4OLDA

Crystal structure of ampc beta-lactamase in complex with the product form of (6r,7r)-7-amino-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate deconstruction and the nonadditivity of enzyme recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 122
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oldA00
1L0FA 1XPBA 3VOZA 1K54A 1XXMA 5KMWA 2H10A 1SCWA 1JWVA 5EUAA 3G32A 3D4FA 3GQZA 4Y7PA 5HX9A 4UA6A 3ISGA 4H8RA 4KZ3A 5FQ9A 4C75A 2HDQA 5FI6A 2B5RA 1YT4A 3UN7A 4R4RA 4E3OA 4DE2A 2DNSA 2HDRA 3UDXA 5DTTA 3RXWA 2JC7A 3G34A 1IKGA 3C7UA 4PM7A 5FAQA 3RXXA 2R9WA 1FR6A 4JKTA 2Y2HA 4ZAMA 4GOGA 4UA9A 2ZQ7A 1JWZA 5F82A 3M2JA 4C3QA 1RGZA 2JE5A 3BRMA 5CHJA 4WEKA 3FV7A 4MBKA 2OLUA 2Y2OA 1E25A 5EOOA 5FA7A 5FQQA 1LLBA 5E2EA 3VMAA 1N9BA 1MWRA 3BFDA 4QU3A 1Q2PA 2Y55A 1ZG6A 4NK3A 1PWCA 3ZHHA 2ZM0A 5FQIA 1YQSA 1CEGA 3PBSA 4XUZA 4JXVA 4JLFA 4BENA 1YMSA 1S6RA 5CERA 3TG9A 1K55C 3IWIA 1IYQA 5DTSA 4DKIA 5DF9A 1RCJA 4OOLA 3P98A 1PWGA 5FDHA 2QMIA 2BLSA 1H8ZA 3M6BA 3AGFA 4U0XA 3A3EA 5TFQA 2EFUA 3WS0A 3V50A 1O7EA 3I7JA 4IBXA 1K57A 4XUXA 3IF5A 2XR0A 1ES2A 1FCOA 4WBGA 5AQ7A 4L0LA 1L0GA 3WRTA 2J7VA 4OVDA 3NDEA 2IWBA 3EQUA 3UDIA 3SH7A 5TGFA 3ZFZA 1W5DA 1ES3A 4MEZA 1PZOA 3W8KA 4S2OA 1VM1A 1W7FA 3UE0A 2ZQ9A 4MBHA 4DDSA 2PBYA 3ZGAB 2XK1A 2WGIA 1CK3A 3G2YA 4N1XA 5FQMA 3MKFA 4S2MA 4IVIA 3VP3A 3VSLA 2WUQA 4ID4A 2WAEA 1SDEA 1XGJA 4PPRA 5EPHA 3ITAA 2HPBA 5F1GA 3UY6A 4E6WA 3NC8A 4UA7A 1IYPA 4R1GA 1MBLA 4YINA 1M40A 1FQGA 1NXYA 1IKIA 2ZJ9A 1YLYA 5HFOA 3VFFA 4Y0UA 4BL2A 1HVBA 2Y2QA 3A3JA 2Y2GA 1Z6FA 1K55A 1C3BA 5A90A 1XKZA 2CC1A 5U47A 3O88A 1MKIA 5AQBA 2EXBA 3NI9A 1MPLA 2ZC3B 2C5WB 3OC2A 3BFGA 1WE4A 4QJGA 3UPOA 3P09A 2A49A 2QZ6A 4DE1A 4KQQA 5GLCA 4WELA 4E3IA 1GA9A 2OSUA 4JBFA 1MWSA 2XEPA 1PIOA 3OPPA 3HLGA 5CGWA 4EBLA 3OCNA 1W8YA 3PBQA 3ZG0A 2VGJA 4X53A 3A3IA 1CEFA 1XA1A 3QHYA 4EUZA 3ZG7B 2Y2LA 2EX2A 2Y2PA 4OPQA 1PWDA 4EBNA 4R23A 2HDUA 4FH2A 1OMEA 3IF6B 3Q7ZA 2FFFB 2J8YA 4R3BA 2WZXA 1O07A 2XD1A 5CHUA 1KGEA 3Q07A 2E8IA 2ZC4B 2ZM8A 3A3FA 4X6TA 3SH9A 4BD1A 4DXBA 5HAIA 4B4ZA 1KDWA 1K54C 5KZHA 3Q81A 2ZC6B 3BECA 4N9KA 1PZPA 2JBFA 2A3UA 2Z2MB 1WYBA 1SKFA 2Y91A 3BEBA 3AGDA 5KSHA 3S4XA 1MWTA 5L2FA 1YLPA 3IF6C 1BLPA 4PMAA 3VSKA 1PW8A 3MFDA 1JWPA 3HLDA 3BM6A 1BT5A 5GLDA 1MXOA 4GB7A 4OP8A 4OQHA 5CEBA 5CTMA 4S2LA 2EX6A 1RGYA 3PAEA 1K56D 3IF6A 4WM9A 2Q9MA 3ZCZA 4BJPA 4ZJ2A 1L0DA 2OV5A 2G2WA 2ZMAA 3FWLA 4GN2A 1W79A 2WGWB 5FAPA 4WMCA 3IT9A 1G6AA 4P6BA 1K6RA 4DE0A 3VP0A 4CJNA 4KQOA 4OQIA 4ZJ3A 2OLVA 4LV3A 5KSCA 4HEFA 4QHCA 4KZBA 5DVAA 1GHIA 2XF3A 2H0YA 1LL5A 1W8QA 1DY6A 1YLJA 2XH9A 1JTDA 5JYPA 3QNBA 1HZOA 3N8SA 1FR1A 5JYOA 4WZ4A 3OPLA 4B88A 2EXAA 1NYMA 1S0WA 4EWFA 4QB8A 4GNUA 4S2JA 3WS2A 1JTGA 1YLTA 4Z9QA 4LCLA 3W4QA 2EFXA 1Q2QA 1HTZA 1SDNA 2J9OA 2VGKA 4GD6A 1BTLA 4XXRA 4MNRA 5CHMA 2G2UA 1EI5A 3LCEA 3MXSA 3PBTA 1K25A 1I2WA 4FCFA 4NETA 5EOEA 2HP9A 1L0EA 3HLFA 4DRTA 2WZZA 1FSWA 3A3DA 3SS4A 5FI2A 4DF6A 3PTEA 5HAQA 3G35A 2P74A 3Q7VA 4DXCA 5F1FA 1BULA 2ZM2A 1PYYA 5M1AA 2Y2IA 2J9PA 3BLSA 1KVLA 2WGWA 3DWKA 2Q9NA 3VP1A 4WEJA 4Y0OA 3OZHA 3WWXA 1YM1A 5TR7A 1YLZA 4E3MA 3PBNA 2HDSA 4K0XA 3CG5A 3DWZA 3HLWA 5FSRA 3V3SA 3OPHA 1TVFA 1K56A 5GL9A 1CI9A 1ERMA 3GV9A 4R0QA 3M6HA 4LV2A 1K6SA 4P87A 5EECA 3ZNYA 1IEMA 2IWCA 4S2IA 1PW1A 4WMCD 3BFFA 1YMXA 3IWOA 2Y2MA 3ZDJA 4E3LA 5HW3A 3IHBA 1M6KA 3N8LA 4WZ5C 3LY3A 4JXWA 2WGVA 5GHYA 4FD8A 1DJBA 2BG1A 4GD8A 3HBRA 4X68A 2WAFA 4QY5A 4KZ4A 2EX9A 4ZDXA 3SS3A 3UNWA 1N4OA 1FOFA 4N9LA 2XLNA 3W4PA 3GTCA 5EVIB 3CJMA 1NZUA 4KZAA 2RL3A 3NBLA 4GDNA 2R9XA 1XA7A 3B3XA 3IQAA 4OQ0A 1ZG4A 1K57C 4LCMA 5EVID 3UO9A 4M3KA 2Y4AA 4BLMA 2WKHA 1ZC2A 4K0WA 1BUEA 1ES4A 1I2SA 5FATA 5I94A 3FKVA 3UE1A 1BLHA 4PM9A 2IWDA 4OKPA 3FKWA 4KZ8A 4YFMA 3GVBA 3HUOA 1KVMA 2V2FF 2I72A 2V1ZA 1FSYA 2X02A 1K38A 2ZQCA 3OCLA 2JCHA 3NY4A 4BQMA 1G68A 3IXDA 1TEMA 3C4PA 3N8RA 5M19A 4P85A 5D3OA 3FZCA 3GSGA 5E2HA 4R3JA 3ZVWA 2PU4A 4OQGA 5CRFA 1K4EA 4OPYA 3V39A 4PM5A 4OONA 3HREA 3LO7A 3M2KA 3PBOA 3BYDA 5CXWA 3V5MA 3IXGA 4OLGA 1TDLA 4MLLA 5GLAA 5CGXA 5HARA 5EVLA 3DW0A 3IXHA 4N92A 3UE3A 4GZBA 1KE3A 5CECA 2ZQDA 1KGFA 4KZ9A 3BFCA 1CI8A 2C6WB 4JF6A 3CZDA 3SS5A 1H5XA 3MZFA 2WKIA 5FI7A 2PU2A 2WYXA 1Y54A 3G2ZA 3HLBA 3MBZA 2Y2KA 4KZ5A 4R4SA 4RVAA 4E3JA 4QY6A 3JYIA 5FASA 1PI4A 2RCXA 2V20A 5GHZA 2ZD8A 3IWQA 1PI5A 3N6IA 1HD8A 4GDBA 3WS5A 4OH0A 1K4FA 4S2NA 2QPNA 3WS4A 4WYYA 5HL1A 5GLBA 1ZKJA 3NIAA 1ES5A 4X55A 3ZG8B 5EVIA 4EBPA 5FQKA 3EQVA 5IHVA 2ZQAA 3BFEA 4S2KA 5DTKA 4JXGA 4OPRA 5F83A 3ZG5A 4X69A 2ZC7A 3IXBA 4N1HA 1NY0A 4PM6A 3HL9A 3WRZA 4E3KA 1LHYA 2WKEA 3V3RA 1BLSA 4PM8A 1GA0A 1L2SA 3G4PA 5DF8A 1NJ4A 3ZNTA 4D2OA 1E3UD 1H8YA 4LV1A 4S2NC 2XDMA 3IHAA 5FAOA 1GHPA 4DDYA 1J9MA 1BLCA 4P0MA 3HLEA 4LV0A 1KE4A 4KQRA 2H5SA 3IH8A 5AQAA 1LI0A 3O3VA 4KZ7A 1XX2A 3C7VA 3NDGA 1ONHA 4U3TA 1NYYA 3MZEA 3UPNA 3MXRA 3O86A 5CEDA 5CTNA 4O7DA 3UPPA 4U0TA 1U60A 2XFTA 4UHUA 5A91A 5M18A 4JPMA 3W4OA 5HAPA 3HUNA 4BL3A 4X56A 1FCNA 3HUMA 1KDSA 3ITBA 2UWXA 4MBFA 3G30A 4A5RA 3SOIA 1IELA 5DF7A 2Y2JA 1MWUA 1NRFA 1XP4A 4OOMA 2XGNA 4JXSA 5CGSA 3S1YA 5AQ9A 3BLMA 4FSFA 1GCEA 3AGEA 1YLWA 5E43A 2X71A 1IYOA 3E2LA 4EQIA 1ERQA 5A92A 4IEDA 3CMZA 4LENA 1FCMA 5EE8A 1IYSA 1RP5A 4ZTKA 4ZBEA 1SHVA 3N4IA 3RJUA 4CPKA 2ZC5B 4KENB 4FH4A 3OPRA 3Q1FA 4HESA 4GKUA 2XD5A 3IH9A 1DJCA 4QD4A 1EROA 3LY4A 3GMWA 3GR2A 4OPZA 4RA7A 3NCKA 4IBRA 3DTMA 3HVFA 1ESUA 3ZVTA 1MY8A 4RYEA 4B4XA 3PAGA 2DCFA 3VFHA 1GHMA 1E4DA 3FYZA 4OLDA 4RX2A 1AXBA 4EV4A 3O87A 1TDGA 5BOHA 5EVIC 3LEZA 1ONGA 2EX8A 1WYCA 2P9VA 2XQZA 2ZQ8A 2WADA 3Q82A 3WS1A 4BD0A 3TOIA 4JF5A 4C6YA 1KE0A 1ALQA 3TSGA 4Y0TA 4KZ6A 2ZLYA 1BZAA 3G31A 3MZDA 4ZJ1A 4IVKA 1E3UA 4K91A 1QMEA 3C4OA 4DE3A 1LI9A 1EWZA 3S22A 1KGGA 4WZ5A 2Y2NA 3E2KA 4UAAA 5A93A 2Y59A 4JF4A 4OP5A 4OOYA 4KG6A 3C5AA 1VQQA 2HP6A 3HLCA 3Q7VB 3MKEA 2X01A 3GRJA 4E6XA 2H0TA 4S2PA 3QNCA 3VP4A 2GDNA 2WK0A 2HP5A 4HBTA 4KG5A 1BSGA 1DJAA 5GHXA 5FQJA 5G18A 4F94A 4RX3A 3UDFA 1XGIA 5E2FA 2XFSA 1I5QA 4KG2A 3VOYA 2DRWA 1QMFA 2P9VB 1JVJA 4HBUA 1NZOA 2Z2LB 3VP2A 1LL9A 5E2GA 3N7WA 2FFYA 1ESIA 3PBRA 3ZG9B 5J8XA 4E3NA 4Q8IA 3SH8A
chains in the Genus database with same CATH superfamily
3CUEC 3IS2A 1SCWA 3UMDA 3KYQA 3GQZA 3LIFA 1L3LA 4C75A 1G28A 4E3OA 5DTTA 2JC7A 2Y2HA 2OAP1 4PAUA 3M2JA 1RGZA 5CHJA 4WEKA 2Y2OA 5FA7A 1P9RA 1V9ZA 1PWCA 3ZHHA 2ZM0A 1CEGA 4Y17A 4XUZA 4BENA 5HDDA 5CERA 3LIAA 3IWIA 5DTSA 4OOLA 1GSWA 1PWGA 4KUKA 2QMIA 2P7JA 4U0XA 1GSXA 3V50A 3IF5A 1L0GA 3A0VA 5AQ7A 4L0LA 2IWBA 3UDIA 1W5DA 4MEZA 4ME4A 1VM1A 1W7FA 2PD7A 4I5SA 4DDSA 2HF6A 3G2YA 4S2MA 5G4YA 3VSLA 3BWLA 4ID4A 2WAEA 2M1CA 4WL9A 3ITAA 4WN5A 4L9GA 4E6WA 3NC8A 1IYPA 2KOIA 2PBDP 3A3JA 1C3BA 1ZHHB 3O88A 5AQBA 3NI9A 1MPLA 2ZC3B 4E3IA 3OPPA 3A3IA 3ZG7B 1PWDA 4FH2A 1G5UA 4H6JA 2J8YA 1O07A 3UB9A 2E8IA 3V67A 1K0KA 3MQ0A 4N9KA 2AVXA 1VETA 2VKSA 3IX8A 2A24B 3BEBA 5KSHA 3S4XA 3IF6C 4ESPA 3QP6A 1UGUA 1BT5A 4OP8A 5CEBA 2EX6A 3PAEA 3IF6A 2Q9MA 4Q0JA 2G2WA 2ZMAA 1P9WA 4WMCA 4P6BA 1K6RA 4DE0A 2L1MA 2XF3A 5HDSA 4WF0A 3CLOA 1JTDA 3LGOA 3F1OA 2B95A 5I5LA 1OTEA 3OPLA 3MF0A 1P0ZA 1JTGA 1CF0A 1BTLA 5CHMA 2G2UA 3EWKA 1EI5A 3PBTA 4NG2A 1I2WA 5EOEA 1L0EA 1S4RA 3SS4A 2V8FA 3TE8A 3HJKA 3PR6A 1OT9A 2P74A 3Q7VA 2ZM2A 1VHMA 3EOIA 1IFQA 3KYEA 2P04A 5TR7A 1SKOB 1LL8A 4K0XA 5AVFA 1DP9A 4NXFA 4M4XA 1ERMA 4LGWA 3M6HA 4LV2A 5EECA 3T4KA 4XT2B 4S2IA 1NWZA 4KQDA 4WMCD 5HW3A 3IHBA 2WGVA 4GD8A 2WAFA 4HH3A 2EX9A 2HGVA 3QP1A 2RL3A 2R9XA 2ZL1B 4LLOB 3BJNA 3LR4A 1BUEA 3FKVA 2JKTM 5TBMA 3UB8A 4OKPA 4KZ8A 3T50A 3T1SA 3NY4A 2NUTC 4BQMA 1TEMA 3GSGA 5E2HA 3ZVWA 5CRFA 1K4EA 4OPYA 4PM5A 3BYDA 5CXWA 3IXGA 4OLGA 3T4JA 2XSSA 4KZ9A 5CECA 3BFCA 3SS5A 1NLZA 3MZFA 1JNUA 3LICA 2VGLS 3HLBA 4L9FA 4EQ1A 3F1NA 1S67L 4QY6A 3JYIA 3BQ8A 2ZD8A 3IWQA 1HD8A 4GDBA 2H28A 2O0YA 2QPNA 4GS9B 3H82B 3QP5A 4WYYA 2M7VA 2JN7A 5GLBA 1XFNA 2M7UA 1MC0A 1ZKJA 1PRQA 1TS7A 2JKTI 4JXGA 5J4EA 3IXBA 4E3KA 4PM6A 3HL9A 4HOIA 1E3UD 4JGQA 5FAOA 1GHPA 1J9MA 4LV0A 4ETXA 4EU0A 4YNRA 3O3VA 4KZ7A 1OJ5A 3NDGA 3MZEA 3MXRA 3O86A 5CEDA 3UPPA 4MN6A 1U60A 4U0TA 5M18A 4BL3A 1N9OA 4MBFA 4A5RA 1MKMA 3ICYA 2XGNA 4JXSA 4R38A 2HJ9C 2EWWA 2X71A 3E2LA 3CMZA 1ZTUA 3A0SA 3OPRA 4HESA 4GKUA 3DTMA 3CAXA 2JKGA 4NXGA 1GHMA 3UB7A 1TDGA 4MCWA 5EVIC 2EX8A 2ZQ8A 3DBAA 3WS1A 2LB9A 1TS6A 3BW6A 4KZ6A 1BZAA 4I3JA 4G3VA 4IVKA 4DE3A 1LI9A 2GZAA 3S22A 5EVEA 3BY9A 4WZ5A 2Y2NA 4UAAA 3EGXC 4JF4A 2W3FA 3C5AA 4LRZE 3MKEA 3MFXA 2EWVA 2H0TA 4S2PA 3MR0A 3F1NB 4QWOA 1BSGA 2Q0OA 1X0OA 3UMEA 5E2FA 1A0KA 2XFSA 1QMFA 4MN5A 3VP2A 1LL9A 5E2GA 3PBRA 2FFYA 1OTAA 1FIKA 3VOZA 1K54A 2H10A 5FEFA 2G7UA 4UA6A 1UWPX 3ISGA 4H8RA 4O01A 2HDQA 3MJQA 2B5RA 4PKYG 3UN7A 4R4RA 4DJ2A 2DNSA 1XJ3A 2PR6A 5FAQA 1STZA 4JKTA 4ZAMA 3DAVA 5F82A 4C3QA 2JE5A 3BRMA 3SZTA 5FQQA 2QHKA 2JKRM 3K3DA 4GHIA 1MWRA 3BFDA 1LSXA 3EGDC 1ZG6A 4DKIA 1RCJA 2VJWA 3UB5P 1LT0A 3AGFA 4XT2A 3CHWP 3A3EA 2A24A 3WS0A 1O7EA 4IBXA 4XUXA 5HPFA 5F6AA 3JPUA 2J7VA 4OVDA 2ZMVA 3SH7A 5L07A 3ZFZA 3IX4A 1PZOA 4ZRRA 2LB5A 1N9NA 3UE0A 2PBYA 2XK1A 2L4RA 2WGIA 5FQMA 3B33A 5EM1A 1G6OA 3UB6A 2D02A 3NULA 5F1GA 2PAVP 4R6LA 1CJFA 4HJ4A 1MBLA 1M40A 2QJ5A 1T1CA 1YLYA 3VFFA 5G4ZA 2Y2QA 1OTBA 2Y2GA 3F1OB 2HV1A 2CC1A 2IA2A 1FILA 5HWVA 1MKIA 2EXBA 3IBRA 2C5WB 3BFGA 3UPOA 4Y3IA 1HLUP 2K7SA 3OCNA 1W8YA 1D1JA 2VGJA 1CEFA 3QHYA 4EUZA 2Y2PA 2GJ3A 2HDUA 1OMEA 3Q7ZA 4YOFA 2O99A 4R3BA 2WZXA 2XD1A 1NLYA 3SH9A 3PHYA 5HAIA 5EV0A 3D72A 2JBFA 2A3UA 4L9EA 4G3WA 3AGDA 1YSPA 1YLPA 3VSKA 1PW8A 3MFDA 3HLDA 3BM6A 3C30A 3H82A 5GLDA 4MN7A 2ZOHA 5CTMA 1SZVA 4BJPA 4ZJ2A 4KUOA 2GX5A 3IT9A 1G6AA 4EEPA 3VP0A 4KQOA 2OLVA 3EEAA 4HI4A 4LV3A 5KSCA 1V9YA 4QHCA 4KZBA 2OWJA 1YPRA 5DVAA 1GHIA 5HDCA 4AFIA 1LL5A 1W8QA 3T4LA 5J3WA 2VX8A 3QNBA 3N8SA 4WZ4A 4B88A 2EXAA 4EWFA 4QB8A 1OPXA 4GNUA 4LCLA 2EFXA 1SDNA 1HTZA 2J9OA 4XXRA 3QP2A 2V8CA 3MXSA 4FCFA 4NETA 4DRTA 3FC7A 2WZZA 3JVVA 3K2NA 4DF6A 3NECA 2W1RA 5HZHA 2Y2IA 2XRNA 4DMZA 3BY8A 1OTIA 4IHQA 1YKDA 3CG5A 3HLWA 5FSRA 3V3SA 1IEMA 2IWCA 1PW1A 3ZDJA 4E3LA 2Y2MA 4UQIS 3MXQA 3N8LA 1M6KA 4JXWA 4FD8A 2BG1A 3FPVA 4KZ4A 4II7A 3UNWA 4GDNA 3CITA 2MJ6A 4F3LA 4LCMA 1K57C 5EVID 3KO6A 2Y4AA 1ZC2A 4K0WA 1ES4A 1I2SA 3UE1A 4PM9A 4YFMA 3GVBA 1H3QA 3F1PA 2V1ZA 5FDSA 2X02A 2JCHA 1G68A 3C4PA 3N8RA 4P85A 3FZCA 4R3JA 3V39A 4NXEA 2VLGA 3M2KA 3PBOA 3V5MA 5GLAA 5HARA 4MLLA 4UQIM 2O9AA 1CI8A 5A8BA 3CZDA 4MDZA 5IT5A 2WYXA 3MBZA 5C5KA 4F3LB 4E3JA 4LRYC 5GHZA 3N6IA 4S2NA 4IUHA 3BQAA 3LYXA 2INWA 3EQVA 5IHVA 3BFEA 3ZG5A 4X69A 1XJ2A 2CMNA 1VEUA 1LHYA 4I3AA 3JVUA 2OAQ1 3VOLA 1GA0A 3CI6A 4D2OA 1S1ZA 5DJTA 4P0MA 4RQ9A 2H5SA 2OWHA 3IH8A 1XX2A 3C7VA 1PFLA 4U3TA 3UPNA 4O7DA 1LSWA 4UHUA 3NOPC 4JPMA 3W4OA 3HUNA 3HUMA 2JKFA 2UWXA 3G30A 5DF7A 2ZMFA 3VV4A 2Y2JA 1NRFA 3S7OA 3S1YA 3AGEA 3CWFA 3L9KA 3VE4A 5A92A 4EQIA 4LENA 5EE8A 4ZTKA 2XA7S 3N4IA 4CPKA 2XD5A 3MQOA 3IH9A 1DJCA 3GMWA 3GR2A 2PDRA 4RA7A 4IBRA 5TJJA 4GW9A 5DFYA 3ZVTA 3KX0X 2DCFA 3VFHA 4RX2A 3FYZA 4OLDA 1J3WA 3FG8A 2ACGA 1ONGA 3Q82A 4JF5A 5CX7A 4Y0TA 4EW7A 3C4OA 3T1RA 2J3TD 3E2KA 1VQQA 2HP6A 3HLCA 5AJGA 3PYPA 5EM0A 3GRJA 4E6XA 3QNCA 2HP5A 4Z1WA 2W3GA 1P97A 1DJAA 5FQJA 3NOTC 3T1QB 3UDFA 3TJZC 2DRWA 2P9VB 1JVJA 3E4QA 1NZOA 2BTFP 5J8XA 4ARZA 3LFVA 1Y4OA 3KSFA 2UV0E 1TS8A 5EUAA 2VV6A 3D4FA 5HX9A 4KZ3A 5FQ9A 5FI6A 1YT4A 4DE2A 3ULFA 2HDRA 2Z6CA 3G34A 4E04A 1FR6A 1T1AA 4B9OA 1W63M 4UA9A 2ZQ7A 1JWZA 2HJEA 3FV7A 4X1LA 5EOOA 1LLBA 3VMAA 4DN0A 3DTEA 2Y55A 3K3CA 2BASA 3PBSA 4JXVA 4JLFA 5F5YA 2P08A 5DF9A 3P98A 4DJ3A 3CPTB 5TFQA 3I7JA 4HP9A 4WBGA 2XR0A 1ES2A 2Z6DA 3NDEA 5TGFA 5L8MA 1ES3A 4S2OA 2Y8HA 4HP4A 5MC7A 2WUQA 1XFQA 1SDEA 1XGJA 4PPRA 3KSHA 4HH2A 1AWIA 3F1PB 2VV8A 2FZ0A 1FQGA 1IKIA 2D01A 2ZOIA 1YSQA 4BL2A 5KIZA 1OT6A 4HJ6A 2J80A 1Z6FA 1F98A 3CPTA 5EFWA 3ZYTA 4QJGA 5J7EA 4DE1A 4KQQA 5GLCA 4FOFA 4WELA 2OSUA 1MWSA 2XEPA 5CGWA 4EBLA 5HSQA 3PBQA 3IBJA 2JKRI 4ARZB 5HD3A 1XA1A 4CQHA 3G6OA 4EBNA 4R23A 1NRJA 3IF6B 3LI8A 3UE6A 3U2AA 5CHUA 3Q07A 2ZC4B 3A3FA 4BD1A 4HNBA 4DXBA 1KDWA 5KZHA 3Q81A 2QKPA 3OLOA 2Z2MB 3H9WA 1TD5A 3RH8B 1MWTA 1N9LA 1BLPA 3B47A 2VEAA 3MS6A 3RTYA 3LIDA 4OQHA 4S2LA 3DTKA 4WM9A 4CLCB 2OV5A 3FWLA 4GN2A 1W79A 2PYRA 2WGWB 3L7HA 5FAPA 3OOVA 3LUQA 4ZJ3A 3C38A 4HEFA 2H0YA 2WKRA 3E98A 1YLJA 4IJGA 4GLQA 5JYPA 4HJ3A 3LIEA 5FEGA 1S0WA 2PT7A 4S2JA 2W3DA 1YLTA 3W4QA 2VGKA 1Q2QA 4GD6A 5HD5A 4MNRA 2Y79A 3LCEA 1K25A 2HP9A 3HLFA 1FSWA 2W1TB 1TS0A 3PTEA 3EEHA 5HAQA 4DXCA 2O9CA 1BULA 5M1AA 1PYYA 5HWWA 1KVLA 2WGWA 3DWKA 4WEJA 4Y0OA 3OZHA 3WWXA 1YM1A 4R70A 1YLZA 4E3MA 1W63Q 2HDSA 5IS1A 3LR0A 3OPHA 5GL9A 4R0QA 1PNEA 1CQAA 1K6SA 3TW8A 3BFFA 1YMXA 2O9BA 4WZ5C 5GHYA 1DJBA 3HBRA 4X68A 3R4KA 4ZDXA 3O5YA 4N9LA 2XLNA 3W4PA 3GTCA 3CJMA 4GHIB 1VB6A 1XA7A 4OQ0A 1H0MA 4O8GA 4M3KA 3E4PA 4PKYA 4FUWA 5FATA 5I94A 2B02A 1WA9A 2IWDA 3FKWA 1KVMA 2V2FF 1FSYA 1K38A 4CLCC 2ZQCA 3IXDA 2WKQA 2R78A 4OQGA 4OONA 3HREA 2W3EA 1TDLA 5CGXA 5M19A 5EVLA 3DW0A 3UE3A 1H5XA 4EEUA 5FI7A 3IS2B 5DJUA 4QPRA 4LRXC 1Y54A 3DTIA 3G2ZA 2Y2KA 4KZ5A 5FASA 1DP8A 1PI4A 3H7WB 3CUEA 3WS5A 4Y15A 4OH0A 1K4FA 1KOUA 3S7NA 4HHDA 3P7NA 5HL1A 3NIAA 4X55A 4EBPA 2K2NA 5FQKA 2V0UA 3TRCA 5DTKA 4OPRA 4H6JB 3T4SA 1VETB 4N1HA 5HL6A 1NY0A 4P6ZM 2WKEA 3V3RA 4PM8A 1L2SA 1NJ4A 1H8YA 2XDMA 3IHAA 3U4LP 1BLCA 1T18A 1KE4A 4KQRA 4FTXA 1ONHA 4Y2FA 1NYYA 5CTNA 2XFTA 2VGLM 1H8MA 4LPZA 3SOIA 2GNXA 1D06A 1MWUA 1XP4A 5CGSA 4FSFA 1GCEA 1ERQA 4IEDA 3S7PA 1FCMA 2JHEA 4D60A 1T1BA 1SHVA 2OOLA 4FH4A 3Q1FA 4QD4A 3LY4A 3FPWA 4OPZA 3NCKA 3HVFA 4P6ZS 1MY8A 4RYEA 4EV4A 3O87A 5BOHA 3LEZA 2KLIA 2P9VA 2XQZA 3TOIA 4C6YA 1KE0A 3TSGA 4K91A 1E3UA 1QMEA 1OJGA 4UEYA 3NJAA 1KGGA 2V0WA 5A93A 5TBMB 4OOYA 4KG6A 1GSVA 3MMHA 4JGOA 4KG5A 5G18A 4F94A 1XGIA 1I5QA 4KG2A 3A0RA 2Z2LB 2PHYA 1ESIA 3ZG9B 4E3NA 3MSHA 1L0FA 1XPBA 1XXMA 5KMWA 4K08A 1JWVA 4Y13A 3G32A 2FH5A 4Y7PA 3VE3A 3T1XA 4G3KA 3B42A 4NKPA 2PRFA 3UDXA 3RXWA 4HQAA 1IKGA 3C7UA 4PM7A 3RXXA 2R9WA 4Q0IA 4LFUA 4GOGA 4NXBA 4ETZA 3RFBA 4MBKA 2OLUA 1E25A 1ODVA 5E2EA 1N9BA 4QU3A 1Q2PA 4NEED 4NK3A 4PHTA 5FQIA 1YQSA 1DRMA 1YMSA 1S6RA 3T4QA 3TG9A 1K55C 1IYQA 2VZWA 4WUJA 3R7WB 3HJIA 5FDHA 4I3IA 2BLSA 1H8ZA 3M6BA 4EUVA 1SKOA 4JGPA 4CLCE 2EFUA 4GJ4A 1K57A 3LI9A 2YKFA 2V9AA 1FCOA 3WRTA 2VK3A 1YAXA 3T4OA 3EQUA 1S1YA 1MZUA 3W8KA 3T12B 1UWNX 2ZQ9A 4MBHA 3ZGAB 4N1XA 1CK3A 3MKFA 4IVIA 3VP3A 4I39A 5EPHA 2HPBA 3UY6A 4UA7A 1T19A 4BMWA 4R1GA 4YINA 3C2WA 1NXYA 5HFOA 2ZJ9A 4Y0UA 1HVBA 1K55A 5A90A 1XKZA 5U47A 4BBVA 3OC2A 1WE4A 3P09A 2DMWA 2A49A 2QZ6A 1GA9A 4JBFA 2K31A 1PIOA 3HLGA 3ZG0A 4X53A 1S66L 2Y2LA 2EX2A 4OPQA 2QWSA 2FFFB 1KGEA 2ZM8A 5LBRA 4X6TA 4B4ZA 1K54C 3R7WA 2ZC6B 3BECA 1PZPA 2I9VA 1WYBA 2PYPA 1SKFA 4EXOA 2Y91A 5L2FA 4PMAA 3OBFA 4Q0HA 3W2ZA 1JWPA 2HZ5A 1MXOA 4GB7A 4EETB 2VA0A 1RGYA 1K56D 3ZCZA 1L0DA 4HY8A 2W1TA 2EA9A 4EESA 4CJNA 4OQIA 2J3TC 1IOUA 1Y28A 2V1BA 1DY6A 2XH9A 4I38A 3ZQ5A 1HZOA 1FR1A 5JYOA 1NYMA 2L0WA 3WS2A 4Z9QA 1F5MA 1Z09A 5IU1A 2ZL1A 2V1AA 3A3DA 5FI2A 3P01A 3G35A 5F1FA 4B93A 3BLSA 2J9PA 1ACFA 4MMNA 3LEQA 2QJ7A 3VP1A 2Q9NA 5AVEA 3PBNA 1XJ6A 3SW1A 4BBUA 4X1MA 3DWZA 3QP8A 4BBTA 2B18A 1TVFA 1K56A 1CI9A 3GV9A 4P87A 2A2LA 5HPIA 3KYZA 3IWOA 5FL3A 3T4TA 3LY3A 4QY5A 3GDIA 3SS3A 1N4OA 1FOFA 5EVIB 4WLAA 1NZUA 4KZAA 4EERA 3NBLA 3B3XA 5K5BA 3IQAA 1ZG4A 5HWTA 3UO9A 4BLMA 2VV7A 2WKHA 1D7EA 1BLHA 5F69A 3E0YA 3HUOA 2I72A 2QYBA 2PD8A 3D9YA 3OCLA 2W27A 5D3OA 2NUPC 5DKLA 2PU4A 3LO7A 2W3HA 3KSGA 3LR3A 3ZNYA 3KSIA 3IXHA 3LR5A 4N92A 4GZBA 1KE3A 2ZQDA 1KGFA 1XJ4A 2C6WB 4JF6A 2WKIA 2PU2A 3E4OA 2WKPA 3IX3A 4JGRA 4R4SA 4YWZA 4RVAA 2XROA 3NHQA 2RCXA 3MQQA 2V20A 4CLCA 2W0NA 2YKHA 1PI5A 1VEUB 3PXPA 3H7WA 3WS4A 3D3OA 3GECA 5DFXA 1ES5A 3ZG8B 5EVIA 2ZQAA 4S2KA 5F83A 2ZC7A 3WRZA 1BLSA 3G4PA 5DF8A 3ZNTA 4LV1A 4S2NC 4DDYA 3LIBA 5DKKA 3HLEA 5AQAA 1LI0A 2KDKA 4R3AA 1LSVA 5A91A 3S7QA 5HAPA 4X56A 1FCNA 3HCYA 1KDSA 3ITBA 1OTDA 1DP6A 1IELA 4OOMA 5AQ9A 3BLMA 5E43A 1YLWA 1IYOA 1S4SA 4BWIA 1IYSA 1RP5A 4ZBEA 3RJUA 2ZC5B 4KENB 4CLCD 1EROA 4O0PA 1ESUA 1BYWA 4B4XA 3PAGA 1E4DA 2ZBBA 1AXBA 1WYCA 2WADA 4BD0A 1EW0A 1ALQA 2ZLYA 2PR5A 3G31A 5L09A 3MZDA 4ZJ1A 2KX6A 1EWZA 2E8JA 4GCZA 2Y59A 4OP5A 5F68A 1TF1A 3Q7VB 2X01A 2J3WA 5L10A 3VP4A 2GDNA 2WK0A 4HBTA 3QP4A 5GHXA 4IUKA 4RX3A 2XA7M 4GS9A 3VOYA 4X25A 4Y5FA 4HBUA 1F2KA 3NOUC 4HIAA 3N7WA 1F9IA 3C8CA 4Q8IA 3SH8A
chains in the Genus database with same CATH topology
1L0FA 1XPBA 3VOZA 1K54A 1XXMA 5KMWA 2H10A 1SCWA 1JWVA 5EUAA 3G32A 3D4FA 3GQZA 4Y7PA 5HX9A 4UA6A 3ISGA 4H8RA 4KZ3A 5FQ9A 4C75A 2HDQA 5FI6A 2B5RA 1YT4A 3UN7A 4R4RA 4E3OA 4DE2A 2DNSA 2HDRA 3UDXA 5DTTA 3RXWA 2JC7A 3G34A 1IKGA 3C7UA 4PM7A 5FAQA 3RXXA 2R9WA 1FR6A 4JKTA 2Y2HA 4ZAMA 4GOGA 4UA9A 2ZQ7A 1JWZA 5F82A 3M2JA 4C3QA 1RGZA 2JE5A 3BRMA 5CHJA 4WEKA 3FV7A 4MBKA 2OLUA 2Y2OA 1E25A 5EOOA 5FA7A 5FQQA 1LLBA 5E2EA 3VMAA 1N9BA 1MWRA 3BFDA 4QU3A 1Q2PA 2Y55A 1ZG6A 4NK3A 1PWCA 3ZHHA 2ZM0A 5FQIA 1YQSA 1CEGA 3PBSA 4XUZA 4JXVA 4JLFA 4BENA 1YMSA 1S6RA 5CERA 3TG9A 1K55C 3IWIA 1IYQA 5DTSA 4DKIA 5DF9A 1RCJA 4OOLA 3P98A 1PWGA 5FDHA 2QMIA 2BLSA 1H8ZA 3M6BA 3AGFA 4U0XA 3A3EA 5TFQA 2EFUA 3WS0A 3V50A 1O7EA 3I7JA 4IBXA 1K57A 4XUXA 3IF5A 2XR0A 1ES2A 1FCOA 4WBGA 5AQ7A 4L0LA 1L0GA 3WRTA 2J7VA 4OVDA 3NDEA 2IWBA 3EQUA 3UDIA 3SH7A 5TGFA 3ZFZA 1W5DA 1ES3A 4MEZA 1PZOA 3W8KA 4S2OA 1VM1A 1W7FA 3UE0A 2ZQ9A 4MBHA 4DDSA 2PBYA 3ZGAB 2XK1A 2WGIA 1CK3A 3G2YA 4N1XA 5FQMA 3MKFA 4S2MA 4IVIA 3VP3A 3VSLA 2WUQA 4ID4A 2WAEA 1SDEA 1XGJA 4PPRA 5EPHA 3ITAA 2HPBA 5F1GA 3UY6A 4E6WA 3NC8A 4UA7A 1IYPA 4R1GA 1MBLA 4YINA 1M40A 1FQGA 1NXYA 1IKIA 2ZJ9A 1YLYA 5HFOA 3VFFA 4Y0UA 4BL2A 1HVBA 2Y2QA 3A3JA 2Y2GA 1Z6FA 1K55A 1C3BA 5A90A 1XKZA 2CC1A 5U47A 3O88A 1MKIA 5AQBA 2EXBA 3NI9A 1MPLA 2ZC3B 2C5WB 3OC2A 3BFGA 1WE4A 4QJGA 3UPOA 3P09A 2A49A 2QZ6A 4DE1A 4KQQA 5GLCA 4WELA 4E3IA 1GA9A 2OSUA 4JBFA 1MWSA 2XEPA 1PIOA 3OPPA 3HLGA 5CGWA 4EBLA 3OCNA 1W8YA 3PBQA 3ZG0A 2VGJA 4X53A 3A3IA 1CEFA 1XA1A 3QHYA 4EUZA 3ZG7B 2Y2LA 2EX2A 2Y2PA 4OPQA 1PWDA 4EBNA 4R23A 2HDUA 4FH2A 1OMEA 3IF6B 3Q7ZA 2FFFB 2J8YA 4R3BA 2WZXA 1O07A 2XD1A 5CHUA 1KGEA 3Q07A 2E8IA 2ZC4B 2ZM8A 3A3FA 4X6TA 3SH9A 4BD1A 4DXBA 5HAIA 4B4ZA 1KDWA 1K54C 5KZHA 3Q81A 2ZC6B 3BECA 4N9KA 1PZPA 2JBFA 2A3UA 2Z2MB 1WYBA 1SKFA 2Y91A 3BEBA 3AGDA 5KSHA 3S4XA 1MWTA 5L2FA 1YLPA 3IF6C 1BLPA 4PMAA 3VSKA 1PW8A 3MFDA 1JWPA 3HLDA 3BM6A 1BT5A 5GLDA 1MXOA 4GB7A 4OP8A 4OQHA 5CEBA 5CTMA 4S2LA 2EX6A 1RGYA 3PAEA 1K56D 3IF6A 4WM9A 2Q9MA 3ZCZA 4BJPA 4ZJ2A 1L0DA 2OV5A 2G2WA 2ZMAA 3FWLA 4GN2A 1W79A 2WGWB 5FAPA 4WMCA 3IT9A 1G6AA 4P6BA 1K6RA 4DE0A 3VP0A 4CJNA 4KQOA 4OQIA 4ZJ3A 2OLVA 4LV3A 5KSCA 4HEFA 4QHCA 4KZBA 5DVAA 1GHIA 2XF3A 2H0YA 1LL5A 1W8QA 1DY6A 1YLJA 2XH9A 1JTDA 5JYPA 3QNBA 1HZOA 3N8SA 1FR1A 5JYOA 4WZ4A 3OPLA 4B88A 2EXAA 1NYMA 1S0WA 4EWFA 4QB8A 4GNUA 4S2JA 3WS2A 1JTGA 1YLTA 4Z9QA 4LCLA 3W4QA 2EFXA 1Q2QA 1HTZA 1SDNA 2J9OA 2VGKA 4GD6A 1BTLA 4XXRA 4MNRA 5CHMA 2G2UA 1EI5A 3LCEA 3MXSA 3PBTA 1K25A 1I2WA 4FCFA 4NETA 5EOEA 2HP9A 1L0EA 3HLFA 4DRTA 2WZZA 1FSWA 3A3DA 3SS4A 5FI2A 4DF6A 3PTEA 5HAQA 3G35A 2P74A 3Q7VA 4DXCA 5F1FA 1BULA 2ZM2A 1PYYA 5M1AA 2Y2IA 2J9PA 3BLSA 1KVLA 2WGWA 3DWKA 2Q9NA 3VP1A 4WEJA 4Y0OA 3OZHA 3WWXA 1YM1A 5TR7A 1YLZA 4E3MA 3PBNA 2HDSA 4K0XA 3CG5A 3DWZA 3HLWA 5FSRA 3V3SA 3OPHA 1TVFA 1K56A 5GL9A 1CI9A 1ERMA 3GV9A 4R0QA 3M6HA 4LV2A 1K6SA 4P87A 5EECA 3ZNYA 1IEMA 2IWCA 4S2IA 1PW1A 4WMCD 3BFFA 1YMXA 3IWOA 2Y2MA 3ZDJA 4E3LA 5HW3A 3IHBA 1M6KA 3N8LA 4WZ5C 3LY3A 4JXWA 2WGVA 5GHYA 4FD8A 1DJBA 2BG1A 4GD8A 3HBRA 4X68A 2WAFA 4QY5A 4KZ4A 2EX9A 4ZDXA 3SS3A 3UNWA 1N4OA 1FOFA 4N9LA 2XLNA 3W4PA 3GTCA 5EVIB 3CJMA 1NZUA 4KZAA 2RL3A 3NBLA 4GDNA 2R9XA 1XA7A 3B3XA 3IQAA 4OQ0A 1ZG4A 1K57C 4LCMA 5EVID 3UO9A 4M3KA 2Y4AA 4BLMA 2WKHA 1ZC2A 4K0WA 1BUEA 1ES4A 1I2SA 5FATA 5I94A 3FKVA 3UE1A 1BLHA 4PM9A 2IWDA 4OKPA 3FKWA 4KZ8A 4YFMA 3GVBA 3HUOA 1KVMA 2V2FF 2I72A 2V1ZA 1FSYA 2X02A 1K38A 2ZQCA 3OCLA 2JCHA 3NY4A 4BQMA 1G68A 3IXDA 1TEMA 3C4PA 3N8RA 5M19A 4P85A 5D3OA 3FZCA 3GSGA 5E2HA 4R3JA 3ZVWA 2PU4A 4OQGA 5CRFA 1K4EA 4OPYA 3V39A 4PM5A 4OONA 3HREA 3LO7A 3M2KA 3PBOA 3BYDA 5CXWA 3V5MA 3IXGA 4OLGA 1TDLA 4MLLA 5GLAA 5CGXA 5HARA 5EVLA 3DW0A 3IXHA 4N92A 3UE3A 4GZBA 1KE3A 5CECA 2ZQDA 1KGFA 4KZ9A 3BFCA 1CI8A 2C6WB 4JF6A 3CZDA 3SS5A 1H5XA 3MZFA 2WKIA 5FI7A 2PU2A 2WYXA 1Y54A 3G2ZA 3HLBA 3MBZA 2Y2KA 4KZ5A 4R4SA 4RVAA 4E3JA 4QY6A 3JYIA 5FASA 1PI4A 2RCXA 2V20A 5GHZA 2ZD8A 3IWQA 1PI5A 3N6IA 1HD8A 4GDBA 3WS5A 4OH0A 1K4FA 4S2NA 2QPNA 3WS4A 4WYYA 5HL1A 5GLBA 1ZKJA 3NIAA 1ES5A 4X55A 3ZG8B 5EVIA 4EBPA 5FQKA 3EQVA 5IHVA 2ZQAA 3BFEA 4S2KA 5DTKA 4JXGA 4OPRA 5F83A 3ZG5A 4X69A 2ZC7A 3IXBA 4N1HA 1NY0A 4PM6A 3HL9A 3WRZA 4E3KA 1LHYA 2WKEA 3V3RA 1BLSA 4PM8A 1GA0A 1L2SA 3G4PA 5DF8A 1NJ4A 3ZNTA 4D2OA 1E3UD 1H8YA 4LV1A 4S2NC 2XDMA 3IHAA 5FAOA 1GHPA 4DDYA 1J9MA 1BLCA 4P0MA 3HLEA 4LV0A 1KE4A 4KQRA 2H5SA 3IH8A 5AQAA 1LI0A 3O3VA 4KZ7A 1XX2A 3C7VA 3NDGA 1ONHA 4U3TA 1NYYA 3MZEA 3UPNA 3MXRA 3O86A 5CEDA 5CTNA 4O7DA 3UPPA 4U0TA 1U60A 2XFTA 4UHUA 5A91A 5M18A 4JPMA 3W4OA 5HAPA 3HUNA 4BL3A 4X56A 1FCNA 3HUMA 1KDSA 3ITBA 2UWXA 4MBFA 3G30A 4A5RA 3SOIA 1IELA 5DF7A 2Y2JA 1MWUA 1NRFA 1XP4A 4OOMA 2XGNA 4JXSA 5CGSA 3S1YA 5AQ9A 3BLMA 4FSFA 1GCEA 3AGEA 1YLWA 5E43A 2X71A 1IYOA 3E2LA 4EQIA 1ERQA 5A92A 4IEDA 3CMZA 4LENA 1FCMA 5EE8A 1IYSA 1RP5A 4ZTKA 4ZBEA 1SHVA 3N4IA 3RJUA 4CPKA 2ZC5B 4KENB 4FH4A 3OPRA 3Q1FA 4HESA 4GKUA 2XD5A 3IH9A 1DJCA 4QD4A 1EROA 3LY4A 3GMWA 3GR2A 4OPZA 4RA7A 3NCKA 4IBRA 3DTMA 3HVFA 1ESUA 3ZVTA 1MY8A 4RYEA 4B4XA 3PAGA 2DCFA 3VFHA 1GHMA 1E4DA 3FYZA 4OLDA 4RX2A 1AXBA 4EV4A 3O87A 1TDGA 5BOHA 5EVIC 3LEZA 1ONGA 2EX8A 1WYCA 2P9VA 2XQZA 2ZQ8A 2WADA 3Q82A 3WS1A 4BD0A 3TOIA 4JF5A 4C6YA 1KE0A 1ALQA 3TSGA 4Y0TA 4KZ6A 2ZLYA 1BZAA 3G31A 3MZDA 4ZJ1A 4IVKA 1E3UA 4K91A 1QMEA 3C4OA 4DE3A 1LI9A 1EWZA 3S22A 1KGGA 4WZ5A 2Y2NA 3E2KA 4UAAA 5A93A 2Y59A 4JF4A 4OP5A 4OOYA 4KG6A 3C5AA 1VQQA 2HP6A 3HLCA 3Q7VB 3MKEA 2X01A 3GRJA 4E6XA 2H0TA 4S2PA 3QNCA 3VP4A 2GDNA 2WK0A 2HP5A 4HBTA 4KG5A 1BSGA 1DJAA 5GHXA 5FQJA 5G18A 4F94A 4RX3A 3UDFA 1XGIA 5E2FA 2XFSA 1I5QA 4KG2A 3VOYA 2DRWA 1QMFA 2P9VB 1JVJA 4HBUA 1NZOA 2Z2LB 3VP2A 1LL9A 5E2GA 3N7WA 2FFYA 1ESIA 3PBRA 3ZG9B 5J8XA 4E3NA 4Q8IA 3SH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0F A;  1XPB A;  3VOZ A;  1K54 A;  1XXM A;  5KMW A;  2H10 A;  1SCW A;  1JWV A;  5EUA A;  3G32 A;  3D4F A;  3GQZ A;  4Y7P A;  5HX9 A;  4UA6 A;  3ISG A;  4H8R A;  4KZ3 A;  5FQ9 A;  4C75 A;  2HDQ A;  5FI6 A;  2B5R A;  1YT4 A;  3UN7 A;  4R4R A;  4E3O A;  4DE2 A;  2DNS A;  2HDR A;  3UDX A;  5DTT A;  3RXW A;  2JC7 A;  3G34 A;  1IKG A;  3C7U A;  4PM7 A;  5FAQ A;  3RXX A;  2R9W A;  1FR6 A;  4JKT A;  2Y2H A;  4ZAM A;  4GOG A;  4UA9 A;  2ZQ7 A;  1JWZ A;  5F82 A;  3M2J A;  4C3Q A;  1RGZ A;  2JE5 A;  3BRM A;  5CHJ A;  4WEK A;  3FV7 A;  4MBK A;  2OLU A;  2Y2O A;  1E25 A;  5EOO A;  5FA7 A;  5FQQ A;  1LLB A;  5E2E A;  3VMA A;  1N9B A;  1MWR A;  3BFD A;  4QU3 A;  1Q2P A;  2Y55 A;  1ZG6 A;  4NK3 A;  1PWC A;  3ZHH A;  2ZM0 A;  5FQI A;  1YQS A;  1CEG A;  3PBS A;  4XUZ A;  4JXV A;  4JLF A;  4BEN A;  1YMS A;  1S6R A;  5CER A;  3TG9 A;  1K55 C;  3IWI A;  1IYQ A;  5DTS A;  4DKI A;  5DF9 A;  1RCJ A;  4OOL A;  3P98 A;  1PWG A;  5FDH A;  2QMI A;  2BLS A;  1H8Z A;  3M6B A;  3AGF A;  4U0X A;  3A3E A;  5TFQ A;  2EFU A;  3WS0 A;  3V50 A;  1O7E A;  3I7J A;  4IBX A;  1K57 A;  4XUX A;  3IF5 A;  2XR0 A;  1ES2 A;  1FCO A;  4WBG A;  5AQ7 A;  4L0L A;  1L0G A;  3WRT A;  2J7V A;  4OVD A;  3NDE A;  2IWB A;  3EQU A;  3UDI A;  3SH7 A;  5TGF A;  3ZFZ A;  1W5D A;  1ES3 A;  4MEZ A;  1PZO A;  3W8K A;  4S2O A;  1VM1 A;  1W7F A;  3UE0 A;  2ZQ9 A;  4MBH A;  4DDS A;  2PBY A;  3ZGA B;  2XK1 A;  2WGI A;  1CK3 A;  3G2Y A;  4N1X A;  5FQM A;  3MKF A;  4S2M A;  4IVI A;  3VP3 A;  3VSL A;  2WUQ A;  4ID4 A;  2WAE A;  1SDE A;  1XGJ A;  4PPR A;  5EPH A;  3ITA A;  2HPB A;  5F1G A;  3UY6 A;  4E6W A;  3NC8 A;  4UA7 A;  1IYP A;  4R1G A;  1MBL A;  4YIN A;  1M40 A;  1FQG A;  1NXY A;  1IKI A;  2ZJ9 A;  1YLY A;  5HFO A;  3VFF A;  4Y0U A;  4BL2 A;  1HVB A;  2Y2Q A;  3A3J A;  2Y2G A;  1Z6F A;  1K55 A;  1C3B A;  5A90 A;  1XKZ A;  2CC1 A;  5U47 A;  3O88 A;  1MKI A;  5AQB A;  2EXB A;  3NI9 A;  1MPL A;  2ZC3 B;  2C5W B;  3OC2 A;  3BFG A;  1WE4 A;  4QJG A;  3UPO A;  3P09 A;  2A49 A;  2QZ6 A;  4DE1 A;  4KQQ A;  5GLC A;  4WEL A;  4E3I A;  1GA9 A;  2OSU A;  4JBF A;  1MWS A;  2XEP A;  1PIO A;  3OPP A;  3HLG A;  5CGW A;  4EBL A;  3OCN A;  1W8Y A;  3PBQ A;  3ZG0 A;  2VGJ A;  4X53 A;  3A3I A;  1CEF A;  1XA1 A;  3QHY A;  4EUZ A;  3ZG7 B;  2Y2L A;  2EX2 A;  2Y2P A;  4OPQ A;  1PWD A;  4EBN A;  4R23 A;  2HDU A;  4FH2 A;  1OME A;  3IF6 B;  3Q7Z A;  2FFF B;  2J8Y A;  4R3B A;  2WZX A;  1O07 A;  2XD1 A;  5CHU A;  1KGE A;  3Q07 A;  2E8I A;  2ZC4 B;  2ZM8 A;  3A3F A;  4X6T A;  3SH9 A;  4BD1 A;  4DXB A;  5HAI A;  4B4Z A;  1KDW A;  1K54 C;  5KZH A;  3Q81 A;  2ZC6 B;  3BEC A;  4N9K A;  1PZP A;  2JBF A;  2A3U A;  2Z2M B;  1WYB A;  1SKF A;  2Y91 A;  3BEB A;  3AGD A;  5KSH A;  3S4X A;  1MWT A;  5L2F A;  1YLP A;  3IF6 C;  1BLP A;  4PMA A;  3VSK A;  1PW8 A;  3MFD A;  1JWP A;  3HLD A;  3BM6 A;  1BT5 A;  5GLD A;  1MXO A;  4GB7 A;  4OP8 A;  4OQH A;  5CEB A;  5CTM A;  4S2L A;  2EX6 A;  1RGY A;  3PAE A;  1K56 D;  3IF6 A;  4WM9 A;  2Q9M A;  3ZCZ A;  4BJP A;  4ZJ2 A;  1L0D A;  2OV5 A;  2G2W A;  2ZMA A;  3FWL A;  4GN2 A;  1W79 A;  2WGW B;  5FAP A;  4WMC A;  3IT9 A;  1G6A A;  4P6B A;  1K6R A;  4DE0 A;  3VP0 A;  4CJN A;  4KQO A;  4OQI A;  4ZJ3 A;  2OLV A;  4LV3 A;  5KSC A;  4HEF A;  4QHC A;  4KZB A;  5DVA A;  1GHI A;  2XF3 A;  2H0Y A;  1LL5 A;  1W8Q A;  1DY6 A;  1YLJ A;  2XH9 A;  1JTD A;  5JYP A;  3QNB A;  1HZO A;  3N8S A;  1FR1 A;  5JYO A;  4WZ4 A;  3OPL A;  4B88 A;  2EXA A;  1NYM A;  1S0W A;  4EWF A;  4QB8 A;  4GNU A;  4S2J A;  3WS2 A;  1JTG A;  1YLT A;  4Z9Q A;  4LCL A;  3W4Q A;  2EFX A;  1Q2Q A;  1HTZ A;  1SDN A;  2J9O A;  2VGK A;  4GD6 A;  1BTL A;  4XXR A;  4MNR A;  5CHM A;  2G2U A;  1EI5 A;  3LCE A;  3MXS A;  3PBT A;  1K25 A;  1I2W A;  4FCF A;  4NET A;  5EOE A;  2HP9 A;  1L0E A;  3HLF A;  4DRT A;  2WZZ A;  1FSW A;  3A3D A;  3SS4 A;  5FI2 A;  4DF6 A;  3PTE A;  5HAQ A;  3G35 A;  2P74 A;  3Q7V A;  4DXC A;  5F1F A;  1BUL A;  2ZM2 A;  1PYY A;  5M1A A;  2Y2I A;  2J9P A;  3BLS A;  1KVL A;  2WGW A;  3DWK A;  2Q9N A;  3VP1 A;  4WEJ A;  4Y0O A;  3OZH A;  3WWX A;  1YM1 A;  5TR7 A;  1YLZ A;  4E3M A;  3PBN A;  2HDS A;  4K0X A;  3CG5 A;  3DWZ A;  3HLW A;  5FSR A;  3V3S A;  3OPH A;  1TVF A;  1K56 A;  5GL9 A;  1CI9 A;  1ERM A;  3GV9 A;  4R0Q A;  3M6H A;  4LV2 A;  1K6S A;  4P87 A;  5EEC A;  3ZNY A;  1IEM A;  2IWC A;  4S2I A;  1PW1 A;  4WMC D;  3BFF A;  1YMX A;  3IWO A;  2Y2M A;  3ZDJ A;  4E3L A;  5HW3 A;  3IHB A;  1M6K A;  3N8L A;  4WZ5 C;  3LY3 A;  4JXW A;  2WGV A;  5GHY A;  4FD8 A;  1DJB A;  2BG1 A;  4GD8 A;  3HBR A;  4X68 A;  2WAF A;  4QY5 A;  4KZ4 A;  2EX9 A;  4ZDX A;  3SS3 A;  3UNW A;  1N4O A;  1FOF A;  4N9L A;  2XLN A;  3W4P A;  3GTC A;  5EVI B;  3CJM A;  1NZU A;  4KZA A;  2RL3 A;  3NBL A;  4GDN A;  2R9X A;  1XA7 A;  3B3X A;  3IQA A;  4OQ0 A;  1ZG4 A;  1K57 C;  4LCM A;  5EVI D;  3UO9 A;  4M3K A;  2Y4A A;  4BLM A;  2WKH A;  1ZC2 A;  4K0W A;  1BUE A;  1ES4 A;  1I2S A;  5FAT A;  5I94 A;  3FKV A;  3UE1 A;  1BLH A;  4PM9 A;  2IWD A;  4OKP A;  3FKW A;  4KZ8 A;  4YFM A;  3GVB A;  3HUO A;  1KVM A;  2V2F F;  2I72 A;  2V1Z A;  1FSY A;  2X02 A;  1K38 A;  2ZQC A;  3OCL A;  2JCH A;  3NY4 A;  4BQM A;  1G68 A;  3IXD A;  1TEM A;  3C4P A;  3N8R A;  5M19 A;  4P85 A;  5D3O A;  3FZC A;  3GSG A;  5E2H A;  4R3J A;  3ZVW A;  2PU4 A;  4OQG A;  5CRF A;  1K4E A;  4OPY A;  3V39 A;  4PM5 A;  4OON A;  3HRE A;  3LO7 A;  3M2K A;  3PBO A;  3BYD A;  5CXW A;  3V5M A;  3IXG A;  4OLG A;  1TDL A;  4MLL A;  5GLA A;  5CGX A;  5HAR A;  5EVL A;  3DW0 A;  3IXH A;  4N92 A;  3UE3 A;  4GZB A;  1KE3 A;  5CEC A;  2ZQD A;  1KGF A;  4KZ9 A;  3BFC A;  1CI8 A;  2C6W B;  4JF6 A;  3CZD A;  3SS5 A;  1H5X A;  3MZF A;  2WKI A;  5FI7 A;  2PU2 A;  2WYX A;  1Y54 A;  3G2Z A;  3HLB A;  3MBZ A;  2Y2K A;  4KZ5 A;  4R4S A;  4RVA A;  4E3J A;  4QY6 A;  3JYI A;  5FAS A;  1PI4 A;  2RCX A;  2V20 A;  5GHZ A;  2ZD8 A;  3IWQ A;  1PI5 A;  3N6I A;  1HD8 A;  4GDB A;  3WS5 A;  4OH0 A;  1K4F A;  4S2N A;  2QPN A;  3WS4 A;  4WYY A;  5HL1 A;  5GLB A;  1ZKJ A;  3NIA A;  1ES5 A;  4X55 A;  3ZG8 B;  5EVI A;  4EBP A;  5FQK A;  3EQV A;  5IHV A;  2ZQA A;  3BFE A;  4S2K A;  5DTK A;  4JXG A;  4OPR A;  5F83 A;  3ZG5 A;  4X69 A;  2ZC7 A;  3IXB A;  4N1H A;  1NY0 A;  4PM6 A;  3HL9 A;  3WRZ A;  4E3K A;  1LHY A;  2WKE A;  3V3R A;  1BLS A;  4PM8 A;  1GA0 A;  1L2S A;  3G4P A;  5DF8 A;  1NJ4 A;  3ZNT A;  4D2O A;  1E3U D;  1H8Y A;  4LV1 A;  4S2N C;  2XDM A;  3IHA A;  5FAO A;  1GHP A;  4DDY A;  1J9M A;  1BLC A;  4P0M A;  3HLE A;  4LV0 A;  1KE4 A;  4KQR A;  2H5S A;  3IH8 A;  5AQA A;  1LI0 A;  3O3V A;  4KZ7 A;  1XX2 A;  3C7V A;  3NDG A;  1ONH A;  4U3T A;  1NYY A;  3MZE A;  3UPN A;  3MXR A;  3O86 A;  5CED A;  5CTN A;  4O7D A;  3UPP A;  4U0T A;  1U60 A;  2XFT A;  4UHU A;  5A91 A;  5M18 A;  4JPM A;  3W4O A;  5HAP A;  3HUN A;  4BL3 A;  4X56 A;  1FCN A;  3HUM A;  1KDS A;  3ITB A;  2UWX A;  4MBF A;  3G30 A;  4A5R A;  3SOI A;  1IEL A;  5DF7 A;  2Y2J A;  1MWU A;  1NRF A;  1XP4 A;  4OOM A;  2XGN A;  4JXS A;  5CGS A;  3S1Y A;  5AQ9 A;  3BLM A;  4FSF A;  1GCE A;  3AGE A;  1YLW A;  5E43 A;  2X71 A;  1IYO A;  3E2L A;  4EQI A;  1ERQ A;  5A92 A;  4IED A;  3CMZ A;  4LEN A;  1FCM A;  5EE8 A;  1IYS A;  1RP5 A;  4ZTK A;  4ZBE A;  1SHV A;  3N4I A;  3RJU A;  4CPK A;  2ZC5 B;  4KEN B;  4FH4 A;  3OPR A;  3Q1F A;  4HES A;  4GKU A;  2XD5 A;  3IH9 A;  1DJC A;  4QD4 A;  1ERO A;  3LY4 A;  3GMW A;  3GR2 A;  4OPZ A;  4RA7 A;  3NCK A;  4IBR A;  3DTM A;  3HVF A;  1ESU A;  3ZVT A;  1MY8 A;  4RYE A;  4B4X A;  3PAG A;  2DCF A;  3VFH A;  1GHM A;  1E4D A;  3FYZ A;  4OLD A;  4RX2 A;  1AXB A;  4EV4 A;  3O87 A;  1TDG A;  5BOH A;  5EVI C;  3LEZ A;  1ONG A;  2EX8 A;  1WYC A;  2P9V A;  2XQZ A;  2ZQ8 A;  2WAD A;  3Q82 A;  3WS1 A;  4BD0 A;  3TOI A;  4JF5 A;  4C6Y A;  1KE0 A;  1ALQ A;  3TSG A;  4Y0T A;  4KZ6 A;  2ZLY A;  1BZA A;  3G31 A;  3MZD A;  4ZJ1 A;  4IVK A;  1E3U A;  4K91 A;  1QME A;  3C4O A;  4DE3 A;  1LI9 A;  1EWZ A;  3S22 A;  1KGG A;  4WZ5 A;  2Y2N A;  3E2K A;  4UAA A;  5A93 A;  2Y59 A;  4JF4 A;  4OP5 A;  4OOY A;  4KG6 A;  3C5A A;  1VQQ A;  2HP6 A;  3HLC A;  3Q7V B;  3MKE A;  2X01 A;  3GRJ A;  4E6X A;  2H0T A;  4S2P A;  3QNC A;  3VP4 A;  2GDN A;  2WK0 A;  2HP5 A;  4HBT A;  4KG5 A;  1BSG A;  1DJA A;  5GHX A;  5FQJ A;  5G18 A;  4F94 A;  4RX3 A;  3UDF A;  1XGI A;  5E2F A;  2XFS A;  1I5Q A;  4KG2 A;  3VOY A;  2DRW A;  1QMF A;  2P9V B;  1JVJ A;  4HBU A;  1NZO A;  2Z2L B;  3VP2 A;  1LL9 A;  5E2G A;  3N7W A;  2FFY A;  1ESI A;  3PBR A;  3ZG9 B;  5J8X A;  4E3N A;  4Q8I A;  3SH8 A; 
#chains in the Genus database with same CATH topology
 3CUE C;  3IS2 A;  1SCW A;  3UMD A;  3KYQ A;  3GQZ A;  3LIF A;  1L3L A;  4C75 A;  1G28 A;  4E3O A;  5DTT A;  2JC7 A;  2Y2H A;  2OAP 1;  4PAU A;  3M2J A;  1RGZ A;  5CHJ A;  4WEK A;  2Y2O A;  5FA7 A;  1P9R A;  1V9Z A;  1PWC A;  3ZHH A;  2ZM0 A;  1CEG A;  4Y17 A;  4XUZ A;  4BEN A;  5HDD A;  5CER A;  3LIA A;  3IWI A;  5DTS A;  4OOL A;  1GSW A;  1PWG A;  4KUK A;  2QMI A;  2P7J A;  4U0X A;  1GSX A;  3V50 A;  3IF5 A;  1L0G A;  3A0V A;  5AQ7 A;  4L0L A;  2IWB A;  3UDI A;  1W5D A;  4MEZ A;  4ME4 A;  1VM1 A;  1W7F A;  2PD7 A;  4I5S A;  4DDS A;  2HF6 A;  3G2Y A;  4S2M A;  5G4Y A;  3VSL A;  3BWL A;  4ID4 A;  2WAE A;  2M1C A;  4WL9 A;  3ITA A;  4WN5 A;  4L9G A;  4E6W A;  3NC8 A;  1IYP A;  2KOI A;  2PBD P;  3A3J A;  1C3B A;  1ZHH B;  3O88 A;  5AQB A;  3NI9 A;  1MPL A;  2ZC3 B;  4E3I A;  3OPP A;  3A3I A;  3ZG7 B;  1PWD A;  4FH2 A;  1G5U A;  4H6J A;  2J8Y A;  1O07 A;  3UB9 A;  2E8I A;  3V67 A;  1K0K A;  3MQ0 A;  4N9K A;  2AVX A;  1VET A;  2VKS A;  3IX8 A;  2A24 B;  3BEB A;  5KSH A;  3S4X A;  3IF6 C;  4ESP A;  3QP6 A;  1UGU A;  1BT5 A;  4OP8 A;  5CEB A;  2EX6 A;  3PAE A;  3IF6 A;  2Q9M A;  4Q0J A;  2G2W A;  2ZMA A;  1P9W A;  4WMC A;  4P6B A;  1K6R A;  4DE0 A;  2L1M A;  2XF3 A;  5HDS A;  4WF0 A;  3CLO A;  1JTD A;  3LGO A;  3F1O A;  2B95 A;  5I5L A;  1OTE A;  3OPL A;  3MF0 A;  1P0Z A;  1JTG A;  1CF0 A;  1BTL A;  5CHM A;  2G2U A;  3EWK A;  1EI5 A;  3PBT A;  4NG2 A;  1I2W A;  5EOE A;  1L0E A;  1S4R A;  3SS4 A;  2V8F A;  3TE8 A;  3HJK A;  3PR6 A;  1OT9 A;  2P74 A;  3Q7V A;  2ZM2 A;  1VHM A;  3EOI A;  1IFQ A;  3KYE A;  2P04 A;  5TR7 A;  1SKO B;  1LL8 A;  4K0X A;  5AVF A;  1DP9 A;  4NXF A;  4M4X A;  1ERM A;  4LGW A;  3M6H A;  4LV2 A;  5EEC A;  3T4K A;  4XT2 B;  4S2I A;  1NWZ A;  4KQD A;  4WMC D;  5HW3 A;  3IHB A;  2WGV A;  4GD8 A;  2WAF A;  4HH3 A;  2EX9 A;  2HGV A;  3QP1 A;  2RL3 A;  2R9X A;  2ZL1 B;  4LLO B;  3BJN A;  3LR4 A;  1BUE A;  3FKV A;  2JKT M;  5TBM A;  3UB8 A;  4OKP A;  4KZ8 A;  3T50 A;  3T1S A;  3NY4 A;  2NUT C;  4BQM A;  1TEM A;  3GSG A;  5E2H A;  3ZVW A;  5CRF A;  1K4E A;  4OPY A;  4PM5 A;  3BYD A;  5CXW A;  3IXG A;  4OLG A;  3T4J A;  2XSS A;  4KZ9 A;  5CEC A;  3BFC A;  3SS5 A;  1NLZ A;  3MZF A;  1JNU A;  3LIC A;  2VGL S;  3HLB A;  4L9F A;  4EQ1 A;  3F1N A;  1S67 L;  4QY6 A;  3JYI A;  3BQ8 A;  2ZD8 A;  3IWQ A;  1HD8 A;  4GDB A;  2H28 A;  2O0Y A;  2QPN A;  4GS9 B;  3H82 B;  3QP5 A;  4WYY A;  2M7V A;  2JN7 A;  5GLB A;  1XFN A;  2M7U A;  1MC0 A;  1ZKJ A;  1PRQ A;  1TS7 A;  2JKT I;  4JXG A;  5J4E A;  3IXB A;  4E3K A;  4PM6 A;  3HL9 A;  4HOI A;  1E3U D;  4JGQ A;  5FAO A;  1GHP A;  1J9M A;  4LV0 A;  4ETX A;  4EU0 A;  4YNR A;  3O3V A;  4KZ7 A;  1OJ5 A;  3NDG A;  3MZE A;  3MXR A;  3O86 A;  5CED A;  3UPP A;  4MN6 A;  1U60 A;  4U0T A;  5M18 A;  4BL3 A;  1N9O A;  4MBF A;  4A5R A;  1MKM A;  3ICY A;  2XGN A;  4JXS A;  4R38 A;  2HJ9 C;  2EWW A;  2X71 A;  3E2L A;  3CMZ A;  1ZTU A;  3A0S A;  3OPR A;  4HES A;  4GKU A;  3DTM A;  3CAX A;  2JKG A;  4NXG A;  1GHM A;  3UB7 A;  1TDG A;  4MCW A;  5EVI C;  2EX8 A;  2ZQ8 A;  3DBA A;  3WS1 A;  2LB9 A;  1TS6 A;  3BW6 A;  4KZ6 A;  1BZA A;  4I3J A;  4G3V A;  4IVK A;  4DE3 A;  1LI9 A;  2GZA A;  3S22 A;  5EVE A;  3BY9 A;  4WZ5 A;  2Y2N A;  4UAA A;  3EGX C;  4JF4 A;  2W3F A;  3C5A A;  4LRZ E;  3MKE A;  3MFX A;  2EWV A;  2H0T A;  4S2P A;  3MR0 A;  3F1N B;  4QWO A;  1BSG A;  2Q0O A;  1X0O A;  3UME A;  5E2F A;  1A0K A;  2XFS A;  1QMF A;  4MN5 A;  3VP2 A;  1LL9 A;  5E2G A;  3PBR A;  2FFY A;  1OTA A;  1FIK A;  3VOZ A;  1K54 A;  2H10 A;  5FEF A;  2G7U A;  4UA6 A;  1UWP X;  3ISG A;  4H8R A;  4O01 A;  2HDQ A;  3MJQ A;  2B5R A;  4PKY G;  3UN7 A;  4R4R A;  4DJ2 A;  2DNS A;  1XJ3 A;  2PR6 A;  5FAQ A;  1STZ A;  4JKT A;  4ZAM A;  3DAV A;  5F82 A;  4C3Q A;  2JE5 A;  3BRM A;  3SZT A;  5FQQ A;  2QHK A;  2JKR M;  3K3D A;  4GHI A;  1MWR A;  3BFD A;  1LSX A;  3EGD C;  1ZG6 A;  4DKI A;  1RCJ A;  2VJW A;  3UB5 P;  1LT0 A;  3AGF A;  4XT2 A;  3CHW P;  3A3E A;  2A24 A;  3WS0 A;  1O7E A;  4IBX A;  4XUX A;  5HPF A;  5F6A A;  3JPU A;  2J7V A;  4OVD A;  2ZMV A;  3SH7 A;  5L07 A;  3ZFZ A;  3IX4 A;  1PZO A;  4ZRR A;  2LB5 A;  1N9N A;  3UE0 A;  2PBY A;  2XK1 A;  2L4R A;  2WGI A;  5FQM A;  3B33 A;  5EM1 A;  1G6O A;  3UB6 A;  2D02 A;  3NUL A;  5F1G A;  2PAV P;  4R6L A;  1CJF A;  4HJ4 A;  1MBL A;  1M40 A;  2QJ5 A;  1T1C A;  1YLY A;  3VFF A;  5G4Z A;  2Y2Q A;  1OTB A;  2Y2G A;  3F1O B;  2HV1 A;  2CC1 A;  2IA2 A;  1FIL A;  5HWV A;  1MKI A;  2EXB A;  3IBR A;  2C5W B;  3BFG A;  3UPO A;  4Y3I A;  1HLU P;  2K7S A;  3OCN A;  1W8Y A;  1D1J A;  2VGJ A;  1CEF A;  3QHY A;  4EUZ A;  2Y2P A;  2GJ3 A;  2HDU A;  1OME A;  3Q7Z A;  4YOF A;  2O99 A;  4R3B A;  2WZX A;  2XD1 A;  1NLY A;  3SH9 A;  3PHY A;  5HAI A;  5EV0 A;  3D72 A;  2JBF A;  2A3U A;  4L9E A;  4G3W A;  3AGD A;  1YSP A;  1YLP A;  3VSK A;  1PW8 A;  3MFD A;  3HLD A;  3BM6 A;  3C30 A;  3H82 A;  5GLD A;  4MN7 A;  2ZOH A;  5CTM A;  1SZV A;  4BJP A;  4ZJ2 A;  4KUO A;  2GX5 A;  3IT9 A;  1G6A A;  4EEP A;  3VP0 A;  4KQO A;  2OLV A;  3EEA A;  4HI4 A;  4LV3 A;  5KSC A;  1V9Y A;  4QHC A;  4KZB A;  2OWJ A;  1YPR A;  5DVA A;  1GHI A;  5HDC A;  4AFI A;  1LL5 A;  1W8Q A;  3T4L A;  5J3W A;  2VX8 A;  3QNB A;  3N8S A;  4WZ4 A;  4B88 A;  2EXA A;  4EWF A;  4QB8 A;  1OPX A;  4GNU A;  4LCL A;  2EFX A;  1SDN A;  1HTZ A;  2J9O A;  4XXR A;  3QP2 A;  2V8C A;  3MXS A;  4FCF A;  4NET A;  4DRT A;  3FC7 A;  2WZZ A;  3JVV A;  3K2N A;  4DF6 A;  3NEC A;  2W1R A;  5HZH A;  2Y2I A;  2XRN A;  4DMZ A;  3BY8 A;  1OTI A;  4IHQ A;  1YKD A;  3CG5 A;  3HLW A;  5FSR A;  3V3S A;  1IEM A;  2IWC A;  1PW1 A;  3ZDJ A;  4E3L A;  2Y2M A;  4UQI S;  3MXQ A;  3N8L A;  1M6K A;  4JXW A;  4FD8 A;  2BG1 A;  3FPV A;  4KZ4 A;  4II7 A;  3UNW A;  4GDN A;  3CIT A;  2MJ6 A;  4F3L A;  4LCM A;  1K57 C;  5EVI D;  3KO6 A;  2Y4A A;  1ZC2 A;  4K0W A;  1ES4 A;  1I2S A;  3UE1 A;  4PM9 A;  4YFM A;  3GVB A;  1H3Q A;  3F1P A;  2V1Z A;  5FDS A;  2X02 A;  2JCH A;  1G68 A;  3C4P A;  3N8R A;  4P85 A;  3FZC A;  4R3J A;  3V39 A;  4NXE A;  2VLG A;  3M2K A;  3PBO A;  3V5M A;  5GLA A;  5HAR A;  4MLL A;  4UQI M;  2O9A A;  1CI8 A;  5A8B A;  3CZD A;  4MDZ A;  5IT5 A;  2WYX A;  3MBZ A;  5C5K A;  4F3L B;  4E3J A;  4LRY C;  5GHZ A;  3N6I A;  4S2N A;  4IUH A;  3BQA A;  3LYX A;  2INW A;  3EQV A;  5IHV A;  3BFE A;  3ZG5 A;  4X69 A;  1XJ2 A;  2CMN A;  1VEU A;  1LHY A;  4I3A A;  3JVU A;  2OAQ 1;  3VOL A;  1GA0 A;  3CI6 A;  4D2O A;  1S1Z A;  5DJT A;  4P0M A;  4RQ9 A;  2H5S A;  2OWH A;  3IH8 A;  1XX2 A;  3C7V A;  1PFL A;  4U3T A;  3UPN A;  4O7D A;  1LSW A;  4UHU A;  3NOP C;  4JPM A;  3W4O A;  3HUN A;  3HUM A;  2JKF A;  2UWX A;  3G30 A;  5DF7 A;  2ZMF A;  3VV4 A;  2Y2J A;  1NRF A;  3S7O A;  3S1Y A;  3AGE A;  3CWF A;  3L9K A;  3VE4 A;  5A92 A;  4EQI A;  4LEN A;  5EE8 A;  4ZTK A;  2XA7 S;  3N4I A;  4CPK A;  2XD5 A;  3MQO A;  3IH9 A;  1DJC A;  3GMW A;  3GR2 A;  2PDR A;  4RA7 A;  4IBR A;  5TJJ A;  4GW9 A;  5DFY A;  3ZVT A;  3KX0 X;  2DCF A;  3VFH A;  4RX2 A;  3FYZ A;  4OLD A;  1J3W A;  3FG8 A;  2ACG A;  1ONG A;  3Q82 A;  4JF5 A;  5CX7 A;  4Y0T A;  4EW7 A;  3C4O A;  3T1R A;  2J3T D;  3E2K A;  1VQQ A;  2HP6 A;  3HLC A;  5AJG A;  3PYP A;  5EM0 A;  3GRJ A;  4E6X A;  3QNC A;  2HP5 A;  4Z1W A;  2W3G A;  1P97 A;  1DJA A;  5FQJ A;  3NOT C;  3T1Q B;  3UDF A;  3TJZ C;  2DRW A;  2P9V B;  1JVJ A;  3E4Q A;  1NZO A;  2BTF P;  5J8X A;  4ARZ A;  3LFV A;  1Y4O A;  3KSF A;  2UV0 E;  1TS8 A;  5EUA A;  2VV6 A;  3D4F A;  5HX9 A;  4KZ3 A;  5FQ9 A;  5FI6 A;  1YT4 A;  4DE2 A;  3ULF A;  2HDR A;  2Z6C A;  3G34 A;  4E04 A;  1FR6 A;  1T1A A;  4B9O A;  1W63 M;  4UA9 A;  2ZQ7 A;  1JWZ A;  2HJE A;  3FV7 A;  4X1L A;  5EOO A;  1LLB A;  3VMA A;  4DN0 A;  3DTE A;  2Y55 A;  3K3C A;  2BAS A;  3PBS A;  4JXV A;  4JLF A;  5F5Y A;  2P08 A;  5DF9 A;  3P98 A;  4DJ3 A;  3CPT B;  5TFQ A;  3I7J A;  4HP9 A;  4WBG A;  2XR0 A;  1ES2 A;  2Z6D A;  3NDE A;  5TGF A;  5L8M A;  1ES3 A;  4S2O A;  2Y8H A;  4HP4 A;  5MC7 A;  2WUQ A;  1XFQ A;  1SDE A;  1XGJ A;  4PPR A;  3KSH A;  4HH2 A;  1AWI A;  3F1P B;  2VV8 A;  2FZ0 A;  1FQG A;  1IKI A;  2D01 A;  2ZOI A;  1YSQ A;  4BL2 A;  5KIZ A;  1OT6 A;  4HJ6 A;  2J80 A;  1Z6F A;  1F98 A;  3CPT A;  5EFW A;  3ZYT A;  4QJG A;  5J7E A;  4DE1 A;  4KQQ A;  5GLC A;  4FOF A;  4WEL A;  2OSU A;  1MWS A;  2XEP A;  5CGW A;  4EBL A;  5HSQ A;  3PBQ A;  3IBJ A;  2JKR I;  4ARZ B;  5HD3 A;  1XA1 A;  4CQH A;  3G6O A;  4EBN A;  4R23 A;  1NRJ A;  3IF6 B;  3LI8 A;  3UE6 A;  3U2A A;  5CHU A;  3Q07 A;  2ZC4 B;  3A3F A;  4BD1 A;  4HNB A;  4DXB A;  1KDW A;  5KZH A;  3Q81 A;  2QKP A;  3OLO A;  2Z2M B;  3H9W A;  1TD5 A;  3RH8 B;  1MWT A;  1N9L A;  1BLP A;  3B47 A;  2VEA A;  3MS6 A;  3RTY A;  3LID A;  4OQH A;  4S2L A;  3DTK A;  4WM9 A;  4CLC B;  2OV5 A;  3FWL A;  4GN2 A;  1W79 A;  2PYR A;  2WGW B;  3L7H A;  5FAP A;  3OOV A;  3LUQ A;  4ZJ3 A;  3C38 A;  4HEF A;  2H0Y A;  2WKR A;  3E98 A;  1YLJ A;  4IJG A;  4GLQ A;  5JYP A;  4HJ3 A;  3LIE A;  5FEG A;  1S0W A;  2PT7 A;  4S2J A;  2W3D A;  1YLT A;  3W4Q A;  2VGK A;  1Q2Q A;  4GD6 A;  5HD5 A;  4MNR A;  2Y79 A;  3LCE A;  1K25 A;  2HP9 A;  3HLF A;  1FSW A;  2W1T B;  1TS0 A;  3PTE A;  3EEH A;  5HAQ A;  4DXC A;  2O9C A;  1BUL A;  5M1A A;  1PYY A;  5HWW A;  1KVL A;  2WGW A;  3DWK A;  4WEJ A;  4Y0O A;  3OZH A;  3WWX A;  1YM1 A;  4R70 A;  1YLZ A;  4E3M A;  1W63 Q;  2HDS A;  5IS1 A;  3LR0 A;  3OPH A;  5GL9 A;  4R0Q A;  1PNE A;  1CQA A;  1K6S A;  3TW8 A;  3BFF A;  1YMX A;  2O9B A;  4WZ5 C;  5GHY A;  1DJB A;  3HBR A;  4X68 A;  3R4K A;  4ZDX A;  3O5Y A;  4N9L A;  2XLN A;  3W4P A;  3GTC A;  3CJM A;  4GHI B;  1VB6 A;  1XA7 A;  4OQ0 A;  1H0M A;  4O8G A;  4M3K A;  3E4P A;  4PKY A;  4FUW A;  5FAT A;  5I94 A;  2B02 A;  1WA9 A;  2IWD A;  3FKW A;  1KVM A;  2V2F F;  1FSY A;  1K38 A;  4CLC C;  2ZQC A;  3IXD A;  2WKQ A;  2R78 A;  4OQG A;  4OON A;  3HRE A;  2W3E A;  1TDL A;  5CGX A;  5M19 A;  5EVL A;  3DW0 A;  3UE3 A;  1H5X A;  4EEU A;  5FI7 A;  3IS2 B;  5DJU A;  4QPR A;  4LRX C;  1Y54 A;  3DTI A;  3G2Z A;  2Y2K A;  4KZ5 A;  5FAS A;  1DP8 A;  1PI4 A;  3H7W B;  3CUE A;  3WS5 A;  4Y15 A;  4OH0 A;  1K4F A;  1KOU A;  3S7N A;  4HHD A;  3P7N A;  5HL1 A;  3NIA A;  4X55 A;  4EBP A;  2K2N A;  5FQK A;  2V0U A;  3TRC A;  5DTK A;  4OPR A;  4H6J B;  3T4S A;  1VET B;  4N1H A;  5HL6 A;  1NY0 A;  4P6Z M;  2WKE A;  3V3R A;  4PM8 A;  1L2S A;  1NJ4 A;  1H8Y A;  2XDM A;  3IHA A;  3U4L P;  1BLC A;  1T18 A;  1KE4 A;  4KQR A;  4FTX A;  1ONH A;  4Y2F A;  1NYY A;  5CTN A;  2XFT A;  2VGL M;  1H8M A;  4LPZ A;  3SOI A;  2GNX A;  1D06 A;  1MWU A;  1XP4 A;  5CGS A;  4FSF A;  1GCE A;  1ERQ A;  4IED A;  3S7P A;  1FCM A;  2JHE A;  4D60 A;  1T1B A;  1SHV A;  2OOL A;  4FH4 A;  3Q1F A;  4QD4 A;  3LY4 A;  3FPW A;  4OPZ A;  3NCK A;  3HVF A;  4P6Z S;  1MY8 A;  4RYE A;  4EV4 A;  3O87 A;  5BOH A;  3LEZ A;  2KLI A;  2P9V A;  2XQZ A;  3TOI A;  4C6Y A;  1KE0 A;  3TSG A;  4K91 A;  1E3U A;  1QME A;  1OJG A;  4UEY A;  3NJA A;  1KGG A;  2V0W A;  5A93 A;  5TBM B;  4OOY A;  4KG6 A;  1GSV A;  3MMH A;  4JGO A;  4KG5 A;  5G18 A;  4F94 A;  1XGI A;  1I5Q A;  4KG2 A;  3A0R A;  2Z2L B;  2PHY A;  1ESI A;  3ZG9 B;  4E3N A;  3MSH A;  1L0F A;  1XPB A;  1XXM A;  5KMW A;  4K08 A;  1JWV A;  4Y13 A;  3G32 A;  2FH5 A;  4Y7P A;  3VE3 A;  3T1X A;  4G3K A;  3B42 A;  4NKP A;  2PRF A;  3UDX A;  3RXW A;  4HQA A;  1IKG A;  3C7U A;  4PM7 A;  3RXX A;  2R9W A;  4Q0I A;  4LFU A;  4GOG A;  4NXB A;  4ETZ A;  3RFB A;  4MBK A;  2OLU A;  1E25 A;  1ODV A;  5E2E A;  1N9B A;  4QU3 A;  1Q2P A;  4NEE D;  4NK3 A;  4PHT A;  5FQI A;  1YQS A;  1DRM A;  1YMS A;  1S6R A;  3T4Q A;  3TG9 A;  1K55 C;  1IYQ A;  2VZW A;  4WUJ A;  3R7W B;  3HJI A;  5FDH A;  4I3I A;  2BLS A;  1H8Z A;  3M6B A;  4EUV A;  1SKO A;  4JGP A;  4CLC E;  2EFU A;  4GJ4 A;  1K57 A;  3LI9 A;  2YKF A;  2V9A A;  1FCO A;  3WRT A;  2VK3 A;  1YAX A;  3T4O A;  3EQU A;  1S1Y A;  1MZU A;  3W8K A;  3T12 B;  1UWN X;  2ZQ9 A;  4MBH A;  3ZGA B;  4N1X A;  1CK3 A;  3MKF A;  4IVI A;  3VP3 A;  4I39 A;  5EPH A;  2HPB A;  3UY6 A;  4UA7 A;  1T19 A;  4BMW A;  4R1G A;  4YIN A;  3C2W A;  1NXY A;  5HFO A;  2ZJ9 A;  4Y0U A;  1HVB A;  1K55 A;  5A90 A;  1XKZ A;  5U47 A;  4BBV A;  3OC2 A;  1WE4 A;  3P09 A;  2DMW A;  2A49 A;  2QZ6 A;  1GA9 A;  4JBF A;  2K31 A;  1PIO A;  3HLG A;  3ZG0 A;  4X53 A;  1S66 L;  2Y2L A;  2EX2 A;  4OPQ A;  2QWS A;  2FFF B;  1KGE A;  2ZM8 A;  5LBR A;  4X6T A;  4B4Z A;  1K54 C;  3R7W A;  2ZC6 B;  3BEC A;  1PZP A;  2I9V A;  1WYB A;  2PYP A;  1SKF A;  4EXO A;  2Y91 A;  5L2F A;  4PMA A;  3OBF A;  4Q0H A;  3W2Z A;  1JWP A;  2HZ5 A;  1MXO A;  4GB7 A;  4EET B;  2VA0 A;  1RGY A;  1K56 D;  3ZCZ A;  1L0D A;  4HY8 A;  2W1T A;  2EA9 A;  4EES A;  4CJN A;  4OQI A;  2J3T C;  1IOU A;  1Y28 A;  2V1B A;  1DY6 A;  2XH9 A;  4I38 A;  3ZQ5 A;  1HZO A;  1FR1 A;  5JYO A;  1NYM A;  2L0W A;  3WS2 A;  4Z9Q A;  1F5M A;  1Z09 A;  5IU1 A;  2ZL1 A;  2V1A A;  3A3D A;  5FI2 A;  3P01 A;  3G35 A;  5F1F A;  4B93 A;  3BLS A;  2J9P A;  1ACF A;  4MMN A;  3LEQ A;  2QJ7 A;  3VP1 A;  2Q9N A;  5AVE A;  3PBN A;  1XJ6 A;  3SW1 A;  4BBU A;  4X1M A;  3DWZ A;  3QP8 A;  4BBT A;  2B18 A;  1TVF A;  1K56 A;  1CI9 A;  3GV9 A;  4P87 A;  2A2L A;  5HPI A;  3KYZ A;  3IWO A;  5FL3 A;  3T4T A;  3LY3 A;  4QY5 A;  3GDI A;  3SS3 A;  1N4O A;  1FOF A;  5EVI B;  4WLA A;  1NZU A;  4KZA A;  4EER A;  3NBL A;  3B3X A;  5K5B A;  3IQA A;  1ZG4 A;  5HWT A;  3UO9 A;  4BLM A;  2VV7 A;  2WKH A;  1D7E A;  1BLH A;  5F69 A;  3E0Y A;  3HUO A;  2I72 A;  2QYB A;  2PD8 A;  3D9Y A;  3OCL A;  2W27 A;  5D3O A;  2NUP C;  5DKL A;  2PU4 A;  3LO7 A;  2W3H A;  3KSG A;  3LR3 A;  3ZNY A;  3KSI A;  3IXH A;  3LR5 A;  4N92 A;  4GZB A;  1KE3 A;  2ZQD A;  1KGF A;  1XJ4 A;  2C6W B;  4JF6 A;  2WKI A;  2PU2 A;  3E4O A;  2WKP A;  3IX3 A;  4JGR A;  4R4S A;  4YWZ A;  4RVA A;  2XRO A;  3NHQ A;  2RCX A;  3MQQ A;  2V20 A;  4CLC A;  2W0N A;  2YKH A;  1PI5 A;  1VEU B;  3PXP A;  3H7W A;  3WS4 A;  3D3O A;  3GEC A;  5DFX A;  1ES5 A;  3ZG8 B;  5EVI A;  2ZQA A;  4S2K A;  5F83 A;  2ZC7 A;  3WRZ A;  1BLS A;  3G4P A;  5DF8 A;  3ZNT A;  4LV1 A;  4S2N C;  4DDY A;  3LIB A;  5DKK A;  3HLE A;  5AQA A;  1LI0 A;  2KDK A;  4R3A A;  1LSV A;  5A91 A;  3S7Q A;  5HAP A;  4X56 A;  1FCN A;  3HCY A;  1KDS A;  3ITB A;  1OTD A;  1DP6 A;  1IEL A;  4OOM A;  5AQ9 A;  3BLM A;  5E43 A;  1YLW A;  1IYO A;  1S4S A;  4BWI A;  1IYS A;  1RP5 A;  4ZBE A;  3RJU A;  2ZC5 B;  4KEN B;  4CLC D;  1ERO A;  4O0P A;  1ESU A;  1BYW A;  4B4X A;  3PAG A;  1E4D A;  2ZBB A;  1AXB A;  1WYC A;  2WAD A;  4BD0 A;  1EW0 A;  1ALQ A;  2ZLY A;  2PR5 A;  3G31 A;  5L09 A;  3MZD A;  4ZJ1 A;  2KX6 A;  1EWZ A;  2E8J A;  4GCZ A;  2Y59 A;  4OP5 A;  5F68 A;  1TF1 A;  3Q7V B;  2X01 A;  2J3W A;  5L10 A;  3VP4 A;  2GDN A;  2WK0 A;  4HBT A;  3QP4 A;  5GHX A;  4IUK A;  4RX3 A;  2XA7 M;  4GS9 A;  3VOY A;  4X25 A;  4Y5F A;  4HBU A;  1F2K A;  3NOU C;  4HIA A;  3N7W A;  1F9I A;  3C8C A;  4Q8I A;  3SH8 A; 
#chains in the Genus database with same CATH homology
 1L0F A;  1XPB A;  3VOZ A;  1K54 A;  1XXM A;  5KMW A;  2H10 A;  1SCW A;  1JWV A;  5EUA A;  3G32 A;  3D4F A;  3GQZ A;  4Y7P A;  5HX9 A;  4UA6 A;  3ISG A;  4H8R A;  4KZ3 A;  5FQ9 A;  4C75 A;  2HDQ A;  5FI6 A;  2B5R A;  1YT4 A;  3UN7 A;  4R4R A;  4E3O A;  4DE2 A;  2DNS A;  2HDR A;  3UDX A;  5DTT A;  3RXW A;  2JC7 A;  3G34 A;  1IKG A;  3C7U A;  4PM7 A;  5FAQ A;  3RXX A;  2R9W A;  1FR6 A;  4JKT A;  2Y2H A;  4ZAM A;  4GOG A;  4UA9 A;  2ZQ7 A;  1JWZ A;  5F82 A;  3M2J A;  4C3Q A;  1RGZ A;  2JE5 A;  3BRM A;  5CHJ A;  4WEK A;  3FV7 A;  4MBK A;  2OLU A;  2Y2O A;  1E25 A;  5EOO A;  5FA7 A;  5FQQ A;  1LLB A;  5E2E A;  3VMA A;  1N9B A;  1MWR A;  3BFD A;  4QU3 A;  1Q2P A;  2Y55 A;  1ZG6 A;  4NK3 A;  1PWC A;  3ZHH A;  2ZM0 A;  5FQI A;  1YQS A;  1CEG A;  3PBS A;  4XUZ A;  4JXV A;  4JLF A;  4BEN A;  1YMS A;  1S6R A;  5CER A;  3TG9 A;  1K55 C;  3IWI A;  1IYQ A;  5DTS A;  4DKI A;  5DF9 A;  1RCJ A;  4OOL A;  3P98 A;  1PWG A;  5FDH A;  2QMI A;  2BLS A;  1H8Z A;  3M6B A;  3AGF A;  4U0X A;  3A3E A;  5TFQ A;  2EFU A;  3WS0 A;  3V50 A;  1O7E A;  3I7J A;  4IBX A;  1K57 A;  4XUX A;  3IF5 A;  2XR0 A;  1ES2 A;  1FCO A;  4WBG A;  5AQ7 A;  4L0L A;  1L0G A;  3WRT A;  2J7V A;  4OVD A;  3NDE A;  2IWB A;  3EQU A;  3UDI A;  3SH7 A;  5TGF A;  3ZFZ A;  1W5D A;  1ES3 A;  4MEZ A;  1PZO A;  3W8K A;  4S2O A;  1VM1 A;  1W7F A;  3UE0 A;  2ZQ9 A;  4MBH A;  4DDS A;  2PBY A;  3ZGA B;  2XK1 A;  2WGI A;  1CK3 A;  3G2Y A;  4N1X A;  5FQM A;  3MKF A;  4S2M A;  4IVI A;  3VP3 A;  3VSL A;  2WUQ A;  4ID4 A;  2WAE A;  1SDE A;  1XGJ A;  4PPR A;  5EPH A;  3ITA A;  2HPB A;  5F1G A;  3UY6 A;  4E6W A;  3NC8 A;  4UA7 A;  1IYP A;  4R1G A;  1MBL A;  4YIN A;  1M40 A;  1FQG A;  1NXY A;  1IKI A;  2ZJ9 A;  1YLY A;  5HFO A;  3VFF A;  4Y0U A;  4BL2 A;  1HVB A;  2Y2Q A;  3A3J A;  2Y2G A;  1Z6F A;  1K55 A;  1C3B A;  5A90 A;  1XKZ A;  2CC1 A;  5U47 A;  3O88 A;  1MKI A;  5AQB A;  2EXB A;  3NI9 A;  1MPL A;  2ZC3 B;  2C5W B;  3OC2 A;  3BFG A;  1WE4 A;  4QJG A;  3UPO A;  3P09 A;  2A49 A;  2QZ6 A;  4DE1 A;  4KQQ A;  5GLC A;  4WEL A;  4E3I A;  1GA9 A;  2OSU A;  4JBF A;  1MWS A;  2XEP A;  1PIO A;  3OPP A;  3HLG A;  5CGW A;  4EBL A;  3OCN A;  1W8Y A;  3PBQ A;  3ZG0 A;  2VGJ A;  4X53 A;  3A3I A;  1CEF A;  1XA1 A;  3QHY A;  4EUZ A;  3ZG7 B;  2Y2L A;  2EX2 A;  2Y2P A;  4OPQ A;  1PWD A;  4EBN A;  4R23 A;  2HDU A;  4FH2 A;  1OME A;  3IF6 B;  3Q7Z A;  2FFF B;  2J8Y A;  4R3B A;  2WZX A;  1O07 A;  2XD1 A;  5CHU A;  1KGE A;  3Q07 A;  2E8I A;  2ZC4 B;  2ZM8 A;  3A3F A;  4X6T A;  3SH9 A;  4BD1 A;  4DXB A;  5HAI A;  4B4Z A;  1KDW A;  1K54 C;  5KZH A;  3Q81 A;  2ZC6 B;  3BEC A;  4N9K A;  1PZP A;  2JBF A;  2A3U A;  2Z2M B;  1WYB A;  1SKF A;  2Y91 A;  3BEB A;  3AGD A;  5KSH A;  3S4X A;  1MWT A;  5L2F A;  1YLP A;  3IF6 C;  1BLP A;  4PMA A;  3VSK A;  1PW8 A;  3MFD A;  1JWP A;  3HLD A;  3BM6 A;  1BT5 A;  5GLD A;  1MXO A;  4GB7 A;  4OP8 A;  4OQH A;  5CEB A;  5CTM A;  4S2L A;  2EX6 A;  1RGY A;  3PAE A;  1K56 D;  3IF6 A;  4WM9 A;  2Q9M A;  3ZCZ A;  4BJP A;  4ZJ2 A;  1L0D A;  2OV5 A;  2G2W A;  2ZMA A;  3FWL A;  4GN2 A;  1W79 A;  2WGW B;  5FAP A;  4WMC A;  3IT9 A;  1G6A A;  4P6B A;  1K6R A;  4DE0 A;  3VP0 A;  4CJN A;  4KQO A;  4OQI A;  4ZJ3 A;  2OLV A;  4LV3 A;  5KSC A;  4HEF A;  4QHC A;  4KZB A;  5DVA A;  1GHI A;  2XF3 A;  2H0Y A;  1LL5 A;  1W8Q A;  1DY6 A;  1YLJ A;  2XH9 A;  1JTD A;  5JYP A;  3QNB A;  1HZO A;  3N8S A;  1FR1 A;  5JYO A;  4WZ4 A;  3OPL A;  4B88 A;  2EXA A;  1NYM A;  1S0W A;  4EWF A;  4QB8 A;  4GNU A;  4S2J A;  3WS2 A;  1JTG A;  1YLT A;  4Z9Q A;  4LCL A;  3W4Q A;  2EFX A;  1Q2Q A;  1HTZ A;  1SDN A;  2J9O A;  2VGK A;  4GD6 A;  1BTL A;  4XXR A;  4MNR A;  5CHM A;  2G2U A;  1EI5 A;  3LCE A;  3MXS A;  3PBT A;  1K25 A;  1I2W A;  4FCF A;  4NET A;  5EOE A;  2HP9 A;  1L0E A;  3HLF A;  4DRT A;  2WZZ A;  1FSW A;  3A3D A;  3SS4 A;  5FI2 A;  4DF6 A;  3PTE A;  5HAQ A;  3G35 A;  2P74 A;  3Q7V A;  4DXC A;  5F1F A;  1BUL A;  2ZM2 A;  1PYY A;  5M1A A;  2Y2I A;  2J9P A;  3BLS A;  1KVL A;  2WGW A;  3DWK A;  2Q9N A;  3VP1 A;  4WEJ A;  4Y0O A;  3OZH A;  3WWX A;  1YM1 A;  5TR7 A;  1YLZ A;  4E3M A;  3PBN A;  2HDS A;  4K0X A;  3CG5 A;  3DWZ A;  3HLW A;  5FSR A;  3V3S A;  3OPH A;  1TVF A;  1K56 A;  5GL9 A;  1CI9 A;  1ERM A;  3GV9 A;  4R0Q A;  3M6H A;  4LV2 A;  1K6S A;  4P87 A;  5EEC A;  3ZNY A;  1IEM A;  2IWC A;  4S2I A;  1PW1 A;  4WMC D;  3BFF A;  1YMX A;  3IWO A;  2Y2M A;  3ZDJ A;  4E3L A;  5HW3 A;  3IHB A;  1M6K A;  3N8L A;  4WZ5 C;  3LY3 A;  4JXW A;  2WGV A;  5GHY A;  4FD8 A;  1DJB A;  2BG1 A;  4GD8 A;  3HBR A;  4X68 A;  2WAF A;  4QY5 A;  4KZ4 A;  2EX9 A;  4ZDX A;  3SS3 A;  3UNW A;  1N4O A;  1FOF A;  4N9L A;  2XLN A;  3W4P A;  3GTC A;  5EVI B;  3CJM A;  1NZU A;  4KZA A;  2RL3 A;  3NBL A;  4GDN A;  2R9X A;  1XA7 A;  3B3X A;  3IQA A;  4OQ0 A;  1ZG4 A;  1K57 C;  4LCM A;  5EVI D;  3UO9 A;  4M3K A;  2Y4A A;  4BLM A;  2WKH A;  1ZC2 A;  4K0W A;  1BUE A;  1ES4 A;  1I2S A;  5FAT A;  5I94 A;  3FKV A;  3UE1 A;  1BLH A;  4PM9 A;  2IWD A;  4OKP A;  3FKW A;  4KZ8 A;  4YFM A;  3GVB A;  3HUO A;  1KVM A;  2V2F F;  2I72 A;  2V1Z A;  1FSY A;  2X02 A;  1K38 A;  2ZQC A;  3OCL A;  2JCH A;  3NY4 A;  4BQM A;  1G68 A;  3IXD A;  1TEM A;  3C4P A;  3N8R A;  5M19 A;  4P85 A;  5D3O A;  3FZC A;  3GSG A;  5E2H A;  4R3J A;  3ZVW A;  2PU4 A;  4OQG A;  5CRF A;  1K4E A;  4OPY A;  3V39 A;  4PM5 A;  4OON A;  3HRE A;  3LO7 A;  3M2K A;  3PBO A;  3BYD A;  5CXW A;  3V5M A;  3IXG A;  4OLG A;  1TDL A;  4MLL A;  5GLA A;  5CGX A;  5HAR A;  5EVL A;  3DW0 A;  3IXH A;  4N92 A;  3UE3 A;  4GZB A;  1KE3 A;  5CEC A;  2ZQD A;  1KGF A;  4KZ9 A;  3BFC A;  1CI8 A;  2C6W B;  4JF6 A;  3CZD A;  3SS5 A;  1H5X A;  3MZF A;  2WKI A;  5FI7 A;  2PU2 A;  2WYX A;  1Y54 A;  3G2Z A;  3HLB A;  3MBZ A;  2Y2K A;  4KZ5 A;  4R4S A;  4RVA A;  4E3J A;  4QY6 A;  3JYI A;  5FAS A;  1PI4 A;  2RCX A;  2V20 A;  5GHZ A;  2ZD8 A;  3IWQ A;  1PI5 A;  3N6I A;  1HD8 A;  4GDB A;  3WS5 A;  4OH0 A;  1K4F A;  4S2N A;  2QPN A;  3WS4 A;  4WYY A;  5HL1 A;  5GLB A;  1ZKJ A;  3NIA A;  1ES5 A;  4X55 A;  3ZG8 B;  5EVI A;  4EBP A;  5FQK A;  3EQV A;  5IHV A;  2ZQA A;  3BFE A;  4S2K A;  5DTK A;  4JXG A;  4OPR A;  5F83 A;  3ZG5 A;  4X69 A;  2ZC7 A;  3IXB A;  4N1H A;  1NY0 A;  4PM6 A;  3HL9 A;  3WRZ A;  4E3K A;  1LHY A;  2WKE A;  3V3R A;  1BLS A;  4PM8 A;  1GA0 A;  1L2S A;  3G4P A;  5DF8 A;  1NJ4 A;  3ZNT A;  4D2O A;  1E3U D;  1H8Y A;  4LV1 A;  4S2N C;  2XDM A;  3IHA A;  5FAO A;  1GHP A;  4DDY A;  1J9M A;  1BLC A;  4P0M A;  3HLE A;  4LV0 A;  1KE4 A;  4KQR A;  2H5S A;  3IH8 A;  5AQA A;  1LI0 A;  3O3V A;  4KZ7 A;  1XX2 A;  3C7V A;  3NDG A;  1ONH A;  4U3T A;  1NYY A;  3MZE A;  3UPN A;  3MXR A;  3O86 A;  5CED A;  5CTN A;  4O7D A;  3UPP A;  4U0T A;  1U60 A;  2XFT A;  4UHU A;  5A91 A;  5M18 A;  4JPM A;  3W4O A;  5HAP A;  3HUN A;  4BL3 A;  4X56 A;  1FCN A;  3HUM A;  1KDS A;  3ITB A;  2UWX A;  4MBF A;  3G30 A;  4A5R A;  3SOI A;  1IEL A;  5DF7 A;  2Y2J A;  1MWU A;  1NRF A;  1XP4 A;  4OOM A;  2XGN A;  4JXS A;  5CGS A;  3S1Y A;  5AQ9 A;  3BLM A;  4FSF A;  1GCE A;  3AGE A;  1YLW A;  5E43 A;  2X71 A;  1IYO A;  3E2L A;  4EQI A;  1ERQ A;  5A92 A;  4IED A;  3CMZ A;  4LEN A;  1FCM A;  5EE8 A;  1IYS A;  1RP5 A;  4ZTK A;  4ZBE A;  1SHV A;  3N4I A;  3RJU A;  4CPK A;  2ZC5 B;  4KEN B;  4FH4 A;  3OPR A;  3Q1F A;  4HES A;  4GKU A;  2XD5 A;  3IH9 A;  1DJC A;  4QD4 A;  1ERO A;  3LY4 A;  3GMW A;  3GR2 A;  4OPZ A;  4RA7 A;  3NCK A;  4IBR A;  3DTM A;  3HVF A;  1ESU A;  3ZVT A;  1MY8 A;  4RYE A;  4B4X A;  3PAG A;  2DCF A;  3VFH A;  1GHM A;  1E4D A;  3FYZ A;  4OLD A;  4RX2 A;  1AXB A;  4EV4 A;  3O87 A;  1TDG A;  5BOH A;  5EVI C;  3LEZ A;  1ONG A;  2EX8 A;  1WYC A;  2P9V A;  2XQZ A;  2ZQ8 A;  2WAD A;  3Q82 A;  3WS1 A;  4BD0 A;  3TOI A;  4JF5 A;  4C6Y A;  1KE0 A;  1ALQ A;  3TSG A;  4Y0T A;  4KZ6 A;  2ZLY A;  1BZA A;  3G31 A;  3MZD A;  4ZJ1 A;  4IVK A;  1E3U A;  4K91 A;  1QME A;  3C4O A;  4DE3 A;  1LI9 A;  1EWZ A;  3S22 A;  1KGG A;  4WZ5 A;  2Y2N A;  3E2K A;  4UAA A;  5A93 A;  2Y59 A;  4JF4 A;  4OP5 A;  4OOY A;  4KG6 A;  3C5A A;  1VQQ A;  2HP6 A;  3HLC A;  3Q7V B;  3MKE A;  2X01 A;  3GRJ A;  4E6X A;  2H0T A;  4S2P A;  3QNC A;  3VP4 A;  2GDN A;  2WK0 A;  2HP5 A;  4HBT A;  4KG5 A;  1BSG A;  1DJA A;  5GHX A;  5FQJ A;  5G18 A;  4F94 A;  4RX3 A;  3UDF A;  1XGI A;  5E2F A;  2XFS A;  1I5Q A;  4KG2 A;  3VOY A;  2DRW A;  1QMF A;  2P9V B;  1JVJ A;  4HBU A;  1NZO A;  2Z2L B;  3VP2 A;  1LL9 A;  5E2G A;  3N7W A;  2FFY A;  1ESI A;  3PBR A;  3ZG9 B;  5J8X A;  4E3N A;  4Q8I A;  3SH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...