4OLDA

Crystal structure of ampc beta-lactamase in complex with the product form of (6r,7r)-7-amino-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
358
structure length
351
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase
source organism Escherichia coli
publication title Substrate deconstruction and the nonadditivity of enzyme recognition.
pubmed doi rcsb
total genus 122
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oldA00
4OOLA 3TOIA 4R4SA 2V1ZA 3O87A 5CGWA 3LO7A 1CK3A 4P85A 1CI8A 4MBHA 2JC7A 5FQ9A 3FKVA 4DE3A 1K25A 3BFEA 1W7FA 1C3BA 4DDYA 5FAOA 4S2NC 1BLHA 1TVFA 3M2KA 4PM6A 1PW1A 2ZQDA 4OQGA 1N9BA 1NYYA 1KE3A 3M2JA 2Y91A 2ZC3B 2Z2LB 2H0TA 3N8SA 5FQQA 4ZDXA 4E6XA 4MBFA 5EOEA 4B4ZA 5FQIA 1BLSA 2WKHA 3BFCA 5DTSA 4KZ6A 4ZTKA 1PYYA 4OLGA 2VGJA 3MXSA 4KENB 4R0QA 3VFHA 1ALQA 3BM6A 3MZEA 2XFTA 4YFMA 3NC8A 1BUEA 4Y0OA 3IHAA 1TEMA 3V3SA 3UPOA 1KGGA 4E6WA 5FA7A 3FZCA 1E3UA 4JXVA 1SHVA 1IELA 4UA6A 1FQGA 5GHZA 5FSRA 3V3RA 3NIAA 3W8KA 4UA9A 4PMAA 1DJBA 1NRFA 2BLSA 1ES2A 4KG6A 1YLTA 5HARA 1W8YA 5E2FA 1Y54A 1L0DA 4KZ8A 1ZKJA 4MEZA 4S2LA 4KG2A 4DXCA 5E2GA 3IXHA 3QNCA 3Q7ZA 4QJGA 4E3IA 2PU4A 4OVDA 4WM9A 2EX9A 2XGNA 4QY5A 4X53A 2UWXA 3OPHA 3OPLA 2ZQ9A 3GSGA 3M6HA 3DW0A 4DDSA 3CZDA 5CHJA 4E3LA 5M1AA 2XQZA 5DTKA 3RJUA 4EBPA 1ZC2A 3CG5A 5FI6A 3ZG0A 4OPRA 3OCLA 3BLSA 3EQVA 4ZJ3A 4UAAA 4KZAA 4CJNA 3W4PA 1ES5A 3ZDJA 1AXBA 3ZCZA 1LLBA 1MXOA 2ZLYA 5HX9A 1HD8A 4LV1A 1JWVA 1YLJA 3G30A 3MXRA 4LCLA 2ZQ8A 1K55C 1NY0A 1MWTA 2X71A 4RX2A 3VP0A 3W4QA 1YLYA 2ZC6B 5A90A 4K91A 5DVAA 1ONGA 2Q9NA 3N4IA 3IWOA 4OPQA 4N9LA 2VGKA 4C6YA 4S2JA 5IHVA 1IYSA 2Y2JA 3C5AA 2ZC5B 3GV9A 2Y2LA 3HLBA 1RCJA 1XKZA 3VOYA 1ERQA 5EVIA 3I7JA 2WZXA 4JPMA 4JXGA 3UE3A 1U60A 2V20A 3C4OA 4EQIA 3ZHHA 3OZHA 3CJMA 4OQHA 5CHUA 4WYYA 4NK3A 5TR7A 2ZC7A 3HL9A 4NETA 3LY3A 5FQKA 4K0XA 4P0MA 4R23A 3VP2A 4EWFA 4EBNA 2IWDA 3P98A 2ZQ7A 1H8YA 1IEMA 2JE5A 5A92A 4EUZA 1VM1A 4KZ9A 5A91A 4KQRA 3Q1FA 4X56A 3C4PA 5EVID 2ZMAA 3ZG7B 1CEGA 3FYZA 4U3TA 2WKIA 1MPLA 1W8QA 1YM1A 4LENA 3VMAA 3ZGAB 2XFSA 3UNWA 2WUQA 4IBRA 1PI4A 3G4PA 2WK0A 3UO9A 3LEZA 3QHYA 4M3KA 1RGYA 4ZJ2A 3HREA 1CEFA 4BL3A 3PBQA 2OLVA 4GKUA 5EOOA 4R1GA 3ITBA 4E3OA 2FFYA 3LCEA 3IH8A 3HLWA 2H5SA 4YINA 5E2EA 1ESUA 3ZG9B 3SOIA 1K57A 1IYQA 1FCOA 4HBUA 3Q7VB 4Q8IA 4OOMA 5GHXA 4Y0TA 3C7UA 1JTGA 2WYXA 3SS5A 3G2ZA 3PBOA 1PIOA 4JKTA 5EVLA 3RXWA 3PBRA 2XK1A 4R4RA 3ZVTA 2HP9A 4XUZA 4WELA 5EE8A 4N1XA 2E8IA 4FH4A 1KDSA 1YQSA 4GD8A 2IWBA 4ZJ1A 3V39A 2EXBA 4BD0A 4DE2A 1GA0A 2HDRA 2XF3A 3IF6C 3VSKA 5FI7A 1SDEA 3RXXA 1NXYA 5GLCA 5D3OA 1BSGA 4PM7A 4JXSA 1LL9A 4MBKA 2DRWA 3N6IA 4JF5A 5CTNA 5FQMA 1L0GA 1DJCA 2C6WB 1O07A 4C3QA 1PWGA 1BULA 1XX2A 5GHYA 1EI5A 5CECA 3BLMA 1MKIA 1QMFA 2A3UA 2HP5A 3UDFA 5KMWA 5FAPA 2HDUA 5CRFA 1K6RA 3ZNYA 2XR0A 2HDQA 2QZ6A 3N8LA 2RL3A 2GDNA 5EVIB 1KDWA 4BQMA 3HLCA 2ZQAA 2Y55A 1YT4A 3S4XA 3BFDA 3ISGA 3O3VA 1DY6A 4OP8A 2Y2HA 1JWPA 3A3FA 1EWZA 2XDMA 2R9WA 2Y2IA 3IXDA 1QMEA 3VP1A 1FSYA 3P09A 5A93A 2XD5A 1MY8A 3EQUA 4E3MA 4GOGA 4P87A 3MKFA 3V50A 1I2WA 1E4DA 4WEKA 3B3XA 4QHCA 5EUAA 1PWDA 3IQAA 4KG5A 1I2SA 1J9MA 2DNSA 2Y2MA 3MZDA 3HLGA 2P9VA 1Q2QA 3GMWA 1NYMA 3TSGA 5CGXA 3GQZA 3WS5A 3E2KA 1BLPA 3HBRA 4KZ7A 1XGIA 5AQAA 1GA9A 1HVBA 1XA7A 4U0XA 3NDGA 5AQ9A 3WWXA 2X02A 2V2FF 4PM8A 2X01A 1IYOA 4WZ4A 4WZ5C 3GTCA 3UDXA 4OP5A 4KQOA 2WADA 3IF6A 4K0WA 3A3EA 4BL2A 2XLNA 2IWCA 2Y2KA 4E3KA 3G34A 5GLBA 1ERMA 1YMSA 1HZOA 2J9PA 3AGFA 5J8XA 1W5DA 4QB8A 4R3JA 4S2PA 5HAQA 4X55A 4S2OA 1IYPA 4JF6A 4LV0A 3ZFZA 4EBLA 3IT9A 2J7VA 2QMIA 5EVIC 4IBXA 2BG1A 1M6KA 2CC1A 2XH9A 4GD6A 2OLUA 3O86A 1RP5A 3S1YA 3SH7A 3ZG5A 4BENA 5F83A 5HFOA 3A3IA 2C5WB 4C75A 3HUNA 1KGEA 4BD1A 5DF7A 3AGEA 5EECA 1K56A 1JTDA 3PBTA 4RYEA 4GNUA 2ZQCA 3TG9A 1H8ZA 2WGVA 3NI9A 5AQBA 2HDSA 3UE0A 4PM9A 5DTTA 5CEDA 4N1HA 5CTMA 4LV2A 4R3BA 5L2FA 1JWZA 3E2LA 1ES3A 3G2YA 5AQ7A 1BLCA 2XD1A 4DE0A 1FCNA 4LCMA 5CXWA 1OMEA 1O7EA 4S2IA 2OSUA 5GLAA 1FR1A 1HTZA 3ZNTA 2J9OA 3OC2A 3BEBA 2WGIA 3DWZA 1M40A 4N9KA 5CHMA 3WS1A 1NZUA 4E3NA 4ZAMA 3W4OA 3SS3A 3ITAA 4OQ0A 3Q7VA 5EPHA 4DXBA 4F94A 3HLDA 1KE0A 2FFFB 3BRMA 5HAPA 2WGWB 1ONHA 1Z6FA 5M18A 1K4EA 3IH9A 3D4FA 3BFGA 3WS0A 1K38A 4S2KA 2J8YA 3G31A 3VP3A 4B4XA 1WE4A 1TDLA 1FOFA 4WZ5A 1PWCA 2QPNA 4JF4A 5M19A 2P9VB 2JCHA 2OV5A 5GLDA 3HUOA 4OKPA 3BECA 3HUMA 4CPKA 5F1FA 5BOHA 3ZG8B 3DTMA 2EX2A 4O7DA 4FSFA 4DRTA 1G6AA 1YLZA 1I5QA 3IHBA 1ES4A 4DF6A 3G32A 5KSHA 4L0LA 1MWUA 4WMCA 3OPRA 1FR6A 4X6TA 5CGSA 4GDBA 1PZOA 3OPPA 4JXWA 1GHIA 3IF6B 4QU3A 4U0TA 5HAIA 3C7VA 4RVAA 3WRTA 1EROA 4HESA 5F82A 4RX3A 4X69A 3PBSA 3A3DA 1YLPA 4OPYA 1KE4A 4N92A 4BLMA 1XXMA 5G18A 1PI5A 4S2NA 3HLFA 5KZHA 2XEPA 4OH0A 4DKIA 4BJPA 5CEBA 1E3UD 1K55A 3G35A 3UE1A 3VSLA 2ZM0A 1MWRA 1XGJA 2EX8A 4PPRA 3ZVWA 3N8RA 4UHUA 2ZM8A 3UDIA 2A49A 1XA1A 3IF5A 4OPZA 1SKFA 5FI2A 5DF8A 5FATA 5E2HA 4GN2A 1H5XA 2B5RA 4S2MA 5KSCA 3IWQA 1LI9A 3UY6A 2PBYA 3HLEA 3A3JA 5FAQA 2Y4AA 1KVMA 1S0WA 4IVIA 3QNBA 1FCMA 1K57C 1MWSA 1XP4A 4QY6A 2Y2PA 3MBZA 3FV7A 2EFUA 1ZG6A 2EXAA 2Y2OA 4IEDA 4LV3A 5HW3A 4FD8A 1K4FA 5E43A 4ZBEA 3VFFA 3MKEA 1SCWA 3PBNA 5F1GA 3O88A 4RA7A 2Q9MA 1IKGA 4FCFA 4KZBA 3SH8A 1KVLA 1GCEA 1L0EA 4MLLA 3DWKA 4XUXA 3CMZA 4H8RA 4EV4A 3IWIA 4OONA 4FH2A 4DE1A 1KGFA 1VQQA 4WBGA 1NZOA 5TGFA 2EFXA 1PZPA 4A5RA 1LHYA 4ID4A 1G68A 2G2UA 4OQIA 3S22A 3NCKA 2Y2NA 2G2WA 1L2SA 1GHMA 4XXRA 2HPBA 5CERA 2Y2GA 3M6BA 1LI0A 3GR2A 1L0FA 3AGDA 1WYCA 2HP6A 4KZ3A 3IXGA 5FQJA 5FASA 2H10A 2ZJ9A 2Z2MB 3BYDA 1WYBA 4OLDA 4GB7A 2WZZA 4HEFA 1K6SA 1BTLA 3NY4A 2EX6A 3PAEA 3N7WA 3UPNA 4PM5A 3WRZA 3FWLA 1K54C 4KZ5A 1K56D 5I94A 1E25A 1Q2PA 5GL9A 1CI9A 4UA7A 2WAFA 3NBLA 3OCNA 3IXBA 1K54A 1BT5A 1ESIA 1FSWA 1NJ4A 1S6RA 1YMXA 3JYIA 1RGZA 1BZAA 1N4OA 3HVFA 3PTEA 3Q82A 4WMCD 3WS4A 2P74A 3V5MA 4JBFA 4MNRA 3PAGA 4GZBA 2ZD8A 1MBLA 4WEJA 2H0YA 1GHPA 2Y59A 5DF9A 5FDHA 3WS2A 4P6BA 2RCXA 4KQQA 4OOYA 4X68A 4B88A 3GRJA 2R9XA 3FKWA 4QD4A 4D2OA 2WGWA 1DJAA 4GDNA 2JBFA 3Q81A 5JYPA 2Y2QA 4Y7PA 5U47A 3GVBA 3MZFA 4Y0UA 3UN7A 3VP4A 3MFDA 3SS4A 1W79A 4E3JA 5TFQA 5HL1A 2ZC4B 4HBTA 1SDNA 1TDGA 1YLWA 1PW8A 2PU2A 2WKEA 2I72A 1IKIA 3VOZA 2ZM2A 5JYOA 1LL5A 2WAEA 3Q07A 1XPBA 3NDEA 4JLFA 3BFFA 3UPPA 4KZ4A 4Z9QA 2DCFA 3SH9A 1ZG4A 4IVKA 1JVJA 3LY4A
chains in the Genus database with same CATH superfamily
3QP6A 4Y15A 3TOIA 3TRCA 2LB5A 4UQIM 4R6LA 2JC7A 3KX0X 2PD8A 4R3AA 1LT0A 3FKVA 3LICA 1C3BA 3OOVA 1H3QA 1VHMA 2EWVA 2ZQDA 4UQIS 4YOFA 2PD7A 5FQIA 1BLSA 3BFCA 4ZTKA 4KENB 4CLCD 1ALQA 4M4XA 3UPOA 4EEUA 1IELA 3T1QB 5FSRA 1DJBA 4KG6A 2P04A 1Y54A 1L0DA 4KZ8A 4MEZA 5DFXA 1IFQA 4KG2A 4DXCA 3IS2B 3Q7ZA 2PU4A 1ACFA 3E0YA 2ZQ9A 5FDSA 3M6HA 3CZDA 4E3LA 2XQZA 2P7JA 4EBPA 3CG5A 3BLSA 3EQVA 3RFBA 4KZAA 3W4PA 3PR6A 3JVVA 3UB8A 3ZCZA 2QKPA 2JKTM 1T18A 4NXGA 5DVAA 2XROA 2Q9NA 5HL6A 3IWOA 2JKRI 3T1XA 4C6YA 3NECA 4S2JA 1IYSA 3GV9A 1RCJA 3VOYA 5EVIA 5HD5A 4EQIA 4ETZA 4WYYA 3TE8A 3HL9A 4NETA 3QP1A 4K0XA 4EWFA 2Z6CA 4EQ1A 4EBNA 1IEMA 3F1NB 5EVID 3C4PA 2ZMAA 4G3VA 1CEGA 4U3TA 4LENA 3VMAA 1F2KA 1S1YA 3UNWA 5FL3A 3G4PA 4WL9A 5AVEA 1RGYA 5KIZA 4GKUA 5EOOA 3LCEA 1XFQA 3IH8A 2J3TD 5E2EA 5IT5A 3E4PA 3C7UA 1JTGA 3G2ZA 3PBOA 1PIOA 5EVLA 3RXWA 4PKYG 2PAVP 4WELA 4O0PA 3LIFA 4GD8A 2IWBA 4DE2A 2ZOHA 1GA0A 3IF6C 2PDRA 3VSKA 3RXXA 3NOUC 1BSGA 3LI9A 2Y79A 1LL9A 2DRWA 4JF5A 4I39A 4MN6A 2C6WB 5HPFA 3RH8B 1O07A 4YWZA 1XX2A 1EI5A 3LR5A 5CECA 3B42A 1QMFA 2JN7A 1K6RA 2RL3A 1N9OA 2WKPA 2ZQAA 2V0UA 3U2AA 4X6TA 4OP8A 3IXDA 3VP1A 3BWLA 3P09A 4Q0JA 2XD5A 1S66L 1MY8A 3V50A 1I2WA 3LI8A 3MR0A 1J9MA 2Y2MA 2P9VA 3KYEA 3GMWA 4FUWA 3TSGA 4EW7A 3GDIA 5CGXA 1ZTUA 3GQZA 3HBRA 5DJUA 2HJ9C 1XA7A 4U0XA 2BASA 3GTCA 4OP5A 4KQOA 4BL2A 5L09A 3UMEA 1ERMA 5C5KA 1W5DA 3MF0A 4HIAA 4JF6A 3CUEC 3S1YA 3SH7A 2C5WB 4C75A 3LR0A 3UB5P 4JGPA 3HUNA 5G4YA 3T4LA 1JTDA 4RYEA 3TG9A 2M1CA 3T4JA 1ES3A 2K7SA 5AQ7A 4DE0A 2QYBA 4LCMA 1O7EA 3EGDC 1UWNX 1HTZA 4G3KA 3BEBA 5CHMA 1VETA 4E3NA 4ZAMA 3SS3A 3ITAA 5EPHA 4GS9B 2FFFB 5HAPA 1ONHA 5M18A 2VEAA 3BFGA 1ODVA 3D72A 1K38A 1D06A 1WE4A 5M19A 1IOUA 3A0VA 3MQ0A 3HUOA 4CPKA 3CI6A 3ZG8B 1G6AA 3IHBA 3W2ZA 3G32A 4L0LA 4GDBA 2A24A 4U0TA 3EEHA 3C7VA 2HZ5A 3A3DA 3T4KA 4N92A 5G18A 1GSVA 1PI5A 5KZHA 5F68A 4BJPA 5CEBA 1E3UD 2VV6A 2PYRA 1MWRA 1XGJA 2EX8A 3ZVWA 3N8RA 4BBVA 3S7OA 3UDIA 1XA1A 5FI2A 3V67A 5DF8A 5FATA 2B5RA 5KSCA 2W0NA 5FAQA 4LFUA 1FCMA 1MWSA 3FV7A 1ZG6A 1V9ZA 5HW3A 3VFFA 3MKEA 5F1GA 3R4KA 2V8CA 3F1PB 4KZBA 1KVLA 2EWWA 3BQ8A 3IWIA 1UWPX 1D7EA 4DE1A 4WBGA 5TGFA 2W1TA 2PT7A 1P97A 1G68A 2G2UA 3NCKA 2Y2NA 2MJ6A 5EV0A 2Y2GA 1LI0A 2JKGA 1L0FA 3AGDA 1WYCA 4L9GA 5FASA 2PHYA 3E98A 4HEFA 1K6SA 1BTLA 4R38A 3N7WA 4PM5A 3FWLA 4EUVA 1K54C 4UA7A 4IHQA 4Q0HA 2GZAA 4P6ZM 1OTIA 1NJ4A 1F98A 1RGZA 3PTEA 1N4OA 1G6OA 1MBLA 1GHPA 2Y59A 5DF9A 4P6BA 2RCXA 4X68A 4B88A 4Z1WA 3FKWA 4EETB 3S7NA 5U47A 4Y7PA 3MZFA 4UEYA 2B18A 4Y0UA 4LRXC 3SS4A 1W79A 5HL1A 1TDGA 3VOLA 5J4EA 3VOZA 5JYOA 2ZM2A 1LL5A 3BFFA 3T4OA 2DCFA 4F3LA 3LY4A 3O87A 4Y3IA 1CK3A 2QJ7A 4MBHA 4BBTA 3DTKA 5FQ9A 3NHQA 5FAOA 4PM6A 1PW1A 4MDZA 1N9BA 1NYYA 1KE3A 5AJGA 2Y91A 2Z2LB 2H0TA 4ZDXA 2XA7M 1PNEA 3TJZC 5EOEA 1KOUA 2WKHA 1F5MA 4OLGA 3VFHA 3BM6A 4YNRA 3NC8A 1BUEA 3IHAA 2QJ5A 1KGGA 4E6WA 1E3UA 4UA6A 1SHVA 3NIAA 4PMAA 2P08A 1NRFA 2VLGA 1ZKJA 3K2NA 3QP8A 2FZ0A 4GCZA 4X53A 2UWXA 3OPHA 5L10A 3OPLA 2LB9A 3DW0A 4DDSA 1L3LA 5CHJA 5DTKA 4Y5FA 3RJUA 2OAQ1 5A8BA 5FI6A 3R7WB 2W27A 2O9AA 4ZJ3A 4CJNA 1ES5A 1H0MA 1MXOA 2ZLYA 4L9EA 4LV1A 1JWVA 1YLJA 3G30A 3HJIA 4LCLA 2ZQ8A 1NY0A 4RX2A 5A90A 3MJQA 3BY8A 4I3JA 2VGKA 5CX7A 1OPXA 2Y2LA 3HLBA 1U60A 3T4QA 4EU0A 3OZHA 4NK3A 5FQKA 3P98A 2L1MA 1SKOB 1VM1A 5A91A 4PAUA 4Y17A 4KQRA 3LFVA 3FYZA 1W8QA 3S7PA 3ZGAB 2WUQA 3LEZA 4ZJ2A 4HJ3A 4MMNA 3ITBA 2H5SA 2UV0E 1ESUA 2R78A 3A0SA 3PXPA 1FCOA 4HBUA 3GECA 2HGVA 4Y0TA 2WYXA 3HCYA 3SS5A 5HWTA 3PBRA 4R4RA 2HP9A 2IA2A 4N1XA 2E8IA 4FH4A 1KDSA 4IJGA 4GHIA 3LEQA 1NLYA 2L0WA 3MSHA 4PM7A 2V9AA 3E4OA 4JXSA 3N6IA 4O8GA 1Z09A 1PWGA 1BULA 5GHYA 4ZRRA 4WN5A 1MKIA 5KMWA 3UDFA 3N8LA 5TBMA 5EVIB 2VKSA 1YT4A 3S4XA 3O3VA 1DY6A 1JWPA 1YSPA 2XDMA 2Y2IA 1FSYA 5A93A 5L07A 5FEGA 2KX6A 1Y28A 3MKFA 5I5LA 2XA7S 4CLCC 1I2SA 3MZDA 3HLGA 4GHIB 3NDGA 5J3WA 2X02A 4HNBA 4ME4A 4WZ4A 2IWCA 3G34A 1YMSA 5J8XA 4X55A 4LV0A 4GJ4A 4EBLA 2VA0A 3IT9A 2J7VA 4IBXA 2BG1A 4WUJA 2XH9A 2QWSA 3O86A 5HFOA 1P9WA 3A3IA 3BW6A 3FC7A 3PBTA 4NG2A 2W3EA 2ZQCA 3LGOA 5CEDA 2HDSA 5CTMA 4LV2A 3MQOA 2XD1A 5GLAA 3T1RA 3OC2A 3DWZA 4N9KA 1M40A 3W4OA 3HJKA 2W3HA 3JPUA 3MXQA 2PRFA 4DXBA 3CHWP 3BRMA 2WGWB 4DJ2A 3L7HA 1K4EA 3IH9A 3D4FA 2G7UA 2J8YA 3G31A 3UB9A 3FG8A 4EERA 1FOFA 2P9VB 1TF1A 2B02A 5GLDA 4OKPA 3T4SA 5F1FA 4O7DA 2EX2A 3UMDA 4DRTA 1S67L 4Y2FA 2VGLS 1MWUA 4E3MA 2KOIA 3IF6B 4RVAA 4HESA 4X69A 1YLPA 4OPYA 1TS8A 1KE4A 1XXMA 1STZA 4OH0A 1VETB 3VSLA 4ESPA 2HF6A 1T1AA 1W63Q 2ZM8A 1SKFA 2O9BA 4S2MA 1P0ZA 1TS7A 1LI9A 4GLQA 2Y4AA 1KVMA 4IVIA 4WF0A 3QNBA 2ZMFA 1A0KA 2EFUA 1G5UA 2EXAA 2Y2OA 4LV3A 4FD8A 1K4FA 4ZBEA 2I9VA 1SCWA 3O88A 1GCEA 3DWKA 2PBDP 4EV4A 5F5YA 2NUPC 3MQQA 4FH2A 3VV4A 1VQQA 1NZOA 2EFXA 3OLOA 2INWA 2G2WA 3CWFA 3GR2A 4KZ3A 4H6JB 2XSSA 4MN7A 4F3LB 4OLDA 2WZZA 4CQHA 1DP9A 3WRZA 1K56D 5I94A 1E25A 1Q2PA 4NEED 1S6RA 1YMXA 2D02A 4MNRA 2PYPA 2W1RA 2R9XA 4D2OA 4GDNA 2JBFA 5JYPA 2E8JA 2Y2QA 3MFDA 5TFQA 3F1OB 3Q07A 3NDEA 2J3TC 2PR5A 1WA9A 5EVEA 5DJTA 2ACGA 3SH9A 4IVKA 2O9CA 3LUQA 2OWJA 5DKLA 3F1PA 2V1ZA 3LO7A 4HH2A 5DKKA 1S4RA 2V0WA 4S2NC 1BLHA 1TVFA 3DAVA 3R7WA 3M2JA 2ZC3B 3EWKA 5FQQA 4E6XA 4KZ6A 1PYYA 4MCWA 4R0QA 3MXSA 1CF0A 3IBRA 3FZCA 3LIAA 3KSHA 4UA9A 1ES2A 1MZUA 1YLTA 5HARA 1W8YA 2Y8HA 1DP6A 5HDCA 5E2GA 3KSIA 5HD3A 3IXHA 3QNCA 4QJGA 4WM9A 2EX9A 4QY5A 4B93A 1FILA 2L4RA 1JNUA 4XT2A 1ZHHB 5M1AA 3PHYA 2A2LA 1ZC2A 3T4TA 4OPRA 2M7UA 5HDSA 4H6JA 4II7A 3ZDJA 1AXBA 2AVXA 4R70A 3MXRA 5MC7A 3G6OA 1OT6A 4OPQA 4CLCE 2Y2JA 3C5AA 1SZVA 3C8CA 1X0OA 1ERQA 3I7JA 2WZXA 3UE3A 3H7WB 3C4OA 4EEPA 3KYQA 5TR7A 3VP2A 4P0MA 4R23A 2W3GA 5K5BA 2IWDA 5A92A 1H8YA 5EM1A 2V8FA 4DN0A 3KSGA 3ZG7B 1MPLA 1Y4OA 2XFSA 4IBRA 1PI4A 3UO9A 5DFYA 2VK3A 1CEFA 4BL3A 2OLVA 4L9FA 4CLCA 1FIKA 3TW8A 1YPRA 2FFYA 4E3OA 3HLWA 3ZG9B 3SOIA 1K57A 1IYQA 2JKFA 1YSQA 4KQDA 3Q7VB 4Q8IA 3LR3A 4GS9A 4XT2B 3BY9A 2NUTC 2OOLA 5EE8A 3SZTA 4HP4A 2VGLM 3PYPA 4BD0A 2YKFA 1SDEA 5GLCA 5D3OA 4LPZA 4MBKA 3CAXA 5FQMA 4C3QA 5F69A 1MC0A 4BMWA 2ZOIA 3RTYA 3BLMA 2HP5A 2M7VA 1F9IA 2GJ3A 2HDUA 3IBJA 3ZNYA 2HDQA 2GDNA 1KDWA 3HLCA 2Y55A 3BFDA 3A3FA 1EWZA 1QMEA 4LLOB 5HZHA 4I3AA 1E4DA 4WEKA 2VV8A 1PWDA 1T1CA 5EUAA 4NXEA 1Q2QA 4I3IA 4GW9A 1NYMA 3WS5A 3L9KA 1XGIA 1GA9A 1HVBA 2O99A 5AQ9A 3WWXA 2X01A 1IYOA 2EA9A 2K31A 4K0WA 2Y2KA 4E3KA 5GLBA 3AGFA 4QB8A 4R3JA 4D60A 1IYPA 3ZFZA 2QMIA 3VE3A 3NULA 3EOIA 3ZG5A 4BENA 5F83A 4WLAA 5TJJA 5HSQA 5HWWA 3NI9A 5AQBA 3UE0A 4PM9A 5DTTA 3BJNA 5L2FA 1JWZA 3E2LA 1BLCA 3CITA 3D3OA 5CXWA 1OMEA 2W3DA 4S2IA 1D1JA 1FR1A 4AFIA 3ICYA 3ZNTA 2J9OA 3WS1A 3LIEA 3MMHA 4OQ0A 1KE0A 2JKRM 5HWVA 4IUKA 4S2KA 4B4XA 3KO6A 1TDLA 4WZ5A 4JF4A 2JCHA 2JKTI 5G4ZA 4PHTA 3K3DA 3BECA 4HOIA 2KLIA 4FSFA 3IX3A 4DF6A 1NRJA 4WMCA 4QU3A 2W3FA 4JXWA 5HAIA 2OWHA 2VX8A 5F82A 4RX3A 1TS6A 3LIBA 4BLMA 4S2NA 3HLFA 4NXFA 4DKIA 1LSVA 1K55A 3UE1A 1XJ3A 2ZM0A 4PPRA 4EXOA 2A49A 3IF5A 4GN2A 3UY6A 4IUHA 4Q0IA 3A3JA 1S0WA 3C2WA 1K57C 1XP4A 4QY6A 4BBUA 4QPRA 4IEDA 1NWZA 1LL8A 4X25A 1OJ5A 1IKGA 4FCFA 3SH8A 1L0EA 4MLLA 3CMZA 3IS2A 3EEAA 1KGFA 1OT9A 1PZPA 4A5RA 3B33A 2V1AA 2W1TB 2CMNA 4OQIA 1XJ4A 3DTEA 5CERA 3F1OA 3M6BA 3IX8A 3IXGA 5FQJA 5EM0A 4X1MA 3F1NA 2Z2MB 3BYDA 1WYBA 3E4QA 3NY4A 1CQAA 2EX6A 3MFXA 3NOTC 2WAFA 3OCNA 1K54A 2FH5A 1BZAA 4CLCB 3QP5A 3V5MA 1OTAA 4JBFA 3PAGA 4WEJA 2H0YA 2WKRA 4JGOA 4QWOA 4G3WA 4OOYA 3GRJA 5AVFA 3VP4A 4E3JA 2ZC4B 4HBTA 2WKEA 2I72A 3CPTB 3EGXC 4JLFA 1XPBA 2ZL1A 2ZL1B 3UPPA 3VE4A 2BTFP 1ZG4A 1JVJA 2VV7A 4O01A 2ZMVA 4OOLA 4R4SA 3FPWA 5CGWA 4P85A 1CI8A 2VJWA 1K0KA 4DE3A 1K25A 1W63M 3BFEA 1W7FA 4DDYA 3H7WA 3M2KA 3T12B 4OQGA 3D9YA 3N8SA 3B47A 3KYZA 4MBFA 4B4ZA 5DTSA 1TD5A 4P6ZS 2VGJA 3MZEA 4YFMA 2XFTA 5L8MA 4Y0OA 1TEMA 3V3SA 4HHDA 5IS1A 3P7NA 5FA7A 4DJ3A 4JXVA 1FQGA 5GHZA 3V3RA 3W8KA 2BLSA 4ETXA 1LSXA 5E2FA 4S2LA 1XFNA 3NOPC 4E3IA 4OVDA 2XGNA 2GNXA 4E04A 3GSGA 2D01A 3ZG0A 3OCLA 4PKYA 4UAAA 5HDDA 3JVUA 4NKPA 1LLBA 4JGQA 1HD8A 1LSWA 5HX9A 3QP4A 2H28A 3KSFA 1K55C 3W4QA 1MWTA 2X71A 1S4SA 3VP0A 1YLYA 2ZC6B 4K91A 1ONGA 3N4IA 4N9LA 5IHVA 2ZC5B 4FTXA 1XKZA 4HY8A 4JPMA 4JXGA 2GX5A 2V20A 3ZHHA 4Y13A 3CJMA 4OQHA 5CHUA 2ZC7A 3LY3A 2ZQ7A 2JE5A 4BWIA 1CJFA 4I5SA 4B9OA 4EUZA 4KZ9A 2VZWA 1SKOA 3Q1FA 4X56A 4K08A 2WKIA 1YM1A 2ZBBA 2WK0A 3QHYA 4M3KA 2Q0OA 2B95A 3HREA 3PBQA 4NXBA 4R1GA 1NLZA 1T19A 4YINA 3ULFA 2J80A 3LR4A 1N9LA 1PRQA 4OOMA 3A0RA 5GHXA 1HLUP 1DP8A 4HI4A 1MKMA 3H82B 4JKTA 2O0YA 2XK1A 3ZVTA 4XUZA 1YQSA 4ZJ1A 3V39A 2EXBA 2HDRA 2XF3A 1GSWA 3UE6A 5FI7A 1NXYA 1EW0A 4ARZA 1PFLA 5CTNA 1L0GA 1DJCA 3FPVA 3LIDA 2A24B 1VEUA 2A3UA 5FAPA 5CRFA 4HJ6A 2XR0A 2QZ6A 5TBMB 4BQMA 3ISGA 2Y2HA 2R9WA 3CLOA 3EQUA 4GOGA 2Z6DA 4P87A 4EESA 2DMWA 3B3XA 4QHCA 3IQAA 4KG5A 2DNSA 4RQ9A 3LYXA 5J7EA 3E2KA 1BLPA 4KZ7A 2PR6A 5AQAA 1OTBA 1OJGA 4ARZB 2V2FF 4PM8A 5F6AA 4WZ5C 3UDXA 1N9NA 2WADA 3IF6A 3A3EA 2XLNA 2J9PA 1HZOA 4X1LA 5HAQA 4S2PA 4S2OA 3C30A 2JHEA 5EVIC 3H82A 3T50A 1M6KA 2CC1A 4DMZA 4GD6A 2OLUA 1RP5A 2KDKA 5HPIA 1YAXA 1KGEA 4BD1A 1V9YA 5DF7A 3AGEA 5EECA 1K56A 5LBRA 1T1BA 4GNUA 1H8ZA 2WGVA 4N1HA 4R3BA 3G2YA 1TS0A 1FCNA 3K3CA 2OSUA 1S1ZA 2QHKA 4HQAA 2WGIA 4KUOA 2WKQA 1NZUA 3ZQ5A 3OBFA 3QP2A 3Q7VA 3P01A 4F94A 3HLDA 3U4LP 1Z6FA 3WS0A 5FEFA 3VP3A 2K2NA 1PWCA 2QPNA 1VB6A 3UB6A 2OV5A 1G28A 1AWIA 3HUMA 3H9WA 5BOHA 3DTMA 2YKHA 4LGWA 1YLZA 1I5QA 1ES4A 1XJ6A 5KSHA 3S7QA 3OPRA 1FR6A 5CGSA 1PZOA 3OPPA 1GHIA 3WRTA 1EROA 3DBAA 3PBSA 2XEPA 1BYWA 4MN5A 3G35A 3DTIA 4HH3A 4UHUA 4FOFA 4OPZA 5E2HA 1H5XA 3IWQA 2PBYA 5IU1A 3HLEA 1OTEA 2Y2PA 3MBZA 4I38A 1YKDA 5E43A 3PBNA 4RA7A 2Q9MA 2XRNA 4XUXA 4H8RA 3O5YA 2HV1A 3T1SA 1P9RA 4OONA 3BQAA 2V1BA 4HP9A 3C38A 3NJAA 4KUKA 1LHYA 3CUEA 4JGRA 3UB7A 4ID4A 1J3WA 3S22A 1L2SA 1GHMA 4XXRA 1DRMA 2HPBA 3CPTA 2HJEA 1XJ2A 2HP6A 2H10A 2ZJ9A 1UGUA 4GB7A 1GSXA 3PAEA 3UPNA 4LRYC 1VEUB 4KZ5A 4LRZE 5GL9A 1CI9A 3NBLA 3IXBA 3ZYTA 1BT5A 1ESIA 1H8MA 3MS6A 1FSWA 3JYIA 4WMCD 3WS4A 3HVFA 3Q82A 2P74A 3IX4A 4GZBA 2ZD8A 1OTDA 5FDHA 3WS2A 4KQQA 2OAP1 4QD4A 2WGWA 1DJAA 3Q81A 2J3WA 5EFWA 3GVBA 4HJ4A 3UN7A 1SDNA 1YLWA 2PU2A 1PW8A 1IKIA 2WAEA 4KZ4A 4Z9QA 3SW1A
chains in the Genus database with same CATH topology
4OOLA 3TOIA 4R4SA 2V1ZA 3O87A 5CGWA 3LO7A 1CK3A 4P85A 1CI8A 4MBHA 2JC7A 5FQ9A 3FKVA 4DE3A 1K25A 3BFEA 1W7FA 1C3BA 4DDYA 5FAOA 4S2NC 1BLHA 1TVFA 3M2KA 4PM6A 1PW1A 2ZQDA 4OQGA 1N9BA 1NYYA 1KE3A 3M2JA 2Y91A 2ZC3B 2Z2LB 2H0TA 3N8SA 5FQQA 4ZDXA 4E6XA 4MBFA 5EOEA 4B4ZA 5FQIA 1BLSA 2WKHA 3BFCA 5DTSA 4KZ6A 4ZTKA 1PYYA 4OLGA 2VGJA 3MXSA 4KENB 4R0QA 3VFHA 1ALQA 3BM6A 3MZEA 2XFTA 4YFMA 3NC8A 1BUEA 4Y0OA 3IHAA 1TEMA 3V3SA 3UPOA 1KGGA 4E6WA 5FA7A 3FZCA 1E3UA 4JXVA 1SHVA 1IELA 4UA6A 1FQGA 5GHZA 5FSRA 3V3RA 3NIAA 3W8KA 4UA9A 4PMAA 1DJBA 1NRFA 2BLSA 1ES2A 4KG6A 1YLTA 5HARA 1W8YA 5E2FA 1Y54A 1L0DA 4KZ8A 1ZKJA 4MEZA 4S2LA 4KG2A 4DXCA 5E2GA 3IXHA 3QNCA 3Q7ZA 4QJGA 4E3IA 2PU4A 4OVDA 4WM9A 2EX9A 2XGNA 4QY5A 4X53A 2UWXA 3OPHA 3OPLA 2ZQ9A 3GSGA 3M6HA 3DW0A 4DDSA 3CZDA 5CHJA 4E3LA 5M1AA 2XQZA 5DTKA 3RJUA 4EBPA 1ZC2A 3CG5A 5FI6A 3ZG0A 4OPRA 3OCLA 3BLSA 3EQVA 4ZJ3A 4UAAA 4KZAA 4CJNA 3W4PA 1ES5A 3ZDJA 1AXBA 3ZCZA 1LLBA 1MXOA 2ZLYA 5HX9A 1HD8A 4LV1A 1JWVA 1YLJA 3G30A 3MXRA 4LCLA 2ZQ8A 1K55C 1NY0A 1MWTA 2X71A 4RX2A 3VP0A 3W4QA 1YLYA 2ZC6B 5A90A 4K91A 5DVAA 1ONGA 2Q9NA 3N4IA 3IWOA 4OPQA 4N9LA 2VGKA 4C6YA 4S2JA 5IHVA 1IYSA 2Y2JA 3C5AA 2ZC5B 3GV9A 2Y2LA 3HLBA 1RCJA 1XKZA 3VOYA 1ERQA 5EVIA 3I7JA 2WZXA 4JPMA 4JXGA 3UE3A 1U60A 2V20A 3C4OA 4EQIA 3ZHHA 3OZHA 3CJMA 4OQHA 5CHUA 4WYYA 4NK3A 5TR7A 2ZC7A 3HL9A 4NETA 3LY3A 5FQKA 4K0XA 4P0MA 4R23A 3VP2A 4EWFA 4EBNA 2IWDA 3P98A 2ZQ7A 1H8YA 1IEMA 2JE5A 5A92A 4EUZA 1VM1A 4KZ9A 5A91A 4KQRA 3Q1FA 4X56A 3C4PA 5EVID 2ZMAA 3ZG7B 1CEGA 3FYZA 4U3TA 2WKIA 1MPLA 1W8QA 1YM1A 4LENA 3VMAA 3ZGAB 2XFSA 3UNWA 2WUQA 4IBRA 1PI4A 3G4PA 2WK0A 3UO9A 3LEZA 3QHYA 4M3KA 1RGYA 4ZJ2A 3HREA 1CEFA 4BL3A 3PBQA 2OLVA 4GKUA 5EOOA 4R1GA 3ITBA 4E3OA 2FFYA 3LCEA 3IH8A 3HLWA 2H5SA 4YINA 5E2EA 1ESUA 3ZG9B 3SOIA 1K57A 1IYQA 1FCOA 4HBUA 3Q7VB 4Q8IA 4OOMA 5GHXA 4Y0TA 3C7UA 1JTGA 2WYXA 3SS5A 3G2ZA 3PBOA 1PIOA 4JKTA 5EVLA 3RXWA 3PBRA 2XK1A 4R4RA 3ZVTA 2HP9A 4XUZA 4WELA 5EE8A 4N1XA 2E8IA 4FH4A 1KDSA 1YQSA 4GD8A 2IWBA 4ZJ1A 3V39A 2EXBA 4BD0A 4DE2A 1GA0A 2HDRA 2XF3A 3IF6C 3VSKA 5FI7A 1SDEA 3RXXA 1NXYA 5GLCA 5D3OA 1BSGA 4PM7A 4JXSA 1LL9A 4MBKA 2DRWA 3N6IA 4JF5A 5CTNA 5FQMA 1L0GA 1DJCA 2C6WB 1O07A 4C3QA 1PWGA 1BULA 1XX2A 5GHYA 1EI5A 5CECA 3BLMA 1MKIA 1QMFA 2A3UA 2HP5A 3UDFA 5KMWA 5FAPA 2HDUA 5CRFA 1K6RA 3ZNYA 2XR0A 2HDQA 2QZ6A 3N8LA 2RL3A 2GDNA 5EVIB 1KDWA 4BQMA 3HLCA 2ZQAA 2Y55A 1YT4A 3S4XA 3BFDA 3ISGA 3O3VA 1DY6A 4OP8A 2Y2HA 1JWPA 3A3FA 1EWZA 2XDMA 2R9WA 2Y2IA 3IXDA 1QMEA 3VP1A 1FSYA 3P09A 5A93A 2XD5A 1MY8A 3EQUA 4E3MA 4GOGA 4P87A 3MKFA 3V50A 1I2WA 1E4DA 4WEKA 3B3XA 4QHCA 5EUAA 1PWDA 3IQAA 4KG5A 1I2SA 1J9MA 2DNSA 2Y2MA 3MZDA 3HLGA 2P9VA 1Q2QA 3GMWA 1NYMA 3TSGA 5CGXA 3GQZA 3WS5A 3E2KA 1BLPA 3HBRA 4KZ7A 1XGIA 5AQAA 1GA9A 1HVBA 1XA7A 4U0XA 3NDGA 5AQ9A 3WWXA 2X02A 2V2FF 4PM8A 2X01A 1IYOA 4WZ4A 4WZ5C 3GTCA 3UDXA 4OP5A 4KQOA 2WADA 3IF6A 4K0WA 3A3EA 4BL2A 2XLNA 2IWCA 2Y2KA 4E3KA 3G34A 5GLBA 1ERMA 1YMSA 1HZOA 2J9PA 3AGFA 5J8XA 1W5DA 4QB8A 4R3JA 4S2PA 5HAQA 4X55A 4S2OA 1IYPA 4JF6A 4LV0A 3ZFZA 4EBLA 3IT9A 2J7VA 2QMIA 5EVIC 4IBXA 2BG1A 1M6KA 2CC1A 2XH9A 4GD6A 2OLUA 3O86A 1RP5A 3S1YA 3SH7A 3ZG5A 4BENA 5F83A 5HFOA 3A3IA 2C5WB 4C75A 3HUNA 1KGEA 4BD1A 5DF7A 3AGEA 5EECA 1K56A 1JTDA 3PBTA 4RYEA 4GNUA 2ZQCA 3TG9A 1H8ZA 2WGVA 3NI9A 5AQBA 2HDSA 3UE0A 4PM9A 5DTTA 5CEDA 4N1HA 5CTMA 4LV2A 4R3BA 5L2FA 1JWZA 3E2LA 1ES3A 3G2YA 5AQ7A 1BLCA 2XD1A 4DE0A 1FCNA 4LCMA 5CXWA 1OMEA 1O7EA 4S2IA 2OSUA 5GLAA 1FR1A 1HTZA 3ZNTA 2J9OA 3OC2A 3BEBA 2WGIA 3DWZA 1M40A 4N9KA 5CHMA 3WS1A 1NZUA 4E3NA 4ZAMA 3W4OA 3SS3A 3ITAA 4OQ0A 3Q7VA 5EPHA 4DXBA 4F94A 3HLDA 1KE0A 2FFFB 3BRMA 5HAPA 2WGWB 1ONHA 1Z6FA 5M18A 1K4EA 3IH9A 3D4FA 3BFGA 3WS0A 1K38A 4S2KA 2J8YA 3G31A 3VP3A 4B4XA 1WE4A 1TDLA 1FOFA 4WZ5A 1PWCA 2QPNA 4JF4A 5M19A 2P9VB 2JCHA 2OV5A 5GLDA 3HUOA 4OKPA 3BECA 3HUMA 4CPKA 5F1FA 5BOHA 3ZG8B 3DTMA 2EX2A 4O7DA 4FSFA 4DRTA 1G6AA 1YLZA 1I5QA 3IHBA 1ES4A 4DF6A 3G32A 5KSHA 4L0LA 1MWUA 4WMCA 3OPRA 1FR6A 4X6TA 5CGSA 4GDBA 1PZOA 3OPPA 4JXWA 1GHIA 3IF6B 4QU3A 4U0TA 5HAIA 3C7VA 4RVAA 3WRTA 1EROA 4HESA 5F82A 4RX3A 4X69A 3PBSA 3A3DA 1YLPA 4OPYA 1KE4A 4N92A 4BLMA 1XXMA 5G18A 1PI5A 4S2NA 3HLFA 5KZHA 2XEPA 4OH0A 4DKIA 4BJPA 5CEBA 1E3UD 1K55A 3G35A 3UE1A 3VSLA 2ZM0A 1MWRA 1XGJA 2EX8A 4PPRA 3ZVWA 3N8RA 4UHUA 2ZM8A 3UDIA 2A49A 1XA1A 3IF5A 4OPZA 1SKFA 5FI2A 5DF8A 5FATA 5E2HA 4GN2A 1H5XA 2B5RA 4S2MA 5KSCA 3IWQA 1LI9A 3UY6A 2PBYA 3HLEA 3A3JA 5FAQA 2Y4AA 1KVMA 1S0WA 4IVIA 3QNBA 1FCMA 1K57C 1MWSA 1XP4A 4QY6A 2Y2PA 3MBZA 3FV7A 2EFUA 1ZG6A 2EXAA 2Y2OA 4IEDA 4LV3A 5HW3A 4FD8A 1K4FA 5E43A 4ZBEA 3VFFA 3MKEA 1SCWA 3PBNA 5F1GA 3O88A 4RA7A 2Q9MA 1IKGA 4FCFA 4KZBA 3SH8A 1KVLA 1GCEA 1L0EA 4MLLA 3DWKA 4XUXA 3CMZA 4H8RA 4EV4A 3IWIA 4OONA 4FH2A 4DE1A 1KGFA 1VQQA 4WBGA 1NZOA 5TGFA 2EFXA 1PZPA 4A5RA 1LHYA 4ID4A 1G68A 2G2UA 4OQIA 3S22A 3NCKA 2Y2NA 2G2WA 1L2SA 1GHMA 4XXRA 2HPBA 5CERA 2Y2GA 3M6BA 1LI0A 3GR2A 1L0FA 3AGDA 1WYCA 2HP6A 4KZ3A 3IXGA 5FQJA 5FASA 2H10A 2ZJ9A 2Z2MB 3BYDA 1WYBA 4OLDA 4GB7A 2WZZA 4HEFA 1K6SA 1BTLA 3NY4A 2EX6A 3PAEA 3N7WA 3UPNA 4PM5A 3WRZA 3FWLA 1K54C 4KZ5A 1K56D 5I94A 1E25A 1Q2PA 5GL9A 1CI9A 4UA7A 2WAFA 3NBLA 3OCNA 3IXBA 1K54A 1BT5A 1ESIA 1FSWA 1NJ4A 1S6RA 1YMXA 3JYIA 1RGZA 1BZAA 1N4OA 3HVFA 3PTEA 3Q82A 4WMCD 3WS4A 2P74A 3V5MA 4JBFA 4MNRA 3PAGA 4GZBA 2ZD8A 1MBLA 4WEJA 2H0YA 1GHPA 2Y59A 5DF9A 5FDHA 3WS2A 4P6BA 2RCXA 4KQQA 4OOYA 4X68A 4B88A 3GRJA 2R9XA 3FKWA 4QD4A 4D2OA 2WGWA 1DJAA 4GDNA 2JBFA 3Q81A 5JYPA 2Y2QA 4Y7PA 5U47A 3GVBA 3MZFA 4Y0UA 3UN7A 3VP4A 3MFDA 3SS4A 1W79A 4E3JA 5TFQA 5HL1A 2ZC4B 4HBTA 1SDNA 1TDGA 1YLWA 1PW8A 2PU2A 2WKEA 2I72A 1IKIA 3VOZA 2ZM2A 5JYOA 1LL5A 2WAEA 3Q07A 1XPBA 3NDEA 4JLFA 3BFFA 3UPPA 4KZ4A 4Z9QA 2DCFA 3SH9A 1ZG4A 4IVKA 1JVJA 3LY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OOL A;  3TOI A;  4R4S A;  2V1Z A;  3O87 A;  5CGW A;  3LO7 A;  1CK3 A;  4P85 A;  1CI8 A;  4MBH A;  2JC7 A;  5FQ9 A;  3FKV A;  4DE3 A;  1K25 A;  3BFE A;  1W7F A;  1C3B A;  4DDY A;  5FAO A;  4S2N C;  1BLH A;  1TVF A;  3M2K A;  4PM6 A;  1PW1 A;  2ZQD A;  4OQG A;  1N9B A;  1NYY A;  1KE3 A;  3M2J A;  2Y91 A;  2ZC3 B;  2Z2L B;  2H0T A;  3N8S A;  5FQQ A;  4ZDX A;  4E6X A;  4MBF A;  5EOE A;  4B4Z A;  5FQI A;  1BLS A;  2WKH A;  3BFC A;  5DTS A;  4KZ6 A;  4ZTK A;  1PYY A;  4OLG A;  2VGJ A;  3MXS A;  4KEN B;  4R0Q A;  3VFH A;  1ALQ A;  3BM6 A;  3MZE A;  2XFT A;  4YFM A;  3NC8 A;  1BUE A;  4Y0O A;  3IHA A;  1TEM A;  3V3S A;  3UPO A;  1KGG A;  4E6W A;  5FA7 A;  3FZC A;  1E3U A;  4JXV A;  1SHV A;  1IEL A;  4UA6 A;  1FQG A;  5GHZ A;  5FSR A;  3V3R A;  3NIA A;  3W8K A;  4UA9 A;  4PMA A;  1DJB A;  1NRF A;  2BLS A;  1ES2 A;  4KG6 A;  1YLT A;  5HAR A;  1W8Y A;  5E2F A;  1Y54 A;  1L0D A;  4KZ8 A;  1ZKJ A;  4MEZ A;  4S2L A;  4KG2 A;  4DXC A;  5E2G A;  3IXH A;  3QNC A;  3Q7Z A;  4QJG A;  4E3I A;  2PU4 A;  4OVD A;  4WM9 A;  2EX9 A;  2XGN A;  4QY5 A;  4X53 A;  2UWX A;  3OPH A;  3OPL A;  2ZQ9 A;  3GSG A;  3M6H A;  3DW0 A;  4DDS A;  3CZD A;  5CHJ A;  4E3L A;  5M1A A;  2XQZ A;  5DTK A;  3RJU A;  4EBP A;  1ZC2 A;  3CG5 A;  5FI6 A;  3ZG0 A;  4OPR A;  3OCL A;  3BLS A;  3EQV A;  4ZJ3 A;  4UAA A;  4KZA A;  4CJN A;  3W4P A;  1ES5 A;  3ZDJ A;  1AXB A;  3ZCZ A;  1LLB A;  1MXO A;  2ZLY A;  5HX9 A;  1HD8 A;  4LV1 A;  1JWV A;  1YLJ A;  3G30 A;  3MXR A;  4LCL A;  2ZQ8 A;  1K55 C;  1NY0 A;  1MWT A;  2X71 A;  4RX2 A;  3VP0 A;  3W4Q A;  1YLY A;  2ZC6 B;  5A90 A;  4K91 A;  5DVA A;  1ONG A;  2Q9N A;  3N4I A;  3IWO A;  4OPQ A;  4N9L A;  2VGK A;  4C6Y A;  4S2J A;  5IHV A;  1IYS A;  2Y2J A;  3C5A A;  2ZC5 B;  3GV9 A;  2Y2L A;  3HLB A;  1RCJ A;  1XKZ A;  3VOY A;  1ERQ A;  5EVI A;  3I7J A;  2WZX A;  4JPM A;  4JXG A;  3UE3 A;  1U60 A;  2V20 A;  3C4O A;  4EQI A;  3ZHH A;  3OZH A;  3CJM A;  4OQH A;  5CHU A;  4WYY A;  4NK3 A;  5TR7 A;  2ZC7 A;  3HL9 A;  4NET A;  3LY3 A;  5FQK A;  4K0X A;  4P0M A;  4R23 A;  3VP2 A;  4EWF A;  4EBN A;  2IWD A;  3P98 A;  2ZQ7 A;  1H8Y A;  1IEM A;  2JE5 A;  5A92 A;  4EUZ A;  1VM1 A;  4KZ9 A;  5A91 A;  4KQR A;  3Q1F A;  4X56 A;  3C4P A;  5EVI D;  2ZMA A;  3ZG7 B;  1CEG A;  3FYZ A;  4U3T A;  2WKI A;  1MPL A;  1W8Q A;  1YM1 A;  4LEN A;  3VMA A;  3ZGA B;  2XFS A;  3UNW A;  2WUQ A;  4IBR A;  1PI4 A;  3G4P A;  2WK0 A;  3UO9 A;  3LEZ A;  3QHY A;  4M3K A;  1RGY A;  4ZJ2 A;  3HRE A;  1CEF A;  4BL3 A;  3PBQ A;  2OLV A;  4GKU A;  5EOO A;  4R1G A;  3ITB A;  4E3O A;  2FFY A;  3LCE A;  3IH8 A;  3HLW A;  2H5S A;  4YIN A;  5E2E A;  1ESU A;  3ZG9 B;  3SOI A;  1K57 A;  1IYQ A;  1FCO A;  4HBU A;  3Q7V B;  4Q8I A;  4OOM A;  5GHX A;  4Y0T A;  3C7U A;  1JTG A;  2WYX A;  3SS5 A;  3G2Z A;  3PBO A;  1PIO A;  4JKT A;  5EVL A;  3RXW A;  3PBR A;  2XK1 A;  4R4R A;  3ZVT A;  2HP9 A;  4XUZ A;  4WEL A;  5EE8 A;  4N1X A;  2E8I A;  4FH4 A;  1KDS A;  1YQS A;  4GD8 A;  2IWB A;  4ZJ1 A;  3V39 A;  2EXB A;  4BD0 A;  4DE2 A;  1GA0 A;  2HDR A;  2XF3 A;  3IF6 C;  3VSK A;  5FI7 A;  1SDE A;  3RXX A;  1NXY A;  5GLC A;  5D3O A;  1BSG A;  4PM7 A;  4JXS A;  1LL9 A;  4MBK A;  2DRW A;  3N6I A;  4JF5 A;  5CTN A;  5FQM A;  1L0G A;  1DJC A;  2C6W B;  1O07 A;  4C3Q A;  1PWG A;  1BUL A;  1XX2 A;  5GHY A;  1EI5 A;  5CEC A;  3BLM A;  1MKI A;  1QMF A;  2A3U A;  2HP5 A;  3UDF A;  5KMW A;  5FAP A;  2HDU A;  5CRF A;  1K6R A;  3ZNY A;  2XR0 A;  2HDQ A;  2QZ6 A;  3N8L A;  2RL3 A;  2GDN A;  5EVI B;  1KDW A;  4BQM A;  3HLC A;  2ZQA A;  2Y55 A;  1YT4 A;  3S4X A;  3BFD A;  3ISG A;  3O3V A;  1DY6 A;  4OP8 A;  2Y2H A;  1JWP A;  3A3F A;  1EWZ A;  2XDM A;  2R9W A;  2Y2I A;  3IXD A;  1QME A;  3VP1 A;  1FSY A;  3P09 A;  5A93 A;  2XD5 A;  1MY8 A;  3EQU A;  4E3M A;  4GOG A;  4P87 A;  3MKF A;  3V50 A;  1I2W A;  1E4D A;  4WEK A;  3B3X A;  4QHC A;  5EUA A;  1PWD A;  3IQA A;  4KG5 A;  1I2S A;  1J9M A;  2DNS A;  2Y2M A;  3MZD A;  3HLG A;  2P9V A;  1Q2Q A;  3GMW A;  1NYM A;  3TSG A;  5CGX A;  3GQZ A;  3WS5 A;  3E2K A;  1BLP A;  3HBR A;  4KZ7 A;  1XGI A;  5AQA A;  1GA9 A;  1HVB A;  1XA7 A;  4U0X A;  3NDG A;  5AQ9 A;  3WWX A;  2X02 A;  2V2F F;  4PM8 A;  2X01 A;  1IYO A;  4WZ4 A;  4WZ5 C;  3GTC A;  3UDX A;  4OP5 A;  4KQO A;  2WAD A;  3IF6 A;  4K0W A;  3A3E A;  4BL2 A;  2XLN A;  2IWC A;  2Y2K A;  4E3K A;  3G34 A;  5GLB A;  1ERM A;  1YMS A;  1HZO A;  2J9P A;  3AGF A;  5J8X A;  1W5D A;  4QB8 A;  4R3J A;  4S2P A;  5HAQ A;  4X55 A;  4S2O A;  1IYP A;  4JF6 A;  4LV0 A;  3ZFZ A;  4EBL A;  3IT9 A;  2J7V A;  2QMI A;  5EVI C;  4IBX A;  2BG1 A;  1M6K A;  2CC1 A;  2XH9 A;  4GD6 A;  2OLU A;  3O86 A;  1RP5 A;  3S1Y A;  3SH7 A;  3ZG5 A;  4BEN A;  5F83 A;  5HFO A;  3A3I A;  2C5W B;  4C75 A;  3HUN A;  1KGE A;  4BD1 A;  5DF7 A;  3AGE A;  5EEC A;  1K56 A;  1JTD A;  3PBT A;  4RYE A;  4GNU A;  2ZQC A;  3TG9 A;  1H8Z A;  2WGV A;  3NI9 A;  5AQB A;  2HDS A;  3UE0 A;  4PM9 A;  5DTT A;  5CED A;  4N1H A;  5CTM A;  4LV2 A;  4R3B A;  5L2F A;  1JWZ A;  3E2L A;  1ES3 A;  3G2Y A;  5AQ7 A;  1BLC A;  2XD1 A;  4DE0 A;  1FCN A;  4LCM A;  5CXW A;  1OME A;  1O7E A;  4S2I A;  2OSU A;  5GLA A;  1FR1 A;  1HTZ A;  3ZNT A;  2J9O A;  3OC2 A;  3BEB A;  2WGI A;  3DWZ A;  1M40 A;  4N9K A;  5CHM A;  3WS1 A;  1NZU A;  4E3N A;  4ZAM A;  3W4O A;  3SS3 A;  3ITA A;  4OQ0 A;  3Q7V A;  5EPH A;  4DXB A;  4F94 A;  3HLD A;  1KE0 A;  2FFF B;  3BRM A;  5HAP A;  2WGW B;  1ONH A;  1Z6F A;  5M18 A;  1K4E A;  3IH9 A;  3D4F A;  3BFG A;  3WS0 A;  1K38 A;  4S2K A;  2J8Y A;  3G31 A;  3VP3 A;  4B4X A;  1WE4 A;  1TDL A;  1FOF A;  4WZ5 A;  1PWC A;  2QPN A;  4JF4 A;  5M19 A;  2P9V B;  2JCH A;  2OV5 A;  5GLD A;  3HUO A;  4OKP A;  3BEC A;  3HUM A;  4CPK A;  5F1F A;  5BOH A;  3ZG8 B;  3DTM A;  2EX2 A;  4O7D A;  4FSF A;  4DRT A;  1G6A A;  1YLZ A;  1I5Q A;  3IHB A;  1ES4 A;  4DF6 A;  3G32 A;  5KSH A;  4L0L A;  1MWU A;  4WMC A;  3OPR A;  1FR6 A;  4X6T A;  5CGS A;  4GDB A;  1PZO A;  3OPP A;  4JXW A;  1GHI A;  3IF6 B;  4QU3 A;  4U0T A;  5HAI A;  3C7V A;  4RVA A;  3WRT A;  1ERO A;  4HES A;  5F82 A;  4RX3 A;  4X69 A;  3PBS A;  3A3D A;  1YLP A;  4OPY A;  1KE4 A;  4N92 A;  4BLM A;  1XXM A;  5G18 A;  1PI5 A;  4S2N A;  3HLF A;  5KZH A;  2XEP A;  4OH0 A;  4DKI A;  4BJP A;  5CEB A;  1E3U D;  1K55 A;  3G35 A;  3UE1 A;  3VSL A;  2ZM0 A;  1MWR A;  1XGJ A;  2EX8 A;  4PPR A;  3ZVW A;  3N8R A;  4UHU A;  2ZM8 A;  3UDI A;  2A49 A;  1XA1 A;  3IF5 A;  4OPZ A;  1SKF A;  5FI2 A;  5DF8 A;  5FAT A;  5E2H A;  4GN2 A;  1H5X A;  2B5R A;  4S2M A;  5KSC A;  3IWQ A;  1LI9 A;  3UY6 A;  2PBY A;  3HLE A;  3A3J A;  5FAQ A;  2Y4A A;  1KVM A;  1S0W A;  4IVI A;  3QNB A;  1FCM A;  1K57 C;  1MWS A;  1XP4 A;  4QY6 A;  2Y2P A;  3MBZ A;  3FV7 A;  2EFU A;  1ZG6 A;  2EXA A;  2Y2O A;  4IED A;  4LV3 A;  5HW3 A;  4FD8 A;  1K4F A;  5E43 A;  4ZBE A;  3VFF A;  3MKE A;  1SCW A;  3PBN A;  5F1G A;  3O88 A;  4RA7 A;  2Q9M A;  1IKG A;  4FCF A;  4KZB A;  3SH8 A;  1KVL A;  1GCE A;  1L0E A;  4MLL A;  3DWK A;  4XUX A;  3CMZ A;  4H8R A;  4EV4 A;  3IWI A;  4OON A;  4FH2 A;  4DE1 A;  1KGF A;  1VQQ A;  4WBG A;  1NZO A;  5TGF A;  2EFX A;  1PZP A;  4A5R A;  1LHY A;  4ID4 A;  1G68 A;  2G2U A;  4OQI A;  3S22 A;  3NCK A;  2Y2N A;  2G2W A;  1L2S A;  1GHM A;  4XXR A;  2HPB A;  5CER A;  2Y2G A;  3M6B A;  1LI0 A;  3GR2 A;  1L0F A;  3AGD A;  1WYC A;  2HP6 A;  4KZ3 A;  3IXG A;  5FQJ A;  5FAS A;  2H10 A;  2ZJ9 A;  2Z2M B;  3BYD A;  1WYB A;  4OLD A;  4GB7 A;  2WZZ A;  4HEF A;  1K6S A;  1BTL A;  3NY4 A;  2EX6 A;  3PAE A;  3N7W A;  3UPN A;  4PM5 A;  3WRZ A;  3FWL A;  1K54 C;  4KZ5 A;  1K56 D;  5I94 A;  1E25 A;  1Q2P A;  5GL9 A;  1CI9 A;  4UA7 A;  2WAF A;  3NBL A;  3OCN A;  3IXB A;  1K54 A;  1BT5 A;  1ESI A;  1FSW A;  1NJ4 A;  1S6R A;  1YMX A;  3JYI A;  1RGZ A;  1BZA A;  1N4O A;  3HVF A;  3PTE A;  3Q82 A;  4WMC D;  3WS4 A;  2P74 A;  3V5M A;  4JBF A;  4MNR A;  3PAG A;  4GZB A;  2ZD8 A;  1MBL A;  4WEJ A;  2H0Y A;  1GHP A;  2Y59 A;  5DF9 A;  5FDH A;  3WS2 A;  4P6B A;  2RCX A;  4KQQ A;  4OOY A;  4X68 A;  4B88 A;  3GRJ A;  2R9X A;  3FKW A;  4QD4 A;  4D2O A;  2WGW A;  1DJA A;  4GDN A;  2JBF A;  3Q81 A;  5JYP A;  2Y2Q A;  4Y7P A;  5U47 A;  3GVB A;  3MZF A;  4Y0U A;  3UN7 A;  3VP4 A;  3MFD A;  3SS4 A;  1W79 A;  4E3J A;  5TFQ A;  5HL1 A;  2ZC4 B;  4HBT A;  1SDN A;  1TDG A;  1YLW A;  1PW8 A;  2PU2 A;  2WKE A;  2I72 A;  1IKI A;  3VOZ A;  2ZM2 A;  5JYO A;  1LL5 A;  2WAE A;  3Q07 A;  1XPB A;  3NDE A;  4JLF A;  3BFF A;  3UPP A;  4KZ4 A;  4Z9Q A;  2DCF A;  3SH9 A;  1ZG4 A;  4IVK A;  1JVJ A;  3LY4 A; 
#chains in the Genus database with same CATH topology
 3QP6 A;  4Y15 A;  3TOI A;  3TRC A;  2LB5 A;  4UQI M;  4R6L A;  2JC7 A;  3KX0 X;  2PD8 A;  4R3A A;  1LT0 A;  3FKV A;  3LIC A;  1C3B A;  3OOV A;  1H3Q A;  1VHM A;  2EWV A;  2ZQD A;  4UQI S;  4YOF A;  2PD7 A;  5FQI A;  1BLS A;  3BFC A;  4ZTK A;  4KEN B;  4CLC D;  1ALQ A;  4M4X A;  3UPO A;  4EEU A;  1IEL A;  3T1Q B;  5FSR A;  1DJB A;  4KG6 A;  2P04 A;  1Y54 A;  1L0D A;  4KZ8 A;  4MEZ A;  5DFX A;  1IFQ A;  4KG2 A;  4DXC A;  3IS2 B;  3Q7Z A;  2PU4 A;  1ACF A;  3E0Y A;  2ZQ9 A;  5FDS A;  3M6H A;  3CZD A;  4E3L A;  2XQZ A;  2P7J A;  4EBP A;  3CG5 A;  3BLS A;  3EQV A;  3RFB A;  4KZA A;  3W4P A;  3PR6 A;  3JVV A;  3UB8 A;  3ZCZ A;  2QKP A;  2JKT M;  1T18 A;  4NXG A;  5DVA A;  2XRO A;  2Q9N A;  5HL6 A;  3IWO A;  2JKR I;  3T1X A;  4C6Y A;  3NEC A;  4S2J A;  1IYS A;  3GV9 A;  1RCJ A;  3VOY A;  5EVI A;  5HD5 A;  4EQI A;  4ETZ A;  4WYY A;  3TE8 A;  3HL9 A;  4NET A;  3QP1 A;  4K0X A;  4EWF A;  2Z6C A;  4EQ1 A;  4EBN A;  1IEM A;  3F1N B;  5EVI D;  3C4P A;  2ZMA A;  4G3V A;  1CEG A;  4U3T A;  4LEN A;  3VMA A;  1F2K A;  1S1Y A;  3UNW A;  5FL3 A;  3G4P A;  4WL9 A;  5AVE A;  1RGY A;  5KIZ A;  4GKU A;  5EOO A;  3LCE A;  1XFQ A;  3IH8 A;  2J3T D;  5E2E A;  5IT5 A;  3E4P A;  3C7U A;  1JTG A;  3G2Z A;  3PBO A;  1PIO A;  5EVL A;  3RXW A;  4PKY G;  2PAV P;  4WEL A;  4O0P A;  3LIF A;  4GD8 A;  2IWB A;  4DE2 A;  2ZOH A;  1GA0 A;  3IF6 C;  2PDR A;  3VSK A;  3RXX A;  3NOU C;  1BSG A;  3LI9 A;  2Y79 A;  1LL9 A;  2DRW A;  4JF5 A;  4I39 A;  4MN6 A;  2C6W B;  5HPF A;  3RH8 B;  1O07 A;  4YWZ A;  1XX2 A;  1EI5 A;  3LR5 A;  5CEC A;  3B42 A;  1QMF A;  2JN7 A;  1K6R A;  2RL3 A;  1N9O A;  2WKP A;  2ZQA A;  2V0U A;  3U2A A;  4X6T A;  4OP8 A;  3IXD A;  3VP1 A;  3BWL A;  3P09 A;  4Q0J A;  2XD5 A;  1S66 L;  1MY8 A;  3V50 A;  1I2W A;  3LI8 A;  3MR0 A;  1J9M A;  2Y2M A;  2P9V A;  3KYE A;  3GMW A;  4FUW A;  3TSG A;  4EW7 A;  3GDI A;  5CGX A;  1ZTU A;  3GQZ A;  3HBR A;  5DJU A;  2HJ9 C;  1XA7 A;  4U0X A;  2BAS A;  3GTC A;  4OP5 A;  4KQO A;  4BL2 A;  5L09 A;  3UME A;  1ERM A;  5C5K A;  1W5D A;  3MF0 A;  4HIA A;  4JF6 A;  3CUE C;  3S1Y A;  3SH7 A;  2C5W B;  4C75 A;  3LR0 A;  3UB5 P;  4JGP A;  3HUN A;  5G4Y A;  3T4L A;  1JTD A;  4RYE A;  3TG9 A;  2M1C A;  3T4J A;  1ES3 A;  2K7S A;  5AQ7 A;  4DE0 A;  2QYB A;  4LCM A;  1O7E A;  3EGD C;  1UWN X;  1HTZ A;  4G3K A;  3BEB A;  5CHM A;  1VET A;  4E3N A;  4ZAM A;  3SS3 A;  3ITA A;  5EPH A;  4GS9 B;  2FFF B;  5HAP A;  1ONH A;  5M18 A;  2VEA A;  3BFG A;  1ODV A;  3D72 A;  1K38 A;  1D06 A;  1WE4 A;  5M19 A;  1IOU A;  3A0V A;  3MQ0 A;  3HUO A;  4CPK A;  3CI6 A;  3ZG8 B;  1G6A A;  3IHB A;  3W2Z A;  3G32 A;  4L0L A;  4GDB A;  2A24 A;  4U0T A;  3EEH A;  3C7V A;  2HZ5 A;  3A3D A;  3T4K A;  4N92 A;  5G18 A;  1GSV A;  1PI5 A;  5KZH A;  5F68 A;  4BJP A;  5CEB A;  1E3U D;  2VV6 A;  2PYR A;  1MWR A;  1XGJ A;  2EX8 A;  3ZVW A;  3N8R A;  4BBV A;  3S7O A;  3UDI A;  1XA1 A;  5FI2 A;  3V67 A;  5DF8 A;  5FAT A;  2B5R A;  5KSC A;  2W0N A;  5FAQ A;  4LFU A;  1FCM A;  1MWS A;  3FV7 A;  1ZG6 A;  1V9Z A;  5HW3 A;  3VFF A;  3MKE A;  5F1G A;  3R4K A;  2V8C A;  3F1P B;  4KZB A;  1KVL A;  2EWW A;  3BQ8 A;  3IWI A;  1UWP X;  1D7E A;  4DE1 A;  4WBG A;  5TGF A;  2W1T A;  2PT7 A;  1P97 A;  1G68 A;  2G2U A;  3NCK A;  2Y2N A;  2MJ6 A;  5EV0 A;  2Y2G A;  1LI0 A;  2JKG A;  1L0F A;  3AGD A;  1WYC A;  4L9G A;  5FAS A;  2PHY A;  3E98 A;  4HEF A;  1K6S A;  1BTL A;  4R38 A;  3N7W A;  4PM5 A;  3FWL A;  4EUV A;  1K54 C;  4UA7 A;  4IHQ A;  4Q0H A;  2GZA A;  4P6Z M;  1OTI A;  1NJ4 A;  1F98 A;  1RGZ A;  3PTE A;  1N4O A;  1G6O A;  1MBL A;  1GHP A;  2Y59 A;  5DF9 A;  4P6B A;  2RCX A;  4X68 A;  4B88 A;  4Z1W A;  3FKW A;  4EET B;  3S7N A;  5U47 A;  4Y7P A;  3MZF A;  4UEY A;  2B18 A;  4Y0U A;  4LRX C;  3SS4 A;  1W79 A;  5HL1 A;  1TDG A;  3VOL A;  5J4E A;  3VOZ A;  5JYO A;  2ZM2 A;  1LL5 A;  3BFF A;  3T4O A;  2DCF A;  4F3L A;  3LY4 A;  3O87 A;  4Y3I A;  1CK3 A;  2QJ7 A;  4MBH A;  4BBT A;  3DTK A;  5FQ9 A;  3NHQ A;  5FAO A;  4PM6 A;  1PW1 A;  4MDZ A;  1N9B A;  1NYY A;  1KE3 A;  5AJG A;  2Y91 A;  2Z2L B;  2H0T A;  4ZDX A;  2XA7 M;  1PNE A;  3TJZ C;  5EOE A;  1KOU A;  2WKH A;  1F5M A;  4OLG A;  3VFH A;  3BM6 A;  4YNR A;  3NC8 A;  1BUE A;  3IHA A;  2QJ5 A;  1KGG A;  4E6W A;  1E3U A;  4UA6 A;  1SHV A;  3NIA A;  4PMA A;  2P08 A;  1NRF A;  2VLG A;  1ZKJ A;  3K2N A;  3QP8 A;  2FZ0 A;  4GCZ A;  4X53 A;  2UWX A;  3OPH A;  5L10 A;  3OPL A;  2LB9 A;  3DW0 A;  4DDS A;  1L3L A;  5CHJ A;  5DTK A;  4Y5F A;  3RJU A;  2OAQ 1;  5A8B A;  5FI6 A;  3R7W B;  2W27 A;  2O9A A;  4ZJ3 A;  4CJN A;  1ES5 A;  1H0M A;  1MXO A;  2ZLY A;  4L9E A;  4LV1 A;  1JWV A;  1YLJ A;  3G30 A;  3HJI A;  4LCL A;  2ZQ8 A;  1NY0 A;  4RX2 A;  5A90 A;  3MJQ A;  3BY8 A;  4I3J A;  2VGK A;  5CX7 A;  1OPX A;  2Y2L A;  3HLB A;  1U60 A;  3T4Q A;  4EU0 A;  3OZH A;  4NK3 A;  5FQK A;  3P98 A;  2L1M A;  1SKO B;  1VM1 A;  5A91 A;  4PAU A;  4Y17 A;  4KQR A;  3LFV A;  3FYZ A;  1W8Q A;  3S7P A;  3ZGA B;  2WUQ A;  3LEZ A;  4ZJ2 A;  4HJ3 A;  4MMN A;  3ITB A;  2H5S A;  2UV0 E;  1ESU A;  2R78 A;  3A0S A;  3PXP A;  1FCO A;  4HBU A;  3GEC A;  2HGV A;  4Y0T A;  2WYX A;  3HCY A;  3SS5 A;  5HWT A;  3PBR A;  4R4R A;  2HP9 A;  2IA2 A;  4N1X A;  2E8I A;  4FH4 A;  1KDS A;  4IJG A;  4GHI A;  3LEQ A;  1NLY A;  2L0W A;  3MSH A;  4PM7 A;  2V9A A;  3E4O A;  4JXS A;  3N6I A;  4O8G A;  1Z09 A;  1PWG A;  1BUL A;  5GHY A;  4ZRR A;  4WN5 A;  1MKI A;  5KMW A;  3UDF A;  3N8L A;  5TBM A;  5EVI B;  2VKS A;  1YT4 A;  3S4X A;  3O3V A;  1DY6 A;  1JWP A;  1YSP A;  2XDM A;  2Y2I A;  1FSY A;  5A93 A;  5L07 A;  5FEG A;  2KX6 A;  1Y28 A;  3MKF A;  5I5L A;  2XA7 S;  4CLC C;  1I2S A;  3MZD A;  3HLG A;  4GHI B;  3NDG A;  5J3W A;  2X02 A;  4HNB A;  4ME4 A;  4WZ4 A;  2IWC A;  3G34 A;  1YMS A;  5J8X A;  4X55 A;  4LV0 A;  4GJ4 A;  4EBL A;  2VA0 A;  3IT9 A;  2J7V A;  4IBX A;  2BG1 A;  4WUJ A;  2XH9 A;  2QWS A;  3O86 A;  5HFO A;  1P9W A;  3A3I A;  3BW6 A;  3FC7 A;  3PBT A;  4NG2 A;  2W3E A;  2ZQC A;  3LGO A;  5CED A;  2HDS A;  5CTM A;  4LV2 A;  3MQO A;  2XD1 A;  5GLA A;  3T1R A;  3OC2 A;  3DWZ A;  4N9K A;  1M40 A;  3W4O A;  3HJK A;  2W3H A;  3JPU A;  3MXQ A;  2PRF A;  4DXB A;  3CHW P;  3BRM A;  2WGW B;  4DJ2 A;  3L7H A;  1K4E A;  3IH9 A;  3D4F A;  2G7U A;  2J8Y A;  3G31 A;  3UB9 A;  3FG8 A;  4EER A;  1FOF A;  2P9V B;  1TF1 A;  2B02 A;  5GLD A;  4OKP A;  3T4S A;  5F1F A;  4O7D A;  2EX2 A;  3UMD A;  4DRT A;  1S67 L;  4Y2F A;  2VGL S;  1MWU A;  4E3M A;  2KOI A;  3IF6 B;  4RVA A;  4HES A;  4X69 A;  1YLP A;  4OPY A;  1TS8 A;  1KE4 A;  1XXM A;  1STZ A;  4OH0 A;  1VET B;  3VSL A;  4ESP A;  2HF6 A;  1T1A A;  1W63 Q;  2ZM8 A;  1SKF A;  2O9B A;  4S2M A;  1P0Z A;  1TS7 A;  1LI9 A;  4GLQ A;  2Y4A A;  1KVM A;  4IVI A;  4WF0 A;  3QNB A;  2ZMF A;  1A0K A;  2EFU A;  1G5U A;  2EXA A;  2Y2O A;  4LV3 A;  4FD8 A;  1K4F A;  4ZBE A;  2I9V A;  1SCW A;  3O88 A;  1GCE A;  3DWK A;  2PBD P;  4EV4 A;  5F5Y A;  2NUP C;  3MQQ A;  4FH2 A;  3VV4 A;  1VQQ A;  1NZO A;  2EFX A;  3OLO A;  2INW A;  2G2W A;  3CWF A;  3GR2 A;  4KZ3 A;  4H6J B;  2XSS A;  4MN7 A;  4F3L B;  4OLD A;  2WZZ A;  4CQH A;  1DP9 A;  3WRZ A;  1K56 D;  5I94 A;  1E25 A;  1Q2P A;  4NEE D;  1S6R A;  1YMX A;  2D02 A;  4MNR A;  2PYP A;  2W1R A;  2R9X A;  4D2O A;  4GDN A;  2JBF A;  5JYP A;  2E8J A;  2Y2Q A;  3MFD A;  5TFQ A;  3F1O B;  3Q07 A;  3NDE A;  2J3T C;  2PR5 A;  1WA9 A;  5EVE A;  5DJT A;  2ACG A;  3SH9 A;  4IVK A;  2O9C A;  3LUQ A;  2OWJ A;  5DKL A;  3F1P A;  2V1Z A;  3LO7 A;  4HH2 A;  5DKK A;  1S4R A;  2V0W A;  4S2N C;  1BLH A;  1TVF A;  3DAV A;  3R7W A;  3M2J A;  2ZC3 B;  3EWK A;  5FQQ A;  4E6X A;  4KZ6 A;  1PYY A;  4MCW A;  4R0Q A;  3MXS A;  1CF0 A;  3IBR A;  3FZC A;  3LIA A;  3KSH A;  4UA9 A;  1ES2 A;  1MZU A;  1YLT A;  5HAR A;  1W8Y A;  2Y8H A;  1DP6 A;  5HDC A;  5E2G A;  3KSI A;  5HD3 A;  3IXH A;  3QNC A;  4QJG A;  4WM9 A;  2EX9 A;  4QY5 A;  4B93 A;  1FIL A;  2L4R A;  1JNU A;  4XT2 A;  1ZHH B;  5M1A A;  3PHY A;  2A2L A;  1ZC2 A;  3T4T A;  4OPR A;  2M7U A;  5HDS A;  4H6J A;  4II7 A;  3ZDJ A;  1AXB A;  2AVX A;  4R70 A;  3MXR A;  5MC7 A;  3G6O A;  1OT6 A;  4OPQ A;  4CLC E;  2Y2J A;  3C5A A;  1SZV A;  3C8C A;  1X0O A;  1ERQ A;  3I7J A;  2WZX A;  3UE3 A;  3H7W B;  3C4O A;  4EEP A;  3KYQ A;  5TR7 A;  3VP2 A;  4P0M A;  4R23 A;  2W3G A;  5K5B A;  2IWD A;  5A92 A;  1H8Y A;  5EM1 A;  2V8F A;  4DN0 A;  3KSG A;  3ZG7 B;  1MPL A;  1Y4O A;  2XFS A;  4IBR A;  1PI4 A;  3UO9 A;  5DFY A;  2VK3 A;  1CEF A;  4BL3 A;  2OLV A;  4L9F A;  4CLC A;  1FIK A;  3TW8 A;  1YPR A;  2FFY A;  4E3O A;  3HLW A;  3ZG9 B;  3SOI A;  1K57 A;  1IYQ A;  2JKF A;  1YSQ A;  4KQD A;  3Q7V B;  4Q8I A;  3LR3 A;  4GS9 A;  4XT2 B;  3BY9 A;  2NUT C;  2OOL A;  5EE8 A;  3SZT A;  4HP4 A;  2VGL M;  3PYP A;  4BD0 A;  2YKF A;  1SDE A;  5GLC A;  5D3O A;  4LPZ A;  4MBK A;  3CAX A;  5FQM A;  4C3Q A;  5F69 A;  1MC0 A;  4BMW A;  2ZOI A;  3RTY A;  3BLM A;  2HP5 A;  2M7V A;  1F9I A;  2GJ3 A;  2HDU A;  3IBJ A;  3ZNY A;  2HDQ A;  2GDN A;  1KDW A;  3HLC A;  2Y55 A;  3BFD A;  3A3F A;  1EWZ A;  1QME A;  4LLO B;  5HZH A;  4I3A A;  1E4D A;  4WEK A;  2VV8 A;  1PWD A;  1T1C A;  5EUA A;  4NXE A;  1Q2Q A;  4I3I A;  4GW9 A;  1NYM A;  3WS5 A;  3L9K A;  1XGI A;  1GA9 A;  1HVB A;  2O99 A;  5AQ9 A;  3WWX A;  2X01 A;  1IYO A;  2EA9 A;  2K31 A;  4K0W A;  2Y2K A;  4E3K A;  5GLB A;  3AGF A;  4QB8 A;  4R3J A;  4D60 A;  1IYP A;  3ZFZ A;  2QMI A;  3VE3 A;  3NUL A;  3EOI A;  3ZG5 A;  4BEN A;  5F83 A;  4WLA A;  5TJJ A;  5HSQ A;  5HWW A;  3NI9 A;  5AQB A;  3UE0 A;  4PM9 A;  5DTT A;  3BJN A;  5L2F A;  1JWZ A;  3E2L A;  1BLC A;  3CIT A;  3D3O A;  5CXW A;  1OME A;  2W3D A;  4S2I A;  1D1J A;  1FR1 A;  4AFI A;  3ICY A;  3ZNT A;  2J9O A;  3WS1 A;  3LIE A;  3MMH A;  4OQ0 A;  1KE0 A;  2JKR M;  5HWV A;  4IUK A;  4S2K A;  4B4X A;  3KO6 A;  1TDL A;  4WZ5 A;  4JF4 A;  2JCH A;  2JKT I;  5G4Z A;  4PHT A;  3K3D A;  3BEC A;  4HOI A;  2KLI A;  4FSF A;  3IX3 A;  4DF6 A;  1NRJ A;  4WMC A;  4QU3 A;  2W3F A;  4JXW A;  5HAI A;  2OWH A;  2VX8 A;  5F82 A;  4RX3 A;  1TS6 A;  3LIB A;  4BLM A;  4S2N A;  3HLF A;  4NXF A;  4DKI A;  1LSV A;  1K55 A;  3UE1 A;  1XJ3 A;  2ZM0 A;  4PPR A;  4EXO A;  2A49 A;  3IF5 A;  4GN2 A;  3UY6 A;  4IUH A;  4Q0I A;  3A3J A;  1S0W A;  3C2W A;  1K57 C;  1XP4 A;  4QY6 A;  4BBU A;  4QPR A;  4IED A;  1NWZ A;  1LL8 A;  4X25 A;  1OJ5 A;  1IKG A;  4FCF A;  3SH8 A;  1L0E A;  4MLL A;  3CMZ A;  3IS2 A;  3EEA A;  1KGF A;  1OT9 A;  1PZP A;  4A5R A;  3B33 A;  2V1A A;  2W1T B;  2CMN A;  4OQI A;  1XJ4 A;  3DTE A;  5CER A;  3F1O A;  3M6B A;  3IX8 A;  3IXG A;  5FQJ A;  5EM0 A;  4X1M A;  3F1N A;  2Z2M B;  3BYD A;  1WYB A;  3E4Q A;  3NY4 A;  1CQA A;  2EX6 A;  3MFX A;  3NOT C;  2WAF A;  3OCN A;  1K54 A;  2FH5 A;  1BZA A;  4CLC B;  3QP5 A;  3V5M A;  1OTA A;  4JBF A;  3PAG A;  4WEJ A;  2H0Y A;  2WKR A;  4JGO A;  4QWO A;  4G3W A;  4OOY A;  3GRJ A;  5AVF A;  3VP4 A;  4E3J A;  2ZC4 B;  4HBT A;  2WKE A;  2I72 A;  3CPT B;  3EGX C;  4JLF A;  1XPB A;  2ZL1 A;  2ZL1 B;  3UPP A;  3VE4 A;  2BTF P;  1ZG4 A;  1JVJ A;  2VV7 A;  4O01 A;  2ZMV A;  4OOL A;  4R4S A;  3FPW A;  5CGW A;  4P85 A;  1CI8 A;  2VJW A;  1K0K A;  4DE3 A;  1K25 A;  1W63 M;  3BFE A;  1W7F A;  4DDY A;  3H7W A;  3M2K A;  3T12 B;  4OQG A;  3D9Y A;  3N8S A;  3B47 A;  3KYZ A;  4MBF A;  4B4Z A;  5DTS A;  1TD5 A;  4P6Z S;  2VGJ A;  3MZE A;  4YFM A;  2XFT A;  5L8M A;  4Y0O A;  1TEM A;  3V3S A;  4HHD A;  5IS1 A;  3P7N A;  5FA7 A;  4DJ3 A;  4JXV A;  1FQG A;  5GHZ A;  3V3R A;  3W8K A;  2BLS A;  4ETX A;  1LSX A;  5E2F A;  4S2L A;  1XFN A;  3NOP C;  4E3I A;  4OVD A;  2XGN A;  2GNX A;  4E04 A;  3GSG A;  2D01 A;  3ZG0 A;  3OCL A;  4PKY A;  4UAA A;  5HDD A;  3JVU A;  4NKP A;  1LLB A;  4JGQ A;  1HD8 A;  1LSW A;  5HX9 A;  3QP4 A;  2H28 A;  3KSF A;  1K55 C;  3W4Q A;  1MWT A;  2X71 A;  1S4S A;  3VP0 A;  1YLY A;  2ZC6 B;  4K91 A;  1ONG A;  3N4I A;  4N9L A;  5IHV A;  2ZC5 B;  4FTX A;  1XKZ A;  4HY8 A;  4JPM A;  4JXG A;  2GX5 A;  2V20 A;  3ZHH A;  4Y13 A;  3CJM A;  4OQH A;  5CHU A;  2ZC7 A;  3LY3 A;  2ZQ7 A;  2JE5 A;  4BWI A;  1CJF A;  4I5S A;  4B9O A;  4EUZ A;  4KZ9 A;  2VZW A;  1SKO A;  3Q1F A;  4X56 A;  4K08 A;  2WKI A;  1YM1 A;  2ZBB A;  2WK0 A;  3QHY A;  4M3K A;  2Q0O A;  2B95 A;  3HRE A;  3PBQ A;  4NXB A;  4R1G A;  1NLZ A;  1T19 A;  4YIN A;  3ULF A;  2J80 A;  3LR4 A;  1N9L A;  1PRQ A;  4OOM A;  3A0R A;  5GHX A;  1HLU P;  1DP8 A;  4HI4 A;  1MKM A;  3H82 B;  4JKT A;  2O0Y A;  2XK1 A;  3ZVT A;  4XUZ A;  1YQS A;  4ZJ1 A;  3V39 A;  2EXB A;  2HDR A;  2XF3 A;  1GSW A;  3UE6 A;  5FI7 A;  1NXY A;  1EW0 A;  4ARZ A;  1PFL A;  5CTN A;  1L0G A;  1DJC A;  3FPV A;  3LID A;  2A24 B;  1VEU A;  2A3U A;  5FAP A;  5CRF A;  4HJ6 A;  2XR0 A;  2QZ6 A;  5TBM B;  4BQM A;  3ISG A;  2Y2H A;  2R9W A;  3CLO A;  3EQU A;  4GOG A;  2Z6D A;  4P87 A;  4EES A;  2DMW A;  3B3X A;  4QHC A;  3IQA A;  4KG5 A;  2DNS A;  4RQ9 A;  3LYX A;  5J7E A;  3E2K A;  1BLP A;  4KZ7 A;  2PR6 A;  5AQA A;  1OTB A;  1OJG A;  4ARZ B;  2V2F F;  4PM8 A;  5F6A A;  4WZ5 C;  3UDX A;  1N9N A;  2WAD A;  3IF6 A;  3A3E A;  2XLN A;  2J9P A;  1HZO A;  4X1L A;  5HAQ A;  4S2P A;  4S2O A;  3C30 A;  2JHE A;  5EVI C;  3H82 A;  3T50 A;  1M6K A;  2CC1 A;  4DMZ A;  4GD6 A;  2OLU A;  1RP5 A;  2KDK A;  5HPI A;  1YAX A;  1KGE A;  4BD1 A;  1V9Y A;  5DF7 A;  3AGE A;  5EEC A;  1K56 A;  5LBR A;  1T1B A;  4GNU A;  1H8Z A;  2WGV A;  4N1H A;  4R3B A;  3G2Y A;  1TS0 A;  1FCN A;  3K3C A;  2OSU A;  1S1Z A;  2QHK A;  4HQA A;  2WGI A;  4KUO A;  2WKQ A;  1NZU A;  3ZQ5 A;  3OBF A;  3QP2 A;  3Q7V A;  3P01 A;  4F94 A;  3HLD A;  3U4L P;  1Z6F A;  3WS0 A;  5FEF A;  3VP3 A;  2K2N A;  1PWC A;  2QPN A;  1VB6 A;  3UB6 A;  2OV5 A;  1G28 A;  1AWI A;  3HUM A;  3H9W A;  5BOH A;  3DTM A;  2YKH A;  4LGW A;  1YLZ A;  1I5Q A;  1ES4 A;  1XJ6 A;  5KSH A;  3S7Q A;  3OPR A;  1FR6 A;  5CGS A;  1PZO A;  3OPP A;  1GHI A;  3WRT A;  1ERO A;  3DBA A;  3PBS A;  2XEP A;  1BYW A;  4MN5 A;  3G35 A;  3DTI A;  4HH3 A;  4UHU A;  4FOF A;  4OPZ A;  5E2H A;  1H5X A;  3IWQ A;  2PBY A;  5IU1 A;  3HLE A;  1OTE A;  2Y2P A;  3MBZ A;  4I38 A;  1YKD A;  5E43 A;  3PBN A;  4RA7 A;  2Q9M A;  2XRN A;  4XUX A;  4H8R A;  3O5Y A;  2HV1 A;  3T1S A;  1P9R A;  4OON A;  3BQA A;  2V1B A;  4HP9 A;  3C38 A;  3NJA A;  4KUK A;  1LHY A;  3CUE A;  4JGR A;  3UB7 A;  4ID4 A;  1J3W A;  3S22 A;  1L2S A;  1GHM A;  4XXR A;  1DRM A;  2HPB A;  3CPT A;  2HJE A;  1XJ2 A;  2HP6 A;  2H10 A;  2ZJ9 A;  1UGU A;  4GB7 A;  1GSX A;  3PAE A;  3UPN A;  4LRY C;  1VEU B;  4KZ5 A;  4LRZ E;  5GL9 A;  1CI9 A;  3NBL A;  3IXB A;  3ZYT A;  1BT5 A;  1ESI A;  1H8M A;  3MS6 A;  1FSW A;  3JYI A;  4WMC D;  3WS4 A;  3HVF A;  3Q82 A;  2P74 A;  3IX4 A;  4GZB A;  2ZD8 A;  1OTD A;  5FDH A;  3WS2 A;  4KQQ A;  2OAP 1;  4QD4 A;  2WGW A;  1DJA A;  3Q81 A;  2J3W A;  5EFW A;  3GVB A;  4HJ4 A;  3UN7 A;  1SDN A;  1YLW A;  2PU2 A;  1PW8 A;  1IKI A;  2WAE A;  4KZ4 A;  4Z9Q A;  3SW1 A; 
#chains in the Genus database with same CATH homology
 4OOL A;  3TOI A;  4R4S A;  2V1Z A;  3O87 A;  5CGW A;  3LO7 A;  1CK3 A;  4P85 A;  1CI8 A;  4MBH A;  2JC7 A;  5FQ9 A;  3FKV A;  4DE3 A;  1K25 A;  3BFE A;  1W7F A;  1C3B A;  4DDY A;  5FAO A;  4S2N C;  1BLH A;  1TVF A;  3M2K A;  4PM6 A;  1PW1 A;  2ZQD A;  4OQG A;  1N9B A;  1NYY A;  1KE3 A;  3M2J A;  2Y91 A;  2ZC3 B;  2Z2L B;  2H0T A;  3N8S A;  5FQQ A;  4ZDX A;  4E6X A;  4MBF A;  5EOE A;  4B4Z A;  5FQI A;  1BLS A;  2WKH A;  3BFC A;  5DTS A;  4KZ6 A;  4ZTK A;  1PYY A;  4OLG A;  2VGJ A;  3MXS A;  4KEN B;  4R0Q A;  3VFH A;  1ALQ A;  3BM6 A;  3MZE A;  2XFT A;  4YFM A;  3NC8 A;  1BUE A;  4Y0O A;  3IHA A;  1TEM A;  3V3S A;  3UPO A;  1KGG A;  4E6W A;  5FA7 A;  3FZC A;  1E3U A;  4JXV A;  1SHV A;  1IEL A;  4UA6 A;  1FQG A;  5GHZ A;  5FSR A;  3V3R A;  3NIA A;  3W8K A;  4UA9 A;  4PMA A;  1DJB A;  1NRF A;  2BLS A;  1ES2 A;  4KG6 A;  1YLT A;  5HAR A;  1W8Y A;  5E2F A;  1Y54 A;  1L0D A;  4KZ8 A;  1ZKJ A;  4MEZ A;  4S2L A;  4KG2 A;  4DXC A;  5E2G A;  3IXH A;  3QNC A;  3Q7Z A;  4QJG A;  4E3I A;  2PU4 A;  4OVD A;  4WM9 A;  2EX9 A;  2XGN A;  4QY5 A;  4X53 A;  2UWX A;  3OPH A;  3OPL A;  2ZQ9 A;  3GSG A;  3M6H A;  3DW0 A;  4DDS A;  3CZD A;  5CHJ A;  4E3L A;  5M1A A;  2XQZ A;  5DTK A;  3RJU A;  4EBP A;  1ZC2 A;  3CG5 A;  5FI6 A;  3ZG0 A;  4OPR A;  3OCL A;  3BLS A;  3EQV A;  4ZJ3 A;  4UAA A;  4KZA A;  4CJN A;  3W4P A;  1ES5 A;  3ZDJ A;  1AXB A;  3ZCZ A;  1LLB A;  1MXO A;  2ZLY A;  5HX9 A;  1HD8 A;  4LV1 A;  1JWV A;  1YLJ A;  3G30 A;  3MXR A;  4LCL A;  2ZQ8 A;  1K55 C;  1NY0 A;  1MWT A;  2X71 A;  4RX2 A;  3VP0 A;  3W4Q A;  1YLY A;  2ZC6 B;  5A90 A;  4K91 A;  5DVA A;  1ONG A;  2Q9N A;  3N4I A;  3IWO A;  4OPQ A;  4N9L A;  2VGK A;  4C6Y A;  4S2J A;  5IHV A;  1IYS A;  2Y2J A;  3C5A A;  2ZC5 B;  3GV9 A;  2Y2L A;  3HLB A;  1RCJ A;  1XKZ A;  3VOY A;  1ERQ A;  5EVI A;  3I7J A;  2WZX A;  4JPM A;  4JXG A;  3UE3 A;  1U60 A;  2V20 A;  3C4O A;  4EQI A;  3ZHH A;  3OZH A;  3CJM A;  4OQH A;  5CHU A;  4WYY A;  4NK3 A;  5TR7 A;  2ZC7 A;  3HL9 A;  4NET A;  3LY3 A;  5FQK A;  4K0X A;  4P0M A;  4R23 A;  3VP2 A;  4EWF A;  4EBN A;  2IWD A;  3P98 A;  2ZQ7 A;  1H8Y A;  1IEM A;  2JE5 A;  5A92 A;  4EUZ A;  1VM1 A;  4KZ9 A;  5A91 A;  4KQR A;  3Q1F A;  4X56 A;  3C4P A;  5EVI D;  2ZMA A;  3ZG7 B;  1CEG A;  3FYZ A;  4U3T A;  2WKI A;  1MPL A;  1W8Q A;  1YM1 A;  4LEN A;  3VMA A;  3ZGA B;  2XFS A;  3UNW A;  2WUQ A;  4IBR A;  1PI4 A;  3G4P A;  2WK0 A;  3UO9 A;  3LEZ A;  3QHY A;  4M3K A;  1RGY A;  4ZJ2 A;  3HRE A;  1CEF A;  4BL3 A;  3PBQ A;  2OLV A;  4GKU A;  5EOO A;  4R1G A;  3ITB A;  4E3O A;  2FFY A;  3LCE A;  3IH8 A;  3HLW A;  2H5S A;  4YIN A;  5E2E A;  1ESU A;  3ZG9 B;  3SOI A;  1K57 A;  1IYQ A;  1FCO A;  4HBU A;  3Q7V B;  4Q8I A;  4OOM A;  5GHX A;  4Y0T A;  3C7U A;  1JTG A;  2WYX A;  3SS5 A;  3G2Z A;  3PBO A;  1PIO A;  4JKT A;  5EVL A;  3RXW A;  3PBR A;  2XK1 A;  4R4R A;  3ZVT A;  2HP9 A;  4XUZ A;  4WEL A;  5EE8 A;  4N1X A;  2E8I A;  4FH4 A;  1KDS A;  1YQS A;  4GD8 A;  2IWB A;  4ZJ1 A;  3V39 A;  2EXB A;  4BD0 A;  4DE2 A;  1GA0 A;  2HDR A;  2XF3 A;  3IF6 C;  3VSK A;  5FI7 A;  1SDE A;  3RXX A;  1NXY A;  5GLC A;  5D3O A;  1BSG A;  4PM7 A;  4JXS A;  1LL9 A;  4MBK A;  2DRW A;  3N6I A;  4JF5 A;  5CTN A;  5FQM A;  1L0G A;  1DJC A;  2C6W B;  1O07 A;  4C3Q A;  1PWG A;  1BUL A;  1XX2 A;  5GHY A;  1EI5 A;  5CEC A;  3BLM A;  1MKI A;  1QMF A;  2A3U A;  2HP5 A;  3UDF A;  5KMW A;  5FAP A;  2HDU A;  5CRF A;  1K6R A;  3ZNY A;  2XR0 A;  2HDQ A;  2QZ6 A;  3N8L A;  2RL3 A;  2GDN A;  5EVI B;  1KDW A;  4BQM A;  3HLC A;  2ZQA A;  2Y55 A;  1YT4 A;  3S4X A;  3BFD A;  3ISG A;  3O3V A;  1DY6 A;  4OP8 A;  2Y2H A;  1JWP A;  3A3F A;  1EWZ A;  2XDM A;  2R9W A;  2Y2I A;  3IXD A;  1QME A;  3VP1 A;  1FSY A;  3P09 A;  5A93 A;  2XD5 A;  1MY8 A;  3EQU A;  4E3M A;  4GOG A;  4P87 A;  3MKF A;  3V50 A;  1I2W A;  1E4D A;  4WEK A;  3B3X A;  4QHC A;  5EUA A;  1PWD A;  3IQA A;  4KG5 A;  1I2S A;  1J9M A;  2DNS A;  2Y2M A;  3MZD A;  3HLG A;  2P9V A;  1Q2Q A;  3GMW A;  1NYM A;  3TSG A;  5CGX A;  3GQZ A;  3WS5 A;  3E2K A;  1BLP A;  3HBR A;  4KZ7 A;  1XGI A;  5AQA A;  1GA9 A;  1HVB A;  1XA7 A;  4U0X A;  3NDG A;  5AQ9 A;  3WWX A;  2X02 A;  2V2F F;  4PM8 A;  2X01 A;  1IYO A;  4WZ4 A;  4WZ5 C;  3GTC A;  3UDX A;  4OP5 A;  4KQO A;  2WAD A;  3IF6 A;  4K0W A;  3A3E A;  4BL2 A;  2XLN A;  2IWC A;  2Y2K A;  4E3K A;  3G34 A;  5GLB A;  1ERM A;  1YMS A;  1HZO A;  2J9P A;  3AGF A;  5J8X A;  1W5D A;  4QB8 A;  4R3J A;  4S2P A;  5HAQ A;  4X55 A;  4S2O A;  1IYP A;  4JF6 A;  4LV0 A;  3ZFZ A;  4EBL A;  3IT9 A;  2J7V A;  2QMI A;  5EVI C;  4IBX A;  2BG1 A;  1M6K A;  2CC1 A;  2XH9 A;  4GD6 A;  2OLU A;  3O86 A;  1RP5 A;  3S1Y A;  3SH7 A;  3ZG5 A;  4BEN A;  5F83 A;  5HFO A;  3A3I A;  2C5W B;  4C75 A;  3HUN A;  1KGE A;  4BD1 A;  5DF7 A;  3AGE A;  5EEC A;  1K56 A;  1JTD A;  3PBT A;  4RYE A;  4GNU A;  2ZQC A;  3TG9 A;  1H8Z A;  2WGV A;  3NI9 A;  5AQB A;  2HDS A;  3UE0 A;  4PM9 A;  5DTT A;  5CED A;  4N1H A;  5CTM A;  4LV2 A;  4R3B A;  5L2F A;  1JWZ A;  3E2L A;  1ES3 A;  3G2Y A;  5AQ7 A;  1BLC A;  2XD1 A;  4DE0 A;  1FCN A;  4LCM A;  5CXW A;  1OME A;  1O7E A;  4S2I A;  2OSU A;  5GLA A;  1FR1 A;  1HTZ A;  3ZNT A;  2J9O A;  3OC2 A;  3BEB A;  2WGI A;  3DWZ A;  1M40 A;  4N9K A;  5CHM A;  3WS1 A;  1NZU A;  4E3N A;  4ZAM A;  3W4O A;  3SS3 A;  3ITA A;  4OQ0 A;  3Q7V A;  5EPH A;  4DXB A;  4F94 A;  3HLD A;  1KE0 A;  2FFF B;  3BRM A;  5HAP A;  2WGW B;  1ONH A;  1Z6F A;  5M18 A;  1K4E A;  3IH9 A;  3D4F A;  3BFG A;  3WS0 A;  1K38 A;  4S2K A;  2J8Y A;  3G31 A;  3VP3 A;  4B4X A;  1WE4 A;  1TDL A;  1FOF A;  4WZ5 A;  1PWC A;  2QPN A;  4JF4 A;  5M19 A;  2P9V B;  2JCH A;  2OV5 A;  5GLD A;  3HUO A;  4OKP A;  3BEC A;  3HUM A;  4CPK A;  5F1F A;  5BOH A;  3ZG8 B;  3DTM A;  2EX2 A;  4O7D A;  4FSF A;  4DRT A;  1G6A A;  1YLZ A;  1I5Q A;  3IHB A;  1ES4 A;  4DF6 A;  3G32 A;  5KSH A;  4L0L A;  1MWU A;  4WMC A;  3OPR A;  1FR6 A;  4X6T A;  5CGS A;  4GDB A;  1PZO A;  3OPP A;  4JXW A;  1GHI A;  3IF6 B;  4QU3 A;  4U0T A;  5HAI A;  3C7V A;  4RVA A;  3WRT A;  1ERO A;  4HES A;  5F82 A;  4RX3 A;  4X69 A;  3PBS A;  3A3D A;  1YLP A;  4OPY A;  1KE4 A;  4N92 A;  4BLM A;  1XXM A;  5G18 A;  1PI5 A;  4S2N A;  3HLF A;  5KZH A;  2XEP A;  4OH0 A;  4DKI A;  4BJP A;  5CEB A;  1E3U D;  1K55 A;  3G35 A;  3UE1 A;  3VSL A;  2ZM0 A;  1MWR A;  1XGJ A;  2EX8 A;  4PPR A;  3ZVW A;  3N8R A;  4UHU A;  2ZM8 A;  3UDI A;  2A49 A;  1XA1 A;  3IF5 A;  4OPZ A;  1SKF A;  5FI2 A;  5DF8 A;  5FAT A;  5E2H A;  4GN2 A;  1H5X A;  2B5R A;  4S2M A;  5KSC A;  3IWQ A;  1LI9 A;  3UY6 A;  2PBY A;  3HLE A;  3A3J A;  5FAQ A;  2Y4A A;  1KVM A;  1S0W A;  4IVI A;  3QNB A;  1FCM A;  1K57 C;  1MWS A;  1XP4 A;  4QY6 A;  2Y2P A;  3MBZ A;  3FV7 A;  2EFU A;  1ZG6 A;  2EXA A;  2Y2O A;  4IED A;  4LV3 A;  5HW3 A;  4FD8 A;  1K4F A;  5E43 A;  4ZBE A;  3VFF A;  3MKE A;  1SCW A;  3PBN A;  5F1G A;  3O88 A;  4RA7 A;  2Q9M A;  1IKG A;  4FCF A;  4KZB A;  3SH8 A;  1KVL A;  1GCE A;  1L0E A;  4MLL A;  3DWK A;  4XUX A;  3CMZ A;  4H8R A;  4EV4 A;  3IWI A;  4OON A;  4FH2 A;  4DE1 A;  1KGF A;  1VQQ A;  4WBG A;  1NZO A;  5TGF A;  2EFX A;  1PZP A;  4A5R A;  1LHY A;  4ID4 A;  1G68 A;  2G2U A;  4OQI A;  3S22 A;  3NCK A;  2Y2N A;  2G2W A;  1L2S A;  1GHM A;  4XXR A;  2HPB A;  5CER A;  2Y2G A;  3M6B A;  1LI0 A;  3GR2 A;  1L0F A;  3AGD A;  1WYC A;  2HP6 A;  4KZ3 A;  3IXG A;  5FQJ A;  5FAS A;  2H10 A;  2ZJ9 A;  2Z2M B;  3BYD A;  1WYB A;  4OLD A;  4GB7 A;  2WZZ A;  4HEF A;  1K6S A;  1BTL A;  3NY4 A;  2EX6 A;  3PAE A;  3N7W A;  3UPN A;  4PM5 A;  3WRZ A;  3FWL A;  1K54 C;  4KZ5 A;  1K56 D;  5I94 A;  1E25 A;  1Q2P A;  5GL9 A;  1CI9 A;  4UA7 A;  2WAF A;  3NBL A;  3OCN A;  3IXB A;  1K54 A;  1BT5 A;  1ESI A;  1FSW A;  1NJ4 A;  1S6R A;  1YMX A;  3JYI A;  1RGZ A;  1BZA A;  1N4O A;  3HVF A;  3PTE A;  3Q82 A;  4WMC D;  3WS4 A;  2P74 A;  3V5M A;  4JBF A;  4MNR A;  3PAG A;  4GZB A;  2ZD8 A;  1MBL A;  4WEJ A;  2H0Y A;  1GHP A;  2Y59 A;  5DF9 A;  5FDH A;  3WS2 A;  4P6B A;  2RCX A;  4KQQ A;  4OOY A;  4X68 A;  4B88 A;  3GRJ A;  2R9X A;  3FKW A;  4QD4 A;  4D2O A;  2WGW A;  1DJA A;  4GDN A;  2JBF A;  3Q81 A;  5JYP A;  2Y2Q A;  4Y7P A;  5U47 A;  3GVB A;  3MZF A;  4Y0U A;  3UN7 A;  3VP4 A;  3MFD A;  3SS4 A;  1W79 A;  4E3J A;  5TFQ A;  5HL1 A;  2ZC4 B;  4HBT A;  1SDN A;  1TDG A;  1YLW A;  1PW8 A;  2PU2 A;  2WKE A;  2I72 A;  1IKI A;  3VOZ A;  2ZM2 A;  5JYO A;  1LL5 A;  2WAE A;  3Q07 A;  1XPB A;  3NDE A;  4JLF A;  3BFF A;  3UPP A;  4KZ4 A;  4Z9Q A;  2DCF A;  3SH9 A;  1ZG4 A;  4IVK A;  1JVJ A;  3LY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...