1NYYA

Crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (105)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
publication title Recognition and resistance in TEM beta-lactamase
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1nyyA00
3VSKA 4B4ZA 1GHIA 4OP5A 1FCOA 5FATA 3N7WA 1JTDA 3VOZA 4KZAA 5TGFA 4F94A 2HDQA 4OH0A 5CGWA 1RP5A 4HBUA 4S2JA 1YMXA 2EFUA 4QY6A 5L2FA 3BFFA 4S2PA 4PPRA 3N8RA 1SCWA 2Y2NA 4JF4A 3V3SA 1PI4A 1LL5A 3LCEA 4DE0A 4GB7A 4QD4A 1FCMA 2Y2IA 1KDSA 3BYDA 2QZ6A 5F1FA 3Q81A 4EBPA 3ITAA 4MNRA 2J9PA 3P98A 3NBLA 4S2NC 1ONGA 1NZOA 4P87A 4OVDA 5EVLA 2XFSA 4FH4A 1JVJA 1O7EA 1XA1A 2HP6A 3ZG0A 3DWZA 1YLJA 2B5RA 2H5SA 3LY4A 1BLCA 1KVLA 5CHJA 4E3IA 4BQMA 4FCFA 1ERMA 3BECA 3C4PA 2EX9A 2HP5A 4EV4A 4WZ4A 4ZJ1A 3Q7ZA 4IBXA 1TEMA 3FKWA 2EX8A 1LI0A 5EVID 3CMZA 4KZBA 4RYEA 3BLMA 4EBLA 4C75A 3ISGA 2ZM8A 3MKEA 3MZEA 5F82A 1E25A 1BSGA 4L0LA 2PU4A 1XKZA 1M6KA 2H10A 1YM1A 3PAEA 4QY5A 4WZ5C 3TOIA 1GA0A 4KZ3A 4BLMA 2ZJ9A 5EECA 4K0WA 5DTTA 4DXBA 4FD8A 3S4XA 5CXWA 2ZLYA 3W4OA 4Z9QA 3G31A 4Y7PA 5IHVA 5FQMA 1M40A 3DTMA 5FQJA 3JYIA 1IYPA 2HDSA 1QMEA 4ZJ3A 1XGIA 4DF6A 3A3IA 1RGYA 3NCKA 1FR6A 1PWGA 1JWZA 2WYXA 2Y2QA 3UY6A 4Y0UA 3G2YA 3ZNYA 1GHPA 4IBRA 5A92A 1IYOA 2WGWA 3PBNA 1WYBA 2WUQA 3QNCA 2QPNA 3E2LA 2WKIA 5EVIC 1MKIA 4DE3A 1IKIA 4ZJ2A 1HD8A 3UPOA 4HEFA 3B3XA 2WAFA 1YMSA 4EUZA 3FZCA 3VP2A 3CZDA 2J7VA 3C7UA 3D4FA 1ES5A 1HVBA 2JC7A 3HBRA 3A3EA 3OPHA 4U3TA 1K54A 3A3DA 5A91A 4R0QA 3PTEA 5E2HA 1PZPA 3LEZA 2P9VA 4ZTKA 3FWLA 4KQRA 5E2FA 3BLSA 1LL9A 3BRMA 4DE1A 4MEZA 3Q82A 3HL9A 3PBRA 3M2KA 3WS5A 1DJAA 3G4PA 3NDEA 4R3BA 4UA7A 3ZCZA 4E3NA 4KZ8A 1QMFA 1GHMA 4XXRA 1IELA 3WS1A 4R4RA 2J8YA 4WMCA 4JBFA 2Q9NA 4K91A 2QMIA 3G34A 5EVIB 5FSRA 1MPLA 5HX9A 2EX2A 4KG5A 4JXWA 3RXXA 3WS0A 4S2KA 3M6BA 3IWOA 4E3MA 1CEGA 1ES3A 5CGXA 4GNUA 1L0GA 3IWQA 3IF5A 4R23A 1TDLA 3SS4A 2ZC3B 3TSGA 4EBNA 5JYPA 2OV5A 4OKPA 1O07A 1S6RA 1KE3A 1KE0A 2FFYA 4QHCA 2G2WA 3BFCA 1HZOA 2VGJA 2WZZA 3G30A 3HUNA 1L0EA 2V20A 3QNBA 4S2MA 3S1YA 4JF5A 1K57C 1IEMA 1K55A 3UDFA 1HTZA 1E3UA 3IXBA 1PW8A 4NETA 5CTMA 5HARA 3RXWA 4DDSA 1MWUA 1S0WA 3W8KA 1EWZA 4RA7A 5FQIA 3PBOA 2EX6A 2JCHA 3VFHA 1ESUA 3IH8A 1I2SA 2DNSA 2XFTA 3DW0A 4PM5A 3GR2A 4OOMA 2I72A 2VGKA 3UO9A 1YLTA 1ZG4A 3ZHHA 4GDNA 4JXSA 2C6WB 1BZAA 3MZDA 1JTGA 2ZQ7A 3IHBA 1NY0A 3SH8A 5FASA 1E4DA 4UAAA 3HLEA 3O3VA 3RJUA 2OLVA 3N4IA 4OPQA 4U0TA 4FSFA 5GLCA 2X71A 4MBKA 2ZC7A 1KE4A 4DXCA 3VP0A 3OCNA 3NC8A 3GVBA 1MY8A 5DTSA 2EFXA 2R9XA 2DCFA 1PWCA 2ZC6B 5DF9A 1H8ZA 4M3KA 1K4EA 5GHXA 1XGJA 2ZQCA 2EXAA 2XH9A 4PM8A 3P09A 5FQKA 3GRJA 4ZDXA 5DF8A 1K6RA 5FAPA 5A90A 5HFOA 5KZHA 3WRZA 5CECA 3VMAA 3ZG7B 1YT4A 3BFEA 4MLLA 3OZHA 5E2EA 4PM6A 4DDYA 5HAIA 2HPBA 1GA9A 2IWCA 1OMEA 3IXHA 1PYYA 2FFFB 4BL3A 5HL1A 2ZQAA 4KZ9A 1LHYA 5GLBA 3C5AA 3BFGA 4OOLA 3ZVWA 3IXGA 3S22A 5EOEA 2WKHA 1EROA 1MWSA 4YFMA 2PBYA 1G6AA 1I5QA 4MBFA 4JPMA 3PAGA 4N1HA 4PM9A 4XUZA 4PMAA 5TR7A 2WKEA 5DVAA 5EE8A 4RX2A 4BL2A 1J9MA 4B88A 1L0FA 1NXYA 5E43A 3PBSA 4OPZA 2WGIA 1BUEA 4HESA 2Y2KA 2CC1A 5TFQA 1YLWA 4LCLA 3SOIA 5JYOA 1RCJA 3M2JA 3VP1A 4DE2A 5M19A 4RX3A 1FR1A 3G35A 3MXSA 4R4SA 4E6XA 5KMWA 3WWXA 1KVMA 2JBFA 3AGEA 1CEFA 1XA7A 5FI2A 4BENA 1FSWA 3GTCA 3AGFA 4IEDA 2V1ZA 2UWXA 3WS2A 3PBQA 1K4FA 1ES2A 4KQQA 3E2KA 2X02A 4ZAMA 1SKFA 2ZQDA 5GHYA 4WMCD 1MWRA 1PZOA 3UE1A 1U60A 3LY3A 3SS5A 1PW1A 3CJMA 4P85A 3N6IA 5CTNA 3ZDJA 2XQZA 2Z2MB 3ZFZA 3OPPA 2RL3A 3NDGA 1ERQA 3IF6A 4LV1A 2J9OA 4KG6A 2Z2LB 3A3FA 3VSLA 1MBLA 3SS3A 3C4OA 5AQ7A 4DRTA 4N92A 2IWBA 3NI9A 1K54C 4B4XA 1KGFA 4JKTA 4HBTA 5GHZA 4LCMA 1YLPA 4X68A 1CK3A 1K6SA 2ZM0A 4GOGA 5U47A 4S2OA 1K56D 5CRFA 1ZG6A 3V50A 4OPRA 3UDIA 5EUAA 1E3UD 3ZNTA 4GD6A 4GDBA 4OP8A 5I94A 4X53A 1H8YA 4S2LA 5E2GA 2JE5A 5FDHA 2GDNA 4KG2A 2WGWB 5M1AA 3BFDA 3EQUA 4GKUA 2ZD8A 3WS4A 1IYSA 2RCXA 4DKIA 2ZC4B 2V2FF 2H0YA 4KZ4A 3WRTA 2EXBA 1ZKJA 1TDGA 2Y55A 2WADA 3EQVA 3UDXA 1ES4A 1WYCA 4IVKA 1CI8A 3UE3A 4N9KA 2P9VB 3BM6A 2WK0A 4KZ5A 3SH7A 2XEPA 4NK3A 3OPRA 1KDWA 1W8YA 4X55A 5CHMA 4JXGA 4XUXA 1K55C 4OOYA 2XK1A 1WE4A 3HVFA 1FOFA 4JF6A 1XXMA 3Q7VB 2G2UA 4E3LA 3MKFA 2Y2MA 3IXDA 1JWVA 3UN7A 3IH9A 3N8SA 2Y4AA 4S2NA 5DTKA 1NRFA 5FI6A 5HAPA 2R9WA 2Y2GA 3Q1FA 4BJPA 4Q8IA 5EOOA 3G32A 1C3BA 5AQAA 2Y59A 4H8RA 4C6YA 4WELA 1G68A 3ZG8B 3HUOA 5CHUA 1K38A 1W7FA 2XDMA 1N9BA 5FA7A 3GSGA 3BEBA 1ESIA 5CEBA 4ID4A 3ZG9B 4U0XA 4WM9A 3FYZA 3SH9A 1DY6A 3TG9A 4KENB 4BD1A 1KGGA 4WEJA 1ALQA 3MFDA 4A5RA 1DJCA 3QHYA 4JXVA 3VP4A 1NZUA 3HLFA 4X6TA 2OLUA 2BLSA 3G2ZA 1Q2QA 2Q9MA 3V39A 2IWDA 2ZC5B 4WZ5A 1LI9A 4EQIA 1I2WA 1L0DA 2HP9A 4S2IA 1YLYA 2XR0A 1BLSA 4N1XA 4R1GA 5AQBA 5A93A 4QU3A 4IVIA 4LV2A 1FCNA 5CEDA 2OSUA 1W8QA 3ZGAB 2A49A 1BULA 3HUMA 5CERA 2ZQ9A 4OPYA 5HW3A 3A3JA 1XP4A 2XF3A 4LV0A 5GLAA 2Y2PA 3OCLA 4PM7A 4BD0A 2Y2HA 1VQQA 1IYQA 4JLFA 1MXOA 5F83A 3VFFA 5EVIA 3GV9A 4R3JA 1DJBA 1RGZA 1H5XA 4OQHA 2HDRA 4Y0OA 5F1GA 3NY4A 4KQOA 3V3RA 2Y91A 5HAQA 4UA9A 2BG1A 5DF7A 5J8XA 3W4PA 2WZXA 4K0XA 4OQ0A 4GD8A 2X01A 4N9LA 1BT5A 1FSYA 1KGEA 1GCEA 3N8LA 4KZ6A 5M18A 2XGNA 2H0TA 1JWPA 3O86A 3ITBA 4UA6A 1ZC2A 4QB8A 5GL9A 4WBGA 4C3QA 5AQ9A 3AGDA 4WEKA 4KZ7A 4YINA 4CJNA 3GQZA 1K25A 1XX2A 3OC2A 4FH2A 2HDUA 4OLDA 3LO7A 2WGVA 3IHAA 4UHUA 4Y0TA 3O87A 1N4OA 4X69A 2Y2JA 1YLZA 3MZFA 4GZBA 4E3OA 3CG5A 1NYMA 2A3UA 1W79A 2ZMAA 1AXBA 5CGSA 5KSCA 3C7VA 5EPHA 4MBHA 1L2SA 5FAQA 2Y2LA 4QJGA 3VOYA 5KSHA 3GMWA 2C5WB 1CI9A 3HLWA 5BOHA 2XD1A 3IF6C 4LV3A 3UE0A 2PU2A 2XLNA 3UPNA 1MWTA 1SHVA 1W5DA 3Q7VA 4ZBEA 1PI5A 1Q2PA 1FQGA 3HLDA 5GLDA 1K57A 3VP3A 4E6WA 3I7JA 4P6BA 1TVFA 5FI7A 4OONA 3PBTA 4P0MA 2XD5A 2ZQ8A 1Y54A 3IQAA 3MXRA 1EI5A 5FQ9A 1LLBA 2E8IA 1BTLA 1VM1A 3V5MA 3MBZA 3IT9A 3UNWA 1BLPA 4OQGA 4CPKA 3IWIA 1SDEA 3HLCA 4RVAA 4E3KA 3HREA 3NIAA 1XPBA 4OQIA 4O7DA 2P74A 2WAEA 1PIOA 1PWDA 2DRWA 3Q07A 4EWFA 1SDNA 4LENA 1Z6FA 3OPLA 3HLBA 1K56A 3DWKA 3IF6B 3ZVTA 3FV7A 3UPPA 2ZM2A 5FAOA 1NYYA 3W4QA 4E3JA 3ZG5A 5D3OA 5FQQA 1BLHA 4D2OA 2Y2OA 1YQSA 1NJ4A 3FKVA 4GN2A 3O88A 4OLGA 4WYYA 4X56A 1ONHA 3HLGA 5G18A 1IKGA 3M6HA
chains in the Genus database with same CATH superfamily
2J3TC 4B4ZA 1GHIA 2HJEA 3IX3A 4F94A 4Y17A 2ZMVA 4OH0A 1TF1A 4HBUA 5L2FA 3N8RA 2Y2NA 1LL5A 4YWZA 2Y2IA 3KX0X 1KDSA 2QZ6A 5L8MA 3P98A 3NBLA 3LUQA 1NZOA 1O7EA 1YLJA 5HWWA 3LY4A 1P9RA 1KVLA 4E3IA 1XFNA 2EX9A 4EV4A 4WZ4A 3FKWA 4KZBA 3DTIA 3MKEA 1TS0A 4WZ5C 1GA0A 3T1QB 2ZJ9A 5K5BA 5DTTA 4UQIS 2O9BA 5FL3A 4Y7PA 5IHVA 1FIKA 2BASA 4DF6A 5A92A 2WGWA 1CJFA 2WUQA 3QNCA 3E2LA 2KLIA 4L9EA 1MKIA 1IKIA 3DTEA 2WAFA 3CAXA 3CZDA 3D4FA 1ES5A 2H28A 2JC7A 3A3EA 4U3TA 2LB5A 5A91A 4R0QA 3LEZA 1BYWA 1LL9A 3WS5A 2W1TA 3CWFA 4KZ8A 3WS1A 4XXRA 1IELA 3G34A 3LR4A 3RXXA 2EA9A 1L0GA 2AVXA 3IF5A 4G3VA 2OV5A 2FFYA 2QWSA 5J3WA 1HZOA 3S1YA 3HUNA 3G30A 2V20A 1HTZA 1E3UA 4NXGA 1S0WA 2VKSA 1ESUA 2DNSA 2XFTA 4NXBA 2VGKA 1YLTA 1ZG4A 3ZHHA 4Y3IA 3H82B 5FEFA 3NOTC 5G4YA 3U4LP 5FASA 1E4DA 3HLEA 3O3VA 3RJUA 2X71A 4MBKA 2ZC7A 1KE4A 4HJ3A 3NC8A 3GVBA 3UE6A 3OBFA 1MY8A 2EFXA 5DF9A 1XGJA 2ZQCA 2XH9A 2EWWA 3P09A 5FQKA 4ZDXA 3R4KA 5HFOA 5CECA 5L10A 3BFEA 3PXPA 5E2EA 4Y15A 4DDYA 1PYYA 3C5AA 4OOLA 3S22A 4I5SA 1MWSA 4YFMA 2PBYA 4ARZA 3E98A 2KDKA 2PBDP 4JPMA 5TR7A 3CUEC 5EE8A 4B88A 2WGIA 2Y2KA 2CC1A 1RCJA 2A2LA 2Y79A 5KMWA 1CEFA 4BBTA 4BENA 1FSWA 3GTCA 4IEDA 1K4FA 2X02A 4WMCD 1GSXA 1P9WA 1PZOA 3CJMA 3ZDJA 4EUVA 3IF6A 4LV1A 2YKFA 3A3FA 3C4OA 2J3WA 3ICYA 2IWBA 2P7JA 4B4XA 1KGFA 3MFXA 5U47A 4S2OA 3H82A 2QKPA 3T4QA 4OP8A 3L9KA 5E2GA 5FDHA 4KG2A 3BFDA 3W2ZA 4GKUA 3R7WA 3WS4A 1PNEA 1IYSA 2RCXA 4CQHA 2P04A 2V2FF 2D01A 5AVFA 4LLOB 1WYCA 1LSXA 2XEPA 1W8YA 4X55A 4JXGA 1K55C 2W3GA 4JF6A 4E3LA 4Y5FA 3UN7A 3N8SA 5AJGA 3QP1A 3E0YA 5DTKA 2R9WA 5HD3A 1T19A 3G32A 1XJ2A 5AQAA 4CLCC 3HUOA 5FA7A 1K38A 4EERA 2XDMA 3GSGA 4U0XA 4WM9A 3SH9A 3TJZC 2ACGA 1DJCA 2JN7A 3QP2A 3VP4A 2UV0E 2ZBBA 1Q2QA 4WN5A 2IWDA 4WZ5A 2PAVP 2PD8A 4S2IA 5AQBA 4QU3A 2Z6CA 1FCNA 2JKGA 5CEDA 1W8QA 4IJGA 4EU0A 3HUMA 4LV0A 1OTBA 4BD0A 1L3LA 1IYQA 1OTIA 3T1XA 1MXOA 3VFFA 3G6OA 3K3DA 1RGZA 2VZWA 4GLQA 4HNBA 1DRMA 1D7EA 4WF0A 5F1GA 2JKFA 5J8XA 3MJQA 3UB9A 4OQ0A 3N8LA 4KZ6A 4EESA 2XGNA 4I3IA 1JWPA 2P08A 4UA6A 1ZC2A 5AQ9A 3AGDA 3EEHA 4GS9A 1K25A 1XX2A 4OLDA 5EVEA 4EEPA 4UHUA 1N4OA 3BQ8A 3T4LA 4GZBA 4R6LA 5CGSA 1W63M 4NG2A 2Y2LA 2WKPA 1CI9A 2XA7S 2XD1A 2D02A 1SHVA 5GLDA 1UGUA 1TVFA 2QYBA 2XD5A 1Y54A 5FQ9A 2VK3A 3MBZA 1BLPA 1SDEA 2OWJA 2ZL1A 4OQIA 4O7DA 4O0PA 2DRWA 1K0KA 2W3HA 3HLBA 3DWKA 3FV7A 3W4QA 4E3JA 4EQ1A 1BLHA 2Y2OA 1YQSA 1NJ4A 4GN2A 3O88A 4OLGA 1F98A 4MN7A 2B95A 4S2PA 3M6HA 3C30A 5FATA 3VOZA 4KZAA 3K2NA 4S2JA 1YMXA 4JGQA 3BFFA 4WUJA 4BWIA 3V3SA 4JF4A 1YSQA 4DE0A 4DJ2A 1FCMA 4MN5A 4QWOA 4NXFA 1OT9A 1ONGA 4P87A 2NUPC 2B5RA 2H5SA 3CUEA 2GZAA 5CHJA 5TJJA 1ERMA 3BECA 1VEUB 3C4PA 4CLCB 3K3CA 2EX8A 5EVID 5L07A 3MZEA 4QY5A 4KZ3A 5EECA 2BTFP 4FD8A 3S4XA 5CXWA 3W4OA 3G31A 2V0UA 4B93A 2V1AA 4ZJ3A 3NCKA 2WYXA 4Y0UA 3G2YA 1GHPA 4IBRA 3FC7A 2PYRA 1WYBA 3UPOA 4HEFA 3MQQA 4EUZA 3FZCA 2E8JA 3C7UA 3HBRA 2P9VA 4KQRA 5E2FA 3BLSA 2O9CA 3HL9A 3M2KA 3F1OB 3ZCZA 4UA7A 1ZTUA 4R4RA 3B47A 4K91A 2QMIA 5FSRA 5EFWA 4KG5A 3WS0A 2L0WA 4S2KA 1CEGA 3IBRA 3IWQA 3F1PB 4EBNA 4OKPA 1O07A 1S6RA 1KE3A 4QHCA 2G2WA 5DJTA 4S2MA 3ZYTA 1ACFA 1K55A 4NETA 1S66L 4DDSA 1MWUA 2VA0A 4RA7A 3H9WA 3LFVA 4PHTA 3PBOA 3VOLA 4FUWA 3LIFA 3DW0A 2YKHA 1LSVA 4PM5A 3UO9A 4GDNA 4CLCA 2C6WB 3U2AA 1BZAA 1JTGA 2ZQ7A 4NXEA 2OWHA 4U0TA 1YAXA 4F3LA 3CI6A 2DCFA 1PWCA 4ESPA 3HCYA 3IS2B 5DF8A 1K6RA 5KZHA 2V8CA 4B9OA 3C38A 3ZG7B 3F1NB 4YOFA 2IWCA 1OMEA 4BL3A 1LHYA 3IXGA 3E4QA 2WKHA 4IUHA 2Q0OA 3UMDA 1I5QA 4MBFA 4L9GA 3PAGA 4N1HA 5DVAA 4BL2A 1V9ZA 1L0FA 1NXYA 3PBSA 5F68A 4HESA 3F1OA 5TFQA 2VGLM 5JYOA 2G7UA 2FH5A 4RX3A 1FR1A 3G35A 4R4SA 5HPIA 3EGXC 3AGEA 1N9OA 1XA7A 3AGFA 1NLZA 2UWXA 3IX4A 4Y2FA 1ES2A 3F1PA 4ZAMA 4GW9A 1MWRA 3UE1A 1U60A 4HJ6A 1PW1A 1F5MA 2RL3A 4EEUA 4KG6A 3VSLA 3LI8A 4R3AA 3NI9A 4EXOA 4ZRRA 2O0YA 3NOPC 4EW7A 4X68A 5EM1A 1CK3A 2ZM0A 5CRFA 1ZG6A 2M7UA 3UDIA 1E3UD 4GD6A 4S2LA 1TS7A 1UWPX 3EQUA 4DKIA 4R38A 3TE8A 3BY9A 4E04A 1D06A 1ZKJA 3IS2A 3MXQA 3T4KA 1ES4A 4HHDA 4FOFA 4KZ5A 3SH7A 4NK3A 4ETXA 3OPRA 1WE4A 3IX8A 1FOFA 3Q7VB 1OTEA 1JWVA 3IH9A 2PHYA 1S4RA 5FI6A 2Y2GA 4BJPA 2HGVA 3NJAA 1C3BA 2Y59A 1G68A 1Y4OA 5FEGA 1ESIA 5CEBA 3FYZA 3TG9A 1KGGA 1ALQA 4JXVA 1NZUA 2OLUA 3G2ZA 4HH2A 2Q9MA 2XSSA 3DBAA 1I2WA 4NKPA 2HP9A 2O99A 1BLSA 4N1XA 4R1GA 2OSUA 2I9VA 2PT7A 2Z6DA 4LGWA 1ODVA 5F5YA 2ZQ9A 2OOLA 2OAP1 4HJ4A 3EOIA 4FTXA 2HJ9C 4PM7A 2Y2HA 1VQQA 3GV9A 4O8GA 4R3JA 1DJBA 3GECA 2HDRA 4Y0OA 5L09A 4KUKA 4H6JB 3V3RA 2BG1A 2WZXA 4GD8A 1KGEA 2H0TA 3KSFA 3O86A 3ITBA 5GL9A 4JGOA 4C3QA 4KZ7A 4FH2A 3FPWA 1XJ4A 4Y0TA 4G3KA 5F6AA 2K31A 5EM0A 1YLZA 4D60A 3CG5A 3BJNA 1NYMA 2A3UA 1W79A 2V9AA 3UB7A 5KSCA 3C7VA 1V9YA 2W27A 1L2SA 5HDSA 4QJGA 3HLWA 5BOHA 3BW6A 4LV3A 3Q7VA 1W5DA 1PI5A 4PKYA 5J4EA 1Q2PA 1FQGA 3VP3A 4E6WA 3I7JA 2J3TD 5G4ZA 5FI7A 1JNUA 4HIAA 3MXRA 1IFQA 4Q0HA 2E8IA 3V5MA 3UNWA 1H3QA 4E3KA 2P74A 4PAUA 2WAEA 1PIOA 1PWDA 4EWFA 1SDNA 2GX5A 4ETZA 5FAOA 2VV7A 3FKVA 3JPUA 4MCWA 1DP6A 1FCOA 1JTDA 4WLAA 4HI4A 1YKDA 5CGWA 1RP5A 2EFUA 1PI4A 3LCEA 4JGRA 2L4RA 4GB7A 4R70A 4QD4A 1VHMA 3BYDA 3ITAA 3EWKA 4S2NC 1EW0A 4OVDA 5EVLA 2XFSA 4FH4A 1A0KA 1JVJA 1XA1A 4LRXC 4H6JA 4Z1WA 5HD5A 4LRYC 5HSQA 3E4OA 2HP5A 4ZJ1A 3Q7ZA 1LI0A 3CMZA 4EBLA 4C75A 2ZM8A 1E25A 2HV1A 1XJ3A 1XKZA 2H10A 3A0SA 3RFBA 3TOIA 3JVUA 4BLMA 4DXBA 4QPRA 2ZLYA 4Z9QA 2QHKA 5FQMA 4X25A 5LBRA 3CITA 2HDSA 1XGIA 3A3IA 1RGYA 5F69A 1JWZA 3S7PA 2Y2QA 2HZ5A 5HDCA 2W3DA 4I38A 2WKIA 4IHQA 4DE3A 5HL6A 3LR0A 1HD8A 1S67L 1YMSA 5IU1A 2J7VA 1HVBA 2JKRI 3T50A 3FPVA 3A3DA 3QP6A 2PRFA 3PTEA 5E2HA 1PZPA 5IS1A 3LR5A 3DTKA 3BRMA 4DE1A 4MEZA 3Q82A 3PBRA 3G4PA 4E3NA 2KOIA 1GHMA 4LFUA 2J8YA 4JBFA 2VJWA 1T1BA 2Q9NA 5EVIB 1MPLA 5HX9A 2EX2A 2INWA 1W63Q 4JXWA 3M6BA 1D1JA 3IWOA 4GNUA 3TSGA 3IBJA 3D72A 2QJ7A 3VE4A 3B33A 3BFCA 1F2KA 2VGJA 4G3WA 3ZVTA 1L0EA 4JF5A 3UB6A 3UDFA 4Q0IA 1DP9A 3IXBA 5HARA 3RXWA 3S7QA 5FQIA 3CPTB 4GCZA 2JCHA 3VFHA 1YSPA 3MSHA 1I2SA 2OAQ1 3GR2A 4JXSA 5DFXA 3MZDA 3IHBA 1NY0A 3A0VA 3HJIA 3N4IA 3HJKA 5GLCA 3VP0A 3OCNA 2R9XA 2ZC6B 1H8ZA 4M3KA 5GHXA 2EXAA 4PM8A 2J80A 3LIBA 1P0ZA 2A24B 1CF0A 5MC7A 3WRZA 1MC0A 4JGPA 1YT4A 4MLLA 4RQ9A 4PM6A 4Y13A 5HAIA 3S7OA 1GA9A 3IXHA 2W0NA 2O9AA 5HL1A 3BFGA 3LIDA 3VE3A 5EOEA 2W3EA 1LT0A 2PD7A 3MMHA 4MN6A 4XUZA 3A0RA 2L1MA 2XRNA 4K08A 4EETB 2Y8HA 3JVVA 1X0OA 1YLWA 1HLUP 4X1LA 4DE2A 5M19A 4E6XA 1CQAA 1XJ6A 3FG8A 4M4XA 3WS2A 3PR6A 2ZOHA 3PBQA 1VETB 1WA9A 2ZQDA 1G28A 3SS5A 3N6IA 3LEQA 2Z2MB 3ZFZA 3OPPA 2QJ5A 1S1ZA 3SS3A 5AQ7A 1IOUA 3CPTA 3T4JA 1K54C 4JKTA 4HBTA 3T12B 3OLOA 1K6SA 3RH8B 5HWVA 1K56D 4OPRA 1LSWA 5I94A 4X53A 1G6OA 1H8YA 2GDNA 2WGWB 2ZD8A 3WRTA 2H0YA 3KYZA 4KZ4A 2A24A 2WADA 3EQVA 4MDZA 3BQAA 4IVKA 3D9YA 1CI8A 4P6ZM 1SKOB 1VEUA 2FZ0A 1NLYA 1KDWA 2W1TB 5CHMA 4XUXA 2XK1A 3HVFA 1XXMA 2M7VA 3MF0A 5C5KA 4S2NA 4Q8IA 2W1RA 4C6YA 4WELA 5CHUA 1N9BA 4ID4A 3ZG9B 1J3WA 4HOIA 3QHYA 1Y28A 4X6TA 2BLSA 3V39A 2ZC5B 4HP4A 1L0DA 1YLYA 2XR0A 3MR0A 3LR3A 3MQ0A 1VETA 4IVIA 2JKTM 2V1BA 1H0MA 5DJUA 4HQAA 5CERA 1S4SA 4OPYA 5A8BA 4UQIM 5GLAA 2NUTC 3TRCA 1N9LA 2W3FA 2VGLS 1XFQA 2WKRA 4KUOA 2PYPA 3NY4A 4KQOA 2Y91A 3W4PA 3KYEA 4N9LA 3P01A 1FSYA 2MJ6A 4CJNA 4YINA 3T1RA 3GQZA 5HPFA 4AFIA 2VX8A 4ARZB 3LO7A 3IHAA 4IUKA 3O87A 3EEAA 2Y2JA 2JKRM 3LYXA 2ZMAA 1SKOA 1AXBA 5HZHA 4MBHA 5FAQA 1TS8A 3GMWA 2C5WB 4YNRA 3UPNA 3UE0A 2PU2A 1MWTA 4ZBEA 2V8FA 2GNXA 2JHEA 3LI9A 1OPXA 3LGOA 4P6BA 4OONA 4P0MA 4HY8A 1LLBA 1BTLA 3IT9A 4CPKA 3IWIA 3HREA 3F1NA 2WKQA 3CLOA 3Q07A 1Z6FA 3B42A 3OPLA 3IF6B 2ZM2A 1NYYA 2LB9A 3ZG5A 5DKLA 5IT5A 4WYYA 5FDSA 1ONHA 3HLGA 5G18A 2GJ3A 3VSKA 4OP5A 3N7WA 3T1SA 5CX7A 5J7EA 5TGFA 2HDQA 4GHIB 1NRJA 4QY6A 4PPRA 1SCWA 1F9IA 4CLCE 3KO6A 5F1FA 3Q81A 4EBPA 2XROA 4MNRA 2J9PA 3R7WB 1GSWA 1MKMA 3QP5A 3UB5P 2HP6A 3ZG0A 3DWZA 4BMWA 1BLCA 4BQMA 3PHYA 4FCFA 3LICA 4IBXA 1TEMA 4RYEA 3BLMA 3T4OA 3ISGA 3VV4A 1G5UA 5F82A 1BSGA 4L0LA 3BY8A 2PU4A 3PAEA 1M6KA 1T1CA 1YM1A 5HDDA 4K0WA 1MZUA 5HWTA 4DJ3A 1M40A 3DTMA 3KSIA 5FQJA 3JYIA 1IYPA 1QMEA 4LRZE 1FR6A 2VEAA 1PWGA 3QP4A 4Q0JA 5TBMB 3UY6A 3ZNYA 1TD5A 2B18A 3L7HA 1IYOA 3PBNA 2QPNA 5EVIC 4ZJ2A 3B3XA 3VP2A 3OPHA 1K54A 5EV0A 3SZTA 4ZTKA 3FWLA 4O01A 1AWIA 1DJAA 3NDEA 4R3BA 1QMFA 4WMCA 3BWLA 2VLGA 1ZHHB 1VB6A 4E3MA 5DKKA 1ES3A 5CGXA 4GHIA 3DAVA 3SS4A 4R23A 5JYPA 1TDLA 3SW1A 2ZC3B 3NHQA 1KE0A 4DN0A 4BBUA 2WZZA 3QNBA 1S1YA 1K57C 1IEMA 3TW8A 3GDIA 1PW8A 5CTMA 1N9NA 4GS9B 3W8KA 5I5LA 1EWZA 2EX6A 3C8CA 3IH8A 3EGDC 4OOMA 2I72A 2CMNA 3SH8A 4MMNA 4UAAA 2OLVA 4OPQA 4FSFA 4DXCA 1YPRA 5DTSA 3QP8A 2K7SA 2PDRA 1K4EA 2VV8A 1OJ5A 3GRJA 3D3OA 5FAPA 5A90A 2JKTI 3VMAA 2ZL1B 3E4PA 3OZHA 4KQDA 2HPBA 5TBMA 2FFFB 1STZA 3CHWP 2ZQAA 4KZ9A 1UWNX 5GLBA 2IA2A 3ZVWA 5AVEA 1EROA 1G6AA 1OTDA 4PKYG 4PM9A 4PMAA 2WKEA 4RX2A 1J9MA 2PR6A 1PRQA 5E43A 4OPZA 1BUEA 4LCLA 3SOIA 3M2JA 3VP1A 1T1AA 3MXSA 3WWXA 4XT2B 1KVMA 2JBFA 5FI2A 1GSVA 3H7WB 2V1ZA 3KYQA 1DP8A 4BBVA 4KQQA 3E2KA 1OJGA 2EWVA 1SKFA 1T18A 3NULA 5GHYA 4X1MA 5KIZA 3LY3A 5CTNA 4P85A 3KSHA 2XQZA 3NDGA 1ERQA 2J9OA 2Z2LB 1MBLA 4DRTA 4N92A 3LIEA 4I39A 1NWZA 5GHZA 4LCMA 1YLPA 2XA7M 4GOGA 3V50A 5EUAA 3ZNTA 4GDBA 2JE5A 5M1AA 3O5YA 3PYPA 1OTAA 2ZC4B 2EXBA 1TDGA 2Y55A 2KX6A 4L9FA 3UDXA 3LIAA 1FILA 4HH3A 3UE3A 2ZMFA 4N9KA 2P9VB 3BM6A 2WK0A 4WL9A 3P7NA 2ZOIA 4UEYA 4OOYA 4I3AA 2G2UA 3MKFA 2Y2MA 3IXDA 2Y4AA 1NRFA 5HAPA 3Q1FA 5EOOA 4H8RA 3NECA 4II7A 3ZG8B 3C2WA 1W7FA 3S7NA 3BEBA 1DY6A 4KENB 4BD1A 4WEJA 3MFDA 4A5RA 2DMWA 4XT2A 3T4SA 3HLFA 1LI9A 3H7WA 3NOUC 4EQIA 2HF6A 1H8MA 3MQOA 5A93A 4LV2A 3ZGAB 2A49A 2VV6A 1BULA 5HW3A 3A3JA 1XP4A 2XF3A 3T4TA 2Y2PA 3OCLA 4JLFA 5F83A 2K2NA 4F3LB 4NEED 5EVIA 1H5XA 1TS6A 2M1CA 4OQHA 1SZVA 3OOVA 5HAQA 4UA9A 4I3JA 5DF7A 4K0XA 2X01A 1BT5A 1GCEA 5M18A 4LPZA 4QB8A 4WBGA 4WEKA 3V67A 3OC2A 2HDUA 2WGVA 3UB8A 3ZQ5A 2R78A 4X69A 2PR5A 4E3OA 3MZFA 1P97A 3RTYA 4GJ4A 5EPHA 3MS6A 5DFYA 1LL8A 3VOYA 5KSHA 3IF6C 2XLNA 1PFLA 3HLDA 3KSGA 4ME4A 1K57A 3PBTA 2ZQ8A 3IQAA 1EI5A 1Z09A 1KOUA 1VM1A 4CLCD 4OQGA 3HLCA 4RVAA 2B02A 3NIAA 1XPBA 4HP9A 4LENA 4DMZA 3ULFA 4P6ZS 1K56A 1OT6A 3UPPA 5D3OA 5FQQA 4D2OA 3UMEA 4X56A 2V0WA 1IKGA
chains in the Genus database with same CATH topology
3VSKA 4B4ZA 1GHIA 4OP5A 1FCOA 5FATA 3N7WA 1JTDA 3VOZA 4KZAA 5TGFA 4F94A 2HDQA 4OH0A 5CGWA 1RP5A 4HBUA 4S2JA 1YMXA 2EFUA 4QY6A 5L2FA 3BFFA 4S2PA 4PPRA 3N8RA 1SCWA 2Y2NA 4JF4A 3V3SA 1PI4A 1LL5A 3LCEA 4DE0A 4GB7A 4QD4A 1FCMA 2Y2IA 1KDSA 3BYDA 2QZ6A 5F1FA 3Q81A 4EBPA 3ITAA 4MNRA 2J9PA 3P98A 3NBLA 4S2NC 1ONGA 1NZOA 4P87A 4OVDA 5EVLA 2XFSA 4FH4A 1JVJA 1O7EA 1XA1A 2HP6A 3ZG0A 3DWZA 1YLJA 2B5RA 2H5SA 3LY4A 1BLCA 1KVLA 5CHJA 4E3IA 4BQMA 4FCFA 1ERMA 3BECA 3C4PA 2EX9A 2HP5A 4EV4A 4WZ4A 4ZJ1A 3Q7ZA 4IBXA 1TEMA 3FKWA 2EX8A 1LI0A 5EVID 3CMZA 4KZBA 4RYEA 3BLMA 4EBLA 4C75A 3ISGA 2ZM8A 3MKEA 3MZEA 5F82A 1E25A 1BSGA 4L0LA 2PU4A 1XKZA 1M6KA 2H10A 1YM1A 3PAEA 4QY5A 4WZ5C 3TOIA 1GA0A 4KZ3A 4BLMA 2ZJ9A 5EECA 4K0WA 5DTTA 4DXBA 4FD8A 3S4XA 5CXWA 2ZLYA 3W4OA 4Z9QA 3G31A 4Y7PA 5IHVA 5FQMA 1M40A 3DTMA 5FQJA 3JYIA 1IYPA 2HDSA 1QMEA 4ZJ3A 1XGIA 4DF6A 3A3IA 1RGYA 3NCKA 1FR6A 1PWGA 1JWZA 2WYXA 2Y2QA 3UY6A 4Y0UA 3G2YA 3ZNYA 1GHPA 4IBRA 5A92A 1IYOA 2WGWA 3PBNA 1WYBA 2WUQA 3QNCA 2QPNA 3E2LA 2WKIA 5EVIC 1MKIA 4DE3A 1IKIA 4ZJ2A 1HD8A 3UPOA 4HEFA 3B3XA 2WAFA 1YMSA 4EUZA 3FZCA 3VP2A 3CZDA 2J7VA 3C7UA 3D4FA 1ES5A 1HVBA 2JC7A 3HBRA 3A3EA 3OPHA 4U3TA 1K54A 3A3DA 5A91A 4R0QA 3PTEA 5E2HA 1PZPA 3LEZA 2P9VA 4ZTKA 3FWLA 4KQRA 5E2FA 3BLSA 1LL9A 3BRMA 4DE1A 4MEZA 3Q82A 3HL9A 3PBRA 3M2KA 3WS5A 1DJAA 3G4PA 3NDEA 4R3BA 4UA7A 3ZCZA 4E3NA 4KZ8A 1QMFA 1GHMA 4XXRA 1IELA 3WS1A 4R4RA 2J8YA 4WMCA 4JBFA 2Q9NA 4K91A 2QMIA 3G34A 5EVIB 5FSRA 1MPLA 5HX9A 2EX2A 4KG5A 4JXWA 3RXXA 3WS0A 4S2KA 3M6BA 3IWOA 4E3MA 1CEGA 1ES3A 5CGXA 4GNUA 1L0GA 3IWQA 3IF5A 4R23A 1TDLA 3SS4A 2ZC3B 3TSGA 4EBNA 5JYPA 2OV5A 4OKPA 1O07A 1S6RA 1KE3A 1KE0A 2FFYA 4QHCA 2G2WA 3BFCA 1HZOA 2VGJA 2WZZA 3G30A 3HUNA 1L0EA 2V20A 3QNBA 4S2MA 3S1YA 4JF5A 1K57C 1IEMA 1K55A 3UDFA 1HTZA 1E3UA 3IXBA 1PW8A 4NETA 5CTMA 5HARA 3RXWA 4DDSA 1MWUA 1S0WA 3W8KA 1EWZA 4RA7A 5FQIA 3PBOA 2EX6A 2JCHA 3VFHA 1ESUA 3IH8A 1I2SA 2DNSA 2XFTA 3DW0A 4PM5A 3GR2A 4OOMA 2I72A 2VGKA 3UO9A 1YLTA 1ZG4A 3ZHHA 4GDNA 4JXSA 2C6WB 1BZAA 3MZDA 1JTGA 2ZQ7A 3IHBA 1NY0A 3SH8A 5FASA 1E4DA 4UAAA 3HLEA 3O3VA 3RJUA 2OLVA 3N4IA 4OPQA 4U0TA 4FSFA 5GLCA 2X71A 4MBKA 2ZC7A 1KE4A 4DXCA 3VP0A 3OCNA 3NC8A 3GVBA 1MY8A 5DTSA 2EFXA 2R9XA 2DCFA 1PWCA 2ZC6B 5DF9A 1H8ZA 4M3KA 1K4EA 5GHXA 1XGJA 2ZQCA 2EXAA 2XH9A 4PM8A 3P09A 5FQKA 3GRJA 4ZDXA 5DF8A 1K6RA 5FAPA 5A90A 5HFOA 5KZHA 3WRZA 5CECA 3VMAA 3ZG7B 1YT4A 3BFEA 4MLLA 3OZHA 5E2EA 4PM6A 4DDYA 5HAIA 2HPBA 1GA9A 2IWCA 1OMEA 3IXHA 1PYYA 2FFFB 4BL3A 5HL1A 2ZQAA 4KZ9A 1LHYA 5GLBA 3C5AA 3BFGA 4OOLA 3ZVWA 3IXGA 3S22A 5EOEA 2WKHA 1EROA 1MWSA 4YFMA 2PBYA 1G6AA 1I5QA 4MBFA 4JPMA 3PAGA 4N1HA 4PM9A 4XUZA 4PMAA 5TR7A 2WKEA 5DVAA 5EE8A 4RX2A 4BL2A 1J9MA 4B88A 1L0FA 1NXYA 5E43A 3PBSA 4OPZA 2WGIA 1BUEA 4HESA 2Y2KA 2CC1A 5TFQA 1YLWA 4LCLA 3SOIA 5JYOA 1RCJA 3M2JA 3VP1A 4DE2A 5M19A 4RX3A 1FR1A 3G35A 3MXSA 4R4SA 4E6XA 5KMWA 3WWXA 1KVMA 2JBFA 3AGEA 1CEFA 1XA7A 5FI2A 4BENA 1FSWA 3GTCA 3AGFA 4IEDA 2V1ZA 2UWXA 3WS2A 3PBQA 1K4FA 1ES2A 4KQQA 3E2KA 2X02A 4ZAMA 1SKFA 2ZQDA 5GHYA 4WMCD 1MWRA 1PZOA 3UE1A 1U60A 3LY3A 3SS5A 1PW1A 3CJMA 4P85A 3N6IA 5CTNA 3ZDJA 2XQZA 2Z2MB 3ZFZA 3OPPA 2RL3A 3NDGA 1ERQA 3IF6A 4LV1A 2J9OA 4KG6A 2Z2LB 3A3FA 3VSLA 1MBLA 3SS3A 3C4OA 5AQ7A 4DRTA 4N92A 2IWBA 3NI9A 1K54C 4B4XA 1KGFA 4JKTA 4HBTA 5GHZA 4LCMA 1YLPA 4X68A 1CK3A 1K6SA 2ZM0A 4GOGA 5U47A 4S2OA 1K56D 5CRFA 1ZG6A 3V50A 4OPRA 3UDIA 5EUAA 1E3UD 3ZNTA 4GD6A 4GDBA 4OP8A 5I94A 4X53A 1H8YA 4S2LA 5E2GA 2JE5A 5FDHA 2GDNA 4KG2A 2WGWB 5M1AA 3BFDA 3EQUA 4GKUA 2ZD8A 3WS4A 1IYSA 2RCXA 4DKIA 2ZC4B 2V2FF 2H0YA 4KZ4A 3WRTA 2EXBA 1ZKJA 1TDGA 2Y55A 2WADA 3EQVA 3UDXA 1ES4A 1WYCA 4IVKA 1CI8A 3UE3A 4N9KA 2P9VB 3BM6A 2WK0A 4KZ5A 3SH7A 2XEPA 4NK3A 3OPRA 1KDWA 1W8YA 4X55A 5CHMA 4JXGA 4XUXA 1K55C 4OOYA 2XK1A 1WE4A 3HVFA 1FOFA 4JF6A 1XXMA 3Q7VB 2G2UA 4E3LA 3MKFA 2Y2MA 3IXDA 1JWVA 3UN7A 3IH9A 3N8SA 2Y4AA 4S2NA 5DTKA 1NRFA 5FI6A 5HAPA 2R9WA 2Y2GA 3Q1FA 4BJPA 4Q8IA 5EOOA 3G32A 1C3BA 5AQAA 2Y59A 4H8RA 4C6YA 4WELA 1G68A 3ZG8B 3HUOA 5CHUA 1K38A 1W7FA 2XDMA 1N9BA 5FA7A 3GSGA 3BEBA 1ESIA 5CEBA 4ID4A 3ZG9B 4U0XA 4WM9A 3FYZA 3SH9A 1DY6A 3TG9A 4KENB 4BD1A 1KGGA 4WEJA 1ALQA 3MFDA 4A5RA 1DJCA 3QHYA 4JXVA 3VP4A 1NZUA 3HLFA 4X6TA 2OLUA 2BLSA 3G2ZA 1Q2QA 2Q9MA 3V39A 2IWDA 2ZC5B 4WZ5A 1LI9A 4EQIA 1I2WA 1L0DA 2HP9A 4S2IA 1YLYA 2XR0A 1BLSA 4N1XA 4R1GA 5AQBA 5A93A 4QU3A 4IVIA 4LV2A 1FCNA 5CEDA 2OSUA 1W8QA 3ZGAB 2A49A 1BULA 3HUMA 5CERA 2ZQ9A 4OPYA 5HW3A 3A3JA 1XP4A 2XF3A 4LV0A 5GLAA 2Y2PA 3OCLA 4PM7A 4BD0A 2Y2HA 1VQQA 1IYQA 4JLFA 1MXOA 5F83A 3VFFA 5EVIA 3GV9A 4R3JA 1DJBA 1RGZA 1H5XA 4OQHA 2HDRA 4Y0OA 5F1GA 3NY4A 4KQOA 3V3RA 2Y91A 5HAQA 4UA9A 2BG1A 5DF7A 5J8XA 3W4PA 2WZXA 4K0XA 4OQ0A 4GD8A 2X01A 4N9LA 1BT5A 1FSYA 1KGEA 1GCEA 3N8LA 4KZ6A 5M18A 2XGNA 2H0TA 1JWPA 3O86A 3ITBA 4UA6A 1ZC2A 4QB8A 5GL9A 4WBGA 4C3QA 5AQ9A 3AGDA 4WEKA 4KZ7A 4YINA 4CJNA 3GQZA 1K25A 1XX2A 3OC2A 4FH2A 2HDUA 4OLDA 3LO7A 2WGVA 3IHAA 4UHUA 4Y0TA 3O87A 1N4OA 4X69A 2Y2JA 1YLZA 3MZFA 4GZBA 4E3OA 3CG5A 1NYMA 2A3UA 1W79A 2ZMAA 1AXBA 5CGSA 5KSCA 3C7VA 5EPHA 4MBHA 1L2SA 5FAQA 2Y2LA 4QJGA 3VOYA 5KSHA 3GMWA 2C5WB 1CI9A 3HLWA 5BOHA 2XD1A 3IF6C 4LV3A 3UE0A 2PU2A 2XLNA 3UPNA 1MWTA 1SHVA 1W5DA 3Q7VA 4ZBEA 1PI5A 1Q2PA 1FQGA 3HLDA 5GLDA 1K57A 3VP3A 4E6WA 3I7JA 4P6BA 1TVFA 5FI7A 4OONA 3PBTA 4P0MA 2XD5A 2ZQ8A 1Y54A 3IQAA 3MXRA 1EI5A 5FQ9A 1LLBA 2E8IA 1BTLA 1VM1A 3V5MA 3MBZA 3IT9A 3UNWA 1BLPA 4OQGA 4CPKA 3IWIA 1SDEA 3HLCA 4RVAA 4E3KA 3HREA 3NIAA 1XPBA 4OQIA 4O7DA 2P74A 2WAEA 1PIOA 1PWDA 2DRWA 3Q07A 4EWFA 1SDNA 4LENA 1Z6FA 3OPLA 3HLBA 1K56A 3DWKA 3IF6B 3ZVTA 3FV7A 3UPPA 2ZM2A 5FAOA 1NYYA 3W4QA 4E3JA 3ZG5A 5D3OA 5FQQA 1BLHA 4D2OA 2Y2OA 1YQSA 1NJ4A 3FKVA 4GN2A 3O88A 4OLGA 4WYYA 4X56A 1ONHA 3HLGA 5G18A 1IKGA 3M6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VSK A;  4B4Z A;  1GHI A;  4OP5 A;  1FCO A;  5FAT A;  3N7W A;  1JTD A;  3VOZ A;  4KZA A;  5TGF A;  4F94 A;  2HDQ A;  4OH0 A;  5CGW A;  1RP5 A;  4HBU A;  4S2J A;  1YMX A;  2EFU A;  4QY6 A;  5L2F A;  3BFF A;  4S2P A;  4PPR A;  3N8R A;  1SCW A;  2Y2N A;  4JF4 A;  3V3S A;  1PI4 A;  1LL5 A;  3LCE A;  4DE0 A;  4GB7 A;  4QD4 A;  1FCM A;  2Y2I A;  1KDS A;  3BYD A;  2QZ6 A;  5F1F A;  3Q81 A;  4EBP A;  3ITA A;  4MNR A;  2J9P A;  3P98 A;  3NBL A;  4S2N C;  1ONG A;  1NZO A;  4P87 A;  4OVD A;  5EVL A;  2XFS A;  4FH4 A;  1JVJ A;  1O7E A;  1XA1 A;  2HP6 A;  3ZG0 A;  3DWZ A;  1YLJ A;  2B5R A;  2H5S A;  3LY4 A;  1BLC A;  1KVL A;  5CHJ A;  4E3I A;  4BQM A;  4FCF A;  1ERM A;  3BEC A;  3C4P A;  2EX9 A;  2HP5 A;  4EV4 A;  4WZ4 A;  4ZJ1 A;  3Q7Z A;  4IBX A;  1TEM A;  3FKW A;  2EX8 A;  1LI0 A;  5EVI D;  3CMZ A;  4KZB A;  4RYE A;  3BLM A;  4EBL A;  4C75 A;  3ISG A;  2ZM8 A;  3MKE A;  3MZE A;  5F82 A;  1E25 A;  1BSG A;  4L0L A;  2PU4 A;  1XKZ A;  1M6K A;  2H10 A;  1YM1 A;  3PAE A;  4QY5 A;  4WZ5 C;  3TOI A;  1GA0 A;  4KZ3 A;  4BLM A;  2ZJ9 A;  5EEC A;  4K0W A;  5DTT A;  4DXB A;  4FD8 A;  3S4X A;  5CXW A;  2ZLY A;  3W4O A;  4Z9Q A;  3G31 A;  4Y7P A;  5IHV A;  5FQM A;  1M40 A;  3DTM A;  5FQJ A;  3JYI A;  1IYP A;  2HDS A;  1QME A;  4ZJ3 A;  1XGI A;  4DF6 A;  3A3I A;  1RGY A;  3NCK A;  1FR6 A;  1PWG A;  1JWZ A;  2WYX A;  2Y2Q A;  3UY6 A;  4Y0U A;  3G2Y A;  3ZNY A;  1GHP A;  4IBR A;  5A92 A;  1IYO A;  2WGW A;  3PBN A;  1WYB A;  2WUQ A;  3QNC A;  2QPN A;  3E2L A;  2WKI A;  5EVI C;  1MKI A;  4DE3 A;  1IKI A;  4ZJ2 A;  1HD8 A;  3UPO A;  4HEF A;  3B3X A;  2WAF A;  1YMS A;  4EUZ A;  3FZC A;  3VP2 A;  3CZD A;  2J7V A;  3C7U A;  3D4F A;  1ES5 A;  1HVB A;  2JC7 A;  3HBR A;  3A3E A;  3OPH A;  4U3T A;  1K54 A;  3A3D A;  5A91 A;  4R0Q A;  3PTE A;  5E2H A;  1PZP A;  3LEZ A;  2P9V A;  4ZTK A;  3FWL A;  4KQR A;  5E2F A;  3BLS A;  1LL9 A;  3BRM A;  4DE1 A;  4MEZ A;  3Q82 A;  3HL9 A;  3PBR A;  3M2K A;  3WS5 A;  1DJA A;  3G4P A;  3NDE A;  4R3B A;  4UA7 A;  3ZCZ A;  4E3N A;  4KZ8 A;  1QMF A;  1GHM A;  4XXR A;  1IEL A;  3WS1 A;  4R4R A;  2J8Y A;  4WMC A;  4JBF A;  2Q9N A;  4K91 A;  2QMI A;  3G34 A;  5EVI B;  5FSR A;  1MPL A;  5HX9 A;  2EX2 A;  4KG5 A;  4JXW A;  3RXX A;  3WS0 A;  4S2K A;  3M6B A;  3IWO A;  4E3M A;  1CEG A;  1ES3 A;  5CGX A;  4GNU A;  1L0G A;  3IWQ A;  3IF5 A;  4R23 A;  1TDL A;  3SS4 A;  2ZC3 B;  3TSG A;  4EBN A;  5JYP A;  2OV5 A;  4OKP A;  1O07 A;  1S6R A;  1KE3 A;  1KE0 A;  2FFY A;  4QHC A;  2G2W A;  3BFC A;  1HZO A;  2VGJ A;  2WZZ A;  3G30 A;  3HUN A;  1L0E A;  2V20 A;  3QNB A;  4S2M A;  3S1Y A;  4JF5 A;  1K57 C;  1IEM A;  1K55 A;  3UDF A;  1HTZ A;  1E3U A;  3IXB A;  1PW8 A;  4NET A;  5CTM A;  5HAR A;  3RXW A;  4DDS A;  1MWU A;  1S0W A;  3W8K A;  1EWZ A;  4RA7 A;  5FQI A;  3PBO A;  2EX6 A;  2JCH A;  3VFH A;  1ESU A;  3IH8 A;  1I2S A;  2DNS A;  2XFT A;  3DW0 A;  4PM5 A;  3GR2 A;  4OOM A;  2I72 A;  2VGK A;  3UO9 A;  1YLT A;  1ZG4 A;  3ZHH A;  4GDN A;  4JXS A;  2C6W B;  1BZA A;  3MZD A;  1JTG A;  2ZQ7 A;  3IHB A;  1NY0 A;  3SH8 A;  5FAS A;  1E4D A;  4UAA A;  3HLE A;  3O3V A;  3RJU A;  2OLV A;  3N4I A;  4OPQ A;  4U0T A;  4FSF A;  5GLC A;  2X71 A;  4MBK A;  2ZC7 A;  1KE4 A;  4DXC A;  3VP0 A;  3OCN A;  3NC8 A;  3GVB A;  1MY8 A;  5DTS A;  2EFX A;  2R9X A;  2DCF A;  1PWC A;  2ZC6 B;  5DF9 A;  1H8Z A;  4M3K A;  1K4E A;  5GHX A;  1XGJ A;  2ZQC A;  2EXA A;  2XH9 A;  4PM8 A;  3P09 A;  5FQK A;  3GRJ A;  4ZDX A;  5DF8 A;  1K6R A;  5FAP A;  5A90 A;  5HFO A;  5KZH A;  3WRZ A;  5CEC A;  3VMA A;  3ZG7 B;  1YT4 A;  3BFE A;  4MLL A;  3OZH A;  5E2E A;  4PM6 A;  4DDY A;  5HAI A;  2HPB A;  1GA9 A;  2IWC A;  1OME A;  3IXH A;  1PYY A;  2FFF B;  4BL3 A;  5HL1 A;  2ZQA A;  4KZ9 A;  1LHY A;  5GLB A;  3C5A A;  3BFG A;  4OOL A;  3ZVW A;  3IXG A;  3S22 A;  5EOE A;  2WKH A;  1ERO A;  1MWS A;  4YFM A;  2PBY A;  1G6A A;  1I5Q A;  4MBF A;  4JPM A;  3PAG A;  4N1H A;  4PM9 A;  4XUZ A;  4PMA A;  5TR7 A;  2WKE A;  5DVA A;  5EE8 A;  4RX2 A;  4BL2 A;  1J9M A;  4B88 A;  1L0F A;  1NXY A;  5E43 A;  3PBS A;  4OPZ A;  2WGI A;  1BUE A;  4HES A;  2Y2K A;  2CC1 A;  5TFQ A;  1YLW A;  4LCL A;  3SOI A;  5JYO A;  1RCJ A;  3M2J A;  3VP1 A;  4DE2 A;  5M19 A;  4RX3 A;  1FR1 A;  3G35 A;  3MXS A;  4R4S A;  4E6X A;  5KMW A;  3WWX A;  1KVM A;  2JBF A;  3AGE A;  1CEF A;  1XA7 A;  5FI2 A;  4BEN A;  1FSW A;  3GTC A;  3AGF A;  4IED A;  2V1Z A;  2UWX A;  3WS2 A;  3PBQ A;  1K4F A;  1ES2 A;  4KQQ A;  3E2K A;  2X02 A;  4ZAM A;  1SKF A;  2ZQD A;  5GHY A;  4WMC D;  1MWR A;  1PZO A;  3UE1 A;  1U60 A;  3LY3 A;  3SS5 A;  1PW1 A;  3CJM A;  4P85 A;  3N6I A;  5CTN A;  3ZDJ A;  2XQZ A;  2Z2M B;  3ZFZ A;  3OPP A;  2RL3 A;  3NDG A;  1ERQ A;  3IF6 A;  4LV1 A;  2J9O A;  4KG6 A;  2Z2L B;  3A3F A;  3VSL A;  1MBL A;  3SS3 A;  3C4O A;  5AQ7 A;  4DRT A;  4N92 A;  2IWB A;  3NI9 A;  1K54 C;  4B4X A;  1KGF A;  4JKT A;  4HBT A;  5GHZ A;  4LCM A;  1YLP A;  4X68 A;  1CK3 A;  1K6S A;  2ZM0 A;  4GOG A;  5U47 A;  4S2O A;  1K56 D;  5CRF A;  1ZG6 A;  3V50 A;  4OPR A;  3UDI A;  5EUA A;  1E3U D;  3ZNT A;  4GD6 A;  4GDB A;  4OP8 A;  5I94 A;  4X53 A;  1H8Y A;  4S2L A;  5E2G A;  2JE5 A;  5FDH A;  2GDN A;  4KG2 A;  2WGW B;  5M1A A;  3BFD A;  3EQU A;  4GKU A;  2ZD8 A;  3WS4 A;  1IYS A;  2RCX A;  4DKI A;  2ZC4 B;  2V2F F;  2H0Y A;  4KZ4 A;  3WRT A;  2EXB A;  1ZKJ A;  1TDG A;  2Y55 A;  2WAD A;  3EQV A;  3UDX A;  1ES4 A;  1WYC A;  4IVK A;  1CI8 A;  3UE3 A;  4N9K A;  2P9V B;  3BM6 A;  2WK0 A;  4KZ5 A;  3SH7 A;  2XEP A;  4NK3 A;  3OPR A;  1KDW A;  1W8Y A;  4X55 A;  5CHM A;  4JXG A;  4XUX A;  1K55 C;  4OOY A;  2XK1 A;  1WE4 A;  3HVF A;  1FOF A;  4JF6 A;  1XXM A;  3Q7V B;  2G2U A;  4E3L A;  3MKF A;  2Y2M A;  3IXD A;  1JWV A;  3UN7 A;  3IH9 A;  3N8S A;  2Y4A A;  4S2N A;  5DTK A;  1NRF A;  5FI6 A;  5HAP A;  2R9W A;  2Y2G A;  3Q1F A;  4BJP A;  4Q8I A;  5EOO A;  3G32 A;  1C3B A;  5AQA A;  2Y59 A;  4H8R A;  4C6Y A;  4WEL A;  1G68 A;  3ZG8 B;  3HUO A;  5CHU A;  1K38 A;  1W7F A;  2XDM A;  1N9B A;  5FA7 A;  3GSG A;  3BEB A;  1ESI A;  5CEB A;  4ID4 A;  3ZG9 B;  4U0X A;  4WM9 A;  3FYZ A;  3SH9 A;  1DY6 A;  3TG9 A;  4KEN B;  4BD1 A;  1KGG A;  4WEJ A;  1ALQ A;  3MFD A;  4A5R A;  1DJC A;  3QHY A;  4JXV A;  3VP4 A;  1NZU A;  3HLF A;  4X6T A;  2OLU A;  2BLS A;  3G2Z A;  1Q2Q A;  2Q9M A;  3V39 A;  2IWD A;  2ZC5 B;  4WZ5 A;  1LI9 A;  4EQI A;  1I2W A;  1L0D A;  2HP9 A;  4S2I A;  1YLY A;  2XR0 A;  1BLS A;  4N1X A;  4R1G A;  5AQB A;  5A93 A;  4QU3 A;  4IVI A;  4LV2 A;  1FCN A;  5CED A;  2OSU A;  1W8Q A;  3ZGA B;  2A49 A;  1BUL A;  3HUM A;  5CER A;  2ZQ9 A;  4OPY A;  5HW3 A;  3A3J A;  1XP4 A;  2XF3 A;  4LV0 A;  5GLA A;  2Y2P A;  3OCL A;  4PM7 A;  4BD0 A;  2Y2H A;  1VQQ A;  1IYQ A;  4JLF A;  1MXO A;  5F83 A;  3VFF A;  5EVI A;  3GV9 A;  4R3J A;  1DJB A;  1RGZ A;  1H5X A;  4OQH A;  2HDR A;  4Y0O A;  5F1G A;  3NY4 A;  4KQO A;  3V3R A;  2Y91 A;  5HAQ A;  4UA9 A;  2BG1 A;  5DF7 A;  5J8X A;  3W4P A;  2WZX A;  4K0X A;  4OQ0 A;  4GD8 A;  2X01 A;  4N9L A;  1BT5 A;  1FSY A;  1KGE A;  1GCE A;  3N8L A;  4KZ6 A;  5M18 A;  2XGN A;  2H0T A;  1JWP A;  3O86 A;  3ITB A;  4UA6 A;  1ZC2 A;  4QB8 A;  5GL9 A;  4WBG A;  4C3Q A;  5AQ9 A;  3AGD A;  4WEK A;  4KZ7 A;  4YIN A;  4CJN A;  3GQZ A;  1K25 A;  1XX2 A;  3OC2 A;  4FH2 A;  2HDU A;  4OLD A;  3LO7 A;  2WGV A;  3IHA A;  4UHU A;  4Y0T A;  3O87 A;  1N4O A;  4X69 A;  2Y2J A;  1YLZ A;  3MZF A;  4GZB A;  4E3O A;  3CG5 A;  1NYM A;  2A3U A;  1W79 A;  2ZMA A;  1AXB A;  5CGS A;  5KSC A;  3C7V A;  5EPH A;  4MBH A;  1L2S A;  5FAQ A;  2Y2L A;  4QJG A;  3VOY A;  5KSH A;  3GMW A;  2C5W B;  1CI9 A;  3HLW A;  5BOH A;  2XD1 A;  3IF6 C;  4LV3 A;  3UE0 A;  2PU2 A;  2XLN A;  3UPN A;  1MWT A;  1SHV A;  1W5D A;  3Q7V A;  4ZBE A;  1PI5 A;  1Q2P A;  1FQG A;  3HLD A;  5GLD A;  1K57 A;  3VP3 A;  4E6W A;  3I7J A;  4P6B A;  1TVF A;  5FI7 A;  4OON A;  3PBT A;  4P0M A;  2XD5 A;  2ZQ8 A;  1Y54 A;  3IQA A;  3MXR A;  1EI5 A;  5FQ9 A;  1LLB A;  2E8I A;  1BTL A;  1VM1 A;  3V5M A;  3MBZ A;  3IT9 A;  3UNW A;  1BLP A;  4OQG A;  4CPK A;  3IWI A;  1SDE A;  3HLC A;  4RVA A;  4E3K A;  3HRE A;  3NIA A;  1XPB A;  4OQI A;  4O7D A;  2P74 A;  2WAE A;  1PIO A;  1PWD A;  2DRW A;  3Q07 A;  4EWF A;  1SDN A;  4LEN A;  1Z6F A;  3OPL A;  3HLB A;  1K56 A;  3DWK A;  3IF6 B;  3ZVT A;  3FV7 A;  3UPP A;  2ZM2 A;  5FAO A;  1NYY A;  3W4Q A;  4E3J A;  3ZG5 A;  5D3O A;  5FQQ A;  1BLH A;  4D2O A;  2Y2O A;  1YQS A;  1NJ4 A;  3FKV A;  4GN2 A;  3O88 A;  4OLG A;  4WYY A;  4X56 A;  1ONH A;  3HLG A;  5G18 A;  1IKG A;  3M6H A; 
#chains in the Genus database with same CATH topology
 2J3T C;  4B4Z A;  1GHI A;  2HJE A;  3IX3 A;  4F94 A;  4Y17 A;  2ZMV A;  4OH0 A;  1TF1 A;  4HBU A;  5L2F A;  3N8R A;  2Y2N A;  1LL5 A;  4YWZ A;  2Y2I A;  3KX0 X;  1KDS A;  2QZ6 A;  5L8M A;  3P98 A;  3NBL A;  3LUQ A;  1NZO A;  1O7E A;  1YLJ A;  5HWW A;  3LY4 A;  1P9R A;  1KVL A;  4E3I A;  1XFN A;  2EX9 A;  4EV4 A;  4WZ4 A;  3FKW A;  4KZB A;  3DTI A;  3MKE A;  1TS0 A;  4WZ5 C;  1GA0 A;  3T1Q B;  2ZJ9 A;  5K5B A;  5DTT A;  4UQI S;  2O9B A;  5FL3 A;  4Y7P A;  5IHV A;  1FIK A;  2BAS A;  4DF6 A;  5A92 A;  2WGW A;  1CJF A;  2WUQ A;  3QNC A;  3E2L A;  2KLI A;  4L9E A;  1MKI A;  1IKI A;  3DTE A;  2WAF A;  3CAX A;  3CZD A;  3D4F A;  1ES5 A;  2H28 A;  2JC7 A;  3A3E A;  4U3T A;  2LB5 A;  5A91 A;  4R0Q A;  3LEZ A;  1BYW A;  1LL9 A;  3WS5 A;  2W1T A;  3CWF A;  4KZ8 A;  3WS1 A;  4XXR A;  1IEL A;  3G34 A;  3LR4 A;  3RXX A;  2EA9 A;  1L0G A;  2AVX A;  3IF5 A;  4G3V A;  2OV5 A;  2FFY A;  2QWS A;  5J3W A;  1HZO A;  3S1Y A;  3HUN A;  3G30 A;  2V20 A;  1HTZ A;  1E3U A;  4NXG A;  1S0W A;  2VKS A;  1ESU A;  2DNS A;  2XFT A;  4NXB A;  2VGK A;  1YLT A;  1ZG4 A;  3ZHH A;  4Y3I A;  3H82 B;  5FEF A;  3NOT C;  5G4Y A;  3U4L P;  5FAS A;  1E4D A;  3HLE A;  3O3V A;  3RJU A;  2X71 A;  4MBK A;  2ZC7 A;  1KE4 A;  4HJ3 A;  3NC8 A;  3GVB A;  3UE6 A;  3OBF A;  1MY8 A;  2EFX A;  5DF9 A;  1XGJ A;  2ZQC A;  2XH9 A;  2EWW A;  3P09 A;  5FQK A;  4ZDX A;  3R4K A;  5HFO A;  5CEC A;  5L10 A;  3BFE A;  3PXP A;  5E2E A;  4Y15 A;  4DDY A;  1PYY A;  3C5A A;  4OOL A;  3S22 A;  4I5S A;  1MWS A;  4YFM A;  2PBY A;  4ARZ A;  3E98 A;  2KDK A;  2PBD P;  4JPM A;  5TR7 A;  3CUE C;  5EE8 A;  4B88 A;  2WGI A;  2Y2K A;  2CC1 A;  1RCJ A;  2A2L A;  2Y79 A;  5KMW A;  1CEF A;  4BBT A;  4BEN A;  1FSW A;  3GTC A;  4IED A;  1K4F A;  2X02 A;  4WMC D;  1GSX A;  1P9W A;  1PZO A;  3CJM A;  3ZDJ A;  4EUV A;  3IF6 A;  4LV1 A;  2YKF A;  3A3F A;  3C4O A;  2J3W A;  3ICY A;  2IWB A;  2P7J A;  4B4X A;  1KGF A;  3MFX A;  5U47 A;  4S2O A;  3H82 A;  2QKP A;  3T4Q A;  4OP8 A;  3L9K A;  5E2G A;  5FDH A;  4KG2 A;  3BFD A;  3W2Z A;  4GKU A;  3R7W A;  3WS4 A;  1PNE A;  1IYS A;  2RCX A;  4CQH A;  2P04 A;  2V2F F;  2D01 A;  5AVF A;  4LLO B;  1WYC A;  1LSX A;  2XEP A;  1W8Y A;  4X55 A;  4JXG A;  1K55 C;  2W3G A;  4JF6 A;  4E3L A;  4Y5F A;  3UN7 A;  3N8S A;  5AJG A;  3QP1 A;  3E0Y A;  5DTK A;  2R9W A;  5HD3 A;  1T19 A;  3G32 A;  1XJ2 A;  5AQA A;  4CLC C;  3HUO A;  5FA7 A;  1K38 A;  4EER A;  2XDM A;  3GSG A;  4U0X A;  4WM9 A;  3SH9 A;  3TJZ C;  2ACG A;  1DJC A;  2JN7 A;  3QP2 A;  3VP4 A;  2UV0 E;  2ZBB A;  1Q2Q A;  4WN5 A;  2IWD A;  4WZ5 A;  2PAV P;  2PD8 A;  4S2I A;  5AQB A;  4QU3 A;  2Z6C A;  1FCN A;  2JKG A;  5CED A;  1W8Q A;  4IJG A;  4EU0 A;  3HUM A;  4LV0 A;  1OTB A;  4BD0 A;  1L3L A;  1IYQ A;  1OTI A;  3T1X A;  1MXO A;  3VFF A;  3G6O A;  3K3D A;  1RGZ A;  2VZW A;  4GLQ A;  4HNB A;  1DRM A;  1D7E A;  4WF0 A;  5F1G A;  2JKF A;  5J8X A;  3MJQ A;  3UB9 A;  4OQ0 A;  3N8L A;  4KZ6 A;  4EES A;  2XGN A;  4I3I A;  1JWP A;  2P08 A;  4UA6 A;  1ZC2 A;  5AQ9 A;  3AGD A;  3EEH A;  4GS9 A;  1K25 A;  1XX2 A;  4OLD A;  5EVE A;  4EEP A;  4UHU A;  1N4O A;  3BQ8 A;  3T4L A;  4GZB A;  4R6L A;  5CGS A;  1W63 M;  4NG2 A;  2Y2L A;  2WKP A;  1CI9 A;  2XA7 S;  2XD1 A;  2D02 A;  1SHV A;  5GLD A;  1UGU A;  1TVF A;  2QYB A;  2XD5 A;  1Y54 A;  5FQ9 A;  2VK3 A;  3MBZ A;  1BLP A;  1SDE A;  2OWJ A;  2ZL1 A;  4OQI A;  4O7D A;  4O0P A;  2DRW A;  1K0K A;  2W3H A;  3HLB A;  3DWK A;  3FV7 A;  3W4Q A;  4E3J A;  4EQ1 A;  1BLH A;  2Y2O A;  1YQS A;  1NJ4 A;  4GN2 A;  3O88 A;  4OLG A;  1F98 A;  4MN7 A;  2B95 A;  4S2P A;  3M6H A;  3C30 A;  5FAT A;  3VOZ A;  4KZA A;  3K2N A;  4S2J A;  1YMX A;  4JGQ A;  3BFF A;  4WUJ A;  4BWI A;  3V3S A;  4JF4 A;  1YSQ A;  4DE0 A;  4DJ2 A;  1FCM A;  4MN5 A;  4QWO A;  4NXF A;  1OT9 A;  1ONG A;  4P87 A;  2NUP C;  2B5R A;  2H5S A;  3CUE A;  2GZA A;  5CHJ A;  5TJJ A;  1ERM A;  3BEC A;  1VEU B;  3C4P A;  4CLC B;  3K3C A;  2EX8 A;  5EVI D;  5L07 A;  3MZE A;  4QY5 A;  4KZ3 A;  5EEC A;  2BTF P;  4FD8 A;  3S4X A;  5CXW A;  3W4O A;  3G31 A;  2V0U A;  4B93 A;  2V1A A;  4ZJ3 A;  3NCK A;  2WYX A;  4Y0U A;  3G2Y A;  1GHP A;  4IBR A;  3FC7 A;  2PYR A;  1WYB A;  3UPO A;  4HEF A;  3MQQ A;  4EUZ A;  3FZC A;  2E8J A;  3C7U A;  3HBR A;  2P9V A;  4KQR A;  5E2F A;  3BLS A;  2O9C A;  3HL9 A;  3M2K A;  3F1O B;  3ZCZ A;  4UA7 A;  1ZTU A;  4R4R A;  3B47 A;  4K91 A;  2QMI A;  5FSR A;  5EFW A;  4KG5 A;  3WS0 A;  2L0W A;  4S2K A;  1CEG A;  3IBR A;  3IWQ A;  3F1P B;  4EBN A;  4OKP A;  1O07 A;  1S6R A;  1KE3 A;  4QHC A;  2G2W A;  5DJT A;  4S2M A;  3ZYT A;  1ACF A;  1K55 A;  4NET A;  1S66 L;  4DDS A;  1MWU A;  2VA0 A;  4RA7 A;  3H9W A;  3LFV A;  4PHT A;  3PBO A;  3VOL A;  4FUW A;  3LIF A;  3DW0 A;  2YKH A;  1LSV A;  4PM5 A;  3UO9 A;  4GDN A;  4CLC A;  2C6W B;  3U2A A;  1BZA A;  1JTG A;  2ZQ7 A;  4NXE A;  2OWH A;  4U0T A;  1YAX A;  4F3L A;  3CI6 A;  2DCF A;  1PWC A;  4ESP A;  3HCY A;  3IS2 B;  5DF8 A;  1K6R A;  5KZH A;  2V8C A;  4B9O A;  3C38 A;  3ZG7 B;  3F1N B;  4YOF A;  2IWC A;  1OME A;  4BL3 A;  1LHY A;  3IXG A;  3E4Q A;  2WKH A;  4IUH A;  2Q0O A;  3UMD A;  1I5Q A;  4MBF A;  4L9G A;  3PAG A;  4N1H A;  5DVA A;  4BL2 A;  1V9Z A;  1L0F A;  1NXY A;  3PBS A;  5F68 A;  4HES A;  3F1O A;  5TFQ A;  2VGL M;  5JYO A;  2G7U A;  2FH5 A;  4RX3 A;  1FR1 A;  3G35 A;  4R4S A;  5HPI A;  3EGX C;  3AGE A;  1N9O A;  1XA7 A;  3AGF A;  1NLZ A;  2UWX A;  3IX4 A;  4Y2F A;  1ES2 A;  3F1P A;  4ZAM A;  4GW9 A;  1MWR A;  3UE1 A;  1U60 A;  4HJ6 A;  1PW1 A;  1F5M A;  2RL3 A;  4EEU A;  4KG6 A;  3VSL A;  3LI8 A;  4R3A A;  3NI9 A;  4EXO A;  4ZRR A;  2O0Y A;  3NOP C;  4EW7 A;  4X68 A;  5EM1 A;  1CK3 A;  2ZM0 A;  5CRF A;  1ZG6 A;  2M7U A;  3UDI A;  1E3U D;  4GD6 A;  4S2L A;  1TS7 A;  1UWP X;  3EQU A;  4DKI A;  4R38 A;  3TE8 A;  3BY9 A;  4E04 A;  1D06 A;  1ZKJ A;  3IS2 A;  3MXQ A;  3T4K A;  1ES4 A;  4HHD A;  4FOF A;  4KZ5 A;  3SH7 A;  4NK3 A;  4ETX A;  3OPR A;  1WE4 A;  3IX8 A;  1FOF A;  3Q7V B;  1OTE A;  1JWV A;  3IH9 A;  2PHY A;  1S4R A;  5FI6 A;  2Y2G A;  4BJP A;  2HGV A;  3NJA A;  1C3B A;  2Y59 A;  1G68 A;  1Y4O A;  5FEG A;  1ESI A;  5CEB A;  3FYZ A;  3TG9 A;  1KGG A;  1ALQ A;  4JXV A;  1NZU A;  2OLU A;  3G2Z A;  4HH2 A;  2Q9M A;  2XSS A;  3DBA A;  1I2W A;  4NKP A;  2HP9 A;  2O99 A;  1BLS A;  4N1X A;  4R1G A;  2OSU A;  2I9V A;  2PT7 A;  2Z6D A;  4LGW A;  1ODV A;  5F5Y A;  2ZQ9 A;  2OOL A;  2OAP 1;  4HJ4 A;  3EOI A;  4FTX A;  2HJ9 C;  4PM7 A;  2Y2H A;  1VQQ A;  3GV9 A;  4O8G A;  4R3J A;  1DJB A;  3GEC A;  2HDR A;  4Y0O A;  5L09 A;  4KUK A;  4H6J B;  3V3R A;  2BG1 A;  2WZX A;  4GD8 A;  1KGE A;  2H0T A;  3KSF A;  3O86 A;  3ITB A;  5GL9 A;  4JGO A;  4C3Q A;  4KZ7 A;  4FH2 A;  3FPW A;  1XJ4 A;  4Y0T A;  4G3K A;  5F6A A;  2K31 A;  5EM0 A;  1YLZ A;  4D60 A;  3CG5 A;  3BJN A;  1NYM A;  2A3U A;  1W79 A;  2V9A A;  3UB7 A;  5KSC A;  3C7V A;  1V9Y A;  2W27 A;  1L2S A;  5HDS A;  4QJG A;  3HLW A;  5BOH A;  3BW6 A;  4LV3 A;  3Q7V A;  1W5D A;  1PI5 A;  4PKY A;  5J4E A;  1Q2P A;  1FQG A;  3VP3 A;  4E6W A;  3I7J A;  2J3T D;  5G4Z A;  5FI7 A;  1JNU A;  4HIA A;  3MXR A;  1IFQ A;  4Q0H A;  2E8I A;  3V5M A;  3UNW A;  1H3Q A;  4E3K A;  2P74 A;  4PAU A;  2WAE A;  1PIO A;  1PWD A;  4EWF A;  1SDN A;  2GX5 A;  4ETZ A;  5FAO A;  2VV7 A;  3FKV A;  3JPU A;  4MCW A;  1DP6 A;  1FCO A;  1JTD A;  4WLA A;  4HI4 A;  1YKD A;  5CGW A;  1RP5 A;  2EFU A;  1PI4 A;  3LCE A;  4JGR A;  2L4R A;  4GB7 A;  4R70 A;  4QD4 A;  1VHM A;  3BYD A;  3ITA A;  3EWK A;  4S2N C;  1EW0 A;  4OVD A;  5EVL A;  2XFS A;  4FH4 A;  1A0K A;  1JVJ A;  1XA1 A;  4LRX C;  4H6J A;  4Z1W A;  5HD5 A;  4LRY C;  5HSQ A;  3E4O A;  2HP5 A;  4ZJ1 A;  3Q7Z A;  1LI0 A;  3CMZ A;  4EBL A;  4C75 A;  2ZM8 A;  1E25 A;  2HV1 A;  1XJ3 A;  1XKZ A;  2H10 A;  3A0S A;  3RFB A;  3TOI A;  3JVU A;  4BLM A;  4DXB A;  4QPR A;  2ZLY A;  4Z9Q A;  2QHK A;  5FQM A;  4X25 A;  5LBR A;  3CIT A;  2HDS A;  1XGI A;  3A3I A;  1RGY A;  5F69 A;  1JWZ A;  3S7P A;  2Y2Q A;  2HZ5 A;  5HDC A;  2W3D A;  4I38 A;  2WKI A;  4IHQ A;  4DE3 A;  5HL6 A;  3LR0 A;  1HD8 A;  1S67 L;  1YMS A;  5IU1 A;  2J7V A;  1HVB A;  2JKR I;  3T50 A;  3FPV A;  3A3D A;  3QP6 A;  2PRF A;  3PTE A;  5E2H A;  1PZP A;  5IS1 A;  3LR5 A;  3DTK A;  3BRM A;  4DE1 A;  4MEZ A;  3Q82 A;  3PBR A;  3G4P A;  4E3N A;  2KOI A;  1GHM A;  4LFU A;  2J8Y A;  4JBF A;  2VJW A;  1T1B A;  2Q9N A;  5EVI B;  1MPL A;  5HX9 A;  2EX2 A;  2INW A;  1W63 Q;  4JXW A;  3M6B A;  1D1J A;  3IWO A;  4GNU A;  3TSG A;  3IBJ A;  3D72 A;  2QJ7 A;  3VE4 A;  3B33 A;  3BFC A;  1F2K A;  2VGJ A;  4G3W A;  3ZVT A;  1L0E A;  4JF5 A;  3UB6 A;  3UDF A;  4Q0I A;  1DP9 A;  3IXB A;  5HAR A;  3RXW A;  3S7Q A;  5FQI A;  3CPT B;  4GCZ A;  2JCH A;  3VFH A;  1YSP A;  3MSH A;  1I2S A;  2OAQ 1;  3GR2 A;  4JXS A;  5DFX A;  3MZD A;  3IHB A;  1NY0 A;  3A0V A;  3HJI A;  3N4I A;  3HJK A;  5GLC A;  3VP0 A;  3OCN A;  2R9X A;  2ZC6 B;  1H8Z A;  4M3K A;  5GHX A;  2EXA A;  4PM8 A;  2J80 A;  3LIB A;  1P0Z A;  2A24 B;  1CF0 A;  5MC7 A;  3WRZ A;  1MC0 A;  4JGP A;  1YT4 A;  4MLL A;  4RQ9 A;  4PM6 A;  4Y13 A;  5HAI A;  3S7O A;  1GA9 A;  3IXH A;  2W0N A;  2O9A A;  5HL1 A;  3BFG A;  3LID A;  3VE3 A;  5EOE A;  2W3E A;  1LT0 A;  2PD7 A;  3MMH A;  4MN6 A;  4XUZ A;  3A0R A;  2L1M A;  2XRN A;  4K08 A;  4EET B;  2Y8H A;  3JVV A;  1X0O A;  1YLW A;  1HLU P;  4X1L A;  4DE2 A;  5M19 A;  4E6X A;  1CQA A;  1XJ6 A;  3FG8 A;  4M4X A;  3WS2 A;  3PR6 A;  2ZOH A;  3PBQ A;  1VET B;  1WA9 A;  2ZQD A;  1G28 A;  3SS5 A;  3N6I A;  3LEQ A;  2Z2M B;  3ZFZ A;  3OPP A;  2QJ5 A;  1S1Z A;  3SS3 A;  5AQ7 A;  1IOU A;  3CPT A;  3T4J A;  1K54 C;  4JKT A;  4HBT A;  3T12 B;  3OLO A;  1K6S A;  3RH8 B;  5HWV A;  1K56 D;  4OPR A;  1LSW A;  5I94 A;  4X53 A;  1G6O A;  1H8Y A;  2GDN A;  2WGW B;  2ZD8 A;  3WRT A;  2H0Y A;  3KYZ A;  4KZ4 A;  2A24 A;  2WAD A;  3EQV A;  4MDZ A;  3BQA A;  4IVK A;  3D9Y A;  1CI8 A;  4P6Z M;  1SKO B;  1VEU A;  2FZ0 A;  1NLY A;  1KDW A;  2W1T B;  5CHM A;  4XUX A;  2XK1 A;  3HVF A;  1XXM A;  2M7V A;  3MF0 A;  5C5K A;  4S2N A;  4Q8I A;  2W1R A;  4C6Y A;  4WEL A;  5CHU A;  1N9B A;  4ID4 A;  3ZG9 B;  1J3W A;  4HOI A;  3QHY A;  1Y28 A;  4X6T A;  2BLS A;  3V39 A;  2ZC5 B;  4HP4 A;  1L0D A;  1YLY A;  2XR0 A;  3MR0 A;  3LR3 A;  3MQ0 A;  1VET A;  4IVI A;  2JKT M;  2V1B A;  1H0M A;  5DJU A;  4HQA A;  5CER A;  1S4S A;  4OPY A;  5A8B A;  4UQI M;  5GLA A;  2NUT C;  3TRC A;  1N9L A;  2W3F A;  2VGL S;  1XFQ A;  2WKR A;  4KUO A;  2PYP A;  3NY4 A;  4KQO A;  2Y91 A;  3W4P A;  3KYE A;  4N9L A;  3P01 A;  1FSY A;  2MJ6 A;  4CJN A;  4YIN A;  3T1R A;  3GQZ A;  5HPF A;  4AFI A;  2VX8 A;  4ARZ B;  3LO7 A;  3IHA A;  4IUK A;  3O87 A;  3EEA A;  2Y2J A;  2JKR M;  3LYX A;  2ZMA A;  1SKO A;  1AXB A;  5HZH A;  4MBH A;  5FAQ A;  1TS8 A;  3GMW A;  2C5W B;  4YNR A;  3UPN A;  3UE0 A;  2PU2 A;  1MWT A;  4ZBE A;  2V8F A;  2GNX A;  2JHE A;  3LI9 A;  1OPX A;  3LGO A;  4P6B A;  4OON A;  4P0M A;  4HY8 A;  1LLB A;  1BTL A;  3IT9 A;  4CPK A;  3IWI A;  3HRE A;  3F1N A;  2WKQ A;  3CLO A;  3Q07 A;  1Z6F A;  3B42 A;  3OPL A;  3IF6 B;  2ZM2 A;  1NYY A;  2LB9 A;  3ZG5 A;  5DKL A;  5IT5 A;  4WYY A;  5FDS A;  1ONH A;  3HLG A;  5G18 A;  2GJ3 A;  3VSK A;  4OP5 A;  3N7W A;  3T1S A;  5CX7 A;  5J7E A;  5TGF A;  2HDQ A;  4GHI B;  1NRJ A;  4QY6 A;  4PPR A;  1SCW A;  1F9I A;  4CLC E;  3KO6 A;  5F1F A;  3Q81 A;  4EBP A;  2XRO A;  4MNR A;  2J9P A;  3R7W B;  1GSW A;  1MKM A;  3QP5 A;  3UB5 P;  2HP6 A;  3ZG0 A;  3DWZ A;  4BMW A;  1BLC A;  4BQM A;  3PHY A;  4FCF A;  3LIC A;  4IBX A;  1TEM A;  4RYE A;  3BLM A;  3T4O A;  3ISG A;  3VV4 A;  1G5U A;  5F82 A;  1BSG A;  4L0L A;  3BY8 A;  2PU4 A;  3PAE A;  1M6K A;  1T1C A;  1YM1 A;  5HDD A;  4K0W A;  1MZU A;  5HWT A;  4DJ3 A;  1M40 A;  3DTM A;  3KSI A;  5FQJ A;  3JYI A;  1IYP A;  1QME A;  4LRZ E;  1FR6 A;  2VEA A;  1PWG A;  3QP4 A;  4Q0J A;  5TBM B;  3UY6 A;  3ZNY A;  1TD5 A;  2B18 A;  3L7H A;  1IYO A;  3PBN A;  2QPN A;  5EVI C;  4ZJ2 A;  3B3X A;  3VP2 A;  3OPH A;  1K54 A;  5EV0 A;  3SZT A;  4ZTK A;  3FWL A;  4O01 A;  1AWI A;  1DJA A;  3NDE A;  4R3B A;  1QMF A;  4WMC A;  3BWL A;  2VLG A;  1ZHH B;  1VB6 A;  4E3M A;  5DKK A;  1ES3 A;  5CGX A;  4GHI A;  3DAV A;  3SS4 A;  4R23 A;  5JYP A;  1TDL A;  3SW1 A;  2ZC3 B;  3NHQ A;  1KE0 A;  4DN0 A;  4BBU A;  2WZZ A;  3QNB A;  1S1Y A;  1K57 C;  1IEM A;  3TW8 A;  3GDI A;  1PW8 A;  5CTM A;  1N9N A;  4GS9 B;  3W8K A;  5I5L A;  1EWZ A;  2EX6 A;  3C8C A;  3IH8 A;  3EGD C;  4OOM A;  2I72 A;  2CMN A;  3SH8 A;  4MMN A;  4UAA A;  2OLV A;  4OPQ A;  4FSF A;  4DXC A;  1YPR A;  5DTS A;  3QP8 A;  2K7S A;  2PDR A;  1K4E A;  2VV8 A;  1OJ5 A;  3GRJ A;  3D3O A;  5FAP A;  5A90 A;  2JKT I;  3VMA A;  2ZL1 B;  3E4P A;  3OZH A;  4KQD A;  2HPB A;  5TBM A;  2FFF B;  1STZ A;  3CHW P;  2ZQA A;  4KZ9 A;  1UWN X;  5GLB A;  2IA2 A;  3ZVW A;  5AVE A;  1ERO A;  1G6A A;  1OTD A;  4PKY G;  4PM9 A;  4PMA A;  2WKE A;  4RX2 A;  1J9M A;  2PR6 A;  1PRQ A;  5E43 A;  4OPZ A;  1BUE A;  4LCL A;  3SOI A;  3M2J A;  3VP1 A;  1T1A A;  3MXS A;  3WWX A;  4XT2 B;  1KVM A;  2JBF A;  5FI2 A;  1GSV A;  3H7W B;  2V1Z A;  3KYQ A;  1DP8 A;  4BBV A;  4KQQ A;  3E2K A;  1OJG A;  2EWV A;  1SKF A;  1T18 A;  3NUL A;  5GHY A;  4X1M A;  5KIZ A;  3LY3 A;  5CTN A;  4P85 A;  3KSH A;  2XQZ A;  3NDG A;  1ERQ A;  2J9O A;  2Z2L B;  1MBL A;  4DRT A;  4N92 A;  3LIE A;  4I39 A;  1NWZ A;  5GHZ A;  4LCM A;  1YLP A;  2XA7 M;  4GOG A;  3V50 A;  5EUA A;  3ZNT A;  4GDB A;  2JE5 A;  5M1A A;  3O5Y A;  3PYP A;  1OTA A;  2ZC4 B;  2EXB A;  1TDG A;  2Y55 A;  2KX6 A;  4L9F A;  3UDX A;  3LIA A;  1FIL A;  4HH3 A;  3UE3 A;  2ZMF A;  4N9K A;  2P9V B;  3BM6 A;  2WK0 A;  4WL9 A;  3P7N A;  2ZOI A;  4UEY A;  4OOY A;  4I3A A;  2G2U A;  3MKF A;  2Y2M A;  3IXD A;  2Y4A A;  1NRF A;  5HAP A;  3Q1F A;  5EOO A;  4H8R A;  3NEC A;  4II7 A;  3ZG8 B;  3C2W A;  1W7F A;  3S7N A;  3BEB A;  1DY6 A;  4KEN B;  4BD1 A;  4WEJ A;  3MFD A;  4A5R A;  2DMW A;  4XT2 A;  3T4S A;  3HLF A;  1LI9 A;  3H7W A;  3NOU C;  4EQI A;  2HF6 A;  1H8M A;  3MQO A;  5A93 A;  4LV2 A;  3ZGA B;  2A49 A;  2VV6 A;  1BUL A;  5HW3 A;  3A3J A;  1XP4 A;  2XF3 A;  3T4T A;  2Y2P A;  3OCL A;  4JLF A;  5F83 A;  2K2N A;  4F3L B;  4NEE D;  5EVI A;  1H5X A;  1TS6 A;  2M1C A;  4OQH A;  1SZV A;  3OOV A;  5HAQ A;  4UA9 A;  4I3J A;  5DF7 A;  4K0X A;  2X01 A;  1BT5 A;  1GCE A;  5M18 A;  4LPZ A;  4QB8 A;  4WBG A;  4WEK A;  3V67 A;  3OC2 A;  2HDU A;  2WGV A;  3UB8 A;  3ZQ5 A;  2R78 A;  4X69 A;  2PR5 A;  4E3O A;  3MZF A;  1P97 A;  3RTY A;  4GJ4 A;  5EPH A;  3MS6 A;  5DFY A;  1LL8 A;  3VOY A;  5KSH A;  3IF6 C;  2XLN A;  1PFL A;  3HLD A;  3KSG A;  4ME4 A;  1K57 A;  3PBT A;  2ZQ8 A;  3IQA A;  1EI5 A;  1Z09 A;  1KOU A;  1VM1 A;  4CLC D;  4OQG A;  3HLC A;  4RVA A;  2B02 A;  3NIA A;  1XPB A;  4HP9 A;  4LEN A;  4DMZ A;  3ULF A;  4P6Z S;  1K56 A;  1OT6 A;  3UPP A;  5D3O A;  5FQQ A;  4D2O A;  3UME A;  4X56 A;  2V0W A;  1IKG A; 
#chains in the Genus database with same CATH homology
 3VSK A;  4B4Z A;  1GHI A;  4OP5 A;  1FCO A;  5FAT A;  3N7W A;  1JTD A;  3VOZ A;  4KZA A;  5TGF A;  4F94 A;  2HDQ A;  4OH0 A;  5CGW A;  1RP5 A;  4HBU A;  4S2J A;  1YMX A;  2EFU A;  4QY6 A;  5L2F A;  3BFF A;  4S2P A;  4PPR A;  3N8R A;  1SCW A;  2Y2N A;  4JF4 A;  3V3S A;  1PI4 A;  1LL5 A;  3LCE A;  4DE0 A;  4GB7 A;  4QD4 A;  1FCM A;  2Y2I A;  1KDS A;  3BYD A;  2QZ6 A;  5F1F A;  3Q81 A;  4EBP A;  3ITA A;  4MNR A;  2J9P A;  3P98 A;  3NBL A;  4S2N C;  1ONG A;  1NZO A;  4P87 A;  4OVD A;  5EVL A;  2XFS A;  4FH4 A;  1JVJ A;  1O7E A;  1XA1 A;  2HP6 A;  3ZG0 A;  3DWZ A;  1YLJ A;  2B5R A;  2H5S A;  3LY4 A;  1BLC A;  1KVL A;  5CHJ A;  4E3I A;  4BQM A;  4FCF A;  1ERM A;  3BEC A;  3C4P A;  2EX9 A;  2HP5 A;  4EV4 A;  4WZ4 A;  4ZJ1 A;  3Q7Z A;  4IBX A;  1TEM A;  3FKW A;  2EX8 A;  1LI0 A;  5EVI D;  3CMZ A;  4KZB A;  4RYE A;  3BLM A;  4EBL A;  4C75 A;  3ISG A;  2ZM8 A;  3MKE A;  3MZE A;  5F82 A;  1E25 A;  1BSG A;  4L0L A;  2PU4 A;  1XKZ A;  1M6K A;  2H10 A;  1YM1 A;  3PAE A;  4QY5 A;  4WZ5 C;  3TOI A;  1GA0 A;  4KZ3 A;  4BLM A;  2ZJ9 A;  5EEC A;  4K0W A;  5DTT A;  4DXB A;  4FD8 A;  3S4X A;  5CXW A;  2ZLY A;  3W4O A;  4Z9Q A;  3G31 A;  4Y7P A;  5IHV A;  5FQM A;  1M40 A;  3DTM A;  5FQJ A;  3JYI A;  1IYP A;  2HDS A;  1QME A;  4ZJ3 A;  1XGI A;  4DF6 A;  3A3I A;  1RGY A;  3NCK A;  1FR6 A;  1PWG A;  1JWZ A;  2WYX A;  2Y2Q A;  3UY6 A;  4Y0U A;  3G2Y A;  3ZNY A;  1GHP A;  4IBR A;  5A92 A;  1IYO A;  2WGW A;  3PBN A;  1WYB A;  2WUQ A;  3QNC A;  2QPN A;  3E2L A;  2WKI A;  5EVI C;  1MKI A;  4DE3 A;  1IKI A;  4ZJ2 A;  1HD8 A;  3UPO A;  4HEF A;  3B3X A;  2WAF A;  1YMS A;  4EUZ A;  3FZC A;  3VP2 A;  3CZD A;  2J7V A;  3C7U A;  3D4F A;  1ES5 A;  1HVB A;  2JC7 A;  3HBR A;  3A3E A;  3OPH A;  4U3T A;  1K54 A;  3A3D A;  5A91 A;  4R0Q A;  3PTE A;  5E2H A;  1PZP A;  3LEZ A;  2P9V A;  4ZTK A;  3FWL A;  4KQR A;  5E2F A;  3BLS A;  1LL9 A;  3BRM A;  4DE1 A;  4MEZ A;  3Q82 A;  3HL9 A;  3PBR A;  3M2K A;  3WS5 A;  1DJA A;  3G4P A;  3NDE A;  4R3B A;  4UA7 A;  3ZCZ A;  4E3N A;  4KZ8 A;  1QMF A;  1GHM A;  4XXR A;  1IEL A;  3WS1 A;  4R4R A;  2J8Y A;  4WMC A;  4JBF A;  2Q9N A;  4K91 A;  2QMI A;  3G34 A;  5EVI B;  5FSR A;  1MPL A;  5HX9 A;  2EX2 A;  4KG5 A;  4JXW A;  3RXX A;  3WS0 A;  4S2K A;  3M6B A;  3IWO A;  4E3M A;  1CEG A;  1ES3 A;  5CGX A;  4GNU A;  1L0G A;  3IWQ A;  3IF5 A;  4R23 A;  1TDL A;  3SS4 A;  2ZC3 B;  3TSG A;  4EBN A;  5JYP A;  2OV5 A;  4OKP A;  1O07 A;  1S6R A;  1KE3 A;  1KE0 A;  2FFY A;  4QHC A;  2G2W A;  3BFC A;  1HZO A;  2VGJ A;  2WZZ A;  3G30 A;  3HUN A;  1L0E A;  2V20 A;  3QNB A;  4S2M A;  3S1Y A;  4JF5 A;  1K57 C;  1IEM A;  1K55 A;  3UDF A;  1HTZ A;  1E3U A;  3IXB A;  1PW8 A;  4NET A;  5CTM A;  5HAR A;  3RXW A;  4DDS A;  1MWU A;  1S0W A;  3W8K A;  1EWZ A;  4RA7 A;  5FQI A;  3PBO A;  2EX6 A;  2JCH A;  3VFH A;  1ESU A;  3IH8 A;  1I2S A;  2DNS A;  2XFT A;  3DW0 A;  4PM5 A;  3GR2 A;  4OOM A;  2I72 A;  2VGK A;  3UO9 A;  1YLT A;  1ZG4 A;  3ZHH A;  4GDN A;  4JXS A;  2C6W B;  1BZA A;  3MZD A;  1JTG A;  2ZQ7 A;  3IHB A;  1NY0 A;  3SH8 A;  5FAS A;  1E4D A;  4UAA A;  3HLE A;  3O3V A;  3RJU A;  2OLV A;  3N4I A;  4OPQ A;  4U0T A;  4FSF A;  5GLC A;  2X71 A;  4MBK A;  2ZC7 A;  1KE4 A;  4DXC A;  3VP0 A;  3OCN A;  3NC8 A;  3GVB A;  1MY8 A;  5DTS A;  2EFX A;  2R9X A;  2DCF A;  1PWC A;  2ZC6 B;  5DF9 A;  1H8Z A;  4M3K A;  1K4E A;  5GHX A;  1XGJ A;  2ZQC A;  2EXA A;  2XH9 A;  4PM8 A;  3P09 A;  5FQK A;  3GRJ A;  4ZDX A;  5DF8 A;  1K6R A;  5FAP A;  5A90 A;  5HFO A;  5KZH A;  3WRZ A;  5CEC A;  3VMA A;  3ZG7 B;  1YT4 A;  3BFE A;  4MLL A;  3OZH A;  5E2E A;  4PM6 A;  4DDY A;  5HAI A;  2HPB A;  1GA9 A;  2IWC A;  1OME A;  3IXH A;  1PYY A;  2FFF B;  4BL3 A;  5HL1 A;  2ZQA A;  4KZ9 A;  1LHY A;  5GLB A;  3C5A A;  3BFG A;  4OOL A;  3ZVW A;  3IXG A;  3S22 A;  5EOE A;  2WKH A;  1ERO A;  1MWS A;  4YFM A;  2PBY A;  1G6A A;  1I5Q A;  4MBF A;  4JPM A;  3PAG A;  4N1H A;  4PM9 A;  4XUZ A;  4PMA A;  5TR7 A;  2WKE A;  5DVA A;  5EE8 A;  4RX2 A;  4BL2 A;  1J9M A;  4B88 A;  1L0F A;  1NXY A;  5E43 A;  3PBS A;  4OPZ A;  2WGI A;  1BUE A;  4HES A;  2Y2K A;  2CC1 A;  5TFQ A;  1YLW A;  4LCL A;  3SOI A;  5JYO A;  1RCJ A;  3M2J A;  3VP1 A;  4DE2 A;  5M19 A;  4RX3 A;  1FR1 A;  3G35 A;  3MXS A;  4R4S A;  4E6X A;  5KMW A;  3WWX A;  1KVM A;  2JBF A;  3AGE A;  1CEF A;  1XA7 A;  5FI2 A;  4BEN A;  1FSW A;  3GTC A;  3AGF A;  4IED A;  2V1Z A;  2UWX A;  3WS2 A;  3PBQ A;  1K4F A;  1ES2 A;  4KQQ A;  3E2K A;  2X02 A;  4ZAM A;  1SKF A;  2ZQD A;  5GHY A;  4WMC D;  1MWR A;  1PZO A;  3UE1 A;  1U60 A;  3LY3 A;  3SS5 A;  1PW1 A;  3CJM A;  4P85 A;  3N6I A;  5CTN A;  3ZDJ A;  2XQZ A;  2Z2M B;  3ZFZ A;  3OPP A;  2RL3 A;  3NDG A;  1ERQ A;  3IF6 A;  4LV1 A;  2J9O A;  4KG6 A;  2Z2L B;  3A3F A;  3VSL A;  1MBL A;  3SS3 A;  3C4O A;  5AQ7 A;  4DRT A;  4N92 A;  2IWB A;  3NI9 A;  1K54 C;  4B4X A;  1KGF A;  4JKT A;  4HBT A;  5GHZ A;  4LCM A;  1YLP A;  4X68 A;  1CK3 A;  1K6S A;  2ZM0 A;  4GOG A;  5U47 A;  4S2O A;  1K56 D;  5CRF A;  1ZG6 A;  3V50 A;  4OPR A;  3UDI A;  5EUA A;  1E3U D;  3ZNT A;  4GD6 A;  4GDB A;  4OP8 A;  5I94 A;  4X53 A;  1H8Y A;  4S2L A;  5E2G A;  2JE5 A;  5FDH A;  2GDN A;  4KG2 A;  2WGW B;  5M1A A;  3BFD A;  3EQU A;  4GKU A;  2ZD8 A;  3WS4 A;  1IYS A;  2RCX A;  4DKI A;  2ZC4 B;  2V2F F;  2H0Y A;  4KZ4 A;  3WRT A;  2EXB A;  1ZKJ A;  1TDG A;  2Y55 A;  2WAD A;  3EQV A;  3UDX A;  1ES4 A;  1WYC A;  4IVK A;  1CI8 A;  3UE3 A;  4N9K A;  2P9V B;  3BM6 A;  2WK0 A;  4KZ5 A;  3SH7 A;  2XEP A;  4NK3 A;  3OPR A;  1KDW A;  1W8Y A;  4X55 A;  5CHM A;  4JXG A;  4XUX A;  1K55 C;  4OOY A;  2XK1 A;  1WE4 A;  3HVF A;  1FOF A;  4JF6 A;  1XXM A;  3Q7V B;  2G2U A;  4E3L A;  3MKF A;  2Y2M A;  3IXD A;  1JWV A;  3UN7 A;  3IH9 A;  3N8S A;  2Y4A A;  4S2N A;  5DTK A;  1NRF A;  5FI6 A;  5HAP A;  2R9W A;  2Y2G A;  3Q1F A;  4BJP A;  4Q8I A;  5EOO A;  3G32 A;  1C3B A;  5AQA A;  2Y59 A;  4H8R A;  4C6Y A;  4WEL A;  1G68 A;  3ZG8 B;  3HUO A;  5CHU A;  1K38 A;  1W7F A;  2XDM A;  1N9B A;  5FA7 A;  3GSG A;  3BEB A;  1ESI A;  5CEB A;  4ID4 A;  3ZG9 B;  4U0X A;  4WM9 A;  3FYZ A;  3SH9 A;  1DY6 A;  3TG9 A;  4KEN B;  4BD1 A;  1KGG A;  4WEJ A;  1ALQ A;  3MFD A;  4A5R A;  1DJC A;  3QHY A;  4JXV A;  3VP4 A;  1NZU A;  3HLF A;  4X6T A;  2OLU A;  2BLS A;  3G2Z A;  1Q2Q A;  2Q9M A;  3V39 A;  2IWD A;  2ZC5 B;  4WZ5 A;  1LI9 A;  4EQI A;  1I2W A;  1L0D A;  2HP9 A;  4S2I A;  1YLY A;  2XR0 A;  1BLS A;  4N1X A;  4R1G A;  5AQB A;  5A93 A;  4QU3 A;  4IVI A;  4LV2 A;  1FCN A;  5CED A;  2OSU A;  1W8Q A;  3ZGA B;  2A49 A;  1BUL A;  3HUM A;  5CER A;  2ZQ9 A;  4OPY A;  5HW3 A;  3A3J A;  1XP4 A;  2XF3 A;  4LV0 A;  5GLA A;  2Y2P A;  3OCL A;  4PM7 A;  4BD0 A;  2Y2H A;  1VQQ A;  1IYQ A;  4JLF A;  1MXO A;  5F83 A;  3VFF A;  5EVI A;  3GV9 A;  4R3J A;  1DJB A;  1RGZ A;  1H5X A;  4OQH A;  2HDR A;  4Y0O A;  5F1G A;  3NY4 A;  4KQO A;  3V3R A;  2Y91 A;  5HAQ A;  4UA9 A;  2BG1 A;  5DF7 A;  5J8X A;  3W4P A;  2WZX A;  4K0X A;  4OQ0 A;  4GD8 A;  2X01 A;  4N9L A;  1BT5 A;  1FSY A;  1KGE A;  1GCE A;  3N8L A;  4KZ6 A;  5M18 A;  2XGN A;  2H0T A;  1JWP A;  3O86 A;  3ITB A;  4UA6 A;  1ZC2 A;  4QB8 A;  5GL9 A;  4WBG A;  4C3Q A;  5AQ9 A;  3AGD A;  4WEK A;  4KZ7 A;  4YIN A;  4CJN A;  3GQZ A;  1K25 A;  1XX2 A;  3OC2 A;  4FH2 A;  2HDU A;  4OLD A;  3LO7 A;  2WGV A;  3IHA A;  4UHU A;  4Y0T A;  3O87 A;  1N4O A;  4X69 A;  2Y2J A;  1YLZ A;  3MZF A;  4GZB A;  4E3O A;  3CG5 A;  1NYM A;  2A3U A;  1W79 A;  2ZMA A;  1AXB A;  5CGS A;  5KSC A;  3C7V A;  5EPH A;  4MBH A;  1L2S A;  5FAQ A;  2Y2L A;  4QJG A;  3VOY A;  5KSH A;  3GMW A;  2C5W B;  1CI9 A;  3HLW A;  5BOH A;  2XD1 A;  3IF6 C;  4LV3 A;  3UE0 A;  2PU2 A;  2XLN A;  3UPN A;  1MWT A;  1SHV A;  1W5D A;  3Q7V A;  4ZBE A;  1PI5 A;  1Q2P A;  1FQG A;  3HLD A;  5GLD A;  1K57 A;  3VP3 A;  4E6W A;  3I7J A;  4P6B A;  1TVF A;  5FI7 A;  4OON A;  3PBT A;  4P0M A;  2XD5 A;  2ZQ8 A;  1Y54 A;  3IQA A;  3MXR A;  1EI5 A;  5FQ9 A;  1LLB A;  2E8I A;  1BTL A;  1VM1 A;  3V5M A;  3MBZ A;  3IT9 A;  3UNW A;  1BLP A;  4OQG A;  4CPK A;  3IWI A;  1SDE A;  3HLC A;  4RVA A;  4E3K A;  3HRE A;  3NIA A;  1XPB A;  4OQI A;  4O7D A;  2P74 A;  2WAE A;  1PIO A;  1PWD A;  2DRW A;  3Q07 A;  4EWF A;  1SDN A;  4LEN A;  1Z6F A;  3OPL A;  3HLB A;  1K56 A;  3DWK A;  3IF6 B;  3ZVT A;  3FV7 A;  3UPP A;  2ZM2 A;  5FAO A;  1NYY A;  3W4Q A;  4E3J A;  3ZG5 A;  5D3O A;  5FQQ A;  1BLH A;  4D2O A;  2Y2O A;  1YQS A;  1NJ4 A;  3FKV A;  4GN2 A;  3O88 A;  4OLG A;  4WYY A;  4X56 A;  1ONH A;  3HLG A;  5G18 A;  1IKG A;  3M6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...