP9A 1LSXA 3KYQA 1Q2QA 4HNBA 3P98A 5KIZA 1TDGA 2JCHA 4NK3A 3GR2A 4KZ7A 4WEKA 1NZOA 4JXSA 4DDYA 2UWXA 1QMEA 4Y17A 2Q9MA 3SS3A 3CUEC 4E3NA 5AVEA 4JF6A 4E3JA 3FZCA 2Y4AA 3DWZA 5IS1A 2KLIA 4HP9A 1P9WA 4H6JB 4XUXA 5TGFA 3OC2A 3QNCA 5HZHA 4RVAA 4LGWA 3GVBA 4GN2A 4ME4A 1EROA 3OPHA 2OV5A 1HD8A 1Y28A 4OPYA 3LIDA 4JXVA 2Q9NA 3N8LA 4AFIA 3WS0A 4RX2A 2O9AA 1XGJA 1XP4A 3UPNA 3M6BA 2VGLS 5CXWA 1T1CA 4BBTA 4OONA 1ZHHB 2XD5A 1GA9A 3BRMA 2OOLA 3IWIA 3VOLA 5CHJA 4NXEA 4MCWA 4MN5A 3NI9A 3SH8A 2Y2LA 5AJGA 3NDGA 3W2ZA 2EFUA 2V8FA 1S1ZA 5HWVA 3NOPC 3FC7A 4KZ6A 4FSFA 3EEHA 4EV4A 2XGNA 2P9VA 1RGYA 2K31A 3N8RA 3OCLA 2QWSA 2DRWA 5C5KA 2J9PA 2Y79A 1ONGA 2V1BA 5HDDA 2XROA 3O87A 2OWHA 4HJ3A 3A0VA 5F6AA 4S2JA 1WYBA 3UB7A 3OCNA 3IBJA 1LT0A 1PW1A 4GZBA 3T4TA 3MQQA 1ZC2A 5GLCA 5GLBA 4HI4A 1DY6A 2YKHA 5FQ9A 5F83A 3V39A 2XRNA 4E04A 3L7HA 4RQ9A 2QYBA 2Z6CA 5HSQA 1ERMA 1BTLA 4EEPA 1JNUA 3OBFA 3KSIA 4H6JA 2W3GA 5IHVA 1D06A 4OQIA 1QMFA 5FQMA 2J9OA 3VE4A 4E3OA 4QY5A 5CHUA 2FFYA 3SH9A 3ZGAB 4EERA 1MWTA 1MKIA 5DJUA 1I5QA 3GECA 4HJ4A 1PWGA 2Q0OA 5DF7A 3G31A 2WKIA 5FL3A 4B93A 1KGGA 4XXRA 1CF0A 1DRMA 3B47A 4JGPA 2INWA 5JYOA 3UDXA 5U47A 3ZG9B 3RJUA 2DMWA 4S2NA 3VE3A 4UA6A 4KQQA 2L1MA 2Y2KA 1YQSA 5G4ZA 3HLFA 5L09A 2Y2PA 3E2KA 2HPBA 3CITA 4QWOA 1MXOA 3OPLA 2IWBA 1MWSA 3C4OA 4LV0A 3OPPA 4L9GA 3KO6A 4PM5A 1K6RA 1W8QA 2QJ5A 3P09A 2Y2HA 3KYEA 5M19A 2ZLYA 5CGSA 2XA7M 3DW0A 3F1PB 3PAEA 1DJBA 5FAOA 1FSWA 1W5DA 3PR6A 5DTSA 1FIKA 1XJ4A 4OQ0A 3TRCA 3KSHA 1XJ2A 1L0GA 5EVID 4NKPA 4B4XA 3PBRA 4QJGA 4Y7PA 4OP8A 3MJQA 1YMSA 4R3JA 2QHKA 5FASA 3IXGA 4KZ4A 3N6IA 3B42A 3A3EA 2JE5A 1JWZA 2ZMFA 3VOYA 4X6TA 3Q7ZA 2HP6A 4S2PA 1XGIA 5KSCA 1NXYA 2K7SA
chains in the Genus database with same CATH topology
3UB8A 4ARZB 3C30A 2W1RA 3ZQ5A 3H7WA 4G3KA 3CI6A 2JKRM 3R7WB 3EGDC 2W1TA 4I5SA 3LUQA 2KX6A 3JVUA 2JKTI 2QKPA 3T4KA 2KDKA 2FZ0A 2D02A 1UWPX 4GJ4A 4Q0HA 5L8MA 4YNRA 1IFQA 3RTYA 4ZRRA 3MF0A 1LSWA 4I3AA 4I3IA 1UGUA 3D3OA 4PHTA 4F3LB 3BW6A 4OOMA 1N9OA 4HY8A 2O99A 1S66L 4GHIA 3HCYA 1KOUA 3BY9A 4GCZA 5DKKA 3UMEA 2VV8A 1WA9A 3BQ8A 2HF6A 3C38A 1P9RA 3H82A 3RH8B 2XSSA 1MC0A 4CLCB 4KQDA 4Y2FA 3JVVA 4JGRA 3CLOA 1XFNA 1T1BA 3S7OA 3MMHA 3E98A 1NLZA 1NWZA 3UMDA 3FPWA 2IA2A 1V9YA 1X0OA 4CQHA 4GS9A 5F68A 4DMZA 4BWIA 2I9VA 3F1NA 3S7QA 2P08A 4G3VA 5F5YA 1MKMA 1YSQA 5AVFA 3P7NA 1W63M 1ODVA 3E0YA 3F1PA 1GSVA 2A24A 3UB9A 4I3JA 4HQAA 3A0RA 1NLYA 1S1YA 2W3EA 1VB6A 3MXQA 4O0PA 3ICYA 5HD5A 5IT5A 4HIAA 1LL8A 5HD3A 2JN7A 1OTBA 2J3TC 3LIAA 1GSWA 3LR5A 3PBNA 3FPVA 4CLCC 3EOIA 4L0LA 1TD5A 2PR5A 4Y5FA 1TS8A 4MDZA 4JGQA 1STZA 4UQIM 3C8CA 4BMWA 1H8MA 4LRYC 3V67A 1T19A 1ZTUA 2VA0A 3TW8A 1F5MA 2PD7A 4Z1WA 1YAXA 3PBOA 2V1AA 4L9EA 5HDSA 1OPXA 2J3WA 1H3QA 4G3WA 3PYPA 4EXOA 2JKRI 1OTDA 3HJKA 2GX5A 4NXBA 4CLCD 3E4OA 2L0WA 1NRJA 4UQIS 4ARZA 4BBVA 3KX0X 1DP9A 3HJIA 5TBMB 1N9LA 1LSXA 3D72A 3KYQA 3UB6A 4HNBA 2EA9A 2OWJA 1T18A 3PBQA 5KIZA 4PKYG 3R7WA 1XJ6A 1S4RA 3OOVA 4WEKA 5TJJA 4HH2A 2BASA 5DF9A 1XFQA 2M7VA 1TS7A 2Y8HA 3KYZA 4F3LA 3CUEC 3EEAA 2K2NA 3UE6A 3C2WA 5AVEA 1OTEA 5A8BA 4MMNA 4R3AA 3NOTC 2MJ6A 1G6OA 3BWLA 4NXFA 5IS1A 2KLIA 2WKQA 4HP9A 3F1OB 1P9WA 3PXPA 4H6JB 4Y3IA 1P0ZA 4PAUA 1EW0A 4EQ1A 4CLCA 4EETB 4OOLA 2HJ9C 2VZWA 3OC2A 4NXGA 2R78A 5HZHA 4WLAA 3PHYA 4ME4A 3LI9A 2GZAA 2VGLM 4KQOA 3DBAA 1Y28A 2OAP1 2LB9A 3LIDA 5HWWA 2PDRA 4CLCE 4II7A 4AFIA 4IJGA 4M4XA 4EEUA 2P7JA 4KUKA 2O9AA 4I38A 2CMNA 4WELA 2A2LA 5EFWA 2KOIA 4UEYA 4LLOB 2B18A 2VEAA 2EWVA 2W3HA 2VGLS 4WEJA 1T1CA 2V9AA 4L9FA 4BBTA 3IS2B 1ZHHB 4B9OA 2EWWA 3LR3A 2OAQ1 2OOLA 4LRZE 4P6ZM 4WF0A 3VOLA 4NXEA 4MCWA 4MN5A 4BJPA 1T1AA 5AJGA 3ULFA 3W2ZA 3B33A 1IOUA 2WKRA 1S1ZA 5HWVA 3NOPC 2ZOHA 5J4EA 1DP8A 3NHQA 3FC7A 3TE8A 5DJTA 2P04A 3CUEA 4FSFA 4P6ZS 3LYXA 3EEHA 4R70A 4MN6A 3G6OA 5CX7A 3EQUA 3K3CA 2D01A 3P01A 4IUKA 5I5LA 3NJAA 1G28A 4DJ2A 3K3DA 5HPFA 4EUVA 2K31A 4QPRA 1GSXA 3OCLA 2G7UA 3MQ0A 3GDIA 1TF1A 2QWSA 4NEED 5J3WA 5C5KA 5J7EA 2GJ3A 4O8GA 4R6LA 2VKSA 2Y79A 3T4JA 3T4LA 5TBMA 4MN7A 2V1BA 2W27A 3CWFA 4K08A 5HDDA 3T4OA 2XROA 5K5BA 3S7NA 2OWHA 4HJ3A 3A0VA 2Z6DA 1F9IA 5F6AA 3UB7A 3UE3A 2PT7A 2V0UA 3O5YA 2YKFA 4Q0JA 3RFBA 1TS0A 3OCNA 3IBJA 5MC7A 1LT0A 2O9CA 2LB5A 4HJ6A 3T4TA 3MQQA 4IHQA 3ZYTA 1LSVA 2W3DA 4WN5A 3LR0A 2M1CA 3BY8A 4HI4A 3TJZC 4LPZA 2YKHA 4XT2B 5LBRA 2XRNA 1UWNX 3CAXA 1OJGA 1D7EA 4E04A 3EQVA 3BQAA 2HV1A 2L4RA 3H7WB 4RQ9A 3A0SA 2QYBA 2Z6CA 3MR0A 5HSQA 1VHMA 2ZBBA 3E4QA 4KUOA 5IU1A 1OJ5A 1OTIA 3T50A 3PBTA 3F1OA 2NUPC 4EEPA 1JNUA 2W1TB 3E4PA 3KSIA 3OBFA 4WUJA 4H6JA 2W3GA 2HJEA 3LIFA 1D06A 3KSGA 1F98A 3S7PA 2FH5A 3VE4A 3U2AA 1TS6A 3KSFA 2VV6A 3T4QA 4YOFA 2VX8A 3OLOA 2B02A 1OTAA 3K2NA 3MFXA 4EERA 4GLQA 3SW1A 2GNXA 2JKTM 3EGXC 3LI8A 5DJUA 5HL6A 3GECA 4HJ4A 4YWZA 3BJNA 4GHIB 1V9ZA 3NOUC 1S67L 3FG8A 2VV7A 5FL3A 2QJ7A 1XJ3A 4B93A 1YSPA 3LR4A 4GW9A 1DRMA 3H82B 3R4KA 3IS2A 3B47A 4JGPA 2INWA 2PR6A 1OT6A 1BYWA 2ZMVA 4WL9A 2DMWA 3T4SA 2JHEA 3VV4A 3VE3A 4Q0IA 5KSHA 1MZUA 2L1MA 5G4ZA 2O9BA 3LICA 4GS9B 3CITA 5G4YA 3F1NB 3H9WA 4FOFA 2PYRA 4LRXC 4IUHA 4HOIA 2ZOIA 4EU0A 4DN0A 4L9GA 3KO6A 3LIEA 4ETZA 2QJ5A 1P97A 2W3FA 2PHYA 4HHDA 2XA7M 5F69A 2PYPA 3F1PB 2NUTC 2A24B 2H28A 2O0YA 3LIBA 5HPIA 5DFXA 3PR6A 4ETXA 2W0NA 1XJ4A 3TRCA 3KSHA 1OT9A 2V0WA 1XJ2A 4O01A 4HH3A 5DFYA 2VJWA 4NKPA 4BBUA 1N9NA 3PBRA 4EESA 2J80A 1DP6A 3EWKA 5HDCA 3MJQA 2WKPA 2XA7S 4EW7A 1S4SA 4I39A 2QHKA 4JGOA 3B42A 2HGVA 4HP4A 5HWTA 3IBRA 3MQOA 2ZMFA 1YKDA 3LFVA 4PKYA 4DJ3A 2J3TD 2VLGA 2M7UA 2PD8A 4R38A 4XT2A 1W63Q 3PBSA 5DKLA 2K7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB8 A;  3ZQ5 A;  3H7W A;  4I5S A;  3LUQ A;  2KX6 A;  2QKP A;  2KDK A;  2D02 A;  1UWP X;  3RTY A;  1LSW A;  4I3A A;  4I3I A;  1UGU A;  4F3L B;  1N9O A;  4HY8 A;  1S66 L;  4GHI A;  1KOU A;  3BY9 A;  4GCZ A;  5DKK A;  3UME A;  2VV8 A;  1WA9 A;  3H82 A;  3RH8 B;  4KQD A;  4JGR A;  3CLO A;  1XFN A;  1T1B A;  3UMD A;  1NWZ A;  1V9Y A;  1X0O A;  4GS9 A;  5F68 A;  2I9V A;  3F1N A;  5F5Y A;  5AVF A;  3P7N A;  1ODV A;  3F1P A;  1GSV A;  2A24 A;  3UB9 A;  4I3J A;  4HQA A;  3A0R A;  1S1Y A;  1VB6 A;  3MXQ A;  3ICY A;  5HD5 A;  4HIA A;  1LL8 A;  5HD3 A;  2JN7 A;  1OTB A;  3LIA A;  1GSW A;  2PR5 A;  1TS8 A;  4JGQ A;  3C8C A;  4LRY C;  1T19 A;  2PD7 A;  2V1A A;  4L9E A;  5HDS A;  4EXO A;  3PYP A;  1OTD A;  3HJK A;  4NXB A;  3E4O A;  2L0W A;  4BBV A;  3KX0 X;  1DP9 A;  3HJI A;  5TBM B;  1N9L A;  1LSX A;  3D72 A;  3UB6 A;  4HNB A;  2EA9 A;  2OWJ A;  1T18 A;  5KIZ A;  4PKY G;  1XJ6 A;  1S4R A;  4HH2 A;  2BAS A;  1XFQ A;  1TS7 A;  4F3L A;  3UE6 A;  3C2W A;  5AVE A;  1OTE A;  5A8B A;  4R3A A;  3NOT C;  3BWL A;  4NXF A;  5IS1 A;  2WKQ A;  4HP9 A;  3F1O B;  4H6J B;  1P0Z A;  1EW0 A;  4EQ1 A;  4EET B;  4NXG A;  2R78 A;  5HZH A;  4WLA A;  3PHY A;  3LI9 A;  1Y28 A;  3LID A;  5HWW A;  2PDR A;  4M4X A;  4EEU A;  2P7J A;  4KUK A;  4I38 A;  2CMN A;  5EFW A;  4LLO B;  2VEA A;  1T1C A;  2V9A A;  4L9F A;  4BBT A;  3IS2 B;  4B9O A;  2OOL A;  4LRZ E;  4WF0 A;  3VOL A;  4NXE A;  4MN5 A;  1T1A A;  3ULF A;  3B33 A;  2WKR A;  1S1Z A;  5HWV A;  3NOP C;  2ZOH A;  5J4E A;  1DP8 A;  3NHQ A;  3FC7 A;  5DJT A;  3LYX A;  3EEH A;  4R70 A;  4MN6 A;  3G6O A;  3K3C A;  2D01 A;  5I5L A;  3NJA A;  1G28 A;  4DJ2 A;  3K3D A;  1GSX A;  3GDI A;  2QWS A;  5J3W A;  5J7E A;  2GJ3 A;  4R6L A;  5TBM A;  2V1B A;  2W27 A;  3CWF A;  4K08 A;  5HDD A;  2OWH A;  4HJ3 A;  3A0V A;  2Z6D A;  1F9I A;  5F6A A;  3UB7 A;  2V0U A;  2YKF A;  1TS0 A;  1LT0 A;  4HJ6 A;  3MQQ A;  1LSV A;  4WN5 A;  2M1C A;  3BY8 A;  4HI4 A;  4LPZ A;  2YKH A;  4XT2 B;  1UWN X;  3CAX A;  1OJG A;  1D7E A;  4E04 A;  2HV1 A;  2L4R A;  3H7W B;  4RQ9 A;  3A0S A;  2Z6C A;  3MR0 A;  5HSQ A;  2ZBB A;  3E4Q A;  4KUO A;  5IU1 A;  1OJ5 A;  1OTI A;  3T50 A;  3F1O A;  4EEP A;  1JNU A;  3E4P A;  4WUJ A;  4H6J A;  3LIF A;  1D06 A;  1F98 A;  3VE4 A;  1TS6 A;  2VV6 A;  3OLO A;  2B02 A;  1OTA A;  3MFX A;  4EER A;  3SW1 A;  3LI8 A;  5DJU A;  3GEC A;  4HJ4 A;  4YWZ A;  4GHI B;  1V9Z A;  3NOU C;  1S67 L;  3FG8 A;  2VV7 A;  2QJ7 A;  1XJ3 A;  4GW9 A;  1DRM A;  3H82 B;  3IS2 A;  4JGP A;  2INW A;  2PR6 A;  1OT6 A;  1BYW A;  4WL9 A;  2JHE A;  3VE3 A;  1MZU A;  2L1M A;  5G4Z A;  3LIC A;  4GS9 B;  5G4Y A;  3F1N B;  3H9W A;  2PYR A;  4LRX C;  4HOI A;  2ZOI A;  4L9G A;  3LIE A;  2QJ5 A;  1P97 A;  2PHY A;  4HHD A;  5F69 A;  2PYP A;  3F1P B;  2A24 B;  2H28 A;  3LIB A;  2W0N A;  1XJ4 A;  1OT9 A;  2V0W A;  1XJ2 A;  4HH3 A;  4BBU A;  1N9N A;  4EES A;  2J80 A;  1DP6 A;  3EWK A;  5HDC A;  3MJQ A;  2WKP A;  4EW7 A;  1S4S A;  4I39 A;  2QHK A;  4JGO A;  5HWT A;  4HP4 A;  3IBR A;  3MQO A;  4PKY A;  4DJ3 A;  2VLG A;  2PD8 A;  4R38 A;  4XT2 A;  5DKL A;  2K7S A; 
#chains in the Genus database with same CATH topology
 1XKZ A;  4ARZ B;  5EVE A;  4G3K A;  4B88 A;  3HLD A;  2HP5 A;  5FQI A;  3JVU A;  3Q82 A;  4U3T A;  2JKT I;  3FV7 A;  2KDK A;  5KZH A;  4JXW A;  1UWP X;  1CJF A;  4QD4 A;  5J8X A;  1MY8 A;  3MF0 A;  1PI5 A;  4DXB A;  4DRT A;  4ZDX A;  3ZNT A;  5FAP A;  2VGK A;  2JKF A;  4GCZ A;  5DKK A;  3UME A;  1K54 A;  5EOE A;  2XSS A;  4BLM A;  4BQM A;  4RYE A;  1YMX A;  3JVV A;  2HZ5 A;  2OLV A;  4OVD A;  3C4P A;  1NLZ A;  3ZCZ A;  1FR6 A;  1E3U D;  4DMZ A;  4BWI A;  5AQ9 A;  1WYC A;  1FIL A;  2HP9 A;  2XDM A;  1IYQ A;  5DVA A;  3MFD A;  5HX9 A;  3F1P A;  1GSV A;  1PI4 A;  3A0R A;  3WS4 A;  1L0E A;  2JKG A;  3QP5 A;  3DWK A;  3ISG A;  4O0P A;  2UV0 E;  1LL8 A;  2WAF A;  5HD3 A;  5CHM A;  3LIA A;  4CLC C;  4OH0 A;  2PR5 A;  4ZJ1 A;  4UQI M;  5M1A A;  3C8C A;  3V67 A;  1T19 A;  1M40 A;  5L2F A;  3SOI A;  3TW8 A;  3QNB A;  1KE0 A;  2V1A A;  3QHY A;  4ZJ2 A;  2PBD P;  2JKR I;  1FSY A;  3M2J A;  4DXC A;  3N4I A;  3E4O A;  1IKI A;  3MZF A;  4ARZ A;  1XA7 A;  3KX0 X;  1YPR A;  3HLB A;  5TBM B;  1N9L A;  4PM8 A;  1L0D A;  2EA9 A;  2OWJ A;  3UN7 A;  1XJ6 A;  4X68 A;  2IWC A;  4HH2 A;  4GKU A;  4BD1 A;  1XFQ A;  1JTG A;  4LV1 A;  5EM0 A;  4BL3 A;  4JLF A;  2Y8H A;  1K55 C;  3IF5 A;  3UE6 A;  1ES2 A;  1ESU A;  3C2W A;  4KZ3 A;  4N1H A;  5CEC A;  4R0Q A;  1WE4 A;  1G6O A;  3BWL A;  4R4R A;  3IWQ A;  3PXP A;  2HDU A;  3W4P A;  2WZX A;  4JXG A;  2HJ9 C;  3IWO A;  1CQA A;  2ZC6 B;  3HVF A;  2LB9 A;  5HWW A;  3MBZ A;  3BFF A;  4HBU A;  4M4X A;  2E8I A;  1FQG A;  1L3L A;  2CMN A;  2Y55 A;  4WEL A;  4JF4 A;  2EX6 A;  1O07 A;  3VP3 A;  4UEY A;  2VEA A;  3IF6 C;  5M18 A;  2H0T A;  2W3H A;  4WEJ A;  3IS2 B;  1N4O A;  3U4L P;  4LRZ E;  1T1A A;  4Y15 A;  2ZQD A;  1BT5 A;  3JYI A;  1BUL A;  1VQQ A;  1O7E A;  1LI0 A;  3G35 A;  3CUE A;  4P6Z S;  4HBT A;  3BFC A;  4MN6 A;  3BFD A;  3WS1 A;  3G6O A;  5JYP A;  4N9K A;  4IUK A;  5I5L A;  4X69 A;  1K38 A;  3K3D A;  1E3U A;  5HPF A;  3TOI A;  5FDH A;  5J3W A;  3V3S A;  4R6L A;  3T4L A;  5TBM A;  4R23 A;  3CWF A;  4K08 A;  5K5B A;  1F9I A;  4E6W A;  2PT7 A;  1YM1 A;  3O5Y A;  4Q0J A;  1CI9 A;  3DAV A;  1HVB A;  5HW3 A;  4E6X A;  4PM9 A;  3ZYT A;  4P0M A;  4DE2 A;  2M1C A;  3BY8 A;  2XQZ A;  3N8S A;  5LBR A;  3SZT A;  3CAX A;  1NJ4 A;  4MBH A;  1D7E A;  2BG1 A;  3OZH A;  4PMA A;  2HV1 A;  2L4R A;  3IXB A;  3MR0 A;  1CI8 A;  1YLZ A;  3PBT A;  2Y2M A;  4HES A;  4WUJ A;  3IT9 A;  3IHB A;  3KSG A;  5E2E A;  5AQ7 A;  3DTI A;  2FH5 A;  1TS6 A;  3CPT B;  2VV6 A;  1NRF A;  2VX8 A;  3A3F A;  1F2K A;  5AQB A;  1LLB A;  5FEF A;  3SW1 A;  4DDS A;  2JKT M;  5HL1 A;  4YWZ A;  1U60 A;  2V20 A;  3MS6 A;  2ZL1 B;  3NOU C;  3Q81 A;  1S67 L;  3FG8 A;  4GOG A;  2X01 A;  2QJ7 A;  4KG2 A;  1BLS A;  4LCM A;  3T1S A;  4GW9 A;  4RX3 A;  4ZBE A;  3IS2 A;  3HL9 A;  3ZNY A;  3CHW P;  1OT6 A;  4JPM A;  4WL9 A;  3T4S A;  1S0W A;  2EXA A;  1ESI A;  5CGW A;  4PM7 A;  2B5R A;  3C5A A;  3UNW A;  4EWF A;  2PU4 A;  1LI9 A;  3FKV A;  2X02 A;  3H9W A;  4FOF A;  3Q07 A;  4IUH A;  4HOI A;  1K56 D;  2OLU A;  3LIE A;  5E2G A;  4XUZ A;  4E3L A;  2H28 A;  4KG5 A;  3T1Q B;  4S2L A;  1OT9 A;  2WK0 A;  3QP8 A;  5HAI A;  3CZD A;  3UPP A;  2VJW A;  3IH9 A;  1N9N A;  4LFU A;  3W8K A;  2J80 A;  3EWK A;  1CK3 A;  3QP4 A;  5HDC A;  3NUL A;  3N7W A;  4EW7 A;  1TDL A;  4I39 A;  3SS5 A;  3G30 A;  4MNR A;  3CMZ A;  3GSG A;  4HP4 A;  5HWT A;  3UB5 P;  1YKD A;  3QP2 A;  3ZG7 B;  1ES4 A;  3NIA A;  1Y4O A;  3HUM A;  4NG2 A;  3C30 A;  3UDI A;  1K57 C;  5HAP A;  5DTT A;  4S2O A;  4N92 A;  2JKR M;  2WGW B;  1LHY A;  2WZZ A;  3IQA A;  1ES3 A;  4I5S A;  2EFX A;  3BLS A;  5FAQ A;  4K0W A;  4GDB A;  2HDS A;  1BSG A;  1I2W A;  3CPT A;  4GJ4 A;  1RCJ A;  4FTX A;  1Y54 A;  4I3I A;  4DE3 A;  1UGU A;  3G2Y A;  4F3L B;  3BW6 A;  4MLL A;  4HY8 A;  3W4O A;  2ZL1 A;  3BY9 A;  3M2K A;  4CPK A;  3GMW A;  2HF6 A;  4CLC B;  3CLO A;  2ZM2 A;  3GV9 A;  1T1B A;  4JKT A;  5FSR A;  1NWZ A;  3FPW A;  2IA2 A;  3UPO A;  5EUA A;  1CEG A;  3S7Q A;  3LO7 A;  3VP1 A;  4M3K A;  1YSQ A;  5AVF A;  3P7N A;  2G2U A;  4KZ5 A;  1L2S A;  3UDF A;  2BLS A;  2ACG A;  4I3J A;  1C3B A;  4HQA A;  4WBG A;  1VEU B;  1KE3 A;  1VB6 A;  2WAE A;  4P6B A;  3MXQ A;  5HD5 A;  3V3R A;  5IT5 A;  2XF3 A;  2HDQ A;  2EX8 A;  4QU3 A;  1GSW A;  3FPV A;  1TD5 A;  4Y5F A;  2ZD8 A;  3Q7V B;  5EV0 A;  1F5M A;  4Z1W A;  4DKI A;  3PBO A;  2EXB A;  1OPX A;  2CC1 A;  3VFF A;  1SHV A;  4G3W A;  3PYP A;  1MBL A;  4BL2 A;  1NRJ A;  1PZO A;  4H8R A;  4BBV A;  4D2O A;  4R1G A;  4E3I A;  1K56 A;  5FAT A;  3HJI A;  3VP2 A;  3D72 A;  2PAV P;  2A49 A;  3ZG5 A;  1T18 A;  3PBQ A;  4PKY G;  2WGW A;  4LV3 A;  2WUQ A;  3C7V A;  1S4R A;  3OOV A;  4OQH A;  2ZQ8 A;  5TJJ A;  2BAS A;  1BLH A;  2AVX A;  3UE0 A;  2M7V A;  3IF6 B;  4FUW A;  2OSU A;  4KZ8 A;  3KYZ A;  1K25 A;  4F3L A;  3ZHH A;  3LY3 A;  4D60 A;  2K2N A;  5A8B A;  4MMN A;  4OLD A;  1RGZ A;  2WKE A;  4WMC D;  4NXF A;  3MKF A;  3F1O B;  1IYS A;  4Y3I A;  4PAU A;  4EQ1 A;  4CLC A;  4EET B;  1YLT A;  2VZW A;  4OOL A;  2R78 A;  5A90 A;  1ONH A;  3IH8 A;  2BTF P;  3PHY A;  3LI9 A;  4BD0 A;  5CED A;  2VGL M;  4KQO A;  4IVI A;  1HTZ A;  2VK3 A;  4II7 A;  2P7J A;  2JC7 A;  3GTC A;  4I38 A;  5EFW A;  2Y2I A;  3LGO A;  4U0X A;  3T12 B;  3VSL A;  2EWV A;  3VFH A;  4L9F A;  3WS2 A;  2EWW A;  4UHU A;  3B3X A;  1VEU A;  1G68 A;  2V2F F;  4BJP A;  5GHY A;  1RP5 A;  4N1X A;  3ULF A;  1IOU A;  1PWD A;  2WKR A;  1I2S A;  1DP8 A;  4EQI A;  3BFE A;  3LY4 A;  2P04 A;  1K55 A;  4Y0O A;  3Q7V A;  2WAD A;  3LYX A;  3EQU A;  1NYM A;  2J7V A;  3NJA A;  1J3W A;  1G28 A;  3G34 A;  1FOF A;  4EUV A;  2G7U A;  4OQG A;  1SKO B;  2Y2G A;  4NEE D;  5J7E A;  2GJ3 A;  2VKS A;  3T4J A;  4OLG A;  3BYD A;  1XXM A;  4DF6 A;  3T4O A;  2WGI A;  2E8J A;  2Z6D A;  1AWI A;  3HBR A;  3TG9 A;  1PYY A;  2V0U A;  3NY4 A;  2YKF A;  1TS0 A;  4YFM A;  2XFT A;  3IXH A;  5MC7 A;  2O9C A;  4HJ6 A;  1VET B;  2WYX A;  4IHQ A;  1XX2 A;  5EE8 A;  1LSV A;  3IF6 A;  4C3Q A;  1W7F A;  2IWD A;  5DTK A;  3UO9 A;  3EQV A;  1SZV A;  3BQA A;  1H0M A;  1H8Z A;  5F1G A;  3O3V A;  1VHM A;  3E4Q A;  5TFQ A;  4EBN A;  3F1O A;  4K91 A;  2W1T B;  4S2M A;  3WS5 A;  2RL3 A;  4Q8I A;  2DCF A;  4LEN A;  3KSF A;  1KVM A;  3MSH A;  2ZM0 A;  1YLW A;  2B02 A;  1OTA A;  3MFX A;  1IYO A;  4GLQ A;  2GNX A;  1TVF A;  4O7D A;  2XEP A;  3ZFZ A;  4UA7 A;  3AGD A;  3D9Y A;  3FYZ A;  4QB8 A;  1YSP A;  5EM1 A;  1JTD A;  3M6H A;  2PR6 A;  2Y91 A;  2H0Y A;  4R3B A;  2JHE A;  3GQZ A;  3VV4 A;  5KSH A;  1MZU A;  4E3K A;  4WMC A;  2JBF A;  3V50 A;  2O9B A;  3A3I A;  4X1M A;  4IVK A;  2PYR A;  1FCN A;  2PBY A;  2ZQC A;  4LRX C;  4EU0 A;  1SKF A;  3A3D A;  3A3J A;  5EPH A;  4QY6 A;  4KG6 A;  2XH9 A;  2ZQA A;  2PHY A;  4HHD A;  5F69 A;  2QZ6 A;  1PFL A;  3ZDJ A;  2O0Y A;  3VP0 A;  5HPI A;  4ETX A;  2W0N A;  1YLP A;  1SKO A;  2V0W A;  4OPZ A;  4O01 A;  4HH3 A;  4BBU A;  4EES A;  2RCX A;  2XA7 S;  1KGF A;  5GHZ A;  3V5M A;  4WZ5 C;  1GHM A;  3IBR A;  5F1F A;  4CJN A;  1MWU A;  1VET A;  4ESP A;  1ERQ A;  3WWX A;  2VLG A;  2QMI A;  2M7U A;  2PRF A;  4R38 A;  2B95 A;  4KQR A;  4KZA A;  1W63 Q;  3PBS A;  3UE1 A;  5DKL A;  4JBF A;  1AXB A;  3UB8 A;  4LCL A;  5AQA A;  5GLA A;  4ZJ3 A;  2W1R A;  3ZQ5 A;  1IEM A;  1TEM A;  4GDN A;  3R7W B;  2V1Z A;  3L9K A;  2W1T A;  4MEZ A;  1DJC A;  1MWR A;  1BLC A;  4EBP A;  2QKP A;  1ZG6 A;  3T4K A;  5F82 A;  2XR0 A;  2D02 A;  2ZC5 B;  4YNR A;  2Y2O A;  2HDR A;  5D3O A;  1OME A;  1LSW A;  4I3A A;  4PHT A;  4OOM A;  1N9O A;  2R9W A;  2I72 A;  2O99 A;  1S66 L;  4X56 A;  1KOU A;  2PU2 A;  2C6W B;  2VV8 A;  1WA9 A;  4KEN B;  1N9B A;  3C38 A;  4OPQ A;  2H5S A;  1MC0 A;  5GLD A;  5CRF A;  4KQD A;  4Y2F A;  3UY6 A;  5FI2 A;  1LL9 A;  2P74 A;  4KZB A;  4IED A;  4N9L A;  1XFN A;  3BFG A;  4A5R A;  4DE0 A;  4JF5 A;  3QP6 A;  3E98 A;  2C5W B;  3UMD A;  1V9Y A;  4CQH A;  2P08 A;  4G3V A;  1SCW A;  1W63 M;  1K57 A;  3NEC A;  3VSK A;  1KDW A;  1E25 A;  1NLY A;  4X1L A;  3OPR A;  1E4D A;  5L07 A;  3ICY A;  4HIA A;  2GDN A;  2J3T C;  1PWC A;  3LR5 A;  3PBN A;  4L0L A;  1NY0 A;  4GD8 A;  5E2H A;  1TS8 A;  4MDZ A;  3IX3 A;  3QP1 A;  1STZ A;  1XPB A;  3NBL A;  1H8M A;  1MPL A;  2VA0 A;  5DF8 A;  5E43 A;  4IBR A;  4OKP A;  4P87 A;  1YAX A;  4MBK A;  4PPR A;  4L9E A;  1FR1 A;  2Y2J A;  1K0K A;  1W79 A;  4GB7 A;  2J3W A;  4EXO A;  3BEB A;  2GX5 A;  4NXB A;  4CLC D;  3IX4 A;  4UQI S;  4ZAM A;  4OP5 A;  1H8Y A;  3UB6 A;  3O86 A;  2ZC4 B;  3R7W A;  1BZA A;  2QPN A;  1IEL A;  3O88 A;  4EUZ A;  5CTN A;  1PRQ A;  3HLW A;  5DF9 A;  1PW8 A;  5HAR A;  3HLE A;  1TS7 A;  1L0F A;  1Z09 A;  3PTE A;  4LV2 A;  3E2L A;  3EEA A;  4F94 A;  1OTE A;  5FDS A;  4R3A A;  3NOT C;  2MJ6 A;  2ZQ7 A;  5EOO A;  5FQQ A;  3SH7 A;  2WKQ A;  2A3U A;  1K4E A;  1D1J A;  3BEC A;  1P0Z A;  3HRE A;  1EW0 A;  2Z2M B;  2R9X A;  3FWL A;  3MKE A;  5I94 A;  4NXG A;  1PNE A;  4WLA A;  2GZA A;  3DBA A;  5G18 A;  2OAP 1;  4S2K A;  2PDR A;  4CLC E;  5FI6 A;  4IJG A;  4EEU A;  4KUK A;  1HZO A;  5A93 A;  3W4Q A;  1J9M A;  1ZKJ A;  2A2L A;  2X71 A;  2KOI A;  4LLO B;  5CGX A;  2B18 A;  3HLC A;  2V9A A;  4UA9 A;  5CER A;  4B9O A;  3TSG A;  3LR3 A;  2OAQ 1;  3BM6 A;  4WF0 A;  4IBX A;  4P6Z M;  1PIO A;  4WM9 A;  5HFO A;  4PM6 A;  3WRZ A;  3B33 A;  3MXS A;  4KZ9 A;  1CEF A;  2G2W A;  2ZOH A;  5J4E A;  4BEN A;  4OPR A;  3NHQ A;  1ES5 A;  3TE8 A;  5DJT A;  3DTM A;  1ACF A;  1KGE A;  3NCK A;  2ZC7 A;  2WKH A;  4R70 A;  3IX8 A;  5CTM A;  5CX7 A;  1JVJ A;  3K3C A;  2D01 A;  3P01 A;  2H10 A;  3RXX A;  4B4Z A;  4DJ2 A;  2EX9 A;  4QPR A;  1GSX A;  3MQ0 A;  3GDI A;  5FEG A;  1TF1 A;  3HUO A;  3MXR A;  4O8G A;  5EEC A;  4EBL A;  4MN7 A;  1BLP A;  2W27 A;  1YLY A;  4S2I A;  2ZJ9 A;  3S7N A;  2FFF B;  5BOH A;  3UE3 A;  1K4F A;  4S2N C;  1Q2P A;  3RFB A;  1FCM A;  4X55 A;  3DTK A;  3LCE A;  2LB5 A;  1G6A A;  1SDN A;  5A91 A;  1IYP A;  2W3D A;  4WN5 A;  3LR0 A;  1K6S A;  3TJZ C;  4WYY A;  4LPZ A;  1GHI A;  4XT2 B;  3SS4 A;  1A0K A;  1UWN X;  1OJG A;  1DJA A;  1M6K A;  3VOZ A;  3FKW A;  3I7J A;  3H7W B;  4DE1 A;  3A0S A;  2DNS A;  2ZBB A;  4KUO A;  5IU1 A;  1OJ5 A;  1OTI A;  3T50 A;  2NUP C;  4Y13 A;  3E4P A;  2EX2 A;  2HJE A;  3S22 A;  1XA1 A;  3LIF A;  5EVI B;  5TR7 A;  1F98 A;  3S7P A;  3NDE A;  2WGV A;  3U2A A;  4Y0U A;  3T4Q A;  4YOF A;  4X25 A;  1EI5 A;  3OLO A;  3K2N A;  3G32 A;  3EGX C;  3HLG A;  3LI8 A;  5HL6 A;  3BJN A;  3D4F A;  4GHI B;  1V9Z A;  2VV7 A;  1GA0 A;  2V8C A;  2ZM8 A;  1XJ3 A;  3LR4 A;  3ZG8 B;  3ZVT A;  3H82 B;  3RXW A;  3R4K A;  2ZQ9 A;  3IHA A;  1BYW A;  2ZMV A;  5CEB A;  4Q0I A;  4U0T A;  3S4X A;  3DTE A;  3LIC A;  4GS9 B;  3AGE A;  5G4Y A;  3ZVW A;  3F1N B;  1KDS A;  2J8Y A;  1W8Y A;  2ZOI A;  4DN0 A;  4K0X A;  4ETZ A;  1NZU A;  1P97 A;  2W3F A;  2PYP A;  2Z2L B;  2NUT C;  2A24 B;  1KVL A;  3MZD A;  3ITA A;  3LIB A;  5DFX A;  3NC8 A;  4P85 A;  5FA7 A;  5DFY A;  1K54 C;  3VP4 A;  4WZ4 A;  4GD6 A;  1DP6 A;  2WKP A;  3ZG0 A;  1S4S A;  5HAQ A;  5KMW A;  4JGO A;  3WRT A;  2HGV A;  4C75 A;  3MQO A;  5A92 A;  3LFV A;  4PKY A;  4R4S A;  1GCE A;  4DJ3 A;  2J3T D;  2PD8 A;  2XD1 A;  3CJM A;  4XT2 A;  1IKG A;  1H5X A;  3S1Y A;  3BLM A;  3C7U A;  1YLJ A;  3H7W A;  3CG5 A;  4Y0T A;  4FH4 A;  3CI6 A;  2Y59 A;  1FCO A;  3EGD C;  5E2F A;  3LUQ A;  2KX6 A;  3T1R A;  5EVI A;  5EVL A;  2FZ0 A;  3T1X A;  2Y2N A;  4Q0H A;  4YIN A;  5L8M A;  1JWP A;  1IFQ A;  3RTY A;  4ZRR A;  4MBF A;  1EWZ A;  2VGJ A;  1JWV A;  3D3O A;  4GNU A;  1VM1 A;  4QHC A;  4UAA A;  4GHI A;  3HCY A;  3Q1F A;  2XK1 A;  3BQ8 A;  1Z6F A;  4FD8 A;  1P9R A;  3H82 A;  3RH8 B;  3HUN A;  1NYY A;  4FH2 A;  4Z9Q A;  4JGR A;  4WZ5 A;  4OOY A;  3S7O A;  2Y2Q A;  3MMH A;  1X0O A;  4GS9 A;  1G5U A;  5F68 A;  2I9V A;  3F1N A;  3MZE A;  5F5Y A;  1MKM A;  2ZC3 B;  3LEZ A;  5EVI C;  1YT4 A;  3G4P A;  1KE4 A;  3PAG A;  1ODV A;  5FQJ A;  3E0Y A;  2ZMA A;  3ITB A;  2A24 A;  3UB9 A;  5FQK A;  2W3E A;  1S1Y A;  5L10 A;  4X53 A;  1S6R A;  3JPU A;  5GL9 A;  3IXD A;  5FI7 A;  4HEF A;  1GHP A;  2JN7 A;  1OTB A;  1ZG4 A;  4ID4 A;  4NET A;  3EOI A;  4C6Y A;  4JGQ A;  3LEQ A;  4ZTK A;  4BMW A;  2XLN A;  4LRY C;  3GRJ A;  1ALQ A;  1ZTU A;  1PZP A;  1LL5 A;  5GHX A;  2PD7 A;  4FCF A;  3AGF A;  2P9V B;  1SDE A;  5HDS A;  1HLU P;  1H3Q A;  4E3M A;  1OTD A;  3HJK A;  2XFS A;  2L0W A;  1BUE A;  3G2Z A;  4RA7 A;  3VMA A;  1DP9 A;  1LSX A;  3KYQ A;  1Q2Q A;  4HNB A;  3P98 A;  5KIZ A;  1TDG A;  2JCH A;  4NK3 A;  3GR2 A;  4KZ7 A;  4WEK A;  1NZO A;  4JXS A;  4DDY A;  2UWX A;  1QME A;  4Y17 A;  2Q9M A;  3SS3 A;  3CUE C;  4E3N A;  5AVE A;  4JF6 A;  4E3J A;  3FZC A;  2Y4A A;  3DWZ A;  5IS1 A;  2KLI A;  4HP9 A;  1P9W A;  4H6J B;  4XUX A;  5TGF A;  3OC2 A;  3QNC A;  5HZH A;  4RVA A;  4LGW A;  3GVB A;  4GN2 A;  4ME4 A;  1ERO A;  3OPH A;  2OV5 A;  1HD8 A;  1Y28 A;  4OPY A;  3LID A;  4JXV A;  2Q9N A;  3N8L A;  4AFI A;  3WS0 A;  4RX2 A;  2O9A A;  1XGJ A;  1XP4 A;  3UPN A;  3M6B A;  2VGL S;  5CXW A;  1T1C A;  4BBT A;  4OON A;  1ZHH B;  2XD5 A;  1GA9 A;  3BRM A;  2OOL A;  3IWI A;  3VOL A;  5CHJ A;  4NXE A;  4MCW A;  4MN5 A;  3NI9 A;  3SH8 A;  2Y2L A;  5AJG A;  3NDG A;  3W2Z A;  2EFU A;  2V8F A;  1S1Z A;  5HWV A;  3NOP C;  3FC7 A;  4KZ6 A;  4FSF A;  3EEH A;  4EV4 A;  2XGN A;  2P9V A;  1RGY A;  2K31 A;  3N8R A;  3OCL A;  2QWS A;  2DRW A;  5C5K A;  2J9P A;  2Y79 A;  1ONG A;  2V1B A;  5HDD A;  2XRO A;  3O87 A;  2OWH A;  4HJ3 A;  3A0V A;  5F6A A;  4S2J A;  1WYB A;  3UB7 A;  3OCN A;  3IBJ A;  1LT0 A;  1PW1 A;  4GZB A;  3T4T A;  3MQQ A;  1ZC2 A;  5GLC A;  5GLB A;  4HI4 A;  1DY6 A;  2YKH A;  5FQ9 A;  5F83 A;  3V39 A;  2XRN A;  4E04 A;  3L7H A;  4RQ9 A;  2QYB A;  2Z6C A;  5HSQ A;  1ERM A;  1BTL A;  4EEP A;  1JNU A;  3OBF A;  3KSI A;  4H6J A;  2W3G A;  5IHV A;  1D06 A;  4OQI A;  1QMF A;  5FQM A;  2J9O A;  3VE4 A;  4E3O A;  4QY5 A;  5CHU A;  2FFY A;  3SH9 A;  3ZGA B;  4EER A;  1MWT A;  1MKI A;  5DJU A;  1I5Q A;  3GEC A;  4HJ4 A;  1PWG A;  2Q0O A;  5DF7 A;  3G31 A;  2WKI A;  5FL3 A;  4B93 A;  1KGG A;  4XXR A;  1CF0 A;  1DRM A;  3B47 A;  4JGP A;  2INW A;  5JYO A;  3UDX A;  5U47 A;  3ZG9 B;  3RJU A;  2DMW A;  4S2N A;  3VE3 A;  4UA6 A;  4KQQ A;  2L1M A;  2Y2K A;  1YQS A;  5G4Z A;  3HLF A;  5L09 A;  2Y2P A;  3E2K A;  2HPB A;  3CIT A;  4QWO A;  1MXO A;  3OPL A;  2IWB A;  1MWS A;  3C4O A;  4LV0 A;  3OPP A;  4L9G A;  3KO6 A;  4PM5 A;  1K6R A;  1W8Q A;  2QJ5 A;  3P09 A;  2Y2H A;  3KYE A;  5M19 A;  2ZLY A;  5CGS A;  2XA7 M;  3DW0 A;  3F1P B;  3PAE A;  1DJB A;  5FAO A;  1FSW A;  1W5D A;  3PR6 A;  5DTS A;  1FIK A;  1XJ4 A;  4OQ0 A;  3TRC A;  3KSH A;  1XJ2 A;  1L0G A;  5EVI D;  4NKP A;  4B4X A;  3PBR A;  4QJG A;  4Y7P A;  4OP8 A;  3MJQ A;  1YMS A;  4R3J A;  2QHK A;  5FAS A;  3IXG A;  4KZ4 A;  3N6I A;  3B42 A;  3A3E A;  2JE5 A;  1JWZ A;  2ZMF A;  3VOY A;  4X6T A;  3Q7Z A;  2HP6 A;  4S2P A;  1XGI A;  5KSC A;  1NXY A;  2K7S A; 
#chains in the Genus database with same CATH homology
 3UB8 A;  4ARZ B;  3C30 A;  2W1R A;  3ZQ5 A;  3H7W A;  4G3K A;  3CI6 A;  2JKR M;  3R7W B;  3EGD C;  2W1T A;  4I5S A;  3LUQ A;  2KX6 A;  3JVU A;  2JKT I;  2QKP A;  3T4K A;  2KDK A;  2FZ0 A;  2D02 A;  1UWP X;  4GJ4 A;  4Q0H A;  5L8M A;  4YNR A;  1IFQ A;  3RTY A;  4ZRR A;  3MF0 A;  1LSW A;  4I3A A;  4I3I A;  1UGU A;  3D3O A;  4PHT A;  4F3L B;  3BW6 A;  4OOM A;  1N9O A;  4HY8 A;  2O99 A;  1S66 L;  4GHI A;  3HCY A;  1KOU A;  3BY9 A;  4GCZ A;  5DKK A;  3UME A;  2VV8 A;  1WA9 A;  3BQ8 A;  2HF6 A;  3C38 A;  1P9R A;  3H82 A;  3RH8 B;  2XSS A;  1MC0 A;  4CLC B;  4KQD A;  4Y2F A;  3JVV A;  4JGR A;  3CLO A;  1XFN A;  1T1B A;  3S7O A;  3MMH A;  3E98 A;  1NLZ A;  1NWZ A;  3UMD A;  3FPW A;  2IA2 A;  1V9Y A;  1X0O A;  4CQH A;  4GS9 A;  5F68 A;  4DMZ A;  4BWI A;  2I9V A;  3F1N A;  3S7Q A;  2P08 A;  4G3V A;  5F5Y A;  1MKM A;  1YSQ A;  5AVF A;  3P7N A;  1W63 M;  1ODV A;  3E0Y A;  3F1P A;  1GSV A;  2A24 A;  3UB9 A;  4I3J A;  4HQA A;  3A0R A;  1NLY A;  1S1Y A;  2W3E A;  1VB6 A;  3MXQ A;  4O0P A;  3ICY A;  5HD5 A;  5IT5 A;  4HIA A;  1LL8 A;  5HD3 A;  2JN7 A;  1OTB A;  2J3T C;  3LIA A;  1GSW A;  3LR5 A;  3PBN A;  3FPV A;  4CLC C;  3EOI A;  4L0L A;  1TD5 A;  2PR5 A;  4Y5F A;  1TS8 A;  4MDZ A;  4JGQ A;  1STZ A;  4UQI M;  3C8C A;  4BMW A;  1H8M A;  4LRY C;  3V67 A;  1T19 A;  1ZTU A;  2VA0 A;  3TW8 A;  1F5M A;  2PD7 A;  4Z1W A;  1YAX A;  3PBO A;  2V1A A;  4L9E A;  5HDS A;  1OPX A;  2J3W A;  1H3Q A;  4G3W A;  3PYP A;  4EXO A;  2JKR I;  1OTD A;  3HJK A;  2GX5 A;  4NXB A;  4CLC D;  3E4O A;  2L0W A;  1NRJ A;  4UQI S;  4ARZ A;  4BBV A;  3KX0 X;  1DP9 A;  3HJI A;  5TBM B;  1N9L A;  1LSX A;  3D72 A;  3KYQ A;  3UB6 A;  4HNB A;  2EA9 A;  2OWJ A;  1T18 A;  3PBQ A;  5KIZ A;  4PKY G;  3R7W A;  1XJ6 A;  1S4R A;  3OOV A;  4WEK A;  5TJJ A;  4HH2 A;  2BAS A;  5DF9 A;  1XFQ A;  2M7V A;  1TS7 A;  2Y8H A;  3KYZ A;  4F3L A;  3CUE C;  3EEA A;  2K2N A;  3UE6 A;  3C2W A;  5AVE A;  1OTE A;  5A8B A;  4MMN A;  4R3A A;  3NOT C;  2MJ6 A;  1G6O A;  3BWL A;  4NXF A;  5IS1 A;  2KLI A;  2WKQ A;  4HP9 A;  3F1O B;  1P9W A;  3PXP A;  4H6J B;  4Y3I A;  1P0Z A;  4PAU A;  1EW0 A;  4EQ1 A;  4CLC A;  4EET B;  4OOL A;  2HJ9 C;  2VZW A;  3OC2 A;  4NXG A;  2R78 A;  5HZH A;  4WLA A;  3PHY A;  4ME4 A;  3LI9 A;  2GZA A;  2VGL M;  4KQO A;  3DBA A;  1Y28 A;  2OAP 1;  2LB9 A;  3LID A;  5HWW A;  2PDR A;  4CLC E;  4II7 A;  4AFI A;  4IJG A;  4M4X A;  4EEU A;  2P7J A;  4KUK A;  2O9A A;  4I38 A;  2CMN A;  4WEL A;  2A2L A;  5EFW A;  2KOI A;  4UEY A;  4LLO B;  2B18 A;  2VEA A;  2EWV A;  2W3H A;  2VGL S;  4WEJ A;  1T1C A;  2V9A A;  4L9F A;  4BBT A;  3IS2 B;  1ZHH B;  4B9O A;  2EWW A;  3LR3 A;  2OAQ 1;  2OOL A;  4LRZ E;  4P6Z M;  4WF0 A;  3VOL A;  4NXE A;  4MCW A;  4MN5 A;  4BJP A;  1T1A A;  5AJG A;  3ULF A;  3W2Z A;  3B33 A;  1IOU A;  2WKR A;  1S1Z A;  5HWV A;  3NOP C;  2ZOH A;  5J4E A;  1DP8 A;  3NHQ A;  3FC7 A;  3TE8 A;  5DJT A;  2P04 A;  3CUE A;  4FSF A;  4P6Z S;  3LYX A;  3EEH A;  4R70 A;  4MN6 A;  3G6O A;  5CX7 A;  3EQU A;  3K3C A;  2D01 A;  3P01 A;  4IUK A;  5I5L A;  3NJA A;  1G28 A;  4DJ2 A;  3K3D A;  5HPF A;  4EUV A;  2K31 A;  4QPR A;  1GSX A;  3OCL A;  2G7U A;  3MQ0 A;  3GDI A;  1TF1 A;  2QWS A;  4NEE D;  5J3W A;  5C5K A;  5J7E A;  2GJ3 A;  4O8G A;  4R6L A;  2VKS A;  2Y79 A;  3T4J A;  3T4L A;  5TBM A;  4MN7 A;  2V1B A;  2W27 A;  3CWF A;  4K08 A;  5HDD A;  3T4O A;  2XRO A;  5K5B A;  3S7N A;  2OWH A;  4HJ3 A;  3A0V A;  2Z6D A;  1F9I A;  5F6A A;  3UB7 A;  3UE3 A;  2PT7 A;  2V0U A;  3O5Y A;  2YKF A;  4Q0J A;  3RFB A;  1TS0 A;  3OCN A;  3IBJ A;  5MC7 A;  1LT0 A;  2O9C A;  2LB5 A;  4HJ6 A;  3T4T A;  3MQQ A;  4IHQ A;  3ZYT A;  1LSV A;  2W3D A;  4WN5 A;  3LR0 A;  2M1C A;  3BY8 A;  4HI4 A;  3TJZ C;  4LPZ A;  2YKH A;  4XT2 B;  5LBR A;  2XRN A;  1UWN X;  3CAX A;  1OJG A;  1D7E A;  4E04 A;  3EQV A;  3BQA A;  2HV1 A;  2L4R A;  3H7W B;  4RQ9 A;  3A0S A;  2QYB A;  2Z6C A;  3MR0 A;  5HSQ A;  1VHM A;  2ZBB A;  3E4Q A;  4KUO A;  5IU1 A;  1OJ5 A;  1OTI A;  3T50 A;  3PBT A;  3F1O A;  2NUP C;  4EEP A;  1JNU A;  2W1T B;  3E4P A;  3KSI A;  3OBF A;  4WUJ A;  4H6J A;  2W3G A;  2HJE A;  3LIF A;  1D06 A;  3KSG A;  1F98 A;  3S7P A;  2FH5 A;  3VE4 A;  3U2A A;  1TS6 A;  3KSF A;  2VV6 A;  3T4Q A;  4YOF A;  2VX8 A;  3OLO A;  2B02 A;  1OTA A;  3K2N A;  3MFX A;  4EER A;  4GLQ A;  3SW1 A;  2GNX A;  2JKT M;  3EGX C;  3LI8 A;  5DJU A;  5HL6 A;  3GEC A;  4HJ4 A;  4YWZ A;  3BJN A;  4GHI B;  1V9Z A;  3NOU C;  1S67 L;  3FG8 A;  2VV7 A;  5FL3 A;  2QJ7 A;  1XJ3 A;  4B93 A;  1YSP A;  3LR4 A;  4GW9 A;  1DRM A;  3H82 B;  3R4K A;  3IS2 A;  3B47 A;  4JGP A;  2INW A;  2PR6 A;  1OT6 A;  1BYW A;  2ZMV A;  4WL9 A;  2DMW A;  3T4S A;  2JHE A;  3VV4 A;  3VE3 A;  4Q0I A;  5KSH A;  1MZU A;  2L1M A;  5G4Z A;  2O9B A;  3LIC A;  4GS9 B;  3CIT A;  5G4Y A;  3F1N B;  3H9W A;  4FOF A;  2PYR A;  4LRX C;  4IUH A;  4HOI A;  2ZOI A;  4EU0 A;  4DN0 A;  4L9G A;  3KO6 A;  3LIE A;  4ETZ A;  2QJ5 A;  1P97 A;  2W3F A;  2PHY A;  4HHD A;  2XA7 M;  5F69 A;  2PYP A;  3F1P B;  2NUT C;  2A24 B;  2H28 A;  2O0Y A;  3LIB A;  5HPI A;  5DFX A;  3PR6 A;  4ETX A;  2W0N A;  1XJ4 A;  3TRC A;  3KSH A;  1OT9 A;  2V0W A;  1XJ2 A;  4O01 A;  4HH3 A;  5DFY A;  2VJW A;  4NKP A;  4BBU A;  1N9N A;  3PBR A;  4EES A;  2J80 A;  1DP6 A;  3EWK A;  5HDC A;  3MJQ A;  2WKP A;  2XA7 S;  4EW7 A;  1S4S A;  4I39 A;  2QHK A;  4JGO A;  3B42 A;  2HGV A;  4HP4 A;  5HWT A;  3IBR A;  3MQO A;  2ZMF A;  1YKD A;  3LFV A;  4PKY A;  4DJ3 A;  2J3T D;  2VLG A;  2M7U A;  2PD8 A;  4R38 A;  4XT2 A;  1W63 Q;  3PBS A;  5DKL A;  2K7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...