1NYYA

Crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (105)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Recognition and resistance in TEM beta-lactamase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 96
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1nyyA00
1ZG6A 1ERQA 1SCWA 1ES3A 5IHVA 5KZHA 1KDWA 4HEFA 4WELA 3DWKA 1MWUA 4WBGA 3W8KA 4NK3A 5TR7A 1QMEA 5E2HA 4KQRA 5E2EA 1XPBA 1JTDA 3IQAA 2HPBA 5BOHA 5CTMA 1K6RA 2WKHA 3PBQA 2Y59A 1L2SA 3HLDA 1N4OA 3ZG5A 4IVKA 1ERMA 5KMWA 2OSUA 3V50A 3IXBA 2RCXA 2VGJA 3IXHA 5HX9A 5GHXA 2HP6A 1XGIA 3CJMA 5CEDA 2WGWB 1K56D 3BLSA 3O86A 5CERA 1EROA 3G2ZA 3IWOA 3VSKA 1KE0A 5CHUA 5FQIA 2Y2MA 4Y0OA 3ZCZA 3UDIA 2J9PA 2XD1A 1BT5A 3GV9A 3RJUA 2JCHA 1JWPA 2XDMA 1GA0A 5FSRA 3AGDA 3G2YA 3E2KA 3N6IA 4DE1A 4DXBA 4K91A 3GR2A 3NDGA 5CTNA 4KZ6A 4CPKA 4JXVA 3VP4A 1L0FA 3VP3A 1MWTA 4FH4A 3VFHA 1SKFA 3A3FA 4R3JA 3WRTA 1IELA 1XKZA 2EFXA 4PPRA 1LL5A 5DVAA 1IYPA 3IXDA 4WZ4A 4R0QA 5E2FA 4QY5A 1WE4A 2QZ6A 4MBKA 2H0YA 1DJBA 2Y2KA 3CG5A 3MZEA 4KZ4A 5GHYA 3MZDA 4PM6A 5M18A 4E3IA 2XQZA 4KG6A 2JE5A 4XXRA 4DDYA 5AQBA 4Z9QA 2ZC4B 3IHBA 5M1AA 2Y2GA 1K57C 4S2MA 3OPRA 3Q07A 5L2FA 4OONA 1E3UD 3UPNA 1H8ZA 2IWBA 1MKIA 4S2NA 2ZLYA 4MBFA 4OH0A 4JLFA 3PBRA 3AGEA 4EWFA 1RP5A 4OP8A 2BG1A 1LI9A 4E3KA 1CEFA 1YLPA 1WYBA 1JTGA 3GMWA 3OC2A 2HDQA 4RYEA 1BLPA 3BFGA 2EX2A 5F82A 1Q2PA 3V3RA 4KZ7A 3LY3A 2Y2OA 1Y54A 3GRJA 4OLDA 5CECA 3PBNA 3HLBA 4GNUA 1SDNA 3IH8A 3OCNA 3V5MA 5EECA 4DRTA 1ES2A 3G30A 1YQSA 2ZQCA 3A3DA 3MFDA 3NIAA 4KG2A 4LV3A 5FAPA 1NJ4A 4F94A 5DTTA 1SHVA 3N8RA 3UPOA 5EVIA 1RGYA 3ZDJA 4DKIA 2Q9MA 3Q7ZA 1IKGA 3NCKA 3BFFA 4OQGA 3HLCA 3PBSA 5HAQA 2H10A 5FI2A 2J9OA 1K55A 1MY8A 4P6BA 4GKUA 4KZ9A 1IYOA 1M40A 5DF8A 2P74A 2WYXA 3UPPA 1XA7A 3IF6C 1L0EA 5CGSA 5G18A 3UE3A 3HUNA 4YFMA 4S2PA 1IYQA 3IXGA 2Y2JA 4KZ3A 4E3OA 2ZQ8A 3WS1A 1YLTA 4BL2A 3HUOA 4XUXA 5EPHA 1E25A 4KZAA 1LL9A 2EX6A 1FOFA 5A90A 4KZ5A 2WGIA 3N4IA 4JBFA 3HLEA 1XGJA 4XUZA 4EQIA 2ZC3B 1ZC2A 4CJNA 3NC8A 3ISGA 4FH2A 1I5QA 2I72A 3OPHA 4O7DA 4C3QA 5F1FA 3WRZA 1PWGA 3G32A 5FASA 3VP1A 2WGVA 5EVIC 1W7FA 2HDRA 5TGFA 4HBUA 1ZG4A 2H0TA 5GL9A 4E3LA 3N8SA 5FI6A 2V1ZA 5FI7A 2QPNA 2WZZA 2WZXA 2Y2QA 2WAEA 2XH9A 1K55C 3M2KA 5M19A 4KQQA 1K56A 4OPYA 3C4OA 2J7VA 4WEJA 2Y2LA 3CZDA 5EOEA 3ZHHA 3W4QA 4DF6A 1G6AA 1Z6FA 2XD5A 1K54A 4ID4A 1ALQA 1W8YA 5DF9A 4EV4A 1TEMA 3BECA 2Z2MB 4S2IA 5FA7A 2ZM0A 3UO9A 4UA9A 3ZG8B 1YLJA 3A3EA 2P9VB 1ES4A 4EBPA 1ESIA 3PAEA 1K6SA 1MWSA 1NXYA 1NY0A 3MKEA 4UHUA 1ESUA 3IH9A 3Q1FA 5GLDA 4E3JA 2DCFA 2GDNA 3IF6B 3IT9A 3IF5A 3NI9A 4UA6A 4X6TA 3LEZA 3G35A 2EFUA 3A3IA 3FV7A 4FSFA 3O87A 1LHYA 4R3BA 3PAGA 3MKFA 1HVBA 2FFYA 3RXWA 3VP0A 3D4FA 1PZOA 4BQMA 3SS5A 1XP4A 1NZUA 3LCEA 3ZFZA 2XEPA 4MBHA 1J9MA 3HLWA 3HLFA 4IEDA 4C6YA 4E3NA 3BM6A 3IWIA 3TSGA 3UDFA 3SH9A 5A92A 5DTSA 1BULA 4QHCA 2B5RA 1NZOA 4KZBA 3O3VA 4P0MA 5HAPA 2OLVA 5EVIB 1SDEA 4PM9A 5CHJA 1BLSA 4DXCA 2WK0A 3M6BA 4OVDA 4S2KA 3IHAA 3WS2A 4QJGA 4OPZA 1KGEA 5DTKA 5KSHA 4N9KA 3N8LA 1FSYA 1K38A 1NYMA 4JXGA 4L0LA 2ZC7A 1KVLA 4S2LA 3VOZA 3DTMA 4Q8IA 3QNCA 4KENB 3LO7A 2Y55A 3NY4A 1CI9A 1N9BA 1IYSA 1C3BA 1O07A 3EQUA 3SS3A 3UY6A 3MBZA 2ZC5B 4E6XA 1BZAA 1DY6A 4MEZA 1GA9A 4GN2A 2C6WB 3FZCA 4UAAA 3S1YA 3EQVA 3P09A 1GHIA 4OPRA 5E2GA 2RL3A 3ZVTA 2PU4A 5HARA 3BRMA 3WS4A 2WGWA 3V3SA 2Y2NA 3OCLA 5FAQA 2XF3A 3I7JA 4UA7A 4QD4A 1GCEA 4ZAMA 2Y2PA 4LCMA 2X01A 4LENA 4R4RA 4FCFA 4X55A 1MXOA 4PM7A 3HUMA 3BEBA 3WS0A 4WZ5A 1GHPA 2ZM8A 4LV1A 4S2NC 2ZQ9A 1AXBA 4H8RA 3SS4A 5J8XA 1RGZA 2V20A 2Y4AA 1NYYA 5EE8A 5F1GA 1YMXA 4N9LA 2IWCA 3C7UA 1W5DA 3NDEA 3GSGA 3VSLA 4BJPA 3VP2A 3DW0A 3ZG9B 1PYYA 1LI0A 4GOGA 3VFFA 1FCNA 2JC7A 2HDUA 4EBNA 4DDSA 4IVIA 2Y91A 1HZOA 4FD8A 4N1XA 4GDBA 1RCJA 2BLSA 4Y7PA 4DE3A 3QHYA 1FR1A 2Z2LB 4A5RA 2ZQ7A 3Q7VA 3ITBA 4RX2A 4S2OA 1CEGA 2J8YA 4ZJ3A 5TFQA 3SH8A 1TVFA 1IEMA 3P98A 4JF4A 3TOIA 5EVLA 3W4PA 4Y0TA 2ZQDA 3FWLA 5EVID 1FCOA 1BSGA 2IWDA 4BLMA 5JYOA 4RX3A 3G34A 4K0XA 4E3MA 4K0WA 4ZDXA 3C7VA 1MWRA 1M6KA 4OP5A 5U47A 4LV2A 3FKWA 3AGFA 1KVMA 4X56A 3JYIA 4R1GA 3MXRA 5JYPA 5E43A 2XR0A 2ZMAA 2ZQAA 1YMSA 4GDNA 3SH7A 5HAIA 2WUQA 4OLGA 4MLLA 3WWXA 2G2UA 5AQ9A 1XXMA 4WMCD 2Q9NA 3BFEA 4KG5A 4X69A 1K25A 1ONHA 2PU2A 1HD8A 3QNBA 4BD0A 2OV5A 1LLBA 4IBXA 3ZGAB 3VMAA 1XA1A 2XLNA 2OLUA 4JPMA 3NBLA 4HESA 4KQOA 2ZD8A 1NRFA 5GLBA 2JBFA 5EUAA 4DE2A 1O7EA 1VM1A 4B4ZA 4X68A 3UE1A 2EX9A 4GD8A 4LV0A 2X02A 1YLZA 3G31A 1TDLA 4EBLA 1JVJA 5CGWA 2A3UA 4LCLA 1CI8A 3GQZA 1K57A 4C75A 2DNSA 1BLHA 1E3UA 1K54C 4JF5A 1PZPA 1E4DA 1PW8A 3C4PA 4OQHA 2A49A 4NETA 1VQQA 4WEKA 4ZTKA 5A93A 5FAOA 2WKIA 1QMFA 1S0WA 4MNRA 3WS5A 4IBRA 4QB8A 3FYZA 3G4PA 3M6HA 1EWZA 3HVFA 1S6RA 5F83A 5A91A 3ZG7B 1EI5A 3S22A 2G2WA 3PBTA 2ZC6B 3PTEA 5GLAA 3ZVWA 1K4EA 4ZJ1A 4OOLA 4OQ0A 4ZJ2A 3UE0A 4N1HA 1XX2A 2R9WA 5CGXA 4BD1A 3ZG0A 2PBYA 1KGGA 1ES5A 3OZHA 4KZ8A 4JXWA 3E2LA 4OQIA 4JXSA 2FFFB 3O88A 2WADA 1DJCA 3W4OA 4PM5A 2HP5A 1FQGA 1YT4A 4EUZA 3UN7A 4WYYA 1W79A 2XGNA 3Q81A 1PI4A 3Q7VB 2WAFA 1TDGA 3DWZA 1BLCA 4JKTA 4RA7A 4HBTA 4GD6A 2QMIA 2WKEA 2Y2HA 4PM8A 5CRFA 4DE0A 5AQ7A 1CK3A 1KGFA 3MZFA 4OKPA 3ITAA 5HW3A 3GTCA 2EXAA 1KDSA 1Q2QA 2P9VA 1YLYA 1YM1A 4BL3A 1FR6A 3Q82A 1BUEA 2EX8A 4GZBA 3ZNYA 1KE3A 4B88A 1U60A 1PWCA 1PI5A 3IF6A 5CHMA 3UDXA 2V2FF 1IKIA 4YINA 3UNWA 5AQAA 2ZJ9A 1JWVA 4P87A 2E8IA 1KE4A 2X71A 3FKVA 2UWXA 5HL1A 3PBOA 3ZNTA 4PMAA 4E6WA 4WM9A 2CC1A 5FQ9A 3M2JA 1W8QA 2HDSA 4RVAA 2Y2IA 1H8YA 4P85A 1L0DA 2DRWA 1GHMA 3HREA 2HP9A 3C5AA 5FDHA 5FQKA 1PWDA 5GHZA 4JF6A 4QU3A 1H5XA 4S2JA 3BFCA 3IWQA 4M3KA 1L0GA 2R9XA 3HL9A 4R4SA 4U0XA 3N7WA 3SOIA 1FCMA 5FATA 2ZM2A 5FQQA 3RXXA 5KSCA 1ZKJA 4B4XA 5FQJA 2XFSA 4BENA 3TG9A 1DJAA 5FQMA 5DF7A 3B3XA 5CXWA 4OPQA 1BTLA 4X53A 2XK1A 5D3OA 1I2WA 4WZ5C 3MXSA 3V39A 5HFOA 3S4XA 1K4FA 1PIOA 3BYDA 1PW1A 3HBRA 5GLCA 3OPPA 1MPLA 3BLMA 1MBLA 4Y0UA 3HLGA 3A3JA 4ZBEA 1FSWA 4D2OA 4OOMA 4GB7A 2EXBA 4WMCA 1I2SA 3GVBA 1G68A 4U3TA 1JWZA 1HTZA 3VOYA 5EOOA 2VGKA 4QY6A 1OMEA 4OOYA 3OPLA 2C5WB 5I94A 5CEBA 1ONGA 2H5SA 3BFDA 1YLWA 4U0TA 4R23A 1WYCA 3CMZA 4N92A 3LY4A 2XFTA
chains in the Genus database with same CATH superfamily
5IHVA 2ACGA 4NG2A 2J3TC 5E2HA 3OOVA 3IS2B 1WA9A 5BOHA 3PBQA 4HP9A 1TS8A 2Y8HA 4IVKA 2KLIA 2Z6DA 2VGJA 1XJ2A 2HP6A 1XGIA 3BLSA 5CERA 1EROA 3IWOA 3VSKA 5FQIA 4Y0OA 3RFBA 4CLCA 3JVVA 1BT5A 2KX6A 1JWPA 2XDMA 1GA0A 5FSRA 2O9BA 4HP4A 3E2KA 4DE1A 3GR2A 4JXVA 2HGVA 5AJGA 3VP4A 1DRMA 4FH4A 3T50A 4ME4A 3A3FA 3T4SA 3LGOA 1IYPA 3MS6A 3BJNA 2L4RA 2Y2KA 5GHYA 4PM6A 4GHIA 5KIZA 1FILA 1K57C 4S2MA 3Q07A 5L2FA 1E3UD 4E04A 4JLFA 3C2WA 1LI9A 1YLPA 2FZ0A 1V9YA 4RYEA 2P04A 3A0RA 3BFGA 1Q2PA 1SKOB 3LY3A 5F69A 3PBNA 3HLBA 4GNUA 2M1CA 5EECA 3MFXA 4Y13A 3A3DA 3MFDA 3NIAA 2LB5A 3EGXC 2VEAA 2ZL1B 3UPOA 2Q9MA 1UGUA 4KZ9A 3KYEA 2P74A 4MMNA 5CGSA 3T4JA 1L0EA 4CLCE 3E4OA 4S2PA 3K3CA 3LIFA 3IXGA 4BL2A 5A90A 4ZRRA 3QP1A 1ZC2A 1F5MA 3B47A 3OPHA 5F1FA 1W7FA 4E3LA 2V1ZA 5FI7A 3C8CA 1LL8A 3H82A 3M2KA 2YKFA 4KQQA 4I3JA 3T1XA 3ZHHA 3A0SA 2LB9A 1G6AA 1Z6FA 3KSFA 2VJWA 4ID4A 4EV4A 1TEMA 5FA7A 3UO9A 1H3QA 4EESA 3ZG8B 4MDZA 2V9AA 3PAEA 1K6SA 1YKDA 1ESUA 3IT9A 4X6TA 1Z09A 5FL3A 3K2NA 1XP4A 2UV0E 1PRQA 3ZFZA 4IEDA 3T1SA 3MJQA 3IBJA 4QHCA 3O3VA 2WK0A 4OVDA 4S2KA 4OPZA 4I5SA 1FSYA 4JXGA 2INWA 3A0VA 4ETZA 3LO7A 3C38A 3MMHA 1IYSA 3SS3A 2ZC5B 4Z1WA 1OTBA 4MEZA 1GA9A 5J4EA 3FZCA 3S1YA 4B9OA 3WS4A 1NWZA 4PAUA 2QHKA 4QD4A 4LCMA 2X01A 4R4RA 3T4QA 4PM7A 3BEBA 4WZ5A 4S2NC 5J8XA 3F1PB 4N9LA 4R70A 3VSLA 4D60A 4BJPA 1S1ZA 1SZVA 5DJTA 4R38A 1D06A 1LI0A 1FCNA 3R4KA 4IVIA 1HZOA 4N1XA 4GDBA 2V1AA 2V1BA 3Q7VA 3ITBA 4RX2A 3SH8A 3TOIA 1S67L 4Y0TA 5EVID 3BWLA 3G34A 4K0XA 4E3MA 4FUWA 1MWRA 1M6KA 1D7EA 3AGFA 2HZ5A 1P97A 1X0OA 3HJKA 4GDNA 3SH7A 5AQ9A 3LR0A 1T1BA 3KYQA 1VHMA 5G4YA 1HD8A 4IBXA 1VEUB 2XLNA 2OLUA 3NBLA 4KQOA 2ZD8A 3LICA 5GLBA 5EUAA 4NEED 5EM1A 1T1CA 1YLZA 2X02A 4HI4A 2HJ9C 2JN7A 3W2ZA 1BLHA 1K54C 1E4DA 1PW8A 2A49A 4NETA 5A93A 5FAOA 1S0WA 5HDSA 3WS5A 4QB8A 4ARZB 1EWZA 5A91A 3ZG7B 3UE0A 4N1HA 3KSGA 4L9FA 3ZG0A 3VE3A 2PBYA 2PHYA 1ES5A 4KZ8A 3E2LA 4EUVA 2HV1A 2PT7A 2L0WA 3F1NA 1H0MA 4PM5A 2HP5A 4EUZA 2QKPA 2XGNA 3MQ0A 3Q7VB 2JKGA 2WAFA 3LR5A 5CRFA 4DE0A 1KGFA 5HW3A 3O5YA 1YLYA 3Q82A 4GS9A 4NXBA 4B88A 2W0NA 3IF6A 3UDXA 3PYPA 4YINA 1IKIA 4P87A 4Y5FA 2X71A 3PR6A 3ZNTA 4WM9A 2CC1A 5FQ9A 3IX3A 1GSWA 4P85A 5FQKA 1PWDA 5GHZA 5CX7A 4JF6A 1H5XA 4S2JA 2W1TB 3IWQA 1A0KA 1KOUA 4B4XA 2OWJA 2XFSA 3TG9A 1DJAA 5FDSA 5CXWA 1G6OA 1BTLA 3F1OB 4X53A 5HFOA 3IX8A 1K4FA 1S4RA 4KQDA 5GLCA 4Y0UA 3HLGA 3VOYA 1OMEA 4OOYA 5I94A 5CEBA 5J3WA 1OTEA 3BFDA 2NUPC 4U0TA 4R23A 1WYCA 3CMZA 4Q0IA 1ES3A 1KDWA 4HEFA 2V8CA 3DWKA 3W8KA 4NK3A 5TR7A 1QMEA 5TBMB 1G5UA 2HPBA 5G4ZA 2Z6CA 3UB5P 1L2SA 4FOFA 3V50A 1F9IA 3CJMA 4R3AA 2WGWB 3O86A 3G2ZA 3R7WA 3LIBA 3U4LP 2J9PA 3RJUA 4DXBA 4K91A 3QP2A 1L0FA 3HJIA 1SKFA 3DTKA 4PPRA 1LL5A 5DVAA 3IXDA 5E2FA 4B93A 4QY5A 4LFUA 1EW0A 1WE4A 4MBKA 3MZDA 1MKMA 2XQZA 5AVEA 4DDYA 5AQBA 3SW1A 4Z9QA 3OPRA 5IU1A 4EWFA 2A24B 2O9CA 5HDCA 3OC2A 2HDQA 1BLPA 2EWWA 4LGWA 1H8MA 2FH5A 3KYZA 4OLDA 4HIAA 3UB7A 1SDNA 3OCNA 3FPVA 4ESPA 4KG2A 4LV3A 1NJ4A 3N8RA 3ZDJA 3LIAA 1IKGA 3HLCA 3PBSA 4P6ZS 1MY8A 1F2KA 1IYOA 1M40A 3UPPA 1T18A 3JPUA 2Y2JA 4AFIA 4E3OA 1P0ZA 1YLTA 4F3LB 1E25A 4KZAA 4UEYA 2WGIA 2E8JA 3HLEA 3NC8A 4FH2A 1I5QA 3DTIA 1OPXA 3PXPA 5FASA 2WGVA 5TGFA 2H0TA 2J3TD 1Y28A 2WZZA 1JNUA 2Y2QA 2XH9A 4DJ3A 4P6ZM 5M19A 1N9LA 2J7VA 2Y2LA 5EOEA 2WKQA 5IS1A 2ZM0A 3ICYA 5EVEA 3KSIA 4UA9A 1OTIA 3A3EA 4EBPA 1MWSA 1NY0A 5GLDA 4E3JA 2O9AA 3NHQA 3IF5A 3NI9A 3A3IA 3FV7A 4R3BA 3RXWA 2FFYA 2V0WA 3K3DA 4BQMA 2BASA 3LCEA 2XEPA 2XA7S 4MBHA 3HLWA 3HLFA 3BM6A 3TSGA 3UDFA 3SH9A 5A92A 1LSWA 1BULA 3LR4A 1NZOA 3LI9A 4MN5A 2OLVA 1BLSA 4JGRA 3CI6A 3IHAA 3WS2A 5KSHA 1KGEA 5DTKA 4N9KA 4CLCC 5FEFA 5L07A 3NY4A 3EQUA 1S66L 1BZAA 3CPTA 1DY6A 4GN2A 2GX5A 4BBVA 2K2NA 3P09A 5E2GA 4EERA 2XA7M 4BWIA 3OCLA 2XF3A 2Y2PA 4LENA 1DP9A 4FCFA 2JKTM 4X55A 3HUMA 4NXEA 4LV1A 1ZTUA 1AXBA 4NXFA 1RGZA 2V20A 2Y4AA 3C30A 3C7UA 3NDEA 3DW0A 5DFXA 5DFYA 2JC7A 2HDUA 4EBNA 4FD8A 3D72A 1TS6A 4CLCB 4Y7PA 1PNEA 1VETA 4ETXA 3S7NA 1CEGA 2J8YA 3NOTC 4L9EA 4ZJ3A 3TW8A 5TFQA 5AVFA 2WKRA 2OAQ1 2ZMFA 3P98A 3W4PA 4O8GA 1IOUA 3V67A 4ZDXA 4HJ4A 5HSQA 4GCZA 4OP5A 3CWFA 2OAP1 2JKFA 2W3FA 4X56A 3JYIA 4R1GA 3MXRA 4GHIB 5JYPA 5E43A 1YMSA 2IA2A 1S1YA 1CF0A 4MLLA 1XXMA 1K25A 1ONHA 5DJUA 4BD0A 4JPMA 3GECA 4EU0A 3FG8A 4HHDA 4HESA 2EWVA 1NRFA 3HCYA 2JBFA 3T1RA 4B4ZA 3UE1A 2EX9A 4LV0A 1BYWA 2Q0OA 5CGWA 2A3UA 1P9RA 4I3AA 4EETB 4LCLA 1CI8A 3T12B 4C75A 3C4PA 4OQHA 3TRCA 4WUJA 4ZTKA 3E4QA 1QMFA 1N9OA 4IBRA 3M6HA 2WKPA 5DKKA 3HVFA 1S6RA 5EV0A 2QJ7A 1OJGA 1NLZA 4OOLA 4ZJ2A 2D01A 3O88A 2A2LA 2JKRM 1YT4A 3U2AA 3Q81A 4II7A 2W1RA 1TDGA 4HBTA 2QMIA 1MZUA 4DJ2A 4FTXA 1XFNA 2OWHA 1KDSA 2P9VA 1YM1A 4IJGA 1BUEA 1U60A 3H82B 5HD3A 1FIKA 5AQAA 2ZJ9A 1JWVA 1KE4A 2R78A 1V9ZA 2G7UA 1W8QA 1L0DA 2XSSA 3C5AA 5EM0A 2W3GA 3LI8A 4LRYC 3UB6A 3CUEA 1UWPX 3MSHA 4H6JA 4PKYA 5FATA 2ZM2A 5FQQA 5KSCA 1ZKJA 4WN5A 4BENA 5DF7A 1OTAA 4WZ5C 3EOIA 4HOIA 1MPLA 3BLMA 3A3JA 4ZBEA 4GB7A 2VGLS 3GVBA 1HTZA 5EOOA 1ONGA 3LIEA 2PYPA 3P7NA 5IT5A 2VK3A 4NXGA 3KSHA 3LY4A 1ERQA 1SCWA 4WELA 4WBGA 3KX0X 4EQ1A 3NULA 5E2EA 3L9KA 3IQAA 5CTMA 1K6RA 2WKHA 3ZG5A 1N4OA 5KMWA 2OSUA 3E4PA 5GHXA 5CEDA 1K56D 2VGLM 5CHUA 2Y2MA 2MJ6A 3ZCZA 3GV9A 2XD1A 3CHWP 2JCHA 1Y4OA 3G2YA 3T4LA 2AVXA 3LR3A 3VP3A 4R3JA 1IELA 2EFXA 4WZ4A 1DJBA 3MZEA 3CG5A 4KG6A 5HPFA 4XXRA 1CJFA 2ZC4B 3E98A 3IHBA 5M1AA 1STZA 1H8ZA 1MKIA 4UQIS 4YOFA 2ZLYA 4MBFA 4OH0A 3PBRA 2JKRI 2W3EA 1RP5A 4OP8A 4E3KA 1CEFA 2PR5A 4HJ3A 4BMWA 3UMEA 5F82A 3V3RA 4KZ7A 4WF0A 1Y54A 3GRJA 5CECA 4WL9A 3IH8A 2HJEA 2B95A 4DRTA 3G30A 1YQSA 2ZQCA 4F94A 1SHVA 4XT2A 1RGYA 4DKIA 3Q7ZA 2VZWA 3NCKA 4UQIM 3BFFA 2W3HA 5HAQA 2H10A 5FI2A 3T4KA 3QP6A 1K55A 2NUTC 3RTYA 3UMDA 2ZMVA 4GKUA 5DF8A 3IF6C 3CITA 3HUNA 4YFMA 1IYQA 3SZTA 1GSXA 4KZ3A 3WS1A 5HPIA 3HUOA 4XUXA 1N9NA 1FOFA 4KZ5A 3EEAA 1PFLA 2ZC3B 2B18A 4CJNA 3ISGA 2I72A 4C3QA 5TJJA 4GW9A 3VP1A 4HBUA 5GL9A 3N8SA 5HWVA 2WAEA 1K55C 4WEJA 2K7SA 3CZDA 3F1NB 4DF6A 3W4QA 2P08A 2XD5A 3LFVA 1ALQA 1W8YA 3BECA 2Z2MB 4S2IA 4LRXC 1ESIA 1NXYA 4GS9B 3MKEA 3GDIA 4UHUA 3JVUA 2DCFA 3IF6B 4HH2A 4UA6A 3BQAA 2EFUA 4FSFA 3O87A 1LHYA 2PD7A 3D4FA 4O0PA 4O01A 3H7WA 1NZUA 4E3NA 1VB6A 3MF0A 3IWIA 3EEHA 3T4TA 4P0MA 3LUQA 4PM9A 5HZHA 4DXCA 3M6BA 3N8LA 1K38A 1NYMA 2ZC7A 1XFQA 4X1MA 3VOZA 1W63M 3QP5A 4QWOA 1CI9A 1N9BA 2V0UA 3IS2A 4E6XA 3UY6A 4BBUA 3MBZA 3H9WA 2H28A 2C6WB 3EQVA 4X1LA 1L3LA 2VV6A 5HARA 3V3SA 1NLYA 2Y2NA 5FAQA 4UA7A 4ZAMA 1GCEA 1DP6A 2KDKA 3BY9A 1GHPA 4YNRA 1DP8A 4YWZA 2ZQ9A 3SS4A 1YMXA 2PYRA 2IWCA 1W5DA 3GSGA 4JGPA 3ZG9B 4GOGA 3QP4A 3R7WB 4DDSA 1NRJA 1RCJA 3D3OA 4Q0HA 2BLSA 3QHYA 4A5RA 2ZQ7A 4DMZA 3IBRA 5EVLA 4BLMA 5JYOA 1FCOA 2J80A 4RX3A 1GSVA 4LV2A 4IHQA 2KOIA 1KVMA 1SKOA 4EEPA 4KUKA 2XR0A 2ZMAA 5I5LA 5HAIA 2WUQA 4OLGA 3WWXA 3DAVA 2G2UA 3MQOA 3MQQA 4JGOA 4GJ4A 5DKLA 4WMCD 4G3KA 2Q9NA 3BFEA 4KG5A 4X69A 3QNBA 1LT0A 2OV5A 3BY8A 4HY8A 1LLBA 3ZGAB 2V8FA 2ZL1A 1XA1A 2O99A 3E0YA 4IUKA 5L8MA 1OJ5A 1XJ6A 1CQAA 2ZBBA 5LBRA 4DE2A 1O7EA 3ZQ5A 4X68A 3S7PA 3G31A 4K08A 4GLQA 2JHEA 2ZOHA 1K57A 4P6BA 1E3UA 1TS0A 1PZPA 4WEKA 4Y15A 2WKIA 4HQAA 5FEGA 4CLCD 5F83A 1EI5A 3S22A 2G2WA 3PBTA 3PTEA 3ZVWA 1K4EA 4OQ0A 5C5KA 3OBFA 3OZHA 2GJ3A 4OQIA 4WLAA 3W4OA 1FQGA 1TD5A 1TF1A 1W79A 3NOUC 1PI4A 5HDDA 4RA7A 1BLCA 4I3IA 4PM8A 4G3WA 4GD6A 2Y2HA 4R6LA 5AQ7A 1CK3A 4OKPA 3GTCA 1Q2QA 4MN6A 2B02A 4BL3A 3D9YA 2EX8A 1D1JA 4IUHA 1MC0A 1PI5A 5CHMA 2V2FF 2E8IA 3FKVA 2UWXA 3B42A 5HL1A 5F5YA 3UB9A 4PMAA 3M2JA 2D02A 2HDSA 4LLOB 4EXOA 1H8YA 2DRWA 3HREA 2GZAA 2HP9A 2BTFP 3BFCA 4M3KA 2R9XA 4U0XA 3SOIA 4PKYG 2VA0A 5FQJA 1J3WA 3B3XA 1I2WA 3MXSA 3V39A 1PIOA 3BYDA 1PW1A 3OPPA 4L9GA 4DN0A 1MBLA 2VV7A 4D2OA 4OOMA 2EXBA 1G68A 1JWZA 2VGKA 4QY6A 3OPLA 2C5WB 3FC7A 1YLWA 1ZG6A 5KZHA 1MWUA 4BBTA 1F98A 4KQRA 3ZYTA 1XPBA 1JTDA 3BW6A 4HH3A 3G6OA 3CPTB 3KO6A 2Y59A 3F1PA 3CLOA 3HLDA 3IX4A 1ERMA 4PHTA 3IXBA 2RCXA 2PDRA 3IXHA 5HX9A 2O0YA 1KE0A 3UDIA 3LEQA 4JGQA 3AGDA 3N6IA 5CTNA 3NDGA 4KZ6A 2VLGA 1UWNX 3ULFA 4CPKA 1MWTA 3VFHA 2W27A 4Q0JA 3WRTA 3UE6A 1XKZA 4R0QA 1YAXA 2QZ6A 2H0YA 4KZ4A 5M18A 4MCWA 3BQ8A 4E3IA 2JE5A 2P7JA 1VETB 2Y2GA 4Y17A 2DMWA 4OONA 3UPNA 2IWBA 4NKPA 4S2NA 3S7OA 1VEUA 3AGEA 2BG1A 2VX8A 1WYBA 1JTGA 3GMWA 2EX2A 1LSXA 2Y2OA 2JKTI 3MXQA 3V5MA 1ODVA 1ES2A 3FPWA 5FAPA 5DTTA 5EVIA 4ARZA 4OQGA 2J9OA 3EWKA 3DTEA 1G28A 2WYXA 5HWWA 1XA7A 5G18A 3UE3A 1T1AA 2ZQ8A 4MN7A 5EPHA 1LL9A 2EX6A 3VOLA 3N4IA 4JBFA 1XGJA 4XUZA 4EQIA 1ACFA 4O7DA 3WRZA 1PWGA 3G32A 2J3WA 1YSQA 1W63Q 5EVIC 2HDRA 1ZG4A 2L1MA 3CUEC 5FI6A 3S7QA 2QPNA 2WZXA 5K5BA 2QYBA 1K56A 4OPYA 3C4OA 5L10A 1K54A 5DF9A 1OT9A 1OT6A 1YLJA 2P9VB 1ES4A 3TE8A 2W1TA 1LSVA 1T19A 4I38A 3IH9A 2Y79A 3MR0A 3Q1FA 2GDNA 3RH8B 1OTDA 3UB8A 3LEZA 3G35A 3LIDA 3PAGA 3MKFA 1HVBA 3F1OA 3VP0A 2GNXA 1PZOA 3SS5A 1J9MA 4C6YA 3NECA 5DTSA 2B5RA 4KZBA 3TJZC 5HAPA 5EVIB 1SDEA 5CHJA 5L09A 4QJGA 4H6JB 2QJ5A 4L0LA 2PBDP 2W3DA 1KVLA 4S2LA 3DTMA 4Q8IA 3QNCA 4KENB 2Y55A 4X25A 1C3BA 1O07A 1XJ3A 5TBMA 1S4SA 4UAAA 4CQHA 1K0KA 1GHIA 4OPRA 5HWTA 4RQ9A 2RL3A 3ZVTA 2PU4A 3BRMA 2WGWA 3I7JA 4Y2FA 1YSPA 4G3VA 1MXOA 3WS0A 4M4XA 2ZM8A 4QPRA 4EEUA 3T1QB 4H8RA 3T4OA 2PD8A 1NYYA 5EE8A 4I39A 5F1GA 5J7EA 3VP2A 4LRZE 1PYYA 3VFFA 2Y91A 4DE3A 1FR1A 2Z2LB 2M7UA 3CAXA 2QWSA 4S2OA 1TVFA 1IEMA 4JF4A 2ZQDA 3FWLA 1BSGA 2IWDA 3L7HA 4K0WA 3C7VA 2A24A 3PHYA 5U47A 3FKWA 3NOPC 1IFQA 3DBAA 4HJ6A 2ZQAA 2PU2A 4Y3IA 4HNBA 3VMAA 4EW7A 2ZOIA 1VM1A 5F68A 4GD8A 4EBLA 1TDLA 1JVJA 3GQZA 2DNSA 4F3LA 4JF5A 3P01A 1VQQA 4XT2B 4MNRA 3FYZA 3G4PA 2ZC6B 5GLAA 4ZJ1A 5CGXA 1AWIA 1XX2A 2R9WA 4BD1A 4KUOA 1KGGA 3VV4A 3B33A 4JXWA 4JXSA 2FFFB 3VE4A 2WADA 1DJCA 2I9VA 2YKHA 3UN7A 4WYYA 2HF6A 3DWZA 4JKTA 2WKEA 3MZFA 5F6AA 3ITAA 2PAVP 1P9WA 2EXAA 2VKSA 1FR6A 4GZBA 5HL6A 3ZNYA 1KE3A 1PWCA 3UNWA 3LYXA 4LPZA 3PBOA 4E6WA 2XROA 2PR6A 1TS7A 4RVAA 3EGDC 2Y2IA 2VV8A 2K31A 1GHMA 2OOLA 1XJ4A 5FDHA 3OLOA 4QU3A 1HLUP 1L0GA 3HL9A 4R4SA 3N7WA 1FCMA 3RXXA 5EFWA 2CMNA 2XRNA 2PRFA 5FQMA 4OPQA 2XK1A 5D3OA 2M7VA 3S4XA 3H7WB 5A8BA 3HBRA 5MC7A 1YPRA 1FSWA 4WMCA 1I2SA 4U3TA 2EA9A 2H5SA 3QP8A 1ZHHB 5HD5A 3NJAA 4N92A 2XFTA
chains in the Genus database with same CATH topology
1ZG6A 1ERQA 1SCWA 1ES3A 5IHVA 5KZHA 1KDWA 4HEFA 4WELA 3DWKA 1MWUA 4WBGA 3W8KA 4NK3A 5TR7A 1QMEA 5E2HA 4KQRA 5E2EA 1XPBA 1JTDA 3IQAA 2HPBA 5BOHA 5CTMA 1K6RA 2WKHA 3PBQA 2Y59A 1L2SA 3HLDA 1N4OA 3ZG5A 4IVKA 1ERMA 5KMWA 2OSUA 3V50A 3IXBA 2RCXA 2VGJA 3IXHA 5HX9A 5GHXA 2HP6A 1XGIA 3CJMA 5CEDA 2WGWB 1K56D 3BLSA 3O86A 5CERA 1EROA 3G2ZA 3IWOA 3VSKA 1KE0A 5CHUA 5FQIA 2Y2MA 4Y0OA 3ZCZA 3UDIA 2J9PA 2XD1A 1BT5A 3GV9A 3RJUA 2JCHA 1JWPA 2XDMA 1GA0A 5FSRA 3AGDA 3G2YA 3E2KA 3N6IA 4DE1A 4DXBA 4K91A 3GR2A 3NDGA 5CTNA 4KZ6A 4CPKA 4JXVA 3VP4A 1L0FA 3VP3A 1MWTA 4FH4A 3VFHA 1SKFA 3A3FA 4R3JA 3WRTA 1IELA 1XKZA 2EFXA 4PPRA 1LL5A 5DVAA 1IYPA 3IXDA 4WZ4A 4R0QA 5E2FA 4QY5A 1WE4A 2QZ6A 4MBKA 2H0YA 1DJBA 2Y2KA 3CG5A 3MZEA 4KZ4A 5GHYA 3MZDA 4PM6A 5M18A 4E3IA 2XQZA 4KG6A 2JE5A 4XXRA 4DDYA 5AQBA 4Z9QA 2ZC4B 3IHBA 5M1AA 2Y2GA 1K57C 4S2MA 3OPRA 3Q07A 5L2FA 4OONA 1E3UD 3UPNA 1H8ZA 2IWBA 1MKIA 4S2NA 2ZLYA 4MBFA 4OH0A 4JLFA 3PBRA 3AGEA 4EWFA 1RP5A 4OP8A 2BG1A 1LI9A 4E3KA 1CEFA 1YLPA 1WYBA 1JTGA 3GMWA 3OC2A 2HDQA 4RYEA 1BLPA 3BFGA 2EX2A 5F82A 1Q2PA 3V3RA 4KZ7A 3LY3A 2Y2OA 1Y54A 3GRJA 4OLDA 5CECA 3PBNA 3HLBA 4GNUA 1SDNA 3IH8A 3OCNA 3V5MA 5EECA 4DRTA 1ES2A 3G30A 1YQSA 2ZQCA 3A3DA 3MFDA 3NIAA 4KG2A 4LV3A 5FAPA 1NJ4A 4F94A 5DTTA 1SHVA 3N8RA 3UPOA 5EVIA 1RGYA 3ZDJA 4DKIA 2Q9MA 3Q7ZA 1IKGA 3NCKA 3BFFA 4OQGA 3HLCA 3PBSA 5HAQA 2H10A 5FI2A 2J9OA 1K55A 1MY8A 4P6BA 4GKUA 4KZ9A 1IYOA 1M40A 5DF8A 2P74A 2WYXA 3UPPA 1XA7A 3IF6C 1L0EA 5CGSA 5G18A 3UE3A 3HUNA 4YFMA 4S2PA 1IYQA 3IXGA 2Y2JA 4KZ3A 4E3OA 2ZQ8A 3WS1A 1YLTA 4BL2A 3HUOA 4XUXA 5EPHA 1E25A 4KZAA 1LL9A 2EX6A 1FOFA 5A90A 4KZ5A 2WGIA 3N4IA 4JBFA 3HLEA 1XGJA 4XUZA 4EQIA 2ZC3B 1ZC2A 4CJNA 3NC8A 3ISGA 4FH2A 1I5QA 2I72A 3OPHA 4O7DA 4C3QA 5F1FA 3WRZA 1PWGA 3G32A 5FASA 3VP1A 2WGVA 5EVIC 1W7FA 2HDRA 5TGFA 4HBUA 1ZG4A 2H0TA 5GL9A 4E3LA 3N8SA 5FI6A 2V1ZA 5FI7A 2QPNA 2WZZA 2WZXA 2Y2QA 2WAEA 2XH9A 1K55C 3M2KA 5M19A 4KQQA 1K56A 4OPYA 3C4OA 2J7VA 4WEJA 2Y2LA 3CZDA 5EOEA 3ZHHA 3W4QA 4DF6A 1G6AA 1Z6FA 2XD5A 1K54A 4ID4A 1ALQA 1W8YA 5DF9A 4EV4A 1TEMA 3BECA 2Z2MB 4S2IA 5FA7A 2ZM0A 3UO9A 4UA9A 3ZG8B 1YLJA 3A3EA 2P9VB 1ES4A 4EBPA 1ESIA 3PAEA 1K6SA 1MWSA 1NXYA 1NY0A 3MKEA 4UHUA 1ESUA 3IH9A 3Q1FA 5GLDA 4E3JA 2DCFA 2GDNA 3IF6B 3IT9A 3IF5A 3NI9A 4UA6A 4X6TA 3LEZA 3G35A 2EFUA 3A3IA 3FV7A 4FSFA 3O87A 1LHYA 4R3BA 3PAGA 3MKFA 1HVBA 2FFYA 3RXWA 3VP0A 3D4FA 1PZOA 4BQMA 3SS5A 1XP4A 1NZUA 3LCEA 3ZFZA 2XEPA 4MBHA 1J9MA 3HLWA 3HLFA 4IEDA 4C6YA 4E3NA 3BM6A 3IWIA 3TSGA 3UDFA 3SH9A 5A92A 5DTSA 1BULA 4QHCA 2B5RA 1NZOA 4KZBA 3O3VA 4P0MA 5HAPA 2OLVA 5EVIB 1SDEA 4PM9A 5CHJA 1BLSA 4DXCA 2WK0A 3M6BA 4OVDA 4S2KA 3IHAA 3WS2A 4QJGA 4OPZA 1KGEA 5DTKA 5KSHA 4N9KA 3N8LA 1FSYA 1K38A 1NYMA 4JXGA 4L0LA 2ZC7A 1KVLA 4S2LA 3VOZA 3DTMA 4Q8IA 3QNCA 4KENB 3LO7A 2Y55A 3NY4A 1CI9A 1N9BA 1IYSA 1C3BA 1O07A 3EQUA 3SS3A 3UY6A 3MBZA 2ZC5B 4E6XA 1BZAA 1DY6A 4MEZA 1GA9A 4GN2A 2C6WB 3FZCA 4UAAA 3S1YA 3EQVA 3P09A 1GHIA 4OPRA 5E2GA 2RL3A 3ZVTA 2PU4A 5HARA 3BRMA 3WS4A 2WGWA 3V3SA 2Y2NA 3OCLA 5FAQA 2XF3A 3I7JA 4UA7A 4QD4A 1GCEA 4ZAMA 2Y2PA 4LCMA 2X01A 4LENA 4R4RA 4FCFA 4X55A 1MXOA 4PM7A 3HUMA 3BEBA 3WS0A 4WZ5A 1GHPA 2ZM8A 4LV1A 4S2NC 2ZQ9A 1AXBA 4H8RA 3SS4A 5J8XA 1RGZA 2V20A 2Y4AA 1NYYA 5EE8A 5F1GA 1YMXA 4N9LA 2IWCA 3C7UA 1W5DA 3NDEA 3GSGA 3VSLA 4BJPA 3VP2A 3DW0A 3ZG9B 1PYYA 1LI0A 4GOGA 3VFFA 1FCNA 2JC7A 2HDUA 4EBNA 4DDSA 4IVIA 2Y91A 1HZOA 4FD8A 4N1XA 4GDBA 1RCJA 2BLSA 4Y7PA 4DE3A 3QHYA 1FR1A 2Z2LB 4A5RA 2ZQ7A 3Q7VA 3ITBA 4RX2A 4S2OA 1CEGA 2J8YA 4ZJ3A 5TFQA 3SH8A 1TVFA 1IEMA 3P98A 4JF4A 3TOIA 5EVLA 3W4PA 4Y0TA 2ZQDA 3FWLA 5EVID 1FCOA 1BSGA 2IWDA 4BLMA 5JYOA 4RX3A 3G34A 4K0XA 4E3MA 4K0WA 4ZDXA 3C7VA 1MWRA 1M6KA 4OP5A 5U47A 4LV2A 3FKWA 3AGFA 1KVMA 4X56A 3JYIA 4R1GA 3MXRA 5JYPA 5E43A 2XR0A 2ZMAA 2ZQAA 1YMSA 4GDNA 3SH7A 5HAIA 2WUQA 4OLGA 4MLLA 3WWXA 2G2UA 5AQ9A 1XXMA 4WMCD 2Q9NA 3BFEA 4KG5A 4X69A 1K25A 1ONHA 2PU2A 1HD8A 3QNBA 4BD0A 2OV5A 1LLBA 4IBXA 3ZGAB 3VMAA 1XA1A 2XLNA 2OLUA 4JPMA 3NBLA 4HESA 4KQOA 2ZD8A 1NRFA 5GLBA 2JBFA 5EUAA 4DE2A 1O7EA 1VM1A 4B4ZA 4X68A 3UE1A 2EX9A 4GD8A 4LV0A 2X02A 1YLZA 3G31A 1TDLA 4EBLA 1JVJA 5CGWA 2A3UA 4LCLA 1CI8A 3GQZA 1K57A 4C75A 2DNSA 1BLHA 1E3UA 1K54C 4JF5A 1PZPA 1E4DA 1PW8A 3C4PA 4OQHA 2A49A 4NETA 1VQQA 4WEKA 4ZTKA 5A93A 5FAOA 2WKIA 1QMFA 1S0WA 4MNRA 3WS5A 4IBRA 4QB8A 3FYZA 3G4PA 3M6HA 1EWZA 3HVFA 1S6RA 5F83A 5A91A 3ZG7B 1EI5A 3S22A 2G2WA 3PBTA 2ZC6B 3PTEA 5GLAA 3ZVWA 1K4EA 4ZJ1A 4OOLA 4OQ0A 4ZJ2A 3UE0A 4N1HA 1XX2A 2R9WA 5CGXA 4BD1A 3ZG0A 2PBYA 1KGGA 1ES5A 3OZHA 4KZ8A 4JXWA 3E2LA 4OQIA 4JXSA 2FFFB 3O88A 2WADA 1DJCA 3W4OA 4PM5A 2HP5A 1FQGA 1YT4A 4EUZA 3UN7A 4WYYA 1W79A 2XGNA 3Q81A 1PI4A 3Q7VB 2WAFA 1TDGA 3DWZA 1BLCA 4JKTA 4RA7A 4HBTA 4GD6A 2QMIA 2WKEA 2Y2HA 4PM8A 5CRFA 4DE0A 5AQ7A 1CK3A 1KGFA 3MZFA 4OKPA 3ITAA 5HW3A 3GTCA 2EXAA 1KDSA 1Q2QA 2P9VA 1YLYA 1YM1A 4BL3A 1FR6A 3Q82A 1BUEA 2EX8A 4GZBA 3ZNYA 1KE3A 4B88A 1U60A 1PWCA 1PI5A 3IF6A 5CHMA 3UDXA 2V2FF 1IKIA 4YINA 3UNWA 5AQAA 2ZJ9A 1JWVA 4P87A 2E8IA 1KE4A 2X71A 3FKVA 2UWXA 5HL1A 3PBOA 3ZNTA 4PMAA 4E6WA 4WM9A 2CC1A 5FQ9A 3M2JA 1W8QA 2HDSA 4RVAA 2Y2IA 1H8YA 4P85A 1L0DA 2DRWA 1GHMA 3HREA 2HP9A 3C5AA 5FDHA 5FQKA 1PWDA 5GHZA 4JF6A 4QU3A 1H5XA 4S2JA 3BFCA 3IWQA 4M3KA 1L0GA 2R9XA 3HL9A 4R4SA 4U0XA 3N7WA 3SOIA 1FCMA 5FATA 2ZM2A 5FQQA 3RXXA 5KSCA 1ZKJA 4B4XA 5FQJA 2XFSA 4BENA 3TG9A 1DJAA 5FQMA 5DF7A 3B3XA 5CXWA 4OPQA 1BTLA 4X53A 2XK1A 5D3OA 1I2WA 4WZ5C 3MXSA 3V39A 5HFOA 3S4XA 1K4FA 1PIOA 3BYDA 1PW1A 3HBRA 5GLCA 3OPPA 1MPLA 3BLMA 1MBLA 4Y0UA 3HLGA 3A3JA 4ZBEA 1FSWA 4D2OA 4OOMA 4GB7A 2EXBA 4WMCA 1I2SA 3GVBA 1G68A 4U3TA 1JWZA 1HTZA 3VOYA 5EOOA 2VGKA 4QY6A 1OMEA 4OOYA 3OPLA 2C5WB 5I94A 5CEBA 1ONGA 2H5SA 3BFDA 1YLWA 4U0TA 4R23A 1WYCA 3CMZA 4N92A 3LY4A 2XFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZG6 A;  1ERQ A;  1SCW A;  1ES3 A;  5IHV A;  5KZH A;  1KDW A;  4HEF A;  4WEL A;  3DWK A;  1MWU A;  4WBG A;  3W8K A;  4NK3 A;  5TR7 A;  1QME A;  5E2H A;  4KQR A;  5E2E A;  1XPB A;  1JTD A;  3IQA A;  2HPB A;  5BOH A;  5CTM A;  1K6R A;  2WKH A;  3PBQ A;  2Y59 A;  1L2S A;  3HLD A;  1N4O A;  3ZG5 A;  4IVK A;  1ERM A;  5KMW A;  2OSU A;  3V50 A;  3IXB A;  2RCX A;  2VGJ A;  3IXH A;  5HX9 A;  5GHX A;  2HP6 A;  1XGI A;  3CJM A;  5CED A;  2WGW B;  1K56 D;  3BLS A;  3O86 A;  5CER A;  1ERO A;  3G2Z A;  3IWO A;  3VSK A;  1KE0 A;  5CHU A;  5FQI A;  2Y2M A;  4Y0O A;  3ZCZ A;  3UDI A;  2J9P A;  2XD1 A;  1BT5 A;  3GV9 A;  3RJU A;  2JCH A;  1JWP A;  2XDM A;  1GA0 A;  5FSR A;  3AGD A;  3G2Y A;  3E2K A;  3N6I A;  4DE1 A;  4DXB A;  4K91 A;  3GR2 A;  3NDG A;  5CTN A;  4KZ6 A;  4CPK A;  4JXV A;  3VP4 A;  1L0F A;  3VP3 A;  1MWT A;  4FH4 A;  3VFH A;  1SKF A;  3A3F A;  4R3J A;  3WRT A;  1IEL A;  1XKZ A;  2EFX A;  4PPR A;  1LL5 A;  5DVA A;  1IYP A;  3IXD A;  4WZ4 A;  4R0Q A;  5E2F A;  4QY5 A;  1WE4 A;  2QZ6 A;  4MBK A;  2H0Y A;  1DJB A;  2Y2K A;  3CG5 A;  3MZE A;  4KZ4 A;  5GHY A;  3MZD A;  4PM6 A;  5M18 A;  4E3I A;  2XQZ A;  4KG6 A;  2JE5 A;  4XXR A;  4DDY A;  5AQB A;  4Z9Q A;  2ZC4 B;  3IHB A;  5M1A A;  2Y2G A;  1K57 C;  4S2M A;  3OPR A;  3Q07 A;  5L2F A;  4OON A;  1E3U D;  3UPN A;  1H8Z A;  2IWB A;  1MKI A;  4S2N A;  2ZLY A;  4MBF A;  4OH0 A;  4JLF A;  3PBR A;  3AGE A;  4EWF A;  1RP5 A;  4OP8 A;  2BG1 A;  1LI9 A;  4E3K A;  1CEF A;  1YLP A;  1WYB A;  1JTG A;  3GMW A;  3OC2 A;  2HDQ A;  4RYE A;  1BLP A;  3BFG A;  2EX2 A;  5F82 A;  1Q2P A;  3V3R A;  4KZ7 A;  3LY3 A;  2Y2O A;  1Y54 A;  3GRJ A;  4OLD A;  5CEC A;  3PBN A;  3HLB A;  4GNU A;  1SDN A;  3IH8 A;  3OCN A;  3V5M A;  5EEC A;  4DRT A;  1ES2 A;  3G30 A;  1YQS A;  2ZQC A;  3A3D A;  3MFD A;  3NIA A;  4KG2 A;  4LV3 A;  5FAP A;  1NJ4 A;  4F94 A;  5DTT A;  1SHV A;  3N8R A;  3UPO A;  5EVI A;  1RGY A;  3ZDJ A;  4DKI A;  2Q9M A;  3Q7Z A;  1IKG A;  3NCK A;  3BFF A;  4OQG A;  3HLC A;  3PBS A;  5HAQ A;  2H10 A;  5FI2 A;  2J9O A;  1K55 A;  1MY8 A;  4P6B A;  4GKU A;  4KZ9 A;  1IYO A;  1M40 A;  5DF8 A;  2P74 A;  2WYX A;  3UPP A;  1XA7 A;  3IF6 C;  1L0E A;  5CGS A;  5G18 A;  3UE3 A;  3HUN A;  4YFM A;  4S2P A;  1IYQ A;  3IXG A;  2Y2J A;  4KZ3 A;  4E3O A;  2ZQ8 A;  3WS1 A;  1YLT A;  4BL2 A;  3HUO A;  4XUX A;  5EPH A;  1E25 A;  4KZA A;  1LL9 A;  2EX6 A;  1FOF A;  5A90 A;  4KZ5 A;  2WGI A;  3N4I A;  4JBF A;  3HLE A;  1XGJ A;  4XUZ A;  4EQI A;  2ZC3 B;  1ZC2 A;  4CJN A;  3NC8 A;  3ISG A;  4FH2 A;  1I5Q A;  2I72 A;  3OPH A;  4O7D A;  4C3Q A;  5F1F A;  3WRZ A;  1PWG A;  3G32 A;  5FAS A;  3VP1 A;  2WGV A;  5EVI C;  1W7F A;  2HDR A;  5TGF A;  4HBU A;  1ZG4 A;  2H0T A;  5GL9 A;  4E3L A;  3N8S A;  5FI6 A;  2V1Z A;  5FI7 A;  2QPN A;  2WZZ A;  2WZX A;  2Y2Q A;  2WAE A;  2XH9 A;  1K55 C;  3M2K A;  5M19 A;  4KQQ A;  1K56 A;  4OPY A;  3C4O A;  2J7V A;  4WEJ A;  2Y2L A;  3CZD A;  5EOE A;  3ZHH A;  3W4Q A;  4DF6 A;  1G6A A;  1Z6F A;  2XD5 A;  1K54 A;  4ID4 A;  1ALQ A;  1W8Y A;  5DF9 A;  4EV4 A;  1TEM A;  3BEC A;  2Z2M B;  4S2I A;  5FA7 A;  2ZM0 A;  3UO9 A;  4UA9 A;  3ZG8 B;  1YLJ A;  3A3E A;  2P9V B;  1ES4 A;  4EBP A;  1ESI A;  3PAE A;  1K6S A;  1MWS A;  1NXY A;  1NY0 A;  3MKE A;  4UHU A;  1ESU A;  3IH9 A;  3Q1F A;  5GLD A;  4E3J A;  2DCF A;  2GDN A;  3IF6 B;  3IT9 A;  3IF5 A;  3NI9 A;  4UA6 A;  4X6T A;  3LEZ A;  3G35 A;  2EFU A;  3A3I A;  3FV7 A;  4FSF A;  3O87 A;  1LHY A;  4R3B A;  3PAG A;  3MKF A;  1HVB A;  2FFY A;  3RXW A;  3VP0 A;  3D4F A;  1PZO A;  4BQM A;  3SS5 A;  1XP4 A;  1NZU A;  3LCE A;  3ZFZ A;  2XEP A;  4MBH A;  1J9M A;  3HLW A;  3HLF A;  4IED A;  4C6Y A;  4E3N A;  3BM6 A;  3IWI A;  3TSG A;  3UDF A;  3SH9 A;  5A92 A;  5DTS A;  1BUL A;  4QHC A;  2B5R A;  1NZO A;  4KZB A;  3O3V A;  4P0M A;  5HAP A;  2OLV A;  5EVI B;  1SDE A;  4PM9 A;  5CHJ A;  1BLS A;  4DXC A;  2WK0 A;  3M6B A;  4OVD A;  4S2K A;  3IHA A;  3WS2 A;  4QJG A;  4OPZ A;  1KGE A;  5DTK A;  5KSH A;  4N9K A;  3N8L A;  1FSY A;  1K38 A;  1NYM A;  4JXG A;  4L0L A;  2ZC7 A;  1KVL A;  4S2L A;  3VOZ A;  3DTM A;  4Q8I A;  3QNC A;  4KEN B;  3LO7 A;  2Y55 A;  3NY4 A;  1CI9 A;  1N9B A;  1IYS A;  1C3B A;  1O07 A;  3EQU A;  3SS3 A;  3UY6 A;  3MBZ A;  2ZC5 B;  4E6X A;  1BZA A;  1DY6 A;  4MEZ A;  1GA9 A;  4GN2 A;  2C6W B;  3FZC A;  4UAA A;  3S1Y A;  3EQV A;  3P09 A;  1GHI A;  4OPR A;  5E2G A;  2RL3 A;  3ZVT A;  2PU4 A;  5HAR A;  3BRM A;  3WS4 A;  2WGW A;  3V3S A;  2Y2N A;  3OCL A;  5FAQ A;  2XF3 A;  3I7J A;  4UA7 A;  4QD4 A;  1GCE A;  4ZAM A;  2Y2P A;  4LCM A;  2X01 A;  4LEN A;  4R4R A;  4FCF A;  4X55 A;  1MXO A;  4PM7 A;  3HUM A;  3BEB A;  3WS0 A;  4WZ5 A;  1GHP A;  2ZM8 A;  4LV1 A;  4S2N C;  2ZQ9 A;  1AXB A;  4H8R A;  3SS4 A;  5J8X A;  1RGZ A;  2V20 A;  2Y4A A;  1NYY A;  5EE8 A;  5F1G A;  1YMX A;  4N9L A;  2IWC A;  3C7U A;  1W5D A;  3NDE A;  3GSG A;  3VSL A;  4BJP A;  3VP2 A;  3DW0 A;  3ZG9 B;  1PYY A;  1LI0 A;  4GOG A;  3VFF A;  1FCN A;  2JC7 A;  2HDU A;  4EBN A;  4DDS A;  4IVI A;  2Y91 A;  1HZO A;  4FD8 A;  4N1X A;  4GDB A;  1RCJ A;  2BLS A;  4Y7P A;  4DE3 A;  3QHY A;  1FR1 A;  2Z2L B;  4A5R A;  2ZQ7 A;  3Q7V A;  3ITB A;  4RX2 A;  4S2O A;  1CEG A;  2J8Y A;  4ZJ3 A;  5TFQ A;  3SH8 A;  1TVF A;  1IEM A;  3P98 A;  4JF4 A;  3TOI A;  5EVL A;  3W4P A;  4Y0T A;  2ZQD A;  3FWL A;  5EVI D;  1FCO A;  1BSG A;  2IWD A;  4BLM A;  5JYO A;  4RX3 A;  3G34 A;  4K0X A;  4E3M A;  4K0W A;  4ZDX A;  3C7V A;  1MWR A;  1M6K A;  4OP5 A;  5U47 A;  4LV2 A;  3FKW A;  3AGF A;  1KVM A;  4X56 A;  3JYI A;  4R1G A;  3MXR A;  5JYP A;  5E43 A;  2XR0 A;  2ZMA A;  2ZQA A;  1YMS A;  4GDN A;  3SH7 A;  5HAI A;  2WUQ A;  4OLG A;  4MLL A;  3WWX A;  2G2U A;  5AQ9 A;  1XXM A;  4WMC D;  2Q9N A;  3BFE A;  4KG5 A;  4X69 A;  1K25 A;  1ONH A;  2PU2 A;  1HD8 A;  3QNB A;  4BD0 A;  2OV5 A;  1LLB A;  4IBX A;  3ZGA B;  3VMA A;  1XA1 A;  2XLN A;  2OLU A;  4JPM A;  3NBL A;  4HES A;  4KQO A;  2ZD8 A;  1NRF A;  5GLB A;  2JBF A;  5EUA A;  4DE2 A;  1O7E A;  1VM1 A;  4B4Z A;  4X68 A;  3UE1 A;  2EX9 A;  4GD8 A;  4LV0 A;  2X02 A;  1YLZ A;  3G31 A;  1TDL A;  4EBL A;  1JVJ A;  5CGW A;  2A3U A;  4LCL A;  1CI8 A;  3GQZ A;  1K57 A;  4C75 A;  2DNS A;  1BLH A;  1E3U A;  1K54 C;  4JF5 A;  1PZP A;  1E4D A;  1PW8 A;  3C4P A;  4OQH A;  2A49 A;  4NET A;  1VQQ A;  4WEK A;  4ZTK A;  5A93 A;  5FAO A;  2WKI A;  1QMF A;  1S0W A;  4MNR A;  3WS5 A;  4IBR A;  4QB8 A;  3FYZ A;  3G4P A;  3M6H A;  1EWZ A;  3HVF A;  1S6R A;  5F83 A;  5A91 A;  3ZG7 B;  1EI5 A;  3S22 A;  2G2W A;  3PBT A;  2ZC6 B;  3PTE A;  5GLA A;  3ZVW A;  1K4E A;  4ZJ1 A;  4OOL A;  4OQ0 A;  4ZJ2 A;  3UE0 A;  4N1H A;  1XX2 A;  2R9W A;  5CGX A;  4BD1 A;  3ZG0 A;  2PBY A;  1KGG A;  1ES5 A;  3OZH A;  4KZ8 A;  4JXW A;  3E2L A;  4OQI A;  4JXS A;  2FFF B;  3O88 A;  2WAD A;  1DJC A;  3W4O A;  4PM5 A;  2HP5 A;  1FQG A;  1YT4 A;  4EUZ A;  3UN7 A;  4WYY A;  1W79 A;  2XGN A;  3Q81 A;  1PI4 A;  3Q7V B;  2WAF A;  1TDG A;  3DWZ A;  1BLC A;  4JKT A;  4RA7 A;  4HBT A;  4GD6 A;  2QMI A;  2WKE A;  2Y2H A;  4PM8 A;  5CRF A;  4DE0 A;  5AQ7 A;  1CK3 A;  1KGF A;  3MZF A;  4OKP A;  3ITA A;  5HW3 A;  3GTC A;  2EXA A;  1KDS A;  1Q2Q A;  2P9V A;  1YLY A;  1YM1 A;  4BL3 A;  1FR6 A;  3Q82 A;  1BUE A;  2EX8 A;  4GZB A;  3ZNY A;  1KE3 A;  4B88 A;  1U60 A;  1PWC A;  1PI5 A;  3IF6 A;  5CHM A;  3UDX A;  2V2F F;  1IKI A;  4YIN A;  3UNW A;  5AQA A;  2ZJ9 A;  1JWV A;  4P87 A;  2E8I A;  1KE4 A;  2X71 A;  3FKV A;  2UWX A;  5HL1 A;  3PBO A;  3ZNT A;  4PMA A;  4E6W A;  4WM9 A;  2CC1 A;  5FQ9 A;  3M2J A;  1W8Q A;  2HDS A;  4RVA A;  2Y2I A;  1H8Y A;  4P85 A;  1L0D A;  2DRW A;  1GHM A;  3HRE A;  2HP9 A;  3C5A A;  5FDH A;  5FQK A;  1PWD A;  5GHZ A;  4JF6 A;  4QU3 A;  1H5X A;  4S2J A;  3BFC A;  3IWQ A;  4M3K A;  1L0G A;  2R9X A;  3HL9 A;  4R4S A;  4U0X A;  3N7W A;  3SOI A;  1FCM A;  5FAT A;  2ZM2 A;  5FQQ A;  3RXX A;  5KSC A;  1ZKJ A;  4B4X A;  5FQJ A;  2XFS A;  4BEN A;  3TG9 A;  1DJA A;  5FQM A;  5DF7 A;  3B3X A;  5CXW A;  4OPQ A;  1BTL A;  4X53 A;  2XK1 A;  5D3O A;  1I2W A;  4WZ5 C;  3MXS A;  3V39 A;  5HFO A;  3S4X A;  1K4F A;  1PIO A;  3BYD A;  1PW1 A;  3HBR A;  5GLC A;  3OPP A;  1MPL A;  3BLM A;  1MBL A;  4Y0U A;  3HLG A;  3A3J A;  4ZBE A;  1FSW A;  4D2O A;  4OOM A;  4GB7 A;  2EXB A;  4WMC A;  1I2S A;  3GVB A;  1G68 A;  4U3T A;  1JWZ A;  1HTZ A;  3VOY A;  5EOO A;  2VGK A;  4QY6 A;  1OME A;  4OOY A;  3OPL A;  2C5W B;  5I94 A;  5CEB A;  1ONG A;  2H5S A;  3BFD A;  1YLW A;  4U0T A;  4R23 A;  1WYC A;  3CMZ A;  4N92 A;  3LY4 A;  2XFT A; 
#chains in the Genus database with same CATH topology
 5IHV A;  2ACG A;  4NG2 A;  2J3T C;  5E2H A;  3OOV A;  3IS2 B;  1WA9 A;  5BOH A;  3PBQ A;  4HP9 A;  1TS8 A;  2Y8H A;  4IVK A;  2KLI A;  2Z6D A;  2VGJ A;  1XJ2 A;  2HP6 A;  1XGI A;  3BLS A;  5CER A;  1ERO A;  3IWO A;  3VSK A;  5FQI A;  4Y0O A;  3RFB A;  4CLC A;  3JVV A;  1BT5 A;  2KX6 A;  1JWP A;  2XDM A;  1GA0 A;  5FSR A;  2O9B A;  4HP4 A;  3E2K A;  4DE1 A;  3GR2 A;  4JXV A;  2HGV A;  5AJG A;  3VP4 A;  1DRM A;  4FH4 A;  3T50 A;  4ME4 A;  3A3F A;  3T4S A;  3LGO A;  1IYP A;  3MS6 A;  3BJN A;  2L4R A;  2Y2K A;  5GHY A;  4PM6 A;  4GHI A;  5KIZ A;  1FIL A;  1K57 C;  4S2M A;  3Q07 A;  5L2F A;  1E3U D;  4E04 A;  4JLF A;  3C2W A;  1LI9 A;  1YLP A;  2FZ0 A;  1V9Y A;  4RYE A;  2P04 A;  3A0R A;  3BFG A;  1Q2P A;  1SKO B;  3LY3 A;  5F69 A;  3PBN A;  3HLB A;  4GNU A;  2M1C A;  5EEC A;  3MFX A;  4Y13 A;  3A3D A;  3MFD A;  3NIA A;  2LB5 A;  3EGX C;  2VEA A;  2ZL1 B;  3UPO A;  2Q9M A;  1UGU A;  4KZ9 A;  3KYE A;  2P74 A;  4MMN A;  5CGS A;  3T4J A;  1L0E A;  4CLC E;  3E4O A;  4S2P A;  3K3C A;  3LIF A;  3IXG A;  4BL2 A;  5A90 A;  4ZRR A;  3QP1 A;  1ZC2 A;  1F5M A;  3B47 A;  3OPH A;  5F1F A;  1W7F A;  4E3L A;  2V1Z A;  5FI7 A;  3C8C A;  1LL8 A;  3H82 A;  3M2K A;  2YKF A;  4KQQ A;  4I3J A;  3T1X A;  3ZHH A;  3A0S A;  2LB9 A;  1G6A A;  1Z6F A;  3KSF A;  2VJW A;  4ID4 A;  4EV4 A;  1TEM A;  5FA7 A;  3UO9 A;  1H3Q A;  4EES A;  3ZG8 B;  4MDZ A;  2V9A A;  3PAE A;  1K6S A;  1YKD A;  1ESU A;  3IT9 A;  4X6T A;  1Z09 A;  5FL3 A;  3K2N A;  1XP4 A;  2UV0 E;  1PRQ A;  3ZFZ A;  4IED A;  3T1S A;  3MJQ A;  3IBJ A;  4QHC A;  3O3V A;  2WK0 A;  4OVD A;  4S2K A;  4OPZ A;  4I5S A;  1FSY A;  4JXG A;  2INW A;  3A0V A;  4ETZ A;  3LO7 A;  3C38 A;  3MMH A;  1IYS A;  3SS3 A;  2ZC5 B;  4Z1W A;  1OTB A;  4MEZ A;  1GA9 A;  5J4E A;  3FZC A;  3S1Y A;  4B9O A;  3WS4 A;  1NWZ A;  4PAU A;  2QHK A;  4QD4 A;  4LCM A;  2X01 A;  4R4R A;  3T4Q A;  4PM7 A;  3BEB A;  4WZ5 A;  4S2N C;  5J8X A;  3F1P B;  4N9L A;  4R70 A;  3VSL A;  4D60 A;  4BJP A;  1S1Z A;  1SZV A;  5DJT A;  4R38 A;  1D06 A;  1LI0 A;  1FCN A;  3R4K A;  4IVI A;  1HZO A;  4N1X A;  4GDB A;  2V1A A;  2V1B A;  3Q7V A;  3ITB A;  4RX2 A;  3SH8 A;  3TOI A;  1S67 L;  4Y0T A;  5EVI D;  3BWL A;  3G34 A;  4K0X A;  4E3M A;  4FUW A;  1MWR A;  1M6K A;  1D7E A;  3AGF A;  2HZ5 A;  1P97 A;  1X0O A;  3HJK A;  4GDN A;  3SH7 A;  5AQ9 A;  3LR0 A;  1T1B A;  3KYQ A;  1VHM A;  5G4Y A;  1HD8 A;  4IBX A;  1VEU B;  2XLN A;  2OLU A;  3NBL A;  4KQO A;  2ZD8 A;  3LIC A;  5GLB A;  5EUA A;  4NEE D;  5EM1 A;  1T1C A;  1YLZ A;  2X02 A;  4HI4 A;  2HJ9 C;  2JN7 A;  3W2Z A;  1BLH A;  1K54 C;  1E4D A;  1PW8 A;  2A49 A;  4NET A;  5A93 A;  5FAO A;  1S0W A;  5HDS A;  3WS5 A;  4QB8 A;  4ARZ B;  1EWZ A;  5A91 A;  3ZG7 B;  3UE0 A;  4N1H A;  3KSG A;  4L9F A;  3ZG0 A;  3VE3 A;  2PBY A;  2PHY A;  1ES5 A;  4KZ8 A;  3E2L A;  4EUV A;  2HV1 A;  2PT7 A;  2L0W A;  3F1N A;  1H0M A;  4PM5 A;  2HP5 A;  4EUZ A;  2QKP A;  2XGN A;  3MQ0 A;  3Q7V B;  2JKG A;  2WAF A;  3LR5 A;  5CRF A;  4DE0 A;  1KGF A;  5HW3 A;  3O5Y A;  1YLY A;  3Q82 A;  4GS9 A;  4NXB A;  4B88 A;  2W0N A;  3IF6 A;  3UDX A;  3PYP A;  4YIN A;  1IKI A;  4P87 A;  4Y5F A;  2X71 A;  3PR6 A;  3ZNT A;  4WM9 A;  2CC1 A;  5FQ9 A;  3IX3 A;  1GSW A;  4P85 A;  5FQK A;  1PWD A;  5GHZ A;  5CX7 A;  4JF6 A;  1H5X A;  4S2J A;  2W1T B;  3IWQ A;  1A0K A;  1KOU A;  4B4X A;  2OWJ A;  2XFS A;  3TG9 A;  1DJA A;  5FDS A;  5CXW A;  1G6O A;  1BTL A;  3F1O B;  4X53 A;  5HFO A;  3IX8 A;  1K4F A;  1S4R A;  4KQD A;  5GLC A;  4Y0U A;  3HLG A;  3VOY A;  1OME A;  4OOY A;  5I94 A;  5CEB A;  5J3W A;  1OTE A;  3BFD A;  2NUP C;  4U0T A;  4R23 A;  1WYC A;  3CMZ A;  4Q0I A;  1ES3 A;  1KDW A;  4HEF A;  2V8C A;  3DWK A;  3W8K A;  4NK3 A;  5TR7 A;  1QME A;  5TBM B;  1G5U A;  2HPB A;  5G4Z A;  2Z6C A;  3UB5 P;  1L2S A;  4FOF A;  3V50 A;  1F9I A;  3CJM A;  4R3A A;  2WGW B;  3O86 A;  3G2Z A;  3R7W A;  3LIB A;  3U4L P;  2J9P A;  3RJU A;  4DXB A;  4K91 A;  3QP2 A;  1L0F A;  3HJI A;  1SKF A;  3DTK A;  4PPR A;  1LL5 A;  5DVA A;  3IXD A;  5E2F A;  4B93 A;  4QY5 A;  4LFU A;  1EW0 A;  1WE4 A;  4MBK A;  3MZD A;  1MKM A;  2XQZ A;  5AVE A;  4DDY A;  5AQB A;  3SW1 A;  4Z9Q A;  3OPR A;  5IU1 A;  4EWF A;  2A24 B;  2O9C A;  5HDC A;  3OC2 A;  2HDQ A;  1BLP A;  2EWW A;  4LGW A;  1H8M A;  2FH5 A;  3KYZ A;  4OLD A;  4HIA A;  3UB7 A;  1SDN A;  3OCN A;  3FPV A;  4ESP A;  4KG2 A;  4LV3 A;  1NJ4 A;  3N8R A;  3ZDJ A;  3LIA A;  1IKG A;  3HLC A;  3PBS A;  4P6Z S;  1MY8 A;  1F2K A;  1IYO A;  1M40 A;  3UPP A;  1T18 A;  3JPU A;  2Y2J A;  4AFI A;  4E3O A;  1P0Z A;  1YLT A;  4F3L B;  1E25 A;  4KZA A;  4UEY A;  2WGI A;  2E8J A;  3HLE A;  3NC8 A;  4FH2 A;  1I5Q A;  3DTI A;  1OPX A;  3PXP A;  5FAS A;  2WGV A;  5TGF A;  2H0T A;  2J3T D;  1Y28 A;  2WZZ A;  1JNU A;  2Y2Q A;  2XH9 A;  4DJ3 A;  4P6Z M;  5M19 A;  1N9L A;  2J7V A;  2Y2L A;  5EOE A;  2WKQ A;  5IS1 A;  2ZM0 A;  3ICY A;  5EVE A;  3KSI A;  4UA9 A;  1OTI A;  3A3E A;  4EBP A;  1MWS A;  1NY0 A;  5GLD A;  4E3J A;  2O9A A;  3NHQ A;  3IF5 A;  3NI9 A;  3A3I A;  3FV7 A;  4R3B A;  3RXW A;  2FFY A;  2V0W A;  3K3D A;  4BQM A;  2BAS A;  3LCE A;  2XEP A;  2XA7 S;  4MBH A;  3HLW A;  3HLF A;  3BM6 A;  3TSG A;  3UDF A;  3SH9 A;  5A92 A;  1LSW A;  1BUL A;  3LR4 A;  1NZO A;  3LI9 A;  4MN5 A;  2OLV A;  1BLS A;  4JGR A;  3CI6 A;  3IHA A;  3WS2 A;  5KSH A;  1KGE A;  5DTK A;  4N9K A;  4CLC C;  5FEF A;  5L07 A;  3NY4 A;  3EQU A;  1S66 L;  1BZA A;  3CPT A;  1DY6 A;  4GN2 A;  2GX5 A;  4BBV A;  2K2N A;  3P09 A;  5E2G A;  4EER A;  2XA7 M;  4BWI A;  3OCL A;  2XF3 A;  2Y2P A;  4LEN A;  1DP9 A;  4FCF A;  2JKT M;  4X55 A;  3HUM A;  4NXE A;  4LV1 A;  1ZTU A;  1AXB A;  4NXF A;  1RGZ A;  2V20 A;  2Y4A A;  3C30 A;  3C7U A;  3NDE A;  3DW0 A;  5DFX A;  5DFY A;  2JC7 A;  2HDU A;  4EBN A;  4FD8 A;  3D72 A;  1TS6 A;  4CLC B;  4Y7P A;  1PNE A;  1VET A;  4ETX A;  3S7N A;  1CEG A;  2J8Y A;  3NOT C;  4L9E A;  4ZJ3 A;  3TW8 A;  5TFQ A;  5AVF A;  2WKR A;  2OAQ 1;  2ZMF A;  3P98 A;  3W4P A;  4O8G A;  1IOU A;  3V67 A;  4ZDX A;  4HJ4 A;  5HSQ A;  4GCZ A;  4OP5 A;  3CWF A;  2OAP 1;  2JKF A;  2W3F A;  4X56 A;  3JYI A;  4R1G A;  3MXR A;  4GHI B;  5JYP A;  5E43 A;  1YMS A;  2IA2 A;  1S1Y A;  1CF0 A;  4MLL A;  1XXM A;  1K25 A;  1ONH A;  5DJU A;  4BD0 A;  4JPM A;  3GEC A;  4EU0 A;  3FG8 A;  4HHD A;  4HES A;  2EWV A;  1NRF A;  3HCY A;  2JBF A;  3T1R A;  4B4Z A;  3UE1 A;  2EX9 A;  4LV0 A;  1BYW A;  2Q0O A;  5CGW A;  2A3U A;  1P9R A;  4I3A A;  4EET B;  4LCL A;  1CI8 A;  3T12 B;  4C75 A;  3C4P A;  4OQH A;  3TRC A;  4WUJ A;  4ZTK A;  3E4Q A;  1QMF A;  1N9O A;  4IBR A;  3M6H A;  2WKP A;  5DKK A;  3HVF A;  1S6R A;  5EV0 A;  2QJ7 A;  1OJG A;  1NLZ A;  4OOL A;  4ZJ2 A;  2D01 A;  3O88 A;  2A2L A;  2JKR M;  1YT4 A;  3U2A A;  3Q81 A;  4II7 A;  2W1R A;  1TDG A;  4HBT A;  2QMI A;  1MZU A;  4DJ2 A;  4FTX A;  1XFN A;  2OWH A;  1KDS A;  2P9V A;  1YM1 A;  4IJG A;  1BUE A;  1U60 A;  3H82 B;  5HD3 A;  1FIK A;  5AQA A;  2ZJ9 A;  1JWV A;  1KE4 A;  2R78 A;  1V9Z A;  2G7U A;  1W8Q A;  1L0D A;  2XSS A;  3C5A A;  5EM0 A;  2W3G A;  3LI8 A;  4LRY C;  3UB6 A;  3CUE A;  1UWP X;  3MSH A;  4H6J A;  4PKY A;  5FAT A;  2ZM2 A;  5FQQ A;  5KSC A;  1ZKJ A;  4WN5 A;  4BEN A;  5DF7 A;  1OTA A;  4WZ5 C;  3EOI A;  4HOI A;  1MPL A;  3BLM A;  3A3J A;  4ZBE A;  4GB7 A;  2VGL S;  3GVB A;  1HTZ A;  5EOO A;  1ONG A;  3LIE A;  2PYP A;  3P7N A;  5IT5 A;  2VK3 A;  4NXG A;  3KSH A;  3LY4 A;  1ERQ A;  1SCW A;  4WEL A;  4WBG A;  3KX0 X;  4EQ1 A;  3NUL A;  5E2E A;  3L9K A;  3IQA A;  5CTM A;  1K6R A;  2WKH A;  3ZG5 A;  1N4O A;  5KMW A;  2OSU A;  3E4P A;  5GHX A;  5CED A;  1K56 D;  2VGL M;  5CHU A;  2Y2M A;  2MJ6 A;  3ZCZ A;  3GV9 A;  2XD1 A;  3CHW P;  2JCH A;  1Y4O A;  3G2Y A;  3T4L A;  2AVX A;  3LR3 A;  3VP3 A;  4R3J A;  1IEL A;  2EFX A;  4WZ4 A;  1DJB A;  3MZE A;  3CG5 A;  4KG6 A;  5HPF A;  4XXR A;  1CJF A;  2ZC4 B;  3E98 A;  3IHB A;  5M1A A;  1STZ A;  1H8Z A;  1MKI A;  4UQI S;  4YOF A;  2ZLY A;  4MBF A;  4OH0 A;  3PBR A;  2JKR I;  2W3E A;  1RP5 A;  4OP8 A;  4E3K A;  1CEF A;  2PR5 A;  4HJ3 A;  4BMW A;  3UME A;  5F82 A;  3V3R A;  4KZ7 A;  4WF0 A;  1Y54 A;  3GRJ A;  5CEC A;  4WL9 A;  3IH8 A;  2HJE A;  2B95 A;  4DRT A;  3G30 A;  1YQS A;  2ZQC A;  4F94 A;  1SHV A;  4XT2 A;  1RGY A;  4DKI A;  3Q7Z A;  2VZW A;  3NCK A;  4UQI M;  3BFF A;  2W3H A;  5HAQ A;  2H10 A;  5FI2 A;  3T4K A;  3QP6 A;  1K55 A;  2NUT C;  3RTY A;  3UMD A;  2ZMV A;  4GKU A;  5DF8 A;  3IF6 C;  3CIT A;  3HUN A;  4YFM A;  1IYQ A;  3SZT A;  1GSX A;  4KZ3 A;  3WS1 A;  5HPI A;  3HUO A;  4XUX A;  1N9N A;  1FOF A;  4KZ5 A;  3EEA A;  1PFL A;  2ZC3 B;  2B18 A;  4CJN A;  3ISG A;  2I72 A;  4C3Q A;  5TJJ A;  4GW9 A;  3VP1 A;  4HBU A;  5GL9 A;  3N8S A;  5HWV A;  2WAE A;  1K55 C;  4WEJ A;  2K7S A;  3CZD A;  3F1N B;  4DF6 A;  3W4Q A;  2P08 A;  2XD5 A;  3LFV A;  1ALQ A;  1W8Y A;  3BEC A;  2Z2M B;  4S2I A;  4LRX C;  1ESI A;  1NXY A;  4GS9 B;  3MKE A;  3GDI A;  4UHU A;  3JVU A;  2DCF A;  3IF6 B;  4HH2 A;  4UA6 A;  3BQA A;  2EFU A;  4FSF A;  3O87 A;  1LHY A;  2PD7 A;  3D4F A;  4O0P A;  4O01 A;  3H7W A;  1NZU A;  4E3N A;  1VB6 A;  3MF0 A;  3IWI A;  3EEH A;  3T4T A;  4P0M A;  3LUQ A;  4PM9 A;  5HZH A;  4DXC A;  3M6B A;  3N8L A;  1K38 A;  1NYM A;  2ZC7 A;  1XFQ A;  4X1M A;  3VOZ A;  1W63 M;  3QP5 A;  4QWO A;  1CI9 A;  1N9B A;  2V0U A;  3IS2 A;  4E6X A;  3UY6 A;  4BBU A;  3MBZ A;  3H9W A;  2H28 A;  2C6W B;  3EQV A;  4X1L A;  1L3L A;  2VV6 A;  5HAR A;  3V3S A;  1NLY A;  2Y2N A;  5FAQ A;  4UA7 A;  4ZAM A;  1GCE A;  1DP6 A;  2KDK A;  3BY9 A;  1GHP A;  4YNR A;  1DP8 A;  4YWZ A;  2ZQ9 A;  3SS4 A;  1YMX A;  2PYR A;  2IWC A;  1W5D A;  3GSG A;  4JGP A;  3ZG9 B;  4GOG A;  3QP4 A;  3R7W B;  4DDS A;  1NRJ A;  1RCJ A;  3D3O A;  4Q0H A;  2BLS A;  3QHY A;  4A5R A;  2ZQ7 A;  4DMZ A;  3IBR A;  5EVL A;  4BLM A;  5JYO A;  1FCO A;  2J80 A;  4RX3 A;  1GSV A;  4LV2 A;  4IHQ A;  2KOI A;  1KVM A;  1SKO A;  4EEP A;  4KUK A;  2XR0 A;  2ZMA A;  5I5L A;  5HAI A;  2WUQ A;  4OLG A;  3WWX A;  3DAV A;  2G2U A;  3MQO A;  3MQQ A;  4JGO A;  4GJ4 A;  5DKL A;  4WMC D;  4G3K A;  2Q9N A;  3BFE A;  4KG5 A;  4X69 A;  3QNB A;  1LT0 A;  2OV5 A;  3BY8 A;  4HY8 A;  1LLB A;  3ZGA B;  2V8F A;  2ZL1 A;  1XA1 A;  2O99 A;  3E0Y A;  4IUK A;  5L8M A;  1OJ5 A;  1XJ6 A;  1CQA A;  2ZBB A;  5LBR A;  4DE2 A;  1O7E A;  3ZQ5 A;  4X68 A;  3S7P A;  3G31 A;  4K08 A;  4GLQ A;  2JHE A;  2ZOH A;  1K57 A;  4P6B A;  1E3U A;  1TS0 A;  1PZP A;  4WEK A;  4Y15 A;  2WKI A;  4HQA A;  5FEG A;  4CLC D;  5F83 A;  1EI5 A;  3S22 A;  2G2W A;  3PBT A;  3PTE A;  3ZVW A;  1K4E A;  4OQ0 A;  5C5K A;  3OBF A;  3OZH A;  2GJ3 A;  4OQI A;  4WLA A;  3W4O A;  1FQG A;  1TD5 A;  1TF1 A;  1W79 A;  3NOU C;  1PI4 A;  5HDD A;  4RA7 A;  1BLC A;  4I3I A;  4PM8 A;  4G3W A;  4GD6 A;  2Y2H A;  4R6L A;  5AQ7 A;  1CK3 A;  4OKP A;  3GTC A;  1Q2Q A;  4MN6 A;  2B02 A;  4BL3 A;  3D9Y A;  2EX8 A;  1D1J A;  4IUH A;  1MC0 A;  1PI5 A;  5CHM A;  2V2F F;  2E8I A;  3FKV A;  2UWX A;  3B42 A;  5HL1 A;  5F5Y A;  3UB9 A;  4PMA A;  3M2J A;  2D02 A;  2HDS A;  4LLO B;  4EXO A;  1H8Y A;  2DRW A;  3HRE A;  2GZA A;  2HP9 A;  2BTF P;  3BFC A;  4M3K A;  2R9X A;  4U0X A;  3SOI A;  4PKY G;  2VA0 A;  5FQJ A;  1J3W A;  3B3X A;  1I2W A;  3MXS A;  3V39 A;  1PIO A;  3BYD A;  1PW1 A;  3OPP A;  4L9G A;  4DN0 A;  1MBL A;  2VV7 A;  4D2O A;  4OOM A;  2EXB A;  1G68 A;  1JWZ A;  2VGK A;  4QY6 A;  3OPL A;  2C5W B;  3FC7 A;  1YLW A;  1ZG6 A;  5KZH A;  1MWU A;  4BBT A;  1F98 A;  4KQR A;  3ZYT A;  1XPB A;  1JTD A;  3BW6 A;  4HH3 A;  3G6O A;  3CPT B;  3KO6 A;  2Y59 A;  3F1P A;  3CLO A;  3HLD A;  3IX4 A;  1ERM A;  4PHT A;  3IXB A;  2RCX A;  2PDR A;  3IXH A;  5HX9 A;  2O0Y A;  1KE0 A;  3UDI A;  3LEQ A;  4JGQ A;  3AGD A;  3N6I A;  5CTN A;  3NDG A;  4KZ6 A;  2VLG A;  1UWN X;  3ULF A;  4CPK A;  1MWT A;  3VFH A;  2W27 A;  4Q0J A;  3WRT A;  3UE6 A;  1XKZ A;  4R0Q A;  1YAX A;  2QZ6 A;  2H0Y A;  4KZ4 A;  5M18 A;  4MCW A;  3BQ8 A;  4E3I A;  2JE5 A;  2P7J A;  1VET B;  2Y2G A;  4Y17 A;  2DMW A;  4OON A;  3UPN A;  2IWB A;  4NKP A;  4S2N A;  3S7O A;  1VEU A;  3AGE A;  2BG1 A;  2VX8 A;  1WYB A;  1JTG A;  3GMW A;  2EX2 A;  1LSX A;  2Y2O A;  2JKT I;  3MXQ A;  3V5M A;  1ODV A;  1ES2 A;  3FPW A;  5FAP A;  5DTT A;  5EVI A;  4ARZ A;  4OQG A;  2J9O A;  3EWK A;  3DTE A;  1G28 A;  2WYX A;  5HWW A;  1XA7 A;  5G18 A;  3UE3 A;  1T1A A;  2ZQ8 A;  4MN7 A;  5EPH A;  1LL9 A;  2EX6 A;  3VOL A;  3N4I A;  4JBF A;  1XGJ A;  4XUZ A;  4EQI A;  1ACF A;  4O7D A;  3WRZ A;  1PWG A;  3G32 A;  2J3W A;  1YSQ A;  1W63 Q;  5EVI C;  2HDR A;  1ZG4 A;  2L1M A;  3CUE C;  5FI6 A;  3S7Q A;  2QPN A;  2WZX A;  5K5B A;  2QYB A;  1K56 A;  4OPY A;  3C4O A;  5L10 A;  1K54 A;  5DF9 A;  1OT9 A;  1OT6 A;  1YLJ A;  2P9V B;  1ES4 A;  3TE8 A;  2W1T A;  1LSV A;  1T19 A;  4I38 A;  3IH9 A;  2Y79 A;  3MR0 A;  3Q1F A;  2GDN A;  3RH8 B;  1OTD A;  3UB8 A;  3LEZ A;  3G35 A;  3LID A;  3PAG A;  3MKF A;  1HVB A;  3F1O A;  3VP0 A;  2GNX A;  1PZO A;  3SS5 A;  1J9M A;  4C6Y A;  3NEC A;  5DTS A;  2B5R A;  4KZB A;  3TJZ C;  5HAP A;  5EVI B;  1SDE A;  5CHJ A;  5L09 A;  4QJG A;  4H6J B;  2QJ5 A;  4L0L A;  2PBD P;  2W3D A;  1KVL A;  4S2L A;  3DTM A;  4Q8I A;  3QNC A;  4KEN B;  2Y55 A;  4X25 A;  1C3B A;  1O07 A;  1XJ3 A;  5TBM A;  1S4S A;  4UAA A;  4CQH A;  1K0K A;  1GHI A;  4OPR A;  5HWT A;  4RQ9 A;  2RL3 A;  3ZVT A;  2PU4 A;  3BRM A;  2WGW A;  3I7J A;  4Y2F A;  1YSP A;  4G3V A;  1MXO A;  3WS0 A;  4M4X A;  2ZM8 A;  4QPR A;  4EEU A;  3T1Q B;  4H8R A;  3T4O A;  2PD8 A;  1NYY A;  5EE8 A;  4I39 A;  5F1G A;  5J7E A;  3VP2 A;  4LRZ E;  1PYY A;  3VFF A;  2Y91 A;  4DE3 A;  1FR1 A;  2Z2L B;  2M7U A;  3CAX A;  2QWS A;  4S2O A;  1TVF A;  1IEM A;  4JF4 A;  2ZQD A;  3FWL A;  1BSG A;  2IWD A;  3L7H A;  4K0W A;  3C7V A;  2A24 A;  3PHY A;  5U47 A;  3FKW A;  3NOP C;  1IFQ A;  3DBA A;  4HJ6 A;  2ZQA A;  2PU2 A;  4Y3I A;  4HNB A;  3VMA A;  4EW7 A;  2ZOI A;  1VM1 A;  5F68 A;  4GD8 A;  4EBL A;  1TDL A;  1JVJ A;  3GQZ A;  2DNS A;  4F3L A;  4JF5 A;  3P01 A;  1VQQ A;  4XT2 B;  4MNR A;  3FYZ A;  3G4P A;  2ZC6 B;  5GLA A;  4ZJ1 A;  5CGX A;  1AWI A;  1XX2 A;  2R9W A;  4BD1 A;  4KUO A;  1KGG A;  3VV4 A;  3B33 A;  4JXW A;  4JXS A;  2FFF B;  3VE4 A;  2WAD A;  1DJC A;  2I9V A;  2YKH A;  3UN7 A;  4WYY A;  2HF6 A;  3DWZ A;  4JKT A;  2WKE A;  3MZF A;  5F6A A;  3ITA A;  2PAV P;  1P9W A;  2EXA A;  2VKS A;  1FR6 A;  4GZB A;  5HL6 A;  3ZNY A;  1KE3 A;  1PWC A;  3UNW A;  3LYX A;  4LPZ A;  3PBO A;  4E6W A;  2XRO A;  2PR6 A;  1TS7 A;  4RVA A;  3EGD C;  2Y2I A;  2VV8 A;  2K31 A;  1GHM A;  2OOL A;  1XJ4 A;  5FDH A;  3OLO A;  4QU3 A;  1HLU P;  1L0G A;  3HL9 A;  4R4S A;  3N7W A;  1FCM A;  3RXX A;  5EFW A;  2CMN A;  2XRN A;  2PRF A;  5FQM A;  4OPQ A;  2XK1 A;  5D3O A;  2M7V A;  3S4X A;  3H7W B;  5A8B A;  3HBR A;  5MC7 A;  1YPR A;  1FSW A;  4WMC A;  1I2S A;  4U3T A;  2EA9 A;  2H5S A;  3QP8 A;  1ZHH B;  5HD5 A;  3NJA A;  4N92 A;  2XFT A; 
#chains in the Genus database with same CATH homology
 1ZG6 A;  1ERQ A;  1SCW A;  1ES3 A;  5IHV A;  5KZH A;  1KDW A;  4HEF A;  4WEL A;  3DWK A;  1MWU A;  4WBG A;  3W8K A;  4NK3 A;  5TR7 A;  1QME A;  5E2H A;  4KQR A;  5E2E A;  1XPB A;  1JTD A;  3IQA A;  2HPB A;  5BOH A;  5CTM A;  1K6R A;  2WKH A;  3PBQ A;  2Y59 A;  1L2S A;  3HLD A;  1N4O A;  3ZG5 A;  4IVK A;  1ERM A;  5KMW A;  2OSU A;  3V50 A;  3IXB A;  2RCX A;  2VGJ A;  3IXH A;  5HX9 A;  5GHX A;  2HP6 A;  1XGI A;  3CJM A;  5CED A;  2WGW B;  1K56 D;  3BLS A;  3O86 A;  5CER A;  1ERO A;  3G2Z A;  3IWO A;  3VSK A;  1KE0 A;  5CHU A;  5FQI A;  2Y2M A;  4Y0O A;  3ZCZ A;  3UDI A;  2J9P A;  2XD1 A;  1BT5 A;  3GV9 A;  3RJU A;  2JCH A;  1JWP A;  2XDM A;  1GA0 A;  5FSR A;  3AGD A;  3G2Y A;  3E2K A;  3N6I A;  4DE1 A;  4DXB A;  4K91 A;  3GR2 A;  3NDG A;  5CTN A;  4KZ6 A;  4CPK A;  4JXV A;  3VP4 A;  1L0F A;  3VP3 A;  1MWT A;  4FH4 A;  3VFH A;  1SKF A;  3A3F A;  4R3J A;  3WRT A;  1IEL A;  1XKZ A;  2EFX A;  4PPR A;  1LL5 A;  5DVA A;  1IYP A;  3IXD A;  4WZ4 A;  4R0Q A;  5E2F A;  4QY5 A;  1WE4 A;  2QZ6 A;  4MBK A;  2H0Y A;  1DJB A;  2Y2K A;  3CG5 A;  3MZE A;  4KZ4 A;  5GHY A;  3MZD A;  4PM6 A;  5M18 A;  4E3I A;  2XQZ A;  4KG6 A;  2JE5 A;  4XXR A;  4DDY A;  5AQB A;  4Z9Q A;  2ZC4 B;  3IHB A;  5M1A A;  2Y2G A;  1K57 C;  4S2M A;  3OPR A;  3Q07 A;  5L2F A;  4OON A;  1E3U D;  3UPN A;  1H8Z A;  2IWB A;  1MKI A;  4S2N A;  2ZLY A;  4MBF A;  4OH0 A;  4JLF A;  3PBR A;  3AGE A;  4EWF A;  1RP5 A;  4OP8 A;  2BG1 A;  1LI9 A;  4E3K A;  1CEF A;  1YLP A;  1WYB A;  1JTG A;  3GMW A;  3OC2 A;  2HDQ A;  4RYE A;  1BLP A;  3BFG A;  2EX2 A;  5F82 A;  1Q2P A;  3V3R A;  4KZ7 A;  3LY3 A;  2Y2O A;  1Y54 A;  3GRJ A;  4OLD A;  5CEC A;  3PBN A;  3HLB A;  4GNU A;  1SDN A;  3IH8 A;  3OCN A;  3V5M A;  5EEC A;  4DRT A;  1ES2 A;  3G30 A;  1YQS A;  2ZQC A;  3A3D A;  3MFD A;  3NIA A;  4KG2 A;  4LV3 A;  5FAP A;  1NJ4 A;  4F94 A;  5DTT A;  1SHV A;  3N8R A;  3UPO A;  5EVI A;  1RGY A;  3ZDJ A;  4DKI A;  2Q9M A;  3Q7Z A;  1IKG A;  3NCK A;  3BFF A;  4OQG A;  3HLC A;  3PBS A;  5HAQ A;  2H10 A;  5FI2 A;  2J9O A;  1K55 A;  1MY8 A;  4P6B A;  4GKU A;  4KZ9 A;  1IYO A;  1M40 A;  5DF8 A;  2P74 A;  2WYX A;  3UPP A;  1XA7 A;  3IF6 C;  1L0E A;  5CGS A;  5G18 A;  3UE3 A;  3HUN A;  4YFM A;  4S2P A;  1IYQ A;  3IXG A;  2Y2J A;  4KZ3 A;  4E3O A;  2ZQ8 A;  3WS1 A;  1YLT A;  4BL2 A;  3HUO A;  4XUX A;  5EPH A;  1E25 A;  4KZA A;  1LL9 A;  2EX6 A;  1FOF A;  5A90 A;  4KZ5 A;  2WGI A;  3N4I A;  4JBF A;  3HLE A;  1XGJ A;  4XUZ A;  4EQI A;  2ZC3 B;  1ZC2 A;  4CJN A;  3NC8 A;  3ISG A;  4FH2 A;  1I5Q A;  2I72 A;  3OPH A;  4O7D A;  4C3Q A;  5F1F A;  3WRZ A;  1PWG A;  3G32 A;  5FAS A;  3VP1 A;  2WGV A;  5EVI C;  1W7F A;  2HDR A;  5TGF A;  4HBU A;  1ZG4 A;  2H0T A;  5GL9 A;  4E3L A;  3N8S A;  5FI6 A;  2V1Z A;  5FI7 A;  2QPN A;  2WZZ A;  2WZX A;  2Y2Q A;  2WAE A;  2XH9 A;  1K55 C;  3M2K A;  5M19 A;  4KQQ A;  1K56 A;  4OPY A;  3C4O A;  2J7V A;  4WEJ A;  2Y2L A;  3CZD A;  5EOE A;  3ZHH A;  3W4Q A;  4DF6 A;  1G6A A;  1Z6F A;  2XD5 A;  1K54 A;  4ID4 A;  1ALQ A;  1W8Y A;  5DF9 A;  4EV4 A;  1TEM A;  3BEC A;  2Z2M B;  4S2I A;  5FA7 A;  2ZM0 A;  3UO9 A;  4UA9 A;  3ZG8 B;  1YLJ A;  3A3E A;  2P9V B;  1ES4 A;  4EBP A;  1ESI A;  3PAE A;  1K6S A;  1MWS A;  1NXY A;  1NY0 A;  3MKE A;  4UHU A;  1ESU A;  3IH9 A;  3Q1F A;  5GLD A;  4E3J A;  2DCF A;  2GDN A;  3IF6 B;  3IT9 A;  3IF5 A;  3NI9 A;  4UA6 A;  4X6T A;  3LEZ A;  3G35 A;  2EFU A;  3A3I A;  3FV7 A;  4FSF A;  3O87 A;  1LHY A;  4R3B A;  3PAG A;  3MKF A;  1HVB A;  2FFY A;  3RXW A;  3VP0 A;  3D4F A;  1PZO A;  4BQM A;  3SS5 A;  1XP4 A;  1NZU A;  3LCE A;  3ZFZ A;  2XEP A;  4MBH A;  1J9M A;  3HLW A;  3HLF A;  4IED A;  4C6Y A;  4E3N A;  3BM6 A;  3IWI A;  3TSG A;  3UDF A;  3SH9 A;  5A92 A;  5DTS A;  1BUL A;  4QHC A;  2B5R A;  1NZO A;  4KZB A;  3O3V A;  4P0M A;  5HAP A;  2OLV A;  5EVI B;  1SDE A;  4PM9 A;  5CHJ A;  1BLS A;  4DXC A;  2WK0 A;  3M6B A;  4OVD A;  4S2K A;  3IHA A;  3WS2 A;  4QJG A;  4OPZ A;  1KGE A;  5DTK A;  5KSH A;  4N9K A;  3N8L A;  1FSY A;  1K38 A;  1NYM A;  4JXG A;  4L0L A;  2ZC7 A;  1KVL A;  4S2L A;  3VOZ A;  3DTM A;  4Q8I A;  3QNC A;  4KEN B;  3LO7 A;  2Y55 A;  3NY4 A;  1CI9 A;  1N9B A;  1IYS A;  1C3B A;  1O07 A;  3EQU A;  3SS3 A;  3UY6 A;  3MBZ A;  2ZC5 B;  4E6X A;  1BZA A;  1DY6 A;  4MEZ A;  1GA9 A;  4GN2 A;  2C6W B;  3FZC A;  4UAA A;  3S1Y A;  3EQV A;  3P09 A;  1GHI A;  4OPR A;  5E2G A;  2RL3 A;  3ZVT A;  2PU4 A;  5HAR A;  3BRM A;  3WS4 A;  2WGW A;  3V3S A;  2Y2N A;  3OCL A;  5FAQ A;  2XF3 A;  3I7J A;  4UA7 A;  4QD4 A;  1GCE A;  4ZAM A;  2Y2P A;  4LCM A;  2X01 A;  4LEN A;  4R4R A;  4FCF A;  4X55 A;  1MXO A;  4PM7 A;  3HUM A;  3BEB A;  3WS0 A;  4WZ5 A;  1GHP A;  2ZM8 A;  4LV1 A;  4S2N C;  2ZQ9 A;  1AXB A;  4H8R A;  3SS4 A;  5J8X A;  1RGZ A;  2V20 A;  2Y4A A;  1NYY A;  5EE8 A;  5F1G A;  1YMX A;  4N9L A;  2IWC A;  3C7U A;  1W5D A;  3NDE A;  3GSG A;  3VSL A;  4BJP A;  3VP2 A;  3DW0 A;  3ZG9 B;  1PYY A;  1LI0 A;  4GOG A;  3VFF A;  1FCN A;  2JC7 A;  2HDU A;  4EBN A;  4DDS A;  4IVI A;  2Y91 A;  1HZO A;  4FD8 A;  4N1X A;  4GDB A;  1RCJ A;  2BLS A;  4Y7P A;  4DE3 A;  3QHY A;  1FR1 A;  2Z2L B;  4A5R A;  2ZQ7 A;  3Q7V A;  3ITB A;  4RX2 A;  4S2O A;  1CEG A;  2J8Y A;  4ZJ3 A;  5TFQ A;  3SH8 A;  1TVF A;  1IEM A;  3P98 A;  4JF4 A;  3TOI A;  5EVL A;  3W4P A;  4Y0T A;  2ZQD A;  3FWL A;  5EVI D;  1FCO A;  1BSG A;  2IWD A;  4BLM A;  5JYO A;  4RX3 A;  3G34 A;  4K0X A;  4E3M A;  4K0W A;  4ZDX A;  3C7V A;  1MWR A;  1M6K A;  4OP5 A;  5U47 A;  4LV2 A;  3FKW A;  3AGF A;  1KVM A;  4X56 A;  3JYI A;  4R1G A;  3MXR A;  5JYP A;  5E43 A;  2XR0 A;  2ZMA A;  2ZQA A;  1YMS A;  4GDN A;  3SH7 A;  5HAI A;  2WUQ A;  4OLG A;  4MLL A;  3WWX A;  2G2U A;  5AQ9 A;  1XXM A;  4WMC D;  2Q9N A;  3BFE A;  4KG5 A;  4X69 A;  1K25 A;  1ONH A;  2PU2 A;  1HD8 A;  3QNB A;  4BD0 A;  2OV5 A;  1LLB A;  4IBX A;  3ZGA B;  3VMA A;  1XA1 A;  2XLN A;  2OLU A;  4JPM A;  3NBL A;  4HES A;  4KQO A;  2ZD8 A;  1NRF A;  5GLB A;  2JBF A;  5EUA A;  4DE2 A;  1O7E A;  1VM1 A;  4B4Z A;  4X68 A;  3UE1 A;  2EX9 A;  4GD8 A;  4LV0 A;  2X02 A;  1YLZ A;  3G31 A;  1TDL A;  4EBL A;  1JVJ A;  5CGW A;  2A3U A;  4LCL A;  1CI8 A;  3GQZ A;  1K57 A;  4C75 A;  2DNS A;  1BLH A;  1E3U A;  1K54 C;  4JF5 A;  1PZP A;  1E4D A;  1PW8 A;  3C4P A;  4OQH A;  2A49 A;  4NET A;  1VQQ A;  4WEK A;  4ZTK A;  5A93 A;  5FAO A;  2WKI A;  1QMF A;  1S0W A;  4MNR A;  3WS5 A;  4IBR A;  4QB8 A;  3FYZ A;  3G4P A;  3M6H A;  1EWZ A;  3HVF A;  1S6R A;  5F83 A;  5A91 A;  3ZG7 B;  1EI5 A;  3S22 A;  2G2W A;  3PBT A;  2ZC6 B;  3PTE A;  5GLA A;  3ZVW A;  1K4E A;  4ZJ1 A;  4OOL A;  4OQ0 A;  4ZJ2 A;  3UE0 A;  4N1H A;  1XX2 A;  2R9W A;  5CGX A;  4BD1 A;  3ZG0 A;  2PBY A;  1KGG A;  1ES5 A;  3OZH A;  4KZ8 A;  4JXW A;  3E2L A;  4OQI A;  4JXS A;  2FFF B;  3O88 A;  2WAD A;  1DJC A;  3W4O A;  4PM5 A;  2HP5 A;  1FQG A;  1YT4 A;  4EUZ A;  3UN7 A;  4WYY A;  1W79 A;  2XGN A;  3Q81 A;  1PI4 A;  3Q7V B;  2WAF A;  1TDG A;  3DWZ A;  1BLC A;  4JKT A;  4RA7 A;  4HBT A;  4GD6 A;  2QMI A;  2WKE A;  2Y2H A;  4PM8 A;  5CRF A;  4DE0 A;  5AQ7 A;  1CK3 A;  1KGF A;  3MZF A;  4OKP A;  3ITA A;  5HW3 A;  3GTC A;  2EXA A;  1KDS A;  1Q2Q A;  2P9V A;  1YLY A;  1YM1 A;  4BL3 A;  1FR6 A;  3Q82 A;  1BUE A;  2EX8 A;  4GZB A;  3ZNY A;  1KE3 A;  4B88 A;  1U60 A;  1PWC A;  1PI5 A;  3IF6 A;  5CHM A;  3UDX A;  2V2F F;  1IKI A;  4YIN A;  3UNW A;  5AQA A;  2ZJ9 A;  1JWV A;  4P87 A;  2E8I A;  1KE4 A;  2X71 A;  3FKV A;  2UWX A;  5HL1 A;  3PBO A;  3ZNT A;  4PMA A;  4E6W A;  4WM9 A;  2CC1 A;  5FQ9 A;  3M2J A;  1W8Q A;  2HDS A;  4RVA A;  2Y2I A;  1H8Y A;  4P85 A;  1L0D A;  2DRW A;  1GHM A;  3HRE A;  2HP9 A;  3C5A A;  5FDH A;  5FQK A;  1PWD A;  5GHZ A;  4JF6 A;  4QU3 A;  1H5X A;  4S2J A;  3BFC A;  3IWQ A;  4M3K A;  1L0G A;  2R9X A;  3HL9 A;  4R4S A;  4U0X A;  3N7W A;  3SOI A;  1FCM A;  5FAT A;  2ZM2 A;  5FQQ A;  3RXX A;  5KSC A;  1ZKJ A;  4B4X A;  5FQJ A;  2XFS A;  4BEN A;  3TG9 A;  1DJA A;  5FQM A;  5DF7 A;  3B3X A;  5CXW A;  4OPQ A;  1BTL A;  4X53 A;  2XK1 A;  5D3O A;  1I2W A;  4WZ5 C;  3MXS A;  3V39 A;  5HFO A;  3S4X A;  1K4F A;  1PIO A;  3BYD A;  1PW1 A;  3HBR A;  5GLC A;  3OPP A;  1MPL A;  3BLM A;  1MBL A;  4Y0U A;  3HLG A;  3A3J A;  4ZBE A;  1FSW A;  4D2O A;  4OOM A;  4GB7 A;  2EXB A;  4WMC A;  1I2S A;  3GVB A;  1G68 A;  4U3T A;  1JWZ A;  1HTZ A;  3VOY A;  5EOO A;  2VGK A;  4QY6 A;  1OME A;  4OOY A;  3OPL A;  2C5W B;  5I94 A;  5CEB A;  1ONG A;  2H5S A;  3BFD A;  1YLW A;  4U0T A;  4R23 A;  1WYC A;  3CMZ A;  4N92 A;  3LY4 A;  2XFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...