1NYYA

Crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (105)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Recognition and resistance in TEM beta-lactamase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 96
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1nyyA00
3BFFA 4DE0A 1IELA 4WEKA 2WKEA 4KQRA 4ZBEA 4DRTA 3ZFZA 1PZPA 2V20A 3V5MA 4HEFA 3OZHA 3C4OA 1PZOA 1NXYA 2ZC4B 4OP8A 4OPYA 5EE8A 5F1FA 2ZC7A 3S1YA 2ZQAA 4OP5A 4X68A 2ZM8A 2HDRA 5EUAA 4N1HA 4YINA 1LHYA 3O87A 5G18A 4E3LA 2XR0A 3GR2A 3BFGA 2EX6A 4ZTKA 2WGWA 2QMIA 5DTTA 4D2OA 1KE0A 1PWGA 3HL9A 3MZEA 1QMEA 4GOGA 4ZJ1A 5HL1A 4S2KA 1HVBA 3OPHA 4C6YA 5CHMA 2HDSA 2JBFA 4WZ4A 5E2GA 1L0DA 4ZAMA 2RCXA 4JF5A 2OSUA 2DRWA 2XLNA 3LEZA 3BFCA 1PW1A 1E3UD 3V3SA 3QNBA 2ZQCA 3Q7ZA 4CPKA 3TSGA 4BL2A 3ZG5A 4KZ4A 3ZNYA 4Y0TA 4NK3A 1JWZA 3A3IA 2WUQA 1RCJA 2C6WB 1SDNA 2X71A 2RL3A 2WGWB 3IH8A 3M6BA 2Z2LB 5D3OA 3ZDJA 2PBYA 1MPLA 4FD8A 4FH2A 4JPMA 3UE3A 1K57A 3O3VA 2R9WA 3Q81A 4GB7A 1BUEA 4Z9QA 4DXBA 5M1AA 5CRFA 1IYPA 3NDEA 2ZD8A 3VP1A 1K54A 1W8QA 2Y59A 4X56A 3N4IA 1W8YA 1K38A 5FDHA 1K54C 3Q82A 4FCFA 5FQ9A 3A3JA 2HDUA 3G32A 3FWLA 3IWOA 3NY4A 4IVKA 5FQQA 4DF6A 2IWCA 5TR7A 3IXBA 2Y2PA 3GVBA 4S2IA 1CI8A 4MNRA 4P85A 2Y2IA 4EBNA 4KG2A 1BTLA 2ZMAA 3UY6A 1ONGA 2Y2OA 4IEDA 2H0TA 3UE1A 3NC8A 5I94A 2J9PA 1NZUA 3JYIA 4QY5A 4BJPA 3MKFA 5DVAA 4KZ3A 2XD5A 3HUNA 3GMWA 2ZQ8A 4KQQA 4MBKA 4E3JA 5EPHA 1J9MA 4LCLA 3G30A 3HUMA 4PM7A 3UPPA 4XXRA 4PPRA 5DTSA 2VGKA 3MFDA 4RVAA 1ONHA 4R0QA 4QJGA 3AGEA 3OCLA 1S0WA 2G2WA 2PU2A 2WZZA 4P0MA 4K0WA 1FCOA 4KZ8A 5F82A 3HBRA 2XFTA 4RX3A 3SOIA 3HLDA 3IT9A 5J8XA 4X53A 1ZKJA 3ITBA 3WS5A 3ZVTA 5L2FA 2WKIA 4N9KA 4UA9A 3GQZA 1ES5A 1ERMA 2DNSA 4JXGA 3C7VA 2R9XA 2WADA 2A3UA 5M18A 1BLCA 5DF8A 4QB8A 4U3TA 3HLCA 3W4OA 1LI9A 3UNWA 2XFSA 3OC2A 1PW8A 3BLSA 2QPNA 3UE0A 5GLCA 5EVLA 5FQMA 3DWKA 4LV3A 4Y7PA 3VMAA 1K6SA 3IH9A 4Q8IA 2XD1A 4JXWA 5M19A 1KGEA 4IBRA 2ZC3B 2H5SA 1BZAA 1GA0A 4KZ9A 4OQHA 1S6RA 3ZG9B 3NDGA 1H8ZA 4R23A 2WZXA 4GD6A 2BLSA 4JXVA 1JWPA 3VFFA 4WZ5A 1K25A 1CI9A 3BYDA 5FQJA 1E25A 2Y2LA 3M2JA 3PBSA 2FFFB 1PIOA 3VFHA 4JLFA 2X01A 3M2KA 4OLGA 4ID4A 4OOMA 4WELA 4DE2A 4GKUA 3WS1A 2XF3A 4LV2A 4WEJA 3PAEA 3BRMA 2EX8A 5E2HA 5CERA 3P09A 1M40A 4E3IA 4WYYA 5CGXA 5GLDA 3ITAA 1MBLA 3GSGA 4S2PA 5HAPA 5A91A 1DJAA 1YMSA 4MEZA 1DJCA 3I7JA 4OH0A 3V50A 4OQ0A 1GHPA 4QHCA 2HDQA 3EQUA 2IWDA 4UHUA 4WM9A 4XUZA 3NI9A 4KZAA 2WYXA 3IHBA 3V3RA 1L0GA 1WYCA 4GZBA 3ZVWA 5FA7A 3PBNA 1XKZA 4N1XA 3RXWA 4UA6A 4N92A 3MXSA 3BEBA 4Y0UA 1GA9A 4WBGA 1L0EA 4KZ5A 1Y54A 5FI6A 3HVFA 4QD4A 3G34A 1FOFA 1ALQA 1JTGA 1ESUA 3VP4A 2ZC5B 3HLGA 3OPRA 4DE1A 3LY3A 5E2FA 1WE4A 4OOYA 5AQ9A 4ZJ3A 3NCKA 1U60A 1ES2A 1HZOA 1K56A 2P74A 5FAPA 5FI2A 5TGFA 3HLEA 2E8IA 4KENB 5HX9A 4OPRA 2OV5A 3SH9A 4WMCA 1YM1A 1K57C 3CMZA 3ZG8B 1JWVA 4S2MA 5F83A 2JE5A 4OPZA 5CGSA 4UA7A 4R1GA 3MZDA 3IXGA 1YQSA 4A5RA 3WS2A 4EBLA 1HD8A 1MKIA 4GD8A 4JXSA 3HLBA 3A3DA 5GHXA 4HESA 1G68A 3CJMA 3SH8A 4DDYA 3N7WA 3RJUA 1ES3A 1TEMA 3PTEA 2FFYA 3VP0A 2P9VA 3IXHA 1SHVA 3BLMA 4KG6A 1NY0A 2HP6A 3N8LA 3UPNA 5A92A 4PMAA 1DY6A 5A93A 1LLBA 3VOYA 2X02A 1E4DA 4M3KA 4BD1A 1PI5A 1KGGA 2WAEA 4JF6A 1LL5A 3CG5A 5CGWA 4DE3A 5GLBA 2WK0A 1KVMA 1PWDA 3DTMA 3W4PA 4BENA 5A90A 1ESIA 1PI4A 1YLZA 3PBQA 2HP9A 1YLWA 1CEFA 1C3BA 2P9VB 1NYMA 3SH7A 3S22A 3MZFA 1BULA 4DKIA 3C4PA 1VM1A 1XPBA 4KZ7A 1PYYA 3BM6A 3PBRA 5E43A 5AQAA 5FSRA 4R4RA 2WKHA 1IYQA 1NRFA 2WGIA 3PBOA 5JYPA 1HTZA 2B5RA 3MBZA 2Y55A 5CTMA 5BOHA 4FH4A 1K55A 1XXMA 1YLYA 4L0LA 3ZCZA 1NJ4A 2Q9NA 3G35A 4JBFA 2DCFA 3VSLA 3B3XA 5GHYA 2V2FF 4OPQA 4R3BA 3ZGAB 3A3EA 3ZG0A 4MBFA 4OKPA 1KDSA 4PM9A 3ZG7B 3OCNA 3VSKA 1L0FA 3UO9A 2EFUA 3MKEA 1IEMA 1EI5A 2OLUA 2ZM2A 5IHVA 5F1GA 2H10A 2Y2JA 1DJBA 3C5AA 4BLMA 5E2EA 1IKIA 1ES4A 4N9LA 1FSYA 4E6XA 4OOLA 1XA1A 1MWUA 2ZQDA 4XUXA 5HAIA 5KSHA 3WRZA 4JF4A 2EX2A 1CEGA 4WZ5C 3AGDA 5CEBA 3G2YA 1OMEA 1Q2QA 2VGJA 2EXAA 2XH9A 1LI0A 4IVIA 4K91A 3IWQA 4C75A 3HLWA 1TDLA 1FR6A 4OLDA 4U0XA 3SS3A 4ZDXA 1AXBA 2Y91A 2JC7A 2Q9MA 1IYOA 3A3FA 4JKTA 1BLPA 3FKWA 4O7DA 3FKVA 5HFOA 1MWRA 3HLFA 2ZLYA 1I5QA 1FSWA 1N4OA 3E2LA 5DF9A 1MY8A 3UN7A 2C5WB 5EOOA 1SKFA 3LO7A 4LV0A 1KVLA 5HW3A 1E3UA 4OVDA 3TG9A 4IBXA 5DF7A 5FAQA 2JCHA 4LENA 3GV9A 3WWXA 2EXBA 5GL9A 5FASA 4E3KA 1LL9A 3AGFA 3WRTA 1I2SA 4KZBA 2Z2MB 1MXOA 4MBHA 1K4EA 3BFEA 2J8YA 4B88A 3E2KA 3ZHHA 5KZHA 2V1ZA 2J7VA 1FQGA 3IWIA 5CXWA 1VQQA 4E3OA 5CTNA 4BL3A 1KE3A 4F94A 4OONA 5KSCA 3M6HA 2PU4A 1EWZA 2ZQ9A 5FQIA 1ZG6A 4C3QA 3W8KA 1Z6FA 3D4FA 5CHUA 3Q1FA 1YLPA 1XGJA 2Y2HA 1XX2A 5EVIA 4GDBA 1SDEA 3O86A 2HPBA 3IF6A 3CZDA 1ERQA 1W7FA 3DW0A 1CK3A 5CHJA 5EVIC 3IF6C 3BECA 3FV7A 2IWBA 3GTCA 3N8SA 3GRJA 3FYZA 4E6WA 1JVJA 1L2SA 4P6BA 3G31A 5FQKA 5GHZA 4RYEA 3IF5A 1RGYA 4B4XA 4MLLA 4E3MA 3BFDA 4CJNA 2XQZA 4S2OA 5U47A 3VP2A 4GNUA 3SS5A 3HREA 1W5DA 5EVIB 2I72A 5FATA 1NYYA 3IF6B 1BSGA 3IHAA 1TDGA 4DDSA 3FZCA 4FSFA 4ZJ2A 4GN2A 1RGZA 1QMFA 3PAGA 1GCEA 4QU3A 5FI7A 5KMWA 3Q7VA 3MXRA 4LV1A 4RA7A 4OQGA 2EX9A 1K56D 4S2JA 4KG5A 2H0YA 3QNCA 1SCWA 1ZC2A 2ZJ9A 4QY6A 1O7EA 4WMCD 4R4SA 1K6RA 3P98A 4RX2A 5EVID 3N6IA 4EQIA 2QZ6A 3NIAA 2GDNA 2UWXA 1YMXA 2OLVA 4S2NA 1PWCA 1G6AA 3W4QA 1BLSA 1BLHA 1WYBA 4X55A 5AQBA 1RP5A 4LCMA 4U0TA 3TOIA 4S2NC 4BQMA 1XA7A 2A49A 4EV4A 3IQAA 3Q7VB 2WGVA 4PM6A 4X6TA 1K55C 2Y2NA 3O88A 2XDMA 2Y2MA 3PBTA 4EBPA 3EQVA 2G2UA 4E3NA 3OPLA 3VP3A 1H8YA 4PM8A 1JTDA 1IKGA 2XK1A 4Y0OA 3UDXA 5TFQA 5CECA 1Q2PA 3LY4A 2EFXA 5CEDA 4EWFA 3HUOA 1MWSA 1XGIA 5HARA 1I2WA 4NETA 5GLAA 1O07A 3ZNTA 5DTKA 3N8RA 4R3JA 4KQOA 5JYOA 3QHYA 2Y2QA 1KDWA 1YLTA 2Y4AA 3NBLA 5EOEA 1KE4A 3UPOA 1GHIA 3WS0A 1W79A 3G2ZA 4HBUA 4P87A 4H8RA 3RXXA 3SS4A 1N9BA 4HBTA 4YFMA 1KGFA 2CC1A 2ZQ7A 4UAAA 3G4PA 2BG1A 1TVFA 4B4ZA 1YT4A 2Y2KA 1EROA 1FR1A 1K4FA 3UDIA 2Y2GA 5HAQA 5FAOA 1FCNA 1BT5A 2ZM0A 3DWZA 5AQ7A 3S4XA 2XEPA 3VOZA 4K0XA 2J9OA 4BD0A 3WS4A 2XGNA 3LCEA 4OQIA 3V39A 4S2LA 1XP4A 3UDFA 1H5XA 1GHMA 1NZOA 1YLJA 3C7UA 4GDNA 1IYSA 4KZ6A 3OPPA 5EECA 4X69A 3IXDA 2HP5A 4PM5A 1MWTA 1ZG4A 3ISGA 4EUZA 2WAFA 3Q07A 1M6KA 2ZC6B 1FCMA 4DXCA
chains in the Genus database with same CATH superfamily
3BFFA 1IOUA 4DE0A 1IELA 3LI9A 4KQRA 4DRTA 3ZFZA 3OZHA 1NWZA 3C4OA 1PZOA 2ZC4B 4OP8A 2INWA 5EE8A 4OP5A 4N1HA 1NLZA 3VOLA 3O87A 4E3LA 3GR2A 2VK3A 4ZTKA 2QMIA 1J3WA 1PWGA 3HL9A 4GOGA 2HDSA 2JBFA 2OSUA 2DRWA 2XLNA 3LEZA 4EESA 3BFCA 1OTAA 1ZTUA 3V3SA 3QNBA 4Y0TA 3NJAA 1RCJA 2RL3A 5D3OA 3ZDJA 2Z2LB 4FH2A 3UE3A 2R9WA 2W1TA 1GSWA 3RFBA 3T12B 3VP1A 1K54A 4WF0A 2PAVP 1K38A 4HQAA 1HLUP 1S1ZA 3Q82A 3A3JA 3E4OA 3G32A 5FEFA 2GZAA 2H0TA 2M7UA 2J9PA 1VHMA 4BJPA 2R78A 2W1TB 2PHYA 5DVAA 2JKTM 1TD5A 3EOIA 4KQQA 1J9MA 2W3HA 2VGKA 4RVAA 4QJGA 2VEAA 3OCLA 2WZZA 5J8XA 3HBRA 4RX3A 1OTEA 3IS2A 3ITBA 3WS5A 3LGOA 3ZVTA 2OAQ1 4L9FA 4N9KA 1LSXA 4EETB 1ERMA 1TS0A 1X0OA 2A3UA 3C30A 5HDSA 3W4OA 2XFSA 2PRFA 1PW8A 2ZOIA 3TE8A 3QP5A 5IU1A 2JKRM 3IS2B 4LV3A 4Q8IA 4EU0A 1T1BA 3CWFA 3LYXA 1NRJA 4LRYC 3E4QA 4JXVA 1JWPA 4MN7A 5CX7A 5FQJA 1E25A 1PIOA 3TJZC 4OOMA 4GKUA 4PKYA 1CJFA 4E3IA 4WYYA 5CGXA 5GLDA 1MBLA 2G7UA 4MEZA 4EW7A 1DJCA 1GHPA 4QHCA 4UHUA 3NI9A 4M4XA 2WYXA 3IHBA 1WYCA 3ZVWA 2O9CA 4UA6A 4N92A 4Y0UA 1Y54A 5HZHA 1ALQA 1ESUA 3F1OB 3RTYA 2ZC5B 3K3DA 4BBTA 4D60A 2OAP1 5FI2A 4KENB 3JPUA 1YPRA 3SH9A 1V9ZA 2FZ0A 5F83A 4R1GA 4I3IA 2GJ3A 3S7QA 3MZDA 3IXGA 3DTIA 1YQSA 1S66L 4JXSA 3A3DA 3N7WA 1ES3A 4LPZA 4FOFA 4KG6A 3LIFA 1NY0A 3UPNA 3R7WA 1E4DA 4M3KA 3CUEC 5CGWA 2W3FA 3DTMA 2VX8A 1ESIA 1PI4A 3CITA 3T1QB 5IT5A 3T1SA 2HP9A 3SH7A 4HH3A 4II7A 3C4PA 3BM6A 3KSGA 5AQAA 2V8FA 3NECA 3R7WB 2A24A 1HTZA 4HH2A 4I5SA 4FH4A 4EEUA 4Y13A 4L0LA 2ZL1A 3KSFA 3ZCZA 2Q9NA 3ZGAB 2V2FF 4MBFA 4OKPA 4F3LA 3OCNA 1L0FA 3UO9A 2EFUA 3B42A 5IHVA 1TF1A 2A24B 3C5AA 4BLMA 2ZQDA 2ZL1B 4WZ5C 2VGJA 4IVIA 3IWQA 4IHQA 4F3LB 3MJQA 2Y91A 2HZ5A 1IYOA 4G3KA 2QHKA 3FKVA 3S7OA 1MWRA 5EOOA 3LO7A 1KVLA 3QP6A 5G4ZA 1E3UA 3MR0A 4OVDA 1TS8A 4IBXA 2JCHA 4LENA 3GV9A 2EA9A 1P97A 3WWXA 2EXBA 4E3KA 3DTKA 3D9YA 3WRTA 3LICA 4MBHA 5TJJA 1VETA 1DP6A 3ZHHA 5L10A 1F9IA 5MC7A 4BL3A 5KSCA 1ZG6A 2B18A 4C3QA 3W8KA 3QP4A 1XGJA 1XX2A 2HPBA 1VETB 1W7FA 3BY8A 3P7NA 5CHJA 5EVIC 3FV7A 3MS6A 1JVJA 1L2SA 3G31A 2EWVA 5FQKA 3IF5A 1RGYA 4MLLA 3BFDA 4CJNA 3E0YA 4KUOA 3UB8A 3HREA 2BASA 1W5DA 2I72A 1BSGA 3IHAA 3H7WA 3FZCA 1RGZA 1QMFA 4UQIM 3PAGA 5KMWA 3Q7VA 2Q0OA 4LV1A 3DBAA 3T4KA 4R4SA 5EVID 3P98A 3NIAA 1YMXA 1RP5A 5HDDA 1S67L 5AVEA 3Q7VB 2XDMA 2G2UA 3T1XA 3OPLA 3EGXC 1JTDA 3UDXA 4Y0OA 3EEAA 5CECA 5CEDA 4DJ3A 3HUOA 4HOIA 4NETA 3FG8A 5DTKA 3N8RA 4QPRA 4H8RA 2CC1A 4PAUA 2Y2KA 1K4FA 5AQ7A 4K0XA 4KQDA 4I39A 3TW8A 1NZOA 1IYSA 4KZ6A 3OPPA 5EECA 4X69A 3IXDA 4B93A 1MWTA 1ZG4A 3ISGA 3SZTA 1Y28A 2ZC6B 3CLOA 4DXCA 2WKEA 3PR6A 2QJ5A 4HEFA 3UE6A 1NXYA 1NLYA 3S1YA 4X68A 4CLCC 2HDRA 2EWWA 5EUAA 2XR0A 3BFGA 2EX6A 2WGWA 5DTTA 4D2OA 3MZEA 3LR0A 1HVBA 3OPHA 4C6YA 5CHMA 3C2WA 4JF5A 1ODVA 3D72A 3TSGA 4KZ4A 3ZNYA 1JWZA 2C6WB 2WGWB 3M6BA 4Z9QA 1A0KA 5DJUA 4CLCD 5CRFA 2ZD8A 1Y4OA 4O01A 5FDSA 3N4IA 1W8YA 1K54C 5FQ9A 2HDUA 5I5LA 3FWLA 3IWOA 4LLOB 3IXBA 3GVBA 4MNRA 4P85A 2Y2IA 1BTLA 2ZMAA 3QP2A 3GMWA 1XJ6A 1MZUA 4L9GA 4JGOA 4LCLA 2PDRA 5DTSA 3S7PA 3MFXA 4R0QA 2PU2A 4HJ4A 1LSVA 3HLDA 3IT9A 5L2FA 3H82A 4BMWA 3DTEA 2WKIA 1DP8A 2DNSA 4JXGA 5M18A 1LI9A 3UNWA 4NKPA 3OC2A 3BLSA 5EVLA 3VMAA 2PYRA 2J3WA 2XD1A 3H82B 4JXWA 3T4SA 1KGEA 1S6RA 4R23A 2WZXA 1OPXA 4GD6A 3T50A 1T18A 2Y2LA 3M2JA 3PBSA 3L9KA 4JLFA 4WELA 1P0ZA 2J80A 2O0YA 4QWOA 4WEJA 2FH5A 3BRMA 3O5YA 4S2PA 1WA9A 5A91A 1YMSA 2IWDA 4XUZA 4MMNA 3V3RA 3EEHA 3V67A 2L4RA 2O99A 3C8CA 3MQQA 3MXSA 3BEBA 1L0EA 4ME4A 5FI6A 4QD4A 4YNRA 3VP4A 1CQAA 1OTBA 5AQ9A 3NCKA 1U60A 1K56A 4GCZA 3KSHA 5HX9A 2OV5A 4WMCA 1K57C 5C5KA 1F5MA 3VE3A 1S4SA 5F69A 4UA7A 3KX0X 4A5RA 5GHXA 3JVUA 4HESA 3CJMA 3SH8A 2JHEA 2H28A 3VP0A 2P9VA 1SHVA 2HGVA 2I9VA 4IUHA 2HP6A 3N8LA 5L09A 2X02A 5J4EA 4BD1A 5TBMA 2XROA 2WAEA 3CG5A 4DE3A 1MC0A 5A90A 5EM0A 1W63Q 4HJ6A 3D3OA 1C3BA 2P9VB 3K2NA 1XPBA 2WKHA 3PBOA 3HJKA 1MKMA 5CTMA 5BOHA 1K55A 2W1RA 5TBMB 5HSQA 1W63M 3IBRA 5G4YA 5GHYA 3ZG0A 3A3EA 3VSKA 4YWZA 4DN0A 4WN5A 1BYWA 2OLUA 1PRQA 2ZBBA 5F1GA 2H10A 3BY9A 3MSHA 4PHTA 1ES4A 1FSYA 4E6XA 4I3AA 3OLOA 4JF4A 1Q2QA 2AVXA 4ZDXA 3LFVA 2Q9MA 3IX8A 3A3FA 1IFQA 1BLPA 3FKWA 4JKTA 4RQ9A 1UWNX 3HLFA 1I5QA 1N4OA 5DF9A 4NXEA 3FPVA 4LV0A 3F1OA 3IX4A 1OTDA 5DF7A 5FAQA 3BQ8A 5GL9A 5FASA 2V9AA 3AGFA 1JNUA 2GNXA 4KZBA 1MXOA 3RH8B 1K4EA 3BFEA 4B88A 3E2KA 2K2NA 5EFWA 2V1ZA 1FQGA 3G6OA 4E3OA 4G3WA 5CTNA 4P6ZM 3H9WA 3M6HA 2PU4A 2ZMFA 3T4OA 1Z6FA 3D4FA 1LL8A 1YSQA 1SDEA 4WL9A 3IF6A 3T4JA 4UQIS 3DW0A 4EQ1A 4X1LA 3GTCA 1PNEA 2XA7M 4E6WA 3PYPA 3UB9A 5DFYA 4RYEA 4E3MA 4B4XA 4MCWA 2QJ7A 3T4LA 2XQZA 5U47A 3VP2A 4GNUA 4IUKA 2V0WA 3IF6B 1TDGA 1XJ3A 4QU3A 5FI7A 3LI8A 4RA7A 4LRZE 4S2JA 4KG5A 4GS9B 2H0YA 1SCWA 1S4RA 5DJTA 4RX2A 3R4KA 2D01A 3N6IA 3NOUC 4EQIA 4S2NA 1PWCA 1G6AA 3A0RA 1BLSA 1WYBA 2NUPC 3ICYA 2WKRA 3O88A 3OOVA 3EQVA 4DMZA 2XK1A 2EFXA 1MWSA 1I2WA 2K31A 1TS6A 5JYOA 2VA0A 1KDWA 3UPOA 1KE4A 3WS0A 4KUKA 3RXXA 4HBTA 4YFMA 1KGFA 4B4ZA 1YT4A 3UDIA 1EROA 2Y2GA 4EEPA 5FAOA 2JN7A 3S4XA 2ZM0A 2IA2A 4IJGA 3LIAA 4NXFA 3UDFA 1H5XA 1LSWA 2V8CA 4GLQA 3C7UA 3KYZA 4PM5A 2WAFA 2QKPA 4LGWA 3Q07A 2HJEA 3BW6A 1XJ4A 1YAXA 1V9YA 2V20A 3V5MA 4MDZA 4B9OA 5F1FA 2ZC7A 4HJ3A 1L3LA 3CAXA 2UV0E 4YINA 2WKQA 5HD3A 4R38A 1KE0A 4ZJ1A 5HL1A 4S2KA 3NHQA 2WKPA 4ZAMA 5E2GA 1L0DA 3LIEA 5DKLA 2RCXA 3B33A 1LT0A 1PW1A 3T4TA 3Q7ZA 4CPKA 3A0SA 3CHWP 3ZG5A 4NK3A 5KIZA 1MPLA 2HJ9C 4FD8A 3O3VA 2O9BA 3Q81A 1S1YA 3QP1A 4ETZA 4X56A 4R70A 5FDHA 2PT7A 4FCFA 3NY4A 5FQQA 4IVKA 4DF6A 5TR7A 4S2IA 5FL3A 1CI8A 1NZUA 3JYIA 4QY5A 1P9WA 2KLIA 2XD5A 2ZQ8A 4E3JA 1K0KA 2O9AA 3HUMA 3UPPA 4XXRA 3MFDA 1D06A 1ONHA 4JGRA 4K0WA 1FCOA 1D1JA 4KZ8A 4X53A 3QP8A 3ZYTA 2J3TC 3GQZA 1ES5A 3C7VA 2WADA 1DP9A 2QPNA 3UE0A 1FIKA 5GLCA 4HP4A 5FQMA 4Y5FA 1K6SA 2PD7A 4YOFA 1BZAA 1GA0A 4KZ9A 4OQHA 4ARZA 4WZ5A 1K25A 3S7NA 3BYDA 2PYPA 3VFHA 2GX5A 3HJIA 2J3TD 2X01A 4OLGA 4DE2A 3WS1A 4CLCE 1VB6A 2V1AA 1XFNA 2Y79A 2EX8A 5CERA 4GJ4A 3ITAA 4ARZB 1DJAA 3I7JA 4OH0A 2HDQA 1CF0A 3EQUA 4WM9A 4ETXA 2VLGA 4GZBA 3PBNA 1XKZA 4N1XA 3RXWA 3T4QA 2XSSA 4WBGA 1GSVA 4KZ5A 3MXQA 4UEYA 3IBJA 4LFUA 1DRMA 3OPRA 4DE1A 3LY3A 4O8GA 4ZJ3A 1H0MA 4HIAA 5K5BA 2P74A 3HLEA 3LIDA 4OPRA 1YM1A 2VZWA 3UMDA 3ZG8B 1JWVA 4S2MA 4AFIA 5CGSA 5J3WA 3WS2A 1MKIA 4HI4A 1N9NA 1TEMA 3IXHA 5A92A 4Y3IA 1DY6A 1H8MA 1PI5A 2PBDP 2WK0A 1KVMA 3W4PA 5HD5A 3UB6A 3PBQA 1YLWA 1CEFA 3S22A 1BULA 4KZ7A 4Q0JA 1PYYA 5FSRA 3F1NA 1IYQA 2WGIA 2B5RA 3MBZA 1XXMA 1NJ4A 2NUTC 2DCFA 3VSLA 4OPQA 4R3BA 4PM9A 1KDSA 3ZG7B 4ZRRA 1G5UA 2D02A 2OOLA 3F1NB 2KOIA 2Y2JA 1DJBA 2Z6DA 1IKIA 3UB5P 4OOLA 5KSHA 5HAIA 3WRZA 2EX2A 5HDCA 3AGDA 5CEBA 3G2YA 2EXAA 2XH9A 1LI0A 4K91A 2ZOHA 3HLWA 2HV1A 1FR6A 4HHDA 4OLDA 4U0XA 3SW1A 1AXBA 2JC7A 5HFOA 2QYBA 2M7VA 4EXOA 2ZLYA 4BWIA 1FSWA 4K08A 5HW3A 4P6ZS 3FC7A 5AJGA 2W3EA 4Y15A 1I2SA 4CLCA 5L07A 2J8YA 3E98A 5HWTA 2XA7S 4MN6A 2J7VA 3IWIA 5CXWA 4F94A 4OONA 1YSPA 1EWZA 2KDKA 3DAVA 4WLAA 1YLPA 1YKDA 4GW9A 3O86A 2W3DA 4LRXC 4CLCB 1ERQA 1CK3A 4E04A 1Z09A 3IF6C 3BECA 3GRJA 3KO6A 5L8MA 3OBFA 2Z6CA 5IS1A 4Q0HA 3MF0A 3SS5A 3BQAA 1NYYA 4FSFA 2E8JA 4GN2A 1GCEA 1T1AA 3MXRA 2YKFA 1ACFA 2VGLM 1ZC2A 3GECA 3JVVA 4I3JA 4QY6A 2B02A 2GDNA 2OLVA 1OJGA 3LR5A 1BLHA 2KX6A 4X55A 2VV7A 4LCMA 2XRNA 3TOIA 4S2NC 4EV4A 3IQAA 2WGVA 2Y2NA 3PBTA 4PM8A 1IKGA 1PFLA 3L7HA 4EWFA 4O0PA 4GHIA 3GDIA 5HARA 5GLAA 1O07A 4NEED 3ZNTA 4R3JA 3QHYA 1YLTA 1GHIA 4Q0IA 1W79A 3G2ZA 4P87A 3SS4A 1N9BA 2BG1A 1KOUA 5HAQA 1H3QA 1FCNA 3UMEA 2XEPA 4GHIB 3WS4A 2XGNA 4OQIA 3NOPC 5HWVA 1YLJA 4GDNA 1UWPX 2HP5A 2LB5A 4EUZA 1M6KA 1T1CA 1N9LA 4WEKA 3LEQA 4FTXA 4ZBEA 1PZPA 4MN5A 1VEUA 4OPYA 2LB9A 3MMHA 2V1BA 2ZQAA 1SKOA 2ZM8A 1EW0A 1LHYA 5G18A 1N9OA 2P04A 3NULA 1P9RA 1QMEA 1ZHHB 1VEUB 4WZ4A 3IX3A 2HF6A 3CPTA 1E3UD 1SKOB 2ZQCA 4BL2A 2W0NA 3LR4A 4Y2FA 3A3IA 2WUQA 2MJ6A 4GS9A 1SDNA 2X71A 3IH8A 2PBYA 4JPMA 1K57A 4GB7A 1T19A 1BUEA 4DXBA 5M1AA 1IYPA 3NDEA 4JGQA 1W8QA 2Y59A 2YKHA 3CPTB 4NXGA 3ZQ5A 2IWCA 2Y2PA 4EBNA 4KG2A 3UY6A 1ONGA 2Y2OA 3EGDC 4IEDA 5I94A 3UE1A 3NC8A 4G3VA 2JKTI 3MKFA 5HPIA 4KZ3A 3HUNA 4MBKA 5EPHA 3G30A 4PM7A 4PPRA 5A8BA 3PXPA 3B47A 3AGEA 1S0WA 2G2WA 4P0MA 4HP9A 5F82A 2XFTA 3SOIA 1ZKJA 4CQHA 4NXBA 4HNBA 4UA9A 2VKSA 4DJ2A 5F5YA 2R9XA 3W2ZA 1BLCA 3P01A 5DF8A 4QB8A 4U3TA 3HLCA 2K7SA 4EERA 2JKRI 4Y17A 3DWKA 4Y7PA 3IH9A 5M19A 4IBRA 2ZC3B 1XFQA 2H5SA 3ZG9B 3NDGA 1H8ZA 1GSXA 2BLSA 3VFFA 1CI9A 2FFFB 3M2KA 4ID4A 4PKYG 2XF3A 4X1MA 4LV2A 3PAEA 5E2HA 3P09A 1M40A 2V0UA 5DKKA 3GSGA 5HAPA 1G6OA 3A0VA 3E4PA 3V50A 4OQ0A 2A2LA 5EM1A 4KZAA 2VV8A 1L0GA 5FA7A 1STZA 4HY8A 1SZVA 2JKGA 1GA9A 2PD8A 3HVFA 4FUWA 2JKFA 3G34A 1FOFA 1JTGA 3FPWA 4R3AA 5AVFA 4I38A 3HLGA 2L0WA 5E2FA 1WE4A 4OOYA 5FAPA 1ES2A 1HZOA 5TGFA 2E8IA 1OTIA 4JGPA 2DMWA 3T1RA 3CMZA 2JE5A 4OPZA 3BWLA 4EBLA 3F1PA 1HD8A 4GD8A 3HLBA 1G68A 5EVEA 3RJUA 4DDYA 3PTEA 2FFYA 1AWIA 3BLMA 1OT6A 4NG2A 3CUEA 4PMAA 5A93A 1LLBA 3VOYA 1KGGA 4JF6A 3TRCA 1LL5A 3BJNA 5GLBA 1PWDA 4BENA 1F98A 3LIBA 2W3GA 3F1PB 1YLZA 4BBUA 1NYMA 3MZFA 4DKIA 1VM1A 5E43A 3PBRA 4R6LA 4R4RA 1NRFA 5JYPA 3C38A 3H7WB 2Y55A 2P08A 2CMNA 3MQOA 3VE4A 4WUJA 1YLYA 3G35A 2L1MA 4JBFA 2VV6A 3B3XA 1FILA 1UGUA 4BBVA 2PR5A 3MKEA 1IEMA 1EI5A 3K3CA 2ZM2A 5E2EA 4N9LA 3KSIA 2PR6A 1XA1A 1MWUA 4XUXA 5HPFA 4Z1WA 1CEGA 3NOTC 1OMEA 5EV0A 2VJWA 4C75A 1TDLA 4L9EA 1TS7A 3SS3A 4O7DA 5DFXA 3EWKA 3E2LA 3UN7A 1MY8A 2C5WB 1SKFA 2ZMVA 4EUVA 3TG9A 3KYQA 1OJ5A 3U2AA 1XJ2A 1LL9A 3MQ0A 2Z2MB 5LBRA 4XT2A 5KZHA 1VQQA 1KE3A 2M1CA 2ZQ9A 5FQIA 4H6JA 5CHUA 3Q1FA 2ACGA 1OT9A 2Y2HA 2OWHA 5EVIA 4GDBA 3CZDA 3ULFA 4XT2B 2OWJA 2IWBA 3N8SA 3FYZA 4X25A 1F2KA 4P6BA 2VGLS 4ESPA 5GHZA 3VV4A 2QWSA 4S2OA 4H6JB 2Y8HA 5EVIB 5FATA 4DDSA 4ZJ2A 1D7EA 2BTFP 4OQGA 2EX9A 1K56D 3QNCA 2ZJ9A 4WMCD 1O7EA 1K6RA 2QZ6A 2UWXA 3UB7A 3W4QA 5AQBA 4U0TA 4BQMA 1XA7A 2A49A 5HL6A 3HCYA 4X6TA 3LR3A 4PM6A 1K55C 2Y2MA 5J7EA 3CI6A 4EBPA 4E3NA 3VP3A 1H8YA 3KYEA 5TFQA 1Q2PA 3LY4A 1XGIA 3PHYA 4KQOA 2B95A 2Y2QA 1G28A 2Y4AA 3NBLA 5EOEA 5F6AA 4HBUA 2ZQ7A 4UAAA 3G4PA 3LUQA 1TVFA 1FR1A 2P7JA 3U4LP 1BT5A 3DWZA 3VOZA 2J9OA 4BD0A 5F68A 3LCEA 3V39A 4S2LA 1XP4A 1GHMA 5HWWA 2W27A 5FEGA 1FCMA
chains in the Genus database with same CATH topology
3BFFA 4DE0A 1IELA 4WEKA 2WKEA 4KQRA 4ZBEA 4DRTA 3ZFZA 1PZPA 2V20A 3V5MA 4HEFA 3OZHA 3C4OA 1PZOA 1NXYA 2ZC4B 4OP8A 4OPYA 5EE8A 5F1FA 2ZC7A 3S1YA 2ZQAA 4OP5A 4X68A 2ZM8A 2HDRA 5EUAA 4N1HA 4YINA 1LHYA 3O87A 5G18A 4E3LA 2XR0A 3GR2A 3BFGA 2EX6A 4ZTKA 2WGWA 2QMIA 5DTTA 4D2OA 1KE0A 1PWGA 3HL9A 3MZEA 1QMEA 4GOGA 4ZJ1A 5HL1A 4S2KA 1HVBA 3OPHA 4C6YA 5CHMA 2HDSA 2JBFA 4WZ4A 5E2GA 1L0DA 4ZAMA 2RCXA 4JF5A 2OSUA 2DRWA 2XLNA 3LEZA 3BFCA 1PW1A 1E3UD 3V3SA 3QNBA 2ZQCA 3Q7ZA 4CPKA 3TSGA 4BL2A 3ZG5A 4KZ4A 3ZNYA 4Y0TA 4NK3A 1JWZA 3A3IA 2WUQA 1RCJA 2C6WB 1SDNA 2X71A 2RL3A 2WGWB 3IH8A 3M6BA 2Z2LB 5D3OA 3ZDJA 2PBYA 1MPLA 4FD8A 4FH2A 4JPMA 3UE3A 1K57A 3O3VA 2R9WA 3Q81A 4GB7A 1BUEA 4Z9QA 4DXBA 5M1AA 5CRFA 1IYPA 3NDEA 2ZD8A 3VP1A 1K54A 1W8QA 2Y59A 4X56A 3N4IA 1W8YA 1K38A 5FDHA 1K54C 3Q82A 4FCFA 5FQ9A 3A3JA 2HDUA 3G32A 3FWLA 3IWOA 3NY4A 4IVKA 5FQQA 4DF6A 2IWCA 5TR7A 3IXBA 2Y2PA 3GVBA 4S2IA 1CI8A 4MNRA 4P85A 2Y2IA 4EBNA 4KG2A 1BTLA 2ZMAA 3UY6A 1ONGA 2Y2OA 4IEDA 2H0TA 3UE1A 3NC8A 5I94A 2J9PA 1NZUA 3JYIA 4QY5A 4BJPA 3MKFA 5DVAA 4KZ3A 2XD5A 3HUNA 3GMWA 2ZQ8A 4KQQA 4MBKA 4E3JA 5EPHA 1J9MA 4LCLA 3G30A 3HUMA 4PM7A 3UPPA 4XXRA 4PPRA 5DTSA 2VGKA 3MFDA 4RVAA 1ONHA 4R0QA 4QJGA 3AGEA 3OCLA 1S0WA 2G2WA 2PU2A 2WZZA 4P0MA 4K0WA 1FCOA 4KZ8A 5F82A 3HBRA 2XFTA 4RX3A 3SOIA 3HLDA 3IT9A 5J8XA 4X53A 1ZKJA 3ITBA 3WS5A 3ZVTA 5L2FA 2WKIA 4N9KA 4UA9A 3GQZA 1ES5A 1ERMA 2DNSA 4JXGA 3C7VA 2R9XA 2WADA 2A3UA 5M18A 1BLCA 5DF8A 4QB8A 4U3TA 3HLCA 3W4OA 1LI9A 3UNWA 2XFSA 3OC2A 1PW8A 3BLSA 2QPNA 3UE0A 5GLCA 5EVLA 5FQMA 3DWKA 4LV3A 4Y7PA 3VMAA 1K6SA 3IH9A 4Q8IA 2XD1A 4JXWA 5M19A 1KGEA 4IBRA 2ZC3B 2H5SA 1BZAA 1GA0A 4KZ9A 4OQHA 1S6RA 3ZG9B 3NDGA 1H8ZA 4R23A 2WZXA 4GD6A 2BLSA 4JXVA 1JWPA 3VFFA 4WZ5A 1K25A 1CI9A 3BYDA 5FQJA 1E25A 2Y2LA 3M2JA 3PBSA 2FFFB 1PIOA 3VFHA 4JLFA 2X01A 3M2KA 4OLGA 4ID4A 4OOMA 4WELA 4DE2A 4GKUA 3WS1A 2XF3A 4LV2A 4WEJA 3PAEA 3BRMA 2EX8A 5E2HA 5CERA 3P09A 1M40A 4E3IA 4WYYA 5CGXA 5GLDA 3ITAA 1MBLA 3GSGA 4S2PA 5HAPA 5A91A 1DJAA 1YMSA 4MEZA 1DJCA 3I7JA 4OH0A 3V50A 4OQ0A 1GHPA 4QHCA 2HDQA 3EQUA 2IWDA 4UHUA 4WM9A 4XUZA 3NI9A 4KZAA 2WYXA 3IHBA 3V3RA 1L0GA 1WYCA 4GZBA 3ZVWA 5FA7A 3PBNA 1XKZA 4N1XA 3RXWA 4UA6A 4N92A 3MXSA 3BEBA 4Y0UA 1GA9A 4WBGA 1L0EA 4KZ5A 1Y54A 5FI6A 3HVFA 4QD4A 3G34A 1FOFA 1ALQA 1JTGA 1ESUA 3VP4A 2ZC5B 3HLGA 3OPRA 4DE1A 3LY3A 5E2FA 1WE4A 4OOYA 5AQ9A 4ZJ3A 3NCKA 1U60A 1ES2A 1HZOA 1K56A 2P74A 5FAPA 5FI2A 5TGFA 3HLEA 2E8IA 4KENB 5HX9A 4OPRA 2OV5A 3SH9A 4WMCA 1YM1A 1K57C 3CMZA 3ZG8B 1JWVA 4S2MA 5F83A 2JE5A 4OPZA 5CGSA 4UA7A 4R1GA 3MZDA 3IXGA 1YQSA 4A5RA 3WS2A 4EBLA 1HD8A 1MKIA 4GD8A 4JXSA 3HLBA 3A3DA 5GHXA 4HESA 1G68A 3CJMA 3SH8A 4DDYA 3N7WA 3RJUA 1ES3A 1TEMA 3PTEA 2FFYA 3VP0A 2P9VA 3IXHA 1SHVA 3BLMA 4KG6A 1NY0A 2HP6A 3N8LA 3UPNA 5A92A 4PMAA 1DY6A 5A93A 1LLBA 3VOYA 2X02A 1E4DA 4M3KA 4BD1A 1PI5A 1KGGA 2WAEA 4JF6A 1LL5A 3CG5A 5CGWA 4DE3A 5GLBA 2WK0A 1KVMA 1PWDA 3DTMA 3W4PA 4BENA 5A90A 1ESIA 1PI4A 1YLZA 3PBQA 2HP9A 1YLWA 1CEFA 1C3BA 2P9VB 1NYMA 3SH7A 3S22A 3MZFA 1BULA 4DKIA 3C4PA 1VM1A 1XPBA 4KZ7A 1PYYA 3BM6A 3PBRA 5E43A 5AQAA 5FSRA 4R4RA 2WKHA 1IYQA 1NRFA 2WGIA 3PBOA 5JYPA 1HTZA 2B5RA 3MBZA 2Y55A 5CTMA 5BOHA 4FH4A 1K55A 1XXMA 1YLYA 4L0LA 3ZCZA 1NJ4A 2Q9NA 3G35A 4JBFA 2DCFA 3VSLA 3B3XA 5GHYA 2V2FF 4OPQA 4R3BA 3ZGAB 3A3EA 3ZG0A 4MBFA 4OKPA 1KDSA 4PM9A 3ZG7B 3OCNA 3VSKA 1L0FA 3UO9A 2EFUA 3MKEA 1IEMA 1EI5A 2OLUA 2ZM2A 5IHVA 5F1GA 2H10A 2Y2JA 1DJBA 3C5AA 4BLMA 5E2EA 1IKIA 1ES4A 4N9LA 1FSYA 4E6XA 4OOLA 1XA1A 1MWUA 2ZQDA 4XUXA 5HAIA 5KSHA 3WRZA 4JF4A 2EX2A 1CEGA 4WZ5C 3AGDA 5CEBA 3G2YA 1OMEA 1Q2QA 2VGJA 2EXAA 2XH9A 1LI0A 4IVIA 4K91A 3IWQA 4C75A 3HLWA 1TDLA 1FR6A 4OLDA 4U0XA 3SS3A 4ZDXA 1AXBA 2Y91A 2JC7A 2Q9MA 1IYOA 3A3FA 4JKTA 1BLPA 3FKWA 4O7DA 3FKVA 5HFOA 1MWRA 3HLFA 2ZLYA 1I5QA 1FSWA 1N4OA 3E2LA 5DF9A 1MY8A 3UN7A 2C5WB 5EOOA 1SKFA 3LO7A 4LV0A 1KVLA 5HW3A 1E3UA 4OVDA 3TG9A 4IBXA 5DF7A 5FAQA 2JCHA 4LENA 3GV9A 3WWXA 2EXBA 5GL9A 5FASA 4E3KA 1LL9A 3AGFA 3WRTA 1I2SA 4KZBA 2Z2MB 1MXOA 4MBHA 1K4EA 3BFEA 2J8YA 4B88A 3E2KA 3ZHHA 5KZHA 2V1ZA 2J7VA 1FQGA 3IWIA 5CXWA 1VQQA 4E3OA 5CTNA 4BL3A 1KE3A 4F94A 4OONA 5KSCA 3M6HA 2PU4A 1EWZA 2ZQ9A 5FQIA 1ZG6A 4C3QA 3W8KA 1Z6FA 3D4FA 5CHUA 3Q1FA 1YLPA 1XGJA 2Y2HA 1XX2A 5EVIA 4GDBA 1SDEA 3O86A 2HPBA 3IF6A 3CZDA 1ERQA 1W7FA 3DW0A 1CK3A 5CHJA 5EVIC 3IF6C 3BECA 3FV7A 2IWBA 3GTCA 3N8SA 3GRJA 3FYZA 4E6WA 1JVJA 1L2SA 4P6BA 3G31A 5FQKA 5GHZA 4RYEA 3IF5A 1RGYA 4B4XA 4MLLA 4E3MA 3BFDA 4CJNA 2XQZA 4S2OA 5U47A 3VP2A 4GNUA 3SS5A 3HREA 1W5DA 5EVIB 2I72A 5FATA 1NYYA 3IF6B 1BSGA 3IHAA 1TDGA 4DDSA 3FZCA 4FSFA 4ZJ2A 4GN2A 1RGZA 1QMFA 3PAGA 1GCEA 4QU3A 5FI7A 5KMWA 3Q7VA 3MXRA 4LV1A 4RA7A 4OQGA 2EX9A 1K56D 4S2JA 4KG5A 2H0YA 3QNCA 1SCWA 1ZC2A 2ZJ9A 4QY6A 1O7EA 4WMCD 4R4SA 1K6RA 3P98A 4RX2A 5EVID 3N6IA 4EQIA 2QZ6A 3NIAA 2GDNA 2UWXA 1YMXA 2OLVA 4S2NA 1PWCA 1G6AA 3W4QA 1BLSA 1BLHA 1WYBA 4X55A 5AQBA 1RP5A 4LCMA 4U0TA 3TOIA 4S2NC 4BQMA 1XA7A 2A49A 4EV4A 3IQAA 3Q7VB 2WGVA 4PM6A 4X6TA 1K55C 2Y2NA 3O88A 2XDMA 2Y2MA 3PBTA 4EBPA 3EQVA 2G2UA 4E3NA 3OPLA 3VP3A 1H8YA 4PM8A 1JTDA 1IKGA 2XK1A 4Y0OA 3UDXA 5TFQA 5CECA 1Q2PA 3LY4A 2EFXA 5CEDA 4EWFA 3HUOA 1MWSA 1XGIA 5HARA 1I2WA 4NETA 5GLAA 1O07A 3ZNTA 5DTKA 3N8RA 4R3JA 4KQOA 5JYOA 3QHYA 2Y2QA 1KDWA 1YLTA 2Y4AA 3NBLA 5EOEA 1KE4A 3UPOA 1GHIA 3WS0A 1W79A 3G2ZA 4HBUA 4P87A 4H8RA 3RXXA 3SS4A 1N9BA 4HBTA 4YFMA 1KGFA 2CC1A 2ZQ7A 4UAAA 3G4PA 2BG1A 1TVFA 4B4ZA 1YT4A 2Y2KA 1EROA 1FR1A 1K4FA 3UDIA 2Y2GA 5HAQA 5FAOA 1FCNA 1BT5A 2ZM0A 3DWZA 5AQ7A 3S4XA 2XEPA 3VOZA 4K0XA 2J9OA 4BD0A 3WS4A 2XGNA 3LCEA 4OQIA 3V39A 4S2LA 1XP4A 3UDFA 1H5XA 1GHMA 1NZOA 1YLJA 3C7UA 4GDNA 1IYSA 4KZ6A 3OPPA 5EECA 4X69A 3IXDA 2HP5A 4PM5A 1MWTA 1ZG4A 3ISGA 4EUZA 2WAFA 3Q07A 1M6KA 2ZC6B 1FCMA 4DXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFF A;  4DE0 A;  1IEL A;  4WEK A;  2WKE A;  4KQR A;  4ZBE A;  4DRT A;  3ZFZ A;  1PZP A;  2V20 A;  3V5M A;  4HEF A;  3OZH A;  3C4O A;  1PZO A;  1NXY A;  2ZC4 B;  4OP8 A;  4OPY A;  5EE8 A;  5F1F A;  2ZC7 A;  3S1Y A;  2ZQA A;  4OP5 A;  4X68 A;  2ZM8 A;  2HDR A;  5EUA A;  4N1H A;  4YIN A;  1LHY A;  3O87 A;  5G18 A;  4E3L A;  2XR0 A;  3GR2 A;  3BFG A;  2EX6 A;  4ZTK A;  2WGW A;  2QMI A;  5DTT A;  4D2O A;  1KE0 A;  1PWG A;  3HL9 A;  3MZE A;  1QME A;  4GOG A;  4ZJ1 A;  5HL1 A;  4S2K A;  1HVB A;  3OPH A;  4C6Y A;  5CHM A;  2HDS A;  2JBF A;  4WZ4 A;  5E2G A;  1L0D A;  4ZAM A;  2RCX A;  4JF5 A;  2OSU A;  2DRW A;  2XLN A;  3LEZ A;  3BFC A;  1PW1 A;  1E3U D;  3V3S A;  3QNB A;  2ZQC A;  3Q7Z A;  4CPK A;  3TSG A;  4BL2 A;  3ZG5 A;  4KZ4 A;  3ZNY A;  4Y0T A;  4NK3 A;  1JWZ A;  3A3I A;  2WUQ A;  1RCJ A;  2C6W B;  1SDN A;  2X71 A;  2RL3 A;  2WGW B;  3IH8 A;  3M6B A;  2Z2L B;  5D3O A;  3ZDJ A;  2PBY A;  1MPL A;  4FD8 A;  4FH2 A;  4JPM A;  3UE3 A;  1K57 A;  3O3V A;  2R9W A;  3Q81 A;  4GB7 A;  1BUE A;  4Z9Q A;  4DXB A;  5M1A A;  5CRF A;  1IYP A;  3NDE A;  2ZD8 A;  3VP1 A;  1K54 A;  1W8Q A;  2Y59 A;  4X56 A;  3N4I A;  1W8Y A;  1K38 A;  5FDH A;  1K54 C;  3Q82 A;  4FCF A;  5FQ9 A;  3A3J A;  2HDU A;  3G32 A;  3FWL A;  3IWO A;  3NY4 A;  4IVK A;  5FQQ A;  4DF6 A;  2IWC A;  5TR7 A;  3IXB A;  2Y2P A;  3GVB A;  4S2I A;  1CI8 A;  4MNR A;  4P85 A;  2Y2I A;  4EBN A;  4KG2 A;  1BTL A;  2ZMA A;  3UY6 A;  1ONG A;  2Y2O A;  4IED A;  2H0T A;  3UE1 A;  3NC8 A;  5I94 A;  2J9P A;  1NZU A;  3JYI A;  4QY5 A;  4BJP A;  3MKF A;  5DVA A;  4KZ3 A;  2XD5 A;  3HUN A;  3GMW A;  2ZQ8 A;  4KQQ A;  4MBK A;  4E3J A;  5EPH A;  1J9M A;  4LCL A;  3G30 A;  3HUM A;  4PM7 A;  3UPP A;  4XXR A;  4PPR A;  5DTS A;  2VGK A;  3MFD A;  4RVA A;  1ONH A;  4R0Q A;  4QJG A;  3AGE A;  3OCL A;  1S0W A;  2G2W A;  2PU2 A;  2WZZ A;  4P0M A;  4K0W A;  1FCO A;  4KZ8 A;  5F82 A;  3HBR A;  2XFT A;  4RX3 A;  3SOI A;  3HLD A;  3IT9 A;  5J8X A;  4X53 A;  1ZKJ A;  3ITB A;  3WS5 A;  3ZVT A;  5L2F A;  2WKI A;  4N9K A;  4UA9 A;  3GQZ A;  1ES5 A;  1ERM A;  2DNS A;  4JXG A;  3C7V A;  2R9X A;  2WAD A;  2A3U A;  5M18 A;  1BLC A;  5DF8 A;  4QB8 A;  4U3T A;  3HLC A;  3W4O A;  1LI9 A;  3UNW A;  2XFS A;  3OC2 A;  1PW8 A;  3BLS A;  2QPN A;  3UE0 A;  5GLC A;  5EVL A;  5FQM A;  3DWK A;  4LV3 A;  4Y7P A;  3VMA A;  1K6S A;  3IH9 A;  4Q8I A;  2XD1 A;  4JXW A;  5M19 A;  1KGE A;  4IBR A;  2ZC3 B;  2H5S A;  1BZA A;  1GA0 A;  4KZ9 A;  4OQH A;  1S6R A;  3ZG9 B;  3NDG A;  1H8Z A;  4R23 A;  2WZX A;  4GD6 A;  2BLS A;  4JXV A;  1JWP A;  3VFF A;  4WZ5 A;  1K25 A;  1CI9 A;  3BYD A;  5FQJ A;  1E25 A;  2Y2L A;  3M2J A;  3PBS A;  2FFF B;  1PIO A;  3VFH A;  4JLF A;  2X01 A;  3M2K A;  4OLG A;  4ID4 A;  4OOM A;  4WEL A;  4DE2 A;  4GKU A;  3WS1 A;  2XF3 A;  4LV2 A;  4WEJ A;  3PAE A;  3BRM A;  2EX8 A;  5E2H A;  5CER A;  3P09 A;  1M40 A;  4E3I A;  4WYY A;  5CGX A;  5GLD A;  3ITA A;  1MBL A;  3GSG A;  4S2P A;  5HAP A;  5A91 A;  1DJA A;  1YMS A;  4MEZ A;  1DJC A;  3I7J A;  4OH0 A;  3V50 A;  4OQ0 A;  1GHP A;  4QHC A;  2HDQ A;  3EQU A;  2IWD A;  4UHU A;  4WM9 A;  4XUZ A;  3NI9 A;  4KZA A;  2WYX A;  3IHB A;  3V3R A;  1L0G A;  1WYC A;  4GZB A;  3ZVW A;  5FA7 A;  3PBN A;  1XKZ A;  4N1X A;  3RXW A;  4UA6 A;  4N92 A;  3MXS A;  3BEB A;  4Y0U A;  1GA9 A;  4WBG A;  1L0E A;  4KZ5 A;  1Y54 A;  5FI6 A;  3HVF A;  4QD4 A;  3G34 A;  1FOF A;  1ALQ A;  1JTG A;  1ESU A;  3VP4 A;  2ZC5 B;  3HLG A;  3OPR A;  4DE1 A;  3LY3 A;  5E2F A;  1WE4 A;  4OOY A;  5AQ9 A;  4ZJ3 A;  3NCK A;  1U60 A;  1ES2 A;  1HZO A;  1K56 A;  2P74 A;  5FAP A;  5FI2 A;  5TGF A;  3HLE A;  2E8I A;  4KEN B;  5HX9 A;  4OPR A;  2OV5 A;  3SH9 A;  4WMC A;  1YM1 A;  1K57 C;  3CMZ A;  3ZG8 B;  1JWV A;  4S2M A;  5F83 A;  2JE5 A;  4OPZ A;  5CGS A;  4UA7 A;  4R1G A;  3MZD A;  3IXG A;  1YQS A;  4A5R A;  3WS2 A;  4EBL A;  1HD8 A;  1MKI A;  4GD8 A;  4JXS A;  3HLB A;  3A3D A;  5GHX A;  4HES A;  1G68 A;  3CJM A;  3SH8 A;  4DDY A;  3N7W A;  3RJU A;  1ES3 A;  1TEM A;  3PTE A;  2FFY A;  3VP0 A;  2P9V A;  3IXH A;  1SHV A;  3BLM A;  4KG6 A;  1NY0 A;  2HP6 A;  3N8L A;  3UPN A;  5A92 A;  4PMA A;  1DY6 A;  5A93 A;  1LLB A;  3VOY A;  2X02 A;  1E4D A;  4M3K A;  4BD1 A;  1PI5 A;  1KGG A;  2WAE A;  4JF6 A;  1LL5 A;  3CG5 A;  5CGW A;  4DE3 A;  5GLB A;  2WK0 A;  1KVM A;  1PWD A;  3DTM A;  3W4P A;  4BEN A;  5A90 A;  1ESI A;  1PI4 A;  1YLZ A;  3PBQ A;  2HP9 A;  1YLW A;  1CEF A;  1C3B A;  2P9V B;  1NYM A;  3SH7 A;  3S22 A;  3MZF A;  1BUL A;  4DKI A;  3C4P A;  1VM1 A;  1XPB A;  4KZ7 A;  1PYY A;  3BM6 A;  3PBR A;  5E43 A;  5AQA A;  5FSR A;  4R4R A;  2WKH A;  1IYQ A;  1NRF A;  2WGI A;  3PBO A;  5JYP A;  1HTZ A;  2B5R A;  3MBZ A;  2Y55 A;  5CTM A;  5BOH A;  4FH4 A;  1K55 A;  1XXM A;  1YLY A;  4L0L A;  3ZCZ A;  1NJ4 A;  2Q9N A;  3G35 A;  4JBF A;  2DCF A;  3VSL A;  3B3X A;  5GHY A;  2V2F F;  4OPQ A;  4R3B A;  3ZGA B;  3A3E A;  3ZG0 A;  4MBF A;  4OKP A;  1KDS A;  4PM9 A;  3ZG7 B;  3OCN A;  3VSK A;  1L0F A;  3UO9 A;  2EFU A;  3MKE A;  1IEM A;  1EI5 A;  2OLU A;  2ZM2 A;  5IHV A;  5F1G A;  2H10 A;  2Y2J A;  1DJB A;  3C5A A;  4BLM A;  5E2E A;  1IKI A;  1ES4 A;  4N9L A;  1FSY A;  4E6X A;  4OOL A;  1XA1 A;  1MWU A;  2ZQD A;  4XUX A;  5HAI A;  5KSH A;  3WRZ A;  4JF4 A;  2EX2 A;  1CEG A;  4WZ5 C;  3AGD A;  5CEB A;  3G2Y A;  1OME A;  1Q2Q A;  2VGJ A;  2EXA A;  2XH9 A;  1LI0 A;  4IVI A;  4K91 A;  3IWQ A;  4C75 A;  3HLW A;  1TDL A;  1FR6 A;  4OLD A;  4U0X A;  3SS3 A;  4ZDX A;  1AXB A;  2Y91 A;  2JC7 A;  2Q9M A;  1IYO A;  3A3F A;  4JKT A;  1BLP A;  3FKW A;  4O7D A;  3FKV A;  5HFO A;  1MWR A;  3HLF A;  2ZLY A;  1I5Q A;  1FSW A;  1N4O A;  3E2L A;  5DF9 A;  1MY8 A;  3UN7 A;  2C5W B;  5EOO A;  1SKF A;  3LO7 A;  4LV0 A;  1KVL A;  5HW3 A;  1E3U A;  4OVD A;  3TG9 A;  4IBX A;  5DF7 A;  5FAQ A;  2JCH A;  4LEN A;  3GV9 A;  3WWX A;  2EXB A;  5GL9 A;  5FAS A;  4E3K A;  1LL9 A;  3AGF A;  3WRT A;  1I2S A;  4KZB A;  2Z2M B;  1MXO A;  4MBH A;  1K4E A;  3BFE A;  2J8Y A;  4B88 A;  3E2K A;  3ZHH A;  5KZH A;  2V1Z A;  2J7V A;  1FQG A;  3IWI A;  5CXW A;  1VQQ A;  4E3O A;  5CTN A;  4BL3 A;  1KE3 A;  4F94 A;  4OON A;  5KSC A;  3M6H A;  2PU4 A;  1EWZ A;  2ZQ9 A;  5FQI A;  1ZG6 A;  4C3Q A;  3W8K A;  1Z6F A;  3D4F A;  5CHU A;  3Q1F A;  1YLP A;  1XGJ A;  2Y2H A;  1XX2 A;  5EVI A;  4GDB A;  1SDE A;  3O86 A;  2HPB A;  3IF6 A;  3CZD A;  1ERQ A;  1W7F A;  3DW0 A;  1CK3 A;  5CHJ A;  5EVI C;  3IF6 C;  3BEC A;  3FV7 A;  2IWB A;  3GTC A;  3N8S A;  3GRJ A;  3FYZ A;  4E6W A;  1JVJ A;  1L2S A;  4P6B A;  3G31 A;  5FQK A;  5GHZ A;  4RYE A;  3IF5 A;  1RGY A;  4B4X A;  4MLL A;  4E3M A;  3BFD A;  4CJN A;  2XQZ A;  4S2O A;  5U47 A;  3VP2 A;  4GNU A;  3SS5 A;  3HRE A;  1W5D A;  5EVI B;  2I72 A;  5FAT A;  1NYY A;  3IF6 B;  1BSG A;  3IHA A;  1TDG A;  4DDS A;  3FZC A;  4FSF A;  4ZJ2 A;  4GN2 A;  1RGZ A;  1QMF A;  3PAG A;  1GCE A;  4QU3 A;  5FI7 A;  5KMW A;  3Q7V A;  3MXR A;  4LV1 A;  4RA7 A;  4OQG A;  2EX9 A;  1K56 D;  4S2J A;  4KG5 A;  2H0Y A;  3QNC A;  1SCW A;  1ZC2 A;  2ZJ9 A;  4QY6 A;  1O7E A;  4WMC D;  4R4S A;  1K6R A;  3P98 A;  4RX2 A;  5EVI D;  3N6I A;  4EQI A;  2QZ6 A;  3NIA A;  2GDN A;  2UWX A;  1YMX A;  2OLV A;  4S2N A;  1PWC A;  1G6A A;  3W4Q A;  1BLS A;  1BLH A;  1WYB A;  4X55 A;  5AQB A;  1RP5 A;  4LCM A;  4U0T A;  3TOI A;  4S2N C;  4BQM A;  1XA7 A;  2A49 A;  4EV4 A;  3IQA A;  3Q7V B;  2WGV A;  4PM6 A;  4X6T A;  1K55 C;  2Y2N A;  3O88 A;  2XDM A;  2Y2M A;  3PBT A;  4EBP A;  3EQV A;  2G2U A;  4E3N A;  3OPL A;  3VP3 A;  1H8Y A;  4PM8 A;  1JTD A;  1IKG A;  2XK1 A;  4Y0O A;  3UDX A;  5TFQ A;  5CEC A;  1Q2P A;  3LY4 A;  2EFX A;  5CED A;  4EWF A;  3HUO A;  1MWS A;  1XGI A;  5HAR A;  1I2W A;  4NET A;  5GLA A;  1O07 A;  3ZNT A;  5DTK A;  3N8R A;  4R3J A;  4KQO A;  5JYO A;  3QHY A;  2Y2Q A;  1KDW A;  1YLT A;  2Y4A A;  3NBL A;  5EOE A;  1KE4 A;  3UPO A;  1GHI A;  3WS0 A;  1W79 A;  3G2Z A;  4HBU A;  4P87 A;  4H8R A;  3RXX A;  3SS4 A;  1N9B A;  4HBT A;  4YFM A;  1KGF A;  2CC1 A;  2ZQ7 A;  4UAA A;  3G4P A;  2BG1 A;  1TVF A;  4B4Z A;  1YT4 A;  2Y2K A;  1ERO A;  1FR1 A;  1K4F A;  3UDI A;  2Y2G A;  5HAQ A;  5FAO A;  1FCN A;  1BT5 A;  2ZM0 A;  3DWZ A;  5AQ7 A;  3S4X A;  2XEP A;  3VOZ A;  4K0X A;  2J9O A;  4BD0 A;  3WS4 A;  2XGN A;  3LCE A;  4OQI A;  3V39 A;  4S2L A;  1XP4 A;  3UDF A;  1H5X A;  1GHM A;  1NZO A;  1YLJ A;  3C7U A;  4GDN A;  1IYS A;  4KZ6 A;  3OPP A;  5EEC A;  4X69 A;  3IXD A;  2HP5 A;  4PM5 A;  1MWT A;  1ZG4 A;  3ISG A;  4EUZ A;  2WAF A;  3Q07 A;  1M6K A;  2ZC6 B;  1FCM A;  4DXC A; 
#chains in the Genus database with same CATH topology
 3BFF A;  1IOU A;  4DE0 A;  1IEL A;  3LI9 A;  4KQR A;  4DRT A;  3ZFZ A;  3OZH A;  1NWZ A;  3C4O A;  1PZO A;  2ZC4 B;  4OP8 A;  2INW A;  5EE8 A;  4OP5 A;  4N1H A;  1NLZ A;  3VOL A;  3O87 A;  4E3L A;  3GR2 A;  2VK3 A;  4ZTK A;  2QMI A;  1J3W A;  1PWG A;  3HL9 A;  4GOG A;  2HDS A;  2JBF A;  2OSU A;  2DRW A;  2XLN A;  3LEZ A;  4EES A;  3BFC A;  1OTA A;  1ZTU A;  3V3S A;  3QNB A;  4Y0T A;  3NJA A;  1RCJ A;  2RL3 A;  5D3O A;  3ZDJ A;  2Z2L B;  4FH2 A;  3UE3 A;  2R9W A;  2W1T A;  1GSW A;  3RFB A;  3T12 B;  3VP1 A;  1K54 A;  4WF0 A;  2PAV P;  1K38 A;  4HQA A;  1HLU P;  1S1Z A;  3Q82 A;  3A3J A;  3E4O A;  3G32 A;  5FEF A;  2GZA A;  2H0T A;  2M7U A;  2J9P A;  1VHM A;  4BJP A;  2R78 A;  2W1T B;  2PHY A;  5DVA A;  2JKT M;  1TD5 A;  3EOI A;  4KQQ A;  1J9M A;  2W3H A;  2VGK A;  4RVA A;  4QJG A;  2VEA A;  3OCL A;  2WZZ A;  5J8X A;  3HBR A;  4RX3 A;  1OTE A;  3IS2 A;  3ITB A;  3WS5 A;  3LGO A;  3ZVT A;  2OAQ 1;  4L9F A;  4N9K A;  1LSX A;  4EET B;  1ERM A;  1TS0 A;  1X0O A;  2A3U A;  3C30 A;  5HDS A;  3W4O A;  2XFS A;  2PRF A;  1PW8 A;  2ZOI A;  3TE8 A;  3QP5 A;  5IU1 A;  2JKR M;  3IS2 B;  4LV3 A;  4Q8I A;  4EU0 A;  1T1B A;  3CWF A;  3LYX A;  1NRJ A;  4LRY C;  3E4Q A;  4JXV A;  1JWP A;  4MN7 A;  5CX7 A;  5FQJ A;  1E25 A;  1PIO A;  3TJZ C;  4OOM A;  4GKU A;  4PKY A;  1CJF A;  4E3I A;  4WYY A;  5CGX A;  5GLD A;  1MBL A;  2G7U A;  4MEZ A;  4EW7 A;  1DJC A;  1GHP A;  4QHC A;  4UHU A;  3NI9 A;  4M4X A;  2WYX A;  3IHB A;  1WYC A;  3ZVW A;  2O9C A;  4UA6 A;  4N92 A;  4Y0U A;  1Y54 A;  5HZH A;  1ALQ A;  1ESU A;  3F1O B;  3RTY A;  2ZC5 B;  3K3D A;  4BBT A;  4D60 A;  2OAP 1;  5FI2 A;  4KEN B;  3JPU A;  1YPR A;  3SH9 A;  1V9Z A;  2FZ0 A;  5F83 A;  4R1G A;  4I3I A;  2GJ3 A;  3S7Q A;  3MZD A;  3IXG A;  3DTI A;  1YQS A;  1S66 L;  4JXS A;  3A3D A;  3N7W A;  1ES3 A;  4LPZ A;  4FOF A;  4KG6 A;  3LIF A;  1NY0 A;  3UPN A;  3R7W A;  1E4D A;  4M3K A;  3CUE C;  5CGW A;  2W3F A;  3DTM A;  2VX8 A;  1ESI A;  1PI4 A;  3CIT A;  3T1Q B;  5IT5 A;  3T1S A;  2HP9 A;  3SH7 A;  4HH3 A;  4II7 A;  3C4P A;  3BM6 A;  3KSG A;  5AQA A;  2V8F A;  3NEC A;  3R7W B;  2A24 A;  1HTZ A;  4HH2 A;  4I5S A;  4FH4 A;  4EEU A;  4Y13 A;  4L0L A;  2ZL1 A;  3KSF A;  3ZCZ A;  2Q9N A;  3ZGA B;  2V2F F;  4MBF A;  4OKP A;  4F3L A;  3OCN A;  1L0F A;  3UO9 A;  2EFU A;  3B42 A;  5IHV A;  1TF1 A;  2A24 B;  3C5A A;  4BLM A;  2ZQD A;  2ZL1 B;  4WZ5 C;  2VGJ A;  4IVI A;  3IWQ A;  4IHQ A;  4F3L B;  3MJQ A;  2Y91 A;  2HZ5 A;  1IYO A;  4G3K A;  2QHK A;  3FKV A;  3S7O A;  1MWR A;  5EOO A;  3LO7 A;  1KVL A;  3QP6 A;  5G4Z A;  1E3U A;  3MR0 A;  4OVD A;  1TS8 A;  4IBX A;  2JCH A;  4LEN A;  3GV9 A;  2EA9 A;  1P97 A;  3WWX A;  2EXB A;  4E3K A;  3DTK A;  3D9Y A;  3WRT A;  3LIC A;  4MBH A;  5TJJ A;  1VET A;  1DP6 A;  3ZHH A;  5L10 A;  1F9I A;  5MC7 A;  4BL3 A;  5KSC A;  1ZG6 A;  2B18 A;  4C3Q A;  3W8K A;  3QP4 A;  1XGJ A;  1XX2 A;  2HPB A;  1VET B;  1W7F A;  3BY8 A;  3P7N A;  5CHJ A;  5EVI C;  3FV7 A;  3MS6 A;  1JVJ A;  1L2S A;  3G31 A;  2EWV A;  5FQK A;  3IF5 A;  1RGY A;  4MLL A;  3BFD A;  4CJN A;  3E0Y A;  4KUO A;  3UB8 A;  3HRE A;  2BAS A;  1W5D A;  2I72 A;  1BSG A;  3IHA A;  3H7W A;  3FZC A;  1RGZ A;  1QMF A;  4UQI M;  3PAG A;  5KMW A;  3Q7V A;  2Q0O A;  4LV1 A;  3DBA A;  3T4K A;  4R4S A;  5EVI D;  3P98 A;  3NIA A;  1YMX A;  1RP5 A;  5HDD A;  1S67 L;  5AVE A;  3Q7V B;  2XDM A;  2G2U A;  3T1X A;  3OPL A;  3EGX C;  1JTD A;  3UDX A;  4Y0O A;  3EEA A;  5CEC A;  5CED A;  4DJ3 A;  3HUO A;  4HOI A;  4NET A;  3FG8 A;  5DTK A;  3N8R A;  4QPR A;  4H8R A;  2CC1 A;  4PAU A;  2Y2K A;  1K4F A;  5AQ7 A;  4K0X A;  4KQD A;  4I39 A;  3TW8 A;  1NZO A;  1IYS A;  4KZ6 A;  3OPP A;  5EEC A;  4X69 A;  3IXD A;  4B93 A;  1MWT A;  1ZG4 A;  3ISG A;  3SZT A;  1Y28 A;  2ZC6 B;  3CLO A;  4DXC A;  2WKE A;  3PR6 A;  2QJ5 A;  4HEF A;  3UE6 A;  1NXY A;  1NLY A;  3S1Y A;  4X68 A;  4CLC C;  2HDR A;  2EWW A;  5EUA A;  2XR0 A;  3BFG A;  2EX6 A;  2WGW A;  5DTT A;  4D2O A;  3MZE A;  3LR0 A;  1HVB A;  3OPH A;  4C6Y A;  5CHM A;  3C2W A;  4JF5 A;  1ODV A;  3D72 A;  3TSG A;  4KZ4 A;  3ZNY A;  1JWZ A;  2C6W B;  2WGW B;  3M6B A;  4Z9Q A;  1A0K A;  5DJU A;  4CLC D;  5CRF A;  2ZD8 A;  1Y4O A;  4O01 A;  5FDS A;  3N4I A;  1W8Y A;  1K54 C;  5FQ9 A;  2HDU A;  5I5L A;  3FWL A;  3IWO A;  4LLO B;  3IXB A;  3GVB A;  4MNR A;  4P85 A;  2Y2I A;  1BTL A;  2ZMA A;  3QP2 A;  3GMW A;  1XJ6 A;  1MZU A;  4L9G A;  4JGO A;  4LCL A;  2PDR A;  5DTS A;  3S7P A;  3MFX A;  4R0Q A;  2PU2 A;  4HJ4 A;  1LSV A;  3HLD A;  3IT9 A;  5L2F A;  3H82 A;  4BMW A;  3DTE A;  2WKI A;  1DP8 A;  2DNS A;  4JXG A;  5M18 A;  1LI9 A;  3UNW A;  4NKP A;  3OC2 A;  3BLS A;  5EVL A;  3VMA A;  2PYR A;  2J3W A;  2XD1 A;  3H82 B;  4JXW A;  3T4S A;  1KGE A;  1S6R A;  4R23 A;  2WZX A;  1OPX A;  4GD6 A;  3T50 A;  1T18 A;  2Y2L A;  3M2J A;  3PBS A;  3L9K A;  4JLF A;  4WEL A;  1P0Z A;  2J80 A;  2O0Y A;  4QWO A;  4WEJ A;  2FH5 A;  3BRM A;  3O5Y A;  4S2P A;  1WA9 A;  5A91 A;  1YMS A;  2IWD A;  4XUZ A;  4MMN A;  3V3R A;  3EEH A;  3V67 A;  2L4R A;  2O99 A;  3C8C A;  3MQQ A;  3MXS A;  3BEB A;  1L0E A;  4ME4 A;  5FI6 A;  4QD4 A;  4YNR A;  3VP4 A;  1CQA A;  1OTB A;  5AQ9 A;  3NCK A;  1U60 A;  1K56 A;  4GCZ A;  3KSH A;  5HX9 A;  2OV5 A;  4WMC A;  1K57 C;  5C5K A;  1F5M A;  3VE3 A;  1S4S A;  5F69 A;  4UA7 A;  3KX0 X;  4A5R A;  5GHX A;  3JVU A;  4HES A;  3CJM A;  3SH8 A;  2JHE A;  2H28 A;  3VP0 A;  2P9V A;  1SHV A;  2HGV A;  2I9V A;  4IUH A;  2HP6 A;  3N8L A;  5L09 A;  2X02 A;  5J4E A;  4BD1 A;  5TBM A;  2XRO A;  2WAE A;  3CG5 A;  4DE3 A;  1MC0 A;  5A90 A;  5EM0 A;  1W63 Q;  4HJ6 A;  3D3O A;  1C3B A;  2P9V B;  3K2N A;  1XPB A;  2WKH A;  3PBO A;  3HJK A;  1MKM A;  5CTM A;  5BOH A;  1K55 A;  2W1R A;  5TBM B;  5HSQ A;  1W63 M;  3IBR A;  5G4Y A;  5GHY A;  3ZG0 A;  3A3E A;  3VSK A;  4YWZ A;  4DN0 A;  4WN5 A;  1BYW A;  2OLU A;  1PRQ A;  2ZBB A;  5F1G A;  2H10 A;  3BY9 A;  3MSH A;  4PHT A;  1ES4 A;  1FSY A;  4E6X A;  4I3A A;  3OLO A;  4JF4 A;  1Q2Q A;  2AVX A;  4ZDX A;  3LFV A;  2Q9M A;  3IX8 A;  3A3F A;  1IFQ A;  1BLP A;  3FKW A;  4JKT A;  4RQ9 A;  1UWN X;  3HLF A;  1I5Q A;  1N4O A;  5DF9 A;  4NXE A;  3FPV A;  4LV0 A;  3F1O A;  3IX4 A;  1OTD A;  5DF7 A;  5FAQ A;  3BQ8 A;  5GL9 A;  5FAS A;  2V9A A;  3AGF A;  1JNU A;  2GNX A;  4KZB A;  1MXO A;  3RH8 B;  1K4E A;  3BFE A;  4B88 A;  3E2K A;  2K2N A;  5EFW A;  2V1Z A;  1FQG A;  3G6O A;  4E3O A;  4G3W A;  5CTN A;  4P6Z M;  3H9W A;  3M6H A;  2PU4 A;  2ZMF A;  3T4O A;  1Z6F A;  3D4F A;  1LL8 A;  1YSQ A;  1SDE A;  4WL9 A;  3IF6 A;  3T4J A;  4UQI S;  3DW0 A;  4EQ1 A;  4X1L A;  3GTC A;  1PNE A;  2XA7 M;  4E6W A;  3PYP A;  3UB9 A;  5DFY A;  4RYE A;  4E3M A;  4B4X A;  4MCW A;  2QJ7 A;  3T4L A;  2XQZ A;  5U47 A;  3VP2 A;  4GNU A;  4IUK A;  2V0W A;  3IF6 B;  1TDG A;  1XJ3 A;  4QU3 A;  5FI7 A;  3LI8 A;  4RA7 A;  4LRZ E;  4S2J A;  4KG5 A;  4GS9 B;  2H0Y A;  1SCW A;  1S4R A;  5DJT A;  4RX2 A;  3R4K A;  2D01 A;  3N6I A;  3NOU C;  4EQI A;  4S2N A;  1PWC A;  1G6A A;  3A0R A;  1BLS A;  1WYB A;  2NUP C;  3ICY A;  2WKR A;  3O88 A;  3OOV A;  3EQV A;  4DMZ A;  2XK1 A;  2EFX A;  1MWS A;  1I2W A;  2K31 A;  1TS6 A;  5JYO A;  2VA0 A;  1KDW A;  3UPO A;  1KE4 A;  3WS0 A;  4KUK A;  3RXX A;  4HBT A;  4YFM A;  1KGF A;  4B4Z A;  1YT4 A;  3UDI A;  1ERO A;  2Y2G A;  4EEP A;  5FAO A;  2JN7 A;  3S4X A;  2ZM0 A;  2IA2 A;  4IJG A;  3LIA A;  4NXF A;  3UDF A;  1H5X A;  1LSW A;  2V8C A;  4GLQ A;  3C7U A;  3KYZ A;  4PM5 A;  2WAF A;  2QKP A;  4LGW A;  3Q07 A;  2HJE A;  3BW6 A;  1XJ4 A;  1YAX A;  1V9Y A;  2V20 A;  3V5M A;  4MDZ A;  4B9O A;  5F1F A;  2ZC7 A;  4HJ3 A;  1L3L A;  3CAX A;  2UV0 E;  4YIN A;  2WKQ A;  5HD3 A;  4R38 A;  1KE0 A;  4ZJ1 A;  5HL1 A;  4S2K A;  3NHQ A;  2WKP A;  4ZAM A;  5E2G A;  1L0D A;  3LIE A;  5DKL A;  2RCX A;  3B33 A;  1LT0 A;  1PW1 A;  3T4T A;  3Q7Z A;  4CPK A;  3A0S A;  3CHW P;  3ZG5 A;  4NK3 A;  5KIZ A;  1MPL A;  2HJ9 C;  4FD8 A;  3O3V A;  2O9B A;  3Q81 A;  1S1Y A;  3QP1 A;  4ETZ A;  4X56 A;  4R70 A;  5FDH A;  2PT7 A;  4FCF A;  3NY4 A;  5FQQ A;  4IVK A;  4DF6 A;  5TR7 A;  4S2I A;  5FL3 A;  1CI8 A;  1NZU A;  3JYI A;  4QY5 A;  1P9W A;  2KLI A;  2XD5 A;  2ZQ8 A;  4E3J A;  1K0K A;  2O9A A;  3HUM A;  3UPP A;  4XXR A;  3MFD A;  1D06 A;  1ONH A;  4JGR A;  4K0W A;  1FCO A;  1D1J A;  4KZ8 A;  4X53 A;  3QP8 A;  3ZYT A;  2J3T C;  3GQZ A;  1ES5 A;  3C7V A;  2WAD A;  1DP9 A;  2QPN A;  3UE0 A;  1FIK A;  5GLC A;  4HP4 A;  5FQM A;  4Y5F A;  1K6S A;  2PD7 A;  4YOF A;  1BZA A;  1GA0 A;  4KZ9 A;  4OQH A;  4ARZ A;  4WZ5 A;  1K25 A;  3S7N A;  3BYD A;  2PYP A;  3VFH A;  2GX5 A;  3HJI A;  2J3T D;  2X01 A;  4OLG A;  4DE2 A;  3WS1 A;  4CLC E;  1VB6 A;  2V1A A;  1XFN A;  2Y79 A;  2EX8 A;  5CER A;  4GJ4 A;  3ITA A;  4ARZ B;  1DJA A;  3I7J A;  4OH0 A;  2HDQ A;  1CF0 A;  3EQU A;  4WM9 A;  4ETX A;  2VLG A;  4GZB A;  3PBN A;  1XKZ A;  4N1X A;  3RXW A;  3T4Q A;  2XSS A;  4WBG A;  1GSV A;  4KZ5 A;  3MXQ A;  4UEY A;  3IBJ A;  4LFU A;  1DRM A;  3OPR A;  4DE1 A;  3LY3 A;  4O8G A;  4ZJ3 A;  1H0M A;  4HIA A;  5K5B A;  2P74 A;  3HLE A;  3LID A;  4OPR A;  1YM1 A;  2VZW A;  3UMD A;  3ZG8 B;  1JWV A;  4S2M A;  4AFI A;  5CGS A;  5J3W A;  3WS2 A;  1MKI A;  4HI4 A;  1N9N A;  1TEM A;  3IXH A;  5A92 A;  4Y3I A;  1DY6 A;  1H8M A;  1PI5 A;  2PBD P;  2WK0 A;  1KVM A;  3W4P A;  5HD5 A;  3UB6 A;  3PBQ A;  1YLW A;  1CEF A;  3S22 A;  1BUL A;  4KZ7 A;  4Q0J A;  1PYY A;  5FSR A;  3F1N A;  1IYQ A;  2WGI A;  2B5R A;  3MBZ A;  1XXM A;  1NJ4 A;  2NUT C;  2DCF A;  3VSL A;  4OPQ A;  4R3B A;  4PM9 A;  1KDS A;  3ZG7 B;  4ZRR A;  1G5U A;  2D02 A;  2OOL A;  3F1N B;  2KOI A;  2Y2J A;  1DJB A;  2Z6D A;  1IKI A;  3UB5 P;  4OOL A;  5KSH A;  5HAI A;  3WRZ A;  2EX2 A;  5HDC A;  3AGD A;  5CEB A;  3G2Y A;  2EXA A;  2XH9 A;  1LI0 A;  4K91 A;  2ZOH A;  3HLW A;  2HV1 A;  1FR6 A;  4HHD A;  4OLD A;  4U0X A;  3SW1 A;  1AXB A;  2JC7 A;  5HFO A;  2QYB A;  2M7V A;  4EXO A;  2ZLY A;  4BWI A;  1FSW A;  4K08 A;  5HW3 A;  4P6Z S;  3FC7 A;  5AJG A;  2W3E A;  4Y15 A;  1I2S A;  4CLC A;  5L07 A;  2J8Y A;  3E98 A;  5HWT A;  2XA7 S;  4MN6 A;  2J7V A;  3IWI A;  5CXW A;  4F94 A;  4OON A;  1YSP A;  1EWZ A;  2KDK A;  3DAV A;  4WLA A;  1YLP A;  1YKD A;  4GW9 A;  3O86 A;  2W3D A;  4LRX C;  4CLC B;  1ERQ A;  1CK3 A;  4E04 A;  1Z09 A;  3IF6 C;  3BEC A;  3GRJ A;  3KO6 A;  5L8M A;  3OBF A;  2Z6C A;  5IS1 A;  4Q0H A;  3MF0 A;  3SS5 A;  3BQA A;  1NYY A;  4FSF A;  2E8J A;  4GN2 A;  1GCE A;  1T1A A;  3MXR A;  2YKF A;  1ACF A;  2VGL M;  1ZC2 A;  3GEC A;  3JVV A;  4I3J A;  4QY6 A;  2B02 A;  2GDN A;  2OLV A;  1OJG A;  3LR5 A;  1BLH A;  2KX6 A;  4X55 A;  2VV7 A;  4LCM A;  2XRN A;  3TOI A;  4S2N C;  4EV4 A;  3IQA A;  2WGV A;  2Y2N A;  3PBT A;  4PM8 A;  1IKG A;  1PFL A;  3L7H A;  4EWF A;  4O0P A;  4GHI A;  3GDI A;  5HAR A;  5GLA A;  1O07 A;  4NEE D;  3ZNT A;  4R3J A;  3QHY A;  1YLT A;  1GHI A;  4Q0I A;  1W79 A;  3G2Z A;  4P87 A;  3SS4 A;  1N9B A;  2BG1 A;  1KOU A;  5HAQ A;  1H3Q A;  1FCN A;  3UME A;  2XEP A;  4GHI B;  3WS4 A;  2XGN A;  4OQI A;  3NOP C;  5HWV A;  1YLJ A;  4GDN A;  1UWP X;  2HP5 A;  2LB5 A;  4EUZ A;  1M6K A;  1T1C A;  1N9L A;  4WEK A;  3LEQ A;  4FTX A;  4ZBE A;  1PZP A;  4MN5 A;  1VEU A;  4OPY A;  2LB9 A;  3MMH A;  2V1B A;  2ZQA A;  1SKO A;  2ZM8 A;  1EW0 A;  1LHY A;  5G18 A;  1N9O A;  2P04 A;  3NUL A;  1P9R A;  1QME A;  1ZHH B;  1VEU B;  4WZ4 A;  3IX3 A;  2HF6 A;  3CPT A;  1E3U D;  1SKO B;  2ZQC A;  4BL2 A;  2W0N A;  3LR4 A;  4Y2F A;  3A3I A;  2WUQ A;  2MJ6 A;  4GS9 A;  1SDN A;  2X71 A;  3IH8 A;  2PBY A;  4JPM A;  1K57 A;  4GB7 A;  1T19 A;  1BUE A;  4DXB A;  5M1A A;  1IYP A;  3NDE A;  4JGQ A;  1W8Q A;  2Y59 A;  2YKH A;  3CPT B;  4NXG A;  3ZQ5 A;  2IWC A;  2Y2P A;  4EBN A;  4KG2 A;  3UY6 A;  1ONG A;  2Y2O A;  3EGD C;  4IED A;  5I94 A;  3UE1 A;  3NC8 A;  4G3V A;  2JKT I;  3MKF A;  5HPI A;  4KZ3 A;  3HUN A;  4MBK A;  5EPH A;  3G30 A;  4PM7 A;  4PPR A;  5A8B A;  3PXP A;  3B47 A;  3AGE A;  1S0W A;  2G2W A;  4P0M A;  4HP9 A;  5F82 A;  2XFT A;  3SOI A;  1ZKJ A;  4CQH A;  4NXB A;  4HNB A;  4UA9 A;  2VKS A;  4DJ2 A;  5F5Y A;  2R9X A;  3W2Z A;  1BLC A;  3P01 A;  5DF8 A;  4QB8 A;  4U3T A;  3HLC A;  2K7S A;  4EER A;  2JKR I;  4Y17 A;  3DWK A;  4Y7P A;  3IH9 A;  5M19 A;  4IBR A;  2ZC3 B;  1XFQ A;  2H5S A;  3ZG9 B;  3NDG A;  1H8Z A;  1GSX A;  2BLS A;  3VFF A;  1CI9 A;  2FFF B;  3M2K A;  4ID4 A;  4PKY G;  2XF3 A;  4X1M A;  4LV2 A;  3PAE A;  5E2H A;  3P09 A;  1M40 A;  2V0U A;  5DKK A;  3GSG A;  5HAP A;  1G6O A;  3A0V A;  3E4P A;  3V50 A;  4OQ0 A;  2A2L A;  5EM1 A;  4KZA A;  2VV8 A;  1L0G A;  5FA7 A;  1STZ A;  4HY8 A;  1SZV A;  2JKG A;  1GA9 A;  2PD8 A;  3HVF A;  4FUW A;  2JKF A;  3G34 A;  1FOF A;  1JTG A;  3FPW A;  4R3A A;  5AVF A;  4I38 A;  3HLG A;  2L0W A;  5E2F A;  1WE4 A;  4OOY A;  5FAP A;  1ES2 A;  1HZO A;  5TGF A;  2E8I A;  1OTI A;  4JGP A;  2DMW A;  3T1R A;  3CMZ A;  2JE5 A;  4OPZ A;  3BWL A;  4EBL A;  3F1P A;  1HD8 A;  4GD8 A;  3HLB A;  1G68 A;  5EVE A;  3RJU A;  4DDY A;  3PTE A;  2FFY A;  1AWI A;  3BLM A;  1OT6 A;  4NG2 A;  3CUE A;  4PMA A;  5A93 A;  1LLB A;  3VOY A;  1KGG A;  4JF6 A;  3TRC A;  1LL5 A;  3BJN A;  5GLB A;  1PWD A;  4BEN A;  1F98 A;  3LIB A;  2W3G A;  3F1P B;  1YLZ A;  4BBU A;  1NYM A;  3MZF A;  4DKI A;  1VM1 A;  5E43 A;  3PBR A;  4R6L A;  4R4R A;  1NRF A;  5JYP A;  3C38 A;  3H7W B;  2Y55 A;  2P08 A;  2CMN A;  3MQO A;  3VE4 A;  4WUJ A;  1YLY A;  3G35 A;  2L1M A;  4JBF A;  2VV6 A;  3B3X A;  1FIL A;  1UGU A;  4BBV A;  2PR5 A;  3MKE A;  1IEM A;  1EI5 A;  3K3C A;  2ZM2 A;  5E2E A;  4N9L A;  3KSI A;  2PR6 A;  1XA1 A;  1MWU A;  4XUX A;  5HPF A;  4Z1W A;  1CEG A;  3NOT C;  1OME A;  5EV0 A;  2VJW A;  4C75 A;  1TDL A;  4L9E A;  1TS7 A;  3SS3 A;  4O7D A;  5DFX A;  3EWK A;  3E2L A;  3UN7 A;  1MY8 A;  2C5W B;  1SKF A;  2ZMV A;  4EUV A;  3TG9 A;  3KYQ A;  1OJ5 A;  3U2A A;  1XJ2 A;  1LL9 A;  3MQ0 A;  2Z2M B;  5LBR A;  4XT2 A;  5KZH A;  1VQQ A;  1KE3 A;  2M1C A;  2ZQ9 A;  5FQI A;  4H6J A;  5CHU A;  3Q1F A;  2ACG A;  1OT9 A;  2Y2H A;  2OWH A;  5EVI A;  4GDB A;  3CZD A;  3ULF A;  4XT2 B;  2OWJ A;  2IWB A;  3N8S A;  3FYZ A;  4X25 A;  1F2K A;  4P6B A;  2VGL S;  4ESP A;  5GHZ A;  3VV4 A;  2QWS A;  4S2O A;  4H6J B;  2Y8H A;  5EVI B;  5FAT A;  4DDS A;  4ZJ2 A;  1D7E A;  2BTF P;  4OQG A;  2EX9 A;  1K56 D;  3QNC A;  2ZJ9 A;  4WMC D;  1O7E A;  1K6R A;  2QZ6 A;  2UWX A;  3UB7 A;  3W4Q A;  5AQB A;  4U0T A;  4BQM A;  1XA7 A;  2A49 A;  5HL6 A;  3HCY A;  4X6T A;  3LR3 A;  4PM6 A;  1K55 C;  2Y2M A;  5J7E A;  3CI6 A;  4EBP A;  4E3N A;  3VP3 A;  1H8Y A;  3KYE A;  5TFQ A;  1Q2P A;  3LY4 A;  1XGI A;  3PHY A;  4KQO A;  2B95 A;  2Y2Q A;  1G28 A;  2Y4A A;  3NBL A;  5EOE A;  5F6A A;  4HBU A;  2ZQ7 A;  4UAA A;  3G4P A;  3LUQ A;  1TVF A;  1FR1 A;  2P7J A;  3U4L P;  1BT5 A;  3DWZ A;  3VOZ A;  2J9O A;  4BD0 A;  5F68 A;  3LCE A;  3V39 A;  4S2L A;  1XP4 A;  1GHM A;  5HWW A;  2W27 A;  5FEG A;  1FCM A; 
#chains in the Genus database with same CATH homology
 3BFF A;  4DE0 A;  1IEL A;  4WEK A;  2WKE A;  4KQR A;  4ZBE A;  4DRT A;  3ZFZ A;  1PZP A;  2V20 A;  3V5M A;  4HEF A;  3OZH A;  3C4O A;  1PZO A;  1NXY A;  2ZC4 B;  4OP8 A;  4OPY A;  5EE8 A;  5F1F A;  2ZC7 A;  3S1Y A;  2ZQA A;  4OP5 A;  4X68 A;  2ZM8 A;  2HDR A;  5EUA A;  4N1H A;  4YIN A;  1LHY A;  3O87 A;  5G18 A;  4E3L A;  2XR0 A;  3GR2 A;  3BFG A;  2EX6 A;  4ZTK A;  2WGW A;  2QMI A;  5DTT A;  4D2O A;  1KE0 A;  1PWG A;  3HL9 A;  3MZE A;  1QME A;  4GOG A;  4ZJ1 A;  5HL1 A;  4S2K A;  1HVB A;  3OPH A;  4C6Y A;  5CHM A;  2HDS A;  2JBF A;  4WZ4 A;  5E2G A;  1L0D A;  4ZAM A;  2RCX A;  4JF5 A;  2OSU A;  2DRW A;  2XLN A;  3LEZ A;  3BFC A;  1PW1 A;  1E3U D;  3V3S A;  3QNB A;  2ZQC A;  3Q7Z A;  4CPK A;  3TSG A;  4BL2 A;  3ZG5 A;  4KZ4 A;  3ZNY A;  4Y0T A;  4NK3 A;  1JWZ A;  3A3I A;  2WUQ A;  1RCJ A;  2C6W B;  1SDN A;  2X71 A;  2RL3 A;  2WGW B;  3IH8 A;  3M6B A;  2Z2L B;  5D3O A;  3ZDJ A;  2PBY A;  1MPL A;  4FD8 A;  4FH2 A;  4JPM A;  3UE3 A;  1K57 A;  3O3V A;  2R9W A;  3Q81 A;  4GB7 A;  1BUE A;  4Z9Q A;  4DXB A;  5M1A A;  5CRF A;  1IYP A;  3NDE A;  2ZD8 A;  3VP1 A;  1K54 A;  1W8Q A;  2Y59 A;  4X56 A;  3N4I A;  1W8Y A;  1K38 A;  5FDH A;  1K54 C;  3Q82 A;  4FCF A;  5FQ9 A;  3A3J A;  2HDU A;  3G32 A;  3FWL A;  3IWO A;  3NY4 A;  4IVK A;  5FQQ A;  4DF6 A;  2IWC A;  5TR7 A;  3IXB A;  2Y2P A;  3GVB A;  4S2I A;  1CI8 A;  4MNR A;  4P85 A;  2Y2I A;  4EBN A;  4KG2 A;  1BTL A;  2ZMA A;  3UY6 A;  1ONG A;  2Y2O A;  4IED A;  2H0T A;  3UE1 A;  3NC8 A;  5I94 A;  2J9P A;  1NZU A;  3JYI A;  4QY5 A;  4BJP A;  3MKF A;  5DVA A;  4KZ3 A;  2XD5 A;  3HUN A;  3GMW A;  2ZQ8 A;  4KQQ A;  4MBK A;  4E3J A;  5EPH A;  1J9M A;  4LCL A;  3G30 A;  3HUM A;  4PM7 A;  3UPP A;  4XXR A;  4PPR A;  5DTS A;  2VGK A;  3MFD A;  4RVA A;  1ONH A;  4R0Q A;  4QJG A;  3AGE A;  3OCL A;  1S0W A;  2G2W A;  2PU2 A;  2WZZ A;  4P0M A;  4K0W A;  1FCO A;  4KZ8 A;  5F82 A;  3HBR A;  2XFT A;  4RX3 A;  3SOI A;  3HLD A;  3IT9 A;  5J8X A;  4X53 A;  1ZKJ A;  3ITB A;  3WS5 A;  3ZVT A;  5L2F A;  2WKI A;  4N9K A;  4UA9 A;  3GQZ A;  1ES5 A;  1ERM A;  2DNS A;  4JXG A;  3C7V A;  2R9X A;  2WAD A;  2A3U A;  5M18 A;  1BLC A;  5DF8 A;  4QB8 A;  4U3T A;  3HLC A;  3W4O A;  1LI9 A;  3UNW A;  2XFS A;  3OC2 A;  1PW8 A;  3BLS A;  2QPN A;  3UE0 A;  5GLC A;  5EVL A;  5FQM A;  3DWK A;  4LV3 A;  4Y7P A;  3VMA A;  1K6S A;  3IH9 A;  4Q8I A;  2XD1 A;  4JXW A;  5M19 A;  1KGE A;  4IBR A;  2ZC3 B;  2H5S A;  1BZA A;  1GA0 A;  4KZ9 A;  4OQH A;  1S6R A;  3ZG9 B;  3NDG A;  1H8Z A;  4R23 A;  2WZX A;  4GD6 A;  2BLS A;  4JXV A;  1JWP A;  3VFF A;  4WZ5 A;  1K25 A;  1CI9 A;  3BYD A;  5FQJ A;  1E25 A;  2Y2L A;  3M2J A;  3PBS A;  2FFF B;  1PIO A;  3VFH A;  4JLF A;  2X01 A;  3M2K A;  4OLG A;  4ID4 A;  4OOM A;  4WEL A;  4DE2 A;  4GKU A;  3WS1 A;  2XF3 A;  4LV2 A;  4WEJ A;  3PAE A;  3BRM A;  2EX8 A;  5E2H A;  5CER A;  3P09 A;  1M40 A;  4E3I A;  4WYY A;  5CGX A;  5GLD A;  3ITA A;  1MBL A;  3GSG A;  4S2P A;  5HAP A;  5A91 A;  1DJA A;  1YMS A;  4MEZ A;  1DJC A;  3I7J A;  4OH0 A;  3V50 A;  4OQ0 A;  1GHP A;  4QHC A;  2HDQ A;  3EQU A;  2IWD A;  4UHU A;  4WM9 A;  4XUZ A;  3NI9 A;  4KZA A;  2WYX A;  3IHB A;  3V3R A;  1L0G A;  1WYC A;  4GZB A;  3ZVW A;  5FA7 A;  3PBN A;  1XKZ A;  4N1X A;  3RXW A;  4UA6 A;  4N92 A;  3MXS A;  3BEB A;  4Y0U A;  1GA9 A;  4WBG A;  1L0E A;  4KZ5 A;  1Y54 A;  5FI6 A;  3HVF A;  4QD4 A;  3G34 A;  1FOF A;  1ALQ A;  1JTG A;  1ESU A;  3VP4 A;  2ZC5 B;  3HLG A;  3OPR A;  4DE1 A;  3LY3 A;  5E2F A;  1WE4 A;  4OOY A;  5AQ9 A;  4ZJ3 A;  3NCK A;  1U60 A;  1ES2 A;  1HZO A;  1K56 A;  2P74 A;  5FAP A;  5FI2 A;  5TGF A;  3HLE A;  2E8I A;  4KEN B;  5HX9 A;  4OPR A;  2OV5 A;  3SH9 A;  4WMC A;  1YM1 A;  1K57 C;  3CMZ A;  3ZG8 B;  1JWV A;  4S2M A;  5F83 A;  2JE5 A;  4OPZ A;  5CGS A;  4UA7 A;  4R1G A;  3MZD A;  3IXG A;  1YQS A;  4A5R A;  3WS2 A;  4EBL A;  1HD8 A;  1MKI A;  4GD8 A;  4JXS A;  3HLB A;  3A3D A;  5GHX A;  4HES A;  1G68 A;  3CJM A;  3SH8 A;  4DDY A;  3N7W A;  3RJU A;  1ES3 A;  1TEM A;  3PTE A;  2FFY A;  3VP0 A;  2P9V A;  3IXH A;  1SHV A;  3BLM A;  4KG6 A;  1NY0 A;  2HP6 A;  3N8L A;  3UPN A;  5A92 A;  4PMA A;  1DY6 A;  5A93 A;  1LLB A;  3VOY A;  2X02 A;  1E4D A;  4M3K A;  4BD1 A;  1PI5 A;  1KGG A;  2WAE A;  4JF6 A;  1LL5 A;  3CG5 A;  5CGW A;  4DE3 A;  5GLB A;  2WK0 A;  1KVM A;  1PWD A;  3DTM A;  3W4P A;  4BEN A;  5A90 A;  1ESI A;  1PI4 A;  1YLZ A;  3PBQ A;  2HP9 A;  1YLW A;  1CEF A;  1C3B A;  2P9V B;  1NYM A;  3SH7 A;  3S22 A;  3MZF A;  1BUL A;  4DKI A;  3C4P A;  1VM1 A;  1XPB A;  4KZ7 A;  1PYY A;  3BM6 A;  3PBR A;  5E43 A;  5AQA A;  5FSR A;  4R4R A;  2WKH A;  1IYQ A;  1NRF A;  2WGI A;  3PBO A;  5JYP A;  1HTZ A;  2B5R A;  3MBZ A;  2Y55 A;  5CTM A;  5BOH A;  4FH4 A;  1K55 A;  1XXM A;  1YLY A;  4L0L A;  3ZCZ A;  1NJ4 A;  2Q9N A;  3G35 A;  4JBF A;  2DCF A;  3VSL A;  3B3X A;  5GHY A;  2V2F F;  4OPQ A;  4R3B A;  3ZGA B;  3A3E A;  3ZG0 A;  4MBF A;  4OKP A;  1KDS A;  4PM9 A;  3ZG7 B;  3OCN A;  3VSK A;  1L0F A;  3UO9 A;  2EFU A;  3MKE A;  1IEM A;  1EI5 A;  2OLU A;  2ZM2 A;  5IHV A;  5F1G A;  2H10 A;  2Y2J A;  1DJB A;  3C5A A;  4BLM A;  5E2E A;  1IKI A;  1ES4 A;  4N9L A;  1FSY A;  4E6X A;  4OOL A;  1XA1 A;  1MWU A;  2ZQD A;  4XUX A;  5HAI A;  5KSH A;  3WRZ A;  4JF4 A;  2EX2 A;  1CEG A;  4WZ5 C;  3AGD A;  5CEB A;  3G2Y A;  1OME A;  1Q2Q A;  2VGJ A;  2EXA A;  2XH9 A;  1LI0 A;  4IVI A;  4K91 A;  3IWQ A;  4C75 A;  3HLW A;  1TDL A;  1FR6 A;  4OLD A;  4U0X A;  3SS3 A;  4ZDX A;  1AXB A;  2Y91 A;  2JC7 A;  2Q9M A;  1IYO A;  3A3F A;  4JKT A;  1BLP A;  3FKW A;  4O7D A;  3FKV A;  5HFO A;  1MWR A;  3HLF A;  2ZLY A;  1I5Q A;  1FSW A;  1N4O A;  3E2L A;  5DF9 A;  1MY8 A;  3UN7 A;  2C5W B;  5EOO A;  1SKF A;  3LO7 A;  4LV0 A;  1KVL A;  5HW3 A;  1E3U A;  4OVD A;  3TG9 A;  4IBX A;  5DF7 A;  5FAQ A;  2JCH A;  4LEN A;  3GV9 A;  3WWX A;  2EXB A;  5GL9 A;  5FAS A;  4E3K A;  1LL9 A;  3AGF A;  3WRT A;  1I2S A;  4KZB A;  2Z2M B;  1MXO A;  4MBH A;  1K4E A;  3BFE A;  2J8Y A;  4B88 A;  3E2K A;  3ZHH A;  5KZH A;  2V1Z A;  2J7V A;  1FQG A;  3IWI A;  5CXW A;  1VQQ A;  4E3O A;  5CTN A;  4BL3 A;  1KE3 A;  4F94 A;  4OON A;  5KSC A;  3M6H A;  2PU4 A;  1EWZ A;  2ZQ9 A;  5FQI A;  1ZG6 A;  4C3Q A;  3W8K A;  1Z6F A;  3D4F A;  5CHU A;  3Q1F A;  1YLP A;  1XGJ A;  2Y2H A;  1XX2 A;  5EVI A;  4GDB A;  1SDE A;  3O86 A;  2HPB A;  3IF6 A;  3CZD A;  1ERQ A;  1W7F A;  3DW0 A;  1CK3 A;  5CHJ A;  5EVI C;  3IF6 C;  3BEC A;  3FV7 A;  2IWB A;  3GTC A;  3N8S A;  3GRJ A;  3FYZ A;  4E6W A;  1JVJ A;  1L2S A;  4P6B A;  3G31 A;  5FQK A;  5GHZ A;  4RYE A;  3IF5 A;  1RGY A;  4B4X A;  4MLL A;  4E3M A;  3BFD A;  4CJN A;  2XQZ A;  4S2O A;  5U47 A;  3VP2 A;  4GNU A;  3SS5 A;  3HRE A;  1W5D A;  5EVI B;  2I72 A;  5FAT A;  1NYY A;  3IF6 B;  1BSG A;  3IHA A;  1TDG A;  4DDS A;  3FZC A;  4FSF A;  4ZJ2 A;  4GN2 A;  1RGZ A;  1QMF A;  3PAG A;  1GCE A;  4QU3 A;  5FI7 A;  5KMW A;  3Q7V A;  3MXR A;  4LV1 A;  4RA7 A;  4OQG A;  2EX9 A;  1K56 D;  4S2J A;  4KG5 A;  2H0Y A;  3QNC A;  1SCW A;  1ZC2 A;  2ZJ9 A;  4QY6 A;  1O7E A;  4WMC D;  4R4S A;  1K6R A;  3P98 A;  4RX2 A;  5EVI D;  3N6I A;  4EQI A;  2QZ6 A;  3NIA A;  2GDN A;  2UWX A;  1YMX A;  2OLV A;  4S2N A;  1PWC A;  1G6A A;  3W4Q A;  1BLS A;  1BLH A;  1WYB A;  4X55 A;  5AQB A;  1RP5 A;  4LCM A;  4U0T A;  3TOI A;  4S2N C;  4BQM A;  1XA7 A;  2A49 A;  4EV4 A;  3IQA A;  3Q7V B;  2WGV A;  4PM6 A;  4X6T A;  1K55 C;  2Y2N A;  3O88 A;  2XDM A;  2Y2M A;  3PBT A;  4EBP A;  3EQV A;  2G2U A;  4E3N A;  3OPL A;  3VP3 A;  1H8Y A;  4PM8 A;  1JTD A;  1IKG A;  2XK1 A;  4Y0O A;  3UDX A;  5TFQ A;  5CEC A;  1Q2P A;  3LY4 A;  2EFX A;  5CED A;  4EWF A;  3HUO A;  1MWS A;  1XGI A;  5HAR A;  1I2W A;  4NET A;  5GLA A;  1O07 A;  3ZNT A;  5DTK A;  3N8R A;  4R3J A;  4KQO A;  5JYO A;  3QHY A;  2Y2Q A;  1KDW A;  1YLT A;  2Y4A A;  3NBL A;  5EOE A;  1KE4 A;  3UPO A;  1GHI A;  3WS0 A;  1W79 A;  3G2Z A;  4HBU A;  4P87 A;  4H8R A;  3RXX A;  3SS4 A;  1N9B A;  4HBT A;  4YFM A;  1KGF A;  2CC1 A;  2ZQ7 A;  4UAA A;  3G4P A;  2BG1 A;  1TVF A;  4B4Z A;  1YT4 A;  2Y2K A;  1ERO A;  1FR1 A;  1K4F A;  3UDI A;  2Y2G A;  5HAQ A;  5FAO A;  1FCN A;  1BT5 A;  2ZM0 A;  3DWZ A;  5AQ7 A;  3S4X A;  2XEP A;  3VOZ A;  4K0X A;  2J9O A;  4BD0 A;  3WS4 A;  2XGN A;  3LCE A;  4OQI A;  3V39 A;  4S2L A;  1XP4 A;  3UDF A;  1H5X A;  1GHM A;  1NZO A;  1YLJ A;  3C7U A;  4GDN A;  1IYS A;  4KZ6 A;  3OPP A;  5EEC A;  4X69 A;  3IXD A;  2HP5 A;  4PM5 A;  1MWT A;  1ZG4 A;  3ISG A;  4EUZ A;  2WAF A;  3Q07 A;  1M6K A;  2ZC6 B;  1FCM A;  4DXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...