4OLDA

Crystal structure of ampc beta-lactamase in complex with the product form of (6r,7r)-7-amino-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Substrate deconstruction and the nonadditivity of enzyme recognition.
pubmed doi rcsb
source organism Escherichia coli
total genus 122
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oldA00
1K55C 2ZQ8A 5FI7A 1IELA 1WYBA 4MBKA 5DTTA 1MWTA 2EFXA 4GDBA 4O7DA 4OPQA 4ZTKA 3WS2A 5FI6A 1BTLA 4X53A 1MY8A 3G2ZA 4KZ3A 3PBRA 2FFFB 2Q9NA 3CMZA 3GV9A 4M3KA 4X69A 4Y0OA 1FCMA 3ZG9B 1IEMA 3ITBA 1K56D 5DTSA 1IYPA 1N4OA 4QB8A 1O07A 2VGKA 1BLSA 3G2YA 1YLPA 5I94A 3IHAA 2PU2A 1TDGA 4JKTA 1VM1A 2WAEA 3NCKA 2Q9MA 5EVLA 3N8SA 1MBLA 4R0QA 1E4DA 3MFDA 3HUNA 5FQ9A 3BRMA 5M1AA 2FFYA 4OOYA 1YLWA 3OC2A 5L2FA 2VGJA 4B88A 1JTDA 4N9LA 3W4OA 2ZMAA 5GHZA 5G18A 1W79A 2J8YA 3ZNYA 2WK0A 3C5AA 3M6BA 2HDRA 4LV0A 5EVIA 2P9VA 1PIOA 4MBHA 2Y55A 1KDSA 5GLBA 5FAPA 3V39A 1GCEA 1NYMA 3O88A 3VP2A 1LL9A 3VOYA 4IBXA 2HP6A 4E3JA 4N1XA 2HPBA 3PAGA 3GTCA 5FA7A 4NETA 4Z9QA 1Z6FA 1KE3A 4R4RA 4S2IA 4XXRA 4Y7PA 5CHJA 2Y2OA 1K57A 2ZC5B 1K38A 5KSCA 3OPRA 3N8RA 1BUEA 1PZPA 4CJNA 1HZOA 4ZDXA 2XK1A 5EVIC 1M40A 2Y2MA 3HLBA 2P9VB 3UPOA 5E2HA 3WS5A 2X01A 1BSGA 1HD8A 1SKFA 4OQ0A 1NY0A 1TDLA 2XH9A 4LENA 1LLBA 2BG1A 3VP1A 1PI5A 3O86A 4DE3A 3BFCA 1K57C 3VP4A 3BFEA 1C3BA 5CGSA 4JXVA 4YINA 3VMAA 4D2OA 3NBLA 5EOOA 1JTGA 2ZC4B 3PBOA 4B4XA 5DF7A 4XUZA 1XA7A 1W8YA 1LI9A 3AGDA 5HX9A 4KG5A 3IF5A 1E3UA 3IWOA 3BYDA 4EV4A 2JC7A 3HLDA 4JLFA 4QD4A 1SDEA 1MWRA 3GR2A 2ZQCA 5F1FA 3MBZA 5CEBA 4PM6A 4UA7A 4ZAMA 1JVJA 4R4SA 1SHVA 5F83A 3VOZA 1MWSA 4GD8A 4BD1A 3IT9A 2XD5A 5FDHA 3P98A 3QNBA 3VSLA 1JWPA 4Y0UA 1NJ4A 5FQQA 3WS1A 1PZOA 1K6SA 2GDNA 3A3EA 3FKVA 2H10A 5FATA 5FQKA 4DDSA 5HAQA 2WADA 5A91A 3PBSA 1W8QA 5BOHA 4KZ4A 2ZQAA 4E6XA 4KZ5A 3ZVTA 3BLMA 3MKEA 4IEDA 3N8LA 4WYYA 1FQGA 2XEPA 3GRJA 4FSFA 4OONA 3FYZA 4OPRA 5CRFA 1ES5A 1EI5A 3P09A 2OV5A 4K91A 5EUAA 1KVMA 4JXSA 3A3JA 3NI9A 4F94A 4GDNA 4OOMA 3G30A 4WEKA 1IKGA 4U0TA 2WYXA 5FI2A 5EOEA 3IHBA 2ZLYA 1YMSA 4X6TA 3IXBA 4OLGA 3W4QA 1ONHA 1KGGA 3LY3A 4UAAA 2EX8A 4OP8A 1PWDA 4MLLA 4DF6A 3O87A 2ZQ7A 3UDIA 3S4XA 4KZAA 1MKIA 4X56A 1DJBA 1E3UD 5GLCA 1YM1A 1L0EA 1ERMA 2ZM8A 3A3FA 1J9MA 1PW8A 5CECA 3UNWA 3MZEA 4X55A 3TOIA 2XFSA 3NY4A 1YMXA 4OOLA 3ZNTA 1Q2PA 5CERA 1G68A 1OMEA 3OZHA 4K0WA 5AQ9A 1ZKJA 1ESIA 3QNCA 4KG6A 2DNSA 4WZ5A 1FCNA 3IXDA 1SCWA 3S22A 1EWZA 3ZG5A 5A93A 4NK3A 4R1GA 4DXBA 1IYOA 5E2EA 1WYCA 1BLPA 3FKWA 1XKZA 2I72A 5CHMA 4U0XA 3DWKA 3QHYA 2V20A 4GZBA 2XDMA 3VP0A 2BLSA 5DVAA 2WGWA 4EBLA 3WS0A 4IBRA 1BT5A 3GMWA 3ZCZA 1RGZA 2WGVA 3SH9A 4L0LA 1DJCA 3Q7VA 1S6RA 2EXBA 4WZ5C 3WS4A 2ZQDA 3BLSA 1K54A 1LL5A 4WBGA 3PBQA 3SH7A 1TVFA 1CK3A 4KG2A 5AQBA 5M18A 3VP3A 1BLHA 3CG5A 3IF6A 3HL9A 4WMCD 4E3MA 1FSYA 3LCEA 3B3XA 1G6AA 4LV1A 1NRFA 3DWZA 4C75A 4QHCA 4S2NA 5GLDA 5D3OA 4BL2A 2G2UA 2IWDA 4FH2A 1YT4A 2OLUA 3NDGA 2Z2LB 1GHPA 2J7VA 2R9XA 3Q7ZA 4KZ7A 4MNRA 4DE1A 1K54C 1IYQA 2EFUA 4BENA 1I2WA 3Q1FA 5EVIB 3HUOA 4HEFA 1XXMA 1GHIA 1VQQA 2Z2MB 4P87A 3IF6C 2H0TA 4KQRA 4WM9A 1KGEA 2HP9A 4PM8A 3UN7A 4S2NC 2Y2LA 2EXAA 3C7VA 3HBRA 4MEZA 4DXCA 3I7JA 3HLFA 2C6WB 3JYIA 3PAEA 3SS4A 2ZM0A 1NYYA 1I5QA 5AQAA 1RP5A 3V3SA 3IWQA 2QPNA 2Y4AA 4DDYA 1JWZA 4S2PA 4OPZA 1FOFA 4EBPA 4BJPA 3G4PA 3IH8A 3IWIA 2ZC7A 1IKIA 5HW3A 1GHMA 1HVBA 3G35A 3CJMA 5TGFA 4DRTA 1ES2A 5EPHA 3ZG7B 2JBFA 1LI0A 2EX9A 5EVID 3E2LA 4HBUA 4GNUA 2ZQ9A 4PPRA 4KENB 3RXXA 3SOIA 3V3RA 4C6YA 3G31A 5J8XA 2EX2A 4B4ZA 4KZ8A 5IHVA 4E3IA 4JBFA 1YLZA 4EBNA 1W7FA 3BECA 2QZ6A 2HDUA 4HESA 5FQJA 4GD6A 1L0GA 5FSRA 3HLWA 1PI4A 5CTMA 5GLAA 4CPKA 5EE8A 5M19A 4P6BA 3ITAA 5HL1A 3MZFA 4E6WA 4ZJ1A 2JCHA 1K56A 1L0FA 1IYSA 3ISGA 3OPLA 3MXRA 3ZDJA 3ZGAB 4XUXA 5KZHA 4DE2A 4RVAA 3BFDA 3ZG0A 2A49A 2UWXA 5U47A 2P74A 4GN2A 5CGWA 2XF3A 1E25A 2PBYA 3UY6A 5FASA 3W8KA 4BLMA 1XGIA 3OCNA 5DF8A 1CI8A 1YQSA 2Y91A 3ZFZA 1XPBA 1PWGA 2DCFA 1XA1A 3A3DA 3NC8A 4OKPA 2RL3A 3WRTA 3SH8A 3TG9A 4EQIA 2ZC3B 1FR1A 3Q81A 2Y2PA 5AQ7A 1PYYA 4OPYA 1WE4A 1FSWA 5CTNA 4FCFA 2C5WB 5CGXA 2HDSA 4UHUA 3G34A 1BZAA 3BEBA 4OH0A 2CC1A 1K4EA 2OSUA 3IXGA 2WKIA 5TR7A 1JWVA 1Y54A 4Q8IA 4S2MA 5HARA 1U60A 1XP4A 1H5XA 4KZBA 4KQQA 1ZC2A 3NDEA 4FH4A 4JF4A 4PMAA 1XX2A 1DJAA 3C4OA 3E2KA 3IH9A 4R3JA 5FQMA 4ZJ2A 1NZOA 1EROA 1ES3A 3OCLA 3UPPA 3FZCA 4LV2A 1L0DA 1ZG6A 2Y2GA 3PBTA 4WELA 3BFFA 5EECA 3DTMA 4JF5A 4EWFA 2RCXA 4PM9A 1KGFA 4R3BA 5FAOA 5GL9A 2XLNA 1CEGA 4H8RA 1MWUA 4OP5A 3VFHA 3IQAA 1ONGA 3GVBA 4X68A 2IWCA 1M6KA 2EX6A 4S2OA 3BM6A 3A3IA 3OPHA 3UO9A 2H0YA 4LCMA 1W5DA 3VFFA 4BD0A 2XD1A 4OQHA 2V1ZA 3ZVWA 2G2WA 3ZG8B 2WGWB 3HLGA 4JPMA 4KZ6A 4KQOA 3UE1A 1ZG4A 3O3VA 4UA9A 1YLTA 4P85A 3SS5A 3Q7VB 1PW1A 4S2LA 5JYOA 3IXHA 4WEJA 4C3QA 5CHUA 1CI9A 2J9OA 4DKIA 5KSHA 2Y2JA 1MXOA 1BLCA 1DY6A 3IF6B 3HREA 2WAFA 3HUMA 4K0XA 2E8IA 3W4PA 2H5SA 2HDQA 2Y2NA 5CEDA 4HBTA 2IWBA 3DW0A 4ZBEA 4E3KA 1HTZA 3EQUA 3G32A 1NXYA 3N4IA 3UDXA 3WRZA 5F1GA 3VSKA 2QMIA 2XQZA 5DF9A 4A5RA 3M2KA 5A92A 3NIAA 4QU3A 5A90A 1AXBA 3C7UA 5E2GA 1K4FA 3N6IA 1H8ZA 4OQIA 4P0MA 2Y59A 3EQVA 2HP5A 3ZHHA 4E3NA 3UE0A 4GB7A 5E43A 4KZ9A 4GOGA 4DE0A 5KMWA 1K6RA 3LY4A 3RXWA 1N9BA 4MBFA 4JF6A 2XGNA 2PU4A 3PBNA 1FCOA 2Y2IA 1TEMA 5DTKA 4RX3A 2WGIA 1XGJA 1FR6A 3MZDA 5HFOA 4QY5A 4PM5A 1KVLA 4ID4A 4N1HA 3LEZA 5CXWA 2Y2HA 4R23A 4QY6A 5HAIA 3LO7A 3GSGA 1GA9A 2XFTA 2ZC6B 3AGEA 4U3TA 1L2SA 3UPNA 4BQMA 3SS3A 3UDFA 1I2SA 2X71A 3CZDA 3V50A 2X02A 2JE5A 4BL3A 2V2FF 2Y2QA 5TFQA 2OLVA 4RYEA 4UA6A 4LV3A 1S0WA 3FV7A 2J9PA 1LHYA 2WKHA 3MKFA 4S2JA 4IVKA 5FAQA 2WUQA 4FD8A 4QJGA 1KDWA 2R9WA 2WZXA 4EUZA 3FWLA 1H8YA 4E3LA 3MXSA 1KE4A 2XR0A 2ZM2A 3Q07A 4YFMA 5E2FA 5HAPA 1KE0A 3D4FA 4ZJ3A 5GHYA 3GQZA 4IVIA 3UE3A 3OPPA 1GA0A 5JYPA 1CEFA 4PM7A 2WKEA 3BFGA 2DRWA 2A3UA 1ALQA 1ERQA 4JXWA 1K55A 3M2JA 3RJUA 3S1YA 4WZ4A 3V5MA 1SDNA 4S2KA 1Q2QA 4JXGA 1RCJA 4LCLA 4OLDA 1YLJA 1RGYA 3AGFA 1QMFA 1PWCA 2B5RA 3HLEA 3M6HA 4N9KA 4N92A 4OQGA 4WMCA 5F82A 1YLYA 2WZZA 3HVFA 3Q82A 3PTEA 3N7WA 5FQIA 1ESUA 1K25A 4OVDA 1O7EA 4RA7A 1ES4A 1MPLA 3C4PA 5GHXA 3WWXA 4Y0TA 1QMEA 4GKUA 2Y2KA 4RX2A 3TSGA 4E3OA 3HLCA 1NZUA 2ZJ9A 2ZD8A 1BULA
chains in the Genus database with same CATH superfamily
2ZQ8A 1G28A 1WYBA 2JKTM 4GDBA 4WUJA 1MY8A 2FFFB 1K56D 1IYPA 3PHYA 3G2YA 1VM1A 2WAEA 1CQAA 5EVLA 1MBLA 1E4DA 3HUNA 2FFYA 4BMWA 4RQ9A 1VEUB 5L2FA 4B88A 4N9LA 5G18A 2PD7A 2DMWA 3BWLA 2HDRA 5KIZA 1PIOA 4MBHA 5GLBA 4EEPA 3V39A 2PYRA 3O88A 1LL9A 3KSHA 3PAGA 5FEGA 3RFBA 1PRQA 5LBRA 2V1AA 4R4RA 4Y7PA 4XXRA 2Y2OA 2HJ9C 3IX3A 1OJGA 1K38A 1PZPA 1HZOA 5EVIC 3T4QA 1XJ2A 5E2HA 2X01A 1BSGA 2JKGA 3NOUC 4OQ0A 1TDLA 3BFCA 1C3BA 5CGSA 4JXVA 4YINA 1OTAA 3PBOA 4B4XA 5DF7A 1N9OA 2J3WA 5HX9A 3W2ZA 4JLFA 3EOIA 4QD4A 4F3LB 3GR2A 3MBZA 4PM6A 4I39A 1JVJA 5F83A 4GD8A 4BD1A 4EQ1A 3UB8A 2GDNA 3FKVA 4ETZA 3TRCA 3T4KA 2ZQAA 4KZ5A 4E04A 1FQGA 2XEPA 5HD3A 3QP8A 4CLCC 4ESPA 4ARZA 2W3FA 3P09A 4NKPA 4HNBA 3A3JA 3R4KA 4X6TA 2ZLYA 3F1NB 5FEFA 5TBMB 3LY3A 4OP8A 4MLLA 3O87A 3DBAA 4GS9B 1MKIA 4X56A 5CECA 5GLCA 1YM1A 1ERMA 3MZEA 3E4OA 4EXOA 3ZNTA 3DTIA 1FIKA 3OZHA 2A24A 3QNCA 1ESIA 5HPFA 2GNXA 3LR3A 1SCWA 1EWZA 3T1QB 4NK3A 1IYOA 2W27A 2XDMA 3VP0A 5DVAA 3BY9A 4EBLA 4IBRA 1BT5A 3Q7VA 4L9EA 3BLSA 3LIEA 4Y5FA 3SH7A 4GW9A 3BW6A 5M18A 1BLHA 1ODVA 3IF6A 4WMCD 1FSYA 1G6AA 4G3KA 1NRFA 3DWZA 4QHCA 3T12B 2G2UA 4I5SA 4MDZA 3Q7ZA 4MNRA 3MJQA 1IYQA 4GHIA 4BENA 1V9YA 3LUQA 2P04A 4DJ3A 4PKYG 3UN7A 4MEZA 3HLFA 2P08A 3JYIA 3PAEA 1NYYA 4S2PA 2JKRI 3H7WA 4NG2A 3IH8A 3LFVA 2ZC7A 1IKIA 5HW3A 4HHDA 2VV6A 1ES2A 5HPIA 2JBFA 4XT2A 4I3IA 1TD5A 3E2LA 4HBUA 3V3RA 3G31A 4Z1WA 3LR5A 5IHVA 4EBNA 2QWSA 4HIAA 3BECA 5FQJA 1TF1A 5FSRA 5A8BA 4P6BA 3MZFA 1N9LA 1IYSA 1X0OA 1A0KA 4GCZA 1L3LA 4LGWA 3NHQA 5KZHA 1TS6A 5I5LA 3MQOA 3ZG0A 5U47A 1NLYA 3UY6A 3W8KA 3QP5A 4BLMA 1CI8A 3ZFZA 2W1RA 2DCFA 3LI8A 2Y2PA 1WE4A 5MC7A 5CGXA 3P7NA 1EW0A 1NWZA 2HDSA 3G34A 1BZAA 5L07A 4YOFA 5F6AA 4OH0A 4FTXA 1MZUA 5TR7A 2BTFP 4Q8IA 2VV7A 4FUWA 1T19A 4S2MA 4KZBA 1ZC2A 1JNUA 2Z6CA 3E2KA 3BJNA 1ES3A 2Y8HA 3FZCA 1ZG6A 4WELA 4PM9A 1CEGA 2HV1A 3A3IA 2OAQ1 3VFFA 2VLGA 2G2WA 3ZG8B 2WGWB 4JPMA 5DJTA 1S1YA 1ZG4A 1YLTA 4P85A 2O9BA 2L1MA 1PW1A 3IXHA 4C3QA 5CHUA 1CI9A 2Y2JA 1DY6A 3QP2A 3JVVA 2WAFA 1OT9A 2Y2NA 2IWBA 4ZBEA 4E3KA 4YNRA 3EQUA 1NXYA 3UDXA 5DF9A 1GSVA 1NRJA 3SZTA 3UB5P 4HH3A 4P0MA 4OQIA 5F5YA 3ZHHA 4E3NA 3UE0A 4KUOA 4KZ9A 4GOGA 5KMWA 1K6RA 3LY4A 3RXWA 1OT6A 2WGIA 4R70A 1FR6A 4N1HA 5CXWA 3OLOA 1GA9A 3T4JA 3V50A 3LIDA 4P6ZS 4HQAA 4RYEA 3D3OA 2Q0OA 3MKFA 4FD8A 4QJGA 3T1RA 1KDWA 4EUZA 2R78A 3FWLA 3CPTA 2WKPA 2PAVP 5L10A 5GHYA 4KUKA 1GA0A 2WKEA 3BFGA 2XSSA 3S1YA 4WZ4A 1SDNA 3EGXC 4N9KA 1PWCA 2B5RA 2WZZA 3Q82A 3MQ0A 3N7WA 4RA7A 4OVDA 4Y0TA 1QMEA 2Y2KA 4E3OA 2ZJ9A 5FI7A 3WS2A 4OPQA 5FI6A 3PBRA 4IUKA 2Q9NA 4M3KA 3ZG9B 1FCMA 1IEMA 3ITBA 3K3CA 2V0WA 2VGKA 1BLSA 5I94A 4JKTA 3MFDA 2GJ3A 4EETB 3QP1A 2VGJA 1JTDA 2ZMAA 5GHZA 2Z6DA 4MN7A 1TS0A 1D06A 2WK0A 3M6BA 4LV0A 5EM1A 1XJ6A 1GCEA 1NYMA 3VP2A 3VOYA 1XFNA 4E3JA 5FA7A 1K57A 4EEUA 5KSCA 3OPRA 3MSHA 2W0NA 3U4LP 3V67A 1KOUA 3IBRA 4K08A 1OTEA 1SKFA 5J4EA 5J3WA 5HSQA 3BFEA 1J3WA 1UWPX 4IUHA 2M1CA 1W8YA 3UMDA 4KG5A 3IF5A 5F68A 3E0YA 1SDEA 3LGOA 1SZVA 3PR6A 5CEBA 2NUTC 1SHVA 4MCWA 4MMNA 3D9YA 3QNBA 4Y0UA 3WS1A 1T1BA 3A3EA 5FQKA 5HAQA 4JGRA 2JKRM 3MMHA 4KZ4A 3ZVTA 3MKEA 1GSWA 4OONA 1WA9A 4OPRA 5CRFA 3ULFA 2OV5A 1P9RA 4F94A 4WEKA 4BWIA 3LIBA 5FI2A 3CUEA 3IXBA 1YPRA 1ONHA 1KGGA 2EX8A 3IS2B 4DF6A 2ZQ7A 3UDIA 2QKPA 4KZAA 2G7UA 4HY8A 1L0EA 2K7SA 1J9MA 1PW8A 3F1OB 1P9WA 4X55A 3MF0A 3TOIA 3NY4A 1YMXA 3MS6A 4OOLA 1Q2PA 4K0WA 5AQ9A 4O0PA 1ZKJA 4KG6A 2DNSA 3RTYA 4WZ5A 3F1PA 3ZG5A 5E2EA 1WYCA 3FKWA 1XKZA 2B18A 5CHMA 3K3DA 4U0XA 2V20A 1TS7A 3WS0A 4LLOB 2E8JA 3GMWA 1RGZA 3ZCZA 1DJCA 1S6RA 3LR4A 4HJ6A 1Z09A 1LL5A 4WBGA 4EU0A 3PBQA 1TVFA 4KG2A 2W3GA 3VP3A 2VV8A 2BASA 3B3XA 4S2NA 2LB9A 4AFIA 5D3OA 2IWDA 4PHTA 3NDGA 2WKQA 2Z2LB 1K54C 2EFUA 1OTBA 1XXMA 1GHIA 1VQQA 2Z2MB 4P87A 5HWWA 4PM8A 3LIFA 2EXAA 2J3TD 4HJ3A 2C6WB 1T1CA 5AQAA 3V3SA 3IWQA 1JWZA 4Y13A 4OPZA 4ZRRA 2YKHA 2P7JA 3IWIA 1ACFA 1HVBA 3A0RA 3CJMA 1FILA 3MR0A 2EX9A 3SOIA 4C6YA 5AJGA 1IFQA 3HLWA 1F98A 4CPKA 5EE8A 3LI9A 4NXEA 3ITAA 3CITA 4E6WA 2B95A 3VE3A 2JHEA 3ISGA 3OPLA 3MXRA 4XUXA 4CLCE 3BFDA 2UWXA 5CGWA 2XF3A 2PBYA 1YQSA 2Y91A 3NC8A 4OKPA 4ARZB 3Q81A 4G3WA 2C5WB 4I3JA 2M7VA 2CC1A 2KOIA 2O9CA 3GDIA 3KSFA 1Y54A 4HH2A 5HARA 2M7UA 4KQQA 4JF4A 2GX5A 1W63M 1DRMA 5FQMA 4ZJ2A 2A24B 4LV2A 3E98A 1VHMA 5CX7A 5EECA 4EWFA 3HJIA 2RCXA 1OTIA 1KGFA 1UGUA 4R3BA 5FAOA 4OP5A 3GVBA 2IWCA 2O0YA 4S2OA 4HP4A 3B33A 3BM6A 1W5DA 4BD0A 3ZVWA 3UE1A 3ICYA 4KQOA 2PT7A 3Q7VB 3KYQA 4S2LA 4X1LA 3GECA 2CMNA 1MXOA 3IF6B 1P0ZA 3HUMA 1G5UA 2E8IA 3W4PA 2HDQA 4HBTA 1ZTUA 3WRZA 4GHIB 3M2KA 5A92A 5A90A 3C7UA 2Y59A 3EQVA 2HP5A 3CLOA 4R38A 1N9BA 4MBFA 2XGNA 3PBNA 5DTKA 2PR6A 1KVLA 2W3EA 3LEZA 2Y2HA 4R23A 3GSGA 3H7WB 3CZDA 5L09A 2OWJA 4Y3IA 2V2FF 2Y2QA 3T4TA 4XT2B 5G4ZA 2OLVA 1S0WA 2XROA 1LHYA 4S2JA 2WUQA 2R9WA 3EEAA 1H8YA 1ZHHB 3RH8B 3MFXA 4WF0A 2XR0A 3CAXA 2W3DA 3BY8A 4ZJ3A 5FL3A 4IVIA 3UE3A 1CEFA 4PM7A 2A3UA 1ERQA 1PNEA 2JKTI 2VZWA 3M2JA 3C2WA 2WKRA 4JXGA 1YLJA 5F82A 1OPXA 1YLYA 3QP4A 2D02A 5FQIA 4HI4A 1K25A 1LT0A 3OBFA 3C4PA 1BULA 1K55C 4MBKA 4ZTKA 1MWTA 2EFXA 4O7DA 1BTLA 4X53A 3CHWP 4KZ3A 3GV9A 4WL9A 5DTSA 1O07A 5EV0A 2PU2A 1TDGA 4Y15A 3LYXA 2MJ6A 3BRMA 5AVFA 4ETXA 1P97A 3IBJA 1W79A 3IX8A 3ZNYA 4JGOA 3C5AA 5EVIA 4WLAA 2Y55A 1KDSA 1N9NA 1YAXA 1F2KA 2HP6A 4IBXA 3TJZC 2HPBA 3S7OA 4HP9A 4Z9QA 1Z6FA 1KE3A 4S2IA 2HJEA 1D1JA 2UV0E 2ZC5B 1BUEA 2O9AA 1TS8A 4CJNA 4DMZA 4ZDXA 3NOPC 2XK1A 4H6JA 1M40A 1VETA 2Y2MA 3KX0X 5TJJA 3HLBA 3WS5A 3C8CA 1NY0A 3IX4A 4LENA 2PR5A 3VP1A 1PI5A 3VP4A 3S7QA 3VMAA 4D2OA 1JTGA 2ZC4B 3HJKA 1XA7A 1LI9A 3K2NA 3VV4A 3T4SA 2KLIA 2I9VA 4UA7A 5HDCA 4R4SA 1MWSA 4CLCA 4IJGA 5J7EA 1Y4OA 3IT9A 1PFLA 2XD5A 5FDHA 3P98A 3VSLA 1JWPA 1NJ4A 5FQQA 4DDSA 5FATA 3UE6A 5A91A 3OOVA 2JKFA 3PBSA 4E6XA 3KO6A 4JGPA 3BLMA 3L9KA 3LEQA 4WYYA 3L7HA 3GRJA 3C30A 1EI5A 4K91A 5EUAA 4GDNA 4OOMA 4U0TA 2NUPC 5EOEA 3IHBA 3CPTB 1YMSA 3W4QA 3S4XA 1BYWA 1DJBA 1E3UD 3UNWA 1DP9A 5DKLA 2XFSA 1STZA 5CERA 1OMEA 4BBVA 1FCNA 3IXDA 3S22A 5A93A 2OAP1 4R1GA 4X1MA 1BLPA 2I72A 3DWKA 3QHYA 4GZBA 3H82A 4UQIS 3SH9A 4DJ2A 4L0LA 3WS4A 2EXBA 1AWIA 2ZQDA 4O01A 3CG5A 4EUVA 4C75A 2ZBBA 3DTEA 4UEYA 4BL2A 4KZ7A 4LRYC 5IS1A 4PAUA 1I2WA 3EWKA 3Q1FA 2V8CA 3HUOA 3IF6C 2H0TA 4WM9A 2HP9A 2Y2LA 3HBRA 4DXCA 3I7JA 1XJ3A 3KSIA 3MXQA 1RP5A 2EA9A 2QPNA 5DFYA 2Y4AA 1F9IA 2QJ7A 1V9ZA 2HF6A 3KYZA 4BJPA 1SKOA 5TGFA 4DRTA 2W1TA 3ZG7B 5EVID 2ZL1A 4KENB 2J80A 2EX2A 4B4ZA 4KZ8A 4E3IA 4JBFA 1YLZA 1W7FA 3TW8A 4GD6A 1CF0A 1Y28A 4UQIM 3ZYTA 4HJ4A 5CTMA 4LPZA 5GLAA 5M19A 5HL1A 4ZJ1A 5DFXA 2VX8A 1L0FA 5HDSA 1S67L 5HWVA 4LRXC 4DE2A 4RVAA 3C38A 2A49A 4GN2A 5G4YA 1E25A 4FOFA 3U2AA 3D72A 5EM0A 3WRTA 2VA0A 3TG9A 3LIAA 3T4OA 4EERA 5AQ7A 4R6LA 2OOLA 5CTNA 4FCFA 2AVXA 4CLCD 2LB5A 4B9OA 1W63Q 3T1SA 2PRFA 4NXGA 2WKIA 1JWVA 2VGLS 1T1AA 3UB9A 1VEUA 1XP4A 1H5XA 3LICA 2ZMFA 5L8MA 1XX2A 2VEAA 1DJAA 3C4OA 3IH9A 2ZOIA 3G6OA 3MQQA 5IU1A 3UMEA 3F1PB 3DTMA 4JF5A 5GL9A 3VFHA 2XLNA 1MWUA 4X68A 2EX6A 1H8MA 4LCMA 2OWHA 2XD1A 4OQHA 2V1ZA 1GSXA 3HLGA 4UA9A 4GLQA 5JYOA 3EEHA 4WEJA 2J9OA 4DKIA 4Y2FA 3NOTC 3T1XA 3HREA 2H5SA 2V1BA 5EFWA 4D60A 1HTZA 3G32A 3N4IA 1VB6A 5F1GA 4NXBA 2XQZA 3VE4A 1H0MA 4F3LA 3NIAA 4QU3A 2V8FA 1AXBA 3PYPA 1H8ZA 3NJAA 4GB7A 5E43A 3DAVA 2VGLM 4R3AA 4JF6A 2PU4A 4LFUA 1TEMA 1XGJA 3MZDA 2V9AA 4ID4A 4EESA 4QY6A 3LO7A 3AGEA 4U3TA 1L2SA 4BQMA 3LR0A 3SS3A 2X71A 2X02A 4BL3A 4NXFA 4UA6A 4LV3A 2XA7S 3FV7A 4BBTA 2J9PA 2HZ5A 4IVKA 4E3LA 3MXSA 1KE4A 2GZAA 3F1NA 5TBMA 3HCYA 3Q07A 4YFMA 4G3VA 1KE0A 2VKSA 3H9WA 3GQZA 4GS9A 3OPPA 5JYPA 2W3HA 4M4XA 4O8GA 4MN6A 4YWZA 4JXWA 3V5MA 1S1ZA 4S2KA 1RCJA 3AGFA 5GLDA 3HVFA 3PTEA 1NLZA 1ESUA 5HD5A 3WWXA 2Y79A 4RX2A 1NZUA 4WN5A 1IELA 4Q0JA 5DTTA 2JN7A 3G2ZA 3CMZA 4X69A 4Y0OA 1N4OA 4QB8A 1YLPA 3IHAA 2FH5A 3NCKA 2Q9MA 3N8SA 4R0QA 5FQ9A 3T50A 1F5MA 5M1AA 4OOYA 3S7PA 1YLWA 3EGDC 3OC2A 1IOUA 5EVEA 3JVUA 3W4OA 3UB7A 2J8YA 2XA7M 2A2LA 3B47A 5HWTA 3T4LA 2P9VA 2J3TC 3O5YA 5FAPA 4LRZE 4N1XA 3GTCA 4NETA 3TE8A 5CHJA 2PHYA 3N8RA 4II7A 4DN0A 3SW1A 4MN5A 2P9VB 3UPOA 1HD8A 5DKKA 4CQHA 2XH9A 1LLBA 2BG1A 4DE3A 3O86A 1K57C 3DTKA 2ZOHA 3NBLA 4GJ4A 4HOIA 5EOOA 4XUZA 3AGDA 3IWOA 1E3UA 3NULA 3BYDA 4EV4A 2JC7A 3HLDA 1MWRA 2ZQCA 5F1FA 1CJFA 2KDKA 2PYPA 4ZAMA 3VOZA 3BQ8A 1LSVA 5AVEA 1PZOA 1K6SA 2H10A 2WADA 1W8QA 1H3QA 5BOHA 3FG8A 4IEDA 3N8LA 4FSFA 4ME4A 3FYZA 1ES5A 1LSWA 1KVMA 4JXSA 3NI9A 2D01A 3G30A 1IKGA 2WYXA 1MKMA 4OLGA 3KSGA 2HGVA 4UAAA 1PWDA 2PDRA 1S4SA 2ZM8A 3A3FA 1LSXA 1G68A 2ZMVA 1S4RA 1OJ5A 5C5KA 1XJ4A 2FZ0A 3CUEC 4DXBA 5K5BA 4KQDA 2BLSA 2WGWA 2WGVA 4X25A 2PBDP 2VK3A 4WZ5C 1K54A 2QJ5A 4JGQA 1CK3A 1YSPA 4I38A 5AQBA 5DJUA 2H28A 3HL9A 3BQAA 4E3MA 3LCEA 4LV1A 1UWNX 4FH2A 1YT4A 2OLUA 4NEED 1GHPA 2J7VA 2R9XA 4DE1A 1T18A 5EVIB 4HEFA 4L9GA 3E4QA 2O99A 4KQRA 1KGEA 4S2NC 1YKDA 3C7VA 3SS4A 1D7EA 2ZM0A 1I5QA 4QPRA 4DDYA 4H6JB 1FOFA 1K0KA 4EBPA 1VETB 3G4PA 4Y17A 1GHMA 3G35A 5EPHA 5IT5A 1LI0A 5FDSA 4PPRA 4GNUA 2V0UA 2ZQ9A 3RXXA 5J8XA 1XFQA 2B02A 3ZQ5A 2QZ6A 2HDUA 4HESA 1L0GA 1PI4A 2XRNA 3A0SA 2JCHA 3R7WA 1K56A 4CLCB 3ZDJA 3ZGAB 2L0WA 1MC0A 2P74A 2YKFA 2K2NA 5FASA 4B93A 1XGIA 3OCNA 5DF8A 5F69A 1XPBA 1PWGA 1XA1A 3A3DA 2VJWA 1S66L 2RL3A 3R7WB 3SH8A 4EQIA 2ZC3B 1FR1A 4QWOA 1PYYA 4OPYA 1FSWA 4IHQA 4UHUA 3BEBA 5HDDA 2ACGA 3QP6A 1K4EA 2OSUA 3PXPA 3IXGA 3E4PA 2INWA 3VOLA 1U60A 3NDEA 3NECA 4FH4A 4PMAA 4R3JA 1OTDA 2QYBA 1NZOA 3UB6A 1EROA 3OCLA 3UPPA 1L0DA 5HL6A 2Y2GA 3PBTA 3BFFA 2L4RA 4PKYA 4I3AA 4H8RA 3IQAA 1ONGA 1M6KA 3UO9A 3OPHA 2H0YA 3H82B 4P6ZM 4KZ6A 3O3VA 3SS5A 5HZHA 5KSHA 1BLCA 4K0XA 3B42A 1G6OA 5CEDA 3DW0A 3FPVA 1LL8A 3VSKA 2QMIA 4A5RA 3CWFA 5E2GA 3KYEA 1K4FA 3JPUA 3N6IA 4DE0A 4EW7A 1FCOA 2Y2IA 4RX3A 4Q0HA 3P01A 5HFOA 4PM5A 4QY5A 2KX6A 2PD8A 2EWWA 2K31A 1YSQA 3A0VA 5HAIA 2XFTA 2ZC6B 3UPNA 3UDFA 1I2SA 1SKOB 2JE5A 2W1TB 3CI6A 5TFQA 3FC7A 2ZL1B 2WKHA 4L9FA 5FAQA 2WZXA 1HLUP 2ZM2A 4BBUA 5E2FA 5HAPA 3IS2A 3D4FA 2DRWA 2EWVA 1ALQA 3F1OA 1K55A 3RJUA 4Q0IA 1Q2QA 2IA2A 4LCLA 4OLDA 1RGYA 3HLEA 1QMFA 4OQGA 4N92A 3M6HA 4WMCA 3S7NA 1O7EA 3FPWA 1ES4A 1MPLA 1DP8A 2QHKA 5GHXA 4GKUA 3TSGA 3HLCA 1DP6A 2ZD8A
chains in the Genus database with same CATH topology
1K55C 2ZQ8A 5FI7A 1IELA 1WYBA 4MBKA 5DTTA 1MWTA 2EFXA 4GDBA 4O7DA 4OPQA 4ZTKA 3WS2A 5FI6A 1BTLA 4X53A 1MY8A 3G2ZA 4KZ3A 3PBRA 2FFFB 2Q9NA 3CMZA 3GV9A 4M3KA 4X69A 4Y0OA 1FCMA 3ZG9B 1IEMA 3ITBA 1K56D 5DTSA 1IYPA 1N4OA 4QB8A 1O07A 2VGKA 1BLSA 3G2YA 1YLPA 5I94A 3IHAA 2PU2A 1TDGA 4JKTA 1VM1A 2WAEA 3NCKA 2Q9MA 5EVLA 3N8SA 1MBLA 4R0QA 1E4DA 3MFDA 3HUNA 5FQ9A 3BRMA 5M1AA 2FFYA 4OOYA 1YLWA 3OC2A 5L2FA 2VGJA 4B88A 1JTDA 4N9LA 3W4OA 2ZMAA 5GHZA 5G18A 1W79A 2J8YA 3ZNYA 2WK0A 3C5AA 3M6BA 2HDRA 4LV0A 5EVIA 2P9VA 1PIOA 4MBHA 2Y55A 1KDSA 5GLBA 5FAPA 3V39A 1GCEA 1NYMA 3O88A 3VP2A 1LL9A 3VOYA 4IBXA 2HP6A 4E3JA 4N1XA 2HPBA 3PAGA 3GTCA 5FA7A 4NETA 4Z9QA 1Z6FA 1KE3A 4R4RA 4S2IA 4XXRA 4Y7PA 5CHJA 2Y2OA 1K57A 2ZC5B 1K38A 5KSCA 3OPRA 3N8RA 1BUEA 1PZPA 4CJNA 1HZOA 4ZDXA 2XK1A 5EVIC 1M40A 2Y2MA 3HLBA 2P9VB 3UPOA 5E2HA 3WS5A 2X01A 1BSGA 1HD8A 1SKFA 4OQ0A 1NY0A 1TDLA 2XH9A 4LENA 1LLBA 2BG1A 3VP1A 1PI5A 3O86A 4DE3A 3BFCA 1K57C 3VP4A 3BFEA 1C3BA 5CGSA 4JXVA 4YINA 3VMAA 4D2OA 3NBLA 5EOOA 1JTGA 2ZC4B 3PBOA 4B4XA 5DF7A 4XUZA 1XA7A 1W8YA 1LI9A 3AGDA 5HX9A 4KG5A 3IF5A 1E3UA 3IWOA 3BYDA 4EV4A 2JC7A 3HLDA 4JLFA 4QD4A 1SDEA 1MWRA 3GR2A 2ZQCA 5F1FA 3MBZA 5CEBA 4PM6A 4UA7A 4ZAMA 1JVJA 4R4SA 1SHVA 5F83A 3VOZA 1MWSA 4GD8A 4BD1A 3IT9A 2XD5A 5FDHA 3P98A 3QNBA 3VSLA 1JWPA 4Y0UA 1NJ4A 5FQQA 3WS1A 1PZOA 1K6SA 2GDNA 3A3EA 3FKVA 2H10A 5FATA 5FQKA 4DDSA 5HAQA 2WADA 5A91A 3PBSA 1W8QA 5BOHA 4KZ4A 2ZQAA 4E6XA 4KZ5A 3ZVTA 3BLMA 3MKEA 4IEDA 3N8LA 4WYYA 1FQGA 2XEPA 3GRJA 4FSFA 4OONA 3FYZA 4OPRA 5CRFA 1ES5A 1EI5A 3P09A 2OV5A 4K91A 5EUAA 1KVMA 4JXSA 3A3JA 3NI9A 4F94A 4GDNA 4OOMA 3G30A 4WEKA 1IKGA 4U0TA 2WYXA 5FI2A 5EOEA 3IHBA 2ZLYA 1YMSA 4X6TA 3IXBA 4OLGA 3W4QA 1ONHA 1KGGA 3LY3A 4UAAA 2EX8A 4OP8A 1PWDA 4MLLA 4DF6A 3O87A 2ZQ7A 3UDIA 3S4XA 4KZAA 1MKIA 4X56A 1DJBA 1E3UD 5GLCA 1YM1A 1L0EA 1ERMA 2ZM8A 3A3FA 1J9MA 1PW8A 5CECA 3UNWA 3MZEA 4X55A 3TOIA 2XFSA 3NY4A 1YMXA 4OOLA 3ZNTA 1Q2PA 5CERA 1G68A 1OMEA 3OZHA 4K0WA 5AQ9A 1ZKJA 1ESIA 3QNCA 4KG6A 2DNSA 4WZ5A 1FCNA 3IXDA 1SCWA 3S22A 1EWZA 3ZG5A 5A93A 4NK3A 4R1GA 4DXBA 1IYOA 5E2EA 1WYCA 1BLPA 3FKWA 1XKZA 2I72A 5CHMA 4U0XA 3DWKA 3QHYA 2V20A 4GZBA 2XDMA 3VP0A 2BLSA 5DVAA 2WGWA 4EBLA 3WS0A 4IBRA 1BT5A 3GMWA 3ZCZA 1RGZA 2WGVA 3SH9A 4L0LA 1DJCA 3Q7VA 1S6RA 2EXBA 4WZ5C 3WS4A 2ZQDA 3BLSA 1K54A 1LL5A 4WBGA 3PBQA 3SH7A 1TVFA 1CK3A 4KG2A 5AQBA 5M18A 3VP3A 1BLHA 3CG5A 3IF6A 3HL9A 4WMCD 4E3MA 1FSYA 3LCEA 3B3XA 1G6AA 4LV1A 1NRFA 3DWZA 4C75A 4QHCA 4S2NA 5GLDA 5D3OA 4BL2A 2G2UA 2IWDA 4FH2A 1YT4A 2OLUA 3NDGA 2Z2LB 1GHPA 2J7VA 2R9XA 3Q7ZA 4KZ7A 4MNRA 4DE1A 1K54C 1IYQA 2EFUA 4BENA 1I2WA 3Q1FA 5EVIB 3HUOA 4HEFA 1XXMA 1GHIA 1VQQA 2Z2MB 4P87A 3IF6C 2H0TA 4KQRA 4WM9A 1KGEA 2HP9A 4PM8A 3UN7A 4S2NC 2Y2LA 2EXAA 3C7VA 3HBRA 4MEZA 4DXCA 3I7JA 3HLFA 2C6WB 3JYIA 3PAEA 3SS4A 2ZM0A 1NYYA 1I5QA 5AQAA 1RP5A 3V3SA 3IWQA 2QPNA 2Y4AA 4DDYA 1JWZA 4S2PA 4OPZA 1FOFA 4EBPA 4BJPA 3G4PA 3IH8A 3IWIA 2ZC7A 1IKIA 5HW3A 1GHMA 1HVBA 3G35A 3CJMA 5TGFA 4DRTA 1ES2A 5EPHA 3ZG7B 2JBFA 1LI0A 2EX9A 5EVID 3E2LA 4HBUA 4GNUA 2ZQ9A 4PPRA 4KENB 3RXXA 3SOIA 3V3RA 4C6YA 3G31A 5J8XA 2EX2A 4B4ZA 4KZ8A 5IHVA 4E3IA 4JBFA 1YLZA 4EBNA 1W7FA 3BECA 2QZ6A 2HDUA 4HESA 5FQJA 4GD6A 1L0GA 5FSRA 3HLWA 1PI4A 5CTMA 5GLAA 4CPKA 5EE8A 5M19A 4P6BA 3ITAA 5HL1A 3MZFA 4E6WA 4ZJ1A 2JCHA 1K56A 1L0FA 1IYSA 3ISGA 3OPLA 3MXRA 3ZDJA 3ZGAB 4XUXA 5KZHA 4DE2A 4RVAA 3BFDA 3ZG0A 2A49A 2UWXA 5U47A 2P74A 4GN2A 5CGWA 2XF3A 1E25A 2PBYA 3UY6A 5FASA 3W8KA 4BLMA 1XGIA 3OCNA 5DF8A 1CI8A 1YQSA 2Y91A 3ZFZA 1XPBA 1PWGA 2DCFA 1XA1A 3A3DA 3NC8A 4OKPA 2RL3A 3WRTA 3SH8A 3TG9A 4EQIA 2ZC3B 1FR1A 3Q81A 2Y2PA 5AQ7A 1PYYA 4OPYA 1WE4A 1FSWA 5CTNA 4FCFA 2C5WB 5CGXA 2HDSA 4UHUA 3G34A 1BZAA 3BEBA 4OH0A 2CC1A 1K4EA 2OSUA 3IXGA 2WKIA 5TR7A 1JWVA 1Y54A 4Q8IA 4S2MA 5HARA 1U60A 1XP4A 1H5XA 4KZBA 4KQQA 1ZC2A 3NDEA 4FH4A 4JF4A 4PMAA 1XX2A 1DJAA 3C4OA 3E2KA 3IH9A 4R3JA 5FQMA 4ZJ2A 1NZOA 1EROA 1ES3A 3OCLA 3UPPA 3FZCA 4LV2A 1L0DA 1ZG6A 2Y2GA 3PBTA 4WELA 3BFFA 5EECA 3DTMA 4JF5A 4EWFA 2RCXA 4PM9A 1KGFA 4R3BA 5FAOA 5GL9A 2XLNA 1CEGA 4H8RA 1MWUA 4OP5A 3VFHA 3IQAA 1ONGA 3GVBA 4X68A 2IWCA 1M6KA 2EX6A 4S2OA 3BM6A 3A3IA 3OPHA 3UO9A 2H0YA 4LCMA 1W5DA 3VFFA 4BD0A 2XD1A 4OQHA 2V1ZA 3ZVWA 2G2WA 3ZG8B 2WGWB 3HLGA 4JPMA 4KZ6A 4KQOA 3UE1A 1ZG4A 3O3VA 4UA9A 1YLTA 4P85A 3SS5A 3Q7VB 1PW1A 4S2LA 5JYOA 3IXHA 4WEJA 4C3QA 5CHUA 1CI9A 2J9OA 4DKIA 5KSHA 2Y2JA 1MXOA 1BLCA 1DY6A 3IF6B 3HREA 2WAFA 3HUMA 4K0XA 2E8IA 3W4PA 2H5SA 2HDQA 2Y2NA 5CEDA 4HBTA 2IWBA 3DW0A 4ZBEA 4E3KA 1HTZA 3EQUA 3G32A 1NXYA 3N4IA 3UDXA 3WRZA 5F1GA 3VSKA 2QMIA 2XQZA 5DF9A 4A5RA 3M2KA 5A92A 3NIAA 4QU3A 5A90A 1AXBA 3C7UA 5E2GA 1K4FA 3N6IA 1H8ZA 4OQIA 4P0MA 2Y59A 3EQVA 2HP5A 3ZHHA 4E3NA 3UE0A 4GB7A 5E43A 4KZ9A 4GOGA 4DE0A 5KMWA 1K6RA 3LY4A 3RXWA 1N9BA 4MBFA 4JF6A 2XGNA 2PU4A 3PBNA 1FCOA 2Y2IA 1TEMA 5DTKA 4RX3A 2WGIA 1XGJA 1FR6A 3MZDA 5HFOA 4QY5A 4PM5A 1KVLA 4ID4A 4N1HA 3LEZA 5CXWA 2Y2HA 4R23A 4QY6A 5HAIA 3LO7A 3GSGA 1GA9A 2XFTA 2ZC6B 3AGEA 4U3TA 1L2SA 3UPNA 4BQMA 3SS3A 3UDFA 1I2SA 2X71A 3CZDA 3V50A 2X02A 2JE5A 4BL3A 2V2FF 2Y2QA 5TFQA 2OLVA 4RYEA 4UA6A 4LV3A 1S0WA 3FV7A 2J9PA 1LHYA 2WKHA 3MKFA 4S2JA 4IVKA 5FAQA 2WUQA 4FD8A 4QJGA 1KDWA 2R9WA 2WZXA 4EUZA 3FWLA 1H8YA 4E3LA 3MXSA 1KE4A 2XR0A 2ZM2A 3Q07A 4YFMA 5E2FA 5HAPA 1KE0A 3D4FA 4ZJ3A 5GHYA 3GQZA 4IVIA 3UE3A 3OPPA 1GA0A 5JYPA 1CEFA 4PM7A 2WKEA 3BFGA 2DRWA 2A3UA 1ALQA 1ERQA 4JXWA 1K55A 3M2JA 3RJUA 3S1YA 4WZ4A 3V5MA 1SDNA 4S2KA 1Q2QA 4JXGA 1RCJA 4LCLA 4OLDA 1YLJA 1RGYA 3AGFA 1QMFA 1PWCA 2B5RA 3HLEA 3M6HA 4N9KA 4N92A 4OQGA 4WMCA 5F82A 1YLYA 2WZZA 3HVFA 3Q82A 3PTEA 3N7WA 5FQIA 1ESUA 1K25A 4OVDA 1O7EA 4RA7A 1ES4A 1MPLA 3C4PA 5GHXA 3WWXA 4Y0TA 1QMEA 4GKUA 2Y2KA 4RX2A 3TSGA 4E3OA 3HLCA 1NZUA 2ZJ9A 2ZD8A 1BULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K55 C;  2ZQ8 A;  5FI7 A;  1IEL A;  1WYB A;  4MBK A;  5DTT A;  1MWT A;  2EFX A;  4GDB A;  4O7D A;  4OPQ A;  4ZTK A;  3WS2 A;  5FI6 A;  1BTL A;  4X53 A;  1MY8 A;  3G2Z A;  4KZ3 A;  3PBR A;  2FFF B;  2Q9N A;  3CMZ A;  3GV9 A;  4M3K A;  4X69 A;  4Y0O A;  1FCM A;  3ZG9 B;  1IEM A;  3ITB A;  1K56 D;  5DTS A;  1IYP A;  1N4O A;  4QB8 A;  1O07 A;  2VGK A;  1BLS A;  3G2Y A;  1YLP A;  5I94 A;  3IHA A;  2PU2 A;  1TDG A;  4JKT A;  1VM1 A;  2WAE A;  3NCK A;  2Q9M A;  5EVL A;  3N8S A;  1MBL A;  4R0Q A;  1E4D A;  3MFD A;  3HUN A;  5FQ9 A;  3BRM A;  5M1A A;  2FFY A;  4OOY A;  1YLW A;  3OC2 A;  5L2F A;  2VGJ A;  4B88 A;  1JTD A;  4N9L A;  3W4O A;  2ZMA A;  5GHZ A;  5G18 A;  1W79 A;  2J8Y A;  3ZNY A;  2WK0 A;  3C5A A;  3M6B A;  2HDR A;  4LV0 A;  5EVI A;  2P9V A;  1PIO A;  4MBH A;  2Y55 A;  1KDS A;  5GLB A;  5FAP A;  3V39 A;  1GCE A;  1NYM A;  3O88 A;  3VP2 A;  1LL9 A;  3VOY A;  4IBX A;  2HP6 A;  4E3J A;  4N1X A;  2HPB A;  3PAG A;  3GTC A;  5FA7 A;  4NET A;  4Z9Q A;  1Z6F A;  1KE3 A;  4R4R A;  4S2I A;  4XXR A;  4Y7P A;  5CHJ A;  2Y2O A;  1K57 A;  2ZC5 B;  1K38 A;  5KSC A;  3OPR A;  3N8R A;  1BUE A;  1PZP A;  4CJN A;  1HZO A;  4ZDX A;  2XK1 A;  5EVI C;  1M40 A;  2Y2M A;  3HLB A;  2P9V B;  3UPO A;  5E2H A;  3WS5 A;  2X01 A;  1BSG A;  1HD8 A;  1SKF A;  4OQ0 A;  1NY0 A;  1TDL A;  2XH9 A;  4LEN A;  1LLB A;  2BG1 A;  3VP1 A;  1PI5 A;  3O86 A;  4DE3 A;  3BFC A;  1K57 C;  3VP4 A;  3BFE A;  1C3B A;  5CGS A;  4JXV A;  4YIN A;  3VMA A;  4D2O A;  3NBL A;  5EOO A;  1JTG A;  2ZC4 B;  3PBO A;  4B4X A;  5DF7 A;  4XUZ A;  1XA7 A;  1W8Y A;  1LI9 A;  3AGD A;  5HX9 A;  4KG5 A;  3IF5 A;  1E3U A;  3IWO A;  3BYD A;  4EV4 A;  2JC7 A;  3HLD A;  4JLF A;  4QD4 A;  1SDE A;  1MWR A;  3GR2 A;  2ZQC A;  5F1F A;  3MBZ A;  5CEB A;  4PM6 A;  4UA7 A;  4ZAM A;  1JVJ A;  4R4S A;  1SHV A;  5F83 A;  3VOZ A;  1MWS A;  4GD8 A;  4BD1 A;  3IT9 A;  2XD5 A;  5FDH A;  3P98 A;  3QNB A;  3VSL A;  1JWP A;  4Y0U A;  1NJ4 A;  5FQQ A;  3WS1 A;  1PZO A;  1K6S A;  2GDN A;  3A3E A;  3FKV A;  2H10 A;  5FAT A;  5FQK A;  4DDS A;  5HAQ A;  2WAD A;  5A91 A;  3PBS A;  1W8Q A;  5BOH A;  4KZ4 A;  2ZQA A;  4E6X A;  4KZ5 A;  3ZVT A;  3BLM A;  3MKE A;  4IED A;  3N8L A;  4WYY A;  1FQG A;  2XEP A;  3GRJ A;  4FSF A;  4OON A;  3FYZ A;  4OPR A;  5CRF A;  1ES5 A;  1EI5 A;  3P09 A;  2OV5 A;  4K91 A;  5EUA A;  1KVM A;  4JXS A;  3A3J A;  3NI9 A;  4F94 A;  4GDN A;  4OOM A;  3G30 A;  4WEK A;  1IKG A;  4U0T A;  2WYX A;  5FI2 A;  5EOE A;  3IHB A;  2ZLY A;  1YMS A;  4X6T A;  3IXB A;  4OLG A;  3W4Q A;  1ONH A;  1KGG A;  3LY3 A;  4UAA A;  2EX8 A;  4OP8 A;  1PWD A;  4MLL A;  4DF6 A;  3O87 A;  2ZQ7 A;  3UDI A;  3S4X A;  4KZA A;  1MKI A;  4X56 A;  1DJB A;  1E3U D;  5GLC A;  1YM1 A;  1L0E A;  1ERM A;  2ZM8 A;  3A3F A;  1J9M A;  1PW8 A;  5CEC A;  3UNW A;  3MZE A;  4X55 A;  3TOI A;  2XFS A;  3NY4 A;  1YMX A;  4OOL A;  3ZNT A;  1Q2P A;  5CER A;  1G68 A;  1OME A;  3OZH A;  4K0W A;  5AQ9 A;  1ZKJ A;  1ESI A;  3QNC A;  4KG6 A;  2DNS A;  4WZ5 A;  1FCN A;  3IXD A;  1SCW A;  3S22 A;  1EWZ A;  3ZG5 A;  5A93 A;  4NK3 A;  4R1G A;  4DXB A;  1IYO A;  5E2E A;  1WYC A;  1BLP A;  3FKW A;  1XKZ A;  2I72 A;  5CHM A;  4U0X A;  3DWK A;  3QHY A;  2V20 A;  4GZB A;  2XDM A;  3VP0 A;  2BLS A;  5DVA A;  2WGW A;  4EBL A;  3WS0 A;  4IBR A;  1BT5 A;  3GMW A;  3ZCZ A;  1RGZ A;  2WGV A;  3SH9 A;  4L0L A;  1DJC A;  3Q7V A;  1S6R A;  2EXB A;  4WZ5 C;  3WS4 A;  2ZQD A;  3BLS A;  1K54 A;  1LL5 A;  4WBG A;  3PBQ A;  3SH7 A;  1TVF A;  1CK3 A;  4KG2 A;  5AQB A;  5M18 A;  3VP3 A;  1BLH A;  3CG5 A;  3IF6 A;  3HL9 A;  4WMC D;  4E3M A;  1FSY A;  3LCE A;  3B3X A;  1G6A A;  4LV1 A;  1NRF A;  3DWZ A;  4C75 A;  4QHC A;  4S2N A;  5GLD A;  5D3O A;  4BL2 A;  2G2U A;  2IWD A;  4FH2 A;  1YT4 A;  2OLU A;  3NDG A;  2Z2L B;  1GHP A;  2J7V A;  2R9X A;  3Q7Z A;  4KZ7 A;  4MNR A;  4DE1 A;  1K54 C;  1IYQ A;  2EFU A;  4BEN A;  1I2W A;  3Q1F A;  5EVI B;  3HUO A;  4HEF A;  1XXM A;  1GHI A;  1VQQ A;  2Z2M B;  4P87 A;  3IF6 C;  2H0T A;  4KQR A;  4WM9 A;  1KGE A;  2HP9 A;  4PM8 A;  3UN7 A;  4S2N C;  2Y2L A;  2EXA A;  3C7V A;  3HBR A;  4MEZ A;  4DXC A;  3I7J A;  3HLF A;  2C6W B;  3JYI A;  3PAE A;  3SS4 A;  2ZM0 A;  1NYY A;  1I5Q A;  5AQA A;  1RP5 A;  3V3S A;  3IWQ A;  2QPN A;  2Y4A A;  4DDY A;  1JWZ A;  4S2P A;  4OPZ A;  1FOF A;  4EBP A;  4BJP A;  3G4P A;  3IH8 A;  3IWI A;  2ZC7 A;  1IKI A;  5HW3 A;  1GHM A;  1HVB A;  3G35 A;  3CJM A;  5TGF A;  4DRT A;  1ES2 A;  5EPH A;  3ZG7 B;  2JBF A;  1LI0 A;  2EX9 A;  5EVI D;  3E2L A;  4HBU A;  4GNU A;  2ZQ9 A;  4PPR A;  4KEN B;  3RXX A;  3SOI A;  3V3R A;  4C6Y A;  3G31 A;  5J8X A;  2EX2 A;  4B4Z A;  4KZ8 A;  5IHV A;  4E3I A;  4JBF A;  1YLZ A;  4EBN A;  1W7F A;  3BEC A;  2QZ6 A;  2HDU A;  4HES A;  5FQJ A;  4GD6 A;  1L0G A;  5FSR A;  3HLW A;  1PI4 A;  5CTM A;  5GLA A;  4CPK A;  5EE8 A;  5M19 A;  4P6B A;  3ITA A;  5HL1 A;  3MZF A;  4E6W A;  4ZJ1 A;  2JCH A;  1K56 A;  1L0F A;  1IYS A;  3ISG A;  3OPL A;  3MXR A;  3ZDJ A;  3ZGA B;  4XUX A;  5KZH A;  4DE2 A;  4RVA A;  3BFD A;  3ZG0 A;  2A49 A;  2UWX A;  5U47 A;  2P74 A;  4GN2 A;  5CGW A;  2XF3 A;  1E25 A;  2PBY A;  3UY6 A;  5FAS A;  3W8K A;  4BLM A;  1XGI A;  3OCN A;  5DF8 A;  1CI8 A;  1YQS A;  2Y91 A;  3ZFZ A;  1XPB A;  1PWG A;  2DCF A;  1XA1 A;  3A3D A;  3NC8 A;  4OKP A;  2RL3 A;  3WRT A;  3SH8 A;  3TG9 A;  4EQI A;  2ZC3 B;  1FR1 A;  3Q81 A;  2Y2P A;  5AQ7 A;  1PYY A;  4OPY A;  1WE4 A;  1FSW A;  5CTN A;  4FCF A;  2C5W B;  5CGX A;  2HDS A;  4UHU A;  3G34 A;  1BZA A;  3BEB A;  4OH0 A;  2CC1 A;  1K4E A;  2OSU A;  3IXG A;  2WKI A;  5TR7 A;  1JWV A;  1Y54 A;  4Q8I A;  4S2M A;  5HAR A;  1U60 A;  1XP4 A;  1H5X A;  4KZB A;  4KQQ A;  1ZC2 A;  3NDE A;  4FH4 A;  4JF4 A;  4PMA A;  1XX2 A;  1DJA A;  3C4O A;  3E2K A;  3IH9 A;  4R3J A;  5FQM A;  4ZJ2 A;  1NZO A;  1ERO A;  1ES3 A;  3OCL A;  3UPP A;  3FZC A;  4LV2 A;  1L0D A;  1ZG6 A;  2Y2G A;  3PBT A;  4WEL A;  3BFF A;  5EEC A;  3DTM A;  4JF5 A;  4EWF A;  2RCX A;  4PM9 A;  1KGF A;  4R3B A;  5FAO A;  5GL9 A;  2XLN A;  1CEG A;  4H8R A;  1MWU A;  4OP5 A;  3VFH A;  3IQA A;  1ONG A;  3GVB A;  4X68 A;  2IWC A;  1M6K A;  2EX6 A;  4S2O A;  3BM6 A;  3A3I A;  3OPH A;  3UO9 A;  2H0Y A;  4LCM A;  1W5D A;  3VFF A;  4BD0 A;  2XD1 A;  4OQH A;  2V1Z A;  3ZVW A;  2G2W A;  3ZG8 B;  2WGW B;  3HLG A;  4JPM A;  4KZ6 A;  4KQO A;  3UE1 A;  1ZG4 A;  3O3V A;  4UA9 A;  1YLT A;  4P85 A;  3SS5 A;  3Q7V B;  1PW1 A;  4S2L A;  5JYO A;  3IXH A;  4WEJ A;  4C3Q A;  5CHU A;  1CI9 A;  2J9O A;  4DKI A;  5KSH A;  2Y2J A;  1MXO A;  1BLC A;  1DY6 A;  3IF6 B;  3HRE A;  2WAF A;  3HUM A;  4K0X A;  2E8I A;  3W4P A;  2H5S A;  2HDQ A;  2Y2N A;  5CED A;  4HBT A;  2IWB A;  3DW0 A;  4ZBE A;  4E3K A;  1HTZ A;  3EQU A;  3G32 A;  1NXY A;  3N4I A;  3UDX A;  3WRZ A;  5F1G A;  3VSK A;  2QMI A;  2XQZ A;  5DF9 A;  4A5R A;  3M2K A;  5A92 A;  3NIA A;  4QU3 A;  5A90 A;  1AXB A;  3C7U A;  5E2G A;  1K4F A;  3N6I A;  1H8Z A;  4OQI A;  4P0M A;  2Y59 A;  3EQV A;  2HP5 A;  3ZHH A;  4E3N A;  3UE0 A;  4GB7 A;  5E43 A;  4KZ9 A;  4GOG A;  4DE0 A;  5KMW A;  1K6R A;  3LY4 A;  3RXW A;  1N9B A;  4MBF A;  4JF6 A;  2XGN A;  2PU4 A;  3PBN A;  1FCO A;  2Y2I A;  1TEM A;  5DTK A;  4RX3 A;  2WGI A;  1XGJ A;  1FR6 A;  3MZD A;  5HFO A;  4QY5 A;  4PM5 A;  1KVL A;  4ID4 A;  4N1H A;  3LEZ A;  5CXW A;  2Y2H A;  4R23 A;  4QY6 A;  5HAI A;  3LO7 A;  3GSG A;  1GA9 A;  2XFT A;  2ZC6 B;  3AGE A;  4U3T A;  1L2S A;  3UPN A;  4BQM A;  3SS3 A;  3UDF A;  1I2S A;  2X71 A;  3CZD A;  3V50 A;  2X02 A;  2JE5 A;  4BL3 A;  2V2F F;  2Y2Q A;  5TFQ A;  2OLV A;  4RYE A;  4UA6 A;  4LV3 A;  1S0W A;  3FV7 A;  2J9P A;  1LHY A;  2WKH A;  3MKF A;  4S2J A;  4IVK A;  5FAQ A;  2WUQ A;  4FD8 A;  4QJG A;  1KDW A;  2R9W A;  2WZX A;  4EUZ A;  3FWL A;  1H8Y A;  4E3L A;  3MXS A;  1KE4 A;  2XR0 A;  2ZM2 A;  3Q07 A;  4YFM A;  5E2F A;  5HAP A;  1KE0 A;  3D4F A;  4ZJ3 A;  5GHY A;  3GQZ A;  4IVI A;  3UE3 A;  3OPP A;  1GA0 A;  5JYP A;  1CEF A;  4PM7 A;  2WKE A;  3BFG A;  2DRW A;  2A3U A;  1ALQ A;  1ERQ A;  4JXW A;  1K55 A;  3M2J A;  3RJU A;  3S1Y A;  4WZ4 A;  3V5M A;  1SDN A;  4S2K A;  1Q2Q A;  4JXG A;  1RCJ A;  4LCL A;  4OLD A;  1YLJ A;  1RGY A;  3AGF A;  1QMF A;  1PWC A;  2B5R A;  3HLE A;  3M6H A;  4N9K A;  4N92 A;  4OQG A;  4WMC A;  5F82 A;  1YLY A;  2WZZ A;  3HVF A;  3Q82 A;  3PTE A;  3N7W A;  5FQI A;  1ESU A;  1K25 A;  4OVD A;  1O7E A;  4RA7 A;  1ES4 A;  1MPL A;  3C4P A;  5GHX A;  3WWX A;  4Y0T A;  1QME A;  4GKU A;  2Y2K A;  4RX2 A;  3TSG A;  4E3O A;  3HLC A;  1NZU A;  2ZJ9 A;  2ZD8 A;  1BUL A; 
#chains in the Genus database with same CATH topology
 2ZQ8 A;  1G28 A;  1WYB A;  2JKT M;  4GDB A;  4WUJ A;  1MY8 A;  2FFF B;  1K56 D;  1IYP A;  3PHY A;  3G2Y A;  1VM1 A;  2WAE A;  1CQA A;  5EVL A;  1MBL A;  1E4D A;  3HUN A;  2FFY A;  4BMW A;  4RQ9 A;  1VEU B;  5L2F A;  4B88 A;  4N9L A;  5G18 A;  2PD7 A;  2DMW A;  3BWL A;  2HDR A;  5KIZ A;  1PIO A;  4MBH A;  5GLB A;  4EEP A;  3V39 A;  2PYR A;  3O88 A;  1LL9 A;  3KSH A;  3PAG A;  5FEG A;  3RFB A;  1PRQ A;  5LBR A;  2V1A A;  4R4R A;  4Y7P A;  4XXR A;  2Y2O A;  2HJ9 C;  3IX3 A;  1OJG A;  1K38 A;  1PZP A;  1HZO A;  5EVI C;  3T4Q A;  1XJ2 A;  5E2H A;  2X01 A;  1BSG A;  2JKG A;  3NOU C;  4OQ0 A;  1TDL A;  3BFC A;  1C3B A;  5CGS A;  4JXV A;  4YIN A;  1OTA A;  3PBO A;  4B4X A;  5DF7 A;  1N9O A;  2J3W A;  5HX9 A;  3W2Z A;  4JLF A;  3EOI A;  4QD4 A;  4F3L B;  3GR2 A;  3MBZ A;  4PM6 A;  4I39 A;  1JVJ A;  5F83 A;  4GD8 A;  4BD1 A;  4EQ1 A;  3UB8 A;  2GDN A;  3FKV A;  4ETZ A;  3TRC A;  3T4K A;  2ZQA A;  4KZ5 A;  4E04 A;  1FQG A;  2XEP A;  5HD3 A;  3QP8 A;  4CLC C;  4ESP A;  4ARZ A;  2W3F A;  3P09 A;  4NKP A;  4HNB A;  3A3J A;  3R4K A;  4X6T A;  2ZLY A;  3F1N B;  5FEF A;  5TBM B;  3LY3 A;  4OP8 A;  4MLL A;  3O87 A;  3DBA A;  4GS9 B;  1MKI A;  4X56 A;  5CEC A;  5GLC A;  1YM1 A;  1ERM A;  3MZE A;  3E4O A;  4EXO A;  3ZNT A;  3DTI A;  1FIK A;  3OZH A;  2A24 A;  3QNC A;  1ESI A;  5HPF A;  2GNX A;  3LR3 A;  1SCW A;  1EWZ A;  3T1Q B;  4NK3 A;  1IYO A;  2W27 A;  2XDM A;  3VP0 A;  5DVA A;  3BY9 A;  4EBL A;  4IBR A;  1BT5 A;  3Q7V A;  4L9E A;  3BLS A;  3LIE A;  4Y5F A;  3SH7 A;  4GW9 A;  3BW6 A;  5M18 A;  1BLH A;  1ODV A;  3IF6 A;  4WMC D;  1FSY A;  1G6A A;  4G3K A;  1NRF A;  3DWZ A;  4QHC A;  3T12 B;  2G2U A;  4I5S A;  4MDZ A;  3Q7Z A;  4MNR A;  3MJQ A;  1IYQ A;  4GHI A;  4BEN A;  1V9Y A;  3LUQ A;  2P04 A;  4DJ3 A;  4PKY G;  3UN7 A;  4MEZ A;  3HLF A;  2P08 A;  3JYI A;  3PAE A;  1NYY A;  4S2P A;  2JKR I;  3H7W A;  4NG2 A;  3IH8 A;  3LFV A;  2ZC7 A;  1IKI A;  5HW3 A;  4HHD A;  2VV6 A;  1ES2 A;  5HPI A;  2JBF A;  4XT2 A;  4I3I A;  1TD5 A;  3E2L A;  4HBU A;  3V3R A;  3G31 A;  4Z1W A;  3LR5 A;  5IHV A;  4EBN A;  2QWS A;  4HIA A;  3BEC A;  5FQJ A;  1TF1 A;  5FSR A;  5A8B A;  4P6B A;  3MZF A;  1N9L A;  1IYS A;  1X0O A;  1A0K A;  4GCZ A;  1L3L A;  4LGW A;  3NHQ A;  5KZH A;  1TS6 A;  5I5L A;  3MQO A;  3ZG0 A;  5U47 A;  1NLY A;  3UY6 A;  3W8K A;  3QP5 A;  4BLM A;  1CI8 A;  3ZFZ A;  2W1R A;  2DCF A;  3LI8 A;  2Y2P A;  1WE4 A;  5MC7 A;  5CGX A;  3P7N A;  1EW0 A;  1NWZ A;  2HDS A;  3G34 A;  1BZA A;  5L07 A;  4YOF A;  5F6A A;  4OH0 A;  4FTX A;  1MZU A;  5TR7 A;  2BTF P;  4Q8I A;  2VV7 A;  4FUW A;  1T19 A;  4S2M A;  4KZB A;  1ZC2 A;  1JNU A;  2Z6C A;  3E2K A;  3BJN A;  1ES3 A;  2Y8H A;  3FZC A;  1ZG6 A;  4WEL A;  4PM9 A;  1CEG A;  2HV1 A;  3A3I A;  2OAQ 1;  3VFF A;  2VLG A;  2G2W A;  3ZG8 B;  2WGW B;  4JPM A;  5DJT A;  1S1Y A;  1ZG4 A;  1YLT A;  4P85 A;  2O9B A;  2L1M A;  1PW1 A;  3IXH A;  4C3Q A;  5CHU A;  1CI9 A;  2Y2J A;  1DY6 A;  3QP2 A;  3JVV A;  2WAF A;  1OT9 A;  2Y2N A;  2IWB A;  4ZBE A;  4E3K A;  4YNR A;  3EQU A;  1NXY A;  3UDX A;  5DF9 A;  1GSV A;  1NRJ A;  3SZT A;  3UB5 P;  4HH3 A;  4P0M A;  4OQI A;  5F5Y A;  3ZHH A;  4E3N A;  3UE0 A;  4KUO A;  4KZ9 A;  4GOG A;  5KMW A;  1K6R A;  3LY4 A;  3RXW A;  1OT6 A;  2WGI A;  4R70 A;  1FR6 A;  4N1H A;  5CXW A;  3OLO A;  1GA9 A;  3T4J A;  3V50 A;  3LID A;  4P6Z S;  4HQA A;  4RYE A;  3D3O A;  2Q0O A;  3MKF A;  4FD8 A;  4QJG A;  3T1R A;  1KDW A;  4EUZ A;  2R78 A;  3FWL A;  3CPT A;  2WKP A;  2PAV P;  5L10 A;  5GHY A;  4KUK A;  1GA0 A;  2WKE A;  3BFG A;  2XSS A;  3S1Y A;  4WZ4 A;  1SDN A;  3EGX C;  4N9K A;  1PWC A;  2B5R A;  2WZZ A;  3Q82 A;  3MQ0 A;  3N7W A;  4RA7 A;  4OVD A;  4Y0T A;  1QME A;  2Y2K A;  4E3O A;  2ZJ9 A;  5FI7 A;  3WS2 A;  4OPQ A;  5FI6 A;  3PBR A;  4IUK A;  2Q9N A;  4M3K A;  3ZG9 B;  1FCM A;  1IEM A;  3ITB A;  3K3C A;  2V0W A;  2VGK A;  1BLS A;  5I94 A;  4JKT A;  3MFD A;  2GJ3 A;  4EET B;  3QP1 A;  2VGJ A;  1JTD A;  2ZMA A;  5GHZ A;  2Z6D A;  4MN7 A;  1TS0 A;  1D06 A;  2WK0 A;  3M6B A;  4LV0 A;  5EM1 A;  1XJ6 A;  1GCE A;  1NYM A;  3VP2 A;  3VOY A;  1XFN A;  4E3J A;  5FA7 A;  1K57 A;  4EEU A;  5KSC A;  3OPR A;  3MSH A;  2W0N A;  3U4L P;  3V67 A;  1KOU A;  3IBR A;  4K08 A;  1OTE A;  1SKF A;  5J4E A;  5J3W A;  5HSQ A;  3BFE A;  1J3W A;  1UWP X;  4IUH A;  2M1C A;  1W8Y A;  3UMD A;  4KG5 A;  3IF5 A;  5F68 A;  3E0Y A;  1SDE A;  3LGO A;  1SZV A;  3PR6 A;  5CEB A;  2NUT C;  1SHV A;  4MCW A;  4MMN A;  3D9Y A;  3QNB A;  4Y0U A;  3WS1 A;  1T1B A;  3A3E A;  5FQK A;  5HAQ A;  4JGR A;  2JKR M;  3MMH A;  4KZ4 A;  3ZVT A;  3MKE A;  1GSW A;  4OON A;  1WA9 A;  4OPR A;  5CRF A;  3ULF A;  2OV5 A;  1P9R A;  4F94 A;  4WEK A;  4BWI A;  3LIB A;  5FI2 A;  3CUE A;  3IXB A;  1YPR A;  1ONH A;  1KGG A;  2EX8 A;  3IS2 B;  4DF6 A;  2ZQ7 A;  3UDI A;  2QKP A;  4KZA A;  2G7U A;  4HY8 A;  1L0E A;  2K7S A;  1J9M A;  1PW8 A;  3F1O B;  1P9W A;  4X55 A;  3MF0 A;  3TOI A;  3NY4 A;  1YMX A;  3MS6 A;  4OOL A;  1Q2P A;  4K0W A;  5AQ9 A;  4O0P A;  1ZKJ A;  4KG6 A;  2DNS A;  3RTY A;  4WZ5 A;  3F1P A;  3ZG5 A;  5E2E A;  1WYC A;  3FKW A;  1XKZ A;  2B18 A;  5CHM A;  3K3D A;  4U0X A;  2V20 A;  1TS7 A;  3WS0 A;  4LLO B;  2E8J A;  3GMW A;  1RGZ A;  3ZCZ A;  1DJC A;  1S6R A;  3LR4 A;  4HJ6 A;  1Z09 A;  1LL5 A;  4WBG A;  4EU0 A;  3PBQ A;  1TVF A;  4KG2 A;  2W3G A;  3VP3 A;  2VV8 A;  2BAS A;  3B3X A;  4S2N A;  2LB9 A;  4AFI A;  5D3O A;  2IWD A;  4PHT A;  3NDG A;  2WKQ A;  2Z2L B;  1K54 C;  2EFU A;  1OTB A;  1XXM A;  1GHI A;  1VQQ A;  2Z2M B;  4P87 A;  5HWW A;  4PM8 A;  3LIF A;  2EXA A;  2J3T D;  4HJ3 A;  2C6W B;  1T1C A;  5AQA A;  3V3S A;  3IWQ A;  1JWZ A;  4Y13 A;  4OPZ A;  4ZRR A;  2YKH A;  2P7J A;  3IWI A;  1ACF A;  1HVB A;  3A0R A;  3CJM A;  1FIL A;  3MR0 A;  2EX9 A;  3SOI A;  4C6Y A;  5AJG A;  1IFQ A;  3HLW A;  1F98 A;  4CPK A;  5EE8 A;  3LI9 A;  4NXE A;  3ITA A;  3CIT A;  4E6W A;  2B95 A;  3VE3 A;  2JHE A;  3ISG A;  3OPL A;  3MXR A;  4XUX A;  4CLC E;  3BFD A;  2UWX A;  5CGW A;  2XF3 A;  2PBY A;  1YQS A;  2Y91 A;  3NC8 A;  4OKP A;  4ARZ B;  3Q81 A;  4G3W A;  2C5W B;  4I3J A;  2M7V A;  2CC1 A;  2KOI A;  2O9C A;  3GDI A;  3KSF A;  1Y54 A;  4HH2 A;  5HAR A;  2M7U A;  4KQQ A;  4JF4 A;  2GX5 A;  1W63 M;  1DRM A;  5FQM A;  4ZJ2 A;  2A24 B;  4LV2 A;  3E98 A;  1VHM A;  5CX7 A;  5EEC A;  4EWF A;  3HJI A;  2RCX A;  1OTI A;  1KGF A;  1UGU A;  4R3B A;  5FAO A;  4OP5 A;  3GVB A;  2IWC A;  2O0Y A;  4S2O A;  4HP4 A;  3B33 A;  3BM6 A;  1W5D A;  4BD0 A;  3ZVW A;  3UE1 A;  3ICY A;  4KQO A;  2PT7 A;  3Q7V B;  3KYQ A;  4S2L A;  4X1L A;  3GEC A;  2CMN A;  1MXO A;  3IF6 B;  1P0Z A;  3HUM A;  1G5U A;  2E8I A;  3W4P A;  2HDQ A;  4HBT A;  1ZTU A;  3WRZ A;  4GHI B;  3M2K A;  5A92 A;  5A90 A;  3C7U A;  2Y59 A;  3EQV A;  2HP5 A;  3CLO A;  4R38 A;  1N9B A;  4MBF A;  2XGN A;  3PBN A;  5DTK A;  2PR6 A;  1KVL A;  2W3E A;  3LEZ A;  2Y2H A;  4R23 A;  3GSG A;  3H7W B;  3CZD A;  5L09 A;  2OWJ A;  4Y3I A;  2V2F F;  2Y2Q A;  3T4T A;  4XT2 B;  5G4Z A;  2OLV A;  1S0W A;  2XRO A;  1LHY A;  4S2J A;  2WUQ A;  2R9W A;  3EEA A;  1H8Y A;  1ZHH B;  3RH8 B;  3MFX A;  4WF0 A;  2XR0 A;  3CAX A;  2W3D A;  3BY8 A;  4ZJ3 A;  5FL3 A;  4IVI A;  3UE3 A;  1CEF A;  4PM7 A;  2A3U A;  1ERQ A;  1PNE A;  2JKT I;  2VZW A;  3M2J A;  3C2W A;  2WKR A;  4JXG A;  1YLJ A;  5F82 A;  1OPX A;  1YLY A;  3QP4 A;  2D02 A;  5FQI A;  4HI4 A;  1K25 A;  1LT0 A;  3OBF A;  3C4P A;  1BUL A;  1K55 C;  4MBK A;  4ZTK A;  1MWT A;  2EFX A;  4O7D A;  1BTL A;  4X53 A;  3CHW P;  4KZ3 A;  3GV9 A;  4WL9 A;  5DTS A;  1O07 A;  5EV0 A;  2PU2 A;  1TDG A;  4Y15 A;  3LYX A;  2MJ6 A;  3BRM A;  5AVF A;  4ETX A;  1P97 A;  3IBJ A;  1W79 A;  3IX8 A;  3ZNY A;  4JGO A;  3C5A A;  5EVI A;  4WLA A;  2Y55 A;  1KDS A;  1N9N A;  1YAX A;  1F2K A;  2HP6 A;  4IBX A;  3TJZ C;  2HPB A;  3S7O A;  4HP9 A;  4Z9Q A;  1Z6F A;  1KE3 A;  4S2I A;  2HJE A;  1D1J A;  2UV0 E;  2ZC5 B;  1BUE A;  2O9A A;  1TS8 A;  4CJN A;  4DMZ A;  4ZDX A;  3NOP C;  2XK1 A;  4H6J A;  1M40 A;  1VET A;  2Y2M A;  3KX0 X;  5TJJ A;  3HLB A;  3WS5 A;  3C8C A;  1NY0 A;  3IX4 A;  4LEN A;  2PR5 A;  3VP1 A;  1PI5 A;  3VP4 A;  3S7Q A;  3VMA A;  4D2O A;  1JTG A;  2ZC4 B;  3HJK A;  1XA7 A;  1LI9 A;  3K2N A;  3VV4 A;  3T4S A;  2KLI A;  2I9V A;  4UA7 A;  5HDC A;  4R4S A;  1MWS A;  4CLC A;  4IJG A;  5J7E A;  1Y4O A;  3IT9 A;  1PFL A;  2XD5 A;  5FDH A;  3P98 A;  3VSL A;  1JWP A;  1NJ4 A;  5FQQ A;  4DDS A;  5FAT A;  3UE6 A;  5A91 A;  3OOV A;  2JKF A;  3PBS A;  4E6X A;  3KO6 A;  4JGP A;  3BLM A;  3L9K A;  3LEQ A;  4WYY A;  3L7H A;  3GRJ A;  3C30 A;  1EI5 A;  4K91 A;  5EUA A;  4GDN A;  4OOM A;  4U0T A;  2NUP C;  5EOE A;  3IHB A;  3CPT B;  1YMS A;  3W4Q A;  3S4X A;  1BYW A;  1DJB A;  1E3U D;  3UNW A;  1DP9 A;  5DKL A;  2XFS A;  1STZ A;  5CER A;  1OME A;  4BBV A;  1FCN A;  3IXD A;  3S22 A;  5A93 A;  2OAP 1;  4R1G A;  4X1M A;  1BLP A;  2I72 A;  3DWK A;  3QHY A;  4GZB A;  3H82 A;  4UQI S;  3SH9 A;  4DJ2 A;  4L0L A;  3WS4 A;  2EXB A;  1AWI A;  2ZQD A;  4O01 A;  3CG5 A;  4EUV A;  4C75 A;  2ZBB A;  3DTE A;  4UEY A;  4BL2 A;  4KZ7 A;  4LRY C;  5IS1 A;  4PAU A;  1I2W A;  3EWK A;  3Q1F A;  2V8C A;  3HUO A;  3IF6 C;  2H0T A;  4WM9 A;  2HP9 A;  2Y2L A;  3HBR A;  4DXC A;  3I7J A;  1XJ3 A;  3KSI A;  3MXQ A;  1RP5 A;  2EA9 A;  2QPN A;  5DFY A;  2Y4A A;  1F9I A;  2QJ7 A;  1V9Z A;  2HF6 A;  3KYZ A;  4BJP A;  1SKO A;  5TGF A;  4DRT A;  2W1T A;  3ZG7 B;  5EVI D;  2ZL1 A;  4KEN B;  2J80 A;  2EX2 A;  4B4Z A;  4KZ8 A;  4E3I A;  4JBF A;  1YLZ A;  1W7F A;  3TW8 A;  4GD6 A;  1CF0 A;  1Y28 A;  4UQI M;  3ZYT A;  4HJ4 A;  5CTM A;  4LPZ A;  5GLA A;  5M19 A;  5HL1 A;  4ZJ1 A;  5DFX A;  2VX8 A;  1L0F A;  5HDS A;  1S67 L;  5HWV A;  4LRX C;  4DE2 A;  4RVA A;  3C38 A;  2A49 A;  4GN2 A;  5G4Y A;  1E25 A;  4FOF A;  3U2A A;  3D72 A;  5EM0 A;  3WRT A;  2VA0 A;  3TG9 A;  3LIA A;  3T4O A;  4EER A;  5AQ7 A;  4R6L A;  2OOL A;  5CTN A;  4FCF A;  2AVX A;  4CLC D;  2LB5 A;  4B9O A;  1W63 Q;  3T1S A;  2PRF A;  4NXG A;  2WKI A;  1JWV A;  2VGL S;  1T1A A;  3UB9 A;  1VEU A;  1XP4 A;  1H5X A;  3LIC A;  2ZMF A;  5L8M A;  1XX2 A;  2VEA A;  1DJA A;  3C4O A;  3IH9 A;  2ZOI A;  3G6O A;  3MQQ A;  5IU1 A;  3UME A;  3F1P B;  3DTM A;  4JF5 A;  5GL9 A;  3VFH A;  2XLN A;  1MWU A;  4X68 A;  2EX6 A;  1H8M A;  4LCM A;  2OWH A;  2XD1 A;  4OQH A;  2V1Z A;  1GSX A;  3HLG A;  4UA9 A;  4GLQ A;  5JYO A;  3EEH A;  4WEJ A;  2J9O A;  4DKI A;  4Y2F A;  3NOT C;  3T1X A;  3HRE A;  2H5S A;  2V1B A;  5EFW A;  4D60 A;  1HTZ A;  3G32 A;  3N4I A;  1VB6 A;  5F1G A;  4NXB A;  2XQZ A;  3VE4 A;  1H0M A;  4F3L A;  3NIA A;  4QU3 A;  2V8F A;  1AXB A;  3PYP A;  1H8Z A;  3NJA A;  4GB7 A;  5E43 A;  3DAV A;  2VGL M;  4R3A A;  4JF6 A;  2PU4 A;  4LFU A;  1TEM A;  1XGJ A;  3MZD A;  2V9A A;  4ID4 A;  4EES A;  4QY6 A;  3LO7 A;  3AGE A;  4U3T A;  1L2S A;  4BQM A;  3LR0 A;  3SS3 A;  2X71 A;  2X02 A;  4BL3 A;  4NXF A;  4UA6 A;  4LV3 A;  2XA7 S;  3FV7 A;  4BBT A;  2J9P A;  2HZ5 A;  4IVK A;  4E3L A;  3MXS A;  1KE4 A;  2GZA A;  3F1N A;  5TBM A;  3HCY A;  3Q07 A;  4YFM A;  4G3V A;  1KE0 A;  2VKS A;  3H9W A;  3GQZ A;  4GS9 A;  3OPP A;  5JYP A;  2W3H A;  4M4X A;  4O8G A;  4MN6 A;  4YWZ A;  4JXW A;  3V5M A;  1S1Z A;  4S2K A;  1RCJ A;  3AGF A;  5GLD A;  3HVF A;  3PTE A;  1NLZ A;  1ESU A;  5HD5 A;  3WWX A;  2Y79 A;  4RX2 A;  1NZU A;  4WN5 A;  1IEL A;  4Q0J A;  5DTT A;  2JN7 A;  3G2Z A;  3CMZ A;  4X69 A;  4Y0O A;  1N4O A;  4QB8 A;  1YLP A;  3IHA A;  2FH5 A;  3NCK A;  2Q9M A;  3N8S A;  4R0Q A;  5FQ9 A;  3T50 A;  1F5M A;  5M1A A;  4OOY A;  3S7P A;  1YLW A;  3EGD C;  3OC2 A;  1IOU A;  5EVE A;  3JVU A;  3W4O A;  3UB7 A;  2J8Y A;  2XA7 M;  2A2L A;  3B47 A;  5HWT A;  3T4L A;  2P9V A;  2J3T C;  3O5Y A;  5FAP A;  4LRZ E;  4N1X A;  3GTC A;  4NET A;  3TE8 A;  5CHJ A;  2PHY A;  3N8R A;  4II7 A;  4DN0 A;  3SW1 A;  4MN5 A;  2P9V B;  3UPO A;  1HD8 A;  5DKK A;  4CQH A;  2XH9 A;  1LLB A;  2BG1 A;  4DE3 A;  3O86 A;  1K57 C;  3DTK A;  2ZOH A;  3NBL A;  4GJ4 A;  4HOI A;  5EOO A;  4XUZ A;  3AGD A;  3IWO A;  1E3U A;  3NUL A;  3BYD A;  4EV4 A;  2JC7 A;  3HLD A;  1MWR A;  2ZQC A;  5F1F A;  1CJF A;  2KDK A;  2PYP A;  4ZAM A;  3VOZ A;  3BQ8 A;  1LSV A;  5AVE A;  1PZO A;  1K6S A;  2H10 A;  2WAD A;  1W8Q A;  1H3Q A;  5BOH A;  3FG8 A;  4IED A;  3N8L A;  4FSF A;  4ME4 A;  3FYZ A;  1ES5 A;  1LSW A;  1KVM A;  4JXS A;  3NI9 A;  2D01 A;  3G30 A;  1IKG A;  2WYX A;  1MKM A;  4OLG A;  3KSG A;  2HGV A;  4UAA A;  1PWD A;  2PDR A;  1S4S A;  2ZM8 A;  3A3F A;  1LSX A;  1G68 A;  2ZMV A;  1S4R A;  1OJ5 A;  5C5K A;  1XJ4 A;  2FZ0 A;  3CUE C;  4DXB A;  5K5B A;  4KQD A;  2BLS A;  2WGW A;  2WGV A;  4X25 A;  2PBD P;  2VK3 A;  4WZ5 C;  1K54 A;  2QJ5 A;  4JGQ A;  1CK3 A;  1YSP A;  4I38 A;  5AQB A;  5DJU A;  2H28 A;  3HL9 A;  3BQA A;  4E3M A;  3LCE A;  4LV1 A;  1UWN X;  4FH2 A;  1YT4 A;  2OLU A;  4NEE D;  1GHP A;  2J7V A;  2R9X A;  4DE1 A;  1T18 A;  5EVI B;  4HEF A;  4L9G A;  3E4Q A;  2O99 A;  4KQR A;  1KGE A;  4S2N C;  1YKD A;  3C7V A;  3SS4 A;  1D7E A;  2ZM0 A;  1I5Q A;  4QPR A;  4DDY A;  4H6J B;  1FOF A;  1K0K A;  4EBP A;  1VET B;  3G4P A;  4Y17 A;  1GHM A;  3G35 A;  5EPH A;  5IT5 A;  1LI0 A;  5FDS A;  4PPR A;  4GNU A;  2V0U A;  2ZQ9 A;  3RXX A;  5J8X A;  1XFQ A;  2B02 A;  3ZQ5 A;  2QZ6 A;  2HDU A;  4HES A;  1L0G A;  1PI4 A;  2XRN A;  3A0S A;  2JCH A;  3R7W A;  1K56 A;  4CLC B;  3ZDJ A;  3ZGA B;  2L0W A;  1MC0 A;  2P74 A;  2YKF A;  2K2N A;  5FAS A;  4B93 A;  1XGI A;  3OCN A;  5DF8 A;  5F69 A;  1XPB A;  1PWG A;  1XA1 A;  3A3D A;  2VJW A;  1S66 L;  2RL3 A;  3R7W B;  3SH8 A;  4EQI A;  2ZC3 B;  1FR1 A;  4QWO A;  1PYY A;  4OPY A;  1FSW A;  4IHQ A;  4UHU A;  3BEB A;  5HDD A;  2ACG A;  3QP6 A;  1K4E A;  2OSU A;  3PXP A;  3IXG A;  3E4P A;  2INW A;  3VOL A;  1U60 A;  3NDE A;  3NEC A;  4FH4 A;  4PMA A;  4R3J A;  1OTD A;  2QYB A;  1NZO A;  3UB6 A;  1ERO A;  3OCL A;  3UPP A;  1L0D A;  5HL6 A;  2Y2G A;  3PBT A;  3BFF A;  2L4R A;  4PKY A;  4I3A A;  4H8R A;  3IQA A;  1ONG A;  1M6K A;  3UO9 A;  3OPH A;  2H0Y A;  3H82 B;  4P6Z M;  4KZ6 A;  3O3V A;  3SS5 A;  5HZH A;  5KSH A;  1BLC A;  4K0X A;  3B42 A;  1G6O A;  5CED A;  3DW0 A;  3FPV A;  1LL8 A;  3VSK A;  2QMI A;  4A5R A;  3CWF A;  5E2G A;  3KYE A;  1K4F A;  3JPU A;  3N6I A;  4DE0 A;  4EW7 A;  1FCO A;  2Y2I A;  4RX3 A;  4Q0H A;  3P01 A;  5HFO A;  4PM5 A;  4QY5 A;  2KX6 A;  2PD8 A;  2EWW A;  2K31 A;  1YSQ A;  3A0V A;  5HAI A;  2XFT A;  2ZC6 B;  3UPN A;  3UDF A;  1I2S A;  1SKO B;  2JE5 A;  2W1T B;  3CI6 A;  5TFQ A;  3FC7 A;  2ZL1 B;  2WKH A;  4L9F A;  5FAQ A;  2WZX A;  1HLU P;  2ZM2 A;  4BBU A;  5E2F A;  5HAP A;  3IS2 A;  3D4F A;  2DRW A;  2EWV A;  1ALQ A;  3F1O A;  1K55 A;  3RJU A;  4Q0I A;  1Q2Q A;  2IA2 A;  4LCL A;  4OLD A;  1RGY A;  3HLE A;  1QMF A;  4OQG A;  4N92 A;  3M6H A;  4WMC A;  3S7N A;  1O7E A;  3FPW A;  1ES4 A;  1MPL A;  1DP8 A;  2QHK A;  5GHX A;  4GKU A;  3TSG A;  3HLC A;  1DP6 A;  2ZD8 A; 
#chains in the Genus database with same CATH homology
 1K55 C;  2ZQ8 A;  5FI7 A;  1IEL A;  1WYB A;  4MBK A;  5DTT A;  1MWT A;  2EFX A;  4GDB A;  4O7D A;  4OPQ A;  4ZTK A;  3WS2 A;  5FI6 A;  1BTL A;  4X53 A;  1MY8 A;  3G2Z A;  4KZ3 A;  3PBR A;  2FFF B;  2Q9N A;  3CMZ A;  3GV9 A;  4M3K A;  4X69 A;  4Y0O A;  1FCM A;  3ZG9 B;  1IEM A;  3ITB A;  1K56 D;  5DTS A;  1IYP A;  1N4O A;  4QB8 A;  1O07 A;  2VGK A;  1BLS A;  3G2Y A;  1YLP A;  5I94 A;  3IHA A;  2PU2 A;  1TDG A;  4JKT A;  1VM1 A;  2WAE A;  3NCK A;  2Q9M A;  5EVL A;  3N8S A;  1MBL A;  4R0Q A;  1E4D A;  3MFD A;  3HUN A;  5FQ9 A;  3BRM A;  5M1A A;  2FFY A;  4OOY A;  1YLW A;  3OC2 A;  5L2F A;  2VGJ A;  4B88 A;  1JTD A;  4N9L A;  3W4O A;  2ZMA A;  5GHZ A;  5G18 A;  1W79 A;  2J8Y A;  3ZNY A;  2WK0 A;  3C5A A;  3M6B A;  2HDR A;  4LV0 A;  5EVI A;  2P9V A;  1PIO A;  4MBH A;  2Y55 A;  1KDS A;  5GLB A;  5FAP A;  3V39 A;  1GCE A;  1NYM A;  3O88 A;  3VP2 A;  1LL9 A;  3VOY A;  4IBX A;  2HP6 A;  4E3J A;  4N1X A;  2HPB A;  3PAG A;  3GTC A;  5FA7 A;  4NET A;  4Z9Q A;  1Z6F A;  1KE3 A;  4R4R A;  4S2I A;  4XXR A;  4Y7P A;  5CHJ A;  2Y2O A;  1K57 A;  2ZC5 B;  1K38 A;  5KSC A;  3OPR A;  3N8R A;  1BUE A;  1PZP A;  4CJN A;  1HZO A;  4ZDX A;  2XK1 A;  5EVI C;  1M40 A;  2Y2M A;  3HLB A;  2P9V B;  3UPO A;  5E2H A;  3WS5 A;  2X01 A;  1BSG A;  1HD8 A;  1SKF A;  4OQ0 A;  1NY0 A;  1TDL A;  2XH9 A;  4LEN A;  1LLB A;  2BG1 A;  3VP1 A;  1PI5 A;  3O86 A;  4DE3 A;  3BFC A;  1K57 C;  3VP4 A;  3BFE A;  1C3B A;  5CGS A;  4JXV A;  4YIN A;  3VMA A;  4D2O A;  3NBL A;  5EOO A;  1JTG A;  2ZC4 B;  3PBO A;  4B4X A;  5DF7 A;  4XUZ A;  1XA7 A;  1W8Y A;  1LI9 A;  3AGD A;  5HX9 A;  4KG5 A;  3IF5 A;  1E3U A;  3IWO A;  3BYD A;  4EV4 A;  2JC7 A;  3HLD A;  4JLF A;  4QD4 A;  1SDE A;  1MWR A;  3GR2 A;  2ZQC A;  5F1F A;  3MBZ A;  5CEB A;  4PM6 A;  4UA7 A;  4ZAM A;  1JVJ A;  4R4S A;  1SHV A;  5F83 A;  3VOZ A;  1MWS A;  4GD8 A;  4BD1 A;  3IT9 A;  2XD5 A;  5FDH A;  3P98 A;  3QNB A;  3VSL A;  1JWP A;  4Y0U A;  1NJ4 A;  5FQQ A;  3WS1 A;  1PZO A;  1K6S A;  2GDN A;  3A3E A;  3FKV A;  2H10 A;  5FAT A;  5FQK A;  4DDS A;  5HAQ A;  2WAD A;  5A91 A;  3PBS A;  1W8Q A;  5BOH A;  4KZ4 A;  2ZQA A;  4E6X A;  4KZ5 A;  3ZVT A;  3BLM A;  3MKE A;  4IED A;  3N8L A;  4WYY A;  1FQG A;  2XEP A;  3GRJ A;  4FSF A;  4OON A;  3FYZ A;  4OPR A;  5CRF A;  1ES5 A;  1EI5 A;  3P09 A;  2OV5 A;  4K91 A;  5EUA A;  1KVM A;  4JXS A;  3A3J A;  3NI9 A;  4F94 A;  4GDN A;  4OOM A;  3G30 A;  4WEK A;  1IKG A;  4U0T A;  2WYX A;  5FI2 A;  5EOE A;  3IHB A;  2ZLY A;  1YMS A;  4X6T A;  3IXB A;  4OLG A;  3W4Q A;  1ONH A;  1KGG A;  3LY3 A;  4UAA A;  2EX8 A;  4OP8 A;  1PWD A;  4MLL A;  4DF6 A;  3O87 A;  2ZQ7 A;  3UDI A;  3S4X A;  4KZA A;  1MKI A;  4X56 A;  1DJB A;  1E3U D;  5GLC A;  1YM1 A;  1L0E A;  1ERM A;  2ZM8 A;  3A3F A;  1J9M A;  1PW8 A;  5CEC A;  3UNW A;  3MZE A;  4X55 A;  3TOI A;  2XFS A;  3NY4 A;  1YMX A;  4OOL A;  3ZNT A;  1Q2P A;  5CER A;  1G68 A;  1OME A;  3OZH A;  4K0W A;  5AQ9 A;  1ZKJ A;  1ESI A;  3QNC A;  4KG6 A;  2DNS A;  4WZ5 A;  1FCN A;  3IXD A;  1SCW A;  3S22 A;  1EWZ A;  3ZG5 A;  5A93 A;  4NK3 A;  4R1G A;  4DXB A;  1IYO A;  5E2E A;  1WYC A;  1BLP A;  3FKW A;  1XKZ A;  2I72 A;  5CHM A;  4U0X A;  3DWK A;  3QHY A;  2V20 A;  4GZB A;  2XDM A;  3VP0 A;  2BLS A;  5DVA A;  2WGW A;  4EBL A;  3WS0 A;  4IBR A;  1BT5 A;  3GMW A;  3ZCZ A;  1RGZ A;  2WGV A;  3SH9 A;  4L0L A;  1DJC A;  3Q7V A;  1S6R A;  2EXB A;  4WZ5 C;  3WS4 A;  2ZQD A;  3BLS A;  1K54 A;  1LL5 A;  4WBG A;  3PBQ A;  3SH7 A;  1TVF A;  1CK3 A;  4KG2 A;  5AQB A;  5M18 A;  3VP3 A;  1BLH A;  3CG5 A;  3IF6 A;  3HL9 A;  4WMC D;  4E3M A;  1FSY A;  3LCE A;  3B3X A;  1G6A A;  4LV1 A;  1NRF A;  3DWZ A;  4C75 A;  4QHC A;  4S2N A;  5GLD A;  5D3O A;  4BL2 A;  2G2U A;  2IWD A;  4FH2 A;  1YT4 A;  2OLU A;  3NDG A;  2Z2L B;  1GHP A;  2J7V A;  2R9X A;  3Q7Z A;  4KZ7 A;  4MNR A;  4DE1 A;  1K54 C;  1IYQ A;  2EFU A;  4BEN A;  1I2W A;  3Q1F A;  5EVI B;  3HUO A;  4HEF A;  1XXM A;  1GHI A;  1VQQ A;  2Z2M B;  4P87 A;  3IF6 C;  2H0T A;  4KQR A;  4WM9 A;  1KGE A;  2HP9 A;  4PM8 A;  3UN7 A;  4S2N C;  2Y2L A;  2EXA A;  3C7V A;  3HBR A;  4MEZ A;  4DXC A;  3I7J A;  3HLF A;  2C6W B;  3JYI A;  3PAE A;  3SS4 A;  2ZM0 A;  1NYY A;  1I5Q A;  5AQA A;  1RP5 A;  3V3S A;  3IWQ A;  2QPN A;  2Y4A A;  4DDY A;  1JWZ A;  4S2P A;  4OPZ A;  1FOF A;  4EBP A;  4BJP A;  3G4P A;  3IH8 A;  3IWI A;  2ZC7 A;  1IKI A;  5HW3 A;  1GHM A;  1HVB A;  3G35 A;  3CJM A;  5TGF A;  4DRT A;  1ES2 A;  5EPH A;  3ZG7 B;  2JBF A;  1LI0 A;  2EX9 A;  5EVI D;  3E2L A;  4HBU A;  4GNU A;  2ZQ9 A;  4PPR A;  4KEN B;  3RXX A;  3SOI A;  3V3R A;  4C6Y A;  3G31 A;  5J8X A;  2EX2 A;  4B4Z A;  4KZ8 A;  5IHV A;  4E3I A;  4JBF A;  1YLZ A;  4EBN A;  1W7F A;  3BEC A;  2QZ6 A;  2HDU A;  4HES A;  5FQJ A;  4GD6 A;  1L0G A;  5FSR A;  3HLW A;  1PI4 A;  5CTM A;  5GLA A;  4CPK A;  5EE8 A;  5M19 A;  4P6B A;  3ITA A;  5HL1 A;  3MZF A;  4E6W A;  4ZJ1 A;  2JCH A;  1K56 A;  1L0F A;  1IYS A;  3ISG A;  3OPL A;  3MXR A;  3ZDJ A;  3ZGA B;  4XUX A;  5KZH A;  4DE2 A;  4RVA A;  3BFD A;  3ZG0 A;  2A49 A;  2UWX A;  5U47 A;  2P74 A;  4GN2 A;  5CGW A;  2XF3 A;  1E25 A;  2PBY A;  3UY6 A;  5FAS A;  3W8K A;  4BLM A;  1XGI A;  3OCN A;  5DF8 A;  1CI8 A;  1YQS A;  2Y91 A;  3ZFZ A;  1XPB A;  1PWG A;  2DCF A;  1XA1 A;  3A3D A;  3NC8 A;  4OKP A;  2RL3 A;  3WRT A;  3SH8 A;  3TG9 A;  4EQI A;  2ZC3 B;  1FR1 A;  3Q81 A;  2Y2P A;  5AQ7 A;  1PYY A;  4OPY A;  1WE4 A;  1FSW A;  5CTN A;  4FCF A;  2C5W B;  5CGX A;  2HDS A;  4UHU A;  3G34 A;  1BZA A;  3BEB A;  4OH0 A;  2CC1 A;  1K4E A;  2OSU A;  3IXG A;  2WKI A;  5TR7 A;  1JWV A;  1Y54 A;  4Q8I A;  4S2M A;  5HAR A;  1U60 A;  1XP4 A;  1H5X A;  4KZB A;  4KQQ A;  1ZC2 A;  3NDE A;  4FH4 A;  4JF4 A;  4PMA A;  1XX2 A;  1DJA A;  3C4O A;  3E2K A;  3IH9 A;  4R3J A;  5FQM A;  4ZJ2 A;  1NZO A;  1ERO A;  1ES3 A;  3OCL A;  3UPP A;  3FZC A;  4LV2 A;  1L0D A;  1ZG6 A;  2Y2G A;  3PBT A;  4WEL A;  3BFF A;  5EEC A;  3DTM A;  4JF5 A;  4EWF A;  2RCX A;  4PM9 A;  1KGF A;  4R3B A;  5FAO A;  5GL9 A;  2XLN A;  1CEG A;  4H8R A;  1MWU A;  4OP5 A;  3VFH A;  3IQA A;  1ONG A;  3GVB A;  4X68 A;  2IWC A;  1M6K A;  2EX6 A;  4S2O A;  3BM6 A;  3A3I A;  3OPH A;  3UO9 A;  2H0Y A;  4LCM A;  1W5D A;  3VFF A;  4BD0 A;  2XD1 A;  4OQH A;  2V1Z A;  3ZVW A;  2G2W A;  3ZG8 B;  2WGW B;  3HLG A;  4JPM A;  4KZ6 A;  4KQO A;  3UE1 A;  1ZG4 A;  3O3V A;  4UA9 A;  1YLT A;  4P85 A;  3SS5 A;  3Q7V B;  1PW1 A;  4S2L A;  5JYO A;  3IXH A;  4WEJ A;  4C3Q A;  5CHU A;  1CI9 A;  2J9O A;  4DKI A;  5KSH A;  2Y2J A;  1MXO A;  1BLC A;  1DY6 A;  3IF6 B;  3HRE A;  2WAF A;  3HUM A;  4K0X A;  2E8I A;  3W4P A;  2H5S A;  2HDQ A;  2Y2N A;  5CED A;  4HBT A;  2IWB A;  3DW0 A;  4ZBE A;  4E3K A;  1HTZ A;  3EQU A;  3G32 A;  1NXY A;  3N4I A;  3UDX A;  3WRZ A;  5F1G A;  3VSK A;  2QMI A;  2XQZ A;  5DF9 A;  4A5R A;  3M2K A;  5A92 A;  3NIA A;  4QU3 A;  5A90 A;  1AXB A;  3C7U A;  5E2G A;  1K4F A;  3N6I A;  1H8Z A;  4OQI A;  4P0M A;  2Y59 A;  3EQV A;  2HP5 A;  3ZHH A;  4E3N A;  3UE0 A;  4GB7 A;  5E43 A;  4KZ9 A;  4GOG A;  4DE0 A;  5KMW A;  1K6R A;  3LY4 A;  3RXW A;  1N9B A;  4MBF A;  4JF6 A;  2XGN A;  2PU4 A;  3PBN A;  1FCO A;  2Y2I A;  1TEM A;  5DTK A;  4RX3 A;  2WGI A;  1XGJ A;  1FR6 A;  3MZD A;  5HFO A;  4QY5 A;  4PM5 A;  1KVL A;  4ID4 A;  4N1H A;  3LEZ A;  5CXW A;  2Y2H A;  4R23 A;  4QY6 A;  5HAI A;  3LO7 A;  3GSG A;  1GA9 A;  2XFT A;  2ZC6 B;  3AGE A;  4U3T A;  1L2S A;  3UPN A;  4BQM A;  3SS3 A;  3UDF A;  1I2S A;  2X71 A;  3CZD A;  3V50 A;  2X02 A;  2JE5 A;  4BL3 A;  2V2F F;  2Y2Q A;  5TFQ A;  2OLV A;  4RYE A;  4UA6 A;  4LV3 A;  1S0W A;  3FV7 A;  2J9P A;  1LHY A;  2WKH A;  3MKF A;  4S2J A;  4IVK A;  5FAQ A;  2WUQ A;  4FD8 A;  4QJG A;  1KDW A;  2R9W A;  2WZX A;  4EUZ A;  3FWL A;  1H8Y A;  4E3L A;  3MXS A;  1KE4 A;  2XR0 A;  2ZM2 A;  3Q07 A;  4YFM A;  5E2F A;  5HAP A;  1KE0 A;  3D4F A;  4ZJ3 A;  5GHY A;  3GQZ A;  4IVI A;  3UE3 A;  3OPP A;  1GA0 A;  5JYP A;  1CEF A;  4PM7 A;  2WKE A;  3BFG A;  2DRW A;  2A3U A;  1ALQ A;  1ERQ A;  4JXW A;  1K55 A;  3M2J A;  3RJU A;  3S1Y A;  4WZ4 A;  3V5M A;  1SDN A;  4S2K A;  1Q2Q A;  4JXG A;  1RCJ A;  4LCL A;  4OLD A;  1YLJ A;  1RGY A;  3AGF A;  1QMF A;  1PWC A;  2B5R A;  3HLE A;  3M6H A;  4N9K A;  4N92 A;  4OQG A;  4WMC A;  5F82 A;  1YLY A;  2WZZ A;  3HVF A;  3Q82 A;  3PTE A;  3N7W A;  5FQI A;  1ESU A;  1K25 A;  4OVD A;  1O7E A;  4RA7 A;  1ES4 A;  1MPL A;  3C4P A;  5GHX A;  3WWX A;  4Y0T A;  1QME A;  4GKU A;  2Y2K A;  4RX2 A;  3TSG A;  4E3O A;  3HLC A;  1NZU A;  2ZJ9 A;  2ZD8 A;  1BUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...