1YMXA

X-ray crystallographic structure of ctx-m-9 beta-lactamase covalently linked to cefoxitin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-lactamase CTX-M-9
publication title Structure, Function, and Inhibition along the Reaction Coordinate of CTX-M beta-Lactamases.
pubmed doi rcsb
source organism Escherichia coli
total genus 93
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ymxA00
1K4EA 2H0TA 3IF6B 4KZ6A 4GDNA 1SDEA 3FKWA 2WGIA 4N1HA 3UN7A 4IVIA 4OOYA 3HBRA 3BYDA 2HDQA 5HAQA 1NZUA 2G2WA 4BLMA 2E8IA 4EUZA 4M3KA 1XA1A 3NY4A 5EE8A 3A3DA 5A93A 1K54C 3O3VA 1ONHA 3D4FA 3OCNA 4N92A 3OPPA 4JF4A 4NK3A 4QY5A 1IELA 2EX6A 5F1FA 1PW1A 4LV0A 3UPPA 5CHJA 1IYSA 1YLYA 4S2OA 4ZJ3A 3HLEA 4OOMA 4DKIA 3HVFA 3HUNA 4FD8A 4UA9A 4ZJ2A 4XXRA 3HLWA 5GLDA 3G30A 4S2IA 2EX2A 2PBYA 2WGWB 2Z2LB 2PU4A 3Q07A 2J9PA 1K56D 4KZAA 3PBSA 4QD4A 3UE3A 2Y2OA 3BFCA 2VGJA 4KG2A 5EOOA 1WYBA 3W4QA 1BUEA 3PAGA 3IHBA 3RXWA 1PW8A 3VOYA 1YMSA 3BFDA 4C3QA 1GA0A 3ZNTA 5KSHA 4EWFA 2JCHA 5GL9A 3HUOA 4WM9A 1K6SA 4GNUA 4EBLA 3V3RA 3GSGA 4PM5A 1ERQA 5CERA 2XR0A 1IEMA 4PM6A 3VFHA 3ZDJA 4S2NC 4DF6A 3HLBA 4YINA 4R3JA 1ERMA 3CG5A 3MXRA 4R3BA 1YLZA 2WAEA 3GQZA 4K91A 3NC8A 4B88A 2Y2KA 3ZG7B 4Q8IA 1MBLA 3VMAA 1ZG6A 3IXBA 2PU2A 3GR2A 1FCNA 2XK1A 4GN2A 1S0WA 3IWIA 3NIAA 1E3UD 1JTDA 3TSGA 4QB8A 3Q7ZA 4WEKA 2JBFA 4C6YA 3V3SA 4DXCA 2J7VA 3IQAA 1DY6A 4BD0A 5M19A 4X55A 3ISGA 1Z6FA 3G34A 4X53A 4S2MA 3A3JA 3G4PA 1H8YA 4X56A 1GHIA 5DF7A 3UY6A 1L0DA 3DTMA 4R0QA 1I2WA 5A92A 4OPYA 4FH2A 1PI4A 3G31A 2Y2GA 4QJGA 4L0LA 3E2KA 5U47A 2XDMA 5KZHA 4KZ9A 5DTSA 1FSWA 2OLVA 4BL2A 1IKGA 4KQOA 3VP2A 4R23A 4XUZA 4OPQA 3G2ZA 3GTCA 2P74A 1RCJA 3MZEA 4LCLA 5F82A 4KQRA 5CTNA 4R4SA 3HLCA 3G32A 3N7WA 2WAFA 4E3KA 5AQAA 3ZVWA 1YLJA 1TDLA 1TEMA 1EI5A 3BEBA 4LENA 2ZQAA 4R4RA 2XH9A 4S2JA 4R1GA 2WKHA 3MKFA 1PI5A 4MBFA 4RA7A 2P9VB 5IHVA 2V2FF 4S2NA 5CEDA 1I5QA 1YQSA 3W4PA 2ZC3B 5DF9A 3LEZA 3B3XA 5DTKA 5FI6A 5E2EA 3S1YA 3W8KA 4E3OA 4JF6A 4U0TA 4DDYA 2X01A 4WEJA 1K55A 3ZG5A 3SOIA 1JWPA 3PTEA 1KVMA 4KZ7A 4P85A 4E3JA 1BT5A 2WYXA 1YM1A 1LL9A 4JXGA 2DRWA 5CXWA 4ZTKA 3SS4A 1XKZA 3VP0A 3RXXA 3SH9A 1LL5A 3UPOA 5CRFA 2ZC4B 3VP3A 2G2UA 3VSKA 4EV4A 4OONA 1NY0A 5DVAA 4NETA 2ZM8A 4BD1A 4A5RA 1MY8A 3WWXA 4OOLA 1KGFA 1NYYA 1O7EA 4GKUA 5E2FA 4MLLA 1TVFA 2HDSA 2ZQ7A 4WBGA 4LV3A 2Y2QA 2HP5A 4N9KA 3VOZA 1JWZA 1MPLA 3O87A 3ZFZA 2FFYA 1K25A 3M2JA 4UHUA 1YLPA 1ZKJA 3FYZA 1SKFA 5EUAA 5AQ7A 1M6KA 3NCKA 1TDGA 4MBHA 3PBOA 4N9LA 2EXAA 3VFFA 1YT4A 4PPRA 5FQ9A 2Y55A 3JYIA 2OLUA 2Q9NA 5EOEA 1HZOA 1YMXA 5F83A 5EVIC 5FASA 3HLFA 3Q7VB 2C5WB 3HLDA 4FSFA 3PBNA 5G18A 3UDIA 4D2OA 3MKEA 2Y2NA 5CGXA 1W8YA 2V20A 1LLBA 1PWGA 2CC1A 3IF6C 3M6HA 4DE0A 4B4XA 5KSCA 3OCLA 3OZHA 1BLCA 4CJNA 2WZXA 3S4XA 1MXOA 2C6WB 2J8YA 3SH7A 5A91A 2Y2JA 4E6WA 1E4DA 1ZG4A 3FKVA 4ZBEA 3MZDA 1HTZA 2Y91A 4S2KA 4FCFA 4E3LA 4KZ3A 3P98A 1MWRA 2WGVA 3LY4A 2XD5A 3RJUA 3WRZA 4X68A 2EFXA 5A90A 3MBZA 3IWQA 3C4PA 4GZBA 4WZ5C 2ZQCA 3WS5A 3AGFA 4DE2A 2VGKA 3HLGA 3PBQA 4HBTA 4HBUA 3UE0A 1K55C 1W5DA 4OLGA 1WYCA 1FSYA 4CPKA 1W7FA 5JYOA 2EXBA 3QHYA 2JE5A 1MWSA 4IBXA 1N4OA 2ZM2A 2WUQA 3C7UA 4P0MA 3TG9A 5HARA 1CK3A 4PM8A 1E25A 2Q9MA 4OKPA 1Y54A 4Y7PA 5FDHA 5HX9A 4Y0OA 1FCOA 2IWBA 3SS3A 4EBNA 3IHAA 4S2PA 3IXDA 4S2LA 2OSUA 3DW0A 5EVIA 1H8ZA 4EBPA 4LCMA 1ES4A 3ZG8B 3C4OA 1PIOA 2WKEA 3ZCZA 4WELA 5CGWA 2WKIA 2A3UA 4IEDA 4JXSA 1ONGA 5HFOA 2ZC7A 2H0YA 3IF6A 3LCEA 4FH4A 4OQGA 2DNSA 3WS2A 2ZD8A 4KZ4A 2XFTA 4OPRA 1S6RA 4EQIA 5FAQA 1GHPA 4KG6A 2QPNA 3PBTA 4GOGA 1JVJA 4OP5A 4WYYA 5GLCA 3IXGA 5GLBA 1KGEA 3VP1A 3GV9A 5FSRA 3P09A 4WMCA 2DCFA 2QMIA 4GD6A 4E6XA 5JYPA 1KDWA 5GLAA 3O86A 3SS5A 2R9WA 4Z9QA 2EX8A 2I72A 3WS4A 5CHUA 3NDGA 2H5SA 1G6AA 2RL3A 3PBRA 4OP8A 4KG5A 4PM7A 4B4ZA 5HL1A 1KDSA 4WZ5A 3GRJA 4QHCA 4F94A 4MBKA 3DWKA 1YLWA 5CGSA 3Q82A 4DDSA 4GDBA 5L2FA 4PM9A 3MZFA 1IYQA 5D3OA 2WGWA 1PZPA 3PAEA 3OPLA 4ID4A 3BM6A 5HAIA 5M1AA 1ESIA 2J9OA 1NYMA 3Q81A 2EX9A 3M2KA 5EVLA 3UNWA 3SH8A 3V50A 4H8RA 3GMWA 1XX2A 3N8SA 4IVKA 2B5RA 1ESUA 2EFUA 4E3MA 1ES5A 4JF5A 2FFFB 5TR7A 3EQVA 3WS1A 4BJPA 5AQBA 4RX3A 1PWDA 5BOHA 1ES2A 4C75A 2Z2MB 3FWLA 1LI9A 1QMEA 3N8LA 4K0WA 5CHMA 4OQIA 2Y2LA 4LV1A 3ZG0A 5DTTA 4IBRA 3C5AA 4P87A 1XPBA 3IH8A 4JKTA 4X69A 5HAPA 3FZCA 1M40A 1YLTA 5F1GA 4RVAA 5FAPA 1W79A 4ZAMA 1LI0A 4OQ0A 1N9BA 3NDEA 2ZJ9A 3HL9A 4QU3A 1Q2QA 5CTMA 1C3BA 2HP9A 2Y2MA 1CEFA 3TOIA 3BLSA 1XA7A 4ZJ1A 5FI7A 4UA6A 4YFMA 3I7JA 4GD8A 2OV5A 4XUXA 3CMZA 4OQHA 1BULA 2ZC6B 4JLFA 2UWXA 5EVID 5FQMA 3ZVTA 2WZZA 3BFEA 5TGFA 1DJCA 1SCWA 1DJAA 1QMFA 2A49A 2ZQ8A 3UE1A 4U0XA 3VP4A 4DE3A 1CI8A 1XGJA 5FQKA 5KMWA 1BZAA 4OH0A 3GVBA 2GDNA 2X02A 4UA7A 1W8QA 1EWZA 3N8RA 4JXVA 1KGGA 4MNRA 5AQ9A 3A3EA 1H5XA 5FQJA 1SDNA 4DXBA 1K6RA 4LV2A 4WMCD 5GHXA 1NXYA 2IWDA 5FAOA 4BL3A 1WE4A 2ZQDA 5DF8A 3ZNYA 1BLHA 3AGEA 1NRFA 2ZC5B 3N4IA 4BENA 2HDUA 3OPRA 1ES3A 2WADA 2RCXA 3MFDA 1KE0A 2XF3A 1U60A 4KZ8A 2Y59A 4X6TA 2Y2IA 1SHVA 3NI9A 1PYYA 1JTGA 4O7DA 1O07A 3CJMA 2P9VA 4PMAA 1PWCA 3O88A 1GHMA 2ZQ9A 3NBLA 2IWCA 3UDXA 4KENB 2H10A 3HREA 3IF5A 1FOFA 3UO9A 1HD8A 3BECA 3G35A 3EQUA 5E2HA 1JWVA 2XD1A 3LO7A 2R9XA 5M18A 5GHZA 1G68A 2XLNA 1ZC2A 4BQMA 3N6IA 2XEPA 1IKIA 2BG1A 5FA7A 3BFGA 4UAAA 3G2YA 4U3TA 5E2GA 1AXBA 2V1ZA 3V39A 4E3IA 3AGDA 5FATA 1KVLA 3ITBA 4K0XA 1K54A 1I2SA 3Q1FA 1L0EA 2JC7A 1GA9A 4KZ5A 3BFFA 2BLSA 5EPHA 3C7VA 4P6BA 3S22A 3BLMA 1EROA 1IYPA 1K57C 2XFSA 3M6BA 1CEGA 4OVDA 1KE4A 2XGNA 4HEFA 3WRTA 3IXHA 3FV7A 5CECA 2X71A 1FR6A 3OPHA 4JBFA 4RX2A 2XQZA 1NZOA 4E3NA 4DE1A 1FR1A 1K38A 1BTLA 1BSGA 1K56A 1VQQA 4GB7A 4QY6A 4WZ4A 4Y0UA 1K4FA 1GCEA 5FQIA 4JXWA 4KQQA 4RYEA 1L2SA 5EECA 2ZLYA 3LY3A 2Y2PA 1XP4A 3QNCA 1MKIA 1KE3A 1MWTA 3IT9A 1CI9A 3OC2A 5CEBA 5GHYA 2ZM0A 5FI2A 5TFQA 5I94A 3UDFA 1PZOA 4OPZA 3BRMA 4ZDXA 3Q7VA 4OLDA 1LHYA 3HUMA 2Y4AA 1DJBA 3VSLA 1NJ4A 5E43A 3UPNA 1RP5A 4KZBA 3ZHHA 2Y2HA 4N1XA 3A3IA 3QNBA 1J9MA 4MEZA 4DRTA 1L0FA 5HW3A 2ZMAA 1XXMA 4Y0TA 2WK0A 1BLPA 3A3FA 3E2LA 3ITAA 3W4OA 1Q2PA 1E3UA 4HESA 1HVBA 3MXSA 5FQQA 1OMEA 1MWUA 3ZG9B 2HDRA 2HP6A 1RGYA 5J8XA 1IYOA 3V5MA 1XGIA 1FCMA 1BLSA 1RGZA 3IH9A 3IWOA 4JPMA 3DWZA 1VM1A 5EVIB 1L0GA 3ZGAB 1FQGA 2QZ6A 2HPBA 1ALQA 3CZDA 3WS0A 1K57A
chains in the Genus database with same CATH superfamily
2H0TA 4FOFA 3DTIA 3CHWP 3FKWA 2XROA 3T1QB 5HAQA 1XA1A 3A3DA 5EM0A 3NOUC 3VE3A 3VE4A 1P9RA 4HHDA 1MKMA 2EWVA 1SKOA 3IBJA 1PW1A 2QKPA 2JKRI 3HVFA 5HDCA 1S1ZA 4S2IA 2KLIA 4KZAA 1K56D 4GHIB 4FTXA 3BFCA 5K5BA 1PFLA 3IHBA 3RXWA 1PW8A 3VOYA 3W2ZA 1NWZA 4EWFA 2JCHA 5GL9A 4WM9A 1K6SA 4HQAA 3V3RA 4PM5A 1OTBA 2XR0A 4S2NC 4YINA 1ERMA 4R3BA 5MC7A 4LGWA 3NJAA 3NHQA 3GQZA 3A0RA 1N9LA 4B88A 3ZG7B 4Q8IA 4GN2A 1S0WA 3LIBA 4QB8A 1S4SA 2O9AA 2JBFA 1OTDA 3T4OA 2V0WA 3IQAA 4KUKA 3A3JA 1H8YA 2V8CA 1ACFA 1I2WA 4FH2A 4NXEA 1PI4A 2Y2GA 4QJGA 4L0LA 5DTSA 4BBTA 1FSWA 2OLVA 3KSHA 4X1LA 4KQRA 3HLCA 3G32A 2WAFA 2K7SA 5AQAA 1TEMA 1EI5A 5HPIA 4MBFA 4S2NA 1I5QA 2B02A 2PRFA 3DBAA 4UQIM 3T4JA 5DF9A 3T4SA 3L7HA 4U0TA 2X01A 4WEJA 1K55A 3SOIA 2INWA 3LICA 3F1NB 3VP0A 4HH3A 5CRFA 2VK3A 3A0SA 4A5RA 1MY8A 4Q0IA 2PYPA 1OT9A 4LV3A 2HP5A 1JWZA 3O87A 4B93A 2FFYA 5FEGA 2P04A 4ESPA 5EUAA 3NCKA 1TDGA 4XT2B 3VFFA 4PPRA 5EOEA 1YMXA 5F83A 2V8FA 3UDIA 4LRZE 2A2LA 1LLBA 2CC1A 4ETXA 4Y5FA 3U2AA 2WZXA 1MXOA 2J8YA 3SH7A 4Z1WA 3MZDA 4S2KA 1MWRA 2XD5A 4R6LA 4F3LB 3IWQA 1LSVA 3C4PA 4GZBA 4O0PA 2VGKA 1W5DA 2PDRA 1FSYA 3QHYA 3H7WB 3C7UA 1CK3A 1E25A 2Q9MA 5HL6A 4JGOA 2OOLA 4Y0OA 3T50A 4NXBA 3C8CA 4S2PA 3T4LA 4S2LA 2OSUA 3DW0A 1H8ZA 4LCMA 4QWOA 3MFXA 5CGWA 2WKIA 5C5KA 2PR6A 1G5UA 3DTKA 3WS2A 2ZD8A 4KZ4A 2D02A 2G7UA 4I39A 4LRXC 5FSRA 3P09A 4WMCA 4E6XA 3T1SA 5GLAA 3CUEC 2I72A 4OP8A 4PM7A 4B4ZA 1ODVA 4QHCA 3LGOA 1YLWA 4PM9A 2FH5A 1F98A 5D3OA 1PZPA 2Q0OA 2EA9A 1ESIA 3Q81A 5EVLA 4GHIA 3RFBA 3SH8A 3V50A 4IVKA 1XX2A 4E3MA 1ES5A 4JF5A 3FC7A 2OAP1 4ARZB 3UE6A 1XFQA 1ES2A 5TJJA 4C75A 1QMEA 2ZOHA 3FPWA 2W3GA 3NOTC 3P7NA 4IBRA 3IH8A 2W0NA 2PYRA 4X69A 1M40A 1YLTA 4HP9A 5F1GA 2J3TC 4RVAA 1ZTUA 3NDEA 2ZJ9A 3BWLA 3HL9A 3TRCA 3C30A 5CTMA 4K08A 4ZJ1A 5FI7A 4GD8A 2OV5A 4XUXA 1BULA 1QMFA 3BJNA 2I9VA 3GECA 1YAXA 1CI8A 1XGJA 5FQKA 5HPFA 3N8RA 4JXVA 5AQ9A 1H5XA 2V0UA 1SDNA 4LV2A 4WMCD 1NXYA 2IWDA 4L9FA 1WE4A 5DF8A 3FPVA 3N4IA 4BENA 3OPRA 4H6JB 3K3DA 2Y59A 2OWJA 3NI9A 1PRQA 1JTGA 4PMAA 4BBUA 1GHMA 2VV7A 1IFQA 2ZBBA 3HJIA 3HREA 1FOFA 3BECA 3A0VA 2A24B 3KYEA 3NOPC 2XEPA 5AJGA 4NEED 5E2GA 3AGDA 5FATA 3ITBA 4K0XA 2CMNA 1AWIA 5DJTA 2BLSA 4P6BA 3S22A 3BLMA 1EROA 1IYPA 5AVEA 2LB5A 2XGNA 5CECA 3OPHA 4NXGA 2XQZA 3E98A 4DE1A 1K4FA 1GCEA 4B9OA 1L2SA 4XT2A 3KO6A 2V1BA 3UDFA 3BRMA 4EUVA 4JGQA 2BTFP 1NJ4A 4MMNA 3UPNA 1RP5A 2Y2HA 4PKYG 2LB9A 1J9MA 4MEZA 1DP6A 1XXMA 1P97A 4NXFA 1E3UA 1LT0A 1HVBA 1OMEA 1MWUA 4EXOA 2HP6A 1IYOA 4JPMA 5EVIB 1VM1A 3ZGAB 1FQGA 2QZ6A 2HPBA 4R70A 1BYWA 3WS0A 2J3TD 2JHEA 1K4EA 3UN7A 3BYDA 2HDQA 4BLMA 3BQ8A 4HJ3A 3LUQA 3H7WA 1K54C 3D4FA 3OCNA 3OPPA 3QP2A 2Y8HA 2EX6A 3UPPA 1IYSA 3IX3A 3B47A 4S2OA 4WUJA 4XXRA 1JNUA 2Z2LB 4I3IA 2J9PA 3PBSA 4QD4A 3UE3A 1P0ZA 2Y2OA 2P7JA 5F69A 3W4QA 5EV0A 3PAGA 1NRJA 5HDSA 3BFDA 4C3QA 4NKPA 3HUOA 3LR4A 1OJ5A 1ERQA 2J80A 5G4ZA 3CG5A 2R78A 1YLZA 3PYPA 1G28A 2Y2KA 1ZG6A 3ICYA 1E3UD 1JTDA 4EESA 2V1AA 2ZMVA 3H9WA 4C6YA 4DXCA 3UB8A 1DY6A 4ARZA 4X53A 1N9NA 3MQOA 4X56A 1L0DA 3DTMA 5A92A 5FL3A 3E2KA 2XDMA 1IKGA 3VP2A 3K3CA 4GS9B 4OPQA 3G2ZA 2VKSA 4LCLA 3MF0A 4R4SA 3LI9A 2NUPC 1T19A 4UQIS 3ZVWA 1TDLA 1MC0A 3BEBA 2XH9A 2P9VB 2V2FF 1YQSA 5L09A 2W3FA 3OBFA 2E8JA 3T12B 4E3OA 3TW8A 3ZG5A 1KVMA 1BT5A 4JXGA 1F2KA 4MN7A 3RXXA 3SH9A 2VLGA 4EV4A 1GSWA 3S7QA 2ZM8A 3BW6A 4H6JA 4HOIA 2WKQA 4ZRRA 4Q0HA 4DJ2A 5E2FA 2Y2QA 4N9KA 3BY8A 2A24A 3ZFZA 2XA7S 4UHUA 3S7NA 3B42A 3CLOA 3PBOA 2EXAA 4DN0A 1YT4A 5FQ9A 1VEUB 5EVIC 2Z6DA 2Y2NA 2Z6CA 5CGXA 1W8YA 1PWGA 4X25A 3OZHA 4HP4A 1E4DA 3FKVA 4ZBEA 4FUWA 1VETB 4HNBA 4KZ3A 5DKLA 3RJUA 3VV4A 4DE2A 4HBUA 4HBTA 1K55C 3JVVA 4OLGA 1HLUP 5F68A 1LSXA 3MSHA 1MWSA 3MR0A 3LR5A 2ZM2A 5HARA 4Y7PA 2IWBA 3SS3A 3RH8B 1UWNX 3KSGA 5EVIA 1PIOA 3V67A 2ZC7A 3LCEA 4UEYA 3LI8A 4OPRA 1S6RA 3LIEA 2ACGA 3L9KA 5GLCA 2QPNA 4GOGA 4OP5A 1DP9A 5FDSA 3VP1A 5GLBA 3EEAA 3GV9A 2QMIA 4MDZA 3IX4A 3O86A 5DFXA 4Z9QA 2EX8A 1G6AA 1Y4OA 2RL3A 4KG5A 3GRJA 5CGSA 3MZFA 1IYQA 3OPLA 5HAIA 3UNWA 3M2KA 4I3JA 2M1CA 1YSPA 2PD7A 4H8RA 3LEQA 2B5RA 1Z09A 2EFUA 4BJPA 1LI9A 4LV1A 5DTTA 1XPBA 4JKTA 1TF1A 5FAPA 1W79A 1OPXA 2JKFA 3CI6A 2XA7M 1XA7A 4YFMA 3I7JA 3CMZA 5EVID 3ZVTA 3BFEA 1DJAA 2A49A 3UE1A 2YKHA 3VP4A 4DE3A 2KDKA 2GDNA 3EWKA 1KGGA 4RQ9A 3A3EA 4GS9A 2B95A 4DXBA 1K6RA 4IUKA 2K2NA 3ZNYA 1NRFA 2ZC5B 3LYXA 1N9OA 3T4TA 2HDUA 3UB9A 1ES3A 2WADA 1U60A 4X6TA 1DP8A 2P9VA 3EOIA 3NBLA 3CITA 2H10A 3MJQA 4CQHA 1JWVA 3LO7A 5GHZA 1G68A 2IA2A 1IKIA 3BFGA 4CLCE 4U3TA 4E3IA 1VB6A 2V1ZA 3V39A 3VOLA 1L0EA 4KZ5A 5EPHA 1IOUA 4OVDA 3M6BA 4KUOA 1KE4A 3IXHA 3F1PB 4RX2A 4E3NA 1NZOA 1BSGA 2W1TB 4WZ4A 4HY8A 4PHTA 5FQIA 4KQQA 5DKKA 1XP4A 3CPTB 2JKGA 3IT9A 1VHMA 2ZM0A 2VX8A 1VEUA 4PKYA 5FI2A 4GCZA 5TFQA 5I94A 4QPRA 1DRMA 4ZDXA 3O5YA 4N1XA 3A3IA 2BASA 3SZTA 1L0FA 4LLOB 2ZMAA 4DRTA 1BLPA 2L0WA 1UGUA 1Q2PA 4GLQA 3ZG9B 3V5MA 1XGIA 1BLSA 1VETA 1L0GA 5TBMB 3CZDA 3IF6B 4KZ6A 2WGIA 4IVIA 4OOYA 2G2WA 3DAVA 2E8IA 4EUZA 3NY4A 2PHYA 5EE8A 5A93A 1ONHA 5F5YA 4N92A 3P01A 3BY9A 5F1FA 2VV8A 5CHJA 3PHYA 1YLYA 3OLOA 2HJEA 4OOMA 4DKIA 3HUNA 3C38A 4UA9A 4ZJ2A 5GLDA 1SZVA 2EX2A 2PBYA 2WKRA 3Q07A 2PU4A 3UMEA 1CQAA 1FILA 4KG2A 2VGJA 2AVXA 1YMSA 3ZNTA 5J3WA 5KSHA 4HH2A 5CERA 1XJ4A 3VFHA 3HLBA 1OT6A 3MXRA 3QP4A 4YOFA 2JKTM 4K91A 3NC8A 1MBLA 2VZWA 3IXBA 2PU2A 3MS6A 3GR2A 2XK1A 3F1NA 3NIAA 3Q7ZA 4WEKA 3V3SA 4IUHA 4G3VA 2J7VA 4BD0A 3ISGA 3G34A 4S2MA 3G4PA 1GHIA 1SKOB 4OPYA 3G31A 5U47A 2L4RA 4BL2A 4KQOA 2QWSA 1Y28A 4NG2A 3F1OB 2P74A 5F82A 5CTNA 4E04A 3N7WA 1YLJA 4G3KA 2WKPA 4DJ3A 4R1GA 3MKFA 1PI5A 4RA7A 5CEDA 1D7EA 1J3WA 3W4PA 2ZC3B 3LEZA 5IU1A 3B3XA 5FI6A 3S1YA 3W8KA 2VA0A 4JF6A 2B18A 4JGRA 1JWPA 1YSQA 2QJ7A 1T1CA 4HJ6A 5CXWA 4ZTKA 2M7UA 3SS4A 4ETZA 1XKZA 3UPOA 1G6OA 2ZC4B 2G2UA 5DVAA 1NY0A 4F3LA 3D9YA 4BD1A 1H3QA 1NLYA 4D60A 3MQ0A 1NYYA 4GKUA 5FEFA 4MLLA 2HDSA 1MPLA 3E4QA 5HD5A 5I5LA 1YLPA 3T4KA 3FYZA 3MQQA 1M6KA 1GSVA 4N9LA 5HD3A 2KX6A 2HZ5A 2Y55A 2Q9NA 1TS8A 5FASA 2D01A 2C5WB 3HLDA 2NUTC 5G18A 4D2OA 2V20A 3IF6C 3MXQA 3M6HA 4DE0A 2W3HA 1D06A 3F1PA 2QJ5A 3B33A 3OCLA 2C6WB 2W1RA 2W1TA 5A91A 1HTZA 2Y91A 3P98A 2WGVA 3CPTA 3WRZA 3MBZA 4WZ5C 2ZQCA 3HLGA 3UE0A 2O99A 4WL9A 1K0KA 5HZHA 1WYCA 4CPKA 4R38A 1W7FA 5JYOA 2EXBA 2WUQA 4PM8A 4OKPA 1Y54A 5FDHA 5HX9A 2DMWA 3IHAA 1STZA 2J3WA 2H28A 3IXDA 1OTAA 3LR0A 4EBPA 2VGLM 1ES4A 3C4OA 2WKEA 1XJ3A 3ZCZA 2HJ9C 5DJUA 4MN5A 5HFOA 3H82B 4OQGA 3IF6A 2DNSA 4O8GA 2XFTA 4EQIA 5FAQA 1GHPA 3ZQ5A 1A0KA 2V9AA 3FG8A 4GD6A 5JYPA 3UB7A 4X1MA 3PR6A 4Y15A 3SS5A 5HSQA 2H5SA 1KDSA 3KX0X 4WZ5A 4F94A 4MBKA 4GDBA 5M1AA 3BM6A 2J9OA 1TS0A 2Y79A 4M4XA 3GMWA 3N8SA 5TR7A 3WS1A 1XJ2A 5AQBA 2W27A 3S7OA 1PWDA 2Z2MB 3FWLA 2JKRM 3N8LA 3KSIA 4OQIA 1H8MA 1FIKA 2KOIA 3E0YA 4P87A 3C5AA 5HAPA 1LI0A 2M7VA 1N9BA 4QU3A 1MZUA 1C3BA 2Y2MA 4EU0A 3U4LP 3TOIA 3BLSA 1WA9A 1DJCA 1SCWA 2PT7A 4U0XA 2VV6A 5KMWA 3OOVA 3LR3A 3GVBA 1W8QA 3HCYA 1LL8A 1YPRA 4I3AA 4I38A 3F1OA 4CLCB 1KOUA 5GHXA 5FAOA 4BL3A 4L9EA 3AGEA 1XJ6A 3IBRA 4KZ8A 1S4RA 1SHVA 1PYYA 4O7DA 1O07A 2ZQ9A 4P6ZS 3IF5A 1HD8A 3EQUA 2R9XA 1X0OA 2XLNA 4BQMA 1GSXA 1PNEA 2BG1A 5FA7A 3G2YA 1AXBA 4WF0A 3ZYTA 4BMWA 1KVLA 1I2SA 1GA9A 3C7VA 2XFSA 2XRNA 1CEGA 4HEFA 3WRTA 3FV7A 2X71A 4JBFA 1TD5A 5J7EA 3EGDC 4GB7A 4QY6A 4Y0UA 2HF6A 4RYEA 5EECA 3LY3A 1MKIA 1MWTA 3UB5P 3KSFA 4OPZA 3JVUA 1NLZA 1LHYA 3HUMA 2Y4AA 1DJBA 3VSLA 3PXPA 4KZBA 3QNBA 2PD8A 4JGPA 4Y0TA 2ZMFA 3ITAA 5FQQA 2HDRA 1RGYA 1FCMA 1ALQA 2GJ3A 5F6AA 4R3AA 4GDNA 1SDEA 4EW7A 4N1HA 3KYZA 3UMDA 3HBRA 2FZ0A 3IS2B 1NZUA 4M3KA 3TJZC 3O3VA 4JF4A 4NK3A 4QY5A 1IELA 5HWVA 4LV0A 3JPUA 4Q0JA 4ZJ3A 3QP8A 1OTIA 3HLEA 4HJ4A 4FD8A 1T1BA 3HLWA 3G30A 2O0YA 1XFNA 2GNXA 2WGWB 4IHQA 3BQAA 3GDIA 3H82A 5EOOA 2ZOIA 1WYBA 1BUEA 4BBVA 2ZL1B 3DTEA 1GA0A 4GNUA 4EBLA 3GSGA 1IEMA 4PM6A 1V9YA 3ZDJA 4DF6A 3NECA 2O9CA 4R3JA 2WAEA 5A8BA 4YWZA 4AFIA 1L3LA 1W63Q 3VMAA 4P6ZM 1FCNA 3C2WA 3IWIA 5HDDA 2OWHA 3T1RA 5LBRA 3TSGA 4CLCC 1CF0A 5M19A 4X55A 1Z6FA 5DF7A 3UY6A 4R0QA 3HJKA 3T1XA 1S67L 5KZHA 4KZ9A 1S1YA 1OTEA 3QP6A 5L10A 4R23A 4XUZA 4EERA 3GTCA 4HIAA 1RCJA 3MZEA 4E3KA 4LENA 2ZQAA 4R4RA 4S2JA 2WKHA 2JN7A 5IHVA 2EWWA 2K31A 5DTKA 5E2EA 1LSWA 4DDYA 4KZ7A 3PTEA 4P85A 4E3JA 2WYXA 1YM1A 1LL9A 4CLCA 2DRWA 5L07A 1LL5A 3VP3A 3VSKA 5AVFA 4OONA 4NETA 3LFVA 3D72A 1YKDA 2YKFA 3WWXA 4OOLA 1KGFA 5HWWA 1O7EA 5IS1A 1F5MA 1TVFA 2ZQ7A 4Y17A 4WBGA 2HGVA 3VOZA 4BWIA 1OJGA 1K25A 3KYQA 3M2JA 1ZKJA 4PAUA 1SKFA 5AQ7A 4WLAA 4MBHA 4GW9A 2PAVP 3ULFA 3JYIA 2OLUA 3R4KA 1HZOA 4HI4A 2PR5A 3HLFA 3CUEA 3Q7VB 4FSFA 1S66L 3PBNA 3MKEA 4LRYC 4G3WA 4B4XA 5KSCA 1BLCA 4CJNA 3S4XA 4LPZA 2Y2JA 4E6WA 3QP1A 1ZG4A 5IT5A 3E4PA 3LIFA 2QHKA 3D3OA 4E3LA 4FCFA 3LY4A 3R7WB 4Y13A 4X68A 2EFXA 5A90A 1EW0A 3QP5A 3WS5A 3AGFA 1P9WA 3PBQA 3CAXA 2JE5A 4CLCD 4IBXA 1N4OA 4P0MA 4YNRA 2VGLS 3TG9A 4KQDA 5DFYA 2HV1A 3T4QA 1FCOA 5J4EA 4EBNA 4Y3IA 3LIDA 3ZG8B 4WELA 2A3UA 4IEDA 4MN6A 4JXSA 1ONGA 2JKTI 2H0YA 4FH4A 3EEHA 2P08A 3IS2A 4KG6A 3PBTA 1JVJA 3LIAA 4WYYA 3IXGA 1KGEA 4EEPA 2DCFA 1KDWA 4O01A 2R9WA 3WS4A 5CHUA 3NDGA 3PBRA 5HL1A 3NULA 1T18A 2GX5A 3DWKA 3Q82A 4DDSA 5L2FA 2WGWA 3PAEA 4ID4A 1W63M 1NYMA 2EX9A 2QYBA 1TS7A 2W3DA 2PBDP 3S7PA 2ZL1A 1ESUA 4DMZA 2FFFB 4II7A 1F9IA 3EQVA 5EFWA 4RX3A 5BOHA 4K0WA 5CHMA 2Y2LA 3ZG0A 3FZCA 4ZAMA 4OQ0A 2OAQ1 1Q2QA 2HP9A 1CEFA 2GZAA 4UA6A 3EGXC 4OQHA 2ZC6B 5FQMA 4JLFA 2UWXA 2WZZA 3SW1A 5TGFA 4LFUA 2ZQ8A 4EEUA 4EETB 1BZAA 4IJGA 4OH0A 2X02A 4UA7A 1EWZA 4MNRA 2VEAA 5G4YA 5FQJA 3E4OA 1TS6A 2O9BA 2ZQDA 1BLHA 2VJWA 3IX8A 2RCXA 3MFDA 1KE0A 2XF3A 5L8MA 2Y2IA 4EQ1A 3CWFA 3CJMA 3K2NA 1PWCA 3O88A 3MMHA 2IWCA 3UDXA 4KENB 4L9GA 3UO9A 3G6OA 3G35A 4Y2FA 5E2HA 2XD1A 1V9ZA 5M18A 1ZC2A 3N6IA 1ZHHB 5EM1A 4UAAA 5TBMA 3TE8A 5CX7A 1K54A 3Q1FA 2JC7A 2MJ6A 3BFFA 1K57C 1FR6A 3UB6A 1FR1A 1K38A 1BTLA 1K56A 1VQQA 4MCWA 5EVEA 1UWPX 1CJFA 4JXWA 2ZLYA 2Y2PA 2UV0E 1H0MA 3QNCA 2XSSA 1KE3A 3OC2A 5CEBA 1CI9A 4GJ4A 5GHYA 1PZOA 3Q7VA 3RTYA 5KIZA 4OLDA 5E43A 3ZHHA 1T1AA 4ME4A 5HW3A 2WK0A 3A3FA 5HWTA 3E2LA 3W4OA 4I5SA 4HESA 3MXSA 4WN5A 5J8XA 1RGZA 3IH9A 3IWOA 3DWZA 2L1MA 3R7WA 2W3EA 1D1JA 1K57A
chains in the Genus database with same CATH topology
1K4EA 2H0TA 3IF6B 4KZ6A 4GDNA 1SDEA 3FKWA 2WGIA 4N1HA 3UN7A 4IVIA 4OOYA 3HBRA 3BYDA 2HDQA 5HAQA 1NZUA 2G2WA 4BLMA 2E8IA 4EUZA 4M3KA 1XA1A 3NY4A 5EE8A 3A3DA 5A93A 1K54C 3O3VA 1ONHA 3D4FA 3OCNA 4N92A 3OPPA 4JF4A 4NK3A 4QY5A 1IELA 2EX6A 5F1FA 1PW1A 4LV0A 3UPPA 5CHJA 1IYSA 1YLYA 4S2OA 4ZJ3A 3HLEA 4OOMA 4DKIA 3HVFA 3HUNA 4FD8A 4UA9A 4ZJ2A 4XXRA 3HLWA 5GLDA 3G30A 4S2IA 2EX2A 2PBYA 2WGWB 2Z2LB 2PU4A 3Q07A 2J9PA 1K56D 4KZAA 3PBSA 4QD4A 3UE3A 2Y2OA 3BFCA 2VGJA 4KG2A 5EOOA 1WYBA 3W4QA 1BUEA 3PAGA 3IHBA 3RXWA 1PW8A 3VOYA 1YMSA 3BFDA 4C3QA 1GA0A 3ZNTA 5KSHA 4EWFA 2JCHA 5GL9A 3HUOA 4WM9A 1K6SA 4GNUA 4EBLA 3V3RA 3GSGA 4PM5A 1ERQA 5CERA 2XR0A 1IEMA 4PM6A 3VFHA 3ZDJA 4S2NC 4DF6A 3HLBA 4YINA 4R3JA 1ERMA 3CG5A 3MXRA 4R3BA 1YLZA 2WAEA 3GQZA 4K91A 3NC8A 4B88A 2Y2KA 3ZG7B 4Q8IA 1MBLA 3VMAA 1ZG6A 3IXBA 2PU2A 3GR2A 1FCNA 2XK1A 4GN2A 1S0WA 3IWIA 3NIAA 1E3UD 1JTDA 3TSGA 4QB8A 3Q7ZA 4WEKA 2JBFA 4C6YA 3V3SA 4DXCA 2J7VA 3IQAA 1DY6A 4BD0A 5M19A 4X55A 3ISGA 1Z6FA 3G34A 4X53A 4S2MA 3A3JA 3G4PA 1H8YA 4X56A 1GHIA 5DF7A 3UY6A 1L0DA 3DTMA 4R0QA 1I2WA 5A92A 4OPYA 4FH2A 1PI4A 3G31A 2Y2GA 4QJGA 4L0LA 3E2KA 5U47A 2XDMA 5KZHA 4KZ9A 5DTSA 1FSWA 2OLVA 4BL2A 1IKGA 4KQOA 3VP2A 4R23A 4XUZA 4OPQA 3G2ZA 3GTCA 2P74A 1RCJA 3MZEA 4LCLA 5F82A 4KQRA 5CTNA 4R4SA 3HLCA 3G32A 3N7WA 2WAFA 4E3KA 5AQAA 3ZVWA 1YLJA 1TDLA 1TEMA 1EI5A 3BEBA 4LENA 2ZQAA 4R4RA 2XH9A 4S2JA 4R1GA 2WKHA 3MKFA 1PI5A 4MBFA 4RA7A 2P9VB 5IHVA 2V2FF 4S2NA 5CEDA 1I5QA 1YQSA 3W4PA 2ZC3B 5DF9A 3LEZA 3B3XA 5DTKA 5FI6A 5E2EA 3S1YA 3W8KA 4E3OA 4JF6A 4U0TA 4DDYA 2X01A 4WEJA 1K55A 3ZG5A 3SOIA 1JWPA 3PTEA 1KVMA 4KZ7A 4P85A 4E3JA 1BT5A 2WYXA 1YM1A 1LL9A 4JXGA 2DRWA 5CXWA 4ZTKA 3SS4A 1XKZA 3VP0A 3RXXA 3SH9A 1LL5A 3UPOA 5CRFA 2ZC4B 3VP3A 2G2UA 3VSKA 4EV4A 4OONA 1NY0A 5DVAA 4NETA 2ZM8A 4BD1A 4A5RA 1MY8A 3WWXA 4OOLA 1KGFA 1NYYA 1O7EA 4GKUA 5E2FA 4MLLA 1TVFA 2HDSA 2ZQ7A 4WBGA 4LV3A 2Y2QA 2HP5A 4N9KA 3VOZA 1JWZA 1MPLA 3O87A 3ZFZA 2FFYA 1K25A 3M2JA 4UHUA 1YLPA 1ZKJA 3FYZA 1SKFA 5EUAA 5AQ7A 1M6KA 3NCKA 1TDGA 4MBHA 3PBOA 4N9LA 2EXAA 3VFFA 1YT4A 4PPRA 5FQ9A 2Y55A 3JYIA 2OLUA 2Q9NA 5EOEA 1HZOA 1YMXA 5F83A 5EVIC 5FASA 3HLFA 3Q7VB 2C5WB 3HLDA 4FSFA 3PBNA 5G18A 3UDIA 4D2OA 3MKEA 2Y2NA 5CGXA 1W8YA 2V20A 1LLBA 1PWGA 2CC1A 3IF6C 3M6HA 4DE0A 4B4XA 5KSCA 3OCLA 3OZHA 1BLCA 4CJNA 2WZXA 3S4XA 1MXOA 2C6WB 2J8YA 3SH7A 5A91A 2Y2JA 4E6WA 1E4DA 1ZG4A 3FKVA 4ZBEA 3MZDA 1HTZA 2Y91A 4S2KA 4FCFA 4E3LA 4KZ3A 3P98A 1MWRA 2WGVA 3LY4A 2XD5A 3RJUA 3WRZA 4X68A 2EFXA 5A90A 3MBZA 3IWQA 3C4PA 4GZBA 4WZ5C 2ZQCA 3WS5A 3AGFA 4DE2A 2VGKA 3HLGA 3PBQA 4HBTA 4HBUA 3UE0A 1K55C 1W5DA 4OLGA 1WYCA 1FSYA 4CPKA 1W7FA 5JYOA 2EXBA 3QHYA 2JE5A 1MWSA 4IBXA 1N4OA 2ZM2A 2WUQA 3C7UA 4P0MA 3TG9A 5HARA 1CK3A 4PM8A 1E25A 2Q9MA 4OKPA 1Y54A 4Y7PA 5FDHA 5HX9A 4Y0OA 1FCOA 2IWBA 3SS3A 4EBNA 3IHAA 4S2PA 3IXDA 4S2LA 2OSUA 3DW0A 5EVIA 1H8ZA 4EBPA 4LCMA 1ES4A 3ZG8B 3C4OA 1PIOA 2WKEA 3ZCZA 4WELA 5CGWA 2WKIA 2A3UA 4IEDA 4JXSA 1ONGA 5HFOA 2ZC7A 2H0YA 3IF6A 3LCEA 4FH4A 4OQGA 2DNSA 3WS2A 2ZD8A 4KZ4A 2XFTA 4OPRA 1S6RA 4EQIA 5FAQA 1GHPA 4KG6A 2QPNA 3PBTA 4GOGA 1JVJA 4OP5A 4WYYA 5GLCA 3IXGA 5GLBA 1KGEA 3VP1A 3GV9A 5FSRA 3P09A 4WMCA 2DCFA 2QMIA 4GD6A 4E6XA 5JYPA 1KDWA 5GLAA 3O86A 3SS5A 2R9WA 4Z9QA 2EX8A 2I72A 3WS4A 5CHUA 3NDGA 2H5SA 1G6AA 2RL3A 3PBRA 4OP8A 4KG5A 4PM7A 4B4ZA 5HL1A 1KDSA 4WZ5A 3GRJA 4QHCA 4F94A 4MBKA 3DWKA 1YLWA 5CGSA 3Q82A 4DDSA 4GDBA 5L2FA 4PM9A 3MZFA 1IYQA 5D3OA 2WGWA 1PZPA 3PAEA 3OPLA 4ID4A 3BM6A 5HAIA 5M1AA 1ESIA 2J9OA 1NYMA 3Q81A 2EX9A 3M2KA 5EVLA 3UNWA 3SH8A 3V50A 4H8RA 3GMWA 1XX2A 3N8SA 4IVKA 2B5RA 1ESUA 2EFUA 4E3MA 1ES5A 4JF5A 2FFFB 5TR7A 3EQVA 3WS1A 4BJPA 5AQBA 4RX3A 1PWDA 5BOHA 1ES2A 4C75A 2Z2MB 3FWLA 1LI9A 1QMEA 3N8LA 4K0WA 5CHMA 4OQIA 2Y2LA 4LV1A 3ZG0A 5DTTA 4IBRA 3C5AA 4P87A 1XPBA 3IH8A 4JKTA 4X69A 5HAPA 3FZCA 1M40A 1YLTA 5F1GA 4RVAA 5FAPA 1W79A 4ZAMA 1LI0A 4OQ0A 1N9BA 3NDEA 2ZJ9A 3HL9A 4QU3A 1Q2QA 5CTMA 1C3BA 2HP9A 2Y2MA 1CEFA 3TOIA 3BLSA 1XA7A 4ZJ1A 5FI7A 4UA6A 4YFMA 3I7JA 4GD8A 2OV5A 4XUXA 3CMZA 4OQHA 1BULA 2ZC6B 4JLFA 2UWXA 5EVID 5FQMA 3ZVTA 2WZZA 3BFEA 5TGFA 1DJCA 1SCWA 1DJAA 1QMFA 2A49A 2ZQ8A 3UE1A 4U0XA 3VP4A 4DE3A 1CI8A 1XGJA 5FQKA 5KMWA 1BZAA 4OH0A 3GVBA 2GDNA 2X02A 4UA7A 1W8QA 1EWZA 3N8RA 4JXVA 1KGGA 4MNRA 5AQ9A 3A3EA 1H5XA 5FQJA 1SDNA 4DXBA 1K6RA 4LV2A 4WMCD 5GHXA 1NXYA 2IWDA 5FAOA 4BL3A 1WE4A 2ZQDA 5DF8A 3ZNYA 1BLHA 3AGEA 1NRFA 2ZC5B 3N4IA 4BENA 2HDUA 3OPRA 1ES3A 2WADA 2RCXA 3MFDA 1KE0A 2XF3A 1U60A 4KZ8A 2Y59A 4X6TA 2Y2IA 1SHVA 3NI9A 1PYYA 1JTGA 4O7DA 1O07A 3CJMA 2P9VA 4PMAA 1PWCA 3O88A 1GHMA 2ZQ9A 3NBLA 2IWCA 3UDXA 4KENB 2H10A 3HREA 3IF5A 1FOFA 3UO9A 1HD8A 3BECA 3G35A 3EQUA 5E2HA 1JWVA 2XD1A 3LO7A 2R9XA 5M18A 5GHZA 1G68A 2XLNA 1ZC2A 4BQMA 3N6IA 2XEPA 1IKIA 2BG1A 5FA7A 3BFGA 4UAAA 3G2YA 4U3TA 5E2GA 1AXBA 2V1ZA 3V39A 4E3IA 3AGDA 5FATA 1KVLA 3ITBA 4K0XA 1K54A 1I2SA 3Q1FA 1L0EA 2JC7A 1GA9A 4KZ5A 3BFFA 2BLSA 5EPHA 3C7VA 4P6BA 3S22A 3BLMA 1EROA 1IYPA 1K57C 2XFSA 3M6BA 1CEGA 4OVDA 1KE4A 2XGNA 4HEFA 3WRTA 3IXHA 3FV7A 5CECA 2X71A 1FR6A 3OPHA 4JBFA 4RX2A 2XQZA 1NZOA 4E3NA 4DE1A 1FR1A 1K38A 1BTLA 1BSGA 1K56A 1VQQA 4GB7A 4QY6A 4WZ4A 4Y0UA 1K4FA 1GCEA 5FQIA 4JXWA 4KQQA 4RYEA 1L2SA 5EECA 2ZLYA 3LY3A 2Y2PA 1XP4A 3QNCA 1MKIA 1KE3A 1MWTA 3IT9A 1CI9A 3OC2A 5CEBA 5GHYA 2ZM0A 5FI2A 5TFQA 5I94A 3UDFA 1PZOA 4OPZA 3BRMA 4ZDXA 3Q7VA 4OLDA 1LHYA 3HUMA 2Y4AA 1DJBA 3VSLA 1NJ4A 5E43A 3UPNA 1RP5A 4KZBA 3ZHHA 2Y2HA 4N1XA 3A3IA 3QNBA 1J9MA 4MEZA 4DRTA 1L0FA 5HW3A 2ZMAA 1XXMA 4Y0TA 2WK0A 1BLPA 3A3FA 3E2LA 3ITAA 3W4OA 1Q2PA 1E3UA 4HESA 1HVBA 3MXSA 5FQQA 1OMEA 1MWUA 3ZG9B 2HDRA 2HP6A 1RGYA 5J8XA 1IYOA 3V5MA 1XGIA 1FCMA 1BLSA 1RGZA 3IH9A 3IWOA 4JPMA 3DWZA 1VM1A 5EVIB 1L0GA 3ZGAB 1FQGA 2QZ6A 2HPBA 1ALQA 3CZDA 3WS0A 1K57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4E A;  2H0T A;  3IF6 B;  4KZ6 A;  4GDN A;  1SDE A;  3FKW A;  2WGI A;  4N1H A;  3UN7 A;  4IVI A;  4OOY A;  3HBR A;  3BYD A;  2HDQ A;  5HAQ A;  1NZU A;  2G2W A;  4BLM A;  2E8I A;  4EUZ A;  4M3K A;  1XA1 A;  3NY4 A;  5EE8 A;  3A3D A;  5A93 A;  1K54 C;  3O3V A;  1ONH A;  3D4F A;  3OCN A;  4N92 A;  3OPP A;  4JF4 A;  4NK3 A;  4QY5 A;  1IEL A;  2EX6 A;  5F1F A;  1PW1 A;  4LV0 A;  3UPP A;  5CHJ A;  1IYS A;  1YLY A;  4S2O A;  4ZJ3 A;  3HLE A;  4OOM A;  4DKI A;  3HVF A;  3HUN A;  4FD8 A;  4UA9 A;  4ZJ2 A;  4XXR A;  3HLW A;  5GLD A;  3G30 A;  4S2I A;  2EX2 A;  2PBY A;  2WGW B;  2Z2L B;  2PU4 A;  3Q07 A;  2J9P A;  1K56 D;  4KZA A;  3PBS A;  4QD4 A;  3UE3 A;  2Y2O A;  3BFC A;  2VGJ A;  4KG2 A;  5EOO A;  1WYB A;  3W4Q A;  1BUE A;  3PAG A;  3IHB A;  3RXW A;  1PW8 A;  3VOY A;  1YMS A;  3BFD A;  4C3Q A;  1GA0 A;  3ZNT A;  5KSH A;  4EWF A;  2JCH A;  5GL9 A;  3HUO A;  4WM9 A;  1K6S A;  4GNU A;  4EBL A;  3V3R A;  3GSG A;  4PM5 A;  1ERQ A;  5CER A;  2XR0 A;  1IEM A;  4PM6 A;  3VFH A;  3ZDJ A;  4S2N C;  4DF6 A;  3HLB A;  4YIN A;  4R3J A;  1ERM A;  3CG5 A;  3MXR A;  4R3B A;  1YLZ A;  2WAE A;  3GQZ A;  4K91 A;  3NC8 A;  4B88 A;  2Y2K A;  3ZG7 B;  4Q8I A;  1MBL A;  3VMA A;  1ZG6 A;  3IXB A;  2PU2 A;  3GR2 A;  1FCN A;  2XK1 A;  4GN2 A;  1S0W A;  3IWI A;  3NIA A;  1E3U D;  1JTD A;  3TSG A;  4QB8 A;  3Q7Z A;  4WEK A;  2JBF A;  4C6Y A;  3V3S A;  4DXC A;  2J7V A;  3IQA A;  1DY6 A;  4BD0 A;  5M19 A;  4X55 A;  3ISG A;  1Z6F A;  3G34 A;  4X53 A;  4S2M A;  3A3J A;  3G4P A;  1H8Y A;  4X56 A;  1GHI A;  5DF7 A;  3UY6 A;  1L0D A;  3DTM A;  4R0Q A;  1I2W A;  5A92 A;  4OPY A;  4FH2 A;  1PI4 A;  3G31 A;  2Y2G A;  4QJG A;  4L0L A;  3E2K A;  5U47 A;  2XDM A;  5KZH A;  4KZ9 A;  5DTS A;  1FSW A;  2OLV A;  4BL2 A;  1IKG A;  4KQO A;  3VP2 A;  4R23 A;  4XUZ A;  4OPQ A;  3G2Z A;  3GTC A;  2P74 A;  1RCJ A;  3MZE A;  4LCL A;  5F82 A;  4KQR A;  5CTN A;  4R4S A;  3HLC A;  3G32 A;  3N7W A;  2WAF A;  4E3K A;  5AQA A;  3ZVW A;  1YLJ A;  1TDL A;  1TEM A;  1EI5 A;  3BEB A;  4LEN A;  2ZQA A;  4R4R A;  2XH9 A;  4S2J A;  4R1G A;  2WKH A;  3MKF A;  1PI5 A;  4MBF A;  4RA7 A;  2P9V B;  5IHV A;  2V2F F;  4S2N A;  5CED A;  1I5Q A;  1YQS A;  3W4P A;  2ZC3 B;  5DF9 A;  3LEZ A;  3B3X A;  5DTK A;  5FI6 A;  5E2E A;  3S1Y A;  3W8K A;  4E3O A;  4JF6 A;  4U0T A;  4DDY A;  2X01 A;  4WEJ A;  1K55 A;  3ZG5 A;  3SOI A;  1JWP A;  3PTE A;  1KVM A;  4KZ7 A;  4P85 A;  4E3J A;  1BT5 A;  2WYX A;  1YM1 A;  1LL9 A;  4JXG A;  2DRW A;  5CXW A;  4ZTK A;  3SS4 A;  1XKZ A;  3VP0 A;  3RXX A;  3SH9 A;  1LL5 A;  3UPO A;  5CRF A;  2ZC4 B;  3VP3 A;  2G2U A;  3VSK A;  4EV4 A;  4OON A;  1NY0 A;  5DVA A;  4NET A;  2ZM8 A;  4BD1 A;  4A5R A;  1MY8 A;  3WWX A;  4OOL A;  1KGF A;  1NYY A;  1O7E A;  4GKU A;  5E2F A;  4MLL A;  1TVF A;  2HDS A;  2ZQ7 A;  4WBG A;  4LV3 A;  2Y2Q A;  2HP5 A;  4N9K A;  3VOZ A;  1JWZ A;  1MPL A;  3O87 A;  3ZFZ A;  2FFY A;  1K25 A;  3M2J A;  4UHU A;  1YLP A;  1ZKJ A;  3FYZ A;  1SKF A;  5EUA A;  5AQ7 A;  1M6K A;  3NCK A;  1TDG A;  4MBH A;  3PBO A;  4N9L A;  2EXA A;  3VFF A;  1YT4 A;  4PPR A;  5FQ9 A;  2Y55 A;  3JYI A;  2OLU A;  2Q9N A;  5EOE A;  1HZO A;  1YMX A;  5F83 A;  5EVI C;  5FAS A;  3HLF A;  3Q7V B;  2C5W B;  3HLD A;  4FSF A;  3PBN A;  5G18 A;  3UDI A;  4D2O A;  3MKE A;  2Y2N A;  5CGX A;  1W8Y A;  2V20 A;  1LLB A;  1PWG A;  2CC1 A;  3IF6 C;  3M6H A;  4DE0 A;  4B4X A;  5KSC A;  3OCL A;  3OZH A;  1BLC A;  4CJN A;  2WZX A;  3S4X A;  1MXO A;  2C6W B;  2J8Y A;  3SH7 A;  5A91 A;  2Y2J A;  4E6W A;  1E4D A;  1ZG4 A;  3FKV A;  4ZBE A;  3MZD A;  1HTZ A;  2Y91 A;  4S2K A;  4FCF A;  4E3L A;  4KZ3 A;  3P98 A;  1MWR A;  2WGV A;  3LY4 A;  2XD5 A;  3RJU A;  3WRZ A;  4X68 A;  2EFX A;  5A90 A;  3MBZ A;  3IWQ A;  3C4P A;  4GZB A;  4WZ5 C;  2ZQC A;  3WS5 A;  3AGF A;  4DE2 A;  2VGK A;  3HLG A;  3PBQ A;  4HBT A;  4HBU A;  3UE0 A;  1K55 C;  1W5D A;  4OLG A;  1WYC A;  1FSY A;  4CPK A;  1W7F A;  5JYO A;  2EXB A;  3QHY A;  2JE5 A;  1MWS A;  4IBX A;  1N4O A;  2ZM2 A;  2WUQ A;  3C7U A;  4P0M A;  3TG9 A;  5HAR A;  1CK3 A;  4PM8 A;  1E25 A;  2Q9M A;  4OKP A;  1Y54 A;  4Y7P A;  5FDH A;  5HX9 A;  4Y0O A;  1FCO A;  2IWB A;  3SS3 A;  4EBN A;  3IHA A;  4S2P A;  3IXD A;  4S2L A;  2OSU A;  3DW0 A;  5EVI A;  1H8Z A;  4EBP A;  4LCM A;  1ES4 A;  3ZG8 B;  3C4O A;  1PIO A;  2WKE A;  3ZCZ A;  4WEL A;  5CGW A;  2WKI A;  2A3U A;  4IED A;  4JXS A;  1ONG A;  5HFO A;  2ZC7 A;  2H0Y A;  3IF6 A;  3LCE A;  4FH4 A;  4OQG A;  2DNS A;  3WS2 A;  2ZD8 A;  4KZ4 A;  2XFT A;  4OPR A;  1S6R A;  4EQI A;  5FAQ A;  1GHP A;  4KG6 A;  2QPN A;  3PBT A;  4GOG A;  1JVJ A;  4OP5 A;  4WYY A;  5GLC A;  3IXG A;  5GLB A;  1KGE A;  3VP1 A;  3GV9 A;  5FSR A;  3P09 A;  4WMC A;  2DCF A;  2QMI A;  4GD6 A;  4E6X A;  5JYP A;  1KDW A;  5GLA A;  3O86 A;  3SS5 A;  2R9W A;  4Z9Q A;  2EX8 A;  2I72 A;  3WS4 A;  5CHU A;  3NDG A;  2H5S A;  1G6A A;  2RL3 A;  3PBR A;  4OP8 A;  4KG5 A;  4PM7 A;  4B4Z A;  5HL1 A;  1KDS A;  4WZ5 A;  3GRJ A;  4QHC A;  4F94 A;  4MBK A;  3DWK A;  1YLW A;  5CGS A;  3Q82 A;  4DDS A;  4GDB A;  5L2F A;  4PM9 A;  3MZF A;  1IYQ A;  5D3O A;  2WGW A;  1PZP A;  3PAE A;  3OPL A;  4ID4 A;  3BM6 A;  5HAI A;  5M1A A;  1ESI A;  2J9O A;  1NYM A;  3Q81 A;  2EX9 A;  3M2K A;  5EVL A;  3UNW A;  3SH8 A;  3V50 A;  4H8R A;  3GMW A;  1XX2 A;  3N8S A;  4IVK A;  2B5R A;  1ESU A;  2EFU A;  4E3M A;  1ES5 A;  4JF5 A;  2FFF B;  5TR7 A;  3EQV A;  3WS1 A;  4BJP A;  5AQB A;  4RX3 A;  1PWD A;  5BOH A;  1ES2 A;  4C75 A;  2Z2M B;  3FWL A;  1LI9 A;  1QME A;  3N8L A;  4K0W A;  5CHM A;  4OQI A;  2Y2L A;  4LV1 A;  3ZG0 A;  5DTT A;  4IBR A;  3C5A A;  4P87 A;  1XPB A;  3IH8 A;  4JKT A;  4X69 A;  5HAP A;  3FZC A;  1M40 A;  1YLT A;  5F1G A;  4RVA A;  5FAP A;  1W79 A;  4ZAM A;  1LI0 A;  4OQ0 A;  1N9B A;  3NDE A;  2ZJ9 A;  3HL9 A;  4QU3 A;  1Q2Q A;  5CTM A;  1C3B A;  2HP9 A;  2Y2M A;  1CEF A;  3TOI A;  3BLS A;  1XA7 A;  4ZJ1 A;  5FI7 A;  4UA6 A;  4YFM A;  3I7J A;  4GD8 A;  2OV5 A;  4XUX A;  3CMZ A;  4OQH A;  1BUL A;  2ZC6 B;  4JLF A;  2UWX A;  5EVI D;  5FQM A;  3ZVT A;  2WZZ A;  3BFE A;  5TGF A;  1DJC A;  1SCW A;  1DJA A;  1QMF A;  2A49 A;  2ZQ8 A;  3UE1 A;  4U0X A;  3VP4 A;  4DE3 A;  1CI8 A;  1XGJ A;  5FQK A;  5KMW A;  1BZA A;  4OH0 A;  3GVB A;  2GDN A;  2X02 A;  4UA7 A;  1W8Q A;  1EWZ A;  3N8R A;  4JXV A;  1KGG A;  4MNR A;  5AQ9 A;  3A3E A;  1H5X A;  5FQJ A;  1SDN A;  4DXB A;  1K6R A;  4LV2 A;  4WMC D;  5GHX A;  1NXY A;  2IWD A;  5FAO A;  4BL3 A;  1WE4 A;  2ZQD A;  5DF8 A;  3ZNY A;  1BLH A;  3AGE A;  1NRF A;  2ZC5 B;  3N4I A;  4BEN A;  2HDU A;  3OPR A;  1ES3 A;  2WAD A;  2RCX A;  3MFD A;  1KE0 A;  2XF3 A;  1U60 A;  4KZ8 A;  2Y59 A;  4X6T A;  2Y2I A;  1SHV A;  3NI9 A;  1PYY A;  1JTG A;  4O7D A;  1O07 A;  3CJM A;  2P9V A;  4PMA A;  1PWC A;  3O88 A;  1GHM A;  2ZQ9 A;  3NBL A;  2IWC A;  3UDX A;  4KEN B;  2H10 A;  3HRE A;  3IF5 A;  1FOF A;  3UO9 A;  1HD8 A;  3BEC A;  3G35 A;  3EQU A;  5E2H A;  1JWV A;  2XD1 A;  3LO7 A;  2R9X A;  5M18 A;  5GHZ A;  1G68 A;  2XLN A;  1ZC2 A;  4BQM A;  3N6I A;  2XEP A;  1IKI A;  2BG1 A;  5FA7 A;  3BFG A;  4UAA A;  3G2Y A;  4U3T A;  5E2G A;  1AXB A;  2V1Z A;  3V39 A;  4E3I A;  3AGD A;  5FAT A;  1KVL A;  3ITB A;  4K0X A;  1K54 A;  1I2S A;  3Q1F A;  1L0E A;  2JC7 A;  1GA9 A;  4KZ5 A;  3BFF A;  2BLS A;  5EPH A;  3C7V A;  4P6B A;  3S22 A;  3BLM A;  1ERO A;  1IYP A;  1K57 C;  2XFS A;  3M6B A;  1CEG A;  4OVD A;  1KE4 A;  2XGN A;  4HEF A;  3WRT A;  3IXH A;  3FV7 A;  5CEC A;  2X71 A;  1FR6 A;  3OPH A;  4JBF A;  4RX2 A;  2XQZ A;  1NZO A;  4E3N A;  4DE1 A;  1FR1 A;  1K38 A;  1BTL A;  1BSG A;  1K56 A;  1VQQ A;  4GB7 A;  4QY6 A;  4WZ4 A;  4Y0U A;  1K4F A;  1GCE A;  5FQI A;  4JXW A;  4KQQ A;  4RYE A;  1L2S A;  5EEC A;  2ZLY A;  3LY3 A;  2Y2P A;  1XP4 A;  3QNC A;  1MKI A;  1KE3 A;  1MWT A;  3IT9 A;  1CI9 A;  3OC2 A;  5CEB A;  5GHY A;  2ZM0 A;  5FI2 A;  5TFQ A;  5I94 A;  3UDF A;  1PZO A;  4OPZ A;  3BRM A;  4ZDX A;  3Q7V A;  4OLD A;  1LHY A;  3HUM A;  2Y4A A;  1DJB A;  3VSL A;  1NJ4 A;  5E43 A;  3UPN A;  1RP5 A;  4KZB A;  3ZHH A;  2Y2H A;  4N1X A;  3A3I A;  3QNB A;  1J9M A;  4MEZ A;  4DRT A;  1L0F A;  5HW3 A;  2ZMA A;  1XXM A;  4Y0T A;  2WK0 A;  1BLP A;  3A3F A;  3E2L A;  3ITA A;  3W4O A;  1Q2P A;  1E3U A;  4HES A;  1HVB A;  3MXS A;  5FQQ A;  1OME A;  1MWU A;  3ZG9 B;  2HDR A;  2HP6 A;  1RGY A;  5J8X A;  1IYO A;  3V5M A;  1XGI A;  1FCM A;  1BLS A;  1RGZ A;  3IH9 A;  3IWO A;  4JPM A;  3DWZ A;  1VM1 A;  5EVI B;  1L0G A;  3ZGA B;  1FQG A;  2QZ6 A;  2HPB A;  1ALQ A;  3CZD A;  3WS0 A;  1K57 A; 
#chains in the Genus database with same CATH topology
 2H0T A;  4FOF A;  3DTI A;  3CHW P;  3FKW A;  2XRO A;  3T1Q B;  5HAQ A;  1XA1 A;  3A3D A;  5EM0 A;  3NOU C;  3VE3 A;  3VE4 A;  1P9R A;  4HHD A;  1MKM A;  2EWV A;  1SKO A;  3IBJ A;  1PW1 A;  2QKP A;  2JKR I;  3HVF A;  5HDC A;  1S1Z A;  4S2I A;  2KLI A;  4KZA A;  1K56 D;  4GHI B;  4FTX A;  3BFC A;  5K5B A;  1PFL A;  3IHB A;  3RXW A;  1PW8 A;  3VOY A;  3W2Z A;  1NWZ A;  4EWF A;  2JCH A;  5GL9 A;  4WM9 A;  1K6S A;  4HQA A;  3V3R A;  4PM5 A;  1OTB A;  2XR0 A;  4S2N C;  4YIN A;  1ERM A;  4R3B A;  5MC7 A;  4LGW A;  3NJA A;  3NHQ A;  3GQZ A;  3A0R A;  1N9L A;  4B88 A;  3ZG7 B;  4Q8I A;  4GN2 A;  1S0W A;  3LIB A;  4QB8 A;  1S4S A;  2O9A A;  2JBF A;  1OTD A;  3T4O A;  2V0W A;  3IQA A;  4KUK A;  3A3J A;  1H8Y A;  2V8C A;  1ACF A;  1I2W A;  4FH2 A;  4NXE A;  1PI4 A;  2Y2G A;  4QJG A;  4L0L A;  5DTS A;  4BBT A;  1FSW A;  2OLV A;  3KSH A;  4X1L A;  4KQR A;  3HLC A;  3G32 A;  2WAF A;  2K7S A;  5AQA A;  1TEM A;  1EI5 A;  5HPI A;  4MBF A;  4S2N A;  1I5Q A;  2B02 A;  2PRF A;  3DBA A;  4UQI M;  3T4J A;  5DF9 A;  3T4S A;  3L7H A;  4U0T A;  2X01 A;  4WEJ A;  1K55 A;  3SOI A;  2INW A;  3LIC A;  3F1N B;  3VP0 A;  4HH3 A;  5CRF A;  2VK3 A;  3A0S A;  4A5R A;  1MY8 A;  4Q0I A;  2PYP A;  1OT9 A;  4LV3 A;  2HP5 A;  1JWZ A;  3O87 A;  4B93 A;  2FFY A;  5FEG A;  2P04 A;  4ESP A;  5EUA A;  3NCK A;  1TDG A;  4XT2 B;  3VFF A;  4PPR A;  5EOE A;  1YMX A;  5F83 A;  2V8F A;  3UDI A;  4LRZ E;  2A2L A;  1LLB A;  2CC1 A;  4ETX A;  4Y5F A;  3U2A A;  2WZX A;  1MXO A;  2J8Y A;  3SH7 A;  4Z1W A;  3MZD A;  4S2K A;  1MWR A;  2XD5 A;  4R6L A;  4F3L B;  3IWQ A;  1LSV A;  3C4P A;  4GZB A;  4O0P A;  2VGK A;  1W5D A;  2PDR A;  1FSY A;  3QHY A;  3H7W B;  3C7U A;  1CK3 A;  1E25 A;  2Q9M A;  5HL6 A;  4JGO A;  2OOL A;  4Y0O A;  3T50 A;  4NXB A;  3C8C A;  4S2P A;  3T4L A;  4S2L A;  2OSU A;  3DW0 A;  1H8Z A;  4LCM A;  4QWO A;  3MFX A;  5CGW A;  2WKI A;  5C5K A;  2PR6 A;  1G5U A;  3DTK A;  3WS2 A;  2ZD8 A;  4KZ4 A;  2D02 A;  2G7U A;  4I39 A;  4LRX C;  5FSR A;  3P09 A;  4WMC A;  4E6X A;  3T1S A;  5GLA A;  3CUE C;  2I72 A;  4OP8 A;  4PM7 A;  4B4Z A;  1ODV A;  4QHC A;  3LGO A;  1YLW A;  4PM9 A;  2FH5 A;  1F98 A;  5D3O A;  1PZP A;  2Q0O A;  2EA9 A;  1ESI A;  3Q81 A;  5EVL A;  4GHI A;  3RFB A;  3SH8 A;  3V50 A;  4IVK A;  1XX2 A;  4E3M A;  1ES5 A;  4JF5 A;  3FC7 A;  2OAP 1;  4ARZ B;  3UE6 A;  1XFQ A;  1ES2 A;  5TJJ A;  4C75 A;  1QME A;  2ZOH A;  3FPW A;  2W3G A;  3NOT C;  3P7N A;  4IBR A;  3IH8 A;  2W0N A;  2PYR A;  4X69 A;  1M40 A;  1YLT A;  4HP9 A;  5F1G A;  2J3T C;  4RVA A;  1ZTU A;  3NDE A;  2ZJ9 A;  3BWL A;  3HL9 A;  3TRC A;  3C30 A;  5CTM A;  4K08 A;  4ZJ1 A;  5FI7 A;  4GD8 A;  2OV5 A;  4XUX A;  1BUL A;  1QMF A;  3BJN A;  2I9V A;  3GEC A;  1YAX A;  1CI8 A;  1XGJ A;  5FQK A;  5HPF A;  3N8R A;  4JXV A;  5AQ9 A;  1H5X A;  2V0U A;  1SDN A;  4LV2 A;  4WMC D;  1NXY A;  2IWD A;  4L9F A;  1WE4 A;  5DF8 A;  3FPV A;  3N4I A;  4BEN A;  3OPR A;  4H6J B;  3K3D A;  2Y59 A;  2OWJ A;  3NI9 A;  1PRQ A;  1JTG A;  4PMA A;  4BBU A;  1GHM A;  2VV7 A;  1IFQ A;  2ZBB A;  3HJI A;  3HRE A;  1FOF A;  3BEC A;  3A0V A;  2A24 B;  3KYE A;  3NOP C;  2XEP A;  5AJG A;  4NEE D;  5E2G A;  3AGD A;  5FAT A;  3ITB A;  4K0X A;  2CMN A;  1AWI A;  5DJT A;  2BLS A;  4P6B A;  3S22 A;  3BLM A;  1ERO A;  1IYP A;  5AVE A;  2LB5 A;  2XGN A;  5CEC A;  3OPH A;  4NXG A;  2XQZ A;  3E98 A;  4DE1 A;  1K4F A;  1GCE A;  4B9O A;  1L2S A;  4XT2 A;  3KO6 A;  2V1B A;  3UDF A;  3BRM A;  4EUV A;  4JGQ A;  2BTF P;  1NJ4 A;  4MMN A;  3UPN A;  1RP5 A;  2Y2H A;  4PKY G;  2LB9 A;  1J9M A;  4MEZ A;  1DP6 A;  1XXM A;  1P97 A;  4NXF A;  1E3U A;  1LT0 A;  1HVB A;  1OME A;  1MWU A;  4EXO A;  2HP6 A;  1IYO A;  4JPM A;  5EVI B;  1VM1 A;  3ZGA B;  1FQG A;  2QZ6 A;  2HPB A;  4R70 A;  1BYW A;  3WS0 A;  2J3T D;  2JHE A;  1K4E A;  3UN7 A;  3BYD A;  2HDQ A;  4BLM A;  3BQ8 A;  4HJ3 A;  3LUQ A;  3H7W A;  1K54 C;  3D4F A;  3OCN A;  3OPP A;  3QP2 A;  2Y8H A;  2EX6 A;  3UPP A;  1IYS A;  3IX3 A;  3B47 A;  4S2O A;  4WUJ A;  4XXR A;  1JNU A;  2Z2L B;  4I3I A;  2J9P A;  3PBS A;  4QD4 A;  3UE3 A;  1P0Z A;  2Y2O A;  2P7J A;  5F69 A;  3W4Q A;  5EV0 A;  3PAG A;  1NRJ A;  5HDS A;  3BFD A;  4C3Q A;  4NKP A;  3HUO A;  3LR4 A;  1OJ5 A;  1ERQ A;  2J80 A;  5G4Z A;  3CG5 A;  2R78 A;  1YLZ A;  3PYP A;  1G28 A;  2Y2K A;  1ZG6 A;  3ICY A;  1E3U D;  1JTD A;  4EES A;  2V1A A;  2ZMV A;  3H9W A;  4C6Y A;  4DXC A;  3UB8 A;  1DY6 A;  4ARZ A;  4X53 A;  1N9N A;  3MQO A;  4X56 A;  1L0D A;  3DTM A;  5A92 A;  5FL3 A;  3E2K A;  2XDM A;  1IKG A;  3VP2 A;  3K3C A;  4GS9 B;  4OPQ A;  3G2Z A;  2VKS A;  4LCL A;  3MF0 A;  4R4S A;  3LI9 A;  2NUP C;  1T19 A;  4UQI S;  3ZVW A;  1TDL A;  1MC0 A;  3BEB A;  2XH9 A;  2P9V B;  2V2F F;  1YQS A;  5L09 A;  2W3F A;  3OBF A;  2E8J A;  3T12 B;  4E3O A;  3TW8 A;  3ZG5 A;  1KVM A;  1BT5 A;  4JXG A;  1F2K A;  4MN7 A;  3RXX A;  3SH9 A;  2VLG A;  4EV4 A;  1GSW A;  3S7Q A;  2ZM8 A;  3BW6 A;  4H6J A;  4HOI A;  2WKQ A;  4ZRR A;  4Q0H A;  4DJ2 A;  5E2F A;  2Y2Q A;  4N9K A;  3BY8 A;  2A24 A;  3ZFZ A;  2XA7 S;  4UHU A;  3S7N A;  3B42 A;  3CLO A;  3PBO A;  2EXA A;  4DN0 A;  1YT4 A;  5FQ9 A;  1VEU B;  5EVI C;  2Z6D A;  2Y2N A;  2Z6C A;  5CGX A;  1W8Y A;  1PWG A;  4X25 A;  3OZH A;  4HP4 A;  1E4D A;  3FKV A;  4ZBE A;  4FUW A;  1VET B;  4HNB A;  4KZ3 A;  5DKL A;  3RJU A;  3VV4 A;  4DE2 A;  4HBU A;  4HBT A;  1K55 C;  3JVV A;  4OLG A;  1HLU P;  5F68 A;  1LSX A;  3MSH A;  1MWS A;  3MR0 A;  3LR5 A;  2ZM2 A;  5HAR A;  4Y7P A;  2IWB A;  3SS3 A;  3RH8 B;  1UWN X;  3KSG A;  5EVI A;  1PIO A;  3V67 A;  2ZC7 A;  3LCE A;  4UEY A;  3LI8 A;  4OPR A;  1S6R A;  3LIE A;  2ACG A;  3L9K A;  5GLC A;  2QPN A;  4GOG A;  4OP5 A;  1DP9 A;  5FDS A;  3VP1 A;  5GLB A;  3EEA A;  3GV9 A;  2QMI A;  4MDZ A;  3IX4 A;  3O86 A;  5DFX A;  4Z9Q A;  2EX8 A;  1G6A A;  1Y4O A;  2RL3 A;  4KG5 A;  3GRJ A;  5CGS A;  3MZF A;  1IYQ A;  3OPL A;  5HAI A;  3UNW A;  3M2K A;  4I3J A;  2M1C A;  1YSP A;  2PD7 A;  4H8R A;  3LEQ A;  2B5R A;  1Z09 A;  2EFU A;  4BJP A;  1LI9 A;  4LV1 A;  5DTT A;  1XPB A;  4JKT A;  1TF1 A;  5FAP A;  1W79 A;  1OPX A;  2JKF A;  3CI6 A;  2XA7 M;  1XA7 A;  4YFM A;  3I7J A;  3CMZ A;  5EVI D;  3ZVT A;  3BFE A;  1DJA A;  2A49 A;  3UE1 A;  2YKH A;  3VP4 A;  4DE3 A;  2KDK A;  2GDN A;  3EWK A;  1KGG A;  4RQ9 A;  3A3E A;  4GS9 A;  2B95 A;  4DXB A;  1K6R A;  4IUK A;  2K2N A;  3ZNY A;  1NRF A;  2ZC5 B;  3LYX A;  1N9O A;  3T4T A;  2HDU A;  3UB9 A;  1ES3 A;  2WAD A;  1U60 A;  4X6T A;  1DP8 A;  2P9V A;  3EOI A;  3NBL A;  3CIT A;  2H10 A;  3MJQ A;  4CQH A;  1JWV A;  3LO7 A;  5GHZ A;  1G68 A;  2IA2 A;  1IKI A;  3BFG A;  4CLC E;  4U3T A;  4E3I A;  1VB6 A;  2V1Z A;  3V39 A;  3VOL A;  1L0E A;  4KZ5 A;  5EPH A;  1IOU A;  4OVD A;  3M6B A;  4KUO A;  1KE4 A;  3IXH A;  3F1P B;  4RX2 A;  4E3N A;  1NZO A;  1BSG A;  2W1T B;  4WZ4 A;  4HY8 A;  4PHT A;  5FQI A;  4KQQ A;  5DKK A;  1XP4 A;  3CPT B;  2JKG A;  3IT9 A;  1VHM A;  2ZM0 A;  2VX8 A;  1VEU A;  4PKY A;  5FI2 A;  4GCZ A;  5TFQ A;  5I94 A;  4QPR A;  1DRM A;  4ZDX A;  3O5Y A;  4N1X A;  3A3I A;  2BAS A;  3SZT A;  1L0F A;  4LLO B;  2ZMA A;  4DRT A;  1BLP A;  2L0W A;  1UGU A;  1Q2P A;  4GLQ A;  3ZG9 B;  3V5M A;  1XGI A;  1BLS A;  1VET A;  1L0G A;  5TBM B;  3CZD A;  3IF6 B;  4KZ6 A;  2WGI A;  4IVI A;  4OOY A;  2G2W A;  3DAV A;  2E8I A;  4EUZ A;  3NY4 A;  2PHY A;  5EE8 A;  5A93 A;  1ONH A;  5F5Y A;  4N92 A;  3P01 A;  3BY9 A;  5F1F A;  2VV8 A;  5CHJ A;  3PHY A;  1YLY A;  3OLO A;  2HJE A;  4OOM A;  4DKI A;  3HUN A;  3C38 A;  4UA9 A;  4ZJ2 A;  5GLD A;  1SZV A;  2EX2 A;  2PBY A;  2WKR A;  3Q07 A;  2PU4 A;  3UME A;  1CQA A;  1FIL A;  4KG2 A;  2VGJ A;  2AVX A;  1YMS A;  3ZNT A;  5J3W A;  5KSH A;  4HH2 A;  5CER A;  1XJ4 A;  3VFH A;  3HLB A;  1OT6 A;  3MXR A;  3QP4 A;  4YOF A;  2JKT M;  4K91 A;  3NC8 A;  1MBL A;  2VZW A;  3IXB A;  2PU2 A;  3MS6 A;  3GR2 A;  2XK1 A;  3F1N A;  3NIA A;  3Q7Z A;  4WEK A;  3V3S A;  4IUH A;  4G3V A;  2J7V A;  4BD0 A;  3ISG A;  3G34 A;  4S2M A;  3G4P A;  1GHI A;  1SKO B;  4OPY A;  3G31 A;  5U47 A;  2L4R A;  4BL2 A;  4KQO A;  2QWS A;  1Y28 A;  4NG2 A;  3F1O B;  2P74 A;  5F82 A;  5CTN A;  4E04 A;  3N7W A;  1YLJ A;  4G3K A;  2WKP A;  4DJ3 A;  4R1G A;  3MKF A;  1PI5 A;  4RA7 A;  5CED A;  1D7E A;  1J3W A;  3W4P A;  2ZC3 B;  3LEZ A;  5IU1 A;  3B3X A;  5FI6 A;  3S1Y A;  3W8K A;  2VA0 A;  4JF6 A;  2B18 A;  4JGR A;  1JWP A;  1YSQ A;  2QJ7 A;  1T1C A;  4HJ6 A;  5CXW A;  4ZTK A;  2M7U A;  3SS4 A;  4ETZ A;  1XKZ A;  3UPO A;  1G6O A;  2ZC4 B;  2G2U A;  5DVA A;  1NY0 A;  4F3L A;  3D9Y A;  4BD1 A;  1H3Q A;  1NLY A;  4D60 A;  3MQ0 A;  1NYY A;  4GKU A;  5FEF A;  4MLL A;  2HDS A;  1MPL A;  3E4Q A;  5HD5 A;  5I5L A;  1YLP A;  3T4K A;  3FYZ A;  3MQQ A;  1M6K A;  1GSV A;  4N9L A;  5HD3 A;  2KX6 A;  2HZ5 A;  2Y55 A;  2Q9N A;  1TS8 A;  5FAS A;  2D01 A;  2C5W B;  3HLD A;  2NUT C;  5G18 A;  4D2O A;  2V20 A;  3IF6 C;  3MXQ A;  3M6H A;  4DE0 A;  2W3H A;  1D06 A;  3F1P A;  2QJ5 A;  3B33 A;  3OCL A;  2C6W B;  2W1R A;  2W1T A;  5A91 A;  1HTZ A;  2Y91 A;  3P98 A;  2WGV A;  3CPT A;  3WRZ A;  3MBZ A;  4WZ5 C;  2ZQC A;  3HLG A;  3UE0 A;  2O99 A;  4WL9 A;  1K0K A;  5HZH A;  1WYC A;  4CPK A;  4R38 A;  1W7F A;  5JYO A;  2EXB A;  2WUQ A;  4PM8 A;  4OKP A;  1Y54 A;  5FDH A;  5HX9 A;  2DMW A;  3IHA A;  1STZ A;  2J3W A;  2H28 A;  3IXD A;  1OTA A;  3LR0 A;  4EBP A;  2VGL M;  1ES4 A;  3C4O A;  2WKE A;  1XJ3 A;  3ZCZ A;  2HJ9 C;  5DJU A;  4MN5 A;  5HFO A;  3H82 B;  4OQG A;  3IF6 A;  2DNS A;  4O8G A;  2XFT A;  4EQI A;  5FAQ A;  1GHP A;  3ZQ5 A;  1A0K A;  2V9A A;  3FG8 A;  4GD6 A;  5JYP A;  3UB7 A;  4X1M A;  3PR6 A;  4Y15 A;  3SS5 A;  5HSQ A;  2H5S A;  1KDS A;  3KX0 X;  4WZ5 A;  4F94 A;  4MBK A;  4GDB A;  5M1A A;  3BM6 A;  2J9O A;  1TS0 A;  2Y79 A;  4M4X A;  3GMW A;  3N8S A;  5TR7 A;  3WS1 A;  1XJ2 A;  5AQB A;  2W27 A;  3S7O A;  1PWD A;  2Z2M B;  3FWL A;  2JKR M;  3N8L A;  3KSI A;  4OQI A;  1H8M A;  1FIK A;  2KOI A;  3E0Y A;  4P87 A;  3C5A A;  5HAP A;  1LI0 A;  2M7V A;  1N9B A;  4QU3 A;  1MZU A;  1C3B A;  2Y2M A;  4EU0 A;  3U4L P;  3TOI A;  3BLS A;  1WA9 A;  1DJC A;  1SCW A;  2PT7 A;  4U0X A;  2VV6 A;  5KMW A;  3OOV A;  3LR3 A;  3GVB A;  1W8Q A;  3HCY A;  1LL8 A;  1YPR A;  4I3A A;  4I38 A;  3F1O A;  4CLC B;  1KOU A;  5GHX A;  5FAO A;  4BL3 A;  4L9E A;  3AGE A;  1XJ6 A;  3IBR A;  4KZ8 A;  1S4R A;  1SHV A;  1PYY A;  4O7D A;  1O07 A;  2ZQ9 A;  4P6Z S;  3IF5 A;  1HD8 A;  3EQU A;  2R9X A;  1X0O A;  2XLN A;  4BQM A;  1GSX A;  1PNE A;  2BG1 A;  5FA7 A;  3G2Y A;  1AXB A;  4WF0 A;  3ZYT A;  4BMW A;  1KVL A;  1I2S A;  1GA9 A;  3C7V A;  2XFS A;  2XRN A;  1CEG A;  4HEF A;  3WRT A;  3FV7 A;  2X71 A;  4JBF A;  1TD5 A;  5J7E A;  3EGD C;  4GB7 A;  4QY6 A;  4Y0U A;  2HF6 A;  4RYE A;  5EEC A;  3LY3 A;  1MKI A;  1MWT A;  3UB5 P;  3KSF A;  4OPZ A;  3JVU A;  1NLZ A;  1LHY A;  3HUM A;  2Y4A A;  1DJB A;  3VSL A;  3PXP A;  4KZB A;  3QNB A;  2PD8 A;  4JGP A;  4Y0T A;  2ZMF A;  3ITA A;  5FQQ A;  2HDR A;  1RGY A;  1FCM A;  1ALQ A;  2GJ3 A;  5F6A A;  4R3A A;  4GDN A;  1SDE A;  4EW7 A;  4N1H A;  3KYZ A;  3UMD A;  3HBR A;  2FZ0 A;  3IS2 B;  1NZU A;  4M3K A;  3TJZ C;  3O3V A;  4JF4 A;  4NK3 A;  4QY5 A;  1IEL A;  5HWV A;  4LV0 A;  3JPU A;  4Q0J A;  4ZJ3 A;  3QP8 A;  1OTI A;  3HLE A;  4HJ4 A;  4FD8 A;  1T1B A;  3HLW A;  3G30 A;  2O0Y A;  1XFN A;  2GNX A;  2WGW B;  4IHQ A;  3BQA A;  3GDI A;  3H82 A;  5EOO A;  2ZOI A;  1WYB A;  1BUE A;  4BBV A;  2ZL1 B;  3DTE A;  1GA0 A;  4GNU A;  4EBL A;  3GSG A;  1IEM A;  4PM6 A;  1V9Y A;  3ZDJ A;  4DF6 A;  3NEC A;  2O9C A;  4R3J A;  2WAE A;  5A8B A;  4YWZ A;  4AFI A;  1L3L A;  1W63 Q;  3VMA A;  4P6Z M;  1FCN A;  3C2W A;  3IWI A;  5HDD A;  2OWH A;  3T1R A;  5LBR A;  3TSG A;  4CLC C;  1CF0 A;  5M19 A;  4X55 A;  1Z6F A;  5DF7 A;  3UY6 A;  4R0Q A;  3HJK A;  3T1X A;  1S67 L;  5KZH A;  4KZ9 A;  1S1Y A;  1OTE A;  3QP6 A;  5L10 A;  4R23 A;  4XUZ A;  4EER A;  3GTC A;  4HIA A;  1RCJ A;  3MZE A;  4E3K A;  4LEN A;  2ZQA A;  4R4R A;  4S2J A;  2WKH A;  2JN7 A;  5IHV A;  2EWW A;  2K31 A;  5DTK A;  5E2E A;  1LSW A;  4DDY A;  4KZ7 A;  3PTE A;  4P85 A;  4E3J A;  2WYX A;  1YM1 A;  1LL9 A;  4CLC A;  2DRW A;  5L07 A;  1LL5 A;  3VP3 A;  3VSK A;  5AVF A;  4OON A;  4NET A;  3LFV A;  3D72 A;  1YKD A;  2YKF A;  3WWX A;  4OOL A;  1KGF A;  5HWW A;  1O7E A;  5IS1 A;  1F5M A;  1TVF A;  2ZQ7 A;  4Y17 A;  4WBG A;  2HGV A;  3VOZ A;  4BWI A;  1OJG A;  1K25 A;  3KYQ A;  3M2J A;  1ZKJ A;  4PAU A;  1SKF A;  5AQ7 A;  4WLA A;  4MBH A;  4GW9 A;  2PAV P;  3ULF A;  3JYI A;  2OLU A;  3R4K A;  1HZO A;  4HI4 A;  2PR5 A;  3HLF A;  3CUE A;  3Q7V B;  4FSF A;  1S66 L;  3PBN A;  3MKE A;  4LRY C;  4G3W A;  4B4X A;  5KSC A;  1BLC A;  4CJN A;  3S4X A;  4LPZ A;  2Y2J A;  4E6W A;  3QP1 A;  1ZG4 A;  5IT5 A;  3E4P A;  3LIF A;  2QHK A;  3D3O A;  4E3L A;  4FCF A;  3LY4 A;  3R7W B;  4Y13 A;  4X68 A;  2EFX A;  5A90 A;  1EW0 A;  3QP5 A;  3WS5 A;  3AGF A;  1P9W A;  3PBQ A;  3CAX A;  2JE5 A;  4CLC D;  4IBX A;  1N4O A;  4P0M A;  4YNR A;  2VGL S;  3TG9 A;  4KQD A;  5DFY A;  2HV1 A;  3T4Q A;  1FCO A;  5J4E A;  4EBN A;  4Y3I A;  3LID A;  3ZG8 B;  4WEL A;  2A3U A;  4IED A;  4MN6 A;  4JXS A;  1ONG A;  2JKT I;  2H0Y A;  4FH4 A;  3EEH A;  2P08 A;  3IS2 A;  4KG6 A;  3PBT A;  1JVJ A;  3LIA A;  4WYY A;  3IXG A;  1KGE A;  4EEP A;  2DCF A;  1KDW A;  4O01 A;  2R9W A;  3WS4 A;  5CHU A;  3NDG A;  3PBR A;  5HL1 A;  3NUL A;  1T18 A;  2GX5 A;  3DWK A;  3Q82 A;  4DDS A;  5L2F A;  2WGW A;  3PAE A;  4ID4 A;  1W63 M;  1NYM A;  2EX9 A;  2QYB A;  1TS7 A;  2W3D A;  2PBD P;  3S7P A;  2ZL1 A;  1ESU A;  4DMZ A;  2FFF B;  4II7 A;  1F9I A;  3EQV A;  5EFW A;  4RX3 A;  5BOH A;  4K0W A;  5CHM A;  2Y2L A;  3ZG0 A;  3FZC A;  4ZAM A;  4OQ0 A;  2OAQ 1;  1Q2Q A;  2HP9 A;  1CEF A;  2GZA A;  4UA6 A;  3EGX C;  4OQH A;  2ZC6 B;  5FQM A;  4JLF A;  2UWX A;  2WZZ A;  3SW1 A;  5TGF A;  4LFU A;  2ZQ8 A;  4EEU A;  4EET B;  1BZA A;  4IJG A;  4OH0 A;  2X02 A;  4UA7 A;  1EWZ A;  4MNR A;  2VEA A;  5G4Y A;  5FQJ A;  3E4O A;  1TS6 A;  2O9B A;  2ZQD A;  1BLH A;  2VJW A;  3IX8 A;  2RCX A;  3MFD A;  1KE0 A;  2XF3 A;  5L8M A;  2Y2I A;  4EQ1 A;  3CWF A;  3CJM A;  3K2N A;  1PWC A;  3O88 A;  3MMH A;  2IWC A;  3UDX A;  4KEN B;  4L9G A;  3UO9 A;  3G6O A;  3G35 A;  4Y2F A;  5E2H A;  2XD1 A;  1V9Z A;  5M18 A;  1ZC2 A;  3N6I A;  1ZHH B;  5EM1 A;  4UAA A;  5TBM A;  3TE8 A;  5CX7 A;  1K54 A;  3Q1F A;  2JC7 A;  2MJ6 A;  3BFF A;  1K57 C;  1FR6 A;  3UB6 A;  1FR1 A;  1K38 A;  1BTL A;  1K56 A;  1VQQ A;  4MCW A;  5EVE A;  1UWP X;  1CJF A;  4JXW A;  2ZLY A;  2Y2P A;  2UV0 E;  1H0M A;  3QNC A;  2XSS A;  1KE3 A;  3OC2 A;  5CEB A;  1CI9 A;  4GJ4 A;  5GHY A;  1PZO A;  3Q7V A;  3RTY A;  5KIZ A;  4OLD A;  5E43 A;  3ZHH A;  1T1A A;  4ME4 A;  5HW3 A;  2WK0 A;  3A3F A;  5HWT A;  3E2L A;  3W4O A;  4I5S A;  4HES A;  3MXS A;  4WN5 A;  5J8X A;  1RGZ A;  3IH9 A;  3IWO A;  3DWZ A;  2L1M A;  3R7W A;  2W3E A;  1D1J A;  1K57 A; 
#chains in the Genus database with same CATH homology
 1K4E A;  2H0T A;  3IF6 B;  4KZ6 A;  4GDN A;  1SDE A;  3FKW A;  2WGI A;  4N1H A;  3UN7 A;  4IVI A;  4OOY A;  3HBR A;  3BYD A;  2HDQ A;  5HAQ A;  1NZU A;  2G2W A;  4BLM A;  2E8I A;  4EUZ A;  4M3K A;  1XA1 A;  3NY4 A;  5EE8 A;  3A3D A;  5A93 A;  1K54 C;  3O3V A;  1ONH A;  3D4F A;  3OCN A;  4N92 A;  3OPP A;  4JF4 A;  4NK3 A;  4QY5 A;  1IEL A;  2EX6 A;  5F1F A;  1PW1 A;  4LV0 A;  3UPP A;  5CHJ A;  1IYS A;  1YLY A;  4S2O A;  4ZJ3 A;  3HLE A;  4OOM A;  4DKI A;  3HVF A;  3HUN A;  4FD8 A;  4UA9 A;  4ZJ2 A;  4XXR A;  3HLW A;  5GLD A;  3G30 A;  4S2I A;  2EX2 A;  2PBY A;  2WGW B;  2Z2L B;  2PU4 A;  3Q07 A;  2J9P A;  1K56 D;  4KZA A;  3PBS A;  4QD4 A;  3UE3 A;  2Y2O A;  3BFC A;  2VGJ A;  4KG2 A;  5EOO A;  1WYB A;  3W4Q A;  1BUE A;  3PAG A;  3IHB A;  3RXW A;  1PW8 A;  3VOY A;  1YMS A;  3BFD A;  4C3Q A;  1GA0 A;  3ZNT A;  5KSH A;  4EWF A;  2JCH A;  5GL9 A;  3HUO A;  4WM9 A;  1K6S A;  4GNU A;  4EBL A;  3V3R A;  3GSG A;  4PM5 A;  1ERQ A;  5CER A;  2XR0 A;  1IEM A;  4PM6 A;  3VFH A;  3ZDJ A;  4S2N C;  4DF6 A;  3HLB A;  4YIN A;  4R3J A;  1ERM A;  3CG5 A;  3MXR A;  4R3B A;  1YLZ A;  2WAE A;  3GQZ A;  4K91 A;  3NC8 A;  4B88 A;  2Y2K A;  3ZG7 B;  4Q8I A;  1MBL A;  3VMA A;  1ZG6 A;  3IXB A;  2PU2 A;  3GR2 A;  1FCN A;  2XK1 A;  4GN2 A;  1S0W A;  3IWI A;  3NIA A;  1E3U D;  1JTD A;  3TSG A;  4QB8 A;  3Q7Z A;  4WEK A;  2JBF A;  4C6Y A;  3V3S A;  4DXC A;  2J7V A;  3IQA A;  1DY6 A;  4BD0 A;  5M19 A;  4X55 A;  3ISG A;  1Z6F A;  3G34 A;  4X53 A;  4S2M A;  3A3J A;  3G4P A;  1H8Y A;  4X56 A;  1GHI A;  5DF7 A;  3UY6 A;  1L0D A;  3DTM A;  4R0Q A;  1I2W A;  5A92 A;  4OPY A;  4FH2 A;  1PI4 A;  3G31 A;  2Y2G A;  4QJG A;  4L0L A;  3E2K A;  5U47 A;  2XDM A;  5KZH A;  4KZ9 A;  5DTS A;  1FSW A;  2OLV A;  4BL2 A;  1IKG A;  4KQO A;  3VP2 A;  4R23 A;  4XUZ A;  4OPQ A;  3G2Z A;  3GTC A;  2P74 A;  1RCJ A;  3MZE A;  4LCL A;  5F82 A;  4KQR A;  5CTN A;  4R4S A;  3HLC A;  3G32 A;  3N7W A;  2WAF A;  4E3K A;  5AQA A;  3ZVW A;  1YLJ A;  1TDL A;  1TEM A;  1EI5 A;  3BEB A;  4LEN A;  2ZQA A;  4R4R A;  2XH9 A;  4S2J A;  4R1G A;  2WKH A;  3MKF A;  1PI5 A;  4MBF A;  4RA7 A;  2P9V B;  5IHV A;  2V2F F;  4S2N A;  5CED A;  1I5Q A;  1YQS A;  3W4P A;  2ZC3 B;  5DF9 A;  3LEZ A;  3B3X A;  5DTK A;  5FI6 A;  5E2E A;  3S1Y A;  3W8K A;  4E3O A;  4JF6 A;  4U0T A;  4DDY A;  2X01 A;  4WEJ A;  1K55 A;  3ZG5 A;  3SOI A;  1JWP A;  3PTE A;  1KVM A;  4KZ7 A;  4P85 A;  4E3J A;  1BT5 A;  2WYX A;  1YM1 A;  1LL9 A;  4JXG A;  2DRW A;  5CXW A;  4ZTK A;  3SS4 A;  1XKZ A;  3VP0 A;  3RXX A;  3SH9 A;  1LL5 A;  3UPO A;  5CRF A;  2ZC4 B;  3VP3 A;  2G2U A;  3VSK A;  4EV4 A;  4OON A;  1NY0 A;  5DVA A;  4NET A;  2ZM8 A;  4BD1 A;  4A5R A;  1MY8 A;  3WWX A;  4OOL A;  1KGF A;  1NYY A;  1O7E A;  4GKU A;  5E2F A;  4MLL A;  1TVF A;  2HDS A;  2ZQ7 A;  4WBG A;  4LV3 A;  2Y2Q A;  2HP5 A;  4N9K A;  3VOZ A;  1JWZ A;  1MPL A;  3O87 A;  3ZFZ A;  2FFY A;  1K25 A;  3M2J A;  4UHU A;  1YLP A;  1ZKJ A;  3FYZ A;  1SKF A;  5EUA A;  5AQ7 A;  1M6K A;  3NCK A;  1TDG A;  4MBH A;  3PBO A;  4N9L A;  2EXA A;  3VFF A;  1YT4 A;  4PPR A;  5FQ9 A;  2Y55 A;  3JYI A;  2OLU A;  2Q9N A;  5EOE A;  1HZO A;  1YMX A;  5F83 A;  5EVI C;  5FAS A;  3HLF A;  3Q7V B;  2C5W B;  3HLD A;  4FSF A;  3PBN A;  5G18 A;  3UDI A;  4D2O A;  3MKE A;  2Y2N A;  5CGX A;  1W8Y A;  2V20 A;  1LLB A;  1PWG A;  2CC1 A;  3IF6 C;  3M6H A;  4DE0 A;  4B4X A;  5KSC A;  3OCL A;  3OZH A;  1BLC A;  4CJN A;  2WZX A;  3S4X A;  1MXO A;  2C6W B;  2J8Y A;  3SH7 A;  5A91 A;  2Y2J A;  4E6W A;  1E4D A;  1ZG4 A;  3FKV A;  4ZBE A;  3MZD A;  1HTZ A;  2Y91 A;  4S2K A;  4FCF A;  4E3L A;  4KZ3 A;  3P98 A;  1MWR A;  2WGV A;  3LY4 A;  2XD5 A;  3RJU A;  3WRZ A;  4X68 A;  2EFX A;  5A90 A;  3MBZ A;  3IWQ A;  3C4P A;  4GZB A;  4WZ5 C;  2ZQC A;  3WS5 A;  3AGF A;  4DE2 A;  2VGK A;  3HLG A;  3PBQ A;  4HBT A;  4HBU A;  3UE0 A;  1K55 C;  1W5D A;  4OLG A;  1WYC A;  1FSY A;  4CPK A;  1W7F A;  5JYO A;  2EXB A;  3QHY A;  2JE5 A;  1MWS A;  4IBX A;  1N4O A;  2ZM2 A;  2WUQ A;  3C7U A;  4P0M A;  3TG9 A;  5HAR A;  1CK3 A;  4PM8 A;  1E25 A;  2Q9M A;  4OKP A;  1Y54 A;  4Y7P A;  5FDH A;  5HX9 A;  4Y0O A;  1FCO A;  2IWB A;  3SS3 A;  4EBN A;  3IHA A;  4S2P A;  3IXD A;  4S2L A;  2OSU A;  3DW0 A;  5EVI A;  1H8Z A;  4EBP A;  4LCM A;  1ES4 A;  3ZG8 B;  3C4O A;  1PIO A;  2WKE A;  3ZCZ A;  4WEL A;  5CGW A;  2WKI A;  2A3U A;  4IED A;  4JXS A;  1ONG A;  5HFO A;  2ZC7 A;  2H0Y A;  3IF6 A;  3LCE A;  4FH4 A;  4OQG A;  2DNS A;  3WS2 A;  2ZD8 A;  4KZ4 A;  2XFT A;  4OPR A;  1S6R A;  4EQI A;  5FAQ A;  1GHP A;  4KG6 A;  2QPN A;  3PBT A;  4GOG A;  1JVJ A;  4OP5 A;  4WYY A;  5GLC A;  3IXG A;  5GLB A;  1KGE A;  3VP1 A;  3GV9 A;  5FSR A;  3P09 A;  4WMC A;  2DCF A;  2QMI A;  4GD6 A;  4E6X A;  5JYP A;  1KDW A;  5GLA A;  3O86 A;  3SS5 A;  2R9W A;  4Z9Q A;  2EX8 A;  2I72 A;  3WS4 A;  5CHU A;  3NDG A;  2H5S A;  1G6A A;  2RL3 A;  3PBR A;  4OP8 A;  4KG5 A;  4PM7 A;  4B4Z A;  5HL1 A;  1KDS A;  4WZ5 A;  3GRJ A;  4QHC A;  4F94 A;  4MBK A;  3DWK A;  1YLW A;  5CGS A;  3Q82 A;  4DDS A;  4GDB A;  5L2F A;  4PM9 A;  3MZF A;  1IYQ A;  5D3O A;  2WGW A;  1PZP A;  3PAE A;  3OPL A;  4ID4 A;  3BM6 A;  5HAI A;  5M1A A;  1ESI A;  2J9O A;  1NYM A;  3Q81 A;  2EX9 A;  3M2K A;  5EVL A;  3UNW A;  3SH8 A;  3V50 A;  4H8R A;  3GMW A;  1XX2 A;  3N8S A;  4IVK A;  2B5R A;  1ESU A;  2EFU A;  4E3M A;  1ES5 A;  4JF5 A;  2FFF B;  5TR7 A;  3EQV A;  3WS1 A;  4BJP A;  5AQB A;  4RX3 A;  1PWD A;  5BOH A;  1ES2 A;  4C75 A;  2Z2M B;  3FWL A;  1LI9 A;  1QME A;  3N8L A;  4K0W A;  5CHM A;  4OQI A;  2Y2L A;  4LV1 A;  3ZG0 A;  5DTT A;  4IBR A;  3C5A A;  4P87 A;  1XPB A;  3IH8 A;  4JKT A;  4X69 A;  5HAP A;  3FZC A;  1M40 A;  1YLT A;  5F1G A;  4RVA A;  5FAP A;  1W79 A;  4ZAM A;  1LI0 A;  4OQ0 A;  1N9B A;  3NDE A;  2ZJ9 A;  3HL9 A;  4QU3 A;  1Q2Q A;  5CTM A;  1C3B A;  2HP9 A;  2Y2M A;  1CEF A;  3TOI A;  3BLS A;  1XA7 A;  4ZJ1 A;  5FI7 A;  4UA6 A;  4YFM A;  3I7J A;  4GD8 A;  2OV5 A;  4XUX A;  3CMZ A;  4OQH A;  1BUL A;  2ZC6 B;  4JLF A;  2UWX A;  5EVI D;  5FQM A;  3ZVT A;  2WZZ A;  3BFE A;  5TGF A;  1DJC A;  1SCW A;  1DJA A;  1QMF A;  2A49 A;  2ZQ8 A;  3UE1 A;  4U0X A;  3VP4 A;  4DE3 A;  1CI8 A;  1XGJ A;  5FQK A;  5KMW A;  1BZA A;  4OH0 A;  3GVB A;  2GDN A;  2X02 A;  4UA7 A;  1W8Q A;  1EWZ A;  3N8R A;  4JXV A;  1KGG A;  4MNR A;  5AQ9 A;  3A3E A;  1H5X A;  5FQJ A;  1SDN A;  4DXB A;  1K6R A;  4LV2 A;  4WMC D;  5GHX A;  1NXY A;  2IWD A;  5FAO A;  4BL3 A;  1WE4 A;  2ZQD A;  5DF8 A;  3ZNY A;  1BLH A;  3AGE A;  1NRF A;  2ZC5 B;  3N4I A;  4BEN A;  2HDU A;  3OPR A;  1ES3 A;  2WAD A;  2RCX A;  3MFD A;  1KE0 A;  2XF3 A;  1U60 A;  4KZ8 A;  2Y59 A;  4X6T A;  2Y2I A;  1SHV A;  3NI9 A;  1PYY A;  1JTG A;  4O7D A;  1O07 A;  3CJM A;  2P9V A;  4PMA A;  1PWC A;  3O88 A;  1GHM A;  2ZQ9 A;  3NBL A;  2IWC A;  3UDX A;  4KEN B;  2H10 A;  3HRE A;  3IF5 A;  1FOF A;  3UO9 A;  1HD8 A;  3BEC A;  3G35 A;  3EQU A;  5E2H A;  1JWV A;  2XD1 A;  3LO7 A;  2R9X A;  5M18 A;  5GHZ A;  1G68 A;  2XLN A;  1ZC2 A;  4BQM A;  3N6I A;  2XEP A;  1IKI A;  2BG1 A;  5FA7 A;  3BFG A;  4UAA A;  3G2Y A;  4U3T A;  5E2G A;  1AXB A;  2V1Z A;  3V39 A;  4E3I A;  3AGD A;  5FAT A;  1KVL A;  3ITB A;  4K0X A;  1K54 A;  1I2S A;  3Q1F A;  1L0E A;  2JC7 A;  1GA9 A;  4KZ5 A;  3BFF A;  2BLS A;  5EPH A;  3C7V A;  4P6B A;  3S22 A;  3BLM A;  1ERO A;  1IYP A;  1K57 C;  2XFS A;  3M6B A;  1CEG A;  4OVD A;  1KE4 A;  2XGN A;  4HEF A;  3WRT A;  3IXH A;  3FV7 A;  5CEC A;  2X71 A;  1FR6 A;  3OPH A;  4JBF A;  4RX2 A;  2XQZ A;  1NZO A;  4E3N A;  4DE1 A;  1FR1 A;  1K38 A;  1BTL A;  1BSG A;  1K56 A;  1VQQ A;  4GB7 A;  4QY6 A;  4WZ4 A;  4Y0U A;  1K4F A;  1GCE A;  5FQI A;  4JXW A;  4KQQ A;  4RYE A;  1L2S A;  5EEC A;  2ZLY A;  3LY3 A;  2Y2P A;  1XP4 A;  3QNC A;  1MKI A;  1KE3 A;  1MWT A;  3IT9 A;  1CI9 A;  3OC2 A;  5CEB A;  5GHY A;  2ZM0 A;  5FI2 A;  5TFQ A;  5I94 A;  3UDF A;  1PZO A;  4OPZ A;  3BRM A;  4ZDX A;  3Q7V A;  4OLD A;  1LHY A;  3HUM A;  2Y4A A;  1DJB A;  3VSL A;  1NJ4 A;  5E43 A;  3UPN A;  1RP5 A;  4KZB A;  3ZHH A;  2Y2H A;  4N1X A;  3A3I A;  3QNB A;  1J9M A;  4MEZ A;  4DRT A;  1L0F A;  5HW3 A;  2ZMA A;  1XXM A;  4Y0T A;  2WK0 A;  1BLP A;  3A3F A;  3E2L A;  3ITA A;  3W4O A;  1Q2P A;  1E3U A;  4HES A;  1HVB A;  3MXS A;  5FQQ A;  1OME A;  1MWU A;  3ZG9 B;  2HDR A;  2HP6 A;  1RGY A;  5J8X A;  1IYO A;  3V5M A;  1XGI A;  1FCM A;  1BLS A;  1RGZ A;  3IH9 A;  3IWO A;  4JPM A;  3DWZ A;  1VM1 A;  5EVI B;  1L0G A;  3ZGA B;  1FQG A;  2QZ6 A;  2HPB A;  1ALQ A;  3CZD A;  3WS0 A;  1K57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...