2V1AA

N- and c-terminal helices of oat lov2 (404-546) are involved in light-induced signal transduction (room temperature (293k) dark structure of lov2 (404-546))
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
144
structure length
144
Chain Sequence
FLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords NPH1-1
publication title N- and C-Terminal Flanking Regions Modulate Light-Induced Signal Transduction in the Lov2 Domain of the Blue Light Sensor Phototropin 1 from Avena Sativa.
pubmed doi rcsb
source organism Avena sativa
total genus 47
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2v1aA00
5AVEA 1XFQA 4EESA 2KX6A 3EWKA 3IBRA 3HJIA 5J4EA 5EFWA 3C8CA 5IS1A 1F98A 2YKFA 1G28A 4EEUA 3LI8A 3LIAA 5HDCA 2P7JA 3H82A 2QJ5A 1T1BA 3UB8A 3FG8A 3LUQA 2M1CA 1LSWA 5HWVA 3H7WB 3LIFA 4L9EA 4I5SA 4E04A 3LI9A 1TS8A 4K08A 2V1AA 3F1OB 4HOIA 4YWZA 3K3CA 1Y28A 2VLGA 3LIBA 5A8BA 1GSWA 3F1PB 5G4ZA 1BYWA 2Z6DA 4I3JA 5HZHA 4MN6A 4WL9A 2ZBBA 1OTBA 5TBMB 4JGRA 1XFNA 1LL8A 5HWWA 2PDRA 4NXGA 2W27A 4EETB 2VV7A 4NXBA 4JGOA 2PR6A 3BY9A 4WUJA 5HDSA 2PD8A 3F1NA 3ULFA 2CMNA 2QWSA 2QKPA 3NOTC 2L0WA 1DRMA 1OT6A 2V9AA 2WKPA 2A24A 2WKRA 3UB7A 4HHDA 2KDKA 3MXQA 3VOLA 1OJ5A 1XJ6A 3UB9A 5AVFA 3E4PA 4GW9A 3E4QA 4R3AA 2QHKA 4I39A 2I9VA 1D06A 4LLOB 5HDDA 3MQOA 2BASA 3C2WA 3NJAA 1F9IA 1N9OA 2GJ3A 1EW0A 4I3IA 4KUOA 4R6LA 1UWNX 2W0NA 3A0SA 2D01A 4R70A 4PKYG 3ICYA 3UMEA 2OWHA 3BWLA 1XJ2A 5F6AA 5DKKA 1OTAA 1MZUA 2V0WA 2OWJA 4GHIA 4HJ6A 3SW1A 4HIAA 5F68A 3NOPC 3T50A 1OTDA 4LRYC 2D02A 4KUKA 3CAXA 3VE4A 3B33A 1JNUA 4EXOA 3F1NB 4LPZA 1OT9A 4LRZE 3UB6A 1N9NA 3PHYA 3NHQA 3VE3A 1V9ZA 4NXEA 4BBUA 2A24B 4BBVA 4L9GA 2EA9A 1S4RA 5DJTA 1T18A 1T1AA 4JGPA 2V1BA 3K3DA 4I3AA 3BY8A 3IS2A 3MJQA 2VV6A 3HJKA 2WKQA 4JGQA 2YKHA 1OTEA 4WN5A 1X0OA 1S66L 2B02A 5KIZA 2PYRA 1LSXA 2VEAA 5F5YA 4HP4A 2ZOHA 2K7SA 1UGUA 1NWZA 1TS0A 3LYXA 4R38A 1P97A 3LIEA 4PKYA 4H6JA 1LT0A 4GHIB 4F3LA 2V0UA 4HH2A 4M4XA 1T19A 1N9LA 1LSVA 5F69A 1S1YA 3UE6A 3PYPA 1XJ3A 4HY8A 5DJUA 4HI4A 2L4RA 1S4SA 4HP9A 2PR5A 3A0RA 4XT2A 3MQQA 4MN5A 3A0VA 3UMDA 1OJGA 1OTIA 4WF0A 1VB6A 4HQAA 1GSVA 4GS9A 5J3WA 3E4OA 5IU1A 4BBTA 3P7NA 2HV1A 1TS7A 1DP8A 2PD7A 4HH3A 5J7EA 1ODVA 4B9OA 2PYPA 1S67L 3IS2B 3MFXA 3NOUC 1KOUA 3FC7A 5HSQA 4KQDA 1P0ZA 2QJ7A 3EEHA 3RH8B 2ZOIA 2R78A 1V9YA 1D7EA 4I38A 4EEPA 3OLOA 5DKLA 1DP6A 3LIDA 4HNBA 5HWTA 4H6JB 3MR0A 4EW7A 4EQ1A 5HD3A 3CWFA 4F3LB 2H28A 5G4YA 2INWA 4L9FA 4EERA 3G6OA 3D72A 5I5LA 3CLOA 1DP9A 4GCZA 4DJ2A 3H7WA 1TS6A 4HJ4A 1S1ZA 2J80A 1UWPX 4WLAA 3ZQ5A 4XT2B 4DJ3A 3F1OA 2L1MA 3LICA 5HD5A 2PHYA 2Z6CA 4LRXC 3RTYA 4HJ3A 1WA9A 3F1PA 4GS9B 2JHEA 2OOLA 3H82B 2JN7A 3H9WA 5TBMA 3KX0X 4RQ9A 3GECA 2VV8A 4NXFA 1XJ4A 3GDIA 1T1CA 1GSXA
chains in the Genus database with same CATH superfamily
5DF7A 2XA7M 4IHQA 2KX6A 5FDHA 4IJGA 4S2OA 1YLWA 5HX9A 2XEPA 1WYCA 3C8CA 1F98A 3VFFA 1F5MA 2XQZA 4EUZA 3LIAA 4IBXA 3VSLA 4X25A 2QZ6A 3BLMA 3NC8A 4BLMA 3FG8A 2XK1A 3T1SA 3VP4A 1HZOA 2ZC3B 3S1YA 5IT5A 1BT5A 2EX8A 3LR5A 3HLBA 1Y54A 1W8YA 2ZC6B 4Y7PA 4QPRA 4S2NA 3OPHA 1MXOA 1NJ4A 1Y28A 3PBQA 5HAQA 2HDUA 3LIBA 4O7DA 1PW8A 4KZAA 5G4ZA 2VKSA 2GX5A 1K57A 5MC7A 4RA7A 2Z6DA 4I3JA 4MN6A 2ZC7A 5TBMB 2WGWB 2WKEA 5EVIA 1LL9A 2HF6A 3C30A 2PDRA 4NXGA 4EETB 2OAQ1 2Q9NA 3UY6A 4D2OA 1FCOA 3EEAA 3VV4A 4NXBA 4ZAMA 4WMCA 4QWOA 3DWZA 4IBRA 3BY9A 4DXBA 2FH5A 3DBAA 5HAPA 2PD8A 3ULFA 2B18A 2O9BA 1PZPA 5FATA 2ZLYA 3FWLA 2H0TA 4Q8IA 4E6XA 2P74A 3R7WB 4OQ0A 1OJ5A 4JXWA 3C4PA 1FSWA 4S2JA 1ZHHB 3TG9A 3EQUA 4R3AA 3MZEA 4LLOB 3N8LA 3QP2A 5HDDA 3UPOA 3MXSA 3NJAA 4KZ9A 4OQIA 2J9PA 1YLJA 1VETA 1YKDA 1UWNX 4KZ3A 5CGSA 3ICYA 2OWHA 1JWZA 1XJ2A 5FI7A 2BTFP 3WRZA 2A49A 5CEDA 4OOLA 2PAVP 1CEFA 2XD1A 3MSHA 2OWJA 4GHIA 4HJ6A 2X71A 2Y79A 2C5WB 1OTDA 1YAXA 1DJBA 4JKTA 5CTNA 3N7WA 1RP5A 3S4XA 2Y2QA 4DN0A 4EBLA 2Y2GA 1Q2PA 3F1NB 4LPZA 1IEMA 3CPTA 1LI0A 1N9NA 3NHQA 2PRFA 2HJ9C 2Z2LB 1W7FA 2A24B 1FILA 3AGFA 4KZ6A 1ES4A 4L9GA 2EA9A 5GLDA 4HEFA 3VMAA 5DJTA 4P6BA 4R4SA 4X56A 1XA1A 5FAOA 2V1BA 2KOIA 1XKZA 2XLNA 4BQMA 4OH0A 4X1LA 3ZYTA 3AGDA 4MBHA 1OTEA 1JTGA 4WZ5C 1WYBA 3T4QA 5M19A 4MMNA 1S6RA 3TJZC 4NK3A 3LGOA 2K7SA 4NG2A 3RFBA 2HZ5A 2K31A 2H10A 2V8CA 4R38A 3LIEA 2DMWA 3A3FA 2XH9A 2Y2HA 4H6JA 2W3FA 4GD6A 3LEQA 1LI9A 2GNXA 5BOHA 4ZBEA 3BW6A 3C7VA 4X53A 3SOIA 1S1YA 3UE6A 4OPYA 5GLBA 1NZOA 1P9WA 1GHMA 5DVAA 1QMEA 4KQQA 3IWIA 3IF5A 3D9YA 1KDSA 3GRJA 4HI4A 3G2YA 4HP9A 3A0RA 1NY0A 4XT2A 1PFLA 3A0VA 3Q82A 1OJGA 4WF0A 4YOFA 3MS6A 3E98A 5FEGA 2Q0OA 3WWXA 3C5AA 3CZDA 4LV0A 5KZHA 3E4OA 1VHMA 4OPRA 4S2IA 5IU1A 4BBTA 3UE3A 4PM9A 1PW1A 3G35A 1RGYA 3LEZA 1L2SA 3T4TA 1ODVA 2VZWA 5J7EA 2DCFA 1EROA 1S67L 4CQHA 2WUQA 4ZDXA 1Y4OA 4B88A 1I2SA 1K56D 1SDNA 4UA9A 2KLIA 1DY6A 4Y0TA 2ZC5B 3EEHA 2ZD8A 4LCLA 1S0WA 3KO6A 2P9VB 2QYBA 1V9YA 1D7EA 3OPRA 5EOOA 2Y2IA 4P6ZS 2ZQ7A 5DKLA 1DP6A 2EXAA 1ZTUA 5JYOA 1G6AA 4E3OA 1KGFA 3HL9A 4F3LB 2J9OA 1TDLA 4L9FA 4EERA 1MWSA 3QP4A 4QY5A 1Q2QA 4KZ7A 4DE3A 5G18A 2RCXA 1DP9A 3FYZA 3H7WA 1EI5A 3D4FA 3ZDJA 2XRNA 2J80A 5EM1A 5E2FA 1PRQA 3ZQ5A 4FOFA 1IELA 5HD5A 4X6TA 1RGZA 2Y2JA 5HL1A 3A3DA 1WA9A 1YLPA 3W4QA 3UNWA 3P98A 4K91A 5FA7A 5FQJA 3JVVA 3N8SA 1XPBA 4JPMA 4B4XA 4N1XA 4OQGA 1G5UA 4X68A 2JN7A 5HAIA 2VGLS 2PBDP 2W3DA 4DF6A 2ZM0A 3GECA 1K55C 3MKEA 5DTKA 4EESA 1VM1A 4KQOA 3CITA 4QB8A 5A93A 2W1RA 2Y2NA 4QY6A 3CMZA 4MCWA 1U60A 2EFXA 5L8MA 5DFYA 3V50A 1MPLA 4ZRRA 3QHYA 5EUAA 3HVFA 2P7JA 5L09A 2QJ5A 3UPNA 1T1BA 2VGJA 3HLFA 1TF1A 4LV1A 3T4KA 2EFUA 2M1CA 3PBTA 1GA9A 1J3WA 4ARZB 4JF4A 2IA2A 2NUPC 5HWVA 4P87A 3LIFA 4ZTKA 3E2KA 3GV9A 3NULA 5L10A 3T4OA 4X69A 4WYYA 2XSSA 3R4KA 2V1AA 4Y13A 2VLGA 4HESA 4ETXA 3F1PB 3BYDA 5EE8A 1TD5A 1TVFA 5HZHA 1EWZA 5CERA 3BQAA 2ZBBA 3BFEA 4UAAA 5CGWA 4JGRA 2JKTI 1FCMA 1BSGA 5HWWA 2VV7A 1AWIA 1SKFA 2V2FF 2X01A 4R4RA 4EBNA 3FZCA 4ZJ2A 3ZG5A 1PWGA 4EBPA 1BULA 2QWSA 5GLCA 2QKPA 4JF6A 2V8FA 4LFUA 1HD8A 2L0WA 4PMAA 2G7UA 4S2LA 4PM5A 3A3JA 5D3OA 1CF0A 3IXBA 5EVEA 2XFTA 3OCLA 3VOLA 5L2FA 4E3NA 2HDSA 3HLCA 3IX4A 2ZL1A 5AVFA 4GW9A 3E4QA 1C3BA 5KSHA 4Y5FA 5F82A 3KYQA 3V3RA 2JKGA 1ZKJA 5EVLA 4IUKA 1N9OA 3HREA 3O5YA 5U47A 3RXXA 3IH9A 1W63Q 4KUOA 4R6LA 3A0SA 3FV7A 4E3LA 5GLAA 4EU0A 3WRTA 4PM6A 1XA7A 4E3IA 3ZVWA 2HP9A 1VQQA 5LBRA 1L0GA 4FCFA 2HGVA 4E3MA 1ONGA 5A90A 5FI2A 3SH8A 2EXBA 1VEUA 3IXGA 3SW1A 4HIAA 5F68A 3NOPC 4LRYC 4DDSA 5M18A 3SS4A 1LLBA 3B33A 2OSUA 3HLWA 2I72A 4P0MA 3PHYA 4RX3A 5CHJA 3DAVA 1K4EA 3VE3A 4EQIA 2P08A 4NXEA 5EOEA 1KVMA 4BBUA 4BD1A 1YM1A 1ES5A 3IF6B 2E8IA 3VP2A 4C3QA 5DTTA 5AJGA 3MBZA 2JKTM 1YLTA 4JGPA 3RXWA 3L7HA 3K3DA 4EUVA 3ITBA 1H3QA 3IS2A 3MJQA 4MBFA 1KE4A 3GSGA 3IX3A 2VV6A 4NKPA 2BLSA 3HJKA 3FKVA 2VJWA 4DXCA 4JGQA 1X0OA 1K38A 4FSFA 1S66L 2B02A 2OLUA 4R3BA 1IYQA 2J7VA 2VK3A 2PYRA 5FSRA 5IHVA 2VEAA 2P04A 5F5YA 3EOIA 2ZOHA 3KSIA 1P97A 1ES3A 2XF3A 5F83A 2ZJ9A 1FR1A 4JBFA 2C6WB 5E43A 4MLLA 3PBNA 4GZBA 4M4XA 1N9LA 1LSVA 4P85A 2J8YA 1JWVA 1G6OA 3PYPA 3ZG8B 3QNCA 1W8QA 4DE2A 2L4RA 2PR5A 2JBFA 4FH4A 1K6SA 3UE0A 2W1TA 4II7A 3BEBA 5EM0A 3TSGA 2W3EA 3BJNA 1YPRA 5J3WA 3ZHHA 3IHBA 3LFVA 5I94A 3MXRA 1DP8A 2PD7A 4B9OA 3HLDA 2AVXA 3U4LP 3CUEC 2J3WA 3NOUC 3JPUA 1KOUA 4ETZA 3S7PA 5HPIA 5FQKA 1K6RA 4X1MA 4UA6A 4RX2A 1P0ZA 1NRJA 2ZOIA 2R78A 1YLYA 1XX2A 3EQVA 1L0DA 2XA7S 5C5KA 1PWDA 3LIDA 5HWTA 1ONHA 5K5BA 3IXDA 4N9LA 4DDYA 1L0FA 1SCWA 3MR0A 4U0TA 3CWFA 3IWOA 1E4DA 1W5DA 4Z9QA 3G6OA 3CLOA 4E3JA 1CQAA 4U0XA 4LGWA 4WEJA 3OCNA 4HJ4A 1KGGA 1S1ZA 5GHYA 4R0QA 3IWQA 3ITAA 3WS5A 5AQ7A 1E25A 2QPNA 5FQQA 3OOVA 1MWTA 5KMWA 4LRXC 3RTYA 3VP3A 3PAEA 3LCEA 4GS9B 3ZCZA 4KQRA 1ESUA 2JHEA 3IH8A 2E8JA 4S2NC 5EECA 4CLCB 1KE3A 1CI9A 2JE5A 3P09A 3V3SA 1YMXA 3H9WA 3MMHA 5TBMA 2WGWA 5AQBA 3Q7VB 4K0WA 3KX0X 1M40A 2V1ZA 3BFCA 3CG5A 3OBFA 2VV8A 1XJ4A 3GDIA 1SKOB 2UWXA 4RVAA 4E3KA 2IWBA 3LY4A 4KENB 4Y2FA 5EFWA 3NI9A 2VX8A 5IS1A 4E6WA 2YKFA 3NY4A 4MDZA 3T4JA 1QMFA 1G28A 3LI8A 5HDCA 4B4ZA 4N9KA 1JWPA 3R7WA 3UB8A 1MWRA 3LUQA 3O86A 3W4PA 3DTMA 1MWUA 1LSWA 1NZUA 1K0KA 4DRTA 4L9EA 4I5SA 4E04A 4O0PA 1TS8A 2LB5A 4F94A 3F1OB 4HOIA 4YWZA 2Y2OA 3K3CA 3CHWP 3MKFA 5A8BA 2WZXA 1KVLA 3BFDA 1IYPA 3N6IA 1BYWA 1GCEA 2O9AA 2NUTC 4FH2A 3G32A 2Y91A 2ZMVA 4N92A 3NBLA 2HDRA 1OTBA 2J3TD 3FPVA 3LR0A 3T12B 5JYPA 3QP1A 1LL8A 4DKIA 3QNBA 4UA7A 3NECA 2VA0A 1PNEA 4ID4A 3OPLA 4JXSA 5GHZA 4JGOA 2PR6A 4WUJA 2PU2A 3F1NA 1FCNA 5CGXA 3W2ZA 3NOTC 2B95A 2X02A 1DRMA 3SH9A 2V9AA 3OPPA 2WKPA 2A24A 2WKRA 4HHDA 4IVIA 2KDKA 1XJ6A 3UB9A 3ZG0A 1G68A 2ZM8A 3A3IA 3T1RA 2QHKA 4I39A 4NETA 5FEFA 2I9VA 1JVJA 3MQOA 5E2EA 2BASA 1ZG6A 3NCKA 1E3UA 5DTSA 2GJ3A 3ZGAB 1EW0A 2PT7A 3BFFA 4DE1A 1H8YA 2A2LA 2OAP1 2W0NA 2Y55A 4JLFA 3DTKA 4WZ4A 4PKYG 4CJNA 3UMEA 2ZM2A 3BWLA 5CTMA 4IEDA 1ESIA 5F6AA 3DW0A 1TEMA 4C6YA 3LR4A 5CRFA 4ME4A 1OTAA 4BL3A 4Y0OA 5EVIB 2V0WA 4OPZA 3IF6C 4K0XA 3T50A 1RCJA 3FKWA 3PR6A 3SS5A 4KUKA 1XP4A 4OLGA 3PAGA 1H0MA 3Q1FA 3IHAA 3VE4A 1OPXA 4O8GA 5FAQA 3JVUA 4G3VA 2HP5A 4OP8A 4EXOA 3LO7A 4CLCD 2Q9MA 4LRZE 3QP6A 1V9ZA 1BLHA 1CJFA 2IWCA 2ZQDA 3T1QB 3GR2A 5DFXA 1T18A 5F1GA 3MF0A 4UHUA 4BWIA 1T1AA 3HCYA 2K2NA 2FFYA 3TW8A 4G3WA 1YT4A 4I3AA 1NLZA 3UB5P 3O3VA 3GVBA 1CEGA 2WKQA 4PM7A 5TFQA 4WN5A 4D60A 1FOFA 1DJAA 3BFGA 1VETB 4WBGA 2IWDA 3PBOA 5FQMA 5AQ9A 5KIZA 1D1JA 1M6KA 3NDEA 3VOZA 3C4OA 2P9VA 2J3TC 4GDBA 4HP4A 5GHXA 1NWZA 1TS0A 3UDIA 5CHUA 3CUEA 2QMIA 4PKYA 3D3OA 2HJEA 4GHIB 3PBSA 1N9BA 4F3LA 2FFFB 3KSGA 2V0UA 4HH2A 1T19A 3VOYA 3BQ8A 1PYYA 3O88A 4OONA 1MC0A 5F69A 1FSYA 4ZJ3A 3KYEA 1PWCA 4HY8A 5DJUA 1BLPA 1XXMA 1BZAA 1IKIA 3L9KA 3CPTB 4B93A 1I5QA 3LY3A 3EGXC 1GA0A 3V39A 1PI4A 1L0EA 4BMWA 4A5RA 4OVDA 3UMDA 1MKIA 1J9MA 1FIKA 2EWWA 4R3JA 3W8KA 4EV4A 3IX8A 4QD4A 2R9WA 1GHPA 2WGVA 1NXYA 3P7NA 1TS7A 2JKRI 3N8RA 1MKMA 4S2MA 3WS4A 5DF9A 4WZ5A 4HH3A 2PYPA 3A3EA 3MFXA 5FDSA 1BLCA 2XFSA 5TJJA 2DRWA 3FC7A 2WYXA 4U3TA 5CHMA 5HSQA 1HVBA 2ZQ8A 2WKIA 1XGJA 5GL9A 1FR6A 3QP8A 2JKFA 4FUWA 1ERQA 4G3KA 5CX7A 4ZJ1A 1ES2A 3OLOA 4LENA 4HNBA 2PBYA 4XUXA 5EPHA 4BL2A 4H6JB 3O87A 1YMSA 4EQ1A 5G4YA 2INWA 2Y4AA 3G4PA 1Z09A 2DNSA 2O9CA 1NYYA 4ARZA 4CLCC 4GCZA 3B42A 4Y3IA 1CI8A 2EX6A 4PAUA 2WADA 3DWKA 3GQZA 5TGFA 1UWPX 1HTZA 3S22A 2G2UA 3KSFA 4C75A 2Z2MB 4HBUA 4XT2B 3M2JA 4DJ3A 3AGEA 1PI5A 2L1MA 5EVID 4KZ5A 3N4IA 2W3GA 1MY8A 3M6HA 4GD8A 3F1PA 4OKPA 1LHYA 4KZBA 1BLSA 4NEED 5HARA 3RJUA 1STZA 3OZHA 5FL3A 3HUMA 1MBLA 5CEBA 4WMCD 1N4OA 4LV3A 4L0LA 2Y59A 1IOUA 1H8ZA 3Q81A 3OC2A 4GOGA 4ESPA 4S2PA 3S7NA 4GJ4A 1T1CA 2WK0A 4Q0HA 5AVEA 2JCHA 1XFQA 4P6ZM 1XGIA 3EWKA 3IBRA 4Q0JA 3WS0A 3HJIA 5J4EA 2MJ6A 5FQIA 4Y15A 3DTEA 1ZG4A 4EEUA 1TDGA 2RL3A 2ACGA 3V67A 2JKRM 3H82A 2G2WA 1IKGA 3B3XA 3SH7A 2W3HA 3TE8A 2XGNA 2ZC4B 4Z1WA 3H7WB 4PPRA 3S7QA 3LI9A 3GTCA 2XD5A 2Y2LA 1K54C 4QJGA 4CLCE 4K08A 4GDNA 3UDFA 3HBRA 1JTDA 5A92A 3CI6A 1AXBA 3WS1A 2LB9A 2OLVA 4KZ8A 1GSWA 4H8RA 2VGLM 5HPFA 4GLQA 4UQIM 3CJMA 1K55A 4M3KA 4WL9A 5M1AA 4JF5A 1XFNA 1GHIA 3UO9A 1KDWA 4FD8A 2W27A 1PIOA 4KZ4A 1I2WA 1W79A 1SDEA 2GDNA 3C7UA 2HP6A 4BD0A 3I7JA 3UDXA 3E0YA 3TRCA 3ZNTA 5HDSA 3PXPA 3VSKA 2CMNA 2ZQAA 2XR0A 2EWVA 1OT6A 4OLDA 4OOYA 1HLUP 4PM8A 2ZMFA 1WE4A 2PU4A 3IF6A 3UB7A 4QHCA 3MXQA 3G34A 1K4FA 3ZNYA 3BECA 1K57C 3E4PA 4KG5A 4OOMA 5HL6A 3ISGA 1D06A 2XROA 5EVIC 4DMZA 1ALQA 2WAEA 3C2WA 1YSQA 1F9IA 1YSPA 2VGKA 1KGEA 4KG6A 4GNUA 5HW3A 4I3IA 2FZ0A 2D01A 2M7VA 4LCMA 1K56A 2GZAA 4R70A 3MZDA 2UV0E 1BUEA 5F1FA 5DKKA 2ZMAA 3GMWA 1MZUA 4Y0UA 1IFQA 4AFIA 3U2AA 2R9XA 4MEZA 3ZVTA 4QU3A 2D02A 4YINA 3CAXA 5J8XA 2Y2KA 1YQSA 4OQHA 5FAPA 3MQ0A 3PTEA 1JNUA 3G2ZA 2HPBA 4R1GA 1O7EA 5DF8A 4UEYA 1OT9A 4Y17A 3UB6A 3P01A 1IYOA 3KSHA 2Y8HA 4BBVA 3G30A 3NDGA 1S4RA 1Z6FA 2O0YA 4WEKA 5EV0A 3G31A 2ZL1B 1NYMA 3MZFA 4R23A 4DE0A 2EX9A 4Q0IA 3BLSA 5FI6A 3BY8A 3JYIA 1K25A 3IT9A 4YNRA 4MN7A 3T4SA 2YKHA 4WM9A 4JXVA 2Y2PA 1L3LA 4WELA 4S2KA 3UE1A 3V5MA 3PBRA 2WGIA 5CECA 1LSXA 3T1XA 3WS2A 4OP5A 5E2HA 5AQAA 1UGUA 1YLZA 3C38A 4LV2A 3LYXA 3ZFZA 3HLGA 1LT0A 1VEUB 4IVKA 4MNRA 3ZG9B 5TR7A 2H0YA 3ZG7B 4MBKA 1LL5A 3SZTA 3IQAA 3B47A 3M2KA 3IXHA 2HDQA 4OPQA 4UQIS 5FASA 1XJ3A 3UN7A 3QP5A 1NRFA 3HUOA 4O01A 3M6BA 1H8MA 1S4SA 5L07A 3MQQA 2A3UA 2H5SA 2B5RA 4MN5A 2WKHA 2ZQ9A 3W4OA 2BG1A 3NIAA 2CC1A 1OTIA 1W63M 1VB6A 2WZZA 4IUHA 3VP0A 4HQAA 1GSVA 4GS9A 2JC7A 2O99A 2ZQCA 1SZVA 3MFDA 2HV1A 4CLCA 3T4LA 1E3UD 3IS2B 1H5XA 1P9RA 3Q7VA 3FPWA 2XDMA 4N1HA 4FTXA 3S7OA 1A0KA 4KQDA 4KG2A 4RYEA 1SKOA 3TOIA 2QJ7A 1IYSA 3RH8B 1FQGA 3DTIA 4CPKA 3BRMA 4YFMA 2Y2MA 4I38A 1ERMA 4EEPA 4X55A 2EX2A 1KE0A 3Q7ZA 3SS3A 4XXRA 4BJPA 4EW7A 5HD3A 5KSCA 2H28A 5A91A 3LR3A 2M7UA 3E2LA 3VP1A 3VFHA 1OMEA 1ZC2A 3D72A 3HUNA 4GN2A 5I5LA 4DJ2A 2V20A 3EGDC 3HLEA 3UPPA 1NLYA 1TS6A 4GKUA 3BM6A 4WLAA 5FQ9A 2OV5A 3F1OA 3LICA 2PHYA 2Z6CA 1O07A 5E2GA 1DJCA 2W1TB 4HJ3A 3KYZA 1F2KA 2OOLA 4PHTA 4EWFA 4HBTA 4BENA 4XUZA 3H82B 1BTLA 3IBJA 1PZOA 3K2NA 2WAFA 5CXWA 1K54A 4JXGA 1SHVA 4RQ9A 1ACFA 1CK3A 4GB7A 4NXFA 3Q07A 1GSXA 5HFOA
chains in the Genus database with same CATH topology
5AVEA 1XFQA 4EESA 4KQOA 2XA7M 4P6ZM 4IHQA 3CITA 2KX6A 3EWKA 3IBRA 4IJGA 4Q0JA 3HJIA 2W1RA 5J4EA 4Y2FA 2MJ6A 4MCWA 5L8MA 5EFWA 2VX8A 5DFYA 3C8CA 5IS1A 1F98A 2YKFA 4ZRRA 1F5MA 4MDZA 3T4JA 1G28A 4EEUA 3LI8A 3LIAA 5HDCA 2P7JA 3V67A 2JKRM 2QJ5A 3H82A 1T1BA 1TF1A 3R7WA 3UB8A 3FG8A 3T4KA 3LUQA 2M1CA 3PBTA 4ARZB 2W3HA 1LSWA 3TE8A 2IA2A 2NUPC 5HWVA 4Z1WA 3H7WB 5IT5A 3LIFA 3S7QA 4L9EA 4I5SA 4E04A 3LI9A 4O0PA 1TS8A 3T4OA 2LB5A 3LR5A 4CLCE 4K08A 2XSSA 3R4KA 2V1AA 3F1OB 4HOIA 4QPRA 4YWZA 3K3CA 3CI6A 1Y28A 3PBQA 2VLGA 3LIBA 2LB9A 5A8BA 1GSWA 4ETXA 3F1PB 5G4ZA 1BYWA 2VGLM 5HPFA 4GLQA 2O9AA 2NUTC 2VKSA 4UQIM 2GX5A 1TD5A 5MC7A 2ZMVA 2Z6DA 4I3JA 5HZHA 4MN6A 4WL9A 3BQAA 2ZBBA 1OTBA 2J3TD 3FPVA 3LR0A 5TBMB 4JGRA 2JKTI 1XFNA 2HF6A 1LL8A 3C30A 5HWWA 2PDRA 4NXGA 2W27A 4EETB 2VV7A 2OAQ1 2VA0A 3EEAA 3VV4A 4NXBA 3E0YA 4JGOA 2PR6A 3TRCA 3BY9A 2FH5A 4WUJA 3DBAA 5HDSA 3PXPA 2PD8A 3F1NA 3ULFA 2B18A 2CMNA 2O9BA 2QKPA 2QWSA 3W2ZA 3NOTC 2L0WA 1DRMA 2EWVA 1OT6A 2G7UA 2V9AA 2ZMFA 2WKPA 2A24A 2WKRA 3UB7A 3R7WB 4HHDA 2KDKA 3MXQA 3OCLA 3VOLA 1OJ5A 1XJ6A 3UB9A 5AVFA 3E4PA 4GW9A 1ZHHB 3E4QA 3EQUA 4R3AA 2QHKA 4I39A 4OOMA 5HL6A 5KSHA 4Y5FA 2I9VA 1D06A 4LLOB 3KYQA 5HDDA 2XROA 4DMZA 3MQOA 2BASA 3C2WA 3NJAA 1YSQA 1F9IA 4IUKA 1YSPA 1N9OA 3O5YA 2GJ3A 1EW0A 2PT7A 1W63Q 1YKDA 2A2LA 2OAP1 4I3IA 4KUOA 4R6LA 1UWNX 2W0NA 3A0SA 4EU0A 2FZ0A 2D01A 2M7VA 2GZAA 4R70A 4PKYG 3ICYA 3UMEA 2OWHA 3BWLA 1XJ2A 5LBRA 5F6AA 3LR4A 2HGVA 4ME4A 4OOLA 1OTAA 5DKKA 1MZUA 2V0WA 2OWJA 1IFQA 4GHIA 4HJ6A 3U2AA 4AFIA 3SW1A 4HIAA 2Y79A 5F68A 3NOPC 3T50A 1OTDA 1YAXA 4LRYC 3PR6A 2D02A 4KUKA 3CAXA 3VE4A 1OPXA 4O8GA 3B33A 3MQ0A 1JNUA 4DN0A 3JVUA 4G3VA 4UEYA 4EXOA 3F1NB 4LPZA 1OT9A 4CLCD 4LRZE 3UB6A 1N9NA 3PHYA 3P01A 3KSHA 3NHQA 3VE3A 1V9ZA 2P08A 4NXEA 2HJ9C 4BBUA 2Y8HA 2A24B 4BBVA 4L9GA 2EA9A 1S4RA 5DJTA 2O0YA 5DFXA 1T18A 4WEKA 3MF0A 5AJGA 2JKTM 4BWIA 1T1AA 4JGPA 3HCYA 2K2NA 4Q0IA 3TW8A 2V1BA 4G3WA 3K3DA 4EUVA 1H3QA 4I3AA 2KOIA 3BY8A 3IS2A 3MJQA 1NLZA 2VV6A 4NKPA 3HJKA 2VJWA 4YNRA 2WKQA 4MN7A 4JGQA 3T4SA 2YKHA 1OTEA 3ZYTA 4WN5A 1X0OA 4FSFA 1S66L 4WELA 2B02A 3PBOA 3PBRA 3T4QA 4MMNA 5KIZA 3TJZC 2PYRA 1LSXA 2P04A 2VEAA 3EOIA 5F5YA 2J3TC 4HP4A 2ZOHA 2K7SA 3RFBA 2K31A 1UGUA 1NWZA 3C38A 3KSIA 1TS0A 3LYXA 4R38A 1P97A 3LIEA 2DMWA 3CUEA 4PKYA 4H6JA 3D3OA 1LT0A 2HJEA 4GHIB 3PBSA 2W3FA 4F3LA 2GNXA 3KSGA 2V0UA 3PBNA 4HH2A 4M4XA 1T19A 1N9LA 1LSVA 3BQ8A 3B47A 3BW6A 1MC0A 4UQIS 1G6OA 5F69A 1S1YA 3UE6A 3PYPA 1P9WA 1XJ3A 4HY8A 5DJUA 4HI4A 4O01A 4B93A 1H8MA 2L4RA 1S4SA 4HP9A 2PR5A 3A0RA 4XT2A 3MQQA 3EGXC 4BMWA 4MN5A 3A0VA 3UMDA 1OJGA 2EWWA 1OTIA 4WF0A 1W63M 4YOFA 1VB6A 2W1TA 4IUHA 4II7A 3E98A 4HQAA 1GSVA 4GS9A 2O99A 2W3EA 3BJNA 5J3WA 3E4OA 1VHMA 5IU1A 4BBTA 3P7NA 2HV1A 3UE3A 1TS7A 3LFVA 4CLCA 1DP8A 2JKRI 1MKMA 2PD7A 5DF9A 3T4LA 4HH3A 3T4TA 1ODVA 2VZWA 4B9OA 5J7EA 2PYPA 3CUEC 1S67L 3IS2B 4CQHA 3MFXA 2J3WA 3NOUC 1P9RA 5TJJA 1KOUA 3FPWA 3S7PA 4ETZA 3FC7A 5HSQA 5HPIA 3S7OA 4KQDA 1P0ZA 1NRJA 2KLIA 2QJ7A 3EEHA 3RH8B 2ZOIA 2R78A 3KO6A 2QYBA 1V9YA 1D7EA 4I38A 4G3KA 3EQVA 5CX7A 4EEPA 2XA7S 4P6ZS 3OLOA 5DKLA 1DP6A 5C5KA 3LIDA 4HNBA 5HWTA 4BJPA 1ZTUA 4H6JB 5K5BA 3MR0A 4EW7A 4EQ1A 5HD3A 3CWFA 4F3LB 2H28A 3LR3A 5G4YA 2M7UA 2INWA 4L9FA 2O9CA 4EERA 3G6OA 3D72A 5I5LA 3CLOA 4ARZA 4CLCC 1DP9A 3B42A 4GCZA 4Y3IA 4DJ2A 3H7WA 4WEJA 4PAUA 3EGDC 3OCNA 1NLYA 1TS6A 4HJ4A 2XRNA 1S1ZA 2J80A 1UWPX 4WLAA 3KSFA 3ZQ5A 4XT2B 4DJ3A 4FOFA 3F1OA 2L1MA 3OOVA 3LICA 5HD5A 2PHYA 2Z6CA 4LRXC 2W3GA 3RTYA 4HJ3A 2W1TB 1WA9A 3KYZA 3F1PA 4GS9B 4NEED 2JHEA 1STZA 2OOLA 5FL3A 3JVVA 4PHTA 4CLCB 3H82B 2JN7A 4L0LA 2VGLS 1IOUA 3H9WA 3IBJA 3MMHA 5TBMA 3K2NA 2W3DA 3KX0X 4RQ9A 3GECA 3OC2A 3S7NA 4GJ4A 3OBFA 2VV8A 4NXFA 1XJ4A 3GDIA 1T1CA 1GSXA 4Q0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVE A;  1XFQ A;  4EES A;  2KX6 A;  3EWK A;  3IBR A;  3HJI A;  5J4E A;  5EFW A;  3C8C A;  5IS1 A;  1F98 A;  2YKF A;  1G28 A;  4EEU A;  3LI8 A;  3LIA A;  5HDC A;  2P7J A;  3H82 A;  2QJ5 A;  1T1B A;  3UB8 A;  3FG8 A;  3LUQ A;  2M1C A;  1LSW A;  5HWV A;  3H7W B;  3LIF A;  4L9E A;  4I5S A;  4E04 A;  3LI9 A;  1TS8 A;  4K08 A;  2V1A A;  3F1O B;  4HOI A;  4YWZ A;  3K3C A;  1Y28 A;  2VLG A;  3LIB A;  5A8B A;  1GSW A;  3F1P B;  5G4Z A;  1BYW A;  2Z6D A;  4I3J A;  5HZH A;  4MN6 A;  4WL9 A;  2ZBB A;  1OTB A;  5TBM B;  4JGR A;  1XFN A;  1LL8 A;  5HWW A;  2PDR A;  4NXG A;  2W27 A;  4EET B;  2VV7 A;  4NXB A;  4JGO A;  2PR6 A;  3BY9 A;  4WUJ A;  5HDS A;  2PD8 A;  3F1N A;  3ULF A;  2CMN A;  2QWS A;  2QKP A;  3NOT C;  2L0W A;  1DRM A;  1OT6 A;  2V9A A;  2WKP A;  2A24 A;  2WKR A;  3UB7 A;  4HHD A;  2KDK A;  3MXQ A;  3VOL A;  1OJ5 A;  1XJ6 A;  3UB9 A;  5AVF A;  3E4P A;  4GW9 A;  3E4Q A;  4R3A A;  2QHK A;  4I39 A;  2I9V A;  1D06 A;  4LLO B;  5HDD A;  3MQO A;  2BAS A;  3C2W A;  3NJA A;  1F9I A;  1N9O A;  2GJ3 A;  1EW0 A;  4I3I A;  4KUO A;  4R6L A;  1UWN X;  2W0N A;  3A0S A;  2D01 A;  4R70 A;  4PKY G;  3ICY A;  3UME A;  2OWH A;  3BWL A;  1XJ2 A;  5F6A A;  5DKK A;  1OTA A;  1MZU A;  2V0W A;  2OWJ A;  4GHI A;  4HJ6 A;  3SW1 A;  4HIA A;  5F68 A;  3NOP C;  3T50 A;  1OTD A;  4LRY C;  2D02 A;  4KUK A;  3CAX A;  3VE4 A;  3B33 A;  1JNU A;  4EXO A;  3F1N B;  4LPZ A;  1OT9 A;  4LRZ E;  3UB6 A;  1N9N A;  3PHY A;  3NHQ A;  3VE3 A;  1V9Z A;  4NXE A;  4BBU A;  2A24 B;  4BBV A;  4L9G A;  2EA9 A;  1S4R A;  5DJT A;  1T18 A;  1T1A A;  4JGP A;  2V1B A;  3K3D A;  4I3A A;  3BY8 A;  3IS2 A;  3MJQ A;  2VV6 A;  3HJK A;  2WKQ A;  4JGQ A;  2YKH A;  1OTE A;  4WN5 A;  1X0O A;  1S66 L;  2B02 A;  5KIZ A;  2PYR A;  1LSX A;  2VEA A;  5F5Y A;  4HP4 A;  2ZOH A;  2K7S A;  1UGU A;  1NWZ A;  1TS0 A;  3LYX A;  4R38 A;  1P97 A;  3LIE A;  4PKY A;  4H6J A;  1LT0 A;  4GHI B;  4F3L A;  2V0U A;  4HH2 A;  4M4X A;  1T19 A;  1N9L A;  1LSV A;  5F69 A;  1S1Y A;  3UE6 A;  3PYP A;  1XJ3 A;  4HY8 A;  5DJU A;  4HI4 A;  2L4R A;  1S4S A;  4HP9 A;  2PR5 A;  3A0R A;  4XT2 A;  3MQQ A;  4MN5 A;  3A0V A;  3UMD A;  1OJG A;  1OTI A;  4WF0 A;  1VB6 A;  4HQA A;  1GSV A;  4GS9 A;  5J3W A;  3E4O A;  5IU1 A;  4BBT A;  3P7N A;  2HV1 A;  1TS7 A;  1DP8 A;  2PD7 A;  4HH3 A;  5J7E A;  1ODV A;  4B9O A;  2PYP A;  1S67 L;  3IS2 B;  3MFX A;  3NOU C;  1KOU A;  3FC7 A;  5HSQ A;  4KQD A;  1P0Z A;  2QJ7 A;  3EEH A;  3RH8 B;  2ZOI A;  2R78 A;  1V9Y A;  1D7E A;  4I38 A;  4EEP A;  3OLO A;  5DKL A;  1DP6 A;  3LID A;  4HNB A;  5HWT A;  4H6J B;  3MR0 A;  4EW7 A;  4EQ1 A;  5HD3 A;  3CWF A;  4F3L B;  2H28 A;  5G4Y A;  2INW A;  4L9F A;  4EER A;  3G6O A;  3D72 A;  5I5L A;  3CLO A;  1DP9 A;  4GCZ A;  4DJ2 A;  3H7W A;  1TS6 A;  4HJ4 A;  1S1Z A;  2J80 A;  1UWP X;  4WLA A;  3ZQ5 A;  4XT2 B;  4DJ3 A;  3F1O A;  2L1M A;  3LIC A;  5HD5 A;  2PHY A;  2Z6C A;  4LRX C;  3RTY A;  4HJ3 A;  1WA9 A;  3F1P A;  4GS9 B;  2JHE A;  2OOL A;  3H82 B;  2JN7 A;  3H9W A;  5TBM A;  3KX0 X;  4RQ9 A;  3GEC A;  2VV8 A;  4NXF A;  1XJ4 A;  3GDI A;  1T1C A;  1GSX A; 
#chains in the Genus database with same CATH topology
 5DF7 A;  2XA7 M;  4IHQ A;  2KX6 A;  5FDH A;  4IJG A;  4S2O A;  1YLW A;  5HX9 A;  2XEP A;  1WYC A;  3C8C A;  1F98 A;  3VFF A;  1F5M A;  2XQZ A;  4EUZ A;  3LIA A;  4IBX A;  3VSL A;  4X25 A;  2QZ6 A;  3BLM A;  3NC8 A;  4BLM A;  3FG8 A;  2XK1 A;  3T1S A;  3VP4 A;  1HZO A;  2ZC3 B;  3S1Y A;  5IT5 A;  1BT5 A;  2EX8 A;  3LR5 A;  3HLB A;  1Y54 A;  1W8Y A;  2ZC6 B;  4Y7P A;  4QPR A;  4S2N A;  3OPH A;  1MXO A;  1NJ4 A;  1Y28 A;  3PBQ A;  5HAQ A;  2HDU A;  3LIB A;  4O7D A;  1PW8 A;  4KZA A;  5G4Z A;  2VKS A;  2GX5 A;  1K57 A;  5MC7 A;  4RA7 A;  2Z6D A;  4I3J A;  4MN6 A;  2ZC7 A;  5TBM B;  2WGW B;  2WKE A;  5EVI A;  1LL9 A;  2HF6 A;  3C30 A;  2PDR A;  4NXG A;  4EET B;  2OAQ 1;  2Q9N A;  3UY6 A;  4D2O A;  1FCO A;  3EEA A;  3VV4 A;  4NXB A;  4ZAM A;  4WMC A;  4QWO A;  3DWZ A;  4IBR A;  3BY9 A;  4DXB A;  2FH5 A;  3DBA A;  5HAP A;  2PD8 A;  3ULF A;  2B18 A;  2O9B A;  1PZP A;  5FAT A;  2ZLY A;  3FWL A;  2H0T A;  4Q8I A;  4E6X A;  2P74 A;  3R7W B;  4OQ0 A;  1OJ5 A;  4JXW A;  3C4P A;  1FSW A;  4S2J A;  1ZHH B;  3TG9 A;  3EQU A;  4R3A A;  3MZE A;  4LLO B;  3N8L A;  3QP2 A;  5HDD A;  3UPO A;  3MXS A;  3NJA A;  4KZ9 A;  4OQI A;  2J9P A;  1YLJ A;  1VET A;  1YKD A;  1UWN X;  4KZ3 A;  5CGS A;  3ICY A;  2OWH A;  1JWZ A;  1XJ2 A;  5FI7 A;  2BTF P;  3WRZ A;  2A49 A;  5CED A;  4OOL A;  2PAV P;  1CEF A;  2XD1 A;  3MSH A;  2OWJ A;  4GHI A;  4HJ6 A;  2X71 A;  2Y79 A;  2C5W B;  1OTD A;  1YAX A;  1DJB A;  4JKT A;  5CTN A;  3N7W A;  1RP5 A;  3S4X A;  2Y2Q A;  4DN0 A;  4EBL A;  2Y2G A;  1Q2P A;  3F1N B;  4LPZ A;  1IEM A;  3CPT A;  1LI0 A;  1N9N A;  3NHQ A;  2PRF A;  2HJ9 C;  2Z2L B;  1W7F A;  2A24 B;  1FIL A;  3AGF A;  4KZ6 A;  1ES4 A;  4L9G A;  2EA9 A;  5GLD A;  4HEF A;  3VMA A;  5DJT A;  4P6B A;  4R4S A;  4X56 A;  1XA1 A;  5FAO A;  2V1B A;  2KOI A;  1XKZ A;  2XLN A;  4BQM A;  4OH0 A;  4X1L A;  3ZYT A;  3AGD A;  4MBH A;  1OTE A;  1JTG A;  4WZ5 C;  1WYB A;  3T4Q A;  5M19 A;  4MMN A;  1S6R A;  3TJZ C;  4NK3 A;  3LGO A;  2K7S A;  4NG2 A;  3RFB A;  2HZ5 A;  2K31 A;  2H10 A;  2V8C A;  4R38 A;  3LIE A;  2DMW A;  3A3F A;  2XH9 A;  2Y2H A;  4H6J A;  2W3F A;  4GD6 A;  3LEQ A;  1LI9 A;  2GNX A;  5BOH A;  4ZBE A;  3BW6 A;  3C7V A;  4X53 A;  3SOI A;  1S1Y A;  3UE6 A;  4OPY A;  5GLB A;  1NZO A;  1P9W A;  1GHM A;  5DVA A;  1QME A;  4KQQ A;  3IWI A;  3IF5 A;  3D9Y A;  1KDS A;  3GRJ A;  4HI4 A;  3G2Y A;  4HP9 A;  3A0R A;  1NY0 A;  4XT2 A;  1PFL A;  3A0V A;  3Q82 A;  1OJG A;  4WF0 A;  4YOF A;  3MS6 A;  3E98 A;  5FEG A;  2Q0O A;  3WWX A;  3C5A A;  3CZD A;  4LV0 A;  5KZH A;  3E4O A;  1VHM A;  4OPR A;  4S2I A;  5IU1 A;  4BBT A;  3UE3 A;  4PM9 A;  1PW1 A;  3G35 A;  1RGY A;  3LEZ A;  1L2S A;  3T4T A;  1ODV A;  2VZW A;  5J7E A;  2DCF A;  1ERO A;  1S67 L;  4CQH A;  2WUQ A;  4ZDX A;  1Y4O A;  4B88 A;  1I2S A;  1K56 D;  1SDN A;  4UA9 A;  2KLI A;  1DY6 A;  4Y0T A;  2ZC5 B;  3EEH A;  2ZD8 A;  4LCL A;  1S0W A;  3KO6 A;  2P9V B;  2QYB A;  1V9Y A;  1D7E A;  3OPR A;  5EOO A;  2Y2I A;  4P6Z S;  2ZQ7 A;  5DKL A;  1DP6 A;  2EXA A;  1ZTU A;  5JYO A;  1G6A A;  4E3O A;  1KGF A;  3HL9 A;  4F3L B;  2J9O A;  1TDL A;  4L9F A;  4EER A;  1MWS A;  3QP4 A;  4QY5 A;  1Q2Q A;  4KZ7 A;  4DE3 A;  5G18 A;  2RCX A;  1DP9 A;  3FYZ A;  3H7W A;  1EI5 A;  3D4F A;  3ZDJ A;  2XRN A;  2J80 A;  5EM1 A;  5E2F A;  1PRQ A;  3ZQ5 A;  4FOF A;  1IEL A;  5HD5 A;  4X6T A;  1RGZ A;  2Y2J A;  5HL1 A;  3A3D A;  1WA9 A;  1YLP A;  3W4Q A;  3UNW A;  3P98 A;  4K91 A;  5FA7 A;  5FQJ A;  3JVV A;  3N8S A;  1XPB A;  4JPM A;  4B4X A;  4N1X A;  4OQG A;  1G5U A;  4X68 A;  2JN7 A;  5HAI A;  2VGL S;  2PBD P;  2W3D A;  4DF6 A;  2ZM0 A;  3GEC A;  1K55 C;  3MKE A;  5DTK A;  4EES A;  1VM1 A;  4KQO A;  3CIT A;  4QB8 A;  5A93 A;  2W1R A;  2Y2N A;  4QY6 A;  3CMZ A;  4MCW A;  1U60 A;  2EFX A;  5L8M A;  5DFY A;  3V50 A;  1MPL A;  4ZRR A;  3QHY A;  5EUA A;  3HVF A;  2P7J A;  5L09 A;  2QJ5 A;  3UPN A;  1T1B A;  2VGJ A;  3HLF A;  1TF1 A;  4LV1 A;  3T4K A;  2EFU A;  2M1C A;  3PBT A;  1GA9 A;  1J3W A;  4ARZ B;  4JF4 A;  2IA2 A;  2NUP C;  5HWV A;  4P87 A;  3LIF A;  4ZTK A;  3E2K A;  3GV9 A;  3NUL A;  5L10 A;  3T4O A;  4X69 A;  4WYY A;  2XSS A;  3R4K A;  2V1A A;  4Y13 A;  2VLG A;  4HES A;  4ETX A;  3F1P B;  3BYD A;  5EE8 A;  1TD5 A;  1TVF A;  5HZH A;  1EWZ A;  5CER A;  3BQA A;  2ZBB A;  3BFE A;  4UAA A;  5CGW A;  4JGR A;  2JKT I;  1FCM A;  1BSG A;  5HWW A;  2VV7 A;  1AWI A;  1SKF A;  2V2F F;  2X01 A;  4R4R A;  4EBN A;  3FZC A;  4ZJ2 A;  3ZG5 A;  1PWG A;  4EBP A;  1BUL A;  2QWS A;  5GLC A;  2QKP A;  4JF6 A;  2V8F A;  4LFU A;  1HD8 A;  2L0W A;  4PMA A;  2G7U A;  4S2L A;  4PM5 A;  3A3J A;  5D3O A;  1CF0 A;  3IXB A;  5EVE A;  2XFT A;  3OCL A;  3VOL A;  5L2F A;  4E3N A;  2HDS A;  3HLC A;  3IX4 A;  2ZL1 A;  5AVF A;  4GW9 A;  3E4Q A;  1C3B A;  5KSH A;  4Y5F A;  5F82 A;  3KYQ A;  3V3R A;  2JKG A;  1ZKJ A;  5EVL A;  4IUK A;  1N9O A;  3HRE A;  3O5Y A;  5U47 A;  3RXX A;  3IH9 A;  1W63 Q;  4KUO A;  4R6L A;  3A0S A;  3FV7 A;  4E3L A;  5GLA A;  4EU0 A;  3WRT A;  4PM6 A;  1XA7 A;  4E3I A;  3ZVW A;  2HP9 A;  1VQQ A;  5LBR A;  1L0G A;  4FCF A;  2HGV A;  4E3M A;  1ONG A;  5A90 A;  5FI2 A;  3SH8 A;  2EXB A;  1VEU A;  3IXG A;  3SW1 A;  4HIA A;  5F68 A;  3NOP C;  4LRY C;  4DDS A;  5M18 A;  3SS4 A;  1LLB A;  3B33 A;  2OSU A;  3HLW A;  2I72 A;  4P0M A;  3PHY A;  4RX3 A;  5CHJ A;  3DAV A;  1K4E A;  3VE3 A;  4EQI A;  2P08 A;  4NXE A;  5EOE A;  1KVM A;  4BBU A;  4BD1 A;  1YM1 A;  1ES5 A;  3IF6 B;  2E8I A;  3VP2 A;  4C3Q A;  5DTT A;  5AJG A;  3MBZ A;  2JKT M;  1YLT A;  4JGP A;  3RXW A;  3L7H A;  3K3D A;  4EUV A;  3ITB A;  1H3Q A;  3IS2 A;  3MJQ A;  4MBF A;  1KE4 A;  3GSG A;  3IX3 A;  2VV6 A;  4NKP A;  2BLS A;  3HJK A;  3FKV A;  2VJW A;  4DXC A;  4JGQ A;  1X0O A;  1K38 A;  4FSF A;  1S66 L;  2B02 A;  2OLU A;  4R3B A;  1IYQ A;  2J7V A;  2VK3 A;  2PYR A;  5FSR A;  5IHV A;  2VEA A;  2P04 A;  5F5Y A;  3EOI A;  2ZOH A;  3KSI A;  1P97 A;  1ES3 A;  2XF3 A;  5F83 A;  2ZJ9 A;  1FR1 A;  4JBF A;  2C6W B;  5E43 A;  4MLL A;  3PBN A;  4GZB A;  4M4X A;  1N9L A;  1LSV A;  4P85 A;  2J8Y A;  1JWV A;  1G6O A;  3PYP A;  3ZG8 B;  3QNC A;  1W8Q A;  4DE2 A;  2L4R A;  2PR5 A;  2JBF A;  4FH4 A;  1K6S A;  3UE0 A;  2W1T A;  4II7 A;  3BEB A;  5EM0 A;  3TSG A;  2W3E A;  3BJN A;  1YPR A;  5J3W A;  3ZHH A;  3IHB A;  3LFV A;  5I94 A;  3MXR A;  1DP8 A;  2PD7 A;  4B9O A;  3HLD A;  2AVX A;  3U4L P;  3CUE C;  2J3W A;  3NOU C;  3JPU A;  1KOU A;  4ETZ A;  3S7P A;  5HPI A;  5FQK A;  1K6R A;  4X1M A;  4UA6 A;  4RX2 A;  1P0Z A;  1NRJ A;  2ZOI A;  2R78 A;  1YLY A;  1XX2 A;  3EQV A;  1L0D A;  2XA7 S;  5C5K A;  1PWD A;  3LID A;  5HWT A;  1ONH A;  5K5B A;  3IXD A;  4N9L A;  4DDY A;  1L0F A;  1SCW A;  3MR0 A;  4U0T A;  3CWF A;  3IWO A;  1E4D A;  1W5D A;  4Z9Q A;  3G6O A;  3CLO A;  4E3J A;  1CQA A;  4U0X A;  4LGW A;  4WEJ A;  3OCN A;  4HJ4 A;  1KGG A;  1S1Z A;  5GHY A;  4R0Q A;  3IWQ A;  3ITA A;  3WS5 A;  5AQ7 A;  1E25 A;  2QPN A;  5FQQ A;  3OOV A;  1MWT A;  5KMW A;  4LRX C;  3RTY A;  3VP3 A;  3PAE A;  3LCE A;  4GS9 B;  3ZCZ A;  4KQR A;  1ESU A;  2JHE A;  3IH8 A;  2E8J A;  4S2N C;  5EEC A;  4CLC B;  1KE3 A;  1CI9 A;  2JE5 A;  3P09 A;  3V3S A;  1YMX A;  3H9W A;  3MMH A;  5TBM A;  2WGW A;  5AQB A;  3Q7V B;  4K0W A;  3KX0 X;  1M40 A;  2V1Z A;  3BFC A;  3CG5 A;  3OBF A;  2VV8 A;  1XJ4 A;  3GDI A;  1SKO B;  2UWX A;  4RVA A;  4E3K A;  2IWB A;  3LY4 A;  4KEN B;  4Y2F A;  5EFW A;  3NI9 A;  2VX8 A;  5IS1 A;  4E6W A;  2YKF A;  3NY4 A;  4MDZ A;  3T4J A;  1QMF A;  1G28 A;  3LI8 A;  5HDC A;  4B4Z A;  4N9K A;  1JWP A;  3R7W A;  3UB8 A;  1MWR A;  3LUQ A;  3O86 A;  3W4P A;  3DTM A;  1MWU A;  1LSW A;  1NZU A;  1K0K A;  4DRT A;  4L9E A;  4I5S A;  4E04 A;  4O0P A;  1TS8 A;  2LB5 A;  4F94 A;  3F1O B;  4HOI A;  4YWZ A;  2Y2O A;  3K3C A;  3CHW P;  3MKF A;  5A8B A;  2WZX A;  1KVL A;  3BFD A;  1IYP A;  3N6I A;  1BYW A;  1GCE A;  2O9A A;  2NUT C;  4FH2 A;  3G32 A;  2Y91 A;  2ZMV A;  4N92 A;  3NBL A;  2HDR A;  1OTB A;  2J3T D;  3FPV A;  3LR0 A;  3T12 B;  5JYP A;  3QP1 A;  1LL8 A;  4DKI A;  3QNB A;  4UA7 A;  3NEC A;  2VA0 A;  1PNE A;  4ID4 A;  3OPL A;  4JXS A;  5GHZ A;  4JGO A;  2PR6 A;  4WUJ A;  2PU2 A;  3F1N A;  1FCN A;  5CGX A;  3W2Z A;  3NOT C;  2B95 A;  2X02 A;  1DRM A;  3SH9 A;  2V9A A;  3OPP A;  2WKP A;  2A24 A;  2WKR A;  4HHD A;  4IVI A;  2KDK A;  1XJ6 A;  3UB9 A;  3ZG0 A;  1G68 A;  2ZM8 A;  3A3I A;  3T1R A;  2QHK A;  4I39 A;  4NET A;  5FEF A;  2I9V A;  1JVJ A;  3MQO A;  5E2E A;  2BAS A;  1ZG6 A;  3NCK A;  1E3U A;  5DTS A;  2GJ3 A;  3ZGA B;  1EW0 A;  2PT7 A;  3BFF A;  4DE1 A;  1H8Y A;  2A2L A;  2OAP 1;  2W0N A;  2Y55 A;  4JLF A;  3DTK A;  4WZ4 A;  4PKY G;  4CJN A;  3UME A;  2ZM2 A;  3BWL A;  5CTM A;  4IED A;  1ESI A;  5F6A A;  3DW0 A;  1TEM A;  4C6Y A;  3LR4 A;  5CRF A;  4ME4 A;  1OTA A;  4BL3 A;  4Y0O A;  5EVI B;  2V0W A;  4OPZ A;  3IF6 C;  4K0X A;  3T50 A;  1RCJ A;  3FKW A;  3PR6 A;  3SS5 A;  4KUK A;  1XP4 A;  4OLG A;  3PAG A;  1H0M A;  3Q1F A;  3IHA A;  3VE4 A;  1OPX A;  4O8G A;  5FAQ A;  3JVU A;  4G3V A;  2HP5 A;  4OP8 A;  4EXO A;  3LO7 A;  4CLC D;  2Q9M A;  4LRZ E;  3QP6 A;  1V9Z A;  1BLH A;  1CJF A;  2IWC A;  2ZQD A;  3T1Q B;  3GR2 A;  5DFX A;  1T18 A;  5F1G A;  3MF0 A;  4UHU A;  4BWI A;  1T1A A;  3HCY A;  2K2N A;  2FFY A;  3TW8 A;  4G3W A;  1YT4 A;  4I3A A;  1NLZ A;  3UB5 P;  3O3V A;  3GVB A;  1CEG A;  2WKQ A;  4PM7 A;  5TFQ A;  4WN5 A;  4D60 A;  1FOF A;  1DJA A;  3BFG A;  1VET B;  4WBG A;  2IWD A;  3PBO A;  5FQM A;  5AQ9 A;  5KIZ A;  1D1J A;  1M6K A;  3NDE A;  3VOZ A;  3C4O A;  2P9V A;  2J3T C;  4GDB A;  4HP4 A;  5GHX A;  1NWZ A;  1TS0 A;  3UDI A;  5CHU A;  3CUE A;  2QMI A;  4PKY A;  3D3O A;  2HJE A;  4GHI B;  3PBS A;  1N9B A;  4F3L A;  2FFF B;  3KSG A;  2V0U A;  4HH2 A;  1T19 A;  3VOY A;  3BQ8 A;  1PYY A;  3O88 A;  4OON A;  1MC0 A;  5F69 A;  1FSY A;  4ZJ3 A;  3KYE A;  1PWC A;  4HY8 A;  5DJU A;  1BLP A;  1XXM A;  1BZA A;  1IKI A;  3L9K A;  3CPT B;  4B93 A;  1I5Q A;  3LY3 A;  3EGX C;  1GA0 A;  3V39 A;  1PI4 A;  1L0E A;  4BMW A;  4A5R A;  4OVD A;  3UMD A;  1MKI A;  1J9M A;  1FIK A;  2EWW A;  4R3J A;  3W8K A;  4EV4 A;  3IX8 A;  4QD4 A;  2R9W A;  1GHP A;  2WGV A;  1NXY A;  3P7N A;  1TS7 A;  2JKR I;  3N8R A;  1MKM A;  4S2M A;  3WS4 A;  5DF9 A;  4WZ5 A;  4HH3 A;  2PYP A;  3A3E A;  3MFX A;  5FDS A;  1BLC A;  2XFS A;  5TJJ A;  2DRW A;  3FC7 A;  2WYX A;  4U3T A;  5CHM A;  5HSQ A;  1HVB A;  2ZQ8 A;  2WKI A;  1XGJ A;  5GL9 A;  1FR6 A;  3QP8 A;  2JKF A;  4FUW A;  1ERQ A;  4G3K A;  5CX7 A;  4ZJ1 A;  1ES2 A;  3OLO A;  4LEN A;  4HNB A;  2PBY A;  4XUX A;  5EPH A;  4BL2 A;  4H6J B;  3O87 A;  1YMS A;  4EQ1 A;  5G4Y A;  2INW A;  2Y4A A;  3G4P A;  1Z09 A;  2DNS A;  2O9C A;  1NYY A;  4ARZ A;  4CLC C;  4GCZ A;  3B42 A;  4Y3I A;  1CI8 A;  2EX6 A;  4PAU A;  2WAD A;  3DWK A;  3GQZ A;  5TGF A;  1UWP X;  1HTZ A;  3S22 A;  2G2U A;  3KSF A;  4C75 A;  2Z2M B;  4HBU A;  4XT2 B;  3M2J A;  4DJ3 A;  3AGE A;  1PI5 A;  2L1M A;  5EVI D;  4KZ5 A;  3N4I A;  2W3G A;  1MY8 A;  3M6H A;  4GD8 A;  3F1P A;  4OKP A;  1LHY A;  4KZB A;  1BLS A;  4NEE D;  5HAR A;  3RJU A;  1STZ A;  3OZH A;  5FL3 A;  3HUM A;  1MBL A;  5CEB A;  4WMC D;  1N4O A;  4LV3 A;  4L0L A;  2Y59 A;  1IOU A;  1H8Z A;  3Q81 A;  3OC2 A;  4GOG A;  4ESP A;  4S2P A;  3S7N A;  4GJ4 A;  1T1C A;  2WK0 A;  4Q0H A;  5AVE A;  2JCH A;  1XFQ A;  4P6Z M;  1XGI A;  3EWK A;  3IBR A;  4Q0J A;  3WS0 A;  3HJI A;  5J4E A;  2MJ6 A;  5FQI A;  4Y15 A;  3DTE A;  1ZG4 A;  4EEU A;  1TDG A;  2RL3 A;  2ACG A;  3V67 A;  2JKR M;  3H82 A;  2G2W A;  1IKG A;  3B3X A;  3SH7 A;  2W3H A;  3TE8 A;  2XGN A;  2ZC4 B;  4Z1W A;  3H7W B;  4PPR A;  3S7Q A;  3LI9 A;  3GTC A;  2XD5 A;  2Y2L A;  1K54 C;  4QJG A;  4CLC E;  4K08 A;  4GDN A;  3UDF A;  3HBR A;  1JTD A;  5A92 A;  3CI6 A;  1AXB A;  3WS1 A;  2LB9 A;  2OLV A;  4KZ8 A;  1GSW A;  4H8R A;  2VGL M;  5HPF A;  4GLQ A;  4UQI M;  3CJM A;  1K55 A;  4M3K A;  4WL9 A;  5M1A A;  4JF5 A;  1XFN A;  1GHI A;  3UO9 A;  1KDW A;  4FD8 A;  2W27 A;  1PIO A;  4KZ4 A;  1I2W A;  1W79 A;  1SDE A;  2GDN A;  3C7U A;  2HP6 A;  4BD0 A;  3I7J A;  3UDX A;  3E0Y A;  3TRC A;  3ZNT A;  5HDS A;  3PXP A;  3VSK A;  2CMN A;  2ZQA A;  2XR0 A;  2EWV A;  1OT6 A;  4OLD A;  4OOY A;  1HLU P;  4PM8 A;  2ZMF A;  1WE4 A;  2PU4 A;  3IF6 A;  3UB7 A;  4QHC A;  3MXQ A;  3G34 A;  1K4F A;  3ZNY A;  3BEC A;  1K57 C;  3E4P A;  4KG5 A;  4OOM A;  5HL6 A;  3ISG A;  1D06 A;  2XRO A;  5EVI C;  4DMZ A;  1ALQ A;  2WAE A;  3C2W A;  1YSQ A;  1F9I A;  1YSP A;  2VGK A;  1KGE A;  4KG6 A;  4GNU A;  5HW3 A;  4I3I A;  2FZ0 A;  2D01 A;  2M7V A;  4LCM A;  1K56 A;  2GZA A;  4R70 A;  3MZD A;  2UV0 E;  1BUE A;  5F1F A;  5DKK A;  2ZMA A;  3GMW A;  1MZU A;  4Y0U A;  1IFQ A;  4AFI A;  3U2A A;  2R9X A;  4MEZ A;  3ZVT A;  4QU3 A;  2D02 A;  4YIN A;  3CAX A;  5J8X A;  2Y2K A;  1YQS A;  4OQH A;  5FAP A;  3MQ0 A;  3PTE A;  1JNU A;  3G2Z A;  2HPB A;  4R1G A;  1O7E A;  5DF8 A;  4UEY A;  1OT9 A;  4Y17 A;  3UB6 A;  3P01 A;  1IYO A;  3KSH A;  2Y8H A;  4BBV A;  3G30 A;  3NDG A;  1S4R A;  1Z6F A;  2O0Y A;  4WEK A;  5EV0 A;  3G31 A;  2ZL1 B;  1NYM A;  3MZF A;  4R23 A;  4DE0 A;  2EX9 A;  4Q0I A;  3BLS A;  5FI6 A;  3BY8 A;  3JYI A;  1K25 A;  3IT9 A;  4YNR A;  4MN7 A;  3T4S A;  2YKH A;  4WM9 A;  4JXV A;  2Y2P A;  1L3L A;  4WEL A;  4S2K A;  3UE1 A;  3V5M A;  3PBR A;  2WGI A;  5CEC A;  1LSX A;  3T1X A;  3WS2 A;  4OP5 A;  5E2H A;  5AQA A;  1UGU A;  1YLZ A;  3C38 A;  4LV2 A;  3LYX A;  3ZFZ A;  3HLG A;  1LT0 A;  1VEU B;  4IVK A;  4MNR A;  3ZG9 B;  5TR7 A;  2H0Y A;  3ZG7 B;  4MBK A;  1LL5 A;  3SZT A;  3IQA A;  3B47 A;  3M2K A;  3IXH A;  2HDQ A;  4OPQ A;  4UQI S;  5FAS A;  1XJ3 A;  3UN7 A;  3QP5 A;  1NRF A;  3HUO A;  4O01 A;  3M6B A;  1H8M A;  1S4S A;  5L07 A;  3MQQ A;  2A3U A;  2H5S A;  2B5R A;  4MN5 A;  2WKH A;  2ZQ9 A;  3W4O A;  2BG1 A;  3NIA A;  2CC1 A;  1OTI A;  1W63 M;  1VB6 A;  2WZZ A;  4IUH A;  3VP0 A;  4HQA A;  1GSV A;  4GS9 A;  2JC7 A;  2O99 A;  2ZQC A;  1SZV A;  3MFD A;  2HV1 A;  4CLC A;  3T4L A;  1E3U D;  3IS2 B;  1H5X A;  1P9R A;  3Q7V A;  3FPW A;  2XDM A;  4N1H A;  4FTX A;  3S7O A;  1A0K A;  4KQD A;  4KG2 A;  4RYE A;  1SKO A;  3TOI A;  2QJ7 A;  1IYS A;  3RH8 B;  1FQG A;  3DTI A;  4CPK A;  3BRM A;  4YFM A;  2Y2M A;  4I38 A;  1ERM A;  4EEP A;  4X55 A;  2EX2 A;  1KE0 A;  3Q7Z A;  3SS3 A;  4XXR A;  4BJP A;  4EW7 A;  5HD3 A;  5KSC A;  2H28 A;  5A91 A;  3LR3 A;  2M7U A;  3E2L A;  3VP1 A;  3VFH A;  1OME A;  1ZC2 A;  3D72 A;  3HUN A;  4GN2 A;  5I5L A;  4DJ2 A;  2V20 A;  3EGD C;  3HLE A;  3UPP A;  1NLY A;  1TS6 A;  4GKU A;  3BM6 A;  4WLA A;  5FQ9 A;  2OV5 A;  3F1O A;  3LIC A;  2PHY A;  2Z6C A;  1O07 A;  5E2G A;  1DJC A;  2W1T B;  4HJ3 A;  3KYZ A;  1F2K A;  2OOL A;  4PHT A;  4EWF A;  4HBT A;  4BEN A;  4XUZ A;  3H82 B;  1BTL A;  3IBJ A;  1PZO A;  3K2N A;  2WAF A;  5CXW A;  1K54 A;  4JXG A;  1SHV A;  4RQ9 A;  1ACF A;  1CK3 A;  4GB7 A;  4NXF A;  3Q07 A;  1GSX A;  5HFO A; 
#chains in the Genus database with same CATH homology
 5AVE A;  1XFQ A;  4EES A;  4KQO A;  2XA7 M;  4P6Z M;  4IHQ A;  3CIT A;  2KX6 A;  3EWK A;  3IBR A;  4IJG A;  4Q0J A;  3HJI A;  2W1R A;  5J4E A;  4Y2F A;  2MJ6 A;  4MCW A;  5L8M A;  5EFW A;  2VX8 A;  5DFY A;  3C8C A;  5IS1 A;  1F98 A;  2YKF A;  4ZRR A;  1F5M A;  4MDZ A;  3T4J A;  1G28 A;  4EEU A;  3LI8 A;  3LIA A;  5HDC A;  2P7J A;  3V67 A;  2JKR M;  2QJ5 A;  3H82 A;  1T1B A;  1TF1 A;  3R7W A;  3UB8 A;  3FG8 A;  3T4K A;  3LUQ A;  2M1C A;  3PBT A;  4ARZ B;  2W3H A;  1LSW A;  3TE8 A;  2IA2 A;  2NUP C;  5HWV A;  4Z1W A;  3H7W B;  5IT5 A;  3LIF A;  3S7Q A;  4L9E A;  4I5S A;  4E04 A;  3LI9 A;  4O0P A;  1TS8 A;  3T4O A;  2LB5 A;  3LR5 A;  4CLC E;  4K08 A;  2XSS A;  3R4K A;  2V1A A;  3F1O B;  4HOI A;  4QPR A;  4YWZ A;  3K3C A;  3CI6 A;  1Y28 A;  3PBQ A;  2VLG A;  3LIB A;  2LB9 A;  5A8B A;  1GSW A;  4ETX A;  3F1P B;  5G4Z A;  1BYW A;  2VGL M;  5HPF A;  4GLQ A;  2O9A A;  2NUT C;  2VKS A;  4UQI M;  2GX5 A;  1TD5 A;  5MC7 A;  2ZMV A;  2Z6D A;  4I3J A;  5HZH A;  4MN6 A;  4WL9 A;  3BQA A;  2ZBB A;  1OTB A;  2J3T D;  3FPV A;  3LR0 A;  5TBM B;  4JGR A;  2JKT I;  1XFN A;  2HF6 A;  1LL8 A;  3C30 A;  5HWW A;  2PDR A;  4NXG A;  2W27 A;  4EET B;  2VV7 A;  2OAQ 1;  2VA0 A;  3EEA A;  3VV4 A;  4NXB A;  3E0Y A;  4JGO A;  2PR6 A;  3TRC A;  3BY9 A;  2FH5 A;  4WUJ A;  3DBA A;  5HDS A;  3PXP A;  2PD8 A;  3F1N A;  3ULF A;  2B18 A;  2CMN A;  2O9B A;  2QKP A;  2QWS A;  3W2Z A;  3NOT C;  2L0W A;  1DRM A;  2EWV A;  1OT6 A;  2G7U A;  2V9A A;  2ZMF A;  2WKP A;  2A24 A;  2WKR A;  3UB7 A;  3R7W B;  4HHD A;  2KDK A;  3MXQ A;  3OCL A;  3VOL A;  1OJ5 A;  1XJ6 A;  3UB9 A;  5AVF A;  3E4P A;  4GW9 A;  1ZHH B;  3E4Q A;  3EQU A;  4R3A A;  2QHK A;  4I39 A;  4OOM A;  5HL6 A;  5KSH A;  4Y5F A;  2I9V A;  1D06 A;  4LLO B;  3KYQ A;  5HDD A;  2XRO A;  4DMZ A;  3MQO A;  2BAS A;  3C2W A;  3NJA A;  1YSQ A;  1F9I A;  4IUK A;  1YSP A;  1N9O A;  3O5Y A;  2GJ3 A;  1EW0 A;  2PT7 A;  1W63 Q;  1YKD A;  2A2L A;  2OAP 1;  4I3I A;  4KUO A;  4R6L A;  1UWN X;  2W0N A;  3A0S A;  4EU0 A;  2FZ0 A;  2D01 A;  2M7V A;  2GZA A;  4R70 A;  4PKY G;  3ICY A;  3UME A;  2OWH A;  3BWL A;  1XJ2 A;  5LBR A;  5F6A A;  3LR4 A;  2HGV A;  4ME4 A;  4OOL A;  1OTA A;  5DKK A;  1MZU A;  2V0W A;  2OWJ A;  1IFQ A;  4GHI A;  4HJ6 A;  3U2A A;  4AFI A;  3SW1 A;  4HIA A;  2Y79 A;  5F68 A;  3NOP C;  3T50 A;  1OTD A;  1YAX A;  4LRY C;  3PR6 A;  2D02 A;  4KUK A;  3CAX A;  3VE4 A;  1OPX A;  4O8G A;  3B33 A;  3MQ0 A;  1JNU A;  4DN0 A;  3JVU A;  4G3V A;  4UEY A;  4EXO A;  3F1N B;  4LPZ A;  1OT9 A;  4CLC D;  4LRZ E;  3UB6 A;  1N9N A;  3PHY A;  3P01 A;  3KSH A;  3NHQ A;  3VE3 A;  1V9Z A;  2P08 A;  4NXE A;  2HJ9 C;  4BBU A;  2Y8H A;  2A24 B;  4BBV A;  4L9G A;  2EA9 A;  1S4R A;  5DJT A;  2O0Y A;  5DFX A;  1T18 A;  4WEK A;  3MF0 A;  5AJG A;  2JKT M;  4BWI A;  1T1A A;  4JGP A;  3HCY A;  2K2N A;  4Q0I A;  3TW8 A;  2V1B A;  4G3W A;  3K3D A;  4EUV A;  1H3Q A;  4I3A A;  2KOI A;  3BY8 A;  3IS2 A;  3MJQ A;  1NLZ A;  2VV6 A;  4NKP A;  3HJK A;  2VJW A;  4YNR A;  2WKQ A;  4MN7 A;  4JGQ A;  3T4S A;  2YKH A;  1OTE A;  3ZYT A;  4WN5 A;  1X0O A;  4FSF A;  1S66 L;  4WEL A;  2B02 A;  3PBO A;  3PBR A;  3T4Q A;  4MMN A;  5KIZ A;  3TJZ C;  2PYR A;  1LSX A;  2P04 A;  2VEA A;  3EOI A;  5F5Y A;  2J3T C;  4HP4 A;  2ZOH A;  2K7S A;  3RFB A;  2K31 A;  1UGU A;  1NWZ A;  3C38 A;  3KSI A;  1TS0 A;  3LYX A;  4R38 A;  1P97 A;  3LIE A;  2DMW A;  3CUE A;  4PKY A;  4H6J A;  3D3O A;  1LT0 A;  2HJE A;  4GHI B;  3PBS A;  2W3F A;  4F3L A;  2GNX A;  3KSG A;  2V0U A;  3PBN A;  4HH2 A;  4M4X A;  1T19 A;  1N9L A;  1LSV A;  3BQ8 A;  3B47 A;  3BW6 A;  1MC0 A;  4UQI S;  1G6O A;  5F69 A;  1S1Y A;  3UE6 A;  3PYP A;  1P9W A;  1XJ3 A;  4HY8 A;  5DJU A;  4HI4 A;  4O01 A;  4B93 A;  1H8M A;  2L4R A;  1S4S A;  4HP9 A;  2PR5 A;  3A0R A;  4XT2 A;  3MQQ A;  3EGX C;  4BMW A;  4MN5 A;  3A0V A;  3UMD A;  1OJG A;  2EWW A;  1OTI A;  4WF0 A;  1W63 M;  4YOF A;  1VB6 A;  2W1T A;  4IUH A;  4II7 A;  3E98 A;  4HQA A;  1GSV A;  4GS9 A;  2O99 A;  2W3E A;  3BJN A;  5J3W A;  3E4O A;  1VHM A;  5IU1 A;  4BBT A;  3P7N A;  2HV1 A;  3UE3 A;  1TS7 A;  3LFV A;  4CLC A;  1DP8 A;  2JKR I;  1MKM A;  2PD7 A;  5DF9 A;  3T4L A;  4HH3 A;  3T4T A;  1ODV A;  2VZW A;  4B9O A;  5J7E A;  2PYP A;  3CUE C;  1S67 L;  3IS2 B;  4CQH A;  3MFX A;  2J3W A;  3NOU C;  1P9R A;  5TJJ A;  1KOU A;  3FPW A;  3S7P A;  4ETZ A;  3FC7 A;  5HSQ A;  5HPI A;  3S7O A;  4KQD A;  1P0Z A;  1NRJ A;  2KLI A;  2QJ7 A;  3EEH A;  3RH8 B;  2ZOI A;  2R78 A;  3KO6 A;  2QYB A;  1V9Y A;  1D7E A;  4I38 A;  4G3K A;  3EQV A;  5CX7 A;  4EEP A;  2XA7 S;  4P6Z S;  3OLO A;  5DKL A;  1DP6 A;  5C5K A;  3LID A;  4HNB A;  5HWT A;  4BJP A;  1ZTU A;  4H6J B;  5K5B A;  3MR0 A;  4EW7 A;  4EQ1 A;  5HD3 A;  3CWF A;  4F3L B;  2H28 A;  3LR3 A;  5G4Y A;  2M7U A;  2INW A;  4L9F A;  2O9C A;  4EER A;  3G6O A;  3D72 A;  5I5L A;  3CLO A;  4ARZ A;  4CLC C;  1DP9 A;  3B42 A;  4GCZ A;  4Y3I A;  4DJ2 A;  3H7W A;  4WEJ A;  4PAU A;  3EGD C;  3OCN A;  1NLY A;  1TS6 A;  4HJ4 A;  2XRN A;  1S1Z A;  2J80 A;  1UWP X;  4WLA A;  3KSF A;  3ZQ5 A;  4XT2 B;  4DJ3 A;  4FOF A;  3F1O A;  2L1M A;  3OOV A;  3LIC A;  5HD5 A;  2PHY A;  2Z6C A;  4LRX C;  2W3G A;  3RTY A;  4HJ3 A;  2W1T B;  1WA9 A;  3KYZ A;  3F1P A;  4GS9 B;  4NEE D;  2JHE A;  1STZ A;  2OOL A;  5FL3 A;  3JVV A;  4PHT A;  4CLC B;  3H82 B;  2JN7 A;  4L0L A;  2VGL S;  1IOU A;  3H9W A;  3IBJ A;  3MMH A;  5TBM A;  3K2N A;  2W3D A;  3KX0 X;  4RQ9 A;  3GEC A;  3OC2 A;  3S7N A;  4GJ4 A;  3OBF A;  2VV8 A;  4NXF A;  1XJ4 A;  3GDI A;  1T1C A;  1GSX A;  4Q0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...