2V1AA

N- and c-terminal helices of oat lov2 (404-546) are involved in light-induced signal transduction (room temperature (293k) dark structure of lov2 (404-546))
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
144
structure length
144
Chain Sequence
b'FLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-1
publication title N- and C-Terminal Flanking Regions Modulate Light-Induced Signal Transduction in the Lov2 Domain of the Blue Light Sensor Phototropin 1 from Avena Sativa.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase
total genus 47
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2v1aA00
4PKYA 3H7WA 1LL8A 3EWKA 3CAXA 4GS9A 3LIFA 4HJ4A 3K3DA 4HJ3A 5I5LA 3ZQ5A 1S1ZA 4PKYG 5HDCA 1OT6A 1S4SA 4GCZA 4KUOA 3BWLA 1DRMA 5HDDA 4R6LA 4H6JB 1TS8A 2PYPA 4HP9A 4WF0A 2A24A 3F1PB 1TS6A 1Y28A 3K3CA 4I5SA 3LYXA 4EQ1A 1TS0A 3PYPA 4I38A 4K08A 2QWSA 2Z6CA 2YKFA 2VEAA 5G4ZA 1XFNA 1EW0A 2Z6DA 2PD7A 1V9YA 1VB6A 2V1BA 4L9GA 1XJ3A 3IS2B 4YWZA 4BBUA 4HJ6A 2QJ7A 4WUJA 4NXGA 2L0WA 3IBRA 3CWFA 4HP4A 4EW7A 1OTBA 3NOUC 2PD8A 1D06A 2M1CA 4GHIA 2VV8A 3LICA 4H6JA 5AVFA 5J3WA 3P7NA 5DKKA 3NHQA 2PDRA 3F1PA 5HWVA 4NXFA 4R38A 1OTEA 2PR5A 3OLOA 3LIBA 1OT9A 4L9FA 5IS1A 3T50A 3GDIA 1KOUA 5DKLA 2ZBBA 5A8BA 3UB7A 1JNUA 3C2WA 3MR0A 1S66L 5DJUA 4WLAA 4NXEA 2R78A 3H82B 3IS2A 4HHDA 1LSXA 2OWHA 4RQ9A 4GHIB 1S67L 1N9LA 5TBMA 2V1AA 4JGQA 3UB8A 4I39A 4R3AA 5HWWA 4F3LB 1S4RA 1P0ZA 4LLOB 4L9EA 3VOLA 1OJ5A 1MZUA 5F5YA 1DP6A 2OOLA 3MJQA 2L1MA 3H9WA 2L4RA 4EEPA 4HQAA 1DP9A 3HJKA 4LRZE 2J80A 2PHYA 4EXOA 4BBTA 2K7SA 5F6AA 2H28A 4R70A 4I3JA 2HV1A 1LSVA 4LPZA 1N9NA 3A0RA 5HD3A 1G28A 5HD5A 5J7EA 1UWPX 5J4EA 1F98A 2PR6A 3MFXA 3NOTC 4BBVA 5TBMB 3LIDA 1OTDA 2V0UA 4HIAA 5G4YA 1BYWA 2I9VA 2V9AA 2ZOHA 1D7EA 4LRXC 2ZOIA 1OJGA 4HOIA 2QJ5A 3UMEA 3H82A 1X0OA 4XT2B 1XFQA 5HWTA 2KDKA 2QKPA 4MN5A 3A0SA 2P7JA 4WN5A 1T1AA 4F3LA 5KIZA 3FG8A 3F1NA 4HNBA 3UB9A 1DP8A 2YKHA 5F68A 1XJ4A 4DJ2A 3EEHA 2WKPA 1T19A 1OTAA 2JN7A 1GSWA 3CLOA 3D72A 2W0NA 3LI8A 1T1CA 2BASA 1GSVA 4WL9A 1T1BA 3UE6A 4KQDA 2CMNA 4JGOA 2WKQA 3LIAA 1V9ZA 1TS7A 3F1OB 3E4QA 5DJTA 2W27A 3RTYA 1S1YA 2V0WA 5HDSA 1ODVA 4HH3A 5IU1A 3F1NB 4XT2A 1LT0A 5EFWA 1P97A 3B33A 4GW9A 3RH8B 2D01A 3HJIA 4DJ3A 2VLGA 4HI4A 3LI9A 1OTIA 3ICYA 3SW1A 1WA9A 3MQOA 4MN6A 2KX6A 3E4OA 3A0VA 3BY8A 4EETB 3LIEA 3C8CA 4HH2A 2JHEA 2B02A 1N9OA 3H7WB 4EEUA 3NJAA 1GSXA 4EERA 4GS9B 5AVEA 1UGUA 4M4XA 4EESA 5HSQA 3VE4A 2INWA 2VV7A 4NXBA 5F69A 4KUKA 3GECA 2EA9A 3LUQA 4I3AA 3G6OA 3KX0X 4JGPA 1XJ6A 4HY8A 2QHKA 1F9IA 4JGRA 2D02A 3F1OA 3PHYA 3FC7A 4LRYC 1XJ2A 1NWZA 3VE3A 3UMDA 2A24B 3MQQA 5HZHA 2GJ3A 4B9OA 2OWJA 3E4PA 2PYRA 3MXQA 3UB6A 4E04A 2VV6A 1LSWA 3NOPC 3ULFA 2WKRA 1UWNX 3BY9A 4I3IA 1T18A
chains in the Genus database with same CATH superfamily
5A91A 5U47A 3SZTA 3HL9A 2ZC4B 3CAXA 4YINA 4C6YA 3K3DA 3SS4A 3ZQ5A 5GLDA 3BYDA 2Q9NA 2X02A 1PI4A 2EX9A 1HTZA 4PM6A 2GX5A 4OH0A 4LCMA 2C6WB 2Y2NA 3BWLA 1YQSA 3UE0A 4QB8A 4IVIA 1OMEA 3FWLA 3HUNA 4X68A 4DKIA 3LY4A 1MWTA 3S7QA 2ZC3B 1G6OA 4LV1A 2W1TB 4KQQA 1Y28A 2ZLYA 3K3CA 2ZM2A 1ES2A 3C7VA 2ZJ9A 1FR6A 3FPWA 1H8MA 4HEFA 4KZ8A 5CERA 1IYOA 4ETZA 2JKRI 4Q0HA 5EVIA 3ZVWA 4R3JA 5KSHA 3V3RA 3KYEA 2WZZA 2XF3A 1L2SA 2K31A 4GOGA 3EQUA 1FSYA 4BD0A 1A0KA 2V2FF 2EFXA 3OPLA 1CEFA 3DWKA 4EBPA 4OOLA 4MBKA 3HLEA 4BBUA 2ZMFA 4WUJA 4DN0A 2XA7M 4NXGA 2L0WA 3SH9A 4EW7A 1OTBA 3LCEA 4EWFA 3E2KA 4XUXA 1DJAA 4B4ZA 4MN7A 4QY6A 4BENA 3P7NA 4S2KA 3VMAA 2HZ5A 4YOFA 3F1PA 4LENA 4PM8A 5HWVA 2HP6A 3DAVA 4R38A 1OTEA 2PR5A 4S2PA 3T50A 5TR7A 3GDIA 3DWZA 3BECA 3GTCA 1FSWA 2HJ9C 1PZPA 1RGYA 3QP1A 4BMWA 5K5BA 1BLCA 1Z6FA 3G35A 4PAUA 2H0TA 4R0QA 4L0LA 5DJUA 5JYOA 4NXEA 2UWXA 3BFDA 3IS2A 4CJNA 1D1JA 5GLBA 3A3DA 5EOOA 4IEDA 1K6RA 1MKIA 1N9LA 4OQ0A 1MBLA 2V1AA 1L0DA 1MWRA 5EM1A 1GHMA 4R3AA 4Y3IA 5HWWA 5L10A 4F3LB 1NRFA 3NECA 4LLOB 4L9EA 3VOLA 1TF1A 5LBRA 3W4OA 4DE3A 4X6TA 5F5YA 1DP6A 5GLCA 2OOLA 1RGZA 2FH5A 3MJQA 4MLLA 3H9WA 3CPTB 1P9WA 4HQAA 2GZAA 1DP9A 3G32A 3HVFA 4S2NC 2J80A 4Z1WA 1YLWA 3Q7VA 3Q1FA 4R23A 2J3TC 2QYBA 5J8XA 4K0WA 3LR3A 4R70A 5CX7A 1CEGA 3C4PA 1G28A 5HD5A 5DTSA 1UWPX 3N6IA 2BLSA 1K54A 2ZL1B 2IA2A 5EV0A 3P09A 1OTDA 4WEJA 2V9AA 4LRXC 1OJGA 3G4PA 5CRFA 4QU3A 3ZG5A 5HW3A 1X0OA 4XT2B 4G3VA 3FV7A 1XFQA 3C7UA 4MN5A 1L3LA 1U60A 5KIZA 1E3UA 2P9VA 3F1NA 4ZDXA 4P6ZM 4PM7A 5F68A 2HDUA 3LR4A 1M6KA 4DJ2A 5CGSA 3GQZA 1FR1A 3MFDA 2O9BA 1XX2A 1E3UD 3CLOA 1LI9A 3S7PA 4DE0A 1CQAA 4D60A 3TG9A 4S2JA 3V39A 3CMZA 4UHUA 3T1RA 1T1BA 1XPBA 3OC2A 4EQIA 5L8MA 4S2LA 3UY6A 4Y0OA 3ISGA 4KZAA 3F1OB 2W27A 4PPRA 4R4SA 2V0WA 2VGLM 2WGWA 1BZAA 4BJPA 1VEUA 4ZRRA 5E2FA 4WBGA 4UA7A 4KG6A 3DTEA 5D3OA 4DXCA 4OLDA 2PRFA 4HBUA 4GW9A 3RH8B 1DJBA 3ITBA 4GLQA 5EVEA 4OLGA 3G2ZA 1WYCA 3UNWA 4ESPA 4HI4A 1FCOA 1DJCA 4NEED 4NG2A 4MNRA 3V3SA 2XFTA 1WA9A 3MQOA 2XD1A 2KX6A 3KSIA 4S2IA 4EETB 1G5UA 3LIEA 2J7VA 3UPNA 5E43A 4E6WA 3MKEA 2EWVA 3BEBA 4EEUA 4GS9B 2RCXA 2JKGA 4KZ6A 4MBHA 5EECA 4S2MA 1MWSA 2Y79A 4KG5A 2VV7A 3WRTA 4NXBA 3WS4A 1IEMA 4HY8A 1K4EA 1GHIA 3Q07A 1F9IA 4LV2A 3PHYA 3BLSA 1RCJA 4NETA 5FQMA 2A24B 2HDQA 4P87A 1BTLA 5HZHA 3VP3A 3NDEA 3UDFA 4B9OA 1FOFA 3EGDC 1H3QA 4Q0IA 3QNCA 3WS0A 3E4PA 3BRMA 1I5QA 3OCNA 3PBSA 5F82A 3S7NA 2JCHA 4CLCB 4OQGA 1E25A 4UAAA 5CGWA 3ZDJA 4ZJ3A 1SDNA 1T18A 1NJ4A 1JWPA 1SKOA 3EWKA 2JKRM 2PAVP 2AVXA 5I5LA 1S1ZA 5GLAA 4KZBA 3UE1A 5HDCA 3S4XA 4JF6A 1FCMA 3KSHA 1HD8A 1K6SA 4N9KA 3W4PA 2Y2IA 5DF7A 2NUTC 3SOIA 5HDDA 1VETB 2WZXA 4HP9A 1YMSA 4U0XA 1W79A 3HLDA 4DRTA 2Y2JA 4D2OA 4Y2FA 3E2LA 5L09A 1ACFA 1K57C 4I5SA 2ACGA 3LYXA 4EQ1A 4O0PA 4FOFA 1W63M 4BQMA 1NLZA 4I38A 4K08A 1CI8A 3D3OA 5F1FA 1ALQA 3W8KA 2QWSA 2Y2KA 2OAQ1 1H8YA 4HESA 4ZJ1A 1EW0A 4Y5FA 2Z6DA 3PBOA 4CPKA 1IKIA 3G34A 1NZUA 1K55C 4N92A 3M2KA 5AQAA 1RP5A 2Y2HA 3OCLA 3CWFA 1YKDA 4HP4A 2WKIA 4ETXA 4R3BA 4RX2A 3A3JA 5KMWA 4X1MA 1FIKA 2OLVA 2P04A 3QP2A 1GA9A 1C3BA 2VX8A 2J3TD 4H6JA 5FQ9A 3G30A 5FAPA 5FDSA 5DKKA 4OPRA 2JBFA 3NHQA 5CGXA 1J9MA 5CHUA 2GNXA 3G31A 3LIBA 1G68A 5FQQA 1JWVA 2Y2QA 1YSPA 3NULA 3HUMA 2IWCA 1IKGA 4OP5A 1OPXA 1ES3A 3KSGA 4IVKA 4OPQA 3Q82A 3O3VA 2M7VA 3T4TA 2O0YA 3SH7A 2OAP1 1NYMA 1XA1A 1BLSA 2BTFP 4MDZA 5HL1A 2R78A 1LSXA 2V1ZA 1IYSA 3JYIA 5IHVA 3W4QA 4GHIB 4U0TA 3IH9A 4JGQA 3UB8A 3L9KA 5GHXA 2MJ6A 1KGGA 4X25A 3B3XA 2ZMVA 2XA7S 2Y8HA 3IF6C 1ES5A 1P0ZA 4FUWA 3UN7A 2A49A 4E3IA 3PAEA 4X55A 3LGOA 3MKFA 4E3LA 2L4RA 4EEPA 3T1XA 4P0MA 2VJWA 4WZ4A 3HJKA 4LRZE 5FI7A 2H5SA 1H5XA 2ZQ9A 5FASA 4EXOA 3HREA 4WZ5C 4BBTA 2K7SA 4IUKA 5FQIA 2HV1A 2JKTM 1LSVA 3C4OA 2R9WA 3FKVA 4LPZA 3GVBA 3WWXA 1GCEA 5J4EA 2W3FA 2XQZA 3O86A 4ARZA 3R7WA 2OLUA 1FCNA 2PU2A 5TBMB 4BLMA 4R1GA 4HIAA 3M2JA 5G4YA 1JTGA 2ZOHA 3LFVA 5E2HA 3IH8A 1W7FA 2ZQ8A 3H82A 3UMEA 1ERMA 2HJEA 2PU4A 5HWTA 5GHYA 2V8CA 3EOIA 4DF6A 2ZC5B 1SZVA 2B95A 4QD4A 3N8SA 3CUEC 2P74A 4KZ9A 3UB9A 3CI6A 5I94A 1DP8A 3LY3A 2Y2LA 2DRWA 4G3KA 4LGWA 3WS1A 3A3EA 2XDMA 2ZQCA 3PBRA 5DFYA 4E3OA 2WKPA 1CK3A 3GR2A 5CECA 3VFFA 2Z2MB 2W3DA 3W2ZA 1GSWA 1HZOA 3ZYTA 3VV4A 4GN2A 2EWWA 2HPBA 3UE6A 4OQHA 1XKZA 4JGOA 4GD8A 2WKQA 2XFSA 3LIAA 1V9ZA 3D4FA 4O01A 1O07A 1WE4A 2XH9A 5HDSA 4HH3A 1JWZA 2HGVA 1K56D 1YT4A 3UO9A 4AFIA 1LLBA 5AQBA 5EFWA 2NUPC 2W3EA 3ZG0A 1G6AA 5HPIA 4GDBA 5HPFA 3UDXA 1ESUA 3B33A 2J3WA 2G7UA 3BQAA 3HJIA 2WUQA 2XD5A 2VLGA 4ME4A 3PBNA 1OTIA 5GL9A 4P6ZS 3SW1A 4MN6A 3NC8A 1XP4A 1KE0A 4GNUA 1IYPA 1KGFA 2B02A 1N9OA 5E2EA 2VK3A 4WM9A 4O8GA 2INWA 3T4KA 1MWUA 3LEQA 4KUKA 5KZHA 3LUQA 3HUOA 1TDGA 3QP5A 5FEGA 2VA0A 4Y0TA 3KX0X 3HLBA 2EXAA 4FSFA 4F94A 4JGRA 3VOYA 5CTNA 4B4XA 1NWZA 3GRJA 3QP8A 3FKWA 5L07A 2VGLS 4JLFA 2JKTI 1K55A 5DTTA 5F1GA 3O87A 3C30A 3UB6A 3QP6A 5EVIB 1AXBA 1QMEA 1ZHHB 1VHMA 4BL2A 2JE5A 4GB7A 1NZOA 1YLTA 3OPPA 5CHMA 4PKYA 3H7WA 4PHTA 4X56A 1O7EA 5FQJA 3LIFA 4HJ4A 3BFGA 1YLJA 4GZBA 1IELA 2XLNA 1S4SA 4GCZA 3FZCA 2Y2OA 3EGXC 4KUOA 1DRMA 1NLYA 4B93A 4LCLA 4R6LA 3HLCA 3VOZA 4E3NA 2WAFA 1QMFA 1TS8A 4II7A 3NIAA 3F1PB 5FL3A 3DTIA 5EVIC 1MKMA 2XGNA 1TS6A 1AWIA 3L7HA 2HP9A 3ZG8B 3T4JA 5CTMA 1L0FA 2ZD8A 2Y2MA 2FZ0A 1XXMA 1TS0A 3IF6A 1PWDA 3EQVA 4OP8A 2FFYA 4B88A 1PW8A 3S1YA 1CJFA 4RVAA 5FI6A 2IWDA 2X71A 1BLHA 4YFMA 2EX6A 3VP0A 2VEAA 5G4ZA 4X53A 2B5RA 3MBZA 5HARA 4LV3A 1XFNA 1K4FA 4QY5A 5E2GA 3SH8A 1YPRA 2W3GA 1VB6A 2V1BA 4L9GA 3IS2B 1LL9A 4KZ5A 1TD5A 1L0EA 4EBNA 4HJ6A 4WZ5A 3OZHA 3MQ0A 1ES4A 3DTKA 2O99A 2EX8A 1Y4OA 4WELA 3NOUC 3T4OA 2PD8A 1D06A 3ZHHA 4IUHA 4GHIA 4UEYA 3LICA 5AVFA 5J3WA 4JF5A 1P9RA 2PDRA 4QHCA 3KYZA 3OBFA 3PBQA 3Q7VB 4Q8IA 4NXFA 4IJGA 2ZMAA 2W1TA 3OLOA 3RJUA 2FFFB 4MBFA 1OT9A 3JVVA 3HCYA 3BFCA 4L9FA 1LI0A 5IS1A 4QPRA 3TE8A 2DMWA 2HP5A 5DKLA 3HLGA 4NK3A 1PNEA 3UB7A 1JNUA 1GA0A 3CUEA 3LEZA 3MR0A 3IHAA 2BG1A 4EUVA 1S66L 2EX2A 4UQIS 4K91A 4DDYA 3P98A 2P08A 1HLUP 3LO7A 4RQ9A 1YLYA 3C5AA 5G18A 3NCKA 2VGJA 1S67L 5TBMA 4I39A 1YLZA 3BFEA 2Z2LB 1S4RA 2P9VB 3BM6A 1I2WA 4CLCC 1OJ5A 1MZUA 4DE1A 4U3TA 3DBAA 3T4LA 2GDNA 2L1MA 4WMCA 3P01A 2HDRA 1LL5A 4ID4A 1ONGA 3T4QA 4Y15A 3HLWA 4HBTA 3UB5P 4UQIM 5F6AA 4I3JA 3KSFA 1ZC2A 1N9NA 3A0RA 5M18A 4WMCD 5J7EA 4S2NA 3MZFA 3ZG9B 5TJJA 4OPYA 3LIDA 3IXDA 1BYWA 2I9VA 1D7EA 3IX4A 2ZOIA 4FD8A 5EM0A 2WGWB 4HOIA 2QJ5A 1VEUB 3T1SA 3ZG7B 4DMZA 2QKPA 1ZG4A 1KVMA 3GV9A 3BLMA 3IWOA 4Y7PA 3GSGA 2P7JA 3ZVTA 4WN5A 4WEKA 1T1AA 4F3LA 3EEAA 2HF6A 3BW6A 3E0YA 4HNBA 1XA7A 3T12B 2WK0A 1N9BA 3WS5A 2YKHA 5TGFA 2OV5A 4MCWA 3BQ8A 3CPTA 3N4IA 2Q0OA 1XJ4A 4UA9A 3D9YA 4JPMA 3EEHA 3JVUA 3CITA 1SKFA 3SS3A 1IYQA 4EBLA 2Y2GA 4C3QA 1PRQA 2QZ6A 4GD6A 4Z9QA 3D72A 2V8FA 2WADA 4MMNA 1T1CA 2BASA 3WS2A 4WL9A 2ZQDA 3N7WA 5F83A 1PWGA 4CQHA 3ZCZA 3FPVA 1ZG6A 2ZL1A 1JTDA 4C75A 3M6BA 4FH4A 3CHWP 3B47A 4G3WA 3E4QA 5DJTA 2XRNA 1S1YA 3MMHA 4JKTA 3C38A 5IU1A 4XT2A 1WYBA 5HAQA 3AGEA 1LT0A 2DCFA 5A93A 3A3FA 4K0XA 1P97A 4JBFA 2D01A 5FAOA 4ZJ2A 1KDWA 4DJ3A 2V20A 4FTXA 3LI9A 3IXGA 1KE3A 3N8RA 3QNBA 2Y55A 3ZNTA 3E4OA 2Y59A 5EPHA 1KVLA 3VP4A 3BY8A 2E8JA 2E8IA 4N9LA 1EROA 3C8CA 4HH2A 2JHEA 4O7DA 2XSSA 1SKOB 1TVFA 5CEBA 4EERA 4M4XA 4EESA 5HSQA 5M19A 3VE4A 4NKPA 3FYZA 5F69A 3GECA 2EA9A 2H10A 3G6OA 2DNSA 3CG5A 1Y54A 5EVID 3V50A 2JC7A 2D02A 2ZC6B 3BJNA 3F1OA 3IWIA 4Q0JA 4DDSA 1XJ2A 3Q81A 1DY6A 4JXVA 5FDHA 1PIOA 3UMDA 3GMWA 2PBDP 3MQQA 3IX3A 1I2SA 1IFQA 5CEDA 2GJ3A 2Y4AA 5DF9A 2OWJA 5FI2A 5M1AA 2PYRA 5FATA 2WGIA 1SHVA 3MXQA 3MS6A 4E04A 5CXWA 4BL3A 2Y91A 2VV6A 5HAPA 1LSWA 1YSQA 1IOUA 3NOPC 3ULFA 4N1HA 4P85A 3S7OA 1ONHA 3BY9A 2B18A 1K56A 1K0KA 4I3IA 1H0MA 1Q2QA 1LL8A 5FAQA 4GS9A 5GHZA 2LB9A 1Z09A 5EUAA 4HJ3A 4X1LA 4PKYG 2WKEA 2K2NA 2QMIA 5HX9A 4KENB 1OT6A 5DVAA 4LFUA 2ZM8A 2W3HA 2PBYA 5FA7A 3ZFZA 5KSCA 2EXBA 5FEFA 4PM5A 1M40A 1PWCA 1HVBA 4H6JB 1W5DA 2PYPA 3RXXA 4ZAMA 4WF0A 4BD1A 3T4SA 1CF0A 2A24A 4RA7A 2J9OA 3TOIA 4JXGA 3KO6A 2C5WB 3PAGA 5A92A 1JVJA 3R4KA 3UPPA 3PYPA 2G2WA 4OKPA 4E3KA 3IX8A 1BULA 5AJGA 3ZGAB 4ZTKA 4CLCA 1PZOA 4Y17A 2Z6CA 2YKFA 1KGEA 2A3UA 2IWBA 1K57A 3V5MA 4OVDA 2I72A 2PD7A 1V9YA 1YM1A 1XJ3A 4DE2A 4PMAA 1MC0A 4GJ4A 1STZA 4PM9A 5HAIA 4YWZA 2ZC7A 3IBJA 1S6RA 4Y0UA 4E3JA 2QJ7A 4CLCD 1EWZA 1XGJA 3IBRA 3RXWA 2PT7A 4M3KA 2M1CA 4KZ4A 4KZ7A 1NXYA 4JXSA 3SS5A 1VETA 2VV8A 5MC7A 4QJGA 4WYYA 2R9XA 3NBLA 4OPZA 4GDNA 1YMXA 1ERQA 1F2KA 1KOUA 2WAEA 2ZBBA 5A8BA 3VP2A 3O5YA 3V67A 2J9PA 4A5RA 4ARZB 4DXBA 4IBRA 1L0GA 3R7WB 3C2WA 4UA6A 3TJZC 5HL6A 3RFBA 4ZBEA 4BWIA 4WLAA 2J8YA 3IXHA 4S2OA 5L2FA 4GKUA 1BSGA 1MY8A 3NI9A 4OONA 1K25A 3H82B 4HHDA 2OWHA 2RL3A 3PXPA 2XK1A 2VKSA 1YLPA 4KQOA 3AGFA 4OOMA 1YAXA 3MXSA 1N4OA 3G2YA 3B42A 3MXRA 3ITAA 4KQRA 3IT9A 1ZTUA 2EFUA 1VM1A 1PYYA 1E4DA 3Q7ZA 2VZWA 1EI5A 3AGDA 3K2NA 2PHYA 2VGKA 4KZ3A 2H28A 2CC1A 3QHYA 5DF8A 2KOIA 5HD3A 4R4RA 3OPRA 2WYXA 1F98A 2PR6A 5FSRA 1Q2PA 3DW0A 2X01A 3MFXA 3NOTC 2W1RA 3CJMA 4IBXA 4BBVA 5HFOA 2V0UA 3S22A 3MZDA 4OQIA 3M6HA 3O88A 2UV0E 3LR0A 3IWQA 3IXBA 3TRCA 3MSHA 1BUEA 1PFLA 3DTMA 2KDKA 1H8ZA 3A0SA 4EUZA 3KYQA 3HBRA 2QPNA 3N8LA 2O9AA 3UE3A 4KG2A 3FG8A 1W63Q 4JXWA 3ZNYA 5AQ7A 4E3MA 5DTKA 1CI9A 3QP4A 1PW1A 1J3WA 3MF0A 5EVLA 1SDEA 2G2UA 3PTEA 1T19A 1OTAA 3UPOA 3U4LP 2JN7A 2O9CA 3E98A 4OOYA 2W0NA 4YNRA 1NYYA 2H0YA 3LI8A 2WGVA 4FH2A 3VSKA 3OPHA 5BOHA 1BT5A 4RX3A 5C5KA 1GSVA 1XGIA 4KQDA 1MPLA 2CMNA 3WRZA 2Q9MA 3LR5A 1NY0A 4X69A 2KLIA 1TS7A 4MEZA 2JKFA 3RTYA 4JF4A 2M7UA 1ODVA 4EV4A 1ESIA 3F1NB 5A90A 1FQGA 3PR6A 3OOVA 3CZDA 1LHYA 5CHJA 3VFHA 1S0WA 5EE8A 3BFFA 1K54C 1ZKJA 4H8RA 4CLCE 1SCWA 3ICYA 3IQAA 5IT5A 3IF5A 1NRJA 3A0VA 4EU0A 2LB5A 3VP1A 5JYPA 2XROA 2XEPA 4E6XA 1VQQA 3H7WB 3NJAA 1GSXA 4XXRA 1K38A 5AVEA 3VSLA 1UGUA 2HDSA 1F5MA 2WKHA 2ZQ7A 3A3IA 4I3AA 4FCFA 3T1QB 4JGPA 1XJ6A 3HLFA 5DFXA 2ZM0A 2QHKA 1FILA 3TSGA 2ZQAA 1MXOA 1KE4A 3FC7A 4LRYC 1GHPA 4QWOA 2OSUA 3JPUA 3VE3A 4N1XA 1W8YA 1W8QA 5AQ9A 3UDIA 2Y2PA 2A2LA 3I7JA 5FQKA 1PI5A 3MZEA 3U2AA 1TEMA 2XR0A 4IHQA 1BLPA 4P6BA 5EOEA 4LV0A 3IF6B 3NDGA 3PBTA 1KDSA 3IHBA 3NY4A 2WKRA 1UWNX 3TW8A 4RYEA 1TDLA 5TFQA 4Y13A 4XUZA
chains in the Genus database with same CATH topology
4PKYA 3H7WA 1LL8A 4PHTA 3EWKA 3CAXA 4GS9A 2LB9A 3LIFA 4HJ4A 2JKRM 3K3DA 4HJ3A 5I5LA 3ZQ5A 1S1ZA 4PKYG 2K2NA 5HDCA 3KSHA 1OT6A 2GX5A 1S4SA 4GCZA 2W3HA 3EGXC 4KUOA 3BWLA 1DRMA 1NLYA 4B93A 2NUTC 5HDDA 4R6LA 4H6JB 1TS8A 2PYPA 4HP9A 4II7A 4WF0A 3T4SA 2A24A 3F1PB 5FL3A 1MKMA 3S7QA 4Y2FA 1G6OA 1TS6A 2W1TB 1Y28A 3K3CA 3KO6A 3T4JA 4I5SA 3FPWA 3LYXA 4EQ1A 1H8MA 4O0PA 2FZ0A 4FOFA 1W63M 3R4KA 1TS0A 1NLZA 3PYPA 3EQVA 4I38A 4K08A 4ETZA 2JKRI 4Q0HA 5KSHA 3D3OA 5AJGA 4CLCA 2QWSA 2Z6CA 2YKFA 2VEAA 2OAQ1 5G4ZA 2K31A 3EQUA 1XFNA 1EW0A 4Y5FA 2Z6DA 2PD7A 3PBOA 1V9YA 1VB6A 2V1BA 2W3GA 4L9GA 1XJ3A 3IS2B 1MC0A 4GJ4A 1STZA 4OOLA 4YWZA 1TD5A 3IBJA 4BBUA 4HJ6A 2QJ7A 2ZMFA 4WUJA 3MQ0A 4CLCD 4DN0A 2XA7M 2O99A 4NXGA 3OCLA 2L0WA 3IBRA 3CWFA 1YKDA 4HP4A 4WELA 4EW7A 4ETXA 2PT7A 1OTBA 3NOUC 3T4OA 2PD8A 2P04A 1D06A 2M1CA 4IUHA 4GHIA 4UEYA 4MN7A 2VV8A 3LICA 2VX8A 2J3TD 4H6JA 5MC7A 5AVFA 5J3WA 3P7NA 5DKKA 3NHQA 4YOFA 1P9RA 2PDRA 2GNXA 3F1PA 5HWVA 3KYZA 3OBFA 3PBQA 4NXFA 4IJGA 4R38A 1OTEA 2PR5A 2W1TA 3OLOA 3LIBA 1OT9A 3JVVA 3HCYA 4L9FA 5IS1A 3T50A 1YSPA 4QPRA 3GDIA 3TE8A 1KOUA 2DMWA 5DKLA 2ZBBA 5A8BA 2HJ9C 3UB7A 1JNUA 3O5YA 3V67A 1OPXA 3KSGA 4BMWA 5K5BA 4ARZB 3R7WB 3C2WA 3CUEA 4PAUA 3MR0A 2M7VA 5HL6A 3T4TA 4L0LA 3TJZC 4EUVA 1S66L 2O0YA 3RFBA 4UQIS 5DJUA 2OAP1 4WLAA 4BWIA 2P08A 4NXEA 4MDZA 2R78A 3H82B 3IS2A 4HHDA 1LSXA 2OWHA 4RQ9A 3PXPA 4GHIB 1S67L 1N9LA 5TBMA 2V1AA 4JGQA 3UB8A 2MJ6A 4I39A 4R3AA 2VKSA 4Y3IA 2ZMVA 2XA7S 2Y8HA 4KQOA 5HWWA 4OOMA 1YAXA 4F3LB 1S4RA 1P0ZA 4LLOB 4L9EA 3VOLA 4CLCC 1TF1A 1OJ5A 5LBRA 1MZUA 5F5YA 1DP6A 3B42A 3DBAA 2OOLA 3T4LA 2FH5A 3MJQA 2L1MA 3H9WA 1ZTUA 2L4RA 4EEPA 1P9WA 4HQAA 3P01A 2GZAA 1DP9A 2VJWA 2VZWA 3HJKA 4LRZE 2J80A 4Z1WA 3T4QA 3K2NA 2J3TC 2PHYA 4EXOA 2QYBA 4UQIM 4BBTA 2K7SA 5F6AA 4IUKA 2H28A 3LR3A 4R70A 4I3JA 5CX7A 2HV1A 3KSFA 2JKTM 1LSVA 4LPZA 1N9NA 3A0RA 2KOIA 5HD3A 1G28A 5HD5A 5J7EA 1UWPX 5J4EA 1F98A 2W3FA 2PR6A 4ARZA 3R7WA 3MFXA 5TJJA 3NOTC 2W1RA 2IA2A 4BBVA 5TBMB 3LIDA 1OTDA 2V0UA 4HIAA 4WEJA 5G4YA 1BYWA 2I9VA 2V9AA 2ZOHA 1D7EA 4LRXC 2ZOIA 3LFVA 1OJGA 4HOIA 2QJ5A 3UMEA 3H82A 2HJEA 1X0OA 4XT2B 4G3VA 1XFQA 3LR0A 5HWTA 3TRCA 4DMZA 2KDKA 2QKPA 4MN5A 3A0SA 3KYQA 3EOIA 2O9AA 3UE3A 2P7JA 4WN5A 4WEKA 1T1AA 4F3LA 5KIZA 3FG8A 1W63Q 2HF6A 3EEAA 3F1NA 3BW6A 3E0YA 3CUEC 4HNBA 4P6ZM 3UB9A 3CI6A 1DP8A 2YKHA 5F68A 4G3KA 3BQ8A 4MCWA 3LR4A 3MF0A 1XJ4A 4DJ2A 3PBRA 5DFYA 3EEHA 2WKPA 1T19A 1OTAA 3JVUA 3CITA 2O9BA 2JN7A 2W3DA 3W2ZA 1GSWA 2O9CA 3E98A 3ZYTA 3CLOA 3S7PA 3D72A 2W0NA 4YNRA 3LI8A 4MMNA 3VV4A 1T1CA 2EWWA 2BASA 5C5KA 1GSVA 4WL9A 1T1BA 3UE6A 4KQDA 2CMNA 4CQHA 3LR5A 4JGOA 3FPVA 3OC2A 5L8MA 2WKQA 3LIAA 1V9ZA 2KLIA 1TS7A 4O01A 3B47A 3F1OB 4G3WA 3E4QA 5DJTA 2XRNA 2W27A 3RTYA 1S1YA 2M7UA 2V0WA 2VGLM 5HDSA 1ODVA 4HH3A 3MMHA 2HGVA 3C38A 5IU1A 4BJPA 4ZRRA 3F1NB 4XT2A 4AFIA 3PR6A 1LT0A 3OOVA 5EFWA 2NUPC 2W3EA 1P97A 5HPIA 5HPFA 3B33A 4GW9A 3RH8B 2D01A 2J3WA 4GLQA 2G7UA 3BQAA 3HJIA 4DJ3A 4CLCE 2VLGA 4ME4A 4HI4A 3LI9A 4NEED 3PBNA 1OTIA 3ICYA 4P6ZS 3SW1A 1WA9A 5IT5A 3MQOA 4MN6A 2KX6A 3KSIA 1NRJA 3E4OA 3A0VA 4EU0A 2LB5A 3BY8A 4EETB 3LIEA 3C8CA 4HH2A 2XROA 2JHEA 2EWVA 2B02A 1N9OA 2XSSA 3H7WB 4EEUA 3NJAA 1GSXA 4EERA 4GS9B 5AVEA 1UGUA 4M4XA 4O8GA 4EESA 2Y79A 5HSQA 1F5MA 3VE4A 2INWA 2VV7A 4NKPA 4NXBA 5F69A 3T4KA 4KUKA 3GECA 2EA9A 3LUQA 4I3AA 3G6OA 2VA0A 3KX0X 4JGPA 1XJ6A 4HY8A 5DFXA 4FSFA 2QHKA 1F9IA 4JGRA 2D02A 3F1OA 3BJNA 3PHYA 3FC7A 4LRYC 4Q0JA 1XJ2A 1NWZA 3VE3A 3UMDA 2A24B 2VGLS 3MQQA 1IFQA 5HZHA 2A2LA 2GJ3A 2JKTI 4B9OA 3EGDC 5DF9A 1H3QA 4Q0IA 2OWJA 3U2AA 3E4PA 2PYRA 3C30A 4IHQA 3OCNA 3MXQA 3UB6A 3PBSA 4E04A 3S7NA 3PBTA 2VV6A 1LSWA 1YSQA 1IOUA 3NOPC 3ULFA 4CLCB 3S7OA 1ZHHB 1VHMA 2WKRA 1UWNX 3TW8A 3BY9A 2B18A 4I3IA 1T18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKY A;  3H7W A;  1LL8 A;  3EWK A;  3CAX A;  4GS9 A;  3LIF A;  4HJ4 A;  3K3D A;  4HJ3 A;  5I5L A;  3ZQ5 A;  1S1Z A;  4PKY G;  5HDC A;  1OT6 A;  1S4S A;  4GCZ A;  4KUO A;  3BWL A;  1DRM A;  5HDD A;  4R6L A;  4H6J B;  1TS8 A;  2PYP A;  4HP9 A;  4WF0 A;  2A24 A;  3F1P B;  1TS6 A;  1Y28 A;  3K3C A;  4I5S A;  3LYX A;  4EQ1 A;  1TS0 A;  3PYP A;  4I38 A;  4K08 A;  2QWS A;  2Z6C A;  2YKF A;  2VEA A;  5G4Z A;  1XFN A;  1EW0 A;  2Z6D A;  2PD7 A;  1V9Y A;  1VB6 A;  2V1B A;  4L9G A;  1XJ3 A;  3IS2 B;  4YWZ A;  4BBU A;  4HJ6 A;  2QJ7 A;  4WUJ A;  4NXG A;  2L0W A;  3IBR A;  3CWF A;  4HP4 A;  4EW7 A;  1OTB A;  3NOU C;  2PD8 A;  1D06 A;  2M1C A;  4GHI A;  2VV8 A;  3LIC A;  4H6J A;  5AVF A;  5J3W A;  3P7N A;  5DKK A;  3NHQ A;  2PDR A;  3F1P A;  5HWV A;  4NXF A;  4R38 A;  1OTE A;  2PR5 A;  3OLO A;  3LIB A;  1OT9 A;  4L9F A;  5IS1 A;  3T50 A;  3GDI A;  1KOU A;  5DKL A;  2ZBB A;  5A8B A;  3UB7 A;  1JNU A;  3C2W A;  3MR0 A;  1S66 L;  5DJU A;  4WLA A;  4NXE A;  2R78 A;  3H82 B;  3IS2 A;  4HHD A;  1LSX A;  2OWH A;  4RQ9 A;  4GHI B;  1S67 L;  1N9L A;  5TBM A;  2V1A A;  4JGQ A;  3UB8 A;  4I39 A;  4R3A A;  5HWW A;  4F3L B;  1S4R A;  1P0Z A;  4LLO B;  4L9E A;  3VOL A;  1OJ5 A;  1MZU A;  5F5Y A;  1DP6 A;  2OOL A;  3MJQ A;  2L1M A;  3H9W A;  2L4R A;  4EEP A;  4HQA A;  1DP9 A;  3HJK A;  4LRZ E;  2J80 A;  2PHY A;  4EXO A;  4BBT A;  2K7S A;  5F6A A;  2H28 A;  4R70 A;  4I3J A;  2HV1 A;  1LSV A;  4LPZ A;  1N9N A;  3A0R A;  5HD3 A;  1G28 A;  5HD5 A;  5J7E A;  1UWP X;  5J4E A;  1F98 A;  2PR6 A;  3MFX A;  3NOT C;  4BBV A;  5TBM B;  3LID A;  1OTD A;  2V0U A;  4HIA A;  5G4Y A;  1BYW A;  2I9V A;  2V9A A;  2ZOH A;  1D7E A;  4LRX C;  2ZOI A;  1OJG A;  4HOI A;  2QJ5 A;  3UME A;  3H82 A;  1X0O A;  4XT2 B;  1XFQ A;  5HWT A;  2KDK A;  2QKP A;  4MN5 A;  3A0S A;  2P7J A;  4WN5 A;  1T1A A;  4F3L A;  5KIZ A;  3FG8 A;  3F1N A;  4HNB A;  3UB9 A;  1DP8 A;  2YKH A;  5F68 A;  1XJ4 A;  4DJ2 A;  3EEH A;  2WKP A;  1T19 A;  1OTA A;  2JN7 A;  1GSW A;  3CLO A;  3D72 A;  2W0N A;  3LI8 A;  1T1C A;  2BAS A;  1GSV A;  4WL9 A;  1T1B A;  3UE6 A;  4KQD A;  2CMN A;  4JGO A;  2WKQ A;  3LIA A;  1V9Z A;  1TS7 A;  3F1O B;  3E4Q A;  5DJT A;  2W27 A;  3RTY A;  1S1Y A;  2V0W A;  5HDS A;  1ODV A;  4HH3 A;  5IU1 A;  3F1N B;  4XT2 A;  1LT0 A;  5EFW A;  1P97 A;  3B33 A;  4GW9 A;  3RH8 B;  2D01 A;  3HJI A;  4DJ3 A;  2VLG A;  4HI4 A;  3LI9 A;  1OTI A;  3ICY A;  3SW1 A;  1WA9 A;  3MQO A;  4MN6 A;  2KX6 A;  3E4O A;  3A0V A;  3BY8 A;  4EET B;  3LIE A;  3C8C A;  4HH2 A;  2JHE A;  2B02 A;  1N9O A;  3H7W B;  4EEU A;  3NJA A;  1GSX A;  4EER A;  4GS9 B;  5AVE A;  1UGU A;  4M4X A;  4EES A;  5HSQ A;  3VE4 A;  2INW A;  2VV7 A;  4NXB A;  5F69 A;  4KUK A;  3GEC A;  2EA9 A;  3LUQ A;  4I3A A;  3G6O A;  3KX0 X;  4JGP A;  1XJ6 A;  4HY8 A;  2QHK A;  1F9I A;  4JGR A;  2D02 A;  3F1O A;  3PHY A;  3FC7 A;  4LRY C;  1XJ2 A;  1NWZ A;  3VE3 A;  3UMD A;  2A24 B;  3MQQ A;  5HZH A;  2GJ3 A;  4B9O A;  2OWJ A;  3E4P A;  2PYR A;  3MXQ A;  3UB6 A;  4E04 A;  2VV6 A;  1LSW A;  3NOP C;  3ULF A;  2WKR A;  1UWN X;  3BY9 A;  4I3I A;  1T18 A; 
#chains in the Genus database with same CATH topology
 5A91 A;  5U47 A;  3SZT A;  3HL9 A;  2ZC4 B;  3CAX A;  4YIN A;  4C6Y A;  3K3D A;  3SS4 A;  3ZQ5 A;  5GLD A;  3BYD A;  2Q9N A;  2X02 A;  1PI4 A;  2EX9 A;  1HTZ A;  4PM6 A;  2GX5 A;  4OH0 A;  4LCM A;  2C6W B;  2Y2N A;  3BWL A;  1YQS A;  3UE0 A;  4QB8 A;  4IVI A;  1OME A;  3FWL A;  3HUN A;  4X68 A;  4DKI A;  3LY4 A;  1MWT A;  3S7Q A;  2ZC3 B;  1G6O A;  4LV1 A;  2W1T B;  4KQQ A;  1Y28 A;  2ZLY A;  3K3C A;  2ZM2 A;  1ES2 A;  3C7V A;  2ZJ9 A;  1FR6 A;  3FPW A;  1H8M A;  4HEF A;  4KZ8 A;  5CER A;  1IYO A;  4ETZ A;  2JKR I;  4Q0H A;  5EVI A;  3ZVW A;  4R3J A;  5KSH A;  3V3R A;  3KYE A;  2WZZ A;  2XF3 A;  1L2S A;  2K31 A;  4GOG A;  3EQU A;  1FSY A;  4BD0 A;  1A0K A;  2V2F F;  2EFX A;  3OPL A;  1CEF A;  3DWK A;  4EBP A;  4OOL A;  4MBK A;  3HLE A;  4BBU A;  2ZMF A;  4WUJ A;  4DN0 A;  2XA7 M;  4NXG A;  2L0W A;  3SH9 A;  4EW7 A;  1OTB A;  3LCE A;  4EWF A;  3E2K A;  4XUX A;  1DJA A;  4B4Z A;  4MN7 A;  4QY6 A;  4BEN A;  3P7N A;  4S2K A;  3VMA A;  2HZ5 A;  4YOF A;  3F1P A;  4LEN A;  4PM8 A;  5HWV A;  2HP6 A;  3DAV A;  4R38 A;  1OTE A;  2PR5 A;  4S2P A;  3T50 A;  5TR7 A;  3GDI A;  3DWZ A;  3BEC A;  3GTC A;  1FSW A;  2HJ9 C;  1PZP A;  1RGY A;  3QP1 A;  4BMW A;  5K5B A;  1BLC A;  1Z6F A;  3G35 A;  4PAU A;  2H0T A;  4R0Q A;  4L0L A;  5DJU A;  5JYO A;  4NXE A;  2UWX A;  3BFD A;  3IS2 A;  4CJN A;  1D1J A;  5GLB A;  3A3D A;  5EOO A;  4IED A;  1K6R A;  1MKI A;  1N9L A;  4OQ0 A;  1MBL A;  2V1A A;  1L0D A;  1MWR A;  5EM1 A;  1GHM A;  4R3A A;  4Y3I A;  5HWW A;  5L10 A;  4F3L B;  1NRF A;  3NEC A;  4LLO B;  4L9E A;  3VOL A;  1TF1 A;  5LBR A;  3W4O A;  4DE3 A;  4X6T A;  5F5Y A;  1DP6 A;  5GLC A;  2OOL A;  1RGZ A;  2FH5 A;  3MJQ A;  4MLL A;  3H9W A;  3CPT B;  1P9W A;  4HQA A;  2GZA A;  1DP9 A;  3G32 A;  3HVF A;  4S2N C;  2J80 A;  4Z1W A;  1YLW A;  3Q7V A;  3Q1F A;  4R23 A;  2J3T C;  2QYB A;  5J8X A;  4K0W A;  3LR3 A;  4R70 A;  5CX7 A;  1CEG A;  3C4P A;  1G28 A;  5HD5 A;  5DTS A;  1UWP X;  3N6I A;  2BLS A;  1K54 A;  2ZL1 B;  2IA2 A;  5EV0 A;  3P09 A;  1OTD A;  4WEJ A;  2V9A A;  4LRX C;  1OJG A;  3G4P A;  5CRF A;  4QU3 A;  3ZG5 A;  5HW3 A;  1X0O A;  4XT2 B;  4G3V A;  3FV7 A;  1XFQ A;  3C7U A;  4MN5 A;  1L3L A;  1U60 A;  5KIZ A;  1E3U A;  2P9V A;  3F1N A;  4ZDX A;  4P6Z M;  4PM7 A;  5F68 A;  2HDU A;  3LR4 A;  1M6K A;  4DJ2 A;  5CGS A;  3GQZ A;  1FR1 A;  3MFD A;  2O9B A;  1XX2 A;  1E3U D;  3CLO A;  1LI9 A;  3S7P A;  4DE0 A;  1CQA A;  4D60 A;  3TG9 A;  4S2J A;  3V39 A;  3CMZ A;  4UHU A;  3T1R A;  1T1B A;  1XPB A;  3OC2 A;  4EQI A;  5L8M A;  4S2L A;  3UY6 A;  4Y0O A;  3ISG A;  4KZA A;  3F1O B;  2W27 A;  4PPR A;  4R4S A;  2V0W A;  2VGL M;  2WGW A;  1BZA A;  4BJP A;  1VEU A;  4ZRR A;  5E2F A;  4WBG A;  4UA7 A;  4KG6 A;  3DTE A;  5D3O A;  4DXC A;  4OLD A;  2PRF A;  4HBU A;  4GW9 A;  3RH8 B;  1DJB A;  3ITB A;  4GLQ A;  5EVE A;  4OLG A;  3G2Z A;  1WYC A;  3UNW A;  4ESP A;  4HI4 A;  1FCO A;  1DJC A;  4NEE D;  4NG2 A;  4MNR A;  3V3S A;  2XFT A;  1WA9 A;  3MQO A;  2XD1 A;  2KX6 A;  3KSI A;  4S2I A;  4EET B;  1G5U A;  3LIE A;  2J7V A;  3UPN A;  5E43 A;  4E6W A;  3MKE A;  2EWV A;  3BEB A;  4EEU A;  4GS9 B;  2RCX A;  2JKG A;  4KZ6 A;  4MBH A;  5EEC A;  4S2M A;  1MWS A;  2Y79 A;  4KG5 A;  2VV7 A;  3WRT A;  4NXB A;  3WS4 A;  1IEM A;  4HY8 A;  1K4E A;  1GHI A;  3Q07 A;  1F9I A;  4LV2 A;  3PHY A;  3BLS A;  1RCJ A;  4NET A;  5FQM A;  2A24 B;  2HDQ A;  4P87 A;  1BTL A;  5HZH A;  3VP3 A;  3NDE A;  3UDF A;  4B9O A;  1FOF A;  3EGD C;  1H3Q A;  4Q0I A;  3QNC A;  3WS0 A;  3E4P A;  3BRM A;  1I5Q A;  3OCN A;  3PBS A;  5F82 A;  3S7N A;  2JCH A;  4CLC B;  4OQG A;  1E25 A;  4UAA A;  5CGW A;  3ZDJ A;  4ZJ3 A;  1SDN A;  1T18 A;  1NJ4 A;  1JWP A;  1SKO A;  3EWK A;  2JKR M;  2PAV P;  2AVX A;  5I5L A;  1S1Z A;  5GLA A;  4KZB A;  3UE1 A;  5HDC A;  3S4X A;  4JF6 A;  1FCM A;  3KSH A;  1HD8 A;  1K6S A;  4N9K A;  3W4P A;  2Y2I A;  5DF7 A;  2NUT C;  3SOI A;  5HDD A;  1VET B;  2WZX A;  4HP9 A;  1YMS A;  4U0X A;  1W79 A;  3HLD A;  4DRT A;  2Y2J A;  4D2O A;  4Y2F A;  3E2L A;  5L09 A;  1ACF A;  1K57 C;  4I5S A;  2ACG A;  3LYX A;  4EQ1 A;  4O0P A;  4FOF A;  1W63 M;  4BQM A;  1NLZ A;  4I38 A;  4K08 A;  1CI8 A;  3D3O A;  5F1F A;  1ALQ A;  3W8K A;  2QWS A;  2Y2K A;  2OAQ 1;  1H8Y A;  4HES A;  4ZJ1 A;  1EW0 A;  4Y5F A;  2Z6D A;  3PBO A;  4CPK A;  1IKI A;  3G34 A;  1NZU A;  1K55 C;  4N92 A;  3M2K A;  5AQA A;  1RP5 A;  2Y2H A;  3OCL A;  3CWF A;  1YKD A;  4HP4 A;  2WKI A;  4ETX A;  4R3B A;  4RX2 A;  3A3J A;  5KMW A;  4X1M A;  1FIK A;  2OLV A;  2P04 A;  3QP2 A;  1GA9 A;  1C3B A;  2VX8 A;  2J3T D;  4H6J A;  5FQ9 A;  3G30 A;  5FAP A;  5FDS A;  5DKK A;  4OPR A;  2JBF A;  3NHQ A;  5CGX A;  1J9M A;  5CHU A;  2GNX A;  3G31 A;  3LIB A;  1G68 A;  5FQQ A;  1JWV A;  2Y2Q A;  1YSP A;  3NUL A;  3HUM A;  2IWC A;  1IKG A;  4OP5 A;  1OPX A;  1ES3 A;  3KSG A;  4IVK A;  4OPQ A;  3Q82 A;  3O3V A;  2M7V A;  3T4T A;  2O0Y A;  3SH7 A;  2OAP 1;  1NYM A;  1XA1 A;  1BLS A;  2BTF P;  4MDZ A;  5HL1 A;  2R78 A;  1LSX A;  2V1Z A;  1IYS A;  3JYI A;  5IHV A;  3W4Q A;  4GHI B;  4U0T A;  3IH9 A;  4JGQ A;  3UB8 A;  3L9K A;  5GHX A;  2MJ6 A;  1KGG A;  4X25 A;  3B3X A;  2ZMV A;  2XA7 S;  2Y8H A;  3IF6 C;  1ES5 A;  1P0Z A;  4FUW A;  3UN7 A;  2A49 A;  4E3I A;  3PAE A;  4X55 A;  3LGO A;  3MKF A;  4E3L A;  2L4R A;  4EEP A;  3T1X A;  4P0M A;  2VJW A;  4WZ4 A;  3HJK A;  4LRZ E;  5FI7 A;  2H5S A;  1H5X A;  2ZQ9 A;  5FAS A;  4EXO A;  3HRE A;  4WZ5 C;  4BBT A;  2K7S A;  4IUK A;  5FQI A;  2HV1 A;  2JKT M;  1LSV A;  3C4O A;  2R9W A;  3FKV A;  4LPZ A;  3GVB A;  3WWX A;  1GCE A;  5J4E A;  2W3F A;  2XQZ A;  3O86 A;  4ARZ A;  3R7W A;  2OLU A;  1FCN A;  2PU2 A;  5TBM B;  4BLM A;  4R1G A;  4HIA A;  3M2J A;  5G4Y A;  1JTG A;  2ZOH A;  3LFV A;  5E2H A;  3IH8 A;  1W7F A;  2ZQ8 A;  3H82 A;  3UME A;  1ERM A;  2HJE A;  2PU4 A;  5HWT A;  5GHY A;  2V8C A;  3EOI A;  4DF6 A;  2ZC5 B;  1SZV A;  2B95 A;  4QD4 A;  3N8S A;  3CUE C;  2P74 A;  4KZ9 A;  3UB9 A;  3CI6 A;  5I94 A;  1DP8 A;  3LY3 A;  2Y2L A;  2DRW A;  4G3K A;  4LGW A;  3WS1 A;  3A3E A;  2XDM A;  2ZQC A;  3PBR A;  5DFY A;  4E3O A;  2WKP A;  1CK3 A;  3GR2 A;  5CEC A;  3VFF A;  2Z2M B;  2W3D A;  3W2Z A;  1GSW A;  1HZO A;  3ZYT A;  3VV4 A;  4GN2 A;  2EWW A;  2HPB A;  3UE6 A;  4OQH A;  1XKZ A;  4JGO A;  4GD8 A;  2WKQ A;  2XFS A;  3LIA A;  1V9Z A;  3D4F A;  4O01 A;  1O07 A;  1WE4 A;  2XH9 A;  5HDS A;  4HH3 A;  1JWZ A;  2HGV A;  1K56 D;  1YT4 A;  3UO9 A;  4AFI A;  1LLB A;  5AQB A;  5EFW A;  2NUP C;  2W3E A;  3ZG0 A;  1G6A A;  5HPI A;  4GDB A;  5HPF A;  3UDX A;  1ESU A;  3B33 A;  2J3W A;  2G7U A;  3BQA A;  3HJI A;  2WUQ A;  2XD5 A;  2VLG A;  4ME4 A;  3PBN A;  1OTI A;  5GL9 A;  4P6Z S;  3SW1 A;  4MN6 A;  3NC8 A;  1XP4 A;  1KE0 A;  4GNU A;  1IYP A;  1KGF A;  2B02 A;  1N9O A;  5E2E A;  2VK3 A;  4WM9 A;  4O8G A;  2INW A;  3T4K A;  1MWU A;  3LEQ A;  4KUK A;  5KZH A;  3LUQ A;  3HUO A;  1TDG A;  3QP5 A;  5FEG A;  2VA0 A;  4Y0T A;  3KX0 X;  3HLB A;  2EXA A;  4FSF A;  4F94 A;  4JGR A;  3VOY A;  5CTN A;  4B4X A;  1NWZ A;  3GRJ A;  3QP8 A;  3FKW A;  5L07 A;  2VGL S;  4JLF A;  2JKT I;  1K55 A;  5DTT A;  5F1G A;  3O87 A;  3C30 A;  3UB6 A;  3QP6 A;  5EVI B;  1AXB A;  1QME A;  1ZHH B;  1VHM A;  4BL2 A;  2JE5 A;  4GB7 A;  1NZO A;  1YLT A;  3OPP A;  5CHM A;  4PKY A;  3H7W A;  4PHT A;  4X56 A;  1O7E A;  5FQJ A;  3LIF A;  4HJ4 A;  3BFG A;  1YLJ A;  4GZB A;  1IEL A;  2XLN A;  1S4S A;  4GCZ A;  3FZC A;  2Y2O A;  3EGX C;  4KUO A;  1DRM A;  1NLY A;  4B93 A;  4LCL A;  4R6L A;  3HLC A;  3VOZ A;  4E3N A;  2WAF A;  1QMF A;  1TS8 A;  4II7 A;  3NIA A;  3F1P B;  5FL3 A;  3DTI A;  5EVI C;  1MKM A;  2XGN A;  1TS6 A;  1AWI A;  3L7H A;  2HP9 A;  3ZG8 B;  3T4J A;  5CTM A;  1L0F A;  2ZD8 A;  2Y2M A;  2FZ0 A;  1XXM A;  1TS0 A;  3IF6 A;  1PWD A;  3EQV A;  4OP8 A;  2FFY A;  4B88 A;  1PW8 A;  3S1Y A;  1CJF A;  4RVA A;  5FI6 A;  2IWD A;  2X71 A;  1BLH A;  4YFM A;  2EX6 A;  3VP0 A;  2VEA A;  5G4Z A;  4X53 A;  2B5R A;  3MBZ A;  5HAR A;  4LV3 A;  1XFN A;  1K4F A;  4QY5 A;  5E2G A;  3SH8 A;  1YPR A;  2W3G A;  1VB6 A;  2V1B A;  4L9G A;  3IS2 B;  1LL9 A;  4KZ5 A;  1TD5 A;  1L0E A;  4EBN A;  4HJ6 A;  4WZ5 A;  3OZH A;  3MQ0 A;  1ES4 A;  3DTK A;  2O99 A;  2EX8 A;  1Y4O A;  4WEL A;  3NOU C;  3T4O A;  2PD8 A;  1D06 A;  3ZHH A;  4IUH A;  4GHI A;  4UEY A;  3LIC A;  5AVF A;  5J3W A;  4JF5 A;  1P9R A;  2PDR A;  4QHC A;  3KYZ A;  3OBF A;  3PBQ A;  3Q7V B;  4Q8I A;  4NXF A;  4IJG A;  2ZMA A;  2W1T A;  3OLO A;  3RJU A;  2FFF B;  4MBF A;  1OT9 A;  3JVV A;  3HCY A;  3BFC A;  4L9F A;  1LI0 A;  5IS1 A;  4QPR A;  3TE8 A;  2DMW A;  2HP5 A;  5DKL A;  3HLG A;  4NK3 A;  1PNE A;  3UB7 A;  1JNU A;  1GA0 A;  3CUE A;  3LEZ A;  3MR0 A;  3IHA A;  2BG1 A;  4EUV A;  1S66 L;  2EX2 A;  4UQI S;  4K91 A;  4DDY A;  3P98 A;  2P08 A;  1HLU P;  3LO7 A;  4RQ9 A;  1YLY A;  3C5A A;  5G18 A;  3NCK A;  2VGJ A;  1S67 L;  5TBM A;  4I39 A;  1YLZ A;  3BFE A;  2Z2L B;  1S4R A;  2P9V B;  3BM6 A;  1I2W A;  4CLC C;  1OJ5 A;  1MZU A;  4DE1 A;  4U3T A;  3DBA A;  3T4L A;  2GDN A;  2L1M A;  4WMC A;  3P01 A;  2HDR A;  1LL5 A;  4ID4 A;  1ONG A;  3T4Q A;  4Y15 A;  3HLW A;  4HBT A;  3UB5 P;  4UQI M;  5F6A A;  4I3J A;  3KSF A;  1ZC2 A;  1N9N A;  3A0R A;  5M18 A;  4WMC D;  5J7E A;  4S2N A;  3MZF A;  3ZG9 B;  5TJJ A;  4OPY A;  3LID A;  3IXD A;  1BYW A;  2I9V A;  1D7E A;  3IX4 A;  2ZOI A;  4FD8 A;  5EM0 A;  2WGW B;  4HOI A;  2QJ5 A;  1VEU B;  3T1S A;  3ZG7 B;  4DMZ A;  2QKP A;  1ZG4 A;  1KVM A;  3GV9 A;  3BLM A;  3IWO A;  4Y7P A;  3GSG A;  2P7J A;  3ZVT A;  4WN5 A;  4WEK A;  1T1A A;  4F3L A;  3EEA A;  2HF6 A;  3BW6 A;  3E0Y A;  4HNB A;  1XA7 A;  3T12 B;  2WK0 A;  1N9B A;  3WS5 A;  2YKH A;  5TGF A;  2OV5 A;  4MCW A;  3BQ8 A;  3CPT A;  3N4I A;  2Q0O A;  1XJ4 A;  4UA9 A;  3D9Y A;  4JPM A;  3EEH A;  3JVU A;  3CIT A;  1SKF A;  3SS3 A;  1IYQ A;  4EBL A;  2Y2G A;  4C3Q A;  1PRQ A;  2QZ6 A;  4GD6 A;  4Z9Q A;  3D72 A;  2V8F A;  2WAD A;  4MMN A;  1T1C A;  2BAS A;  3WS2 A;  4WL9 A;  2ZQD A;  3N7W A;  5F83 A;  1PWG A;  4CQH A;  3ZCZ A;  3FPV A;  1ZG6 A;  2ZL1 A;  1JTD A;  4C75 A;  3M6B A;  4FH4 A;  3CHW P;  3B47 A;  4G3W A;  3E4Q A;  5DJT A;  2XRN A;  1S1Y A;  3MMH A;  4JKT A;  3C38 A;  5IU1 A;  4XT2 A;  1WYB A;  5HAQ A;  3AGE A;  1LT0 A;  2DCF A;  5A93 A;  3A3F A;  4K0X A;  1P97 A;  4JBF A;  2D01 A;  5FAO A;  4ZJ2 A;  1KDW A;  4DJ3 A;  2V20 A;  4FTX A;  3LI9 A;  3IXG A;  1KE3 A;  3N8R A;  3QNB A;  2Y55 A;  3ZNT A;  3E4O A;  2Y59 A;  5EPH A;  1KVL A;  3VP4 A;  3BY8 A;  2E8J A;  2E8I A;  4N9L A;  1ERO A;  3C8C A;  4HH2 A;  2JHE A;  4O7D A;  2XSS A;  1SKO B;  1TVF A;  5CEB A;  4EER A;  4M4X A;  4EES A;  5HSQ A;  5M19 A;  3VE4 A;  4NKP A;  3FYZ A;  5F69 A;  3GEC A;  2EA9 A;  2H10 A;  3G6O A;  2DNS A;  3CG5 A;  1Y54 A;  5EVI D;  3V50 A;  2JC7 A;  2D02 A;  2ZC6 B;  3BJN A;  3F1O A;  3IWI A;  4Q0J A;  4DDS A;  1XJ2 A;  3Q81 A;  1DY6 A;  4JXV A;  5FDH A;  1PIO A;  3UMD A;  3GMW A;  2PBD P;  3MQQ A;  3IX3 A;  1I2S A;  1IFQ A;  5CED A;  2GJ3 A;  2Y4A A;  5DF9 A;  2OWJ A;  5FI2 A;  5M1A A;  2PYR A;  5FAT A;  2WGI A;  1SHV A;  3MXQ A;  3MS6 A;  4E04 A;  5CXW A;  4BL3 A;  2Y91 A;  2VV6 A;  5HAP A;  1LSW A;  1YSQ A;  1IOU A;  3NOP C;  3ULF A;  4N1H A;  4P85 A;  3S7O A;  1ONH A;  3BY9 A;  2B18 A;  1K56 A;  1K0K A;  4I3I A;  1H0M A;  1Q2Q A;  1LL8 A;  5FAQ A;  4GS9 A;  5GHZ A;  2LB9 A;  1Z09 A;  5EUA A;  4HJ3 A;  4X1L A;  4PKY G;  2WKE A;  2K2N A;  2QMI A;  5HX9 A;  4KEN B;  1OT6 A;  5DVA A;  4LFU A;  2ZM8 A;  2W3H A;  2PBY A;  5FA7 A;  3ZFZ A;  5KSC A;  2EXB A;  5FEF A;  4PM5 A;  1M40 A;  1PWC A;  1HVB A;  4H6J B;  1W5D A;  2PYP A;  3RXX A;  4ZAM A;  4WF0 A;  4BD1 A;  3T4S A;  1CF0 A;  2A24 A;  4RA7 A;  2J9O A;  3TOI A;  4JXG A;  3KO6 A;  2C5W B;  3PAG A;  5A92 A;  1JVJ A;  3R4K A;  3UPP A;  3PYP A;  2G2W A;  4OKP A;  4E3K A;  3IX8 A;  1BUL A;  5AJG A;  3ZGA B;  4ZTK A;  4CLC A;  1PZO A;  4Y17 A;  2Z6C A;  2YKF A;  1KGE A;  2A3U A;  2IWB A;  1K57 A;  3V5M A;  4OVD A;  2I72 A;  2PD7 A;  1V9Y A;  1YM1 A;  1XJ3 A;  4DE2 A;  4PMA A;  1MC0 A;  4GJ4 A;  1STZ A;  4PM9 A;  5HAI A;  4YWZ A;  2ZC7 A;  3IBJ A;  1S6R A;  4Y0U A;  4E3J A;  2QJ7 A;  4CLC D;  1EWZ A;  1XGJ A;  3IBR A;  3RXW A;  2PT7 A;  4M3K A;  2M1C A;  4KZ4 A;  4KZ7 A;  1NXY A;  4JXS A;  3SS5 A;  1VET A;  2VV8 A;  5MC7 A;  4QJG A;  4WYY A;  2R9X A;  3NBL A;  4OPZ A;  4GDN A;  1YMX A;  1ERQ A;  1F2K A;  1KOU A;  2WAE A;  2ZBB A;  5A8B A;  3VP2 A;  3O5Y A;  3V67 A;  2J9P A;  4A5R A;  4ARZ B;  4DXB A;  4IBR A;  1L0G A;  3R7W B;  3C2W A;  4UA6 A;  3TJZ C;  5HL6 A;  3RFB A;  4ZBE A;  4BWI A;  4WLA A;  2J8Y A;  3IXH A;  4S2O A;  5L2F A;  4GKU A;  1BSG A;  1MY8 A;  3NI9 A;  4OON A;  1K25 A;  3H82 B;  4HHD A;  2OWH A;  2RL3 A;  3PXP A;  2XK1 A;  2VKS A;  1YLP A;  4KQO A;  3AGF A;  4OOM A;  1YAX A;  3MXS A;  1N4O A;  3G2Y A;  3B42 A;  3MXR A;  3ITA A;  4KQR A;  3IT9 A;  1ZTU A;  2EFU A;  1VM1 A;  1PYY A;  1E4D A;  3Q7Z A;  2VZW A;  1EI5 A;  3AGD A;  3K2N A;  2PHY A;  2VGK A;  4KZ3 A;  2H28 A;  2CC1 A;  3QHY A;  5DF8 A;  2KOI A;  5HD3 A;  4R4R A;  3OPR A;  2WYX A;  1F98 A;  2PR6 A;  5FSR A;  1Q2P A;  3DW0 A;  2X01 A;  3MFX A;  3NOT C;  2W1R A;  3CJM A;  4IBX A;  4BBV A;  5HFO A;  2V0U A;  3S22 A;  3MZD A;  4OQI A;  3M6H A;  3O88 A;  2UV0 E;  3LR0 A;  3IWQ A;  3IXB A;  3TRC A;  3MSH A;  1BUE A;  1PFL A;  3DTM A;  2KDK A;  1H8Z A;  3A0S A;  4EUZ A;  3KYQ A;  3HBR A;  2QPN A;  3N8L A;  2O9A A;  3UE3 A;  4KG2 A;  3FG8 A;  1W63 Q;  4JXW A;  3ZNY A;  5AQ7 A;  4E3M A;  5DTK A;  1CI9 A;  3QP4 A;  1PW1 A;  1J3W A;  3MF0 A;  5EVL A;  1SDE A;  2G2U A;  3PTE A;  1T19 A;  1OTA A;  3UPO A;  3U4L P;  2JN7 A;  2O9C A;  3E98 A;  4OOY A;  2W0N A;  4YNR A;  1NYY A;  2H0Y A;  3LI8 A;  2WGV A;  4FH2 A;  3VSK A;  3OPH A;  5BOH A;  1BT5 A;  4RX3 A;  5C5K A;  1GSV A;  1XGI A;  4KQD A;  1MPL A;  2CMN A;  3WRZ A;  2Q9M A;  3LR5 A;  1NY0 A;  4X69 A;  2KLI A;  1TS7 A;  4MEZ A;  2JKF A;  3RTY A;  4JF4 A;  2M7U A;  1ODV A;  4EV4 A;  1ESI A;  3F1N B;  5A90 A;  1FQG A;  3PR6 A;  3OOV A;  3CZD A;  1LHY A;  5CHJ A;  3VFH A;  1S0W A;  5EE8 A;  3BFF A;  1K54 C;  1ZKJ A;  4H8R A;  4CLC E;  1SCW A;  3ICY A;  3IQA A;  5IT5 A;  3IF5 A;  1NRJ A;  3A0V A;  4EU0 A;  2LB5 A;  3VP1 A;  5JYP A;  2XRO A;  2XEP A;  4E6X A;  1VQQ A;  3H7W B;  3NJA A;  1GSX A;  4XXR A;  1K38 A;  5AVE A;  3VSL A;  1UGU A;  2HDS A;  1F5M A;  2WKH A;  2ZQ7 A;  3A3I A;  4I3A A;  4FCF A;  3T1Q B;  4JGP A;  1XJ6 A;  3HLF A;  5DFX A;  2ZM0 A;  2QHK A;  1FIL A;  3TSG A;  2ZQA A;  1MXO A;  1KE4 A;  3FC7 A;  4LRY C;  1GHP A;  4QWO A;  2OSU A;  3JPU A;  3VE3 A;  4N1X A;  1W8Y A;  1W8Q A;  5AQ9 A;  3UDI A;  2Y2P A;  2A2L A;  3I7J A;  5FQK A;  1PI5 A;  3MZE A;  3U2A A;  1TEM A;  2XR0 A;  4IHQ A;  1BLP A;  4P6B A;  5EOE A;  4LV0 A;  3IF6 B;  3NDG A;  3PBT A;  1KDS A;  3IHB A;  3NY4 A;  2WKR A;  1UWN X;  3TW8 A;  4RYE A;  1TDL A;  5TFQ A;  4Y13 A;  4XUZ A; 
#chains in the Genus database with same CATH homology
 4PKY A;  3H7W A;  1LL8 A;  4PHT A;  3EWK A;  3CAX A;  4GS9 A;  2LB9 A;  3LIF A;  4HJ4 A;  2JKR M;  3K3D A;  4HJ3 A;  5I5L A;  3ZQ5 A;  1S1Z A;  4PKY G;  2K2N A;  5HDC A;  3KSH A;  1OT6 A;  2GX5 A;  1S4S A;  4GCZ A;  2W3H A;  3EGX C;  4KUO A;  3BWL A;  1DRM A;  1NLY A;  4B93 A;  2NUT C;  5HDD A;  4R6L A;  4H6J B;  1TS8 A;  2PYP A;  4HP9 A;  4II7 A;  4WF0 A;  3T4S A;  2A24 A;  3F1P B;  5FL3 A;  1MKM A;  3S7Q A;  4Y2F A;  1G6O A;  1TS6 A;  2W1T B;  1Y28 A;  3K3C A;  3KO6 A;  3T4J A;  4I5S A;  3FPW A;  3LYX A;  4EQ1 A;  1H8M A;  4O0P A;  2FZ0 A;  4FOF A;  1W63 M;  3R4K A;  1TS0 A;  1NLZ A;  3PYP A;  3EQV A;  4I38 A;  4K08 A;  4ETZ A;  2JKR I;  4Q0H A;  5KSH A;  3D3O A;  5AJG A;  4CLC A;  2QWS A;  2Z6C A;  2YKF A;  2VEA A;  2OAQ 1;  5G4Z A;  2K31 A;  3EQU A;  1XFN A;  1EW0 A;  4Y5F A;  2Z6D A;  2PD7 A;  3PBO A;  1V9Y A;  1VB6 A;  2V1B A;  2W3G A;  4L9G A;  1XJ3 A;  3IS2 B;  1MC0 A;  4GJ4 A;  1STZ A;  4OOL A;  4YWZ A;  1TD5 A;  3IBJ A;  4BBU A;  4HJ6 A;  2QJ7 A;  2ZMF A;  4WUJ A;  3MQ0 A;  4CLC D;  4DN0 A;  2XA7 M;  2O99 A;  4NXG A;  3OCL A;  2L0W A;  3IBR A;  3CWF A;  1YKD A;  4HP4 A;  4WEL A;  4EW7 A;  4ETX A;  2PT7 A;  1OTB A;  3NOU C;  3T4O A;  2PD8 A;  2P04 A;  1D06 A;  2M1C A;  4IUH A;  4GHI A;  4UEY A;  4MN7 A;  2VV8 A;  3LIC A;  2VX8 A;  2J3T D;  4H6J A;  5MC7 A;  5AVF A;  5J3W A;  3P7N A;  5DKK A;  3NHQ A;  4YOF A;  1P9R A;  2PDR A;  2GNX A;  3F1P A;  5HWV A;  3KYZ A;  3OBF A;  3PBQ A;  4NXF A;  4IJG A;  4R38 A;  1OTE A;  2PR5 A;  2W1T A;  3OLO A;  3LIB A;  1OT9 A;  3JVV A;  3HCY A;  4L9F A;  5IS1 A;  3T50 A;  1YSP A;  4QPR A;  3GDI A;  3TE8 A;  1KOU A;  2DMW A;  5DKL A;  2ZBB A;  5A8B A;  2HJ9 C;  3UB7 A;  1JNU A;  3O5Y A;  3V67 A;  1OPX A;  3KSG A;  4BMW A;  5K5B A;  4ARZ B;  3R7W B;  3C2W A;  3CUE A;  4PAU A;  3MR0 A;  2M7V A;  5HL6 A;  3T4T A;  4L0L A;  3TJZ C;  4EUV A;  1S66 L;  2O0Y A;  3RFB A;  4UQI S;  5DJU A;  2OAP 1;  4WLA A;  4BWI A;  2P08 A;  4NXE A;  4MDZ A;  2R78 A;  3H82 B;  3IS2 A;  4HHD A;  1LSX A;  2OWH A;  4RQ9 A;  3PXP A;  4GHI B;  1S67 L;  1N9L A;  5TBM A;  2V1A A;  4JGQ A;  3UB8 A;  2MJ6 A;  4I39 A;  4R3A A;  2VKS A;  4Y3I A;  2ZMV A;  2XA7 S;  2Y8H A;  4KQO A;  5HWW A;  4OOM A;  1YAX A;  4F3L B;  1S4R A;  1P0Z A;  4LLO B;  4L9E A;  3VOL A;  4CLC C;  1TF1 A;  1OJ5 A;  5LBR A;  1MZU A;  5F5Y A;  1DP6 A;  3B42 A;  3DBA A;  2OOL A;  3T4L A;  2FH5 A;  3MJQ A;  2L1M A;  3H9W A;  1ZTU A;  2L4R A;  4EEP A;  1P9W A;  4HQA A;  3P01 A;  2GZA A;  1DP9 A;  2VJW A;  2VZW A;  3HJK A;  4LRZ E;  2J80 A;  4Z1W A;  3T4Q A;  3K2N A;  2J3T C;  2PHY A;  4EXO A;  2QYB A;  4UQI M;  4BBT A;  2K7S A;  5F6A A;  4IUK A;  2H28 A;  3LR3 A;  4R70 A;  4I3J A;  5CX7 A;  2HV1 A;  3KSF A;  2JKT M;  1LSV A;  4LPZ A;  1N9N A;  3A0R A;  2KOI A;  5HD3 A;  1G28 A;  5HD5 A;  5J7E A;  1UWP X;  5J4E A;  1F98 A;  2W3F A;  2PR6 A;  4ARZ A;  3R7W A;  3MFX A;  5TJJ A;  3NOT C;  2W1R A;  2IA2 A;  4BBV A;  5TBM B;  3LID A;  1OTD A;  2V0U A;  4HIA A;  4WEJ A;  5G4Y A;  1BYW A;  2I9V A;  2V9A A;  2ZOH A;  1D7E A;  4LRX C;  2ZOI A;  3LFV A;  1OJG A;  4HOI A;  2QJ5 A;  3UME A;  3H82 A;  2HJE A;  1X0O A;  4XT2 B;  4G3V A;  1XFQ A;  3LR0 A;  5HWT A;  3TRC A;  4DMZ A;  2KDK A;  2QKP A;  4MN5 A;  3A0S A;  3KYQ A;  3EOI A;  2O9A A;  3UE3 A;  2P7J A;  4WN5 A;  4WEK A;  1T1A A;  4F3L A;  5KIZ A;  3FG8 A;  1W63 Q;  2HF6 A;  3EEA A;  3F1N A;  3BW6 A;  3E0Y A;  3CUE C;  4HNB A;  4P6Z M;  3UB9 A;  3CI6 A;  1DP8 A;  2YKH A;  5F68 A;  4G3K A;  3BQ8 A;  4MCW A;  3LR4 A;  3MF0 A;  1XJ4 A;  4DJ2 A;  3PBR A;  5DFY A;  3EEH A;  2WKP A;  1T19 A;  1OTA A;  3JVU A;  3CIT A;  2O9B A;  2JN7 A;  2W3D A;  3W2Z A;  1GSW A;  2O9C A;  3E98 A;  3ZYT A;  3CLO A;  3S7P A;  3D72 A;  2W0N A;  4YNR A;  3LI8 A;  4MMN A;  3VV4 A;  1T1C A;  2EWW A;  2BAS A;  5C5K A;  1GSV A;  4WL9 A;  1T1B A;  3UE6 A;  4KQD A;  2CMN A;  4CQH A;  3LR5 A;  4JGO A;  3FPV A;  3OC2 A;  5L8M A;  2WKQ A;  3LIA A;  1V9Z A;  2KLI A;  1TS7 A;  4O01 A;  3B47 A;  3F1O B;  4G3W A;  3E4Q A;  5DJT A;  2XRN A;  2W27 A;  3RTY A;  1S1Y A;  2M7U A;  2V0W A;  2VGL M;  5HDS A;  1ODV A;  4HH3 A;  3MMH A;  2HGV A;  3C38 A;  5IU1 A;  4BJP A;  4ZRR A;  3F1N B;  4XT2 A;  4AFI A;  3PR6 A;  1LT0 A;  3OOV A;  5EFW A;  2NUP C;  2W3E A;  1P97 A;  5HPI A;  5HPF A;  3B33 A;  4GW9 A;  3RH8 B;  2D01 A;  2J3W A;  4GLQ A;  2G7U A;  3BQA A;  3HJI A;  4DJ3 A;  4CLC E;  2VLG A;  4ME4 A;  4HI4 A;  3LI9 A;  4NEE D;  3PBN A;  1OTI A;  3ICY A;  4P6Z S;  3SW1 A;  1WA9 A;  5IT5 A;  3MQO A;  4MN6 A;  2KX6 A;  3KSI A;  1NRJ A;  3E4O A;  3A0V A;  4EU0 A;  2LB5 A;  3BY8 A;  4EET B;  3LIE A;  3C8C A;  4HH2 A;  2XRO A;  2JHE A;  2EWV A;  2B02 A;  1N9O A;  2XSS A;  3H7W B;  4EEU A;  3NJA A;  1GSX A;  4EER A;  4GS9 B;  5AVE A;  1UGU A;  4M4X A;  4O8G A;  4EES A;  2Y79 A;  5HSQ A;  1F5M A;  3VE4 A;  2INW A;  2VV7 A;  4NKP A;  4NXB A;  5F69 A;  3T4K A;  4KUK A;  3GEC A;  2EA9 A;  3LUQ A;  4I3A A;  3G6O A;  2VA0 A;  3KX0 X;  4JGP A;  1XJ6 A;  4HY8 A;  5DFX A;  4FSF A;  2QHK A;  1F9I A;  4JGR A;  2D02 A;  3F1O A;  3BJN A;  3PHY A;  3FC7 A;  4LRY C;  4Q0J A;  1XJ2 A;  1NWZ A;  3VE3 A;  3UMD A;  2A24 B;  2VGL S;  3MQQ A;  1IFQ A;  5HZH A;  2A2L A;  2GJ3 A;  2JKT I;  4B9O A;  3EGD C;  5DF9 A;  1H3Q A;  4Q0I A;  2OWJ A;  3U2A A;  3E4P A;  2PYR A;  3C30 A;  4IHQ A;  3OCN A;  3MXQ A;  3UB6 A;  3PBS A;  4E04 A;  3S7N A;  3PBT A;  2VV6 A;  1LSW A;  1YSQ A;  1IOU A;  3NOP C;  3ULF A;  4CLC B;  3S7O A;  1ZHH B;  1VHM A;  2WKR A;  1UWN X;  3TW8 A;  3BY9 A;  2B18 A;  4I3I A;  1T18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...