1YMXA

X-ray crystallographic structure of ctx-m-9 beta-lactamase covalently linked to cefoxitin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase CTX-M-9
publication title Structure, Function, and Inhibition along the Reaction Coordinate of CTX-M beta-Lactamases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 93
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ymxA00
1TDLA 2P9VB 1L0EA 1EI5A 2JCHA 2RCXA 1H5XA 4H8RA 3VFHA 1M6KA 3N8SA 4GDNA 4MLLA 1E25A 2H0TA 5HL1A 4R1GA 1IYSA 5HX9A 5EOOA 5FATA 5JYPA 2V1ZA 3BFFA 5FQIA 4ZJ1A 2QZ6A 1PWCA 3ZVWA 2R9WA 4OQ0A 4EUZA 4MBHA 5AQ9A 1VQQA 1ZG6A 3HLBA 4DE0A 3UPOA 1XX2A 4FSFA 1DY6A 1NRFA 2WGVA 4PMAA 3EQVA 5FI6A 5M1AA 3S22A 5GHZA 1PW8A 3P98A 2H5SA 3E2LA 3SS5A 4E3OA 5F1GA 4JPMA 3DWKA 4QY6A 2Y2PA 2RL3A 5A91A 3HLFA 5U47A 4B4ZA 3FYZA 1L2SA 5CXWA 4OOMA 4K0XA 3A3DA 3PAEA 3RJUA 4CPKA 3BLMA 3HL9A 4LV2A 5M19A 5FI7A 3WRTA 3OCLA 5KZHA 5CGWA 4QU3A 4YINA 4DE1A 2XR0A 3OPPA 1JTDA 3LY3A 3P09A 3PBRA 4C3QA 4RYEA 3SH7A 5FAPA 4DXCA 4EBNA 1K6SA 1J9MA 1YLPA 1YMXA 1XXMA 2EX2A 4R0QA 2Y2HA 3IHBA 3LY4A 4GD8A 3Q07A 4OQGA 1ZC2A 1W79A 1W8QA 4BLMA 2ZC4B 3HLGA 3GSGA 1XKZA 1MWUA 2JBFA 5G18A 5F1FA 3C4PA 5GHYA 2Y2QA 1AXBA 4MNRA 5CERA 1KDSA 2XGNA 3AGFA 1FQGA 2PBYA 2Z2MB 3G32A 1LL9A 4B4XA 4GDBA 3GR2A 3DWZA 3IH8A 3ZFZA 4K0WA 4FH4A 3Q7VA 4X56A 3W4QA 3IXHA 1K55A 1CK3A 3C4OA 3IXBA 4WM9A 4Y7PA 3C5AA 3ZNTA 4E3JA 4HBUA 5CHJA 2E8IA 2V2FF 3HLCA 2Y59A 4RVAA 1L0DA 1N4OA 4GN2A 1K4EA 4GZBA 5I94A 1LLBA 2ZMAA 1JTGA 3G34A 3D4FA 3NBLA 4WEKA 4LV3A 4OONA 1ES3A 4Y0TA 2Y91A 3PBQA 2XH9A 3DTMA 4UA9A 3ZVTA 1NZOA 1C3BA 4K91A 4X55A 5CGXA 3WS2A 4BD1A 1SDNA 1JVJA 3GQZA 3CZDA 2A3UA 3JYIA 4S2OA 4CJNA 1BLSA 3UDFA 3OPLA 1SKFA 3OCNA 4Y0UA 5HAQA 2DNSA 3ZG7B 3PBOA 1GHPA 4ZJ3A 2C6WB 3BM6A 4U0XA 4QB8A 1PZOA 3OPHA 3M6HA 5FASA 1NZUA 2ZM2A 1I2WA 4NETA 1TVFA 1GA0A 2ZC3B 2ZQ9A 3IF6A 3MBZA 3NDGA 5HAIA 2WKHA 1E4DA 1FCOA 1Z6FA 3SH9A 4ZAMA 3WS0A 4Q8IA 3UO9A 2ZC7A 1K25A 1BTLA 1GCEA 4WBGA 4LCMA 5DF7A 3UNWA 5A90A 4KZ4A 1KE3A 3FKWA 1HD8A 2HP5A 4U0TA 1FCNA 2JC7A 2XEPA 3DW0A 3PBSA 2WYXA 2A49A 1IKGA 3LCEA 3IWQA 3MKEA 3HLDA 2EFXA 1K57C 1K4FA 4JBFA 5E43A 3VP0A 1YQSA 2Y2MA 3CMZA 3NI9A 4YFMA 4M3KA 2ZM8A 4R23A 5EE8A 5FI2A 3G31A 4PM6A 4WZ4A 5HW3A 4FCFA 4P0MA 3SS4A 3HUOA 1HVBA 4JXVA 2XLNA 1SCWA 4S2KA 1ZG4A 1SHVA 2V20A 3LO7A 2Y2JA 3VFFA 3QNCA 3BEBA 5EUAA 4LV1A 3UE3A 1XA1A 3V39A 4E3IA 4ZTKA 4OLDA 3IH9A 1PW1A 1GA9A 1PI4A 4KZ5A 2H0YA 2XQZA 2OLVA 1ERMA 2WGIA 3CG5A 5EVLA 5TR7A 3EQUA 4IVKA 1N9BA 3HUNA 1ONHA 4MBKA 5EVIB 1KE4A 4IEDA 5CRFA 5FSRA 3PBNA 4N9KA 1XA7A 1PI5A 4KQOA 4LCLA 3G35A 1QMEA 5FAQA 4WYYA 1S0WA 5FQ9A 4OP8A 5GLDA 1IEMA 5DVAA 2Z2LB 2VGJA 4WELA 3IWOA 4S2IA 1ONGA 3C7UA 3UE0A 1XGJA 3BYDA 3OZHA 4RX2A 1MWRA 1YMSA 1E3UD 2ZLYA 4OPRA 4QY5A 4JXSA 1L0GA 3V5MA 4E3MA 2WAFA 4OPZA 3VP4A 1Q2QA 4N92A 2OLUA 1CEFA 3VSKA 3VSLA 3AGDA 1NY0A 3Q82A 4BQMA 2Q9NA 5DTSA 2WGWA 4S2PA 4WMCA 3VOZA 2J9OA 2X71A 3QHYA 1K56D 3WWXA 3IF6B 4DE3A 2Y2KA 1CEGA 1FSWA 3G2ZA 1BLPA 1KGGA 1MXOA 2Y2LA 2Y2OA 3O3VA 5J8XA 2Y4AA 4KQQA 1RGZA 3TSGA 1DJCA 2HP6A 3ZG0A 4DKIA 1W7FA 1CI8A 4OQHA 5CTMA 1IYOA 2ZD8A 3FKVA 4E6XA 1KGFA 3NY4A 3W4OA 1BUEA 1NXYA 5GLCA 4OOLA 3N7WA 4PM9A 2WZXA 3GRJA 4R4SA 3UE1A 5E2GA 5FDHA 1LI0A 4GD6A 5L2FA 5DTKA 4HBTA 2G2WA 3ZG9B 4EBLA 5KMWA 4BENA 5JYOA 4A5RA 3QNBA 1K54A 1FR6A 1XP4A 2I72A 4P85A 1ES2A 2P9VA 5F83A 5CECA 1BULA 2PU4A 1ALQA 2HDUA 3GTCA 3IWIA 1H8YA 2XFTA 3VP2A 5CEDA 1K54C 3SH8A 4OKPA 5EECA 4DE2A 1Q2PA 1QMFA 1KDWA 3G4PA 4DF6A 4R3JA 1HZOA 2J9PA 2P74A 3OC2A 1DJAA 4XXRA 5CEBA 1MY8A 3ISGA 4IBRA 1FOFA 3NDEA 5BOHA 4S2MA 2QPNA 1YLJA 3IF5A 1G68A 4LV0A 4N9LA 2J8YA 5E2HA 4GKUA 2OV5A 4OOYA 3GV9A 1ESUA 1NYMA 4WZ5C 3G2YA 4Z9QA 3G30A 2UWXA 4QD4A 5D3OA 4NK3A 2WAEA 3NC8A 4KZ7A 5E2EA 2ZQCA 4JF5A 4MBFA 2ZQDA 3ZDJA 4BD0A 3S4XA 5CTNA 4QHCA 4C75A 5GLAA 5FQKA 3ZHHA 1IYPA 4EBPA 4EV4A 3N6IA 1FR1A 2XF3A 3HLWA 4B88A 3B3XA 3UDIA 3VP1A 4OH0A 2GDNA 1JWPA 5TGFA 1K57A 3V3SA 1ES5A 5CHUA 4S2JA 5HAPA 3C7VA 3VMAA 4ID4A 2FFFB 3FWLA 4UA7A 2EFUA 1S6RA 3M6BA 4P87A 2X01A 3UPNA 4F94A 2HP9A 4JF6A 5EOEA 5FAOA 1VM1A 1WYCA 3GMWA 3RXWA 5F82A 2HDQA 5EPHA 1RCJA 3BFGA 2WKEA 4KZBA 4X53A 3MXSA 5M18A 1RP5A 3BRMA 1O7EA 4IVIA 2VGKA 4D2OA 2ZQ8A 2H10A 5DTTA 3Q7VB 1BT5A 3W4PA 2WK0A 1IKIA 3AGEA 1IYQA 2WZZA 1XPBA 1FSYA 2EX8A 4OP5A 4X69A 1YLTA 1TDGA 4QJGA 1YLZA 5GLBA 5AQBA 2ZC5B 3UY6A 1YLYA 4DXBA 4R3BA 4PPRA 3HBRA 4S2NC 3O86A 1CI9A 4X68A 1NJ4A 1DJBA 4IBXA 3W8KA 5AQ7A 1L0FA 4ZBEA 1ERQA 4GOGA 5EVID 3ITAA 3Q1FA 4XUXA 1MKIA 3Q7ZA 3PTEA 4KENB 1PWDA 2EXBA 4HEFA 2G2UA 3BLSA 1BSGA 4Y0OA 3V50A 4JXGA 3BECA 2XD1A 4PM8A 5E2FA 1KVMA 2FFYA 4BL2A 3MZDA 3MZFA 4P6BA 2Y2GA 3NCKA 2BG1A 3HVFA 3A3JA 4U3TA 1O07A 3WS4A 3UDXA 4OPYA 1YM1A 2ZQAA 4FD8A 4JXWA 3VP3A 1EROA 3IXDA 3M2JA 4WEJA 5FQQA 1W5DA 5TFQA 3SOIA 1MPLA 2HPBA 2X02A 3GVBA 4X6TA 2Y2IA 4E3KA 4FH2A 4C6YA 1YT4A 2DCFA 3A3IA 2QMIA 4KZ9A 4OLGA 5FQMA 5A92A 1LL5A 1GHMA 5GHXA 2ZC6B 3OPRA 1PYYA 3WRZA 1GHIA 1YLWA 1RGYA 2DRWA 2IWBA 4OPQA 3CJMA 4UHUA 3TG9A 3V3RA 5AQAA 1PZPA 2ZM0A 4EWFA 4JLFA 1BZAA 3BFDA 4KZAA 5FA7A 3S1YA 3PAGA 3N8RA 1EWZA 3SS3A 3WS1A 3ZGAB 1WE4A 1ESIA 1U60A 4BL3A 1I5QA 2ZQ7A 5A93A 1IELA 4E3LA 4PM5A 1H8ZA 3MZEA 4E6WA 4L0LA 3ZCZA 1LHYA 2IWDA 4KZ8A 1XGIA 5DF9A 1HTZA 4N1XA 3VOYA 4MEZA 3HUMA 1MWSA 3ITBA 3M2KA 4N1HA 4KZ3A 4ZDXA 1BLHA 3N8LA 4BJPA 3I7JA 4OQIA 1BLCA 4WZ5A 3BFEA 3ZG8B 1K55C 1KGEA 2WUQA 3IQAA 4PM7A 1JWZA 1PWGA 3NIAA 5CGSA 3MXRA 5EVIA 1WYBA 5DF8A 1KVLA 3IT9A 5CHMA 4GNUA 2WADA 2ZJ9A 2CC1A 3IXGA 5EVIC 1SDEA 4LENA 1FCMA 2Y2NA 4E3NA 4KG2A 5GL9A 1MBLA 4HESA 1PIOA 3MKFA 4UAAA 3FZCA 3MFDA 3N4IA 1E3UA 4DDYA 3O88A 2XDMA 1TEMA 2JE5A 3HLEA 1I2SA 3IHAA 5KSCA 3O87A 5FQJA 3E2KA 4S2LA 5HARA 4DDSA 4KZ6A 1W8YA 4KQRA 2EXAA 2Q9MA 2HDRA 4ZJ2A 1G6AA 3A3EA 5KSHA 2WGWB 1K56A 4RA7A 4JKTA 4XUZA 1ES4A 1JWVA 1OMEA 3RXXA 2IWCA 3LEZA 4EQIA 4R4RA 1MWTA 4WMCD 3HREA 2WKIA 3PBTA 5IHVA 3ZNYA 2XD5A 4KG6A 1K38A 2XK1A 2B5RA 1Y54A 3A3FA 1NYYA 2EX6A 3IF6C 3Q81A 2C5WB 3UN7A 4GB7A 3FV7A 1KE0A 3UPPA 4KG5A 1LI9A 2EX9A 4OVDA 3ZG5A 1ZKJA 1K6RA 2R9XA 5HFOA 3TOIA 4DRTA 2Y55A 4UA6A 4JF4A 2BLSA 2PU2A 3WS5A 2XFSA 3BFCA 4S2NA 2J7VA 4RX3A 2HDSA 4O7DA 1M40A 2OSUA
chains in the Genus database with same CATH superfamily
2W3HA 3VFHA 1E25A 3PYPA 2PDRA 3BJNA 3TJZC 2PD7A 3ZVWA 2WKRA 4OQ0A 4EUZA 3UPOA 4FSFA 1DY6A 1NRFA 5AVEA 5F1GA 5HWWA 2RL3A 5A91A 4CPKA 3HL9A 5FI7A 1GSVA 2JN7A 4DE1A 3LR5A 2R78A 3SH7A 5FAPA 1T18A 1YLPA 2V9AA 2Y2HA 4WN5A 2XROA 4BLMA 4E04A 3GSGA 2JBFA 5CERA 4MNRA 2XGNA 2Z2MB 4ETXA 3GR2A 1TS6A 1K55A 4UEYA 4Y7PA 3KO6A 2E8IA 2V2FF 4G3VA 4RVAA 1K4EA 5J3WA 4WEKA 3H7WA 4OONA 1X0OA 4K91A 5CGXA 1JVJA 3VE3A 4M4XA 3KYZA 4Y0UA 4R70A 3PBOA 1GHPA 2C6WB 5DKKA 3M6HA 4MN7A 2M7VA 2WKQA 2ZM2A 4NETA 4YWZA 1TVFA 2ZBBA 1CJFA 3MBZA 3NOPC 4ZAMA 1VEUB 2V0UA 3CPTB 1VHMA 1KE3A 2HP5A 4WUJA 2OWHA 2XEPA 3DW0A 2WYXA 3MKEA 3HLDA 1K57C 1K4FA 3T4SA 3VP0A 3VOLA 1HVBA 2P7JA 1SCWA 1ZG4A 4WF0A 3LI9A 3QNCA 3LUQA 4LV1A 1XA1A 2L1MA 5CX7A 4ZTKA 4OLDA 3IH9A 4KZ5A 4I3JA 1ERMA 2WGIA 5TR7A 5EVLA 1OPXA 1N9BA 2O0YA 4MBKA 5CRFA 1OTEA 3MSHA 3PBNA 4N9KA 5DFYA 5FAQA 1S0WA 5FQ9A 5GLDA 1IEMA 5DVAA 4R3AA 2Z2LB 2VGJA 4H6JB 2PR6A 4S2IA 1ONGA 3UE0A 3CWFA 1YMSA 1E3UD 2WAFA 1CQAA 1OTBA 2A2LA 4YNRA 3D72A 2Y8HA 2J9OA 2X71A 4K08A 1CEGA 3G2ZA 2ZMFA 3O3VA 2Y2OA 5J8XA 3DTIA 1P0ZA 1DJCA 3CITA 3ZG0A 4B9OA 4OQHA 1IYOA 2ZD8A 3FKVA 1LSWA 4I3AA 4OOLA 2WZXA 3GRJA 2JKTM 5L2FA 1K54A 3DBAA 2I72A 2Q0OA 3IWIA 5CEDA 2UV0E 4L9EA 5HL6A 4I3IA 3MJQA 3G4PA 4R3JA 2J9PA 2P74A 2W1TA 4ESPA 3VV4A 5CEBA 3DAVA 4IBRA 1G6OA 4DMZA 5E2HA 3G2YA 3EGDC 1S1YA 4KZ7A 2ZQCA 4MBFA 4Q0IA 3ZDJA 1FILA 5CTNA 4QHCA 2GJ3A 4EBPA 1IYPA 1DRMA 1FR1A 5HD5A 4OH0A 2OAQ1 5HWVA 2GDNA 1K57A 3V3SA 3T1SA 1YSPA 4S2JA 3C7VA 3UB9A 4EUVA 5J4EA 3G6OA 4JF6A 5FAOA 1WYCA 1RCJA 4X53A 3MXSA 5TBMB 5M18A 1RP5A 3BRMA 4IVIA 3EGXC 3IBJA 2H10A 5DTTA 3A0VA 3W4PA 1IYQA 2WZZA 1XPBA 1FSYA 2EX8A 4OP5A 4II7A 1KOUA 2W27A 4QJGA 4R6LA 3JVUA 2ZC5B 3BQ8A 3UY6A 3JVVA 4R3BA 4PPRA 4GJ4A 4X68A 3HBRA 3O86A 1CI9A 4IBXA 5AQ7A 4GOGA 4Q0JA 2EXBA 4Y0OA 3BECA 2B02A 4PM8A 4P6BA 2Y2GA 4U3TA 2BG1A 2PBDP 3WS4A 3T4OA 3VP3A 1ACFA 3IXDA 5FQQA 4X6TA 2DCFA 2QMIA 2D01A 3D9YA 5FQMA 4HQAA 5AQAA 2W1RA 4EWFA 4JLFA 5J7EA 2QYBA 3PAGA 3WS1A 1STZA 1U60A 5A93A 1MKMA 4L0LA 1LHYA 1XGIA 1T1CA 2P08A 1YAXA 3VOYA 5FEGA 3ZQ5A 4KZ3A 4ZDXA 5AVFA 3IS2A 3BFEA 2WUQA 4HHDA 3KSGA 1PWGA 3MXRA 1D1JA 1G28A 5HPIA 4HJ4A 2WADA 5EVIC 5L09A 2V1BA 4LENA 2Y2NA 4WLAA 4UAAA 3BW6A 3O88A 1TS7A 4KQRA 4ZJ2A 5HPFA 1G6AA 1XFQA 1K56A 4RA7A 1ES4A 3UMDA 3LEZA 1MWTA 2WKIA 4KG6A 3UB7A 3FPWA 5TJJA 5DJTA 2VV7A 3NOTC 2C5WB 2HV1A 4GB7A 4OVDA 3ZG5A 4PKYG 3TOIA 2QKPA 3CUEC 4BBVA 4O7DA 2K7SA 5DJUA 2E8JA 4H8RA 4GDNA 2H0TA 4R1GA 3PR6A 5EOOA 5JYPA 4LPZA 3BFFA 5FQIA 2QZ6A 2R9WA 3HLBA 1XJ2A 3S22A 5FI6A 3EQVA 1PW8A 3F1NA 3E2LA 3DWKA 5G4YA 3MXQA 2PR5A 1JNUA 5A8BA 4G3WA 5CGWA 2BTFP 1JTDA 2PRFA 3LY3A 3P09A 3MR0A 4C3QA 4EBNA 1K6SA 1YMXA 3KYEA 2EX2A 3IHBA 3LY4A 3Q07A 3HJKA 4GHIB 1W79A 1UWPX 5G18A 1PFLA 5TBMA 1LSXA 3G32A 4B4XA 3T1QB 5L07A 3IXHA 3IXBA 2PD8A 4WM9A 4E3JA 2KOIA 2Y59A 1N4OA 4GN2A 5I94A 1LLBA 1JTGA 4UQIS 2G7UA 4CLCE 3ULFA 1BYWA 3NBLA 2VV8A 3QP6A 4I5SA 1ODVA 3PBQA 4UA9A 1LT0A 5L8MA 5I5LA 3T1XA 4S2OA 3JYIA 3CZDA 1S66L 4QB8A 2OAP1 5FASA 4ZRRA 4ARZB 1I2WA 2ZC3B 4ME4A 2K2NA 3QP2A 1GCEA 4LCMA 2NUTC 4HJ3A 3PBSA 4NEED 1IKGA 3IWQA 2EFXA 4JBFA 4YFMA 1CF0A 4R23A 5EE8A 2HF6A 4PM6A 3T50A 5HW3A 4FCFA 1YKDA 2Z6DA 1NLZA 1SHVA 1XJ6A 3UE3A 1SKOB 3U4LP 4NG2A 4E3IA 1GSXA 3U2AA 2OLVA 5FSRA 5HSQA 4LLOB 1PI5A 3G35A 1QMEA 5EVEA 4WYYA 3MFXA 3BY8A 4EETB 5FEFA 3PHYA 4QY5A 3HCYA 4JXSA 1DP9A 2OLUA 3VSLA 1NY0A 4S2PA 3LICA 2JKFA 1K56D 3FG8A 3IF6B 3LIDA 4DE3A 1FSWA 1ZHHB 5MC7A 2Y2LA 2Y4AA 3TSGA 1V9ZA 1W7FA 1J3WA 4E6XA 1KGFA 4CQHA 1BUEA 1NXYA 5GLCA 4P6ZS 4R4SA 2JHEA 5E2GA 1LI0A 3ZG9B 3F1OA 4A5RA 5F83A 2NUPC 1ALQA 2HDUA 4CLCB 1S67L 1K54C 3R7WB 5EECA 1F5MA 4X25A 1TS8A 3OC2A 3KX0X 1DJAA 1MY8A 3ISGA 4HIAA 3NDEA 2QPNA 4LV0A 4N9LA 4OOYA 2CMNA 3C8CA 5D3OA 2WAEA 2ZMVA 1OTDA 1NWZA 1W63Q 1S1ZA 5FQKA 3N6IA 3HLWA 3VP1A 1N9LA 4UQIM 5HAPA 3LIEA 3VMAA 2QJ7A 4FUWA 4ID4A 3UB5P 1S6RA 3LIAA 4GHIA 5EOEA 1VM1A 3MQ0A 2HDQA 5EPHA 3BFGA 4KZBA 1O7EA 3OLOA 2VGKA 3Q7VB 2WK0A 1IKIA 1MC0A 1F98A 1YLTA 1TDGA 4GLQA 5AQBA 1YLYA 1Y4OA 1NJ4A 1DJBA 1P9RA 1L0FA 5EVID 3Q1FA 1MKIA 3PTEA 4HEFA 2G2UA 4PKYA 4JXGA 2XD1A 5E2FA 2FFYA 4BL2A 3TE8A 3MZDA 2A24B 4GW9A 2Z6CA 4HP4A 5IT5A 1YM1A 4ARZA 1L3LA 3RFBA 2D02A 5TFQA 1HLUP 2Y2IA 1EW0A 4FH2A 4JGPA 3A3IA 1F9IA 5FL3A 1G5UA 3A0RA 3MS6A 3FPVA 3CJMA 1PZPA 1BZAA 4HY8A 4KZAA 1T1BA 5FA7A 4IHQA 3N8RA 2ZQ7A 2J3WA 4E3LA 4PM5A 4E6WA 2IWDA 2O9CA 1HTZA 4RQ9A 1PRQA 4EW7A 2XSSA 4EXOA 3NECA 2OOLA 3N8LA 4HJ6A 1BLCA 3ZG8B 1KGEA 4FOFA 5HZHA 1WYBA 2WKPA 4MMNA 1KVLA 2MJ6A 5CHMA 4GNUA 2ZJ9A 2CC1A 4Q0HA 1FCMA 4E3NA 4JGOA 5GL9A 1MBLA 4DDYA 3N4IA 4P6ZM 5IU1A 3W2ZA 3HLEA 3IHAA 2VJWA 4DDSA 1W8YA 2HDRA 4X1MA 4XUZA 4I38A 1OMEA 2JKRM 3RXXA 2OWJA 4O8GA 3ZNYA 3LFVA 1NYYA 2EX6A 3Q81A 3FV7A 1KE0A 2QHKA 3L9KA 3BY9A 4JF4A 4KQDA 3WS5A 2J7VA 4RX3A 1N9NA 4YOFA 2HDSA 1IFQA 1TDLA 2P9VB 2RCXA 1H5XA 4LRZE 1M6KA 4MLLA 4CLCA 4HNBA 3R7WA 2M1CA 5FATA 2H28A 4ZJ1A 4NXFA 4PAUA 4MBHA 1ZG6A 4DE0A 1OT9A 5GHZA 2VGLS 3P98A 3SS5A 2Y2PA 4IJGA 3HLFA 1H0MA 3FYZA 4OOMA 4K0XA 3A3DA 4JGRA 3RJUA 3LEQA 1VEUA 2XR0A 3CPTA 3PBRA 2W3DA 3L7HA 1J9MA 1A0KA 4R0QA 4GD8A 4QPRA 2M7UA 4OQGA 1W8QA 5F1FA 1XKZA 3C4PA 1P9WA 3T4JA 5GHYA 2Y2QA 3MQOA 1FQGA 4GDBA 4FH4A 3Q7VA 1CK3A 3C4OA 3C5AA 3ZNTA 1VETB 4PHTA 5CHJA 4O0PA 3S7NA 3HLCA 3QP1A 4GZBA 3C2WA 4LV3A 4H6JA 2Y91A 4XT2B 5F69A 2XH9A 3TRCA 3B47A 1NLYA 4X55A 4BD1A 4GS9B 1SDNA 3GQZA 2A3UA 1BLSA 3UDFA 3OPLA 3CI6A 1S4SA 1SKFA 2PYRA 2A24A 3OCNA 3ZG7B 3LR0A 4ZJ3A 5DKLA 1DP8A 3BM6A 4U0XA 2ZOIA 4IUHA 1NZUA 3T12B 1TD5A 2ZQ9A 3NDGA 3LGOA 1E4DA 5LBRA 3TW8A 3SH9A 4EU0A 1T19A 3WS0A 3UO9A 2ZC7A 3UNWA 5A90A 3LIBA 2LB9A 4NKPA 3FKWA 4Y2FA 4U0TA 1FCNA 3NHQA 3IX8A 2JKTI 3LCEA 1T1AA 5AJGA 2Y2MA 4M3KA 5FI2A 3O5YA 4S2KA 3HUOA 4JXVA 2XLNA 3LO7A 1D06A 3BEBA 3DTEA 5EUAA 3V39A 2FZ0A 3E4OA 4HI4A 5HDDA 5G4ZA 2XQZA 4DJ3A 3HUNA 1ONHA 2VKSA 4IEDA 2B95A 2HJEA 2EWVA 4LCLA 4LRXC 3H7WB 4OP8A 3VE4A 4WELA 4WL9A 3C7UA 1XGJA 3OZHA 4RX2A 2ZLYA 1L0GA 3V5MA 4E3MA 3VP4A 1Q2QA 4N92A 4HOIA 5DFXA 1CEFA 4BQMA 2Q9NA 4WMCA 1FIKA 3WWXA 2J80A 2W3EA 1KGGA 3HJIA 2GX5A 1MXOA 2IA2A 4KQQA 1RGZA 2VGLM 2KLIA 2HP6A 5CTMA 3NY4A 3W4OA 5F68A 5FDHA 5DTKA 4HBTA 4EBLA 5KMWA 5EFWA 4BENA 3QNBA 5CECA 4P85A 2P9VA 2PU4A 1Y28A 3GTCA 2XFTA 2HGVA 3LR3A 3BQAA 3EWKA 4OKPA 2INWA 2XRNA 4DE2A 3E98A 1Q2PA 1KDWA 4DF6A 4KUOA 1FOFA 5BOHA 4DXBA 1YLJA 1G68A 2OV5A 1N9OA 1NYMA 4WZ5C 2UWXA 4LRYC 3CAXA 2W3GA 5E2EA 4JF5A 1W63M 4BD0A 3S4XA 5GLAA 2XF3A 4B88A 3T4TA 3B3XA 1K0KA 3JPUA 1JWPA 1ES5A 2YKHA 3B33A 3UB6A 2FFFB 3FWLA 3P7NA 2EFUA 3M6BA 4P87A 1OTIA 2X01A 3RXWA 3GMWA 3GECA 4D2OA 3K3CA 2ZQ8A 1BT5A 2FH5A 4X69A 3S7OA 3E4QA 3LR4A 4S2NC 2P04A 1ERQA 3ICYA 2QJ5A 1WA9A 4XUXA 1V9YA 1BSGA 3BLSA 4XT2A 4Z1WA 3V50A 2W1TB 2AVXA 4DN0A 3RH8B 1KVMA 4GS9A 3MZFA 3LIFA 3NCKA 3NJAA 3HVFA 1O07A 3GDIA 5F6AA 1OT6A 3UDXA 3IX3A 4FD8A 1PNEA 4R38A 1YPRA 3T4QA 1TF1A 3B42A 3M2JA 1W5DA 2X02A 1YT4A 2VLGA 1AWIA 4OLGA 1LL5A 1GHMA 5GHXA 3OPRA 4NXGA 3WRZA 1RGYA 5EM0A 3TG9A 3E4PA 4HP9A 3K2NA 4MN5A 3UMEA 1EWZA 3ZGAB 4MN6A 1ESIA 1I5QA 1UGUA 4BBUA 1IELA 2Y79A 3UE6A 4N1XA 3HUMA 2ACGA 2LB5A 2W0NA 4BJPA 3FC7A 4WZ5A 4PM7A 3IQAA 3MF0A 5CGSA 3OOVA 5DF8A 4BWIA 2VX8A 1NRJA 1SDEA 1F2KA 1PIOA 3MKFA 3MFDA 4G3KA 1TEMA 2JE5A 1I2SA 3O87A 4JGQA 3E2KA 4S2LA 2I9VA 5HARA 4NXEA 4KZ6A 2Q9MA 3CLOA 5KSHA 2WGWB 2PT7A 2IWCA 3ZYTA 4WMCD 3HREA 3PBTA 3QP5A 5IHVA 2XD5A 1K38A 2B5RA 1MZUA 1Y54A 3IF6C 4KG5A 1LI9A 2EX9A 1ZKJA 2R9XA 3F1PB 4DRTA 1H8MA 2J3TD 2Y55A 4UA6A 2PU2A 2XFSA 4S2NA 5HDCA 4B93A 1L0EA 1EI5A 2JCHA 3N8SA 5HL1A 1IYSA 5HX9A 2V1ZA 4CLCC 1PWCA 3IS2B 5AQ9A 1VQQA 1XX2A 4PMAA 5M1AA 2WGVA 4Y3IA 2H5SA 4E3OA 2KX6A 2L4RA 4JPMA 4QY6A 5U47A 4B4ZA 1L2SA 5CXWA 3H9WA 3PAEA 3BLMA 1H3QA 4LV2A 5M19A 3WRTA 3OCLA 5KZHA 4YINA 4QU3A 2XA7S 3OPPA 3KSHA 4RYEA 4KUKA 4DXCA 1XXMA 4Y5FA 2EWWA 1ZC2A 3EEHA 2ZC4B 3HLGA 1MWUA 4MCWA 1AXBA 1KDSA 3AGFA 2VZWA 2PBYA 1LL9A 5HDSA 3DWZA 3IH8A 2VK3A 4K0WA 3ZFZA 1SKOA 3S7PA 4X56A 1LSVA 3W4QA 1UWNX 4F3LB 3SZTA 4HBUA 3QP4A 1YSQA 1L0DA 4X1LA 4EEPA 2ZMAA 3G34A 3D4FA 1ES3A 3UB8A 4Y0TA 3DTMA 3ZVTA 1NZOA 1C3BA 3WS2A 3P01A 3KYQA 3T4KA 4CJNA 3QP8A 3F1NB 5HAQA 1XJ4A 2DNSA 3CHWP 1OJGA 1PZOA 3OPHA 4DJ2A 1GA0A 3IF6A 5HAIA 2WKHA 1FCOA 1Z6FA 2DMWA 4Q8IA 4WBGA 1K25A 1BTLA 5DF7A 4KZ4A 1HD8A 4L9FA 4D60A 2JC7A 2GNXA 2A49A 2PHYA 4EEUA 5E43A 1YQSA 2V8FA 3CMZA 3NI9A 2ZM8A 2JKGA 3G31A 4WZ4A 1GSWA 4P0MA 4ETZA 1Z09A 3SS4A 2HJ9C 4L9GA 2V20A 5HWTA 2Y2JA 3VFFA 3NOUC 2YKFA 1PW1A 1GA9A 1PI4A 2H0YA 5IS1A 3T1RA 2V1AA 3CG5A 3EQUA 3EEAA 2GZAA 4IVKA 2VV6A 5EVIB 1KE4A 1SZVA 1XA7A 4KQOA 1OTAA 3OBFA 4Y15A 2EA9A 3K3DA 3H82B 3IWOA 5EV0A 5HD3A 3BYDA 1MWRA 2O9AA 4OPRA 2BASA 4FTXA 5EM1A 1TS0A 4OPZA 2W3FA 3E0YA 3VSKA 3AGDA 3Q82A 3IBRA 5DTSA 2WGWA 2ZL1B 3VOZA 4EQ1A 2V8CA 3QHYA 3RTYA 4AFIA 2Y2KA 1BLPA 3A0SA 2PAVP 4DKIA 1CI8A 3C38A 3F1PA 1IOUA 2J3TC 3N7WA 4PM9A 4QWOA 2L0WA 3UE1A 4GD6A 2G2WA 5JYOA 4NXBA 1FR6A 1XP4A 2XA7M 1ES2A 1DP6A 5K5BA 1BULA 2O99A 1H8YA 3VP2A 4GCZA 3SH8A 1OJ5A 1QMFA 1HZOA 1S4RA 4XXRA 3S7QA 4S2MA 3IF5A 2J8YA 4GKUA 3GV9A 1ESUA 4Z9QA 4O01A 3G30A 4QD4A 4NK3A 4Y13A 3MQQA 3NC8A 2ZQDA 4C75A 1D7EA 3ZHHA 4EV4A 3UDIA 5TGFA 5CHUA 2HZ5A 4UA7A 3UPNA 2PYPA 4F94A 2HP9A 3R4KA 5F82A 2WKEA 4EESA 4BBTA 3IX4A 3LI8A 3AGEA 3DTKA 4F3LA 3KSIA 4LFUA 1YLZA 3F1OB 5GLBA 3KSFA 4BMWA 4HH3A 1VB6A 3W8KA 4ZBEA 3ITAA 3Q7ZA 4KENB 1PWDA 4I39A 3D3OA 3V67A 4HH2A 3A3JA 2JKRI 4OPYA 2ZQAA 4JXWA 1EROA 2K31A 4WEJA 2V0WA 1MPLA 2HPBA 3GVBA 3SOIA 4E3KA 1LL8A 4C6YA 5KIZA 4KZ9A 5A92A 2ZC6B 1PYYA 2QWSA 4LGWA 1GHIA 1YLWA 2DRWA 2IWBA 4OPQA 4UHUA 3V3RA 2ZM0A 3MMHA 5FDSA 3BFDA 3S1YA 1XJ3A 3SS3A 1WE4A 3C30A 2KDKA 5F5YA 4BL3A 1H8ZA 3MZEA 3ZCZA 2VEAA 4KZ8A 3NULA 2B18A 5DF9A 4CLCD 4MEZA 1MWSA 3ITBA 3M2KA 4N1HA 1BLHA 4EERA 3I7JA 4OQIA 3T4LA 2VA0A 1K55C 4MDZA 1JWZA 3SW1A 2O9BA 3NIAA 5C5KA 3EOIA 1P97A 5EVIA 3IT9A 3IXGA 2ZOHA 3H82A 4KG2A 4HESA 3FZCA 1E3UA 2XDMA 5KSCA 5FQJA 5L10A 2EXAA 3A3EA 3LYXA 3PXPA 4JKTA 1JWVA 2ZL1A 4IUKA 4EQIA 4R4RA 1XFNA 2XK1A 3A3FA 3UN7A 3UPPA 3CUEA 1K6RA 5HFOA 3BWLA 2BLSA 1VETA 3BFCA 4Y17A 1ZTUA 1M40A 2OSUA
chains in the Genus database with same CATH topology
1TDLA 2P9VB 1L0EA 1EI5A 2JCHA 2RCXA 1H5XA 4H8RA 3VFHA 1M6KA 3N8SA 4GDNA 4MLLA 1E25A 2H0TA 5HL1A 4R1GA 1IYSA 5HX9A 5EOOA 5FATA 5JYPA 2V1ZA 3BFFA 5FQIA 4ZJ1A 2QZ6A 1PWCA 3ZVWA 2R9WA 4OQ0A 4EUZA 4MBHA 5AQ9A 1VQQA 1ZG6A 3HLBA 4DE0A 3UPOA 1XX2A 4FSFA 1DY6A 1NRFA 2WGVA 4PMAA 3EQVA 5FI6A 5M1AA 3S22A 5GHZA 1PW8A 3P98A 2H5SA 3E2LA 3SS5A 4E3OA 5F1GA 4JPMA 3DWKA 4QY6A 2Y2PA 2RL3A 5A91A 3HLFA 5U47A 4B4ZA 3FYZA 1L2SA 5CXWA 4OOMA 4K0XA 3A3DA 3PAEA 3RJUA 4CPKA 3BLMA 3HL9A 4LV2A 5M19A 5FI7A 3WRTA 3OCLA 5KZHA 5CGWA 4QU3A 4YINA 4DE1A 2XR0A 3OPPA 1JTDA 3LY3A 3P09A 3PBRA 4C3QA 4RYEA 3SH7A 5FAPA 4DXCA 4EBNA 1K6SA 1J9MA 1YLPA 1YMXA 1XXMA 2EX2A 4R0QA 2Y2HA 3IHBA 3LY4A 4GD8A 3Q07A 4OQGA 1ZC2A 1W79A 1W8QA 4BLMA 2ZC4B 3HLGA 3GSGA 1XKZA 1MWUA 2JBFA 5G18A 5F1FA 3C4PA 5GHYA 2Y2QA 1AXBA 4MNRA 5CERA 1KDSA 2XGNA 3AGFA 1FQGA 2PBYA 2Z2MB 3G32A 1LL9A 4B4XA 4GDBA 3GR2A 3DWZA 3IH8A 3ZFZA 4K0WA 4FH4A 3Q7VA 4X56A 3W4QA 3IXHA 1K55A 1CK3A 3C4OA 3IXBA 4WM9A 4Y7PA 3C5AA 3ZNTA 4E3JA 4HBUA 5CHJA 2E8IA 2V2FF 3HLCA 2Y59A 4RVAA 1L0DA 1N4OA 4GN2A 1K4EA 4GZBA 5I94A 1LLBA 2ZMAA 1JTGA 3G34A 3D4FA 3NBLA 4WEKA 4LV3A 4OONA 1ES3A 4Y0TA 2Y91A 3PBQA 2XH9A 3DTMA 4UA9A 3ZVTA 1NZOA 1C3BA 4K91A 4X55A 5CGXA 3WS2A 4BD1A 1SDNA 1JVJA 3GQZA 3CZDA 2A3UA 3JYIA 4S2OA 4CJNA 1BLSA 3UDFA 3OPLA 1SKFA 3OCNA 4Y0UA 5HAQA 2DNSA 3ZG7B 3PBOA 1GHPA 4ZJ3A 2C6WB 3BM6A 4U0XA 4QB8A 1PZOA 3OPHA 3M6HA 5FASA 1NZUA 2ZM2A 1I2WA 4NETA 1TVFA 1GA0A 2ZC3B 2ZQ9A 3IF6A 3MBZA 3NDGA 5HAIA 2WKHA 1E4DA 1FCOA 1Z6FA 3SH9A 4ZAMA 3WS0A 4Q8IA 3UO9A 2ZC7A 1K25A 1BTLA 1GCEA 4WBGA 4LCMA 5DF7A 3UNWA 5A90A 4KZ4A 1KE3A 3FKWA 1HD8A 2HP5A 4U0TA 1FCNA 2JC7A 2XEPA 3DW0A 3PBSA 2WYXA 2A49A 1IKGA 3LCEA 3IWQA 3MKEA 3HLDA 2EFXA 1K57C 1K4FA 4JBFA 5E43A 3VP0A 1YQSA 2Y2MA 3CMZA 3NI9A 4YFMA 4M3KA 2ZM8A 4R23A 5EE8A 5FI2A 3G31A 4PM6A 4WZ4A 5HW3A 4FCFA 4P0MA 3SS4A 3HUOA 1HVBA 4JXVA 2XLNA 1SCWA 4S2KA 1ZG4A 1SHVA 2V20A 3LO7A 2Y2JA 3VFFA 3QNCA 3BEBA 5EUAA 4LV1A 3UE3A 1XA1A 3V39A 4E3IA 4ZTKA 4OLDA 3IH9A 1PW1A 1GA9A 1PI4A 4KZ5A 2H0YA 2XQZA 2OLVA 1ERMA 2WGIA 3CG5A 5EVLA 5TR7A 3EQUA 4IVKA 1N9BA 3HUNA 1ONHA 4MBKA 5EVIB 1KE4A 4IEDA 5CRFA 5FSRA 3PBNA 4N9KA 1XA7A 1PI5A 4KQOA 4LCLA 3G35A 1QMEA 5FAQA 4WYYA 1S0WA 5FQ9A 4OP8A 5GLDA 1IEMA 5DVAA 2Z2LB 2VGJA 4WELA 3IWOA 4S2IA 1ONGA 3C7UA 3UE0A 1XGJA 3BYDA 3OZHA 4RX2A 1MWRA 1YMSA 1E3UD 2ZLYA 4OPRA 4QY5A 4JXSA 1L0GA 3V5MA 4E3MA 2WAFA 4OPZA 3VP4A 1Q2QA 4N92A 2OLUA 1CEFA 3VSKA 3VSLA 3AGDA 1NY0A 3Q82A 4BQMA 2Q9NA 5DTSA 2WGWA 4S2PA 4WMCA 3VOZA 2J9OA 2X71A 3QHYA 1K56D 3WWXA 3IF6B 4DE3A 2Y2KA 1CEGA 1FSWA 3G2ZA 1BLPA 1KGGA 1MXOA 2Y2LA 2Y2OA 3O3VA 5J8XA 2Y4AA 4KQQA 1RGZA 3TSGA 1DJCA 2HP6A 3ZG0A 4DKIA 1W7FA 1CI8A 4OQHA 5CTMA 1IYOA 2ZD8A 3FKVA 4E6XA 1KGFA 3NY4A 3W4OA 1BUEA 1NXYA 5GLCA 4OOLA 3N7WA 4PM9A 2WZXA 3GRJA 4R4SA 3UE1A 5E2GA 5FDHA 1LI0A 4GD6A 5L2FA 5DTKA 4HBTA 2G2WA 3ZG9B 4EBLA 5KMWA 4BENA 5JYOA 4A5RA 3QNBA 1K54A 1FR6A 1XP4A 2I72A 4P85A 1ES2A 2P9VA 5F83A 5CECA 1BULA 2PU4A 1ALQA 2HDUA 3GTCA 3IWIA 1H8YA 2XFTA 3VP2A 5CEDA 1K54C 3SH8A 4OKPA 5EECA 4DE2A 1Q2PA 1QMFA 1KDWA 3G4PA 4DF6A 4R3JA 1HZOA 2J9PA 2P74A 3OC2A 1DJAA 4XXRA 5CEBA 1MY8A 3ISGA 4IBRA 1FOFA 3NDEA 5BOHA 4S2MA 2QPNA 1YLJA 3IF5A 1G68A 4LV0A 4N9LA 2J8YA 5E2HA 4GKUA 2OV5A 4OOYA 3GV9A 1ESUA 1NYMA 4WZ5C 3G2YA 4Z9QA 3G30A 2UWXA 4QD4A 5D3OA 4NK3A 2WAEA 3NC8A 4KZ7A 5E2EA 2ZQCA 4JF5A 4MBFA 2ZQDA 3ZDJA 4BD0A 3S4XA 5CTNA 4QHCA 4C75A 5GLAA 5FQKA 3ZHHA 1IYPA 4EBPA 4EV4A 3N6IA 1FR1A 2XF3A 3HLWA 4B88A 3B3XA 3UDIA 3VP1A 4OH0A 2GDNA 1JWPA 5TGFA 1K57A 3V3SA 1ES5A 5CHUA 4S2JA 5HAPA 3C7VA 3VMAA 4ID4A 2FFFB 3FWLA 4UA7A 2EFUA 1S6RA 3M6BA 4P87A 2X01A 3UPNA 4F94A 2HP9A 4JF6A 5EOEA 5FAOA 1VM1A 1WYCA 3GMWA 3RXWA 5F82A 2HDQA 5EPHA 1RCJA 3BFGA 2WKEA 4KZBA 4X53A 3MXSA 5M18A 1RP5A 3BRMA 1O7EA 4IVIA 2VGKA 4D2OA 2ZQ8A 2H10A 5DTTA 3Q7VB 1BT5A 3W4PA 2WK0A 1IKIA 3AGEA 1IYQA 2WZZA 1XPBA 1FSYA 2EX8A 4OP5A 4X69A 1YLTA 1TDGA 4QJGA 1YLZA 5GLBA 5AQBA 2ZC5B 3UY6A 1YLYA 4DXBA 4R3BA 4PPRA 3HBRA 4S2NC 3O86A 1CI9A 4X68A 1NJ4A 1DJBA 4IBXA 3W8KA 5AQ7A 1L0FA 4ZBEA 1ERQA 4GOGA 5EVID 3ITAA 3Q1FA 4XUXA 1MKIA 3Q7ZA 3PTEA 4KENB 1PWDA 2EXBA 4HEFA 2G2UA 3BLSA 1BSGA 4Y0OA 3V50A 4JXGA 3BECA 2XD1A 4PM8A 5E2FA 1KVMA 2FFYA 4BL2A 3MZDA 3MZFA 4P6BA 2Y2GA 3NCKA 2BG1A 3HVFA 3A3JA 4U3TA 1O07A 3WS4A 3UDXA 4OPYA 1YM1A 2ZQAA 4FD8A 4JXWA 3VP3A 1EROA 3IXDA 3M2JA 4WEJA 5FQQA 1W5DA 5TFQA 3SOIA 1MPLA 2HPBA 2X02A 3GVBA 4X6TA 2Y2IA 4E3KA 4FH2A 4C6YA 1YT4A 2DCFA 3A3IA 2QMIA 4KZ9A 4OLGA 5FQMA 5A92A 1LL5A 1GHMA 5GHXA 2ZC6B 3OPRA 1PYYA 3WRZA 1GHIA 1YLWA 1RGYA 2DRWA 2IWBA 4OPQA 3CJMA 4UHUA 3TG9A 3V3RA 5AQAA 1PZPA 2ZM0A 4EWFA 4JLFA 1BZAA 3BFDA 4KZAA 5FA7A 3S1YA 3PAGA 3N8RA 1EWZA 3SS3A 3WS1A 3ZGAB 1WE4A 1ESIA 1U60A 4BL3A 1I5QA 2ZQ7A 5A93A 1IELA 4E3LA 4PM5A 1H8ZA 3MZEA 4E6WA 4L0LA 3ZCZA 1LHYA 2IWDA 4KZ8A 1XGIA 5DF9A 1HTZA 4N1XA 3VOYA 4MEZA 3HUMA 1MWSA 3ITBA 3M2KA 4N1HA 4KZ3A 4ZDXA 1BLHA 3N8LA 4BJPA 3I7JA 4OQIA 1BLCA 4WZ5A 3BFEA 3ZG8B 1K55C 1KGEA 2WUQA 3IQAA 4PM7A 1JWZA 1PWGA 3NIAA 5CGSA 3MXRA 5EVIA 1WYBA 5DF8A 1KVLA 3IT9A 5CHMA 4GNUA 2WADA 2ZJ9A 2CC1A 3IXGA 5EVIC 1SDEA 4LENA 1FCMA 2Y2NA 4E3NA 4KG2A 5GL9A 1MBLA 4HESA 1PIOA 3MKFA 4UAAA 3FZCA 3MFDA 3N4IA 1E3UA 4DDYA 3O88A 2XDMA 1TEMA 2JE5A 3HLEA 1I2SA 3IHAA 5KSCA 3O87A 5FQJA 3E2KA 4S2LA 5HARA 4DDSA 4KZ6A 1W8YA 4KQRA 2EXAA 2Q9MA 2HDRA 4ZJ2A 1G6AA 3A3EA 5KSHA 2WGWB 1K56A 4RA7A 4JKTA 4XUZA 1ES4A 1JWVA 1OMEA 3RXXA 2IWCA 3LEZA 4EQIA 4R4RA 1MWTA 4WMCD 3HREA 2WKIA 3PBTA 5IHVA 3ZNYA 2XD5A 4KG6A 1K38A 2XK1A 2B5RA 1Y54A 3A3FA 1NYYA 2EX6A 3IF6C 3Q81A 2C5WB 3UN7A 4GB7A 3FV7A 1KE0A 3UPPA 4KG5A 1LI9A 2EX9A 4OVDA 3ZG5A 1ZKJA 1K6RA 2R9XA 5HFOA 3TOIA 4DRTA 2Y55A 4UA6A 4JF4A 2BLSA 2PU2A 3WS5A 2XFSA 3BFCA 4S2NA 2J7VA 4RX3A 2HDSA 4O7DA 1M40A 2OSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TDL A;  2P9V B;  1L0E A;  1EI5 A;  2JCH A;  2RCX A;  1H5X A;  4H8R A;  3VFH A;  1M6K A;  3N8S A;  4GDN A;  4MLL A;  1E25 A;  2H0T A;  5HL1 A;  4R1G A;  1IYS A;  5HX9 A;  5EOO A;  5FAT A;  5JYP A;  2V1Z A;  3BFF A;  5FQI A;  4ZJ1 A;  2QZ6 A;  1PWC A;  3ZVW A;  2R9W A;  4OQ0 A;  4EUZ A;  4MBH A;  5AQ9 A;  1VQQ A;  1ZG6 A;  3HLB A;  4DE0 A;  3UPO A;  1XX2 A;  4FSF A;  1DY6 A;  1NRF A;  2WGV A;  4PMA A;  3EQV A;  5FI6 A;  5M1A A;  3S22 A;  5GHZ A;  1PW8 A;  3P98 A;  2H5S A;  3E2L A;  3SS5 A;  4E3O A;  5F1G A;  4JPM A;  3DWK A;  4QY6 A;  2Y2P A;  2RL3 A;  5A91 A;  3HLF A;  5U47 A;  4B4Z A;  3FYZ A;  1L2S A;  5CXW A;  4OOM A;  4K0X A;  3A3D A;  3PAE A;  3RJU A;  4CPK A;  3BLM A;  3HL9 A;  4LV2 A;  5M19 A;  5FI7 A;  3WRT A;  3OCL A;  5KZH A;  5CGW A;  4QU3 A;  4YIN A;  4DE1 A;  2XR0 A;  3OPP A;  1JTD A;  3LY3 A;  3P09 A;  3PBR A;  4C3Q A;  4RYE A;  3SH7 A;  5FAP A;  4DXC A;  4EBN A;  1K6S A;  1J9M A;  1YLP A;  1YMX A;  1XXM A;  2EX2 A;  4R0Q A;  2Y2H A;  3IHB A;  3LY4 A;  4GD8 A;  3Q07 A;  4OQG A;  1ZC2 A;  1W79 A;  1W8Q A;  4BLM A;  2ZC4 B;  3HLG A;  3GSG A;  1XKZ A;  1MWU A;  2JBF A;  5G18 A;  5F1F A;  3C4P A;  5GHY A;  2Y2Q A;  1AXB A;  4MNR A;  5CER A;  1KDS A;  2XGN A;  3AGF A;  1FQG A;  2PBY A;  2Z2M B;  3G32 A;  1LL9 A;  4B4X A;  4GDB A;  3GR2 A;  3DWZ A;  3IH8 A;  3ZFZ A;  4K0W A;  4FH4 A;  3Q7V A;  4X56 A;  3W4Q A;  3IXH A;  1K55 A;  1CK3 A;  3C4O A;  3IXB A;  4WM9 A;  4Y7P A;  3C5A A;  3ZNT A;  4E3J A;  4HBU A;  5CHJ A;  2E8I A;  2V2F F;  3HLC A;  2Y59 A;  4RVA A;  1L0D A;  1N4O A;  4GN2 A;  1K4E A;  4GZB A;  5I94 A;  1LLB A;  2ZMA A;  1JTG A;  3G34 A;  3D4F A;  3NBL A;  4WEK A;  4LV3 A;  4OON A;  1ES3 A;  4Y0T A;  2Y91 A;  3PBQ A;  2XH9 A;  3DTM A;  4UA9 A;  3ZVT A;  1NZO A;  1C3B A;  4K91 A;  4X55 A;  5CGX A;  3WS2 A;  4BD1 A;  1SDN A;  1JVJ A;  3GQZ A;  3CZD A;  2A3U A;  3JYI A;  4S2O A;  4CJN A;  1BLS A;  3UDF A;  3OPL A;  1SKF A;  3OCN A;  4Y0U A;  5HAQ A;  2DNS A;  3ZG7 B;  3PBO A;  1GHP A;  4ZJ3 A;  2C6W B;  3BM6 A;  4U0X A;  4QB8 A;  1PZO A;  3OPH A;  3M6H A;  5FAS A;  1NZU A;  2ZM2 A;  1I2W A;  4NET A;  1TVF A;  1GA0 A;  2ZC3 B;  2ZQ9 A;  3IF6 A;  3MBZ A;  3NDG A;  5HAI A;  2WKH A;  1E4D A;  1FCO A;  1Z6F A;  3SH9 A;  4ZAM A;  3WS0 A;  4Q8I A;  3UO9 A;  2ZC7 A;  1K25 A;  1BTL A;  1GCE A;  4WBG A;  4LCM A;  5DF7 A;  3UNW A;  5A90 A;  4KZ4 A;  1KE3 A;  3FKW A;  1HD8 A;  2HP5 A;  4U0T A;  1FCN A;  2JC7 A;  2XEP A;  3DW0 A;  3PBS A;  2WYX A;  2A49 A;  1IKG A;  3LCE A;  3IWQ A;  3MKE A;  3HLD A;  2EFX A;  1K57 C;  1K4F A;  4JBF A;  5E43 A;  3VP0 A;  1YQS A;  2Y2M A;  3CMZ A;  3NI9 A;  4YFM A;  4M3K A;  2ZM8 A;  4R23 A;  5EE8 A;  5FI2 A;  3G31 A;  4PM6 A;  4WZ4 A;  5HW3 A;  4FCF A;  4P0M A;  3SS4 A;  3HUO A;  1HVB A;  4JXV A;  2XLN A;  1SCW A;  4S2K A;  1ZG4 A;  1SHV A;  2V20 A;  3LO7 A;  2Y2J A;  3VFF A;  3QNC A;  3BEB A;  5EUA A;  4LV1 A;  3UE3 A;  1XA1 A;  3V39 A;  4E3I A;  4ZTK A;  4OLD A;  3IH9 A;  1PW1 A;  1GA9 A;  1PI4 A;  4KZ5 A;  2H0Y A;  2XQZ A;  2OLV A;  1ERM A;  2WGI A;  3CG5 A;  5EVL A;  5TR7 A;  3EQU A;  4IVK A;  1N9B A;  3HUN A;  1ONH A;  4MBK A;  5EVI B;  1KE4 A;  4IED A;  5CRF A;  5FSR A;  3PBN A;  4N9K A;  1XA7 A;  1PI5 A;  4KQO A;  4LCL A;  3G35 A;  1QME A;  5FAQ A;  4WYY A;  1S0W A;  5FQ9 A;  4OP8 A;  5GLD A;  1IEM A;  5DVA A;  2Z2L B;  2VGJ A;  4WEL A;  3IWO A;  4S2I A;  1ONG A;  3C7U A;  3UE0 A;  1XGJ A;  3BYD A;  3OZH A;  4RX2 A;  1MWR A;  1YMS A;  1E3U D;  2ZLY A;  4OPR A;  4QY5 A;  4JXS A;  1L0G A;  3V5M A;  4E3M A;  2WAF A;  4OPZ A;  3VP4 A;  1Q2Q A;  4N92 A;  2OLU A;  1CEF A;  3VSK A;  3VSL A;  3AGD A;  1NY0 A;  3Q82 A;  4BQM A;  2Q9N A;  5DTS A;  2WGW A;  4S2P A;  4WMC A;  3VOZ A;  2J9O A;  2X71 A;  3QHY A;  1K56 D;  3WWX A;  3IF6 B;  4DE3 A;  2Y2K A;  1CEG A;  1FSW A;  3G2Z A;  1BLP A;  1KGG A;  1MXO A;  2Y2L A;  2Y2O A;  3O3V A;  5J8X A;  2Y4A A;  4KQQ A;  1RGZ A;  3TSG A;  1DJC A;  2HP6 A;  3ZG0 A;  4DKI A;  1W7F A;  1CI8 A;  4OQH A;  5CTM A;  1IYO A;  2ZD8 A;  3FKV A;  4E6X A;  1KGF A;  3NY4 A;  3W4O A;  1BUE A;  1NXY A;  5GLC A;  4OOL A;  3N7W A;  4PM9 A;  2WZX A;  3GRJ A;  4R4S A;  3UE1 A;  5E2G A;  5FDH A;  1LI0 A;  4GD6 A;  5L2F A;  5DTK A;  4HBT A;  2G2W A;  3ZG9 B;  4EBL A;  5KMW A;  4BEN A;  5JYO A;  4A5R A;  3QNB A;  1K54 A;  1FR6 A;  1XP4 A;  2I72 A;  4P85 A;  1ES2 A;  2P9V A;  5F83 A;  5CEC A;  1BUL A;  2PU4 A;  1ALQ A;  2HDU A;  3GTC A;  3IWI A;  1H8Y A;  2XFT A;  3VP2 A;  5CED A;  1K54 C;  3SH8 A;  4OKP A;  5EEC A;  4DE2 A;  1Q2P A;  1QMF A;  1KDW A;  3G4P A;  4DF6 A;  4R3J A;  1HZO A;  2J9P A;  2P74 A;  3OC2 A;  1DJA A;  4XXR A;  5CEB A;  1MY8 A;  3ISG A;  4IBR A;  1FOF A;  3NDE A;  5BOH A;  4S2M A;  2QPN A;  1YLJ A;  3IF5 A;  1G68 A;  4LV0 A;  4N9L A;  2J8Y A;  5E2H A;  4GKU A;  2OV5 A;  4OOY A;  3GV9 A;  1ESU A;  1NYM A;  4WZ5 C;  3G2Y A;  4Z9Q A;  3G30 A;  2UWX A;  4QD4 A;  5D3O A;  4NK3 A;  2WAE A;  3NC8 A;  4KZ7 A;  5E2E A;  2ZQC A;  4JF5 A;  4MBF A;  2ZQD A;  3ZDJ A;  4BD0 A;  3S4X A;  5CTN A;  4QHC A;  4C75 A;  5GLA A;  5FQK A;  3ZHH A;  1IYP A;  4EBP A;  4EV4 A;  3N6I A;  1FR1 A;  2XF3 A;  3HLW A;  4B88 A;  3B3X A;  3UDI A;  3VP1 A;  4OH0 A;  2GDN A;  1JWP A;  5TGF A;  1K57 A;  3V3S A;  1ES5 A;  5CHU A;  4S2J A;  5HAP A;  3C7V A;  3VMA A;  4ID4 A;  2FFF B;  3FWL A;  4UA7 A;  2EFU A;  1S6R A;  3M6B A;  4P87 A;  2X01 A;  3UPN A;  4F94 A;  2HP9 A;  4JF6 A;  5EOE A;  5FAO A;  1VM1 A;  1WYC A;  3GMW A;  3RXW A;  5F82 A;  2HDQ A;  5EPH A;  1RCJ A;  3BFG A;  2WKE A;  4KZB A;  4X53 A;  3MXS A;  5M18 A;  1RP5 A;  3BRM A;  1O7E A;  4IVI A;  2VGK A;  4D2O A;  2ZQ8 A;  2H10 A;  5DTT A;  3Q7V B;  1BT5 A;  3W4P A;  2WK0 A;  1IKI A;  3AGE A;  1IYQ A;  2WZZ A;  1XPB A;  1FSY A;  2EX8 A;  4OP5 A;  4X69 A;  1YLT A;  1TDG A;  4QJG A;  1YLZ A;  5GLB A;  5AQB A;  2ZC5 B;  3UY6 A;  1YLY A;  4DXB A;  4R3B A;  4PPR A;  3HBR A;  4S2N C;  3O86 A;  1CI9 A;  4X68 A;  1NJ4 A;  1DJB A;  4IBX A;  3W8K A;  5AQ7 A;  1L0F A;  4ZBE A;  1ERQ A;  4GOG A;  5EVI D;  3ITA A;  3Q1F A;  4XUX A;  1MKI A;  3Q7Z A;  3PTE A;  4KEN B;  1PWD A;  2EXB A;  4HEF A;  2G2U A;  3BLS A;  1BSG A;  4Y0O A;  3V50 A;  4JXG A;  3BEC A;  2XD1 A;  4PM8 A;  5E2F A;  1KVM A;  2FFY A;  4BL2 A;  3MZD A;  3MZF A;  4P6B A;  2Y2G A;  3NCK A;  2BG1 A;  3HVF A;  3A3J A;  4U3T A;  1O07 A;  3WS4 A;  3UDX A;  4OPY A;  1YM1 A;  2ZQA A;  4FD8 A;  4JXW A;  3VP3 A;  1ERO A;  3IXD A;  3M2J A;  4WEJ A;  5FQQ A;  1W5D A;  5TFQ A;  3SOI A;  1MPL A;  2HPB A;  2X02 A;  3GVB A;  4X6T A;  2Y2I A;  4E3K A;  4FH2 A;  4C6Y A;  1YT4 A;  2DCF A;  3A3I A;  2QMI A;  4KZ9 A;  4OLG A;  5FQM A;  5A92 A;  1LL5 A;  1GHM A;  5GHX A;  2ZC6 B;  3OPR A;  1PYY A;  3WRZ A;  1GHI A;  1YLW A;  1RGY A;  2DRW A;  2IWB A;  4OPQ A;  3CJM A;  4UHU A;  3TG9 A;  3V3R A;  5AQA A;  1PZP A;  2ZM0 A;  4EWF A;  4JLF A;  1BZA A;  3BFD A;  4KZA A;  5FA7 A;  3S1Y A;  3PAG A;  3N8R A;  1EWZ A;  3SS3 A;  3WS1 A;  3ZGA B;  1WE4 A;  1ESI A;  1U60 A;  4BL3 A;  1I5Q A;  2ZQ7 A;  5A93 A;  1IEL A;  4E3L A;  4PM5 A;  1H8Z A;  3MZE A;  4E6W A;  4L0L A;  3ZCZ A;  1LHY A;  2IWD A;  4KZ8 A;  1XGI A;  5DF9 A;  1HTZ A;  4N1X A;  3VOY A;  4MEZ A;  3HUM A;  1MWS A;  3ITB A;  3M2K A;  4N1H A;  4KZ3 A;  4ZDX A;  1BLH A;  3N8L A;  4BJP A;  3I7J A;  4OQI A;  1BLC A;  4WZ5 A;  3BFE A;  3ZG8 B;  1K55 C;  1KGE A;  2WUQ A;  3IQA A;  4PM7 A;  1JWZ A;  1PWG A;  3NIA A;  5CGS A;  3MXR A;  5EVI A;  1WYB A;  5DF8 A;  1KVL A;  3IT9 A;  5CHM A;  4GNU A;  2WAD A;  2ZJ9 A;  2CC1 A;  3IXG A;  5EVI C;  1SDE A;  4LEN A;  1FCM A;  2Y2N A;  4E3N A;  4KG2 A;  5GL9 A;  1MBL A;  4HES A;  1PIO A;  3MKF A;  4UAA A;  3FZC A;  3MFD A;  3N4I A;  1E3U A;  4DDY A;  3O88 A;  2XDM A;  1TEM A;  2JE5 A;  3HLE A;  1I2S A;  3IHA A;  5KSC A;  3O87 A;  5FQJ A;  3E2K A;  4S2L A;  5HAR A;  4DDS A;  4KZ6 A;  1W8Y A;  4KQR A;  2EXA A;  2Q9M A;  2HDR A;  4ZJ2 A;  1G6A A;  3A3E A;  5KSH A;  2WGW B;  1K56 A;  4RA7 A;  4JKT A;  4XUZ A;  1ES4 A;  1JWV A;  1OME A;  3RXX A;  2IWC A;  3LEZ A;  4EQI A;  4R4R A;  1MWT A;  4WMC D;  3HRE A;  2WKI A;  3PBT A;  5IHV A;  3ZNY A;  2XD5 A;  4KG6 A;  1K38 A;  2XK1 A;  2B5R A;  1Y54 A;  3A3F A;  1NYY A;  2EX6 A;  3IF6 C;  3Q81 A;  2C5W B;  3UN7 A;  4GB7 A;  3FV7 A;  1KE0 A;  3UPP A;  4KG5 A;  1LI9 A;  2EX9 A;  4OVD A;  3ZG5 A;  1ZKJ A;  1K6R A;  2R9X A;  5HFO A;  3TOI A;  4DRT A;  2Y55 A;  4UA6 A;  4JF4 A;  2BLS A;  2PU2 A;  3WS5 A;  2XFS A;  3BFC A;  4S2N A;  2J7V A;  4RX3 A;  2HDS A;  4O7D A;  1M40 A;  2OSU A; 
#chains in the Genus database with same CATH topology
 2W3H A;  3VFH A;  1E25 A;  3PYP A;  2PDR A;  3BJN A;  3TJZ C;  2PD7 A;  3ZVW A;  2WKR A;  4OQ0 A;  4EUZ A;  3UPO A;  4FSF A;  1DY6 A;  1NRF A;  5AVE A;  5F1G A;  5HWW A;  2RL3 A;  5A91 A;  4CPK A;  3HL9 A;  5FI7 A;  1GSV A;  2JN7 A;  4DE1 A;  3LR5 A;  2R78 A;  3SH7 A;  5FAP A;  1T18 A;  1YLP A;  2V9A A;  2Y2H A;  4WN5 A;  2XRO A;  4BLM A;  4E04 A;  3GSG A;  2JBF A;  5CER A;  4MNR A;  2XGN A;  2Z2M B;  4ETX A;  3GR2 A;  1TS6 A;  1K55 A;  4UEY A;  4Y7P A;  3KO6 A;  2E8I A;  2V2F F;  4G3V A;  4RVA A;  1K4E A;  5J3W A;  4WEK A;  3H7W A;  4OON A;  1X0O A;  4K91 A;  5CGX A;  1JVJ A;  3VE3 A;  4M4X A;  3KYZ A;  4Y0U A;  4R70 A;  3PBO A;  1GHP A;  2C6W B;  5DKK A;  3M6H A;  4MN7 A;  2M7V A;  2WKQ A;  2ZM2 A;  4NET A;  4YWZ A;  1TVF A;  2ZBB A;  1CJF A;  3MBZ A;  3NOP C;  4ZAM A;  1VEU B;  2V0U A;  3CPT B;  1VHM A;  1KE3 A;  2HP5 A;  4WUJ A;  2OWH A;  2XEP A;  3DW0 A;  2WYX A;  3MKE A;  3HLD A;  1K57 C;  1K4F A;  3T4S A;  3VP0 A;  3VOL A;  1HVB A;  2P7J A;  1SCW A;  1ZG4 A;  4WF0 A;  3LI9 A;  3QNC A;  3LUQ A;  4LV1 A;  1XA1 A;  2L1M A;  5CX7 A;  4ZTK A;  4OLD A;  3IH9 A;  4KZ5 A;  4I3J A;  1ERM A;  2WGI A;  5TR7 A;  5EVL A;  1OPX A;  1N9B A;  2O0Y A;  4MBK A;  5CRF A;  1OTE A;  3MSH A;  3PBN A;  4N9K A;  5DFY A;  5FAQ A;  1S0W A;  5FQ9 A;  5GLD A;  1IEM A;  5DVA A;  4R3A A;  2Z2L B;  2VGJ A;  4H6J B;  2PR6 A;  4S2I A;  1ONG A;  3UE0 A;  3CWF A;  1YMS A;  1E3U D;  2WAF A;  1CQA A;  1OTB A;  2A2L A;  4YNR A;  3D72 A;  2Y8H A;  2J9O A;  2X71 A;  4K08 A;  1CEG A;  3G2Z A;  2ZMF A;  3O3V A;  2Y2O A;  5J8X A;  3DTI A;  1P0Z A;  1DJC A;  3CIT A;  3ZG0 A;  4B9O A;  4OQH A;  1IYO A;  2ZD8 A;  3FKV A;  1LSW A;  4I3A A;  4OOL A;  2WZX A;  3GRJ A;  2JKT M;  5L2F A;  1K54 A;  3DBA A;  2I72 A;  2Q0O A;  3IWI A;  5CED A;  2UV0 E;  4L9E A;  5HL6 A;  4I3I A;  3MJQ A;  3G4P A;  4R3J A;  2J9P A;  2P74 A;  2W1T A;  4ESP A;  3VV4 A;  5CEB A;  3DAV A;  4IBR A;  1G6O A;  4DMZ A;  5E2H A;  3G2Y A;  3EGD C;  1S1Y A;  4KZ7 A;  2ZQC A;  4MBF A;  4Q0I A;  3ZDJ A;  1FIL A;  5CTN A;  4QHC A;  2GJ3 A;  4EBP A;  1IYP A;  1DRM A;  1FR1 A;  5HD5 A;  4OH0 A;  2OAQ 1;  5HWV A;  2GDN A;  1K57 A;  3V3S A;  3T1S A;  1YSP A;  4S2J A;  3C7V A;  3UB9 A;  4EUV A;  5J4E A;  3G6O A;  4JF6 A;  5FAO A;  1WYC A;  1RCJ A;  4X53 A;  3MXS A;  5TBM B;  5M18 A;  1RP5 A;  3BRM A;  4IVI A;  3EGX C;  3IBJ A;  2H10 A;  5DTT A;  3A0V A;  3W4P A;  1IYQ A;  2WZZ A;  1XPB A;  1FSY A;  2EX8 A;  4OP5 A;  4II7 A;  1KOU A;  2W27 A;  4QJG A;  4R6L A;  3JVU A;  2ZC5 B;  3BQ8 A;  3UY6 A;  3JVV A;  4R3B A;  4PPR A;  4GJ4 A;  4X68 A;  3HBR A;  3O86 A;  1CI9 A;  4IBX A;  5AQ7 A;  4GOG A;  4Q0J A;  2EXB A;  4Y0O A;  3BEC A;  2B02 A;  4PM8 A;  4P6B A;  2Y2G A;  4U3T A;  2BG1 A;  2PBD P;  3WS4 A;  3T4O A;  3VP3 A;  1ACF A;  3IXD A;  5FQQ A;  4X6T A;  2DCF A;  2QMI A;  2D01 A;  3D9Y A;  5FQM A;  4HQA A;  5AQA A;  2W1R A;  4EWF A;  4JLF A;  5J7E A;  2QYB A;  3PAG A;  3WS1 A;  1STZ A;  1U60 A;  5A93 A;  1MKM A;  4L0L A;  1LHY A;  1XGI A;  1T1C A;  2P08 A;  1YAX A;  3VOY A;  5FEG A;  3ZQ5 A;  4KZ3 A;  4ZDX A;  5AVF A;  3IS2 A;  3BFE A;  2WUQ A;  4HHD A;  3KSG A;  1PWG A;  3MXR A;  1D1J A;  1G28 A;  5HPI A;  4HJ4 A;  2WAD A;  5EVI C;  5L09 A;  2V1B A;  4LEN A;  2Y2N A;  4WLA A;  4UAA A;  3BW6 A;  3O88 A;  1TS7 A;  4KQR A;  4ZJ2 A;  5HPF A;  1G6A A;  1XFQ A;  1K56 A;  4RA7 A;  1ES4 A;  3UMD A;  3LEZ A;  1MWT A;  2WKI A;  4KG6 A;  3UB7 A;  3FPW A;  5TJJ A;  5DJT A;  2VV7 A;  3NOT C;  2C5W B;  2HV1 A;  4GB7 A;  4OVD A;  3ZG5 A;  4PKY G;  3TOI A;  2QKP A;  3CUE C;  4BBV A;  4O7D A;  2K7S A;  5DJU A;  2E8J A;  4H8R A;  4GDN A;  2H0T A;  4R1G A;  3PR6 A;  5EOO A;  5JYP A;  4LPZ A;  3BFF A;  5FQI A;  2QZ6 A;  2R9W A;  3HLB A;  1XJ2 A;  3S22 A;  5FI6 A;  3EQV A;  1PW8 A;  3F1N A;  3E2L A;  3DWK A;  5G4Y A;  3MXQ A;  2PR5 A;  1JNU A;  5A8B A;  4G3W A;  5CGW A;  2BTF P;  1JTD A;  2PRF A;  3LY3 A;  3P09 A;  3MR0 A;  4C3Q A;  4EBN A;  1K6S A;  1YMX A;  3KYE A;  2EX2 A;  3IHB A;  3LY4 A;  3Q07 A;  3HJK A;  4GHI B;  1W79 A;  1UWP X;  5G18 A;  1PFL A;  5TBM A;  1LSX A;  3G32 A;  4B4X A;  3T1Q B;  5L07 A;  3IXH A;  3IXB A;  2PD8 A;  4WM9 A;  4E3J A;  2KOI A;  2Y59 A;  1N4O A;  4GN2 A;  5I94 A;  1LLB A;  1JTG A;  4UQI S;  2G7U A;  4CLC E;  3ULF A;  1BYW A;  3NBL A;  2VV8 A;  3QP6 A;  4I5S A;  1ODV A;  3PBQ A;  4UA9 A;  1LT0 A;  5L8M A;  5I5L A;  3T1X A;  4S2O A;  3JYI A;  3CZD A;  1S66 L;  4QB8 A;  2OAP 1;  5FAS A;  4ZRR A;  4ARZ B;  1I2W A;  2ZC3 B;  4ME4 A;  2K2N A;  3QP2 A;  1GCE A;  4LCM A;  2NUT C;  4HJ3 A;  3PBS A;  4NEE D;  1IKG A;  3IWQ A;  2EFX A;  4JBF A;  4YFM A;  1CF0 A;  4R23 A;  5EE8 A;  2HF6 A;  4PM6 A;  3T50 A;  5HW3 A;  4FCF A;  1YKD A;  2Z6D A;  1NLZ A;  1SHV A;  1XJ6 A;  3UE3 A;  1SKO B;  3U4L P;  4NG2 A;  4E3I A;  1GSX A;  3U2A A;  2OLV A;  5FSR A;  5HSQ A;  4LLO B;  1PI5 A;  3G35 A;  1QME A;  5EVE A;  4WYY A;  3MFX A;  3BY8 A;  4EET B;  5FEF A;  3PHY A;  4QY5 A;  3HCY A;  4JXS A;  1DP9 A;  2OLU A;  3VSL A;  1NY0 A;  4S2P A;  3LIC A;  2JKF A;  1K56 D;  3FG8 A;  3IF6 B;  3LID A;  4DE3 A;  1FSW A;  1ZHH B;  5MC7 A;  2Y2L A;  2Y4A A;  3TSG A;  1V9Z A;  1W7F A;  1J3W A;  4E6X A;  1KGF A;  4CQH A;  1BUE A;  1NXY A;  5GLC A;  4P6Z S;  4R4S A;  2JHE A;  5E2G A;  1LI0 A;  3ZG9 B;  3F1O A;  4A5R A;  5F83 A;  2NUP C;  1ALQ A;  2HDU A;  4CLC B;  1S67 L;  1K54 C;  3R7W B;  5EEC A;  1F5M A;  4X25 A;  1TS8 A;  3OC2 A;  3KX0 X;  1DJA A;  1MY8 A;  3ISG A;  4HIA A;  3NDE A;  2QPN A;  4LV0 A;  4N9L A;  4OOY A;  2CMN A;  3C8C A;  5D3O A;  2WAE A;  2ZMV A;  1OTD A;  1NWZ A;  1W63 Q;  1S1Z A;  5FQK A;  3N6I A;  3HLW A;  3VP1 A;  1N9L A;  4UQI M;  5HAP A;  3LIE A;  3VMA A;  2QJ7 A;  4FUW A;  4ID4 A;  3UB5 P;  1S6R A;  3LIA A;  4GHI A;  5EOE A;  1VM1 A;  3MQ0 A;  2HDQ A;  5EPH A;  3BFG A;  4KZB A;  1O7E A;  3OLO A;  2VGK A;  3Q7V B;  2WK0 A;  1IKI A;  1MC0 A;  1F98 A;  1YLT A;  1TDG A;  4GLQ A;  5AQB A;  1YLY A;  1Y4O A;  1NJ4 A;  1DJB A;  1P9R A;  1L0F A;  5EVI D;  3Q1F A;  1MKI A;  3PTE A;  4HEF A;  2G2U A;  4PKY A;  4JXG A;  2XD1 A;  5E2F A;  2FFY A;  4BL2 A;  3TE8 A;  3MZD A;  2A24 B;  4GW9 A;  2Z6C A;  4HP4 A;  5IT5 A;  1YM1 A;  4ARZ A;  1L3L A;  3RFB A;  2D02 A;  5TFQ A;  1HLU P;  2Y2I A;  1EW0 A;  4FH2 A;  4JGP A;  3A3I A;  1F9I A;  5FL3 A;  1G5U A;  3A0R A;  3MS6 A;  3FPV A;  3CJM A;  1PZP A;  1BZA A;  4HY8 A;  4KZA A;  1T1B A;  5FA7 A;  4IHQ A;  3N8R A;  2ZQ7 A;  2J3W A;  4E3L A;  4PM5 A;  4E6W A;  2IWD A;  2O9C A;  1HTZ A;  4RQ9 A;  1PRQ A;  4EW7 A;  2XSS A;  4EXO A;  3NEC A;  2OOL A;  3N8L A;  4HJ6 A;  1BLC A;  3ZG8 B;  1KGE A;  4FOF A;  5HZH A;  1WYB A;  2WKP A;  4MMN A;  1KVL A;  2MJ6 A;  5CHM A;  4GNU A;  2ZJ9 A;  2CC1 A;  4Q0H A;  1FCM A;  4E3N A;  4JGO A;  5GL9 A;  1MBL A;  4DDY A;  3N4I A;  4P6Z M;  5IU1 A;  3W2Z A;  3HLE A;  3IHA A;  2VJW A;  4DDS A;  1W8Y A;  2HDR A;  4X1M A;  4XUZ A;  4I38 A;  1OME A;  2JKR M;  3RXX A;  2OWJ A;  4O8G A;  3ZNY A;  3LFV A;  1NYY A;  2EX6 A;  3Q81 A;  3FV7 A;  1KE0 A;  2QHK A;  3L9K A;  3BY9 A;  4JF4 A;  4KQD A;  3WS5 A;  2J7V A;  4RX3 A;  1N9N A;  4YOF A;  2HDS A;  1IFQ A;  1TDL A;  2P9V B;  2RCX A;  1H5X A;  4LRZ E;  1M6K A;  4MLL A;  4CLC A;  4HNB A;  3R7W A;  2M1C A;  5FAT A;  2H28 A;  4ZJ1 A;  4NXF A;  4PAU A;  4MBH A;  1ZG6 A;  4DE0 A;  1OT9 A;  5GHZ A;  2VGL S;  3P98 A;  3SS5 A;  2Y2P A;  4IJG A;  3HLF A;  1H0M A;  3FYZ A;  4OOM A;  4K0X A;  3A3D A;  4JGR A;  3RJU A;  3LEQ A;  1VEU A;  2XR0 A;  3CPT A;  3PBR A;  2W3D A;  3L7H A;  1J9M A;  1A0K A;  4R0Q A;  4GD8 A;  4QPR A;  2M7U A;  4OQG A;  1W8Q A;  5F1F A;  1XKZ A;  3C4P A;  1P9W A;  3T4J A;  5GHY A;  2Y2Q A;  3MQO A;  1FQG A;  4GDB A;  4FH4 A;  3Q7V A;  1CK3 A;  3C4O A;  3C5A A;  3ZNT A;  1VET B;  4PHT A;  5CHJ A;  4O0P A;  3S7N A;  3HLC A;  3QP1 A;  4GZB A;  3C2W A;  4LV3 A;  4H6J A;  2Y91 A;  4XT2 B;  5F69 A;  2XH9 A;  3TRC A;  3B47 A;  1NLY A;  4X55 A;  4BD1 A;  4GS9 B;  1SDN A;  3GQZ A;  2A3U A;  1BLS A;  3UDF A;  3OPL A;  3CI6 A;  1S4S A;  1SKF A;  2PYR A;  2A24 A;  3OCN A;  3ZG7 B;  3LR0 A;  4ZJ3 A;  5DKL A;  1DP8 A;  3BM6 A;  4U0X A;  2ZOI A;  4IUH A;  1NZU A;  3T12 B;  1TD5 A;  2ZQ9 A;  3NDG A;  3LGO A;  1E4D A;  5LBR A;  3TW8 A;  3SH9 A;  4EU0 A;  1T19 A;  3WS0 A;  3UO9 A;  2ZC7 A;  3UNW A;  5A90 A;  3LIB A;  2LB9 A;  4NKP A;  3FKW A;  4Y2F A;  4U0T A;  1FCN A;  3NHQ A;  3IX8 A;  2JKT I;  3LCE A;  1T1A A;  5AJG A;  2Y2M A;  4M3K A;  5FI2 A;  3O5Y A;  4S2K A;  3HUO A;  4JXV A;  2XLN A;  3LO7 A;  1D06 A;  3BEB A;  3DTE A;  5EUA A;  3V39 A;  2FZ0 A;  3E4O A;  4HI4 A;  5HDD A;  5G4Z A;  2XQZ A;  4DJ3 A;  3HUN A;  1ONH A;  2VKS A;  4IED A;  2B95 A;  2HJE A;  2EWV A;  4LCL A;  4LRX C;  3H7W B;  4OP8 A;  3VE4 A;  4WEL A;  4WL9 A;  3C7U A;  1XGJ A;  3OZH A;  4RX2 A;  2ZLY A;  1L0G A;  3V5M A;  4E3M A;  3VP4 A;  1Q2Q A;  4N92 A;  4HOI A;  5DFX A;  1CEF A;  4BQM A;  2Q9N A;  4WMC A;  1FIK A;  3WWX A;  2J80 A;  2W3E A;  1KGG A;  3HJI A;  2GX5 A;  1MXO A;  2IA2 A;  4KQQ A;  1RGZ A;  2VGL M;  2KLI A;  2HP6 A;  5CTM A;  3NY4 A;  3W4O A;  5F68 A;  5FDH A;  5DTK A;  4HBT A;  4EBL A;  5KMW A;  5EFW A;  4BEN A;  3QNB A;  5CEC A;  4P85 A;  2P9V A;  2PU4 A;  1Y28 A;  3GTC A;  2XFT A;  2HGV A;  3LR3 A;  3BQA A;  3EWK A;  4OKP A;  2INW A;  2XRN A;  4DE2 A;  3E98 A;  1Q2P A;  1KDW A;  4DF6 A;  4KUO A;  1FOF A;  5BOH A;  4DXB A;  1YLJ A;  1G68 A;  2OV5 A;  1N9O A;  1NYM A;  4WZ5 C;  2UWX A;  4LRY C;  3CAX A;  2W3G A;  5E2E A;  4JF5 A;  1W63 M;  4BD0 A;  3S4X A;  5GLA A;  2XF3 A;  4B88 A;  3T4T A;  3B3X A;  1K0K A;  3JPU A;  1JWP A;  1ES5 A;  2YKH A;  3B33 A;  3UB6 A;  2FFF B;  3FWL A;  3P7N A;  2EFU A;  3M6B A;  4P87 A;  1OTI A;  2X01 A;  3RXW A;  3GMW A;  3GEC A;  4D2O A;  3K3C A;  2ZQ8 A;  1BT5 A;  2FH5 A;  4X69 A;  3S7O A;  3E4Q A;  3LR4 A;  4S2N C;  2P04 A;  1ERQ A;  3ICY A;  2QJ5 A;  1WA9 A;  4XUX A;  1V9Y A;  1BSG A;  3BLS A;  4XT2 A;  4Z1W A;  3V50 A;  2W1T B;  2AVX A;  4DN0 A;  3RH8 B;  1KVM A;  4GS9 A;  3MZF A;  3LIF A;  3NCK A;  3NJA A;  3HVF A;  1O07 A;  3GDI A;  5F6A A;  1OT6 A;  3UDX A;  3IX3 A;  4FD8 A;  1PNE A;  4R38 A;  1YPR A;  3T4Q A;  1TF1 A;  3B42 A;  3M2J A;  1W5D A;  2X02 A;  1YT4 A;  2VLG A;  1AWI A;  4OLG A;  1LL5 A;  1GHM A;  5GHX A;  3OPR A;  4NXG A;  3WRZ A;  1RGY A;  5EM0 A;  3TG9 A;  3E4P A;  4HP9 A;  3K2N A;  4MN5 A;  3UME A;  1EWZ A;  3ZGA B;  4MN6 A;  1ESI A;  1I5Q A;  1UGU A;  4BBU A;  1IEL A;  2Y79 A;  3UE6 A;  4N1X A;  3HUM A;  2ACG A;  2LB5 A;  2W0N A;  4BJP A;  3FC7 A;  4WZ5 A;  4PM7 A;  3IQA A;  3MF0 A;  5CGS A;  3OOV A;  5DF8 A;  4BWI A;  2VX8 A;  1NRJ A;  1SDE A;  1F2K A;  1PIO A;  3MKF A;  3MFD A;  4G3K A;  1TEM A;  2JE5 A;  1I2S A;  3O87 A;  4JGQ A;  3E2K A;  4S2L A;  2I9V A;  5HAR A;  4NXE A;  4KZ6 A;  2Q9M A;  3CLO A;  5KSH A;  2WGW B;  2PT7 A;  2IWC A;  3ZYT A;  4WMC D;  3HRE A;  3PBT A;  3QP5 A;  5IHV A;  2XD5 A;  1K38 A;  2B5R A;  1MZU A;  1Y54 A;  3IF6 C;  4KG5 A;  1LI9 A;  2EX9 A;  1ZKJ A;  2R9X A;  3F1P B;  4DRT A;  1H8M A;  2J3T D;  2Y55 A;  4UA6 A;  2PU2 A;  2XFS A;  4S2N A;  5HDC A;  4B93 A;  1L0E A;  1EI5 A;  2JCH A;  3N8S A;  5HL1 A;  1IYS A;  5HX9 A;  2V1Z A;  4CLC C;  1PWC A;  3IS2 B;  5AQ9 A;  1VQQ A;  1XX2 A;  4PMA A;  5M1A A;  2WGV A;  4Y3I A;  2H5S A;  4E3O A;  2KX6 A;  2L4R A;  4JPM A;  4QY6 A;  5U47 A;  4B4Z A;  1L2S A;  5CXW A;  3H9W A;  3PAE A;  3BLM A;  1H3Q A;  4LV2 A;  5M19 A;  3WRT A;  3OCL A;  5KZH A;  4YIN A;  4QU3 A;  2XA7 S;  3OPP A;  3KSH A;  4RYE A;  4KUK A;  4DXC A;  1XXM A;  4Y5F A;  2EWW A;  1ZC2 A;  3EEH A;  2ZC4 B;  3HLG A;  1MWU A;  4MCW A;  1AXB A;  1KDS A;  3AGF A;  2VZW A;  2PBY A;  1LL9 A;  5HDS A;  3DWZ A;  3IH8 A;  2VK3 A;  4K0W A;  3ZFZ A;  1SKO A;  3S7P A;  4X56 A;  1LSV A;  3W4Q A;  1UWN X;  4F3L B;  3SZT A;  4HBU A;  3QP4 A;  1YSQ A;  1L0D A;  4X1L A;  4EEP A;  2ZMA A;  3G34 A;  3D4F A;  1ES3 A;  3UB8 A;  4Y0T A;  3DTM A;  3ZVT A;  1NZO A;  1C3B A;  3WS2 A;  3P01 A;  3KYQ A;  3T4K A;  4CJN A;  3QP8 A;  3F1N B;  5HAQ A;  1XJ4 A;  2DNS A;  3CHW P;  1OJG A;  1PZO A;  3OPH A;  4DJ2 A;  1GA0 A;  3IF6 A;  5HAI A;  2WKH A;  1FCO A;  1Z6F A;  2DMW A;  4Q8I A;  4WBG A;  1K25 A;  1BTL A;  5DF7 A;  4KZ4 A;  1HD8 A;  4L9F A;  4D60 A;  2JC7 A;  2GNX A;  2A49 A;  2PHY A;  4EEU A;  5E43 A;  1YQS A;  2V8F A;  3CMZ A;  3NI9 A;  2ZM8 A;  2JKG A;  3G31 A;  4WZ4 A;  1GSW A;  4P0M A;  4ETZ A;  1Z09 A;  3SS4 A;  2HJ9 C;  4L9G A;  2V20 A;  5HWT A;  2Y2J A;  3VFF A;  3NOU C;  2YKF A;  1PW1 A;  1GA9 A;  1PI4 A;  2H0Y A;  5IS1 A;  3T1R A;  2V1A A;  3CG5 A;  3EQU A;  3EEA A;  2GZA A;  4IVK A;  2VV6 A;  5EVI B;  1KE4 A;  1SZV A;  1XA7 A;  4KQO A;  1OTA A;  3OBF A;  4Y15 A;  2EA9 A;  3K3D A;  3H82 B;  3IWO A;  5EV0 A;  5HD3 A;  3BYD A;  1MWR A;  2O9A A;  4OPR A;  2BAS A;  4FTX A;  5EM1 A;  1TS0 A;  4OPZ A;  2W3F A;  3E0Y A;  3VSK A;  3AGD A;  3Q82 A;  3IBR A;  5DTS A;  2WGW A;  2ZL1 B;  3VOZ A;  4EQ1 A;  2V8C A;  3QHY A;  3RTY A;  4AFI A;  2Y2K A;  1BLP A;  3A0S A;  2PAV P;  4DKI A;  1CI8 A;  3C38 A;  3F1P A;  1IOU A;  2J3T C;  3N7W A;  4PM9 A;  4QWO A;  2L0W A;  3UE1 A;  4GD6 A;  2G2W A;  5JYO A;  4NXB A;  1FR6 A;  1XP4 A;  2XA7 M;  1ES2 A;  1DP6 A;  5K5B A;  1BUL A;  2O99 A;  1H8Y A;  3VP2 A;  4GCZ A;  3SH8 A;  1OJ5 A;  1QMF A;  1HZO A;  1S4R A;  4XXR A;  3S7Q A;  4S2M A;  3IF5 A;  2J8Y A;  4GKU A;  3GV9 A;  1ESU A;  4Z9Q A;  4O01 A;  3G30 A;  4QD4 A;  4NK3 A;  4Y13 A;  3MQQ A;  3NC8 A;  2ZQD A;  4C75 A;  1D7E A;  3ZHH A;  4EV4 A;  3UDI A;  5TGF A;  5CHU A;  2HZ5 A;  4UA7 A;  3UPN A;  2PYP A;  4F94 A;  2HP9 A;  3R4K A;  5F82 A;  2WKE A;  4EES A;  4BBT A;  3IX4 A;  3LI8 A;  3AGE A;  3DTK A;  4F3L A;  3KSI A;  4LFU A;  1YLZ A;  3F1O B;  5GLB A;  3KSF A;  4BMW A;  4HH3 A;  1VB6 A;  3W8K A;  4ZBE A;  3ITA A;  3Q7Z A;  4KEN B;  1PWD A;  4I39 A;  3D3O A;  3V67 A;  4HH2 A;  3A3J A;  2JKR I;  4OPY A;  2ZQA A;  4JXW A;  1ERO A;  2K31 A;  4WEJ A;  2V0W A;  1MPL A;  2HPB A;  3GVB A;  3SOI A;  4E3K A;  1LL8 A;  4C6Y A;  5KIZ A;  4KZ9 A;  5A92 A;  2ZC6 B;  1PYY A;  2QWS A;  4LGW A;  1GHI A;  1YLW A;  2DRW A;  2IWB A;  4OPQ A;  4UHU A;  3V3R A;  2ZM0 A;  3MMH A;  5FDS A;  3BFD A;  3S1Y A;  1XJ3 A;  3SS3 A;  1WE4 A;  3C30 A;  2KDK A;  5F5Y A;  4BL3 A;  1H8Z A;  3MZE A;  3ZCZ A;  2VEA A;  4KZ8 A;  3NUL A;  2B18 A;  5DF9 A;  4CLC D;  4MEZ A;  1MWS A;  3ITB A;  3M2K A;  4N1H A;  1BLH A;  4EER A;  3I7J A;  4OQI A;  3T4L A;  2VA0 A;  1K55 C;  4MDZ A;  1JWZ A;  3SW1 A;  2O9B A;  3NIA A;  5C5K A;  3EOI A;  1P97 A;  5EVI A;  3IT9 A;  3IXG A;  2ZOH A;  3H82 A;  4KG2 A;  4HES A;  3FZC A;  1E3U A;  2XDM A;  5KSC A;  5FQJ A;  5L10 A;  2EXA A;  3A3E A;  3LYX A;  3PXP A;  4JKT A;  1JWV A;  2ZL1 A;  4IUK A;  4EQI A;  4R4R A;  1XFN A;  2XK1 A;  3A3F A;  3UN7 A;  3UPP A;  3CUE A;  1K6R A;  5HFO A;  3BWL A;  2BLS A;  1VET A;  3BFC A;  4Y17 A;  1ZTU A;  1M40 A;  2OSU A; 
#chains in the Genus database with same CATH homology
 1TDL A;  2P9V B;  1L0E A;  1EI5 A;  2JCH A;  2RCX A;  1H5X A;  4H8R A;  3VFH A;  1M6K A;  3N8S A;  4GDN A;  4MLL A;  1E25 A;  2H0T A;  5HL1 A;  4R1G A;  1IYS A;  5HX9 A;  5EOO A;  5FAT A;  5JYP A;  2V1Z A;  3BFF A;  5FQI A;  4ZJ1 A;  2QZ6 A;  1PWC A;  3ZVW A;  2R9W A;  4OQ0 A;  4EUZ A;  4MBH A;  5AQ9 A;  1VQQ A;  1ZG6 A;  3HLB A;  4DE0 A;  3UPO A;  1XX2 A;  4FSF A;  1DY6 A;  1NRF A;  2WGV A;  4PMA A;  3EQV A;  5FI6 A;  5M1A A;  3S22 A;  5GHZ A;  1PW8 A;  3P98 A;  2H5S A;  3E2L A;  3SS5 A;  4E3O A;  5F1G A;  4JPM A;  3DWK A;  4QY6 A;  2Y2P A;  2RL3 A;  5A91 A;  3HLF A;  5U47 A;  4B4Z A;  3FYZ A;  1L2S A;  5CXW A;  4OOM A;  4K0X A;  3A3D A;  3PAE A;  3RJU A;  4CPK A;  3BLM A;  3HL9 A;  4LV2 A;  5M19 A;  5FI7 A;  3WRT A;  3OCL A;  5KZH A;  5CGW A;  4QU3 A;  4YIN A;  4DE1 A;  2XR0 A;  3OPP A;  1JTD A;  3LY3 A;  3P09 A;  3PBR A;  4C3Q A;  4RYE A;  3SH7 A;  5FAP A;  4DXC A;  4EBN A;  1K6S A;  1J9M A;  1YLP A;  1YMX A;  1XXM A;  2EX2 A;  4R0Q A;  2Y2H A;  3IHB A;  3LY4 A;  4GD8 A;  3Q07 A;  4OQG A;  1ZC2 A;  1W79 A;  1W8Q A;  4BLM A;  2ZC4 B;  3HLG A;  3GSG A;  1XKZ A;  1MWU A;  2JBF A;  5G18 A;  5F1F A;  3C4P A;  5GHY A;  2Y2Q A;  1AXB A;  4MNR A;  5CER A;  1KDS A;  2XGN A;  3AGF A;  1FQG A;  2PBY A;  2Z2M B;  3G32 A;  1LL9 A;  4B4X A;  4GDB A;  3GR2 A;  3DWZ A;  3IH8 A;  3ZFZ A;  4K0W A;  4FH4 A;  3Q7V A;  4X56 A;  3W4Q A;  3IXH A;  1K55 A;  1CK3 A;  3C4O A;  3IXB A;  4WM9 A;  4Y7P A;  3C5A A;  3ZNT A;  4E3J A;  4HBU A;  5CHJ A;  2E8I A;  2V2F F;  3HLC A;  2Y59 A;  4RVA A;  1L0D A;  1N4O A;  4GN2 A;  1K4E A;  4GZB A;  5I94 A;  1LLB A;  2ZMA A;  1JTG A;  3G34 A;  3D4F A;  3NBL A;  4WEK A;  4LV3 A;  4OON A;  1ES3 A;  4Y0T A;  2Y91 A;  3PBQ A;  2XH9 A;  3DTM A;  4UA9 A;  3ZVT A;  1NZO A;  1C3B A;  4K91 A;  4X55 A;  5CGX A;  3WS2 A;  4BD1 A;  1SDN A;  1JVJ A;  3GQZ A;  3CZD A;  2A3U A;  3JYI A;  4S2O A;  4CJN A;  1BLS A;  3UDF A;  3OPL A;  1SKF A;  3OCN A;  4Y0U A;  5HAQ A;  2DNS A;  3ZG7 B;  3PBO A;  1GHP A;  4ZJ3 A;  2C6W B;  3BM6 A;  4U0X A;  4QB8 A;  1PZO A;  3OPH A;  3M6H A;  5FAS A;  1NZU A;  2ZM2 A;  1I2W A;  4NET A;  1TVF A;  1GA0 A;  2ZC3 B;  2ZQ9 A;  3IF6 A;  3MBZ A;  3NDG A;  5HAI A;  2WKH A;  1E4D A;  1FCO A;  1Z6F A;  3SH9 A;  4ZAM A;  3WS0 A;  4Q8I A;  3UO9 A;  2ZC7 A;  1K25 A;  1BTL A;  1GCE A;  4WBG A;  4LCM A;  5DF7 A;  3UNW A;  5A90 A;  4KZ4 A;  1KE3 A;  3FKW A;  1HD8 A;  2HP5 A;  4U0T A;  1FCN A;  2JC7 A;  2XEP A;  3DW0 A;  3PBS A;  2WYX A;  2A49 A;  1IKG A;  3LCE A;  3IWQ A;  3MKE A;  3HLD A;  2EFX A;  1K57 C;  1K4F A;  4JBF A;  5E43 A;  3VP0 A;  1YQS A;  2Y2M A;  3CMZ A;  3NI9 A;  4YFM A;  4M3K A;  2ZM8 A;  4R23 A;  5EE8 A;  5FI2 A;  3G31 A;  4PM6 A;  4WZ4 A;  5HW3 A;  4FCF A;  4P0M A;  3SS4 A;  3HUO A;  1HVB A;  4JXV A;  2XLN A;  1SCW A;  4S2K A;  1ZG4 A;  1SHV A;  2V20 A;  3LO7 A;  2Y2J A;  3VFF A;  3QNC A;  3BEB A;  5EUA A;  4LV1 A;  3UE3 A;  1XA1 A;  3V39 A;  4E3I A;  4ZTK A;  4OLD A;  3IH9 A;  1PW1 A;  1GA9 A;  1PI4 A;  4KZ5 A;  2H0Y A;  2XQZ A;  2OLV A;  1ERM A;  2WGI A;  3CG5 A;  5EVL A;  5TR7 A;  3EQU A;  4IVK A;  1N9B A;  3HUN A;  1ONH A;  4MBK A;  5EVI B;  1KE4 A;  4IED A;  5CRF A;  5FSR A;  3PBN A;  4N9K A;  1XA7 A;  1PI5 A;  4KQO A;  4LCL A;  3G35 A;  1QME A;  5FAQ A;  4WYY A;  1S0W A;  5FQ9 A;  4OP8 A;  5GLD A;  1IEM A;  5DVA A;  2Z2L B;  2VGJ A;  4WEL A;  3IWO A;  4S2I A;  1ONG A;  3C7U A;  3UE0 A;  1XGJ A;  3BYD A;  3OZH A;  4RX2 A;  1MWR A;  1YMS A;  1E3U D;  2ZLY A;  4OPR A;  4QY5 A;  4JXS A;  1L0G A;  3V5M A;  4E3M A;  2WAF A;  4OPZ A;  3VP4 A;  1Q2Q A;  4N92 A;  2OLU A;  1CEF A;  3VSK A;  3VSL A;  3AGD A;  1NY0 A;  3Q82 A;  4BQM A;  2Q9N A;  5DTS A;  2WGW A;  4S2P A;  4WMC A;  3VOZ A;  2J9O A;  2X71 A;  3QHY A;  1K56 D;  3WWX A;  3IF6 B;  4DE3 A;  2Y2K A;  1CEG A;  1FSW A;  3G2Z A;  1BLP A;  1KGG A;  1MXO A;  2Y2L A;  2Y2O A;  3O3V A;  5J8X A;  2Y4A A;  4KQQ A;  1RGZ A;  3TSG A;  1DJC A;  2HP6 A;  3ZG0 A;  4DKI A;  1W7F A;  1CI8 A;  4OQH A;  5CTM A;  1IYO A;  2ZD8 A;  3FKV A;  4E6X A;  1KGF A;  3NY4 A;  3W4O A;  1BUE A;  1NXY A;  5GLC A;  4OOL A;  3N7W A;  4PM9 A;  2WZX A;  3GRJ A;  4R4S A;  3UE1 A;  5E2G A;  5FDH A;  1LI0 A;  4GD6 A;  5L2F A;  5DTK A;  4HBT A;  2G2W A;  3ZG9 B;  4EBL A;  5KMW A;  4BEN A;  5JYO A;  4A5R A;  3QNB A;  1K54 A;  1FR6 A;  1XP4 A;  2I72 A;  4P85 A;  1ES2 A;  2P9V A;  5F83 A;  5CEC A;  1BUL A;  2PU4 A;  1ALQ A;  2HDU A;  3GTC A;  3IWI A;  1H8Y A;  2XFT A;  3VP2 A;  5CED A;  1K54 C;  3SH8 A;  4OKP A;  5EEC A;  4DE2 A;  1Q2P A;  1QMF A;  1KDW A;  3G4P A;  4DF6 A;  4R3J A;  1HZO A;  2J9P A;  2P74 A;  3OC2 A;  1DJA A;  4XXR A;  5CEB A;  1MY8 A;  3ISG A;  4IBR A;  1FOF A;  3NDE A;  5BOH A;  4S2M A;  2QPN A;  1YLJ A;  3IF5 A;  1G68 A;  4LV0 A;  4N9L A;  2J8Y A;  5E2H A;  4GKU A;  2OV5 A;  4OOY A;  3GV9 A;  1ESU A;  1NYM A;  4WZ5 C;  3G2Y A;  4Z9Q A;  3G30 A;  2UWX A;  4QD4 A;  5D3O A;  4NK3 A;  2WAE A;  3NC8 A;  4KZ7 A;  5E2E A;  2ZQC A;  4JF5 A;  4MBF A;  2ZQD A;  3ZDJ A;  4BD0 A;  3S4X A;  5CTN A;  4QHC A;  4C75 A;  5GLA A;  5FQK A;  3ZHH A;  1IYP A;  4EBP A;  4EV4 A;  3N6I A;  1FR1 A;  2XF3 A;  3HLW A;  4B88 A;  3B3X A;  3UDI A;  3VP1 A;  4OH0 A;  2GDN A;  1JWP A;  5TGF A;  1K57 A;  3V3S A;  1ES5 A;  5CHU A;  4S2J A;  5HAP A;  3C7V A;  3VMA A;  4ID4 A;  2FFF B;  3FWL A;  4UA7 A;  2EFU A;  1S6R A;  3M6B A;  4P87 A;  2X01 A;  3UPN A;  4F94 A;  2HP9 A;  4JF6 A;  5EOE A;  5FAO A;  1VM1 A;  1WYC A;  3GMW A;  3RXW A;  5F82 A;  2HDQ A;  5EPH A;  1RCJ A;  3BFG A;  2WKE A;  4KZB A;  4X53 A;  3MXS A;  5M18 A;  1RP5 A;  3BRM A;  1O7E A;  4IVI A;  2VGK A;  4D2O A;  2ZQ8 A;  2H10 A;  5DTT A;  3Q7V B;  1BT5 A;  3W4P A;  2WK0 A;  1IKI A;  3AGE A;  1IYQ A;  2WZZ A;  1XPB A;  1FSY A;  2EX8 A;  4OP5 A;  4X69 A;  1YLT A;  1TDG A;  4QJG A;  1YLZ A;  5GLB A;  5AQB A;  2ZC5 B;  3UY6 A;  1YLY A;  4DXB A;  4R3B A;  4PPR A;  3HBR A;  4S2N C;  3O86 A;  1CI9 A;  4X68 A;  1NJ4 A;  1DJB A;  4IBX A;  3W8K A;  5AQ7 A;  1L0F A;  4ZBE A;  1ERQ A;  4GOG A;  5EVI D;  3ITA A;  3Q1F A;  4XUX A;  1MKI A;  3Q7Z A;  3PTE A;  4KEN B;  1PWD A;  2EXB A;  4HEF A;  2G2U A;  3BLS A;  1BSG A;  4Y0O A;  3V50 A;  4JXG A;  3BEC A;  2XD1 A;  4PM8 A;  5E2F A;  1KVM A;  2FFY A;  4BL2 A;  3MZD A;  3MZF A;  4P6B A;  2Y2G A;  3NCK A;  2BG1 A;  3HVF A;  3A3J A;  4U3T A;  1O07 A;  3WS4 A;  3UDX A;  4OPY A;  1YM1 A;  2ZQA A;  4FD8 A;  4JXW A;  3VP3 A;  1ERO A;  3IXD A;  3M2J A;  4WEJ A;  5FQQ A;  1W5D A;  5TFQ A;  3SOI A;  1MPL A;  2HPB A;  2X02 A;  3GVB A;  4X6T A;  2Y2I A;  4E3K A;  4FH2 A;  4C6Y A;  1YT4 A;  2DCF A;  3A3I A;  2QMI A;  4KZ9 A;  4OLG A;  5FQM A;  5A92 A;  1LL5 A;  1GHM A;  5GHX A;  2ZC6 B;  3OPR A;  1PYY A;  3WRZ A;  1GHI A;  1YLW A;  1RGY A;  2DRW A;  2IWB A;  4OPQ A;  3CJM A;  4UHU A;  3TG9 A;  3V3R A;  5AQA A;  1PZP A;  2ZM0 A;  4EWF A;  4JLF A;  1BZA A;  3BFD A;  4KZA A;  5FA7 A;  3S1Y A;  3PAG A;  3N8R A;  1EWZ A;  3SS3 A;  3WS1 A;  3ZGA B;  1WE4 A;  1ESI A;  1U60 A;  4BL3 A;  1I5Q A;  2ZQ7 A;  5A93 A;  1IEL A;  4E3L A;  4PM5 A;  1H8Z A;  3MZE A;  4E6W A;  4L0L A;  3ZCZ A;  1LHY A;  2IWD A;  4KZ8 A;  1XGI A;  5DF9 A;  1HTZ A;  4N1X A;  3VOY A;  4MEZ A;  3HUM A;  1MWS A;  3ITB A;  3M2K A;  4N1H A;  4KZ3 A;  4ZDX A;  1BLH A;  3N8L A;  4BJP A;  3I7J A;  4OQI A;  1BLC A;  4WZ5 A;  3BFE A;  3ZG8 B;  1K55 C;  1KGE A;  2WUQ A;  3IQA A;  4PM7 A;  1JWZ A;  1PWG A;  3NIA A;  5CGS A;  3MXR A;  5EVI A;  1WYB A;  5DF8 A;  1KVL A;  3IT9 A;  5CHM A;  4GNU A;  2WAD A;  2ZJ9 A;  2CC1 A;  3IXG A;  5EVI C;  1SDE A;  4LEN A;  1FCM A;  2Y2N A;  4E3N A;  4KG2 A;  5GL9 A;  1MBL A;  4HES A;  1PIO A;  3MKF A;  4UAA A;  3FZC A;  3MFD A;  3N4I A;  1E3U A;  4DDY A;  3O88 A;  2XDM A;  1TEM A;  2JE5 A;  3HLE A;  1I2S A;  3IHA A;  5KSC A;  3O87 A;  5FQJ A;  3E2K A;  4S2L A;  5HAR A;  4DDS A;  4KZ6 A;  1W8Y A;  4KQR A;  2EXA A;  2Q9M A;  2HDR A;  4ZJ2 A;  1G6A A;  3A3E A;  5KSH A;  2WGW B;  1K56 A;  4RA7 A;  4JKT A;  4XUZ A;  1ES4 A;  1JWV A;  1OME A;  3RXX A;  2IWC A;  3LEZ A;  4EQI A;  4R4R A;  1MWT A;  4WMC D;  3HRE A;  2WKI A;  3PBT A;  5IHV A;  3ZNY A;  2XD5 A;  4KG6 A;  1K38 A;  2XK1 A;  2B5R A;  1Y54 A;  3A3F A;  1NYY A;  2EX6 A;  3IF6 C;  3Q81 A;  2C5W B;  3UN7 A;  4GB7 A;  3FV7 A;  1KE0 A;  3UPP A;  4KG5 A;  1LI9 A;  2EX9 A;  4OVD A;  3ZG5 A;  1ZKJ A;  1K6R A;  2R9X A;  5HFO A;  3TOI A;  4DRT A;  2Y55 A;  4UA6 A;  4JF4 A;  2BLS A;  2PU2 A;  3WS5 A;  2XFS A;  3BFC A;  4S2N A;  2J7V A;  4RX3 A;  2HDS A;  4O7D A;  1M40 A;  2OSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...