1YMXA

X-ray crystallographic structure of ctx-m-9 beta-lactamase covalently linked to cefoxitin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Function, and Inhibition along the Reaction Coordinate of CTX-M beta-Lactamases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords beta-lactamase CTX-M-9
total genus 93
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ymxA00
3HLGA 1LI9A 1KE3A 1KGEA 3C7UA 2ZC5B 4N9KA 1YM1A 3SH7A 3HUNA 2XLNA 3VFHA 4BD0A 3JYIA 2RCXA 1L2SA 3VSLA 4S2JA 5E2EA 5F1FA 5FAPA 4FH4A 4DE3A 4E3OA 5CGSA 1K38A 4FD8A 2ZQCA 3IXGA 3TSGA 1L0DA 4Y0OA 2EX2A 3PTEA 3MXSA 2JE5A 1KGGA 1XX2A 3PAGA 4EV4A 5FA7A 4S2NC 3FYZA 1OMEA 4KZBA 2WZZA 5DF9A 4EBPA 2Y2MA 1YLZA 4Y0TA 3V50A 1JTGA 3W4QA 4L0LA 4OQGA 5FSRA 5E2HA 4E6WA 3MXRA 4DF6A 1BLPA 4GDNA 2ZC4B 3A3EA 4JXVA 4WEKA 3UPPA 4PMAA 4PM7A 2V1ZA 4PM8A 2R9XA 4DE2A 3ZCZA 3VP2A 4X69A 1HZOA 4E3JA 2Z2LB 4IBRA 3LEZA 5EOOA 3AGDA 1JVJA 1IYPA 2XDMA 3SS5A 1VQQA 1FSYA 4JF6A 4E3NA 3GRJA 5TFQA 4C75A 3BFDA 3GTCA 4JXWA 1K25A 1YLTA 3NI9A 5EE8A 4N92A 1GHMA 4WBGA 3E2LA 2WZXA 5CHMA 3CJMA 4CPKA 3W4PA 4IBXA 2HP6A 4E3KA 1PWGA 1K54C 5FDHA 5HAIA 4OOYA 4P87A 1GHIA 3P98A 1RP5A 3O86A 5CGWA 1LL5A 2WGIA 5FQ9A 4EUZA 2JC7A 4KZ9A 1IYOA 1MXOA 2Y2HA 4WELA 3E2KA 3Q82A 5GLBA 3ITBA 5A92A 3IWOA 4R3BA 5J8XA 5E43A 3WS2A 3SS4A 3VOYA 3V5MA 4S2PA 3NIAA 2EFXA 2BLSA 1E25A 3GQZA 3IH9A 3W4OA 4WZ4A 2C5WB 2WKHA 1FR6A 3A3DA 3BLMA 2OV5A 3PBQA 1FCNA 1BT5A 5HAQA 1ONGA 4JBFA 3Q07A 4D2OA 4R3JA 3HLCA 2JBFA 4OPYA 1I2SA 4X56A 4ZJ1A 3IHAA 2RL3A 3EQUA 4KZAA 3VP4A 5E2GA 1E3UA 2ZLYA 4WMCA 3NC8A 3NCKA 5I94A 1NYMA 4X53A 2P9VB 1PI5A 4R0QA 2Y55A 1L0GA 4HESA 4BL2A 1FCOA 1L0FA 3LCEA 4FCFA 3HL9A 3OCNA 4LV1A 1PWCA 3OZHA 4KG6A 3AGEA 4R4RA 3IF5A 2Z2MB 2J7VA 4LV0A 2UWXA 2XK1A 3IXDA 1XA7A 4K0WA 4WM9A 1FSWA 5F83A 1JWPA 4OPRA 4U3TA 4E6XA 2I72A 1RGYA 5FATA 3FWLA 2VGJA 2ZD8A 1KDSA 4GDBA 1HTZA 4K0XA 2X01A 5CECA 1RCJA 1Q2PA 2J9OA 1EI5A 2Q9MA 1ZKJA 2Y91A 4Y7PA 3N4IA 3SS3A 2C6WB 3NDEA 4JXSA 3FKWA 1ERQA 4JF4A 2FFFB 3G2YA 3LO7A 4JPMA 2FFYA 2ZC7A 1BULA 1C3BA 1Z6FA 3HLDA 4RX3A 4JKTA 3O87A 3G35A 5IHVA 4ZJ3A 2Y2PA 3ZNTA 2X02A 3HLFA 2E8IA 2BG1A 4M3KA 1K55A 5HAPA 2ZQAA 3CZDA 2WGWA 2V20A 3MFDA 3VSKA 2OSUA 5F82A 1W79A 1MWUA 3W8KA 3B3XA 3GMWA 3G2ZA 3G32A 1LL9A 3BFEA 3BLSA 4DDSA 3HBRA 4DE0A 4EBNA 3DWZA 5CTNA 2OLVA 5GLCA 5HFOA 3TOIA 1K57C 3BFGA 1MKIA 1ZG4A 3VOZA 2QMIA 2Q9NA 4OONA 4PPRA 5FI7A 4KZ3A 4GD6A 3Q7VA 4MLLA 1IKIA 2WAEA 2ZMAA 4RYEA 2Y2QA 1YLWA 1GA0A 2WKIA 2WYXA 3S1YA 5EVIA 3ZNYA 4A5RA 3UY6A 3IQAA 4PM6A 2PU2A 5CTMA 2Y2GA 5HARA 1NY0A 5BOHA 2H0YA 2XFSA 3A3IA 5FI2A 1BSGA 1KVLA 3UE3A 1IKGA 3N7WA 2XD5A 4GN2A 1W7FA 3UPOA 1NRFA 3OCLA 5DTTA 1W8YA 4JF5A 4KZ7A 5G18A 2WADA 3PBOA 3VP1A 1JWVA 1PW8A 1KE0A 5FQJA 4XUZA 1WYBA 4UA7A 4ZJ2A 3VFFA 1GA9A 5D3OA 4B88A 1WE4A 2XGNA 2J8YA 3V3RA 1W8QA 4ZTKA 4QJGA 3GR2A 3A3FA 3DTMA 3UDXA 3OPPA 2P74A 3OPHA 2Y2JA 3TG9A 1ES4A 2HP5A 1WYCA 4OPQA 4S2OA 1G68A 4DXCA 5DVAA 2HDQA 4PM9A 1GHPA 4OH0A 4P6BA 1CEFA 5KZHA 1KE4A 3IHBA 1E3UD 4Z9QA 5HX9A 4ID4A 5L2FA 4XUXA 3GV9A 2Y59A 4RVAA 3BM6A 3PBSA 1ZC2A 3BFFA 4B4XA 4E3IA 5A90A 2WGVA 5CRFA 3OPLA 2IWDA 3OPRA 3IWQA 3QNCA 3Q7VB 2JCHA 1ZG6A 1BLCA 2EFUA 5DTSA 4CJNA 1G6AA 1YT4A 2XR0A 2XEPA 3UNWA 3MBZA 4QHCA 3QHYA 1IEMA 4HEFA 1NZUA 3BFCA 4MBFA 4OVDA 4OKPA 2QPNA 4LV3A 4P0MA 2ZM2A 1YMXA 3BYDA 3C7VA 4OPZA 1JTDA 5EECA 4GB7A 5GLDA 1QMEA 4K91A 5EOEA 4ZAMA 1K6RA 4QY6A 5CHUA 5FAQA 4OP8A 2ZQ7A 3BRMA 4GOGA 1O7EA 1S6RA 1LHYA 1L0EA 2G2WA 1TDGA 1MWRA 1DJBA 4QD4A 1BZAA 2Y2OA 4U0XA 1CK3A 1JWZA 3S4XA 4HBUA 4C3QA 3HUOA 4Q8IA 5F1GA 4OOMA 3WS0A 1YLYA 3MZFA 4KZ8A 4NK3A 4KZ5A 1XXMA 4OOLA 3O3VA 3G30A 1MWSA 4E3MA 3NY4A 5EVLA 5CEBA 4GNUA 2WK0A 3C4PA 4UHUA 2Y2LA 3V39A 3ZG8B 5CEDA 2HP9A 4GD8A 3RXXA 1PYYA 4WMCD 3PBNA 2ZJ9A 3BECA 1PW1A 2X71A 2H10A 2XFTA 4QY5A 1EWZA 5AQBA 2G2UA 2Y2NA 5E2FA 3WRTA 4NETA 5CERA 3M6HA 4DXBA 4JXGA 4B4ZA 4LENA 1O07A 1YQSA 1DJAA 4LV2A 2HDUA 4KZ4A 4IVIA 1ONHA 2XD1A 3I7JA 3WS1A 1HD8A 1H8YA 1I2WA 4KG5A 3CG5A 1TEMA 4WZ5A 2H5SA 5JYOA 2HDRA 1CI9A 3IT9A 3WWXA 1SHVA 2GDNA 4O7DA 1RGZA 2ZM8A 3UDIA 4BD1A 1N9BA 3HLBA 3ZG5A 1TDLA 4S2KA 4ZBEA 3VP0A 5FQMA 1U60A 2J9PA 3FV7A 2V2FF 4DKIA 1IYSA 1XKZA 3VMAA 1K55C 1YLPA 5KSHA 4Y0UA 3WS5A 3V3SA 4UA9A 5EVIB 1MY8A 3WRZA 2Y2KA 3IF6A 1PZOA 3Q1FA 3UE1A 1TVFA 1H8ZA 1SDNA 2ZQ8A 3MKFA 4WZ5C 5FQIA 3G31A 1IELA 1GCEA 3HREA 3ISGA 1YMSA 5M19A 4QU3A 4R1GA 4X55A 1DJCA 4C6YA 4N1XA 3N8RA 3PBRA 3IXBA 1Y54A 4N9LA 4S2LA 1MWTA 3IH8A 4S2IA 1K56D 4OP5A 4LCMA 3G34A 2A3UA 4EQIA 4H8RA 4KQRA 5FQKA 2PBYA 3P09A 1H5XA 1J9MA 3Q81A 2WGWB 4KZ6A 3ZGAB 2B5RA 3MZEA 5CGXA 1BTLA 4UAAA 1KVMA 3ZG0A 3UO9A 1HVBA 1CI8A 1MPLA 4PM5A 2H0TA 3UPNA 1BLHA 3ZG9B 3G4PA 4WYYA 4OLDA 1XGIA 1EROA 1ERMA 3HVFA 2VGKA 5A91A 3UDFA 4GKUA 1CEGA 3M2JA 5GHYA 3HLEA 1FCMA 1ESIA 2Y4AA 1NYYA 2CC1A 3FKVA 1NXYA 1NZOA 1Q2QA 2HPBA 1XPBA 3OC2A 3GSGA 4IEDA 4LCLA 3RXWA 4MEZA 2EX8A 4DE1A 4DRTA 3S22A 1W5DA 3UN7A 2IWCA 4F94A 2WUQA 3PAEA 4ZDXA 3A3JA 4BQMA 2PU4A 3IF6C 2EX9A 4P85A 2DCFA 2QZ6A 4KQQA 1LLBA 5EVIC 4GZBA 2XQZA 1M6KA 4BLMA 4S2MA 4MBKA 3VP3A 4BL3A 1SKFA 1YLJA 3LY4A 3WS4A 4QB8A 5DF7A 3CMZA 4WEJA 5FAOA 1M40A 5FASA 1XP4A 1E4DA 1I5QA 1K6SA 4RA7A 1ALQA 3ZVTA 5CHJA 1K54A 3PBTA 3M2KA 2A49A 3GVBA 4DDYA 1ES5A 2EXBA 4UA6A 5CXWA 3ZG7B 4FSFA 3ZVWA 1FR1A 2ZQ9A 4EWFA 2WAFA 3IF6B 3IWIA 1KDWA 4OLGA 1PZPA 2R9WA 3HUMA 5DF8A 2EXAA 4YFMA 3FZCA 1S0WA 4KENB 1PIOA 2ZM0A 3ZHHA 3EQVA 5M18A 1LI0A 4KG2A 4EBLA 1XGJA 3M6BA 5TGFA 1BUEA 5M1AA 3RJUA 4HBTA 3O88A 5TR7A 1ESUA 5AQAA 5GL9A 1SDEA 2DRWA 2WKEA 3AGFA 3C5AA 4BENA 4XXRA 4X68A 4KQOA 1BLSA 3MZDA 1N4OA 3N6IA 3D4FA 2IWBA 4BJPA 3DWKA 5EPHA 4IVKA 5DTKA 5GLAA 3MKEA 5GHXA 4X6TA 5FI6A 2XH9A 1VM1A 2DNSA 4R4SA 3DW0A 1PI4A 1ES3A 2HDSA 4OQ0A 5FQQA 4YINA 1KGFA 5AQ9A 1NJ4A 1K57A 4FH2A 4OQIA 4OQHA 2ZQDA 4E3LA 1QMFA 1K56A 2Y2IA 2EX6A 3Q7ZA 3SOIA 1ES2A 3C4OA 3SH9A 3N8SA 1PWDA 3ZDJA 3QNBA 3NBLA 1AXBA 2OLUA 2P9VA 2XF3A 3UE0A 3HLWA 4U0TA 3NDGA 1K4EA 5HL1A 4MNRA 3IXHA 5KSCA 1FOFA 5KMWA 4R23A 3N8LA 5AQ7A 5A93A 1MBLA 3ITAA 1IYQA 3LY3A 1DY6A 5JYPA 4N1HA 4MBHA 5EVID 4JLFA 1SCWA 2ZC6B 5U47A 1K4FA 5HW3A 4S2NA 1FQGA 5EUAA 5GHZA 1XA1A 4RX2A 3SH8A 3ZFZA 2ZC3B 3BEBA
chains in the Genus database with same CATH superfamily
2O99A 3MSHA 4X1MA 1YM1A 2W3DA 4PAUA 1L2SA 2ZQCA 1CJFA 2VEAA 4Y0OA 3PTEA 1KGGA 1DP6A 3A0SA 4EV4A 5DF9A 4Y0TA 4MDZA 3V50A 5FSRA 1P0ZA 4DF6A 3LI8A 2BTFP 4WEKA 5L10A 4P6ZS 3UPPA 2VX8A 2V1ZA 4PM8A 2R9XA 4Z1WA 3VP2A 3H9WA 4LLOB 3E4OA 4JF6A 4LRYC 5TFQA 3BFDA 4JXWA 1K25A 5EE8A 5G4ZA 1GHMA 5DKKA 2WZXA 5CHMA 2ZL1A 4IBXA 3ZYTA 2A24A 5HAIA 3P98A 1RP5A 3O86A 4NXGA 3P7NA 4IUKA 1MXOA 3Q82A 3K2NA 3ITBA 5A92A 3IWOA 4IHQA 4EUVA 2BLSA 3GQZA 2OV5A 3PBQA 1BT5A 4HY8A 3IHAA 3EQUA 3T1RA 2PYRA 1XFNA 3MQOA 1F2KA 5KIZA 2Y55A 4NXBA 1FCOA 3HL9A 3OCNA 1PWCA 3AGEA 3FG8A 2J7VA 4WM9A 1FSWA 4U3TA 2I72A 4R6LA 4Y3IA 2X01A 4K0XA 1RCJA 2J9OA 2R78A 2MJ6A 1ZKJA 3SS3A 5J4EA 3FKWA 3LO7A 2ZC7A 2DMWA 4PKYG 2Y2PA 2E8IA 1K55A 1W63Q 5HAPA 2ZQAA 3CZDA 4H6JA 2V20A 3MFDA 5AVEA 3BFEA 4EQ1A 3BLSA 4BWIA 1K57C 1MKIA 3MR0A 4OONA 1NWZA 4KZ3A 4GD6A 1IKIA 2WAEA 1YLWA 4A5RA 3UY6A 4PM6A 2Y2GA 1NY0A 3ULFA 2W1TB 3A3IA 5AJGA 5FI2A 1BSGA 1KVLA 1IKGA 2XD5A 4GN2A 2K7SA 3D3OA 4KZ7A 3C8CA 4UQIS 1GA9A 3BY8A 3BY9A 5D3OA 1WE4A 3VE3A 3T1XA 3F1OA 3LR5A 3GR2A 4HH3A 3DTMA 3UDXA 3OPPA 1S66L 4OPQA 4L9EA 4P6BA 5HX9A 4QPRA 4ID4A 2J3WA 5L2FA 3GV9A 2Y59A 3BM6A 1TS8A 2WGVA 3IWQA 3Q7VB 1ZG6A 5DTSA 4CLCB 2XR0A 3UNWA 1MKMA 2QKPA 1IEMA 4MBFA 4OVDA 2QPNA 4HNBA 4LV3A 3BYDA 3LIFA 1QMEA 4JGOA 2KX6A 4K91A 5EOEA 1STZA 5CHUA 5FAQA 4GOGA 1O7EA 1LHYA 2O9BA 4R3AA 4U0XA 3NOUC 1K0KA 5DFYA 4C3QA 3QP5A 3TRCA 4OOMA 1N9OA 4DJ3A 4O8GA 3T50A 2D02A 5CEBA 2WK0A 2Y2LA 2V9AA 1EWZA 4WF0A 2G2UA 2Y2NA 4XT2B 5E2FA 3M6HA 4DXBA 4ETXA 1YQSA 1DJAA 2W27A 1OJ5A 4FUWA 3IS2B 4IVIA 3WS1A 2LB5A 4R70A 1I2WA 4KG5A 3CG5A 3IBJA 3F1OB 4O7DA 1Y4OA 3JPUA 1RGZA 5F69A 2Y79A 4Y2FA 4EERA 5FQMA 2V2FF 4DKIA 1IYSA 5KSHA 4Y0UA 1CF0A 4UA9A 5EVIB 2Q0OA 3WRZA 5K5BA 3IF6A 4LRXC 4HP4A 3UE1A 1SDNA 1YMSA 3OBFA 4C6YA 4N1XA 3N8RA 2BASA 1W63M 4N9LA 4OP5A 3R4KA 4EETB 2JKFA 4EQIA 1H5XA 3ZGAB 2B5RA 1KVMA 3UO9A 3C2WA 1CI8A 3QP6A 3UPNA 1BLHA 3C38A 1TD5A 4WN5A 2CMNA 5A91A 2VA0A 2CC1A 1NZOA 3OC2A 3LIDA 4LCLA 4Y15A 4MEZA 4DE1A 4F94A 3A0VA 4ZDXA 3A3JA 3IF6C 2DCFA 5EVIC 4S2MA 4MBKA 4IUHA 1VB6A 4BL3A 1XFQA 3CMZA 1XP4A 2I9VA 3GECA 4HJ4A 1K54A 3M2KA 3GVBA 4DDYA 5FDSA 2UV0E 4UA6A 2ZQ9A 2WAFA 3IWIA 3EQVA 5J3WA 5TGFA 5TR7A 3AGFA 3N6IA 2IWBA 3D4FA 1ZHHB 3NULA 4IVKA 4AFIA 3JVVA 3MKEA 5AVFA 4X6TA 3UMEA 1D7EA 5FI6A 4R4SA 2VKSA 5A8BA 4OQ0A 3CUEA 3H82B 1NJ4A 3MF0A 1OJGA 1F98A 1ES2A 2FZ0A 3KO6A 4X1LA 3HLWA 2OWJA 5HWVA 2QWSA 2W3HA 3N8LA 4MBHA 4GS9B 4DJ2A 5U47A 1H0MA 4GHIA 2V1AA 2GZAA 2GX5A 3ZFZA 3HLGA 2PRFA 2O9AA 4R38A 4I5SA 3SH7A 3VSLA 1OTIA 4DE3A 4FH4A 5HDCA 4E3OA 5CGSA 1K38A 4Y17A 2EX2A 3MMHA 1OMEA 4M4XA 1OPXA 2Y2MA 1YLZA 3T1QB 2VLGA 4L0LA 4OQGA 4O01A 2M1CA 3MXRA 5HPFA 3A3EA 2VV7A 3F1NA 4X69A 3AGDA 1IYPA 1JVJA 1FSYA 3O5YA 2OAP1 3GTCA 2VV8A 3NI9A 3CJMA 4EESA 2HP6A 4E3KA 3RFBA 4P87A 2ACGA 2WGIA 5IS1A 4EUZA 3F1PA 3S7NA 4R3BA 5FEFA 2PT7A 3IH9A 2INWA 3W4OA 4WZ4A 3R7WA 1FR6A 1NRJA 1ONGA 4YNRA 3Q07A 4D2OA 4R3JA 3HLCA 2JBFA 1I2SA 1MZUA 2RL3A 4KZAA 5E2GA 2ZLYA 3NC8A 1NYMA 2XRNA 4X53A 2P9VB 1PI5A 1Z09A 5DKLA 3C30A 4CLCD 3OZHA 4KG6A 3OOVA 4UEYA 3NOPC 2UWXA 2XK1A 1LL8A 1TS7A 1XA7A 4OPRA 4Y5FA 3FWLA 5CECA 1Q2PA 2Q9MA 3IX3A 3N4IA 1OT9A 2C6WB 3NDEA 4JXSA 4JF4A 4NKPA 2FFFB 4JPMA 2HJEA 4GJ4A 4JKTA 1PNEA 3G35A 3ZNTA 2X02A 2BG1A 3CLOA 2JKTM 5J7EA 2OSUA 3W8KA 3GMWA 3G32A 1LL9A 2PDRA 4DE0A 3VE4A 2HZ5A 5HFOA 1YSPA 3PYPA 3VOZA 2JHEA 2Q9NA 5L09A 2Y2QA 1CQAA 1GA0A 3RH8B 5EVIA 3D9YA 3SZTA 3IQAA 3B42A 3UPOA 5DTTA 4DMZA 1LSWA 4BBUA 4YWZA 2PR6A 1PW8A 1KE0A 5FQJA 1WYBA 3R7WB 3LIAA 3V3RA 2P7JA 3A3FA 2P74A 3QP8A 2Z6CA 3DTEA 5DVAA 1P9WA 1CEFA 5KZHA 1E3UD 5F5YA 3PBSA 4HIAA 5EM0A 3OPLA 3LICA 2JCHA 3QP4A 4CJNA 3QHYA 4KQDA 2KLIA 5C5KA 3C7VA 5I5LA 5EECA 3S7OA 4GB7A 3CPTA 4ZAMA 4QY6A 4JGPA 3QP2A 1S6RA 1L0EA 3FPVA 3DAVA 1DJBA 4QD4A 1BZAA 1JWZA 3S4XA 3HUOA 2V8CA 1YLYA 2ZBBA 1XXMA 4OOLA 3GDIA 3G30A 4GNUA 4Q0IA 2J80A 2ZJ9A 3BECA 1PW1A 3SW1A 1AWIA 3WRTA 3FPWA 4P6ZM 4JXGA 4CLCE 1O07A 2OWHA 1TEMA 4WZ5A 2H5SA 3VOLA 2HDRA 2XROA 1SHVA 3EGXC 3KYQA 3ZG5A 1TDLA 4WLAA 2J9PA 4CQHA 3B47A 1PZOA 3LR0A 5FQIA 1GCEA 1IELA 3L7HA 4R1GA 4X55A 1DJCA 3PBRA 1Y54A 1MWTA 2QYBA 3MXQA 1Y28A 3KSGA 3Q81A 1J9MA 2WGWB 2K31A 3MZEA 1BTLA 3ZG0A 1X0OA 1HVBA 2W3EA 3PXPA 2AVXA 1F5MA 4WYYA 1EROA 3HVFA 1FCMA 1ESIA 2Y4AA 3FKVA 4IEDA 3GSGA 4MCWA 2EX8A 3S22A 2IWCA 5DJTA 3UB8A 5FEGA 4I39A 4P85A 2QZ6A 4JGRA 2L0WA 2XQZA 1M6KA 3MQ0A 3VP3A 1TS0A 3UB6A 4QB8A 5DF7A 5FASA 1E4DA 1I5QA 1K6SA 1ALQA 3LIBA 5F68A 2EXBA 5CXWA 3ZG7B 4D60A 3KSIA 4EWFA 3OLOA 2R9WA 1S0WA 1PIOA 3ZHHA 1XGJA 3RJUA 2ZMFA 1ESUA 5AQAA 5GL9A 2DRWA 3C5AA 4XXRA 4KQOA 2B18A 5EPHA 5GLAA 4ARZB 2VV6A 1S1YA 1VETA 1YPRA 3DW0A 3VV4A 2HDSA 1ES3A 2P04A 5AQ9A 2O9CA 2JKTI 1K57A 4OQHA 3T4OA 2ZQDA 1PFLA 2Y2IA 2EX6A 2O0YA 4EU0A 1P9RA 4B93A 1AXBA 3W2ZA 2OLUA 2P9VA 4EW7A 1GSXA 3UE0A 4F3LB 1IFQA 5KSCA 2B95A 5A93A 3LY3A 4JLFA 1SCWA 2D01A 4S2NA 1FQGA 5EUAA 5GHZA 1TS6A 4HQAA 2ZC3B 4K08A 3S7PA 1LI9A 1KE3A 1VETB 3EGDC 1KGEA 2V0UA 2PBDP 3C7UA 2ZC5B 4N9KA 1DP9A 4BD0A 5E2EA 5F1FA 3EWKA 3T4KA 2ZL1B 3IXGA 3TSGA 2VJWA 5TBMA 1XX2A 3PAGA 3FYZA 3IS2A 2W1RA 4E6WA 3PR6A 1HLUP 2ZC4B 4PMAA 4XT2A 4DE2A 4G3VA 1HZOA 2Z2LB 4IBRA 5EOOA 2XDMA 3B33A 3ZQ5A 1L3LA 4E3NA 3GRJA 1T1AA 4N92A 4CPKA 4Y13A 4FTXA 3V67A 5FDHA 3U4LP 4II7A 3HCYA 1GHIA 1LL5A 5FQ9A 2JC7A 1IYOA 4WELA 5J8XA 3TJZC 1GSWA 5E43A 3VOYA 3V5MA 4S2PA 3BQ8A 2EFXA 2C5WB 2WKHA 3DBAA 4OPYA 4ZJ1A 4LFUA 1YSQA 3VP4A 5L07A 3FC7A 5I94A 4R0QA 2M7UA 4MMNA 3CUEC 4R4RA 4Q0JA 4B9OA 3IF5A 4MN6A 5DJUA 4L9GA 3H7WB 2VGLS 3EOIA 5F83A 1JWPA 1RGYA 5HSQA 5FATA 2VGJA 2ZD8A 1HTZA 1SKOB 4L9FA 4EEUA 1EI5A 4Y7PA 5HWTA 3MS6A 3NHQA 4YOFA 2FFYA 4RX3A 1BULA 1Z6FA 3HLDA 3O87A 4ZJ3A 4CLCA 3HLFA 4M3KA 1S4SA 2PD7A 2WGWA 3B3XA 4DDSA 3HBRA 4EBNA 3DWZA 5GLCA 1OTDA 3BFGA 5EVEA 2W3GA 2VZWA 5FI7A 4G3KA 2WYXA 4ESPA 3ZNYA 2JKRI 1PRQA 2PU2A 5CTMA 4HJ6A 5BOHA 2H0YA 2Y8HA 3UE3A 3OCLA 1W8YA 5G18A 3PBOA 3VP1A 4ZJ2A 3VFFA 2V0WA 1W8QA 1MC0A 4QJGA 1UGUA 3OPHA 2Y2JA 1ES4A 4DXCA 5IU1A 2W0NA 2HDQA 1GHPA 4OH0A 1EW0A 3IHBA 4GCZA 4XUXA 4I3IA 2YKFA 1ZC2A 3BQAA 2EWVA 4B4XA 2IWDA 3KSHA 3QNCA 2WKRA 2L4RA 5HD3A 1YT4A 4ME4A 4HEFA 3BFCA 4OKPA 2ZM2A 1YMXA 5GLDA 1K6RA 1T18A 4ETZA 1A0KA 2VGLM 2A24B 2G2WA 1MWRA 4HI4A 1UWPX 1CK3A 2WKQA 4Q8IA 3DTKA 2PHYA 3WS0A 3T4LA 4KZ8A 4NK3A 4KZ5A 4E3MA 5EVLA 2GJ3A 4UHUA 5CEDA 2YKHA 2HP9A 4GD8A 4WMCD 2X71A 2XFTA 5AQBA 5DFXA 2L1MA 5CERA 2LB9A 1D06A 4LENA 1ONHA 1HD8A 2HGVA 5JYOA 3LR3A 2GDNA 3IBRA 4HJ3A 1S1ZA 2ZM8A 3UDIA 3HLBA 3CPTB 3UB7A 4S2KA 3VMAA 3WS5A 4PKYA 5EFWA 3Q1FA 1TVFA 2ZQ8A 1J3WA 1BYWA 4WZ5C 3ISGA 5M19A 4QU3A 3NOTC 3IXBA 4S2LA 3IH8A 3LEQA 1K56D 3T1SA 2A3UA 4H8RA 4KQRA 3P09A 4EEPA 1V9YA 5CGXA 3LFVA 4UAAA 1MPLA 4PM5A 3JVUA 2H0TA 2A2LA 2B02A 4OLDA 1ERMA 3DTIA 4I3JA 1N9NA 4GKUA 3M2JA 5GHYA 3LYXA 3HLEA 2PD8A 1OTEA 4X25A 3MQQA 1NYYA 1Q2QA 1XJ6A 2E8JA 1W5DA 3PAEA 3UMDA 4BQMA 2PU4A 2EX9A 1JNUA 4GZBA 1DP8A 2JKGA 3LUQA 3LY4A 1LT0A 4WEJA 5FAOA 4F3LA 4RQ9A 4RA7A 3ZVTA 2W3FA 5CHJA 3BW6A 3PBTA 4GS9A 1ES5A 4FSFA 1FR1A 1D1JA 3IF6B 5DF8A 3HUMA 2EXAA 3FZCA 4HH2A 4KENB 1OT6A 4DN0A 3IX4A 5M18A 1LI0A 4KG2A 4EBLA 3M6BA 3S7QA 4HBTA 3RTYA 4BENA 4X68A 1YAXA 1BLSA 2HF6A 3MZDA 1N4OA 5G4YA 4BJPA 1SKOA 3DWKA 3TW8A 2P08A 2DNSA 1VEUA 3H7WA 4E3LA 1S4RA 3SOIA 3SH9A 1PWDA 3ZDJA 3HJIA 2V8FA 3QNBA 4U0TA 5FL3A 5HL1A 3E4QA 4Q0HA 5KMWA 4R23A 2K2NA 1IYQA 5JYPA 4N1HA 5EVID 4I38A 3CHWP 1K4FA 5HW3A 2OAQ1 1XA1A 3CITA 3BEBA 4MN7A 3T4TA 1YKDA 2J3TC 1FILA 3KYEA 2KOIA 3HUNA 2XLNA 3JYIA 2RCXA 2PR5A 5HZHA 4S2JA 3LIEA 5FAPA 4FD8A 1L0DA 1NLZA 3MXSA 1G5UA 2JE5A 2QHKA 5FA7A 4S2NC 4KZBA 2WZZA 1XJ4A 4EBPA 3CI6A 3TE8A 1JTGA 2M7VA 3W4QA 5MC7A 5E2HA 1LSVA 2KDKA 3ICYA 3G6OA 1BLPA 4GDNA 3T4JA 4I3AA 1KOUA 4JXVA 4PM7A 5HPIA 3ZCZA 3L9KA 3BJNA 4ZRRA 4E3JA 1G28A 3LEZA 3SS5A 1VQQA 1UWNX 4C75A 1ACFA 1YLTA 4WBGA 3E2LA 4JGQA 3W4PA 3T12B 1PWGA 1K54C 4OOYA 3K3CA 5CGWA 2HJ9C 1VEUB 4HHDA 4KZ9A 2Y2HA 5HDDA 3E2KA 1P97A 5GLBA 5TJJA 1OTBA 3E98A 4CLCC 3WS2A 3SS4A 2FH5A 3NIAA 5IT5A 1E25A 1OTAA 3BLMA 3A3DA 1FCNA 5HAQA 4JBFA 2J3TD 2JN7A 4X56A 3KSFA 5EV0A 1E3UA 4WMCA 3NCKA 1L0GA 4HESA 4BL2A 1L0FA 2V1BA 3LCEA 4FCFA 4LV1A 2Z2MB 1ZTUA 4LV0A 3IXDA 4O0PA 4WL9A 3LGOA 4K0WA 2VK3A 3K3DA 4E6XA 3E0YA 1KDSA 4GDBA 5HWWA 3QP1A 3A0RA 2IA2A 2Y91A 5EM1A 1TF1A 1ERQA 4G3WA 3CAXA 3G2YA 3F1PB 1C3BA 3U2AA 4PHTA 5IHVA 3UB5P 2GNXA 1GSVA 3VSKA 5F82A 4KUKA 1W79A 1MWUA 3G2ZA 4MN5A 4NXEA 1T19A 3T4SA 5CTNA 2OLVA 3TOIA 3UB9A 1ZG4A 2QMIA 4PPRA 4MLLA 3Q7VA 2ZMAA 1T1CA 4RYEA 2NUPC 2WKIA 3S1YA 3LR4A 5HARA 2XFSA 3N7WA 4QWOA 1W7FA 1NRFA 5F6AA 4JF5A 1F9IA 2WADA 1JWVA 5L8MA 4XUZA 4UA7A 4B88A 2XGNA 2J8YA 4ZTKA 3TG9A 2HP5A 1WYCA 4S2OA 1G68A 4PM9A 1KE4A 4Z9QA 3T4QA 4RVAA 4IJGA 3BFFA 1VHMA 4UQIM 4E3IA 5A90A 5CRFA 3NJAA 3EEAA 3OPRA 4HOIA 2EFUA 1BLCA 1G6AA 2QJ5A 2XEPA 2OOLA 3MBZA 4QHCA 1NZUA 4H6JB 4P0MA 4OPZA 1JTDA 4KUOA 4OP8A 2ZQ7A 3BRMA 2EA9A 3IX8A 2H28A 1TDGA 2Y2OA 4HBUA 4BBVA 5F1GA 2W1TA 3MZFA 3NECA 3O3VA 3P01A 1MWSA 4GLQA 3NY4A 4LPZA 3KX0X 3ZG8B 3C4PA 3V39A 3RXXA 1PYYA 3VFHA 3PBNA 4QY5A 1XJ3A 2H10A 4NETA 1WA9A 4B4ZA 4LV2A 2HDUA 1LSXA 4KZ4A 3UE6A 2XD1A 2XSSA 3I7JA 2QJ7A 1H8YA 1CI9A 3KYZA 3IT9A 3WWXA 4BD1A 1H8MA 1N9BA 4BMWA 3EEHA 4ZBEA 3VP0A 1U60A 3FV7A 1XKZA 3CWFA 1K55C 1YLPA 4ARZA 3V3SA 1MY8A 3E4PA 2Y2KA 2HV1A 1H8ZA 3MKFA 3G31A 3HREA 2XA7S 2ZOIA 1V9ZA 2XA7M 1N9LA 4S2IA 4LCMA 4LGWA 4BBTA 3G34A 2PYPA 5FQKA 2PBYA 4KZ6A 2ZMVA 3PHYA 5HL6A 5HD5A 3ZG9B 2JKRM 3G4PA 1XGIA 2VGKA 3UDFA 1CEGA 4WUJA 1G6OA 3RXWA 1NXYA 2HPBA 1XPBA 4LRZE 4DRTA 3UN7A 2WUQA 1SZVA 2PAVP 1H3QA 1ODVA 4KQQA 1LLBA 3D72A 2G7UA 4BLMA 1SKFA 1YLJA 3WS4A 1IOUA 1M40A 3F1NB 4NG2A 2A49A 4HP9A 3ZVWA 4EXOA 1DRMA 4FOFA 1KDWA 4OLGA 1PZPA 3H82A 4YFMA 4NXFA 1FIKA 2ZM0A 5TBMB 2Z6DA 1BUEA 5M1AA 3O88A 4NEED 2NUTC 1SDEA 2WKEA 2WKPA 5DTKA 5GHXA 2XH9A 1VM1A 3BWLA 5CX7A 5HDSA 1PI4A 4E04A 1T1BA 5FQQA 4YINA 4GHIB 1KGFA 4FH2A 4OQIA 1S67L 2EWWA 4GW9A 1QMFA 1K56A 3Q7ZA 3HJKA 3C4OA 3N8SA 3MFXA 5LBRA 3NBLA 2XF3A 3NDGA 1K4EA 1NLYA 4MNRA 3IXHA 1FOFA 2ZOHA 3LI9A 5AQ7A 1MBLA 3ITAA 1DY6A 2ZC6B 1XJ2A 4RX2A 3SH8A 3MJQA
chains in the Genus database with same CATH topology
3HLGA 1LI9A 1KE3A 1KGEA 3C7UA 2ZC5B 4N9KA 1YM1A 3SH7A 3HUNA 2XLNA 3VFHA 4BD0A 3JYIA 2RCXA 1L2SA 3VSLA 4S2JA 5E2EA 5F1FA 5FAPA 4FH4A 4DE3A 4E3OA 5CGSA 1K38A 4FD8A 2ZQCA 3IXGA 3TSGA 1L0DA 4Y0OA 2EX2A 3PTEA 3MXSA 2JE5A 1KGGA 1XX2A 3PAGA 4EV4A 5FA7A 4S2NC 3FYZA 1OMEA 4KZBA 2WZZA 5DF9A 4EBPA 2Y2MA 1YLZA 4Y0TA 3V50A 1JTGA 3W4QA 4L0LA 4OQGA 5FSRA 5E2HA 4E6WA 3MXRA 4DF6A 1BLPA 4GDNA 2ZC4B 3A3EA 4JXVA 4WEKA 3UPPA 4PMAA 4PM7A 2V1ZA 4PM8A 2R9XA 4DE2A 3ZCZA 3VP2A 4X69A 1HZOA 4E3JA 2Z2LB 4IBRA 3LEZA 5EOOA 3AGDA 1JVJA 1IYPA 2XDMA 3SS5A 1VQQA 1FSYA 4JF6A 4E3NA 3GRJA 5TFQA 4C75A 3BFDA 3GTCA 4JXWA 1K25A 1YLTA 3NI9A 5EE8A 4N92A 1GHMA 4WBGA 3E2LA 2WZXA 5CHMA 3CJMA 4CPKA 3W4PA 4IBXA 2HP6A 4E3KA 1PWGA 1K54C 5FDHA 5HAIA 4OOYA 4P87A 1GHIA 3P98A 1RP5A 3O86A 5CGWA 1LL5A 2WGIA 5FQ9A 4EUZA 2JC7A 4KZ9A 1IYOA 1MXOA 2Y2HA 4WELA 3E2KA 3Q82A 5GLBA 3ITBA 5A92A 3IWOA 4R3BA 5J8XA 5E43A 3WS2A 3SS4A 3VOYA 3V5MA 4S2PA 3NIAA 2EFXA 2BLSA 1E25A 3GQZA 3IH9A 3W4OA 4WZ4A 2C5WB 2WKHA 1FR6A 3A3DA 3BLMA 2OV5A 3PBQA 1FCNA 1BT5A 5HAQA 1ONGA 4JBFA 3Q07A 4D2OA 4R3JA 3HLCA 2JBFA 4OPYA 1I2SA 4X56A 4ZJ1A 3IHAA 2RL3A 3EQUA 4KZAA 3VP4A 5E2GA 1E3UA 2ZLYA 4WMCA 3NC8A 3NCKA 5I94A 1NYMA 4X53A 2P9VB 1PI5A 4R0QA 2Y55A 1L0GA 4HESA 4BL2A 1FCOA 1L0FA 3LCEA 4FCFA 3HL9A 3OCNA 4LV1A 1PWCA 3OZHA 4KG6A 3AGEA 4R4RA 3IF5A 2Z2MB 2J7VA 4LV0A 2UWXA 2XK1A 3IXDA 1XA7A 4K0WA 4WM9A 1FSWA 5F83A 1JWPA 4OPRA 4U3TA 4E6XA 2I72A 1RGYA 5FATA 3FWLA 2VGJA 2ZD8A 1KDSA 4GDBA 1HTZA 4K0XA 2X01A 5CECA 1RCJA 1Q2PA 2J9OA 1EI5A 2Q9MA 1ZKJA 2Y91A 4Y7PA 3N4IA 3SS3A 2C6WB 3NDEA 4JXSA 3FKWA 1ERQA 4JF4A 2FFFB 3G2YA 3LO7A 4JPMA 2FFYA 2ZC7A 1BULA 1C3BA 1Z6FA 3HLDA 4RX3A 4JKTA 3O87A 3G35A 5IHVA 4ZJ3A 2Y2PA 3ZNTA 2X02A 3HLFA 2E8IA 2BG1A 4M3KA 1K55A 5HAPA 2ZQAA 3CZDA 2WGWA 2V20A 3MFDA 3VSKA 2OSUA 5F82A 1W79A 1MWUA 3W8KA 3B3XA 3GMWA 3G2ZA 3G32A 1LL9A 3BFEA 3BLSA 4DDSA 3HBRA 4DE0A 4EBNA 3DWZA 5CTNA 2OLVA 5GLCA 5HFOA 3TOIA 1K57C 3BFGA 1MKIA 1ZG4A 3VOZA 2QMIA 2Q9NA 4OONA 4PPRA 5FI7A 4KZ3A 4GD6A 3Q7VA 4MLLA 1IKIA 2WAEA 2ZMAA 4RYEA 2Y2QA 1YLWA 1GA0A 2WKIA 2WYXA 3S1YA 5EVIA 3ZNYA 4A5RA 3UY6A 3IQAA 4PM6A 2PU2A 5CTMA 2Y2GA 5HARA 1NY0A 5BOHA 2H0YA 2XFSA 3A3IA 5FI2A 1BSGA 1KVLA 3UE3A 1IKGA 3N7WA 2XD5A 4GN2A 1W7FA 3UPOA 1NRFA 3OCLA 5DTTA 1W8YA 4JF5A 4KZ7A 5G18A 2WADA 3PBOA 3VP1A 1JWVA 1PW8A 1KE0A 5FQJA 4XUZA 1WYBA 4UA7A 4ZJ2A 3VFFA 1GA9A 5D3OA 4B88A 1WE4A 2XGNA 2J8YA 3V3RA 1W8QA 4ZTKA 4QJGA 3GR2A 3A3FA 3DTMA 3UDXA 3OPPA 2P74A 3OPHA 2Y2JA 3TG9A 1ES4A 2HP5A 1WYCA 4OPQA 4S2OA 1G68A 4DXCA 5DVAA 2HDQA 4PM9A 1GHPA 4OH0A 4P6BA 1CEFA 5KZHA 1KE4A 3IHBA 1E3UD 4Z9QA 5HX9A 4ID4A 5L2FA 4XUXA 3GV9A 2Y59A 4RVAA 3BM6A 3PBSA 1ZC2A 3BFFA 4B4XA 4E3IA 5A90A 2WGVA 5CRFA 3OPLA 2IWDA 3OPRA 3IWQA 3QNCA 3Q7VB 2JCHA 1ZG6A 1BLCA 2EFUA 5DTSA 4CJNA 1G6AA 1YT4A 2XR0A 2XEPA 3UNWA 3MBZA 4QHCA 3QHYA 1IEMA 4HEFA 1NZUA 3BFCA 4MBFA 4OVDA 4OKPA 2QPNA 4LV3A 4P0MA 2ZM2A 1YMXA 3BYDA 3C7VA 4OPZA 1JTDA 5EECA 4GB7A 5GLDA 1QMEA 4K91A 5EOEA 4ZAMA 1K6RA 4QY6A 5CHUA 5FAQA 4OP8A 2ZQ7A 3BRMA 4GOGA 1O7EA 1S6RA 1LHYA 1L0EA 2G2WA 1TDGA 1MWRA 1DJBA 4QD4A 1BZAA 2Y2OA 4U0XA 1CK3A 1JWZA 3S4XA 4HBUA 4C3QA 3HUOA 4Q8IA 5F1GA 4OOMA 3WS0A 1YLYA 3MZFA 4KZ8A 4NK3A 4KZ5A 1XXMA 4OOLA 3O3VA 3G30A 1MWSA 4E3MA 3NY4A 5EVLA 5CEBA 4GNUA 2WK0A 3C4PA 4UHUA 2Y2LA 3V39A 3ZG8B 5CEDA 2HP9A 4GD8A 3RXXA 1PYYA 4WMCD 3PBNA 2ZJ9A 3BECA 1PW1A 2X71A 2H10A 2XFTA 4QY5A 1EWZA 5AQBA 2G2UA 2Y2NA 5E2FA 3WRTA 4NETA 5CERA 3M6HA 4DXBA 4JXGA 4B4ZA 4LENA 1O07A 1YQSA 1DJAA 4LV2A 2HDUA 4KZ4A 4IVIA 1ONHA 2XD1A 3I7JA 3WS1A 1HD8A 1H8YA 1I2WA 4KG5A 3CG5A 1TEMA 4WZ5A 2H5SA 5JYOA 2HDRA 1CI9A 3IT9A 3WWXA 1SHVA 2GDNA 4O7DA 1RGZA 2ZM8A 3UDIA 4BD1A 1N9BA 3HLBA 3ZG5A 1TDLA 4S2KA 4ZBEA 3VP0A 5FQMA 1U60A 2J9PA 3FV7A 2V2FF 4DKIA 1IYSA 1XKZA 3VMAA 1K55C 1YLPA 5KSHA 4Y0UA 3WS5A 3V3SA 4UA9A 5EVIB 1MY8A 3WRZA 2Y2KA 3IF6A 1PZOA 3Q1FA 3UE1A 1TVFA 1H8ZA 1SDNA 2ZQ8A 3MKFA 4WZ5C 5FQIA 3G31A 1IELA 1GCEA 3HREA 3ISGA 1YMSA 5M19A 4QU3A 4R1GA 4X55A 1DJCA 4C6YA 4N1XA 3N8RA 3PBRA 3IXBA 1Y54A 4N9LA 4S2LA 1MWTA 3IH8A 4S2IA 1K56D 4OP5A 4LCMA 3G34A 2A3UA 4EQIA 4H8RA 4KQRA 5FQKA 2PBYA 3P09A 1H5XA 1J9MA 3Q81A 2WGWB 4KZ6A 3ZGAB 2B5RA 3MZEA 5CGXA 1BTLA 4UAAA 1KVMA 3ZG0A 3UO9A 1HVBA 1CI8A 1MPLA 4PM5A 2H0TA 3UPNA 1BLHA 3ZG9B 3G4PA 4WYYA 4OLDA 1XGIA 1EROA 1ERMA 3HVFA 2VGKA 5A91A 3UDFA 4GKUA 1CEGA 3M2JA 5GHYA 3HLEA 1FCMA 1ESIA 2Y4AA 1NYYA 2CC1A 3FKVA 1NXYA 1NZOA 1Q2QA 2HPBA 1XPBA 3OC2A 3GSGA 4IEDA 4LCLA 3RXWA 4MEZA 2EX8A 4DE1A 4DRTA 3S22A 1W5DA 3UN7A 2IWCA 4F94A 2WUQA 3PAEA 4ZDXA 3A3JA 4BQMA 2PU4A 3IF6C 2EX9A 4P85A 2DCFA 2QZ6A 4KQQA 1LLBA 5EVIC 4GZBA 2XQZA 1M6KA 4BLMA 4S2MA 4MBKA 3VP3A 4BL3A 1SKFA 1YLJA 3LY4A 3WS4A 4QB8A 5DF7A 3CMZA 4WEJA 5FAOA 1M40A 5FASA 1XP4A 1E4DA 1I5QA 1K6SA 4RA7A 1ALQA 3ZVTA 5CHJA 1K54A 3PBTA 3M2KA 2A49A 3GVBA 4DDYA 1ES5A 2EXBA 4UA6A 5CXWA 3ZG7B 4FSFA 3ZVWA 1FR1A 2ZQ9A 4EWFA 2WAFA 3IF6B 3IWIA 1KDWA 4OLGA 1PZPA 2R9WA 3HUMA 5DF8A 2EXAA 4YFMA 3FZCA 1S0WA 4KENB 1PIOA 2ZM0A 3ZHHA 3EQVA 5M18A 1LI0A 4KG2A 4EBLA 1XGJA 3M6BA 5TGFA 1BUEA 5M1AA 3RJUA 4HBTA 3O88A 5TR7A 1ESUA 5AQAA 5GL9A 1SDEA 2DRWA 2WKEA 3AGFA 3C5AA 4BENA 4XXRA 4X68A 4KQOA 1BLSA 3MZDA 1N4OA 3N6IA 3D4FA 2IWBA 4BJPA 3DWKA 5EPHA 4IVKA 5DTKA 5GLAA 3MKEA 5GHXA 4X6TA 5FI6A 2XH9A 1VM1A 2DNSA 4R4SA 3DW0A 1PI4A 1ES3A 2HDSA 4OQ0A 5FQQA 4YINA 1KGFA 5AQ9A 1NJ4A 1K57A 4FH2A 4OQIA 4OQHA 2ZQDA 4E3LA 1QMFA 1K56A 2Y2IA 2EX6A 3Q7ZA 3SOIA 1ES2A 3C4OA 3SH9A 3N8SA 1PWDA 3ZDJA 3QNBA 3NBLA 1AXBA 2OLUA 2P9VA 2XF3A 3UE0A 3HLWA 4U0TA 3NDGA 1K4EA 5HL1A 4MNRA 3IXHA 5KSCA 1FOFA 5KMWA 4R23A 3N8LA 5AQ7A 5A93A 1MBLA 3ITAA 1IYQA 3LY3A 1DY6A 5JYPA 4N1HA 4MBHA 5EVID 4JLFA 1SCWA 2ZC6B 5U47A 1K4FA 5HW3A 4S2NA 1FQGA 5EUAA 5GHZA 1XA1A 4RX2A 3SH8A 3ZFZA 2ZC3B 3BEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HLG A;  1LI9 A;  1KE3 A;  1KGE A;  3C7U A;  2ZC5 B;  4N9K A;  1YM1 A;  3SH7 A;  3HUN A;  2XLN A;  3VFH A;  4BD0 A;  3JYI A;  2RCX A;  1L2S A;  3VSL A;  4S2J A;  5E2E A;  5F1F A;  5FAP A;  4FH4 A;  4DE3 A;  4E3O A;  5CGS A;  1K38 A;  4FD8 A;  2ZQC A;  3IXG A;  3TSG A;  1L0D A;  4Y0O A;  2EX2 A;  3PTE A;  3MXS A;  2JE5 A;  1KGG A;  1XX2 A;  3PAG A;  4EV4 A;  5FA7 A;  4S2N C;  3FYZ A;  1OME A;  4KZB A;  2WZZ A;  5DF9 A;  4EBP A;  2Y2M A;  1YLZ A;  4Y0T A;  3V50 A;  1JTG A;  3W4Q A;  4L0L A;  4OQG A;  5FSR A;  5E2H A;  4E6W A;  3MXR A;  4DF6 A;  1BLP A;  4GDN A;  2ZC4 B;  3A3E A;  4JXV A;  4WEK A;  3UPP A;  4PMA A;  4PM7 A;  2V1Z A;  4PM8 A;  2R9X A;  4DE2 A;  3ZCZ A;  3VP2 A;  4X69 A;  1HZO A;  4E3J A;  2Z2L B;  4IBR A;  3LEZ A;  5EOO A;  3AGD A;  1JVJ A;  1IYP A;  2XDM A;  3SS5 A;  1VQQ A;  1FSY A;  4JF6 A;  4E3N A;  3GRJ A;  5TFQ A;  4C75 A;  3BFD A;  3GTC A;  4JXW A;  1K25 A;  1YLT A;  3NI9 A;  5EE8 A;  4N92 A;  1GHM A;  4WBG A;  3E2L A;  2WZX A;  5CHM A;  3CJM A;  4CPK A;  3W4P A;  4IBX A;  2HP6 A;  4E3K A;  1PWG A;  1K54 C;  5FDH A;  5HAI A;  4OOY A;  4P87 A;  1GHI A;  3P98 A;  1RP5 A;  3O86 A;  5CGW A;  1LL5 A;  2WGI A;  5FQ9 A;  4EUZ A;  2JC7 A;  4KZ9 A;  1IYO A;  1MXO A;  2Y2H A;  4WEL A;  3E2K A;  3Q82 A;  5GLB A;  3ITB A;  5A92 A;  3IWO A;  4R3B A;  5J8X A;  5E43 A;  3WS2 A;  3SS4 A;  3VOY A;  3V5M A;  4S2P A;  3NIA A;  2EFX A;  2BLS A;  1E25 A;  3GQZ A;  3IH9 A;  3W4O A;  4WZ4 A;  2C5W B;  2WKH A;  1FR6 A;  3A3D A;  3BLM A;  2OV5 A;  3PBQ A;  1FCN A;  1BT5 A;  5HAQ A;  1ONG A;  4JBF A;  3Q07 A;  4D2O A;  4R3J A;  3HLC A;  2JBF A;  4OPY A;  1I2S A;  4X56 A;  4ZJ1 A;  3IHA A;  2RL3 A;  3EQU A;  4KZA A;  3VP4 A;  5E2G A;  1E3U A;  2ZLY A;  4WMC A;  3NC8 A;  3NCK A;  5I94 A;  1NYM A;  4X53 A;  2P9V B;  1PI5 A;  4R0Q A;  2Y55 A;  1L0G A;  4HES A;  4BL2 A;  1FCO A;  1L0F A;  3LCE A;  4FCF A;  3HL9 A;  3OCN A;  4LV1 A;  1PWC A;  3OZH A;  4KG6 A;  3AGE A;  4R4R A;  3IF5 A;  2Z2M B;  2J7V A;  4LV0 A;  2UWX A;  2XK1 A;  3IXD A;  1XA7 A;  4K0W A;  4WM9 A;  1FSW A;  5F83 A;  1JWP A;  4OPR A;  4U3T A;  4E6X A;  2I72 A;  1RGY A;  5FAT A;  3FWL A;  2VGJ A;  2ZD8 A;  1KDS A;  4GDB A;  1HTZ A;  4K0X A;  2X01 A;  5CEC A;  1RCJ A;  1Q2P A;  2J9O A;  1EI5 A;  2Q9M A;  1ZKJ A;  2Y91 A;  4Y7P A;  3N4I A;  3SS3 A;  2C6W B;  3NDE A;  4JXS A;  3FKW A;  1ERQ A;  4JF4 A;  2FFF B;  3G2Y A;  3LO7 A;  4JPM A;  2FFY A;  2ZC7 A;  1BUL A;  1C3B A;  1Z6F A;  3HLD A;  4RX3 A;  4JKT A;  3O87 A;  3G35 A;  5IHV A;  4ZJ3 A;  2Y2P A;  3ZNT A;  2X02 A;  3HLF A;  2E8I A;  2BG1 A;  4M3K A;  1K55 A;  5HAP A;  2ZQA A;  3CZD A;  2WGW A;  2V20 A;  3MFD A;  3VSK A;  2OSU A;  5F82 A;  1W79 A;  1MWU A;  3W8K A;  3B3X A;  3GMW A;  3G2Z A;  3G32 A;  1LL9 A;  3BFE A;  3BLS A;  4DDS A;  3HBR A;  4DE0 A;  4EBN A;  3DWZ A;  5CTN A;  2OLV A;  5GLC A;  5HFO A;  3TOI A;  1K57 C;  3BFG A;  1MKI A;  1ZG4 A;  3VOZ A;  2QMI A;  2Q9N A;  4OON A;  4PPR A;  5FI7 A;  4KZ3 A;  4GD6 A;  3Q7V A;  4MLL A;  1IKI A;  2WAE A;  2ZMA A;  4RYE A;  2Y2Q A;  1YLW A;  1GA0 A;  2WKI A;  2WYX A;  3S1Y A;  5EVI A;  3ZNY A;  4A5R A;  3UY6 A;  3IQA A;  4PM6 A;  2PU2 A;  5CTM A;  2Y2G A;  5HAR A;  1NY0 A;  5BOH A;  2H0Y A;  2XFS A;  3A3I A;  5FI2 A;  1BSG A;  1KVL A;  3UE3 A;  1IKG A;  3N7W A;  2XD5 A;  4GN2 A;  1W7F A;  3UPO A;  1NRF A;  3OCL A;  5DTT A;  1W8Y A;  4JF5 A;  4KZ7 A;  5G18 A;  2WAD A;  3PBO A;  3VP1 A;  1JWV A;  1PW8 A;  1KE0 A;  5FQJ A;  4XUZ A;  1WYB A;  4UA7 A;  4ZJ2 A;  3VFF A;  1GA9 A;  5D3O A;  4B88 A;  1WE4 A;  2XGN A;  2J8Y A;  3V3R A;  1W8Q A;  4ZTK A;  4QJG A;  3GR2 A;  3A3F A;  3DTM A;  3UDX A;  3OPP A;  2P74 A;  3OPH A;  2Y2J A;  3TG9 A;  1ES4 A;  2HP5 A;  1WYC A;  4OPQ A;  4S2O A;  1G68 A;  4DXC A;  5DVA A;  2HDQ A;  4PM9 A;  1GHP A;  4OH0 A;  4P6B A;  1CEF A;  5KZH A;  1KE4 A;  3IHB A;  1E3U D;  4Z9Q A;  5HX9 A;  4ID4 A;  5L2F A;  4XUX A;  3GV9 A;  2Y59 A;  4RVA A;  3BM6 A;  3PBS A;  1ZC2 A;  3BFF A;  4B4X A;  4E3I A;  5A90 A;  2WGV A;  5CRF A;  3OPL A;  2IWD A;  3OPR A;  3IWQ A;  3QNC A;  3Q7V B;  2JCH A;  1ZG6 A;  1BLC A;  2EFU A;  5DTS A;  4CJN A;  1G6A A;  1YT4 A;  2XR0 A;  2XEP A;  3UNW A;  3MBZ A;  4QHC A;  3QHY A;  1IEM A;  4HEF A;  1NZU A;  3BFC A;  4MBF A;  4OVD A;  4OKP A;  2QPN A;  4LV3 A;  4P0M A;  2ZM2 A;  1YMX A;  3BYD A;  3C7V A;  4OPZ A;  1JTD A;  5EEC A;  4GB7 A;  5GLD A;  1QME A;  4K91 A;  5EOE A;  4ZAM A;  1K6R A;  4QY6 A;  5CHU A;  5FAQ A;  4OP8 A;  2ZQ7 A;  3BRM A;  4GOG A;  1O7E A;  1S6R A;  1LHY A;  1L0E A;  2G2W A;  1TDG A;  1MWR A;  1DJB A;  4QD4 A;  1BZA A;  2Y2O A;  4U0X A;  1CK3 A;  1JWZ A;  3S4X A;  4HBU A;  4C3Q A;  3HUO A;  4Q8I A;  5F1G A;  4OOM A;  3WS0 A;  1YLY A;  3MZF A;  4KZ8 A;  4NK3 A;  4KZ5 A;  1XXM A;  4OOL A;  3O3V A;  3G30 A;  1MWS A;  4E3M A;  3NY4 A;  5EVL A;  5CEB A;  4GNU A;  2WK0 A;  3C4P A;  4UHU A;  2Y2L A;  3V39 A;  3ZG8 B;  5CED A;  2HP9 A;  4GD8 A;  3RXX A;  1PYY A;  4WMC D;  3PBN A;  2ZJ9 A;  3BEC A;  1PW1 A;  2X71 A;  2H10 A;  2XFT A;  4QY5 A;  1EWZ A;  5AQB A;  2G2U A;  2Y2N A;  5E2F A;  3WRT A;  4NET A;  5CER A;  3M6H A;  4DXB A;  4JXG A;  4B4Z A;  4LEN A;  1O07 A;  1YQS A;  1DJA A;  4LV2 A;  2HDU A;  4KZ4 A;  4IVI A;  1ONH A;  2XD1 A;  3I7J A;  3WS1 A;  1HD8 A;  1H8Y A;  1I2W A;  4KG5 A;  3CG5 A;  1TEM A;  4WZ5 A;  2H5S A;  5JYO A;  2HDR A;  1CI9 A;  3IT9 A;  3WWX A;  1SHV A;  2GDN A;  4O7D A;  1RGZ A;  2ZM8 A;  3UDI A;  4BD1 A;  1N9B A;  3HLB A;  3ZG5 A;  1TDL A;  4S2K A;  4ZBE A;  3VP0 A;  5FQM A;  1U60 A;  2J9P A;  3FV7 A;  2V2F F;  4DKI A;  1IYS A;  1XKZ A;  3VMA A;  1K55 C;  1YLP A;  5KSH A;  4Y0U A;  3WS5 A;  3V3S A;  4UA9 A;  5EVI B;  1MY8 A;  3WRZ A;  2Y2K A;  3IF6 A;  1PZO A;  3Q1F A;  3UE1 A;  1TVF A;  1H8Z A;  1SDN A;  2ZQ8 A;  3MKF A;  4WZ5 C;  5FQI A;  3G31 A;  1IEL A;  1GCE A;  3HRE A;  3ISG A;  1YMS A;  5M19 A;  4QU3 A;  4R1G A;  4X55 A;  1DJC A;  4C6Y A;  4N1X A;  3N8R A;  3PBR A;  3IXB A;  1Y54 A;  4N9L A;  4S2L A;  1MWT A;  3IH8 A;  4S2I A;  1K56 D;  4OP5 A;  4LCM A;  3G34 A;  2A3U A;  4EQI A;  4H8R A;  4KQR A;  5FQK A;  2PBY A;  3P09 A;  1H5X A;  1J9M A;  3Q81 A;  2WGW B;  4KZ6 A;  3ZGA B;  2B5R A;  3MZE A;  5CGX A;  1BTL A;  4UAA A;  1KVM A;  3ZG0 A;  3UO9 A;  1HVB A;  1CI8 A;  1MPL A;  4PM5 A;  2H0T A;  3UPN A;  1BLH A;  3ZG9 B;  3G4P A;  4WYY A;  4OLD A;  1XGI A;  1ERO A;  1ERM A;  3HVF A;  2VGK A;  5A91 A;  3UDF A;  4GKU A;  1CEG A;  3M2J A;  5GHY A;  3HLE A;  1FCM A;  1ESI A;  2Y4A A;  1NYY A;  2CC1 A;  3FKV A;  1NXY A;  1NZO A;  1Q2Q A;  2HPB A;  1XPB A;  3OC2 A;  3GSG A;  4IED A;  4LCL A;  3RXW A;  4MEZ A;  2EX8 A;  4DE1 A;  4DRT A;  3S22 A;  1W5D A;  3UN7 A;  2IWC A;  4F94 A;  2WUQ A;  3PAE A;  4ZDX A;  3A3J A;  4BQM A;  2PU4 A;  3IF6 C;  2EX9 A;  4P85 A;  2DCF A;  2QZ6 A;  4KQQ A;  1LLB A;  5EVI C;  4GZB A;  2XQZ A;  1M6K A;  4BLM A;  4S2M A;  4MBK A;  3VP3 A;  4BL3 A;  1SKF A;  1YLJ A;  3LY4 A;  3WS4 A;  4QB8 A;  5DF7 A;  3CMZ A;  4WEJ A;  5FAO A;  1M40 A;  5FAS A;  1XP4 A;  1E4D A;  1I5Q A;  1K6S A;  4RA7 A;  1ALQ A;  3ZVT A;  5CHJ A;  1K54 A;  3PBT A;  3M2K A;  2A49 A;  3GVB A;  4DDY A;  1ES5 A;  2EXB A;  4UA6 A;  5CXW A;  3ZG7 B;  4FSF A;  3ZVW A;  1FR1 A;  2ZQ9 A;  4EWF A;  2WAF A;  3IF6 B;  3IWI A;  1KDW A;  4OLG A;  1PZP A;  2R9W A;  3HUM A;  5DF8 A;  2EXA A;  4YFM A;  3FZC A;  1S0W A;  4KEN B;  1PIO A;  2ZM0 A;  3ZHH A;  3EQV A;  5M18 A;  1LI0 A;  4KG2 A;  4EBL A;  1XGJ A;  3M6B A;  5TGF A;  1BUE A;  5M1A A;  3RJU A;  4HBT A;  3O88 A;  5TR7 A;  1ESU A;  5AQA A;  5GL9 A;  1SDE A;  2DRW A;  2WKE A;  3AGF A;  3C5A A;  4BEN A;  4XXR A;  4X68 A;  4KQO A;  1BLS A;  3MZD A;  1N4O A;  3N6I A;  3D4F A;  2IWB A;  4BJP A;  3DWK A;  5EPH A;  4IVK A;  5DTK A;  5GLA A;  3MKE A;  5GHX A;  4X6T A;  5FI6 A;  2XH9 A;  1VM1 A;  2DNS A;  4R4S A;  3DW0 A;  1PI4 A;  1ES3 A;  2HDS A;  4OQ0 A;  5FQQ A;  4YIN A;  1KGF A;  5AQ9 A;  1NJ4 A;  1K57 A;  4FH2 A;  4OQI A;  4OQH A;  2ZQD A;  4E3L A;  1QMF A;  1K56 A;  2Y2I A;  2EX6 A;  3Q7Z A;  3SOI A;  1ES2 A;  3C4O A;  3SH9 A;  3N8S A;  1PWD A;  3ZDJ A;  3QNB A;  3NBL A;  1AXB A;  2OLU A;  2P9V A;  2XF3 A;  3UE0 A;  3HLW A;  4U0T A;  3NDG A;  1K4E A;  5HL1 A;  4MNR A;  3IXH A;  5KSC A;  1FOF A;  5KMW A;  4R23 A;  3N8L A;  5AQ7 A;  5A93 A;  1MBL A;  3ITA A;  1IYQ A;  3LY3 A;  1DY6 A;  5JYP A;  4N1H A;  4MBH A;  5EVI D;  4JLF A;  1SCW A;  2ZC6 B;  5U47 A;  1K4F A;  5HW3 A;  4S2N A;  1FQG A;  5EUA A;  5GHZ A;  1XA1 A;  4RX2 A;  3SH8 A;  3ZFZ A;  2ZC3 B;  3BEB A; 
#chains in the Genus database with same CATH topology
 2O99 A;  3MSH A;  4X1M A;  1YM1 A;  2W3D A;  4PAU A;  1L2S A;  2ZQC A;  1CJF A;  2VEA A;  4Y0O A;  3PTE A;  1KGG A;  1DP6 A;  3A0S A;  4EV4 A;  5DF9 A;  4Y0T A;  4MDZ A;  3V50 A;  5FSR A;  1P0Z A;  4DF6 A;  3LI8 A;  2BTF P;  4WEK A;  5L10 A;  4P6Z S;  3UPP A;  2VX8 A;  2V1Z A;  4PM8 A;  2R9X A;  4Z1W A;  3VP2 A;  3H9W A;  4LLO B;  3E4O A;  4JF6 A;  4LRY C;  5TFQ A;  3BFD A;  4JXW A;  1K25 A;  5EE8 A;  5G4Z A;  1GHM A;  5DKK A;  2WZX A;  5CHM A;  2ZL1 A;  4IBX A;  3ZYT A;  2A24 A;  5HAI A;  3P98 A;  1RP5 A;  3O86 A;  4NXG A;  3P7N A;  4IUK A;  1MXO A;  3Q82 A;  3K2N A;  3ITB A;  5A92 A;  3IWO A;  4IHQ A;  4EUV A;  2BLS A;  3GQZ A;  2OV5 A;  3PBQ A;  1BT5 A;  4HY8 A;  3IHA A;  3EQU A;  3T1R A;  2PYR A;  1XFN A;  3MQO A;  1F2K A;  5KIZ A;  2Y55 A;  4NXB A;  1FCO A;  3HL9 A;  3OCN A;  1PWC A;  3AGE A;  3FG8 A;  2J7V A;  4WM9 A;  1FSW A;  4U3T A;  2I72 A;  4R6L A;  4Y3I A;  2X01 A;  4K0X A;  1RCJ A;  2J9O A;  2R78 A;  2MJ6 A;  1ZKJ A;  3SS3 A;  5J4E A;  3FKW A;  3LO7 A;  2ZC7 A;  2DMW A;  4PKY G;  2Y2P A;  2E8I A;  1K55 A;  1W63 Q;  5HAP A;  2ZQA A;  3CZD A;  4H6J A;  2V20 A;  3MFD A;  5AVE A;  3BFE A;  4EQ1 A;  3BLS A;  4BWI A;  1K57 C;  1MKI A;  3MR0 A;  4OON A;  1NWZ A;  4KZ3 A;  4GD6 A;  1IKI A;  2WAE A;  1YLW A;  4A5R A;  3UY6 A;  4PM6 A;  2Y2G A;  1NY0 A;  3ULF A;  2W1T B;  3A3I A;  5AJG A;  5FI2 A;  1BSG A;  1KVL A;  1IKG A;  2XD5 A;  4GN2 A;  2K7S A;  3D3O A;  4KZ7 A;  3C8C A;  4UQI S;  1GA9 A;  3BY8 A;  3BY9 A;  5D3O A;  1WE4 A;  3VE3 A;  3T1X A;  3F1O A;  3LR5 A;  3GR2 A;  4HH3 A;  3DTM A;  3UDX A;  3OPP A;  1S66 L;  4OPQ A;  4L9E A;  4P6B A;  5HX9 A;  4QPR A;  4ID4 A;  2J3W A;  5L2F A;  3GV9 A;  2Y59 A;  3BM6 A;  1TS8 A;  2WGV A;  3IWQ A;  3Q7V B;  1ZG6 A;  5DTS A;  4CLC B;  2XR0 A;  3UNW A;  1MKM A;  2QKP A;  1IEM A;  4MBF A;  4OVD A;  2QPN A;  4HNB A;  4LV3 A;  3BYD A;  3LIF A;  1QME A;  4JGO A;  2KX6 A;  4K91 A;  5EOE A;  1STZ A;  5CHU A;  5FAQ A;  4GOG A;  1O7E A;  1LHY A;  2O9B A;  4R3A A;  4U0X A;  3NOU C;  1K0K A;  5DFY A;  4C3Q A;  3QP5 A;  3TRC A;  4OOM A;  1N9O A;  4DJ3 A;  4O8G A;  3T50 A;  2D02 A;  5CEB A;  2WK0 A;  2Y2L A;  2V9A A;  1EWZ A;  4WF0 A;  2G2U A;  2Y2N A;  4XT2 B;  5E2F A;  3M6H A;  4DXB A;  4ETX A;  1YQS A;  1DJA A;  2W27 A;  1OJ5 A;  4FUW A;  3IS2 B;  4IVI A;  3WS1 A;  2LB5 A;  4R70 A;  1I2W A;  4KG5 A;  3CG5 A;  3IBJ A;  3F1O B;  4O7D A;  1Y4O A;  3JPU A;  1RGZ A;  5F69 A;  2Y79 A;  4Y2F A;  4EER A;  5FQM A;  2V2F F;  4DKI A;  1IYS A;  5KSH A;  4Y0U A;  1CF0 A;  4UA9 A;  5EVI B;  2Q0O A;  3WRZ A;  5K5B A;  3IF6 A;  4LRX C;  4HP4 A;  3UE1 A;  1SDN A;  1YMS A;  3OBF A;  4C6Y A;  4N1X A;  3N8R A;  2BAS A;  1W63 M;  4N9L A;  4OP5 A;  3R4K A;  4EET B;  2JKF A;  4EQI A;  1H5X A;  3ZGA B;  2B5R A;  1KVM A;  3UO9 A;  3C2W A;  1CI8 A;  3QP6 A;  3UPN A;  1BLH A;  3C38 A;  1TD5 A;  4WN5 A;  2CMN A;  5A91 A;  2VA0 A;  2CC1 A;  1NZO A;  3OC2 A;  3LID A;  4LCL A;  4Y15 A;  4MEZ A;  4DE1 A;  4F94 A;  3A0V A;  4ZDX A;  3A3J A;  3IF6 C;  2DCF A;  5EVI C;  4S2M A;  4MBK A;  4IUH A;  1VB6 A;  4BL3 A;  1XFQ A;  3CMZ A;  1XP4 A;  2I9V A;  3GEC A;  4HJ4 A;  1K54 A;  3M2K A;  3GVB A;  4DDY A;  5FDS A;  2UV0 E;  4UA6 A;  2ZQ9 A;  2WAF A;  3IWI A;  3EQV A;  5J3W A;  5TGF A;  5TR7 A;  3AGF A;  3N6I A;  2IWB A;  3D4F A;  1ZHH B;  3NUL A;  4IVK A;  4AFI A;  3JVV A;  3MKE A;  5AVF A;  4X6T A;  3UME A;  1D7E A;  5FI6 A;  4R4S A;  2VKS A;  5A8B A;  4OQ0 A;  3CUE A;  3H82 B;  1NJ4 A;  3MF0 A;  1OJG A;  1F98 A;  1ES2 A;  2FZ0 A;  3KO6 A;  4X1L A;  3HLW A;  2OWJ A;  5HWV A;  2QWS A;  2W3H A;  3N8L A;  4MBH A;  4GS9 B;  4DJ2 A;  5U47 A;  1H0M A;  4GHI A;  2V1A A;  2GZA A;  2GX5 A;  3ZFZ A;  3HLG A;  2PRF A;  2O9A A;  4R38 A;  4I5S A;  3SH7 A;  3VSL A;  1OTI A;  4DE3 A;  4FH4 A;  5HDC A;  4E3O A;  5CGS A;  1K38 A;  4Y17 A;  2EX2 A;  3MMH A;  1OME A;  4M4X A;  1OPX A;  2Y2M A;  1YLZ A;  3T1Q B;  2VLG A;  4L0L A;  4OQG A;  4O01 A;  2M1C A;  3MXR A;  5HPF A;  3A3E A;  2VV7 A;  3F1N A;  4X69 A;  3AGD A;  1IYP A;  1JVJ A;  1FSY A;  3O5Y A;  2OAP 1;  3GTC A;  2VV8 A;  3NI9 A;  3CJM A;  4EES A;  2HP6 A;  4E3K A;  3RFB A;  4P87 A;  2ACG A;  2WGI A;  5IS1 A;  4EUZ A;  3F1P A;  3S7N A;  4R3B A;  5FEF A;  2PT7 A;  3IH9 A;  2INW A;  3W4O A;  4WZ4 A;  3R7W A;  1FR6 A;  1NRJ A;  1ONG A;  4YNR A;  3Q07 A;  4D2O A;  4R3J A;  3HLC A;  2JBF A;  1I2S A;  1MZU A;  2RL3 A;  4KZA A;  5E2G A;  2ZLY A;  3NC8 A;  1NYM A;  2XRN A;  4X53 A;  2P9V B;  1PI5 A;  1Z09 A;  5DKL A;  3C30 A;  4CLC D;  3OZH A;  4KG6 A;  3OOV A;  4UEY A;  3NOP C;  2UWX A;  2XK1 A;  1LL8 A;  1TS7 A;  1XA7 A;  4OPR A;  4Y5F A;  3FWL A;  5CEC A;  1Q2P A;  2Q9M A;  3IX3 A;  3N4I A;  1OT9 A;  2C6W B;  3NDE A;  4JXS A;  4JF4 A;  4NKP A;  2FFF B;  4JPM A;  2HJE A;  4GJ4 A;  4JKT A;  1PNE A;  3G35 A;  3ZNT A;  2X02 A;  2BG1 A;  3CLO A;  2JKT M;  5J7E A;  2OSU A;  3W8K A;  3GMW A;  3G32 A;  1LL9 A;  2PDR A;  4DE0 A;  3VE4 A;  2HZ5 A;  5HFO A;  1YSP A;  3PYP A;  3VOZ A;  2JHE A;  2Q9N A;  5L09 A;  2Y2Q A;  1CQA A;  1GA0 A;  3RH8 B;  5EVI A;  3D9Y A;  3SZT A;  3IQA A;  3B42 A;  3UPO A;  5DTT A;  4DMZ A;  1LSW A;  4BBU A;  4YWZ A;  2PR6 A;  1PW8 A;  1KE0 A;  5FQJ A;  1WYB A;  3R7W B;  3LIA A;  3V3R A;  2P7J A;  3A3F A;  2P74 A;  3QP8 A;  2Z6C A;  3DTE A;  5DVA A;  1P9W A;  1CEF A;  5KZH A;  1E3U D;  5F5Y A;  3PBS A;  4HIA A;  5EM0 A;  3OPL A;  3LIC A;  2JCH A;  3QP4 A;  4CJN A;  3QHY A;  4KQD A;  2KLI A;  5C5K A;  3C7V A;  5I5L A;  5EEC A;  3S7O A;  4GB7 A;  3CPT A;  4ZAM A;  4QY6 A;  4JGP A;  3QP2 A;  1S6R A;  1L0E A;  3FPV A;  3DAV A;  1DJB A;  4QD4 A;  1BZA A;  1JWZ A;  3S4X A;  3HUO A;  2V8C A;  1YLY A;  2ZBB A;  1XXM A;  4OOL A;  3GDI A;  3G30 A;  4GNU A;  4Q0I A;  2J80 A;  2ZJ9 A;  3BEC A;  1PW1 A;  3SW1 A;  1AWI A;  3WRT A;  3FPW A;  4P6Z M;  4JXG A;  4CLC E;  1O07 A;  2OWH A;  1TEM A;  4WZ5 A;  2H5S A;  3VOL A;  2HDR A;  2XRO A;  1SHV A;  3EGX C;  3KYQ A;  3ZG5 A;  1TDL A;  4WLA A;  2J9P A;  4CQH A;  3B47 A;  1PZO A;  3LR0 A;  5FQI A;  1GCE A;  1IEL A;  3L7H A;  4R1G A;  4X55 A;  1DJC A;  3PBR A;  1Y54 A;  1MWT A;  2QYB A;  3MXQ A;  1Y28 A;  3KSG A;  3Q81 A;  1J9M A;  2WGW B;  2K31 A;  3MZE A;  1BTL A;  3ZG0 A;  1X0O A;  1HVB A;  2W3E A;  3PXP A;  2AVX A;  1F5M A;  4WYY A;  1ERO A;  3HVF A;  1FCM A;  1ESI A;  2Y4A A;  3FKV A;  4IED A;  3GSG A;  4MCW A;  2EX8 A;  3S22 A;  2IWC A;  5DJT A;  3UB8 A;  5FEG A;  4I39 A;  4P85 A;  2QZ6 A;  4JGR A;  2L0W A;  2XQZ A;  1M6K A;  3MQ0 A;  3VP3 A;  1TS0 A;  3UB6 A;  4QB8 A;  5DF7 A;  5FAS A;  1E4D A;  1I5Q A;  1K6S A;  1ALQ A;  3LIB A;  5F68 A;  2EXB A;  5CXW A;  3ZG7 B;  4D60 A;  3KSI A;  4EWF A;  3OLO A;  2R9W A;  1S0W A;  1PIO A;  3ZHH A;  1XGJ A;  3RJU A;  2ZMF A;  1ESU A;  5AQA A;  5GL9 A;  2DRW A;  3C5A A;  4XXR A;  4KQO A;  2B18 A;  5EPH A;  5GLA A;  4ARZ B;  2VV6 A;  1S1Y A;  1VET A;  1YPR A;  3DW0 A;  3VV4 A;  2HDS A;  1ES3 A;  2P04 A;  5AQ9 A;  2O9C A;  2JKT I;  1K57 A;  4OQH A;  3T4O A;  2ZQD A;  1PFL A;  2Y2I A;  2EX6 A;  2O0Y A;  4EU0 A;  1P9R A;  4B93 A;  1AXB A;  3W2Z A;  2OLU A;  2P9V A;  4EW7 A;  1GSX A;  3UE0 A;  4F3L B;  1IFQ A;  5KSC A;  2B95 A;  5A93 A;  3LY3 A;  4JLF A;  1SCW A;  2D01 A;  4S2N A;  1FQG A;  5EUA A;  5GHZ A;  1TS6 A;  4HQA A;  2ZC3 B;  4K08 A;  3S7P A;  1LI9 A;  1KE3 A;  1VET B;  3EGD C;  1KGE A;  2V0U A;  2PBD P;  3C7U A;  2ZC5 B;  4N9K A;  1DP9 A;  4BD0 A;  5E2E A;  5F1F A;  3EWK A;  3T4K A;  2ZL1 B;  3IXG A;  3TSG A;  2VJW A;  5TBM A;  1XX2 A;  3PAG A;  3FYZ A;  3IS2 A;  2W1R A;  4E6W A;  3PR6 A;  1HLU P;  2ZC4 B;  4PMA A;  4XT2 A;  4DE2 A;  4G3V A;  1HZO A;  2Z2L B;  4IBR A;  5EOO A;  2XDM A;  3B33 A;  3ZQ5 A;  1L3L A;  4E3N A;  3GRJ A;  1T1A A;  4N92 A;  4CPK A;  4Y13 A;  4FTX A;  3V67 A;  5FDH A;  3U4L P;  4II7 A;  3HCY A;  1GHI A;  1LL5 A;  5FQ9 A;  2JC7 A;  1IYO A;  4WEL A;  5J8X A;  3TJZ C;  1GSW A;  5E43 A;  3VOY A;  3V5M A;  4S2P A;  3BQ8 A;  2EFX A;  2C5W B;  2WKH A;  3DBA A;  4OPY A;  4ZJ1 A;  4LFU A;  1YSQ A;  3VP4 A;  5L07 A;  3FC7 A;  5I94 A;  4R0Q A;  2M7U A;  4MMN A;  3CUE C;  4R4R A;  4Q0J A;  4B9O A;  3IF5 A;  4MN6 A;  5DJU A;  4L9G A;  3H7W B;  2VGL S;  3EOI A;  5F83 A;  1JWP A;  1RGY A;  5HSQ A;  5FAT A;  2VGJ A;  2ZD8 A;  1HTZ A;  1SKO B;  4L9F A;  4EEU A;  1EI5 A;  4Y7P A;  5HWT A;  3MS6 A;  3NHQ A;  4YOF A;  2FFY A;  4RX3 A;  1BUL A;  1Z6F A;  3HLD A;  3O87 A;  4ZJ3 A;  4CLC A;  3HLF A;  4M3K A;  1S4S A;  2PD7 A;  2WGW A;  3B3X A;  4DDS A;  3HBR A;  4EBN A;  3DWZ A;  5GLC A;  1OTD A;  3BFG A;  5EVE A;  2W3G A;  2VZW A;  5FI7 A;  4G3K A;  2WYX A;  4ESP A;  3ZNY A;  2JKR I;  1PRQ A;  2PU2 A;  5CTM A;  4HJ6 A;  5BOH A;  2H0Y A;  2Y8H A;  3UE3 A;  3OCL A;  1W8Y A;  5G18 A;  3PBO A;  3VP1 A;  4ZJ2 A;  3VFF A;  2V0W A;  1W8Q A;  1MC0 A;  4QJG A;  1UGU A;  3OPH A;  2Y2J A;  1ES4 A;  4DXC A;  5IU1 A;  2W0N A;  2HDQ A;  1GHP A;  4OH0 A;  1EW0 A;  3IHB A;  4GCZ A;  4XUX A;  4I3I A;  2YKF A;  1ZC2 A;  3BQA A;  2EWV A;  4B4X A;  2IWD A;  3KSH A;  3QNC A;  2WKR A;  2L4R A;  5HD3 A;  1YT4 A;  4ME4 A;  4HEF A;  3BFC A;  4OKP A;  2ZM2 A;  1YMX A;  5GLD A;  1K6R A;  1T18 A;  4ETZ A;  1A0K A;  2VGL M;  2A24 B;  2G2W A;  1MWR A;  4HI4 A;  1UWP X;  1CK3 A;  2WKQ A;  4Q8I A;  3DTK A;  2PHY A;  3WS0 A;  3T4L A;  4KZ8 A;  4NK3 A;  4KZ5 A;  4E3M A;  5EVL A;  2GJ3 A;  4UHU A;  5CED A;  2YKH A;  2HP9 A;  4GD8 A;  4WMC D;  2X71 A;  2XFT A;  5AQB A;  5DFX A;  2L1M A;  5CER A;  2LB9 A;  1D06 A;  4LEN A;  1ONH A;  1HD8 A;  2HGV A;  5JYO A;  3LR3 A;  2GDN A;  3IBR A;  4HJ3 A;  1S1Z A;  2ZM8 A;  3UDI A;  3HLB A;  3CPT B;  3UB7 A;  4S2K A;  3VMA A;  3WS5 A;  4PKY A;  5EFW A;  3Q1F A;  1TVF A;  2ZQ8 A;  1J3W A;  1BYW A;  4WZ5 C;  3ISG A;  5M19 A;  4QU3 A;  3NOT C;  3IXB A;  4S2L A;  3IH8 A;  3LEQ A;  1K56 D;  3T1S A;  2A3U A;  4H8R A;  4KQR A;  3P09 A;  4EEP A;  1V9Y A;  5CGX A;  3LFV A;  4UAA A;  1MPL A;  4PM5 A;  3JVU A;  2H0T A;  2A2L A;  2B02 A;  4OLD A;  1ERM A;  3DTI A;  4I3J A;  1N9N A;  4GKU A;  3M2J A;  5GHY A;  3LYX A;  3HLE A;  2PD8 A;  1OTE A;  4X25 A;  3MQQ A;  1NYY A;  1Q2Q A;  1XJ6 A;  2E8J A;  1W5D A;  3PAE A;  3UMD A;  4BQM A;  2PU4 A;  2EX9 A;  1JNU A;  4GZB A;  1DP8 A;  2JKG A;  3LUQ A;  3LY4 A;  1LT0 A;  4WEJ A;  5FAO A;  4F3L A;  4RQ9 A;  4RA7 A;  3ZVT A;  2W3F A;  5CHJ A;  3BW6 A;  3PBT A;  4GS9 A;  1ES5 A;  4FSF A;  1FR1 A;  1D1J A;  3IF6 B;  5DF8 A;  3HUM A;  2EXA A;  3FZC A;  4HH2 A;  4KEN B;  1OT6 A;  4DN0 A;  3IX4 A;  5M18 A;  1LI0 A;  4KG2 A;  4EBL A;  3M6B A;  3S7Q A;  4HBT A;  3RTY A;  4BEN A;  4X68 A;  1YAX A;  1BLS A;  2HF6 A;  3MZD A;  1N4O A;  5G4Y A;  4BJP A;  1SKO A;  3DWK A;  3TW8 A;  2P08 A;  2DNS A;  1VEU A;  3H7W A;  4E3L A;  1S4R A;  3SOI A;  3SH9 A;  1PWD A;  3ZDJ A;  3HJI A;  2V8F A;  3QNB A;  4U0T A;  5FL3 A;  5HL1 A;  3E4Q A;  4Q0H A;  5KMW A;  4R23 A;  2K2N A;  1IYQ A;  5JYP A;  4N1H A;  5EVI D;  4I38 A;  3CHW P;  1K4F A;  5HW3 A;  2OAQ 1;  1XA1 A;  3CIT A;  3BEB A;  4MN7 A;  3T4T A;  1YKD A;  2J3T C;  1FIL A;  3KYE A;  2KOI A;  3HUN A;  2XLN A;  3JYI A;  2RCX A;  2PR5 A;  5HZH A;  4S2J A;  3LIE A;  5FAP A;  4FD8 A;  1L0D A;  1NLZ A;  3MXS A;  1G5U A;  2JE5 A;  2QHK A;  5FA7 A;  4S2N C;  4KZB A;  2WZZ A;  1XJ4 A;  4EBP A;  3CI6 A;  3TE8 A;  1JTG A;  2M7V A;  3W4Q A;  5MC7 A;  5E2H A;  1LSV A;  2KDK A;  3ICY A;  3G6O A;  1BLP A;  4GDN A;  3T4J A;  4I3A A;  1KOU A;  4JXV A;  4PM7 A;  5HPI A;  3ZCZ A;  3L9K A;  3BJN A;  4ZRR A;  4E3J A;  1G28 A;  3LEZ A;  3SS5 A;  1VQQ A;  1UWN X;  4C75 A;  1ACF A;  1YLT A;  4WBG A;  3E2L A;  4JGQ A;  3W4P A;  3T12 B;  1PWG A;  1K54 C;  4OOY A;  3K3C A;  5CGW A;  2HJ9 C;  1VEU B;  4HHD A;  4KZ9 A;  2Y2H A;  5HDD A;  3E2K A;  1P97 A;  5GLB A;  5TJJ A;  1OTB A;  3E98 A;  4CLC C;  3WS2 A;  3SS4 A;  2FH5 A;  3NIA A;  5IT5 A;  1E25 A;  1OTA A;  3BLM A;  3A3D A;  1FCN A;  5HAQ A;  4JBF A;  2J3T D;  2JN7 A;  4X56 A;  3KSF A;  5EV0 A;  1E3U A;  4WMC A;  3NCK A;  1L0G A;  4HES A;  4BL2 A;  1L0F A;  2V1B A;  3LCE A;  4FCF A;  4LV1 A;  2Z2M B;  1ZTU A;  4LV0 A;  3IXD A;  4O0P A;  4WL9 A;  3LGO A;  4K0W A;  2VK3 A;  3K3D A;  4E6X A;  3E0Y A;  1KDS A;  4GDB A;  5HWW A;  3QP1 A;  3A0R A;  2IA2 A;  2Y91 A;  5EM1 A;  1TF1 A;  1ERQ A;  4G3W A;  3CAX A;  3G2Y A;  3F1P B;  1C3B A;  3U2A A;  4PHT A;  5IHV A;  3UB5 P;  2GNX A;  1GSV A;  3VSK A;  5F82 A;  4KUK A;  1W79 A;  1MWU A;  3G2Z A;  4MN5 A;  4NXE A;  1T19 A;  3T4S A;  5CTN A;  2OLV A;  3TOI A;  3UB9 A;  1ZG4 A;  2QMI A;  4PPR A;  4MLL A;  3Q7V A;  2ZMA A;  1T1C A;  4RYE A;  2NUP C;  2WKI A;  3S1Y A;  3LR4 A;  5HAR A;  2XFS A;  3N7W A;  4QWO A;  1W7F A;  1NRF A;  5F6A A;  4JF5 A;  1F9I A;  2WAD A;  1JWV A;  5L8M A;  4XUZ A;  4UA7 A;  4B88 A;  2XGN A;  2J8Y A;  4ZTK A;  3TG9 A;  2HP5 A;  1WYC A;  4S2O A;  1G68 A;  4PM9 A;  1KE4 A;  4Z9Q A;  3T4Q A;  4RVA A;  4IJG A;  3BFF A;  1VHM A;  4UQI M;  4E3I A;  5A90 A;  5CRF A;  3NJA A;  3EEA A;  3OPR A;  4HOI A;  2EFU A;  1BLC A;  1G6A A;  2QJ5 A;  2XEP A;  2OOL A;  3MBZ A;  4QHC A;  1NZU A;  4H6J B;  4P0M A;  4OPZ A;  1JTD A;  4KUO A;  4OP8 A;  2ZQ7 A;  3BRM A;  2EA9 A;  3IX8 A;  2H28 A;  1TDG A;  2Y2O A;  4HBU A;  4BBV A;  5F1G A;  2W1T A;  3MZF A;  3NEC A;  3O3V A;  3P01 A;  1MWS A;  4GLQ A;  3NY4 A;  4LPZ A;  3KX0 X;  3ZG8 B;  3C4P A;  3V39 A;  3RXX A;  1PYY A;  3VFH A;  3PBN A;  4QY5 A;  1XJ3 A;  2H10 A;  4NET A;  1WA9 A;  4B4Z A;  4LV2 A;  2HDU A;  1LSX A;  4KZ4 A;  3UE6 A;  2XD1 A;  2XSS A;  3I7J A;  2QJ7 A;  1H8Y A;  1CI9 A;  3KYZ A;  3IT9 A;  3WWX A;  4BD1 A;  1H8M A;  1N9B A;  4BMW A;  3EEH A;  4ZBE A;  3VP0 A;  1U60 A;  3FV7 A;  1XKZ A;  3CWF A;  1K55 C;  1YLP A;  4ARZ A;  3V3S A;  1MY8 A;  3E4P A;  2Y2K A;  2HV1 A;  1H8Z A;  3MKF A;  3G31 A;  3HRE A;  2XA7 S;  2ZOI A;  1V9Z A;  2XA7 M;  1N9L A;  4S2I A;  4LCM A;  4LGW A;  4BBT A;  3G34 A;  2PYP A;  5FQK A;  2PBY A;  4KZ6 A;  2ZMV A;  3PHY A;  5HL6 A;  5HD5 A;  3ZG9 B;  2JKR M;  3G4P A;  1XGI A;  2VGK A;  3UDF A;  1CEG A;  4WUJ A;  1G6O A;  3RXW A;  1NXY A;  2HPB A;  1XPB A;  4LRZ E;  4DRT A;  3UN7 A;  2WUQ A;  1SZV A;  2PAV P;  1H3Q A;  1ODV A;  4KQQ A;  1LLB A;  3D72 A;  2G7U A;  4BLM A;  1SKF A;  1YLJ A;  3WS4 A;  1IOU A;  1M40 A;  3F1N B;  4NG2 A;  2A49 A;  4HP9 A;  3ZVW A;  4EXO A;  1DRM A;  4FOF A;  1KDW A;  4OLG A;  1PZP A;  3H82 A;  4YFM A;  4NXF A;  1FIK A;  2ZM0 A;  5TBM B;  2Z6D A;  1BUE A;  5M1A A;  3O88 A;  4NEE D;  2NUT C;  1SDE A;  2WKE A;  2WKP A;  5DTK A;  5GHX A;  2XH9 A;  1VM1 A;  3BWL A;  5CX7 A;  5HDS A;  1PI4 A;  4E04 A;  1T1B A;  5FQQ A;  4YIN A;  4GHI B;  1KGF A;  4FH2 A;  4OQI A;  1S67 L;  2EWW A;  4GW9 A;  1QMF A;  1K56 A;  3Q7Z A;  3HJK A;  3C4O A;  3N8S A;  3MFX A;  5LBR A;  3NBL A;  2XF3 A;  3NDG A;  1K4E A;  1NLY A;  4MNR A;  3IXH A;  1FOF A;  2ZOH A;  3LI9 A;  5AQ7 A;  1MBL A;  3ITA A;  1DY6 A;  2ZC6 B;  1XJ2 A;  4RX2 A;  3SH8 A;  3MJQ A; 
#chains in the Genus database with same CATH homology
 3HLG A;  1LI9 A;  1KE3 A;  1KGE A;  3C7U A;  2ZC5 B;  4N9K A;  1YM1 A;  3SH7 A;  3HUN A;  2XLN A;  3VFH A;  4BD0 A;  3JYI A;  2RCX A;  1L2S A;  3VSL A;  4S2J A;  5E2E A;  5F1F A;  5FAP A;  4FH4 A;  4DE3 A;  4E3O A;  5CGS A;  1K38 A;  4FD8 A;  2ZQC A;  3IXG A;  3TSG A;  1L0D A;  4Y0O A;  2EX2 A;  3PTE A;  3MXS A;  2JE5 A;  1KGG A;  1XX2 A;  3PAG A;  4EV4 A;  5FA7 A;  4S2N C;  3FYZ A;  1OME A;  4KZB A;  2WZZ A;  5DF9 A;  4EBP A;  2Y2M A;  1YLZ A;  4Y0T A;  3V50 A;  1JTG A;  3W4Q A;  4L0L A;  4OQG A;  5FSR A;  5E2H A;  4E6W A;  3MXR A;  4DF6 A;  1BLP A;  4GDN A;  2ZC4 B;  3A3E A;  4JXV A;  4WEK A;  3UPP A;  4PMA A;  4PM7 A;  2V1Z A;  4PM8 A;  2R9X A;  4DE2 A;  3ZCZ A;  3VP2 A;  4X69 A;  1HZO A;  4E3J A;  2Z2L B;  4IBR A;  3LEZ A;  5EOO A;  3AGD A;  1JVJ A;  1IYP A;  2XDM A;  3SS5 A;  1VQQ A;  1FSY A;  4JF6 A;  4E3N A;  3GRJ A;  5TFQ A;  4C75 A;  3BFD A;  3GTC A;  4JXW A;  1K25 A;  1YLT A;  3NI9 A;  5EE8 A;  4N92 A;  1GHM A;  4WBG A;  3E2L A;  2WZX A;  5CHM A;  3CJM A;  4CPK A;  3W4P A;  4IBX A;  2HP6 A;  4E3K A;  1PWG A;  1K54 C;  5FDH A;  5HAI A;  4OOY A;  4P87 A;  1GHI A;  3P98 A;  1RP5 A;  3O86 A;  5CGW A;  1LL5 A;  2WGI A;  5FQ9 A;  4EUZ A;  2JC7 A;  4KZ9 A;  1IYO A;  1MXO A;  2Y2H A;  4WEL A;  3E2K A;  3Q82 A;  5GLB A;  3ITB A;  5A92 A;  3IWO A;  4R3B A;  5J8X A;  5E43 A;  3WS2 A;  3SS4 A;  3VOY A;  3V5M A;  4S2P A;  3NIA A;  2EFX A;  2BLS A;  1E25 A;  3GQZ A;  3IH9 A;  3W4O A;  4WZ4 A;  2C5W B;  2WKH A;  1FR6 A;  3A3D A;  3BLM A;  2OV5 A;  3PBQ A;  1FCN A;  1BT5 A;  5HAQ A;  1ONG A;  4JBF A;  3Q07 A;  4D2O A;  4R3J A;  3HLC A;  2JBF A;  4OPY A;  1I2S A;  4X56 A;  4ZJ1 A;  3IHA A;  2RL3 A;  3EQU A;  4KZA A;  3VP4 A;  5E2G A;  1E3U A;  2ZLY A;  4WMC A;  3NC8 A;  3NCK A;  5I94 A;  1NYM A;  4X53 A;  2P9V B;  1PI5 A;  4R0Q A;  2Y55 A;  1L0G A;  4HES A;  4BL2 A;  1FCO A;  1L0F A;  3LCE A;  4FCF A;  3HL9 A;  3OCN A;  4LV1 A;  1PWC A;  3OZH A;  4KG6 A;  3AGE A;  4R4R A;  3IF5 A;  2Z2M B;  2J7V A;  4LV0 A;  2UWX A;  2XK1 A;  3IXD A;  1XA7 A;  4K0W A;  4WM9 A;  1FSW A;  5F83 A;  1JWP A;  4OPR A;  4U3T A;  4E6X A;  2I72 A;  1RGY A;  5FAT A;  3FWL A;  2VGJ A;  2ZD8 A;  1KDS A;  4GDB A;  1HTZ A;  4K0X A;  2X01 A;  5CEC A;  1RCJ A;  1Q2P A;  2J9O A;  1EI5 A;  2Q9M A;  1ZKJ A;  2Y91 A;  4Y7P A;  3N4I A;  3SS3 A;  2C6W B;  3NDE A;  4JXS A;  3FKW A;  1ERQ A;  4JF4 A;  2FFF B;  3G2Y A;  3LO7 A;  4JPM A;  2FFY A;  2ZC7 A;  1BUL A;  1C3B A;  1Z6F A;  3HLD A;  4RX3 A;  4JKT A;  3O87 A;  3G35 A;  5IHV A;  4ZJ3 A;  2Y2P A;  3ZNT A;  2X02 A;  3HLF A;  2E8I A;  2BG1 A;  4M3K A;  1K55 A;  5HAP A;  2ZQA A;  3CZD A;  2WGW A;  2V20 A;  3MFD A;  3VSK A;  2OSU A;  5F82 A;  1W79 A;  1MWU A;  3W8K A;  3B3X A;  3GMW A;  3G2Z A;  3G32 A;  1LL9 A;  3BFE A;  3BLS A;  4DDS A;  3HBR A;  4DE0 A;  4EBN A;  3DWZ A;  5CTN A;  2OLV A;  5GLC A;  5HFO A;  3TOI A;  1K57 C;  3BFG A;  1MKI A;  1ZG4 A;  3VOZ A;  2QMI A;  2Q9N A;  4OON A;  4PPR A;  5FI7 A;  4KZ3 A;  4GD6 A;  3Q7V A;  4MLL A;  1IKI A;  2WAE A;  2ZMA A;  4RYE A;  2Y2Q A;  1YLW A;  1GA0 A;  2WKI A;  2WYX A;  3S1Y A;  5EVI A;  3ZNY A;  4A5R A;  3UY6 A;  3IQA A;  4PM6 A;  2PU2 A;  5CTM A;  2Y2G A;  5HAR A;  1NY0 A;  5BOH A;  2H0Y A;  2XFS A;  3A3I A;  5FI2 A;  1BSG A;  1KVL A;  3UE3 A;  1IKG A;  3N7W A;  2XD5 A;  4GN2 A;  1W7F A;  3UPO A;  1NRF A;  3OCL A;  5DTT A;  1W8Y A;  4JF5 A;  4KZ7 A;  5G18 A;  2WAD A;  3PBO A;  3VP1 A;  1JWV A;  1PW8 A;  1KE0 A;  5FQJ A;  4XUZ A;  1WYB A;  4UA7 A;  4ZJ2 A;  3VFF A;  1GA9 A;  5D3O A;  4B88 A;  1WE4 A;  2XGN A;  2J8Y A;  3V3R A;  1W8Q A;  4ZTK A;  4QJG A;  3GR2 A;  3A3F A;  3DTM A;  3UDX A;  3OPP A;  2P74 A;  3OPH A;  2Y2J A;  3TG9 A;  1ES4 A;  2HP5 A;  1WYC A;  4OPQ A;  4S2O A;  1G68 A;  4DXC A;  5DVA A;  2HDQ A;  4PM9 A;  1GHP A;  4OH0 A;  4P6B A;  1CEF A;  5KZH A;  1KE4 A;  3IHB A;  1E3U D;  4Z9Q A;  5HX9 A;  4ID4 A;  5L2F A;  4XUX A;  3GV9 A;  2Y59 A;  4RVA A;  3BM6 A;  3PBS A;  1ZC2 A;  3BFF A;  4B4X A;  4E3I A;  5A90 A;  2WGV A;  5CRF A;  3OPL A;  2IWD A;  3OPR A;  3IWQ A;  3QNC A;  3Q7V B;  2JCH A;  1ZG6 A;  1BLC A;  2EFU A;  5DTS A;  4CJN A;  1G6A A;  1YT4 A;  2XR0 A;  2XEP A;  3UNW A;  3MBZ A;  4QHC A;  3QHY A;  1IEM A;  4HEF A;  1NZU A;  3BFC A;  4MBF A;  4OVD A;  4OKP A;  2QPN A;  4LV3 A;  4P0M A;  2ZM2 A;  1YMX A;  3BYD A;  3C7V A;  4OPZ A;  1JTD A;  5EEC A;  4GB7 A;  5GLD A;  1QME A;  4K91 A;  5EOE A;  4ZAM A;  1K6R A;  4QY6 A;  5CHU A;  5FAQ A;  4OP8 A;  2ZQ7 A;  3BRM A;  4GOG A;  1O7E A;  1S6R A;  1LHY A;  1L0E A;  2G2W A;  1TDG A;  1MWR A;  1DJB A;  4QD4 A;  1BZA A;  2Y2O A;  4U0X A;  1CK3 A;  1JWZ A;  3S4X A;  4HBU A;  4C3Q A;  3HUO A;  4Q8I A;  5F1G A;  4OOM A;  3WS0 A;  1YLY A;  3MZF A;  4KZ8 A;  4NK3 A;  4KZ5 A;  1XXM A;  4OOL A;  3O3V A;  3G30 A;  1MWS A;  4E3M A;  3NY4 A;  5EVL A;  5CEB A;  4GNU A;  2WK0 A;  3C4P A;  4UHU A;  2Y2L A;  3V39 A;  3ZG8 B;  5CED A;  2HP9 A;  4GD8 A;  3RXX A;  1PYY A;  4WMC D;  3PBN A;  2ZJ9 A;  3BEC A;  1PW1 A;  2X71 A;  2H10 A;  2XFT A;  4QY5 A;  1EWZ A;  5AQB A;  2G2U A;  2Y2N A;  5E2F A;  3WRT A;  4NET A;  5CER A;  3M6H A;  4DXB A;  4JXG A;  4B4Z A;  4LEN A;  1O07 A;  1YQS A;  1DJA A;  4LV2 A;  2HDU A;  4KZ4 A;  4IVI A;  1ONH A;  2XD1 A;  3I7J A;  3WS1 A;  1HD8 A;  1H8Y A;  1I2W A;  4KG5 A;  3CG5 A;  1TEM A;  4WZ5 A;  2H5S A;  5JYO A;  2HDR A;  1CI9 A;  3IT9 A;  3WWX A;  1SHV A;  2GDN A;  4O7D A;  1RGZ A;  2ZM8 A;  3UDI A;  4BD1 A;  1N9B A;  3HLB A;  3ZG5 A;  1TDL A;  4S2K A;  4ZBE A;  3VP0 A;  5FQM A;  1U60 A;  2J9P A;  3FV7 A;  2V2F F;  4DKI A;  1IYS A;  1XKZ A;  3VMA A;  1K55 C;  1YLP A;  5KSH A;  4Y0U A;  3WS5 A;  3V3S A;  4UA9 A;  5EVI B;  1MY8 A;  3WRZ A;  2Y2K A;  3IF6 A;  1PZO A;  3Q1F A;  3UE1 A;  1TVF A;  1H8Z A;  1SDN A;  2ZQ8 A;  3MKF A;  4WZ5 C;  5FQI A;  3G31 A;  1IEL A;  1GCE A;  3HRE A;  3ISG A;  1YMS A;  5M19 A;  4QU3 A;  4R1G A;  4X55 A;  1DJC A;  4C6Y A;  4N1X A;  3N8R A;  3PBR A;  3IXB A;  1Y54 A;  4N9L A;  4S2L A;  1MWT A;  3IH8 A;  4S2I A;  1K56 D;  4OP5 A;  4LCM A;  3G34 A;  2A3U A;  4EQI A;  4H8R A;  4KQR A;  5FQK A;  2PBY A;  3P09 A;  1H5X A;  1J9M A;  3Q81 A;  2WGW B;  4KZ6 A;  3ZGA B;  2B5R A;  3MZE A;  5CGX A;  1BTL A;  4UAA A;  1KVM A;  3ZG0 A;  3UO9 A;  1HVB A;  1CI8 A;  1MPL A;  4PM5 A;  2H0T A;  3UPN A;  1BLH A;  3ZG9 B;  3G4P A;  4WYY A;  4OLD A;  1XGI A;  1ERO A;  1ERM A;  3HVF A;  2VGK A;  5A91 A;  3UDF A;  4GKU A;  1CEG A;  3M2J A;  5GHY A;  3HLE A;  1FCM A;  1ESI A;  2Y4A A;  1NYY A;  2CC1 A;  3FKV A;  1NXY A;  1NZO A;  1Q2Q A;  2HPB A;  1XPB A;  3OC2 A;  3GSG A;  4IED A;  4LCL A;  3RXW A;  4MEZ A;  2EX8 A;  4DE1 A;  4DRT A;  3S22 A;  1W5D A;  3UN7 A;  2IWC A;  4F94 A;  2WUQ A;  3PAE A;  4ZDX A;  3A3J A;  4BQM A;  2PU4 A;  3IF6 C;  2EX9 A;  4P85 A;  2DCF A;  2QZ6 A;  4KQQ A;  1LLB A;  5EVI C;  4GZB A;  2XQZ A;  1M6K A;  4BLM A;  4S2M A;  4MBK A;  3VP3 A;  4BL3 A;  1SKF A;  1YLJ A;  3LY4 A;  3WS4 A;  4QB8 A;  5DF7 A;  3CMZ A;  4WEJ A;  5FAO A;  1M40 A;  5FAS A;  1XP4 A;  1E4D A;  1I5Q A;  1K6S A;  4RA7 A;  1ALQ A;  3ZVT A;  5CHJ A;  1K54 A;  3PBT A;  3M2K A;  2A49 A;  3GVB A;  4DDY A;  1ES5 A;  2EXB A;  4UA6 A;  5CXW A;  3ZG7 B;  4FSF A;  3ZVW A;  1FR1 A;  2ZQ9 A;  4EWF A;  2WAF A;  3IF6 B;  3IWI A;  1KDW A;  4OLG A;  1PZP A;  2R9W A;  3HUM A;  5DF8 A;  2EXA A;  4YFM A;  3FZC A;  1S0W A;  4KEN B;  1PIO A;  2ZM0 A;  3ZHH A;  3EQV A;  5M18 A;  1LI0 A;  4KG2 A;  4EBL A;  1XGJ A;  3M6B A;  5TGF A;  1BUE A;  5M1A A;  3RJU A;  4HBT A;  3O88 A;  5TR7 A;  1ESU A;  5AQA A;  5GL9 A;  1SDE A;  2DRW A;  2WKE A;  3AGF A;  3C5A A;  4BEN A;  4XXR A;  4X68 A;  4KQO A;  1BLS A;  3MZD A;  1N4O A;  3N6I A;  3D4F A;  2IWB A;  4BJP A;  3DWK A;  5EPH A;  4IVK A;  5DTK A;  5GLA A;  3MKE A;  5GHX A;  4X6T A;  5FI6 A;  2XH9 A;  1VM1 A;  2DNS A;  4R4S A;  3DW0 A;  1PI4 A;  1ES3 A;  2HDS A;  4OQ0 A;  5FQQ A;  4YIN A;  1KGF A;  5AQ9 A;  1NJ4 A;  1K57 A;  4FH2 A;  4OQI A;  4OQH A;  2ZQD A;  4E3L A;  1QMF A;  1K56 A;  2Y2I A;  2EX6 A;  3Q7Z A;  3SOI A;  1ES2 A;  3C4O A;  3SH9 A;  3N8S A;  1PWD A;  3ZDJ A;  3QNB A;  3NBL A;  1AXB A;  2OLU A;  2P9V A;  2XF3 A;  3UE0 A;  3HLW A;  4U0T A;  3NDG A;  1K4E A;  5HL1 A;  4MNR A;  3IXH A;  5KSC A;  1FOF A;  5KMW A;  4R23 A;  3N8L A;  5AQ7 A;  5A93 A;  1MBL A;  3ITA A;  1IYQ A;  3LY3 A;  1DY6 A;  5JYP A;  4N1H A;  4MBH A;  5EVI D;  4JLF A;  1SCW A;  2ZC6 B;  5U47 A;  1K4F A;  5HW3 A;  4S2N A;  1FQG A;  5EUA A;  5GHZ A;  1XA1 A;  4RX2 A;  3SH8 A;  3ZFZ A;  2ZC3 B;  3BEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...