4OLDA

Crystal structure of ampc beta-lactamase in complex with the product form of (6r,7r)-7-amino-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Substrate deconstruction and the nonadditivity of enzyme recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 122
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oldA00
3C7UA 1NYYA 4RX2A 3G35A 3NIAA 1NZUA 4KENB 1W8QA 4YINA 1BLHA 1IYOA 4WZ4A 2X02A 1CEGA 3OPRA 4HEFA 1O7EA 4U3TA 1TEMA 5FDHA 4N1XA 5CTNA 1MKIA 5HL1A 2JE5A 4NK3A 4OQGA 3A3DA 3HL9A 5GLCA 3MZFA 3V50A 4WMCD 2ZQ7A 3Q7ZA 1ALQA 1WYBA 3WS1A 4JXSA 1K55C 1Q2PA 2ZC5B 2WGWA 4DE2A 3VP0A 3IXDA 1DY6A 1XPBA 3ZVWA 4LV1A 3W4OA 1FCMA 2P74A 2Y2NA 3RJUA 2Y2KA 1YLPA 5E2EA 2H10A 4QB8A 4YFMA 3QHYA 1LI0A 3VP3A 3G4PA 2B5RA 3HLBA 1BLSA 3ZCZA 4OLDA 4RYEA 5FQ9A 2WK0A 5EVID 1H8ZA 1BSGA 4IVIA 3S22A 2HPBA 4OKPA 3Q7VA 1RCJA 5HAPA 3MKEA 1K57A 2Y91A 3BEBA 2BG1A 4A5RA 3PBSA 3BRMA 1N9BA 1YMXA 5DF7A 5HAQA 2C5WB 1RGYA 2Z2LB 3ZGAB 4P85A 4DE3A 4KQOA 4XXRA 3IH9A 3HLFA 5F82A 3BM6A 1MPLA 4KQRA 2QMIA 2V20A 3NCKA 4KQQA 2DNSA 2JC7A 5EPHA 2IWBA 4CJNA 2ZLYA 5AQBA 4C3QA 4OONA 5FQMA 1MXOA 3IF6C 1KDWA 1YLWA 2WKHA 1IYQA 5F83A 1NJ4A 1XKZA 4UA6A 4IBXA 1TDGA 4WEKA 4XUZA 1CK3A 4OPRA 4ZDXA 3HUNA 3W8KA 3ZG5A 3FKWA 4R23A 1NYMA 2HDSA 5GLDA 3DWKA 1IKIA 1KE4A 2J9PA 5AQ7A 1VQQA 4ZJ3A 1JWZA 2ZQ9A 1XP4A 3P98A 4B88A 4KG5A 3M2KA 4K0XA 4MBHA 3Q1FA 3UPNA 3O3VA 4HBUA 3LEZA 1YMSA 3UN7A 1K4FA 4LCLA 1IKGA 3MBZA 1JTDA 4OP8A 2EX8A 4X56A 4X6TA 2X01A 4GD6A 2ZM0A 1BLPA 3D4FA 1U60A 4FH2A 1DJAA 3UE0A 3ISGA 4E3NA 2Q9NA 3ITBA 1PI5A 1I5QA 5A90A 5FASA 3C4OA 4BD0A 2R9XA 3N8SA 4X68A 5D3OA 3HLCA 3PBOA 3VFHA 3MZEA 4EBNA 4S2NC 2Y2LA 3NDEA 4JKTA 4EBLA 4ZJ1A 1XA1A 1PI4A 3DWZA 5EE8A 2H0YA 4S2LA 1FR6A 4EWFA 3G2YA 3GVBA 1EWZA 1K38A 3G32A 5E2GA 5EOEA 5BOHA 4DXBA 3DW0A 1Y54A 2E8IA 5FI7A 3WRTA 5CEDA 2CC1A 4LV2A 1K56A 1XGIA 4N9KA 4UA9A 3WS5A 4F94A 1KVLA 3CG5A 2EX2A 2Y59A 3MXRA 4N92A 3N8RA 4M3KA 4R1GA 1FR1A 5CRFA 1EROA 3E2KA 3BFDA 2XEPA 3V5MA 4S2PA 5EVLA 1IEMA 1LI9A 5CGSA 1PZOA 4KZ9A 3VP2A 4OQHA 1IYPA 4UHUA 2ZC3B 3LY3A 4WEJA 3SH7A 1FCNA 2ZQCA 4OOLA 1BT5A 4GKUA 4JBFA 3EQUA 1W7FA 4X69A 4HBTA 2X71A 4IVKA 3FV7A 3M6BA 4BD1A 3UY6A 4E3IA 2Q9MA 1HTZA 5HW3A 1ES3A 4E3JA 3IXHA 1G68A 4Y0OA 2Z2MB 1CI8A 1PW1A 5M1AA 4E3LA 2Y2MA 2EFXA 5FA7A 3UPOA 3IF6B 3HBRA 2XH9A 2G2WA 1NY0A 1FOFA 1YLTA 2BLSA 2VGKA 4GD8A 2DCFA 1K54C 3HVFA 3NY4A 1K6RA 1RGZA 4H8RA 5HX9A 2PBYA 4WBGA 1K55A 1MWTA 4RA7A 1BULA 4ID4A 1K6SA 1KDSA 2QZ6A 3IXBA 1HZOA 1TVFA 1LHYA 2HP9A 2ZJ9A 1XXMA 1AXBA 1GHPA 2JCHA 3PBTA 5AQ9A 5FQIA 1IELA 3ZG8B 3ZG0A 1FSWA 1K56D 4N9LA 2EXBA 5EECA 1RP5A 4RX3A 2WGIA 2ZC4B 4Y7PA 1YLZA 1GA9A 2Y2JA 4OQIA 4OQ0A 5FAPA 5FATA 3OPLA 3SH8A 2DRWA 2QPNA 3QNBA 1TDLA 4QHCA 3VOZA 3W4QA 3NDGA 3O86A 2ZD8A 3ZG7B 3ZNYA 4FD8A 3PBNA 5CGXA 1NRFA 5TFQA 3WS2A 1PYYA 4LENA 1O07A 4QY6A 1QMFA 3A3FA 3GR2A 3IQAA 4WZ5C 5GHXA 4E3MA 5FQJA 2OLUA 1SKFA 4DKIA 2J7VA 1GCEA 1SHVA 3BFCA 1M6KA 3V39A 3ZVTA 4E3OA 2Y2GA 2Y2PA 3Q07A 1ERQA 4GNUA 4KZ8A 3N6IA 4LV3A 2XD5A 3IF6A 4OP5A 4OOMA 1H8YA 3C7VA 3LY4A 4B4ZA 3VFFA 1PWCA 4MBFA 4FSFA 5L2FA 2A49A 5CXWA 1W5DA 1K4EA 2EX6A 5G18A 1G6AA 4KZ6A 2JBFA 4BL2A 1L0GA 5CHJA 3V3SA 3SS5A 1BUEA 3DTMA 4L0LA 4DDYA 3FYZA 5E2FA 1XA7A 4IBRA 4PPRA 4E6WA 5CHMA 3UPPA 5J8XA 2Y2HA 1GHMA 2XDMA 4JPMA 5KSHA 2EXAA 4RVAA 3VMAA 4PM6A 4IEDA 3NI9A 3A3JA 3ZHHA 4R3JA 1E25A 3A3EA 2Y55A 3IWIA 4PM9A 3HUOA 1MWRA 1YT4A 2WKIA 4KG6A 3BLMA 1XX2A 1ES5A 4JXGA 4GOGA 2PU4A 4ZJ2A 3HLDA 1KE0A 3FKVA 3Q81A 1EI5A 5FAQA 1MWSA 4R4RA 1MY8A 5GHZA 2FFFB 1YLJA 4S2NA 2XFTA 5KSCA 5FI2A 3PAEA 4S2MA 1XGJA 3G31A 4EBPA 1KE3A 3JYIA 3ZFZA 4S2KA 2HP5A 1PW8A 2Y2IA 3GSGA 3ITAA 3TOIA 4GDNA 3P09A 3CMZA 2WKEA 4JF5A 1SDEA 3C5AA 4NETA 3ZDJA 4BENA 2WAFA 4BL3A 3WS4A 5DF8A 2Y4AA 4ZBEA 1LLBA 3G30A 4OPQA 1PWDA 4JF6A 5HFOA 4E6XA 2ZQ8A 5FI6A 5DTKA 4Q8IA 5CERA 5JYOA 4DE0A 3IWQA 3SOIA 2J8YA 1CI9A 3MXSA 4BLMA 3MZDA 1L0DA 1W8YA 2H5SA 3OZHA 3UDFA 3WS0A 5EVIC 4DDSA 4KZ5A 1C3BA 2Y2QA 1KVMA 1NZOA 4QY5A 3SS3A 2ZQDA 5M19A 3WRZA 4C6YA 2EX9A 3PAGA 4R4SA 4XUXA 5CHUA 5F1FA 4PM7A 1FCOA 2XFSA 4GB7A 4JLFA 1J9MA 3SH9A 2XQZA 3OCNA 4D2OA 1E4DA 5CEBA 2HDQA 1ONGA 4WYYA 1PWGA 4R0QA 4MBKA 4BQMA 3B3XA 5A91A 2P9VB 4EQIA 3BFFA 1FQGA 4HESA 2EFUA 1S6RA 4S2OA 5AQAA 5HAIA 3VOYA 3BFGA 4FH4A 4OPZA 5CTMA 4C75A 2ZMAA 4O7DA 3BECA 5FQQA 1LL5A 2HDRA 1E3UA 5M18A 3I7JA 3UNWA 2R9WA 1M40A 3O88A 3HREA 3S1YA 3N8LA 1K54A 4JXWA 2ZQAA 1MWUA 4P87A 4UAAA 4QJGA 2OSUA 2V2FF 2ZM2A 2ZM8A 3IXGA 4QD4A 3PBRA 1PZPA 4E3KA 2WZZA 3HUMA 2OLVA 3UO9A 2WYXA 2XD1A 1JTGA 2XR0A 3IWOA 3MKFA 5FQKA 1W79A 3TG9A 4Y0TA 2WUQA 2RCXA 2J9OA 2XLNA 4DRTA 3MFDA 3SS4A 5U47A 3GRJA 3N7WA 2PU2A 1JWPA 4R3BA 3V3RA 4KZ4A 4P0MA 3WWXA 1ESIA 1DJCA 1L0FA 3OCLA 1K57C 4KZAA 5GL9A 2HP6A 4K0WA 3ZNTA 3UDIA 3O87A 4CPKA 3AGDA 5KZHA 1I2SA 3BLSA 1WYCA 3PBQA 4Z9QA 1ES2A 1KGGA 2OV5A 3VP1A 1GA0A 5GLAA 3VP4A 4MLLA 2WZXA 3M2JA 1SCWA 2C6WB 4S2IA 4P6BA 4WZ5A 2P9VA 3BYDA 4K91A 3HLEA 4FCFA 1Z6FA 3Q82A 3CZDA 1Q2QA 2H0TA 4GN2A 1OMEA 3NC8A 3TSGA 3BFEA 1DJBA 1ES4A 1YLYA 1E3UD 4JXVA 3UDXA 5CECA 5F1GA 5HARA 4PM5A 2I72A 2WGVA 1FSYA 3N4IA 1ZG4A 1BLCA 5IHVA 1CEFA 1H5XA 1YM1A 2VGJA 2HDUA 3IF5A 3IHAA 3OPPA 5EVIB 5FSRA 3VSLA 4ZTKA 1HVBA 3M6HA 3A3IA 4LV0A 3C4PA 1ZC2A 4MEZA 3UE3A 3OC2A 1MBLA 3HLWA 5I94A 1S0WA 4U0TA 5EOOA 4KZ7A 1ESUA 2FFYA 2GDNA 2XGNA 2ZC6B 3FWLA 4GZBA 2RL3A 5CGWA 2ZC7A 2XK1A 1L0EA 3CJMA 1I2WA 1ONHA 1YQSA 1VM1A 3IT9A 1JWVA 3IHBA 4QU3A 5DVAA 3LO7A 4EUZA 4MNRA 4OPYA 5TR7A 3G34A 4JF4A 3GQZA 3ZG9B 4OLGA 3NBLA 1K25A 3GV9A 1IYSA 4X53A 4X55A 1KGFA 1KGEA 5GLBA 4DE1A 3AGEA 4OVDA 3LCEA 4OH0A 5TGFA 4B4XA 3IH8A 1GHIA 2WAEA 4UA7A 1ERMA 5GHYA 4WMCA 2IWDA 5A92A 3RXXA 4LCMA 1ZKJA 4EV4A 3AGFA 1PIOA 4DXCA 2WGWB 2UWXA 2Y2OA 3G2ZA 4PM8A 2A3UA 3W4PA 3OPHA 4KZ3A 4Y0UA 1WE4A 4WM9A 2XF3A 5DTSA 2WADA 4BJPA 4KG2A 1LL9A 3E2LA 4ZAMA 1QMEA 3FZCA 3GMWA 4DF6A 1ZG6A 1L2SA 1JVJA 4PMAA 2V1ZA 3UE1A 4OOYA 2G2UA 3HLGA 3QNCA 4WELA 1NXYA 1SDNA 5EVIA 5DTTA 5FAOA 5JYPA 2IWCA 3Q7VB 3VSKA 3RXWA 3GTCA 3EQVA 4U0XA 1BZAA 3S4XA 1BTLA 3PTEA 4GDBA 4S2JA 5EUAA 4N1HA 5A93A 5E2HA 1N4OA 5DF9A 1HD8A 4KZBA 5KMWA 5E43A
chains in the Genus database with same CATH superfamily
3NIAA 3QP2A 4EU0A 4DN0A 4HEFA 4L9GA 4Z1WA 4BBUA 3CLOA 3MZFA 4H6JA 4WMCD 1S1ZA 1K55C 3JVVA 3VP0A 3VOLA 1XFQA 3UB8A 3F1NA 3LI8A 3JVUA 4LRZE 4LRYC 4NEED 3G4PA 2B5RA 3HLBA 4RYEA 4GS9B 3S22A 4OKPA 3Q7VA 5HDDA 1K57A 3BEBA 3P7NA 5DF7A 4Y2FA 2C5WB 4DE3A 4XXRA 2I9VA 3BY8A 2QMIA 3NCKA 4KQQA 2JC7A 3D3OA 1V9YA 2GX5A 1HLUP 5FQMA 3MR0A 1YLWA 5F83A 1IYQA 4UA6A 1TDGA 4WEKA 4XUZA 4LLOB 3W8KA 3ZG5A 1TF1A 3FKWA 2ZOHA 4R23A 1G28A 3DWKA 1IKIA 3IBJA 2EWVA 3UB5P 4B88A 4NXFA 4HP4A 1KOUA 3UPNA 3O3VA 1FIKA 3UN7A 1G6OA 5HWWA 1JTDA 4X56A 3UE0A 3D4FA 4KUOA 3ITBA 5A90A 5FASA 4BD0A 2R9XA 2ZMFA 2VGLS 5D3OA 3NDEA 4ZJ1A 3PXPA 5EE8A 3DWZA 4S2LA 5BOHA 3DW0A 1Y54A 5L07A 4LV2A 3MMHA 4N9KA 1KVLA 2QJ5A 2EX2A 3MXRA 2GJ3A 4M3KA 1EROA 3E2KA 3MJQA 4S2PA 1LI9A 5CGSA 4KZ9A 4II7A 4WEJA 1FCNA 1LSWA 4X69A 3VV4A 5HW3A 4E3JA 3IXHA 4HI4A 3C8CA 1PW1A 2O9AA 4E3LA 2H28A 2G2WA 1XJ6A 1NY0A 1K0KA 4GD8A 1K54C 3HVFA 1P9WA 1VEUA 2A24B 3HJIA 2QWSA 4CLCC 2QZ6A 4CQHA 1H8MA 1GHPA 5AQ9A 2QKPA 2WGIA 4QWOA 1GA9A 3CHWP 3MSHA 4OQIA 5FAPA 3SH8A 1YPRA 2QPNA 4QHCA 3D72A 2ZD8A 4FD8A 5CGXA 1PYYA 4LENA 4E3MA 4WZ5C 1QMFA 3GR2A 5FQJA 4MDZA 1SKFA 3DBAA 4DKIA 2J7VA 2J80A 3S7NA 1SHVA 3BFCA 1P97A 4Y3IA 3ZVTA 2Y2PA 4E3OA 3R4KA 4X1MA 2XD5A 4OOMA 2QYBA 2VLGA 2A49A 5CXWA 1K4EA 3EEHA 4IHQA 1G6AA 1XJ2A 2GNXA 2VEAA 3DTEA 3DTMA 2P04A 4DDYA 5E2FA 5KSHA 1GHMA 2XDMA 2W3DA 4RVAA 4I39A 4R3JA 1YSQA 3HUOA 2PRFA 5G4ZA 1ES5A 2W1TB 4ZJ2A 3PYPA 3Q81A 4L9FA 5I5LA 4IUHA 4S2NA 3PAEA 1KE3A 3JYIA 1PW8A 3ITAA 3H82A 1SKOA 3P09A 4CLCB 4BENA 2WAFA 4ZBEA 5HFOA 4LRXC 2ZQ8A 2O99A 5FEFA 3MZDA 5EVIC 4DDSA 4KZ5A 1C3BA 5M19A 1KVMA 1NZOA 3TJZC 3TW8A 5CHUA 4XUXA 1FCOA 2XFSA 3L9KA 2YKFA 4D2OA 2V8CA 1MZUA 3BQ8A 3F1OA 1PWGA 3CUEC 4EQ1A 4BQMA 2PD8A 3VOYA 3T4SA 1LL5A 3JPUA 1NRJA 5M18A 2ZMVA 1W63Q 4I3IA 3O88A 3HREA 3PHYA 3N8LA 4JXWA 3U4LP 4E04A 1MWUA 5TBMB 4I5SA 2OSUA 2V2FF 1PZPA 4E3KA 2WZZA 2WYXA 3ULFA 3BQAA 3IWOA 5FQKA 2INWA 3CAXA 2XLNA 4LGWA 1IFQA 3SS4A 5U47A 4P0MA 3KSIA 1ESIA 1DJCA 2VK3A 3OCLA 4KZAA 3ZNTA 3AGDA 2GZAA 1I2SA 4Q0HA 1ES2A 3UB6A 1GA0A 3VP4A 2WZXA 5DKKA 3HLEA 1MKMA 3Q82A 4PAUA 2H0TA 1OMEA 3TSGA 3BFEA 4JXVA 1E3UD 5F1GA 1P0ZA 5IHVA 4O0PA 1FSYA 3N4IA 1CEFA 3IF5A 3IHAA 5EVIB 1HVBA 4LV0A 5L8MA 3UE3A 1ESUA 5CGWA 3VE4A 1L0EA 1ONHA 1VM1A 1IOUA 5DVAA 3LO7A 2P7JA 2B18A 3E4OA 4JF4A 5K5BA 3ZG9B 4OLGA 1K25A 1IYSA 5HZHA 4X53A 4X55A 4WLAA 3AGEA 5FEGA 4B4XA 2WAEA 4WMCA 2P08A 2PDRA 4LCMA 5HD5A 4GS9A 3AGFA 1WA9A 2HV1A 2Q0OA 2PYRA 4WM9A 2R78A 5MC7A 2VGLM 3GMWA 3R7WA 1L2SA 1JVJA 2M1CA 1SDNA 4ARZB 5JYPA 3FPWA 3S4XA 3PTEA 3HJKA 1N4OA 2B02A 5DF9A 2J3TC 1NZUA 1W8QA 4YINA 1IYOA 2X02A 4NKPA 1CEGA 3OPRA 4GLQA 1O7EA 1OJ5A 1TEMA 5FDHA 4N1XA 5CTNA 3T1SA 4OQGA 4NK3A 3HL9A 3LR3A 3DTIA 3QP6A 2ZQ7A 2KX6A 1UWPX 2WKQA 3NECA 2WGWA 3IXDA 1DY6A 1XPBA 3ZVWA 4LV1A 1FCMA 3T4TA 2P74A 1AWIA 3E0YA 5E2EA 4QB8A 1BLSA 3ZCZA 3VE3A 5FQ9A 2DMWA 3IBRA 1RCJA 3MKEA 4A5RA 1N9BA 1YMXA 1OTBA 4CLCE 2Z2LB 4P85A 3HLFA 3BM6A 1MPLA 2JN7A 5EPHA 5AQBA 5IS1A 4C3QA 5DFYA 3NJAA 3IF6C 4Y13A 1KDWA 2WKHA 1NJ4A 4OPRA 3HUNA 3T50A 4EXOA 1KE4A 2J9PA 1VQQA 2L0WA 3P98A 4MBHA 1T1AA 3Q1FA 1YMSA 1K4FA 3MBZA 2EX8A 2X01A 4FH2A 1DJAA 3ISGA 4E3NA 1PI5A 1Y28A 3HLCA 3VFHA 3MZEA 2Y2LA 3QP1A 2H0YA 4EWFA 3GVBA 1OTEA 4DXBA 5CEDA 2CC1A 1TS6A 2VX8A 4N92A 3N8RA 3NOUC 1IEMA 1F2KA 4OQHA 1IYPA 4UHUA 2ZC3B 3SH7A 3K3CA 1BT5A 4GKUA 5L10A 3EQUA 4IVKA 4BD1A 3QP5A 4UQIS 1TS0A 1Y4OA 3MQ0A 2Q9MA 1G68A 2Z2MB 5M1AA 1G5UA 4AFIA 2EFXA 5FA7A 3IF6B 4GHIB 5L09A 5F69A 4H8RA 2Y8HA 4WBGA 1BULA 4ID4A 3IXBA 1HZOA 5J4EA 3OBFA 3NOPC 2JCHA 5FQIA 3ZG8B 4HJ6A 1IELA 1K56D 2K2NA 2V8FA 2EXBA 4RX3A 4LFUA 2ZC4B 4Y7PA 1F9IA 1YKDA 5FATA 4OQ0A 3W4QA 3NDGA 2D02A 3ZG7B 4R3AA 2VA0A 2JKFA 5GHXA 1MC0A 2YKHA 3LR0A 1ERQA 3N6IA 3OOVA 3IX8A 3IS2A 2W0NA 3MQQA 1PWCA 5EVEA 5L2FA 2L1MA 3E4QA 4KZ6A 3SS5A 1BUEA 5TBMA 4IBRA 1GSVA 1LSVA 4PPRA 5CHMA 3T4JA 4HHDA 3VMAA 4IEDA 3DTKA 3A3EA 1MWRA 2V0WA 4KG6A 1N9NA 3FKVA 1D06A 1EI5A 1MWSA 3KO6A 1MY8A 5GHZA 2PR6A 1YLJA 2XFTA 1VETB 4PKYA 4S2MA 1XGJA 3G31A 3KSGA 3LIEA 4EBPA 3ZFZA 2Y2IA 3TOIA 2WKEA 4JF5A 3ZDJA 5IT5A 4BL3A 3T1RA 3WS4A 3G30A 4E6XA 4YNRA 3F1PB 5FDSA 4Q8IA 3IWQA 3SOIA 4BLMA 1CI9A 3MXSA 1W8YA 2H5SA 2Y2QA 3ZQ5A 2ZQDA 3BW6A 2EX9A 3PAGA 1ODVA 3OCNA 1T18A 3W2ZA 3B33A 5A91A 2P9VB 1FQGA 4S2OA 2VKSA 4HP9A 4FH4A 4HNBA 1Z09A 5FQQA 3BECA 1ZHHB 4K08A 1E3UA 2JKTI 2R9WA 1M40A 3B47A 4R38A 3IX3A 4DMZA 4P87A 4UAAA 4XT2B 3ICYA 1W63M 4Q0JA 3IXGA 2ZM8A 3PBRA 3T1QB 3EGXC 4MN6A 3UO9A 3MKFA 1F98A 2RCXA 3MFDA 2ZBBA 4R3BA 1K57C 3BLSA 3PBQA 4I38A 2OV5A 4MLLA 3BJNA 3T4LA 4FCFA 1F5MA 4B93A 1S1YA 2E8JA 4PM5A 1ZG4A 1BLCA 1YM1A 1S67L 5FSRA 4ZTKA 3A3IA 1ZC2A 3OC2A 1S0WA 4U0TA 4KZ7A 4CLCD 3FWLA 3E4PA 3RH8B 1JWVA 3IHBA 4QU3A 4MNRA 5TR7A 2ACGA 3GQZA 5TJJA 5GLBA 1KGFA 4DE1A 4OVDA 3LCEA 4OH0A 3QP8A 1GHIA 4H6JB 4I3AA 5GHYA 2ZL1B 5A92A 5G4YA 2EA9A 1PIOA 2A3UA 3OPHA 1WE4A 5DTSA 2WADA 1YSPA 5J7EA 1ZG6A 2FH5A 5F68A 2G2UA 3HLGA 3QNCA 4WELA 1NXYA 3LR4A 3LGOA 3Q7VB 3L7HA 4N1HA 1XJ3A 5E2HA 1HD8A 4Z9QA 4KZBA 3CPTA 4RX2A 3G35A 1XFNA 1BLHA 4I3JA 2V1AA 4MMNA 2PT7A 1MKIA 2JE5A 1P9RA 3A3DA 5GLCA 3V50A 5DFXA 3Q7ZA 1XJ4A 1ALQA 1WYBA 3WS1A 4DJ2A 5DKLA 4JXSA 2ZC5B 4UQIM 4BWIA 2V1BA 1YAXA 4F3LA 4ZRRA 3RJUA 1YLPA 4P6ZS 4YFMA 1LI0A 1CF0A 4L9EA 3UB9A 1OTDA 4OLDA 5EVID 1BSGA 4IVIA 2HPBA 2Y91A 2BG1A 3S7QA 3T1XA 3BRMA 3ZYTA 4G3KA 1RGYA 3ZGAB 1OPXA 4WUJA 5F82A 2HF6A 4KQRA 2V20A 2IWBA 2ZLYA 4HIAA 2OWHA 4OONA 1H0MA 2L4RA 1MXOA 1V9ZA 1XKZA 4IBXA 4ZDXA 5HPFA 3C38A 1NYMA 2B95A 3RFBA 4GHIA 4MCWA 5HDSA 4ZJ3A 2ZQ9A 1XP4A 4K0XA 3U2AA 3UMDA 4LCLA 3PR6A 1BLPA 1U60A 2Q9NA 3C4OA 3N8SA 3LFVA 3PBOA 4EBNA 4S2NC 4JKTA 2VV6A 1FR6A 2PHYA 1K38A 3NULA 1K56A 3WS5A 4F94A 2Y59A 4R1GA 1FR1A 3BFDA 2PD7A 2XEPA 5EVLA 4BBVA 1PZOA 3VP2A 3LIAA 3LY3A 3T4OA 3UB7A 4JBFA 2JKRI 3FV7A 3UY6A 1DP8A 4E3IA 5AVFA 4Y0OA 4WF0A 3HBRA 2XH9A 5AVEA 4Y5FA 2BTFP 3NY4A 1UGUA 1K6RA 4JGOA 5HX9A 1K55A 2NUPC 1D7EA 1ZTUA 4HY8A 3MXQA 2IA2A 2JKTM 1TVFA 4EEPA 2ZJ9A 4HJ3A 1AXBA 3PBTA 3ZG0A 1FSWA 4JGPA 1RP5A 1S66L 3S7OA 3F1PA 4NXGA 2Y2JA 4UEYA 3OPLA 2DRWA 3QNBA 3ZNYA 1NRFA 5TFQA 3WS2A 3UE6A 2J3TD 3A3FA 1TS8A 3IQAA 3KX0X 3H82B 1SKOB 1GCEA 4GW9A 2Y2GA 2KDKA 4KZ8A 4MN7A 2V0UA 4OP5A 3C7VA 4B4ZA 2W3GA 4FSFA 2VV8A 2EX6A 5G18A 2A24A 2JBFA 1L0GA 5CHJA 4G3VA 3F1OB 3FYZA 4E6WA 5J8XA 2Y2HA 4JPMA 5F5YA 2VJWA 5DJUA 1E25A 4KQDA 2Y55A 4PM9A 2WKIA 3BLMA 1XX2A 4Q0IA 3HLDA 1KE0A 1TS7A 2G7UA 2OWJA 2FFFB 5KSCA 3EOIA 4S2KA 2HP5A 4GDNA 4NETA 4O8GA 3SW1A 5DF8A 2XRNA 1LLBA 4OPQA 4JF6A 4G3WA 5CERA 5EFWA 1LL8A 1L0DA 5HDCA 3OZHA 3WS0A 5HL6A 3SS3A 2WKRA 4QY5A 2HGVA 4C6YA 4R4SA 4PHTA 5F1FA 4PM7A 1NLYA 4GB7A 2XA7S 3SH9A 2XQZA 2QHKA 1E4DA 1LT0A 2HDQA 3B3XA 3BFFA 4HESA 2Z6CA 2EFUA 5AQAA 5F6AA 4Y15A 4ETXA 3BFGA 4O7DA 2A2LA 2D01A 2W1TA 3I7JA 5HWVA 3S1YA 2W27A 1K54A 4D60A 2ZQAA 5EM0A 4HQAA 2ZL1A 4QJGA 4QPRA 4CLCA 3HUMA 2OLVA 3B42A 2XD1A 1JTGA 1W79A 2WUQA 2J9OA 3C2WA 2PU2A 1JWPA 4KZ4A 3WWXA 4HJ4A 3H7WB 2HP6A 5HWTA 3O87A 1WYCA 3LEQA 3VP1A 4P6ZM 5AJGA 3M2JA 1SCWA 2C6WB 3LICA 4P6BA 1UWNX 4S2IA 4WZ5A 1Z6FA 3CZDA 2JHEA 4GN2A 2K31A 3NC8A 3R7WB 3MF0A 1ES4A 2O9CA 5IU1A 2I72A 3RTYA 3KYEA 3VSLA 4EESA 3M6HA 1MBLA 3K3DA 3HLWA 5I94A 2PBDP 2OAQ1 2GDNA 2XGNA 2ZC7A 4GCZA 1L3LA 3EWKA 5J3WA 4OPYA 4R6LA 3G34A 2NUTC 1S4SA 3QP4A 3K2NA 2W3FA 3EGDC 2V9AA 1ERMA 2IWDA 3T4QA 3RXXA 1ZKJA 2WGWB 1GSXA 3G2ZA 3C30A 3W4PA 3D9YA 2XF3A 1S4RA 4KG2A 1LL9A 4BJPA 3E2LA 2OAP1 3LIFA 1QMEA 4NXBA 4DF6A 4X25A 4Y17A 2FZ0A 3UE1A 3CI6A 2PYPA 5EVIA 5DTTA 2W3EA 3O5YA 4HH2A 4R70A 5FAOA 4EETB 4FTXA 1BZAA 1BTLA 3NOTC 4S2JA 4DJ3A 4RQ9A 1FILA 5KMWA 4PKYG 3LI9A 5LBRA 3C7UA 1NYYA 2Z6DA 1T1BA 4KENB 1NLZA 3CUEA 1OT6A 4GJ4A 4WZ4A 4ESPA 5A8BA 4U3TA 2WKPA 5HL1A 1T19A 5HSQA 2JKRM 1Q2PA 4DE2A 3IX4A 3FC7A 1DP9A 3W4OA 1N9LA 2Y2NA 2Y2KA 2H10A 3KSHA 3QHYA 3SZTA 3VP3A 3A0VA 2WK0A 1H8ZA 3EEAA 3FG8A 2W1RA 5FL3A 4ARZA 5HAPA 3PBSA 5HAQA 4JGRA 4KQOA 3IH9A 2DNSA 1ACFA 4CJNA 5HD3A 3P01A 4HOIA 1CK3A 4FOFA 1X0OA 2PR5A 2HDSA 5GLDA 4WL9A 5AQ7A 4O01A 1JNUA 1JWZA 4KG5A 3M2KA 3MFXA 4HBUA 3V67A 3LEZA 1IKGA 3UMEA 4FUWA 4OP8A 2VV7A 4X6TA 4GD6A 2ZM0A 4NXEA 1I5QA 3CWFA 1DP6A 2BASA 4X68A 4YOFA 4EBLA 1XA1A 1PI4A 3F1NB 4HH3A 3G2YA 2XROA 1EWZA 2CMNA 3CITA 3G32A 5E2GA 2O0YA 5EOEA 2E8IA 1CQAA 5FI7A 3WRTA 4UA9A 1XGIA 3MS6A 3CG5A 1LSXA 2HZ5A 5CX7A 5CRFA 3V5MA 2QJ7A 2LB5A 2ZQCA 4OOLA 5HPIA 4B9OA 1W7FA 4HBTA 2X71A 3M6BA 4MN5A 1HTZA 1ES3A 1CI8A 3BY9A 2Y2MA 2XA7M 3UPOA 3IS2B 1FOFA 1YLTA 2BLSA 2VGKA 1GSWA 2DCFA 4WN5A 1RGZA 2PBYA 4RA7A 1MWTA 1K6SA 1KDSA 2KLIA 1LHYA 2HP9A 1STZA 1XXMA 4NG2A 4N9LA 3HCYA 5EECA 2M7UA 5EM1A 5EV0A 1PRQA 1YLZA 4EUVA 1CJFA 1TDLA 3VOZA 3DAVA 3O86A 4JGQA 3PBNA 2M7VA 1A0KA 1O07A 4QY6A 2VZWA 2OLUA 2KOIA 5KIZA 1VB6A 3V39A 1M6KA 3Q07A 1PFLA 4GNUA 4LV3A 3IF6A 1H8YA 1OTAA 3LY4A 3VFFA 4MBFA 1W5DA 4BL2A 3V3SA 4L0LA 4BMWA 5DJTA 1XA7A 3UPPA 2EWWA 2EXAA 4PM6A 3MQOA 2OOLA 3NI9A 3A3JA 3FPVA 3ZHHA 1PNEA 3IWIA 3TRCA 1YT4A 4JXGA 3KYQA 4GOGA 2PU4A 1VEUB 2UV0E 5FAQA 4R4RA 1OJGA 5FI2A 3H7WA 3GSGA 3CMZA 1SDEA 3C5AA 3KSFA 2Y4AA 1PWDA 5FI6A 4IJGA 5DTKA 5JYOA 4DE0A 4X1LA 2J8YA 3UDFA 3TE8A 3GDIA 3WRZA 2PAVP 1H3QA 4EEUA 4JLFA 1J9MA 3LIDA 5CEBA 4YWZA 4WYYA 1ONGA 4R0QA 4MBKA 4EQIA 5HAIA 1S6RA 3LYXA 1DRMA 4OPZA 5CTMA 4C75A 2AVXA 2ZMAA 2HDRA 3E98A 3OLOA 3UNWA 1OTIA 2JKGA 2HJEA 1VETA 1N9OA 2ZM2A 4QD4A 1TD5A 4M4XA 2XR0A 4Y0TA 3TG9A 1BYWA 3BWLA 4DRTA 3LUQA 3LR5A 5C5KA 3GRJA 3N7WA 3V3RA 1OT9A 1VHMA 2ZOIA 4EERA 2MJ6A 1L0FA 2J3WA 5GL9A 4K0WA 4LPZA 3UDIA 5KZHA 4CPKA 1T1CA 4ME4A 1KGGA 5GLAA 3S7PA 2XSSA 4BBTA 2P9VA 3BYDA 4K91A 3NHQA 1Q2QA 2O9BA 1DJBA 1YLYA 3UDXA 5CECA 5HARA 3A0RA 1NWZA 2WGVA 1H5XA 2VGJA 2HDUA 3A0SA 3OPPA 3T4KA 2LB9A 4ETZA 4MEZA 3C4PA 3LIBA 3G6OA 2W3HA 4XT2A 5EOOA 1SZVA 4GZBA 2FFYA 2ZC6B 4KUKA 2RL3A 2XK1A 3CJMA 3CPTB 1I2WA 1YQSA 3IT9A 4EUZA 3T12B 2HJ9C 3NBLA 3KYZA 3GECA 1J3WA 3GV9A 1KGEA 5TGFA 3IH8A 3H9WA 4UA7A 4IUKA 4EV4A 4DXCA 2UWXA 2Y2OA 4PM8A 1D1JA 4KZ3A 4Y0UA 4F3LB 4ZAMA 3FZCA 4PMAA 2K7SA 2V1ZA 4OOYA 1EW0A 2Y79A 2IWCA 3VSKA 3RXWA 3GTCA 3EQVA 4U0XA 5EUAA 4EW7A 4GDBA 5A93A 5E43A
chains in the Genus database with same CATH topology
3C7UA 1NYYA 4RX2A 3G35A 3NIAA 1NZUA 4KENB 1W8QA 4YINA 1BLHA 1IYOA 4WZ4A 2X02A 1CEGA 3OPRA 4HEFA 1O7EA 4U3TA 1TEMA 5FDHA 4N1XA 5CTNA 1MKIA 5HL1A 2JE5A 4NK3A 4OQGA 3A3DA 3HL9A 5GLCA 3MZFA 3V50A 4WMCD 2ZQ7A 3Q7ZA 1ALQA 1WYBA 3WS1A 4JXSA 1K55C 1Q2PA 2ZC5B 2WGWA 4DE2A 3VP0A 3IXDA 1DY6A 1XPBA 3ZVWA 4LV1A 3W4OA 1FCMA 2P74A 2Y2NA 3RJUA 2Y2KA 1YLPA 5E2EA 2H10A 4QB8A 4YFMA 3QHYA 1LI0A 3VP3A 3G4PA 2B5RA 3HLBA 1BLSA 3ZCZA 4OLDA 4RYEA 5FQ9A 2WK0A 5EVID 1H8ZA 1BSGA 4IVIA 3S22A 2HPBA 4OKPA 3Q7VA 1RCJA 5HAPA 3MKEA 1K57A 2Y91A 3BEBA 2BG1A 4A5RA 3PBSA 3BRMA 1N9BA 1YMXA 5DF7A 5HAQA 2C5WB 1RGYA 2Z2LB 3ZGAB 4P85A 4DE3A 4KQOA 4XXRA 3IH9A 3HLFA 5F82A 3BM6A 1MPLA 4KQRA 2QMIA 2V20A 3NCKA 4KQQA 2DNSA 2JC7A 5EPHA 2IWBA 4CJNA 2ZLYA 5AQBA 4C3QA 4OONA 5FQMA 1MXOA 3IF6C 1KDWA 1YLWA 2WKHA 1IYQA 5F83A 1NJ4A 1XKZA 4UA6A 4IBXA 1TDGA 4WEKA 4XUZA 1CK3A 4OPRA 4ZDXA 3HUNA 3W8KA 3ZG5A 3FKWA 4R23A 1NYMA 2HDSA 5GLDA 3DWKA 1IKIA 1KE4A 2J9PA 5AQ7A 1VQQA 4ZJ3A 1JWZA 2ZQ9A 1XP4A 3P98A 4B88A 4KG5A 3M2KA 4K0XA 4MBHA 3Q1FA 3UPNA 3O3VA 4HBUA 3LEZA 1YMSA 3UN7A 1K4FA 4LCLA 1IKGA 3MBZA 1JTDA 4OP8A 2EX8A 4X56A 4X6TA 2X01A 4GD6A 2ZM0A 1BLPA 3D4FA 1U60A 4FH2A 1DJAA 3UE0A 3ISGA 4E3NA 2Q9NA 3ITBA 1PI5A 1I5QA 5A90A 5FASA 3C4OA 4BD0A 2R9XA 3N8SA 4X68A 5D3OA 3HLCA 3PBOA 3VFHA 3MZEA 4EBNA 4S2NC 2Y2LA 3NDEA 4JKTA 4EBLA 4ZJ1A 1XA1A 1PI4A 3DWZA 5EE8A 2H0YA 4S2LA 1FR6A 4EWFA 3G2YA 3GVBA 1EWZA 1K38A 3G32A 5E2GA 5EOEA 5BOHA 4DXBA 3DW0A 1Y54A 2E8IA 5FI7A 3WRTA 5CEDA 2CC1A 4LV2A 1K56A 1XGIA 4N9KA 4UA9A 3WS5A 4F94A 1KVLA 3CG5A 2EX2A 2Y59A 3MXRA 4N92A 3N8RA 4M3KA 4R1GA 1FR1A 5CRFA 1EROA 3E2KA 3BFDA 2XEPA 3V5MA 4S2PA 5EVLA 1IEMA 1LI9A 5CGSA 1PZOA 4KZ9A 3VP2A 4OQHA 1IYPA 4UHUA 2ZC3B 3LY3A 4WEJA 3SH7A 1FCNA 2ZQCA 4OOLA 1BT5A 4GKUA 4JBFA 3EQUA 1W7FA 4X69A 4HBTA 2X71A 4IVKA 3FV7A 3M6BA 4BD1A 3UY6A 4E3IA 2Q9MA 1HTZA 5HW3A 1ES3A 4E3JA 3IXHA 1G68A 4Y0OA 2Z2MB 1CI8A 1PW1A 5M1AA 4E3LA 2Y2MA 2EFXA 5FA7A 3UPOA 3IF6B 3HBRA 2XH9A 2G2WA 1NY0A 1FOFA 1YLTA 2BLSA 2VGKA 4GD8A 2DCFA 1K54C 3HVFA 3NY4A 1K6RA 1RGZA 4H8RA 5HX9A 2PBYA 4WBGA 1K55A 1MWTA 4RA7A 1BULA 4ID4A 1K6SA 1KDSA 2QZ6A 3IXBA 1HZOA 1TVFA 1LHYA 2HP9A 2ZJ9A 1XXMA 1AXBA 1GHPA 2JCHA 3PBTA 5AQ9A 5FQIA 1IELA 3ZG8B 3ZG0A 1FSWA 1K56D 4N9LA 2EXBA 5EECA 1RP5A 4RX3A 2WGIA 2ZC4B 4Y7PA 1YLZA 1GA9A 2Y2JA 4OQIA 4OQ0A 5FAPA 5FATA 3OPLA 3SH8A 2DRWA 2QPNA 3QNBA 1TDLA 4QHCA 3VOZA 3W4QA 3NDGA 3O86A 2ZD8A 3ZG7B 3ZNYA 4FD8A 3PBNA 5CGXA 1NRFA 5TFQA 3WS2A 1PYYA 4LENA 1O07A 4QY6A 1QMFA 3A3FA 3GR2A 3IQAA 4WZ5C 5GHXA 4E3MA 5FQJA 2OLUA 1SKFA 4DKIA 2J7VA 1GCEA 1SHVA 3BFCA 1M6KA 3V39A 3ZVTA 4E3OA 2Y2GA 2Y2PA 3Q07A 1ERQA 4GNUA 4KZ8A 3N6IA 4LV3A 2XD5A 3IF6A 4OP5A 4OOMA 1H8YA 3C7VA 3LY4A 4B4ZA 3VFFA 1PWCA 4MBFA 4FSFA 5L2FA 2A49A 5CXWA 1W5DA 1K4EA 2EX6A 5G18A 1G6AA 4KZ6A 2JBFA 4BL2A 1L0GA 5CHJA 3V3SA 3SS5A 1BUEA 3DTMA 4L0LA 4DDYA 3FYZA 5E2FA 1XA7A 4IBRA 4PPRA 4E6WA 5CHMA 3UPPA 5J8XA 2Y2HA 1GHMA 2XDMA 4JPMA 5KSHA 2EXAA 4RVAA 3VMAA 4PM6A 4IEDA 3NI9A 3A3JA 3ZHHA 4R3JA 1E25A 3A3EA 2Y55A 3IWIA 4PM9A 3HUOA 1MWRA 1YT4A 2WKIA 4KG6A 3BLMA 1XX2A 1ES5A 4JXGA 4GOGA 2PU4A 4ZJ2A 3HLDA 1KE0A 3FKVA 3Q81A 1EI5A 5FAQA 1MWSA 4R4RA 1MY8A 5GHZA 2FFFB 1YLJA 4S2NA 2XFTA 5KSCA 5FI2A 3PAEA 4S2MA 1XGJA 3G31A 4EBPA 1KE3A 3JYIA 3ZFZA 4S2KA 2HP5A 1PW8A 2Y2IA 3GSGA 3ITAA 3TOIA 4GDNA 3P09A 3CMZA 2WKEA 4JF5A 1SDEA 3C5AA 4NETA 3ZDJA 4BENA 2WAFA 4BL3A 3WS4A 5DF8A 2Y4AA 4ZBEA 1LLBA 3G30A 4OPQA 1PWDA 4JF6A 5HFOA 4E6XA 2ZQ8A 5FI6A 5DTKA 4Q8IA 5CERA 5JYOA 4DE0A 3IWQA 3SOIA 2J8YA 1CI9A 3MXSA 4BLMA 3MZDA 1L0DA 1W8YA 2H5SA 3OZHA 3UDFA 3WS0A 5EVIC 4DDSA 4KZ5A 1C3BA 2Y2QA 1KVMA 1NZOA 4QY5A 3SS3A 2ZQDA 5M19A 3WRZA 4C6YA 2EX9A 3PAGA 4R4SA 4XUXA 5CHUA 5F1FA 4PM7A 1FCOA 2XFSA 4GB7A 4JLFA 1J9MA 3SH9A 2XQZA 3OCNA 4D2OA 1E4DA 5CEBA 2HDQA 1ONGA 4WYYA 1PWGA 4R0QA 4MBKA 4BQMA 3B3XA 5A91A 2P9VB 4EQIA 3BFFA 1FQGA 4HESA 2EFUA 1S6RA 4S2OA 5AQAA 5HAIA 3VOYA 3BFGA 4FH4A 4OPZA 5CTMA 4C75A 2ZMAA 4O7DA 3BECA 5FQQA 1LL5A 2HDRA 1E3UA 5M18A 3I7JA 3UNWA 2R9WA 1M40A 3O88A 3HREA 3S1YA 3N8LA 1K54A 4JXWA 2ZQAA 1MWUA 4P87A 4UAAA 4QJGA 2OSUA 2V2FF 2ZM2A 2ZM8A 3IXGA 4QD4A 3PBRA 1PZPA 4E3KA 2WZZA 3HUMA 2OLVA 3UO9A 2WYXA 2XD1A 1JTGA 2XR0A 3IWOA 3MKFA 5FQKA 1W79A 3TG9A 4Y0TA 2WUQA 2RCXA 2J9OA 2XLNA 4DRTA 3MFDA 3SS4A 5U47A 3GRJA 3N7WA 2PU2A 1JWPA 4R3BA 3V3RA 4KZ4A 4P0MA 3WWXA 1ESIA 1DJCA 1L0FA 3OCLA 1K57C 4KZAA 5GL9A 2HP6A 4K0WA 3ZNTA 3UDIA 3O87A 4CPKA 3AGDA 5KZHA 1I2SA 3BLSA 1WYCA 3PBQA 4Z9QA 1ES2A 1KGGA 2OV5A 3VP1A 1GA0A 5GLAA 3VP4A 4MLLA 2WZXA 3M2JA 1SCWA 2C6WB 4S2IA 4P6BA 4WZ5A 2P9VA 3BYDA 4K91A 3HLEA 4FCFA 1Z6FA 3Q82A 3CZDA 1Q2QA 2H0TA 4GN2A 1OMEA 3NC8A 3TSGA 3BFEA 1DJBA 1ES4A 1YLYA 1E3UD 4JXVA 3UDXA 5CECA 5F1GA 5HARA 4PM5A 2I72A 2WGVA 1FSYA 3N4IA 1ZG4A 1BLCA 5IHVA 1CEFA 1H5XA 1YM1A 2VGJA 2HDUA 3IF5A 3IHAA 3OPPA 5EVIB 5FSRA 3VSLA 4ZTKA 1HVBA 3M6HA 3A3IA 4LV0A 3C4PA 1ZC2A 4MEZA 3UE3A 3OC2A 1MBLA 3HLWA 5I94A 1S0WA 4U0TA 5EOOA 4KZ7A 1ESUA 2FFYA 2GDNA 2XGNA 2ZC6B 3FWLA 4GZBA 2RL3A 5CGWA 2ZC7A 2XK1A 1L0EA 3CJMA 1I2WA 1ONHA 1YQSA 1VM1A 3IT9A 1JWVA 3IHBA 4QU3A 5DVAA 3LO7A 4EUZA 4MNRA 4OPYA 5TR7A 3G34A 4JF4A 3GQZA 3ZG9B 4OLGA 3NBLA 1K25A 3GV9A 1IYSA 4X53A 4X55A 1KGFA 1KGEA 5GLBA 4DE1A 3AGEA 4OVDA 3LCEA 4OH0A 5TGFA 4B4XA 3IH8A 1GHIA 2WAEA 4UA7A 1ERMA 5GHYA 4WMCA 2IWDA 5A92A 3RXXA 4LCMA 1ZKJA 4EV4A 3AGFA 1PIOA 4DXCA 2WGWB 2UWXA 2Y2OA 3G2ZA 4PM8A 2A3UA 3W4PA 3OPHA 4KZ3A 4Y0UA 1WE4A 4WM9A 2XF3A 5DTSA 2WADA 4BJPA 4KG2A 1LL9A 3E2LA 4ZAMA 1QMEA 3FZCA 3GMWA 4DF6A 1ZG6A 1L2SA 1JVJA 4PMAA 2V1ZA 3UE1A 4OOYA 2G2UA 3HLGA 3QNCA 4WELA 1NXYA 1SDNA 5EVIA 5DTTA 5FAOA 5JYPA 2IWCA 3Q7VB 3VSKA 3RXWA 3GTCA 3EQVA 4U0XA 1BZAA 3S4XA 1BTLA 3PTEA 4GDBA 4S2JA 5EUAA 4N1HA 5A93A 5E2HA 1N4OA 5DF9A 1HD8A 4KZBA 5KMWA 5E43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7U A;  1NYY A;  4RX2 A;  3G35 A;  3NIA A;  1NZU A;  4KEN B;  1W8Q A;  4YIN A;  1BLH A;  1IYO A;  4WZ4 A;  2X02 A;  1CEG A;  3OPR A;  4HEF A;  1O7E A;  4U3T A;  1TEM A;  5FDH A;  4N1X A;  5CTN A;  1MKI A;  5HL1 A;  2JE5 A;  4NK3 A;  4OQG A;  3A3D A;  3HL9 A;  5GLC A;  3MZF A;  3V50 A;  4WMC D;  2ZQ7 A;  3Q7Z A;  1ALQ A;  1WYB A;  3WS1 A;  4JXS A;  1K55 C;  1Q2P A;  2ZC5 B;  2WGW A;  4DE2 A;  3VP0 A;  3IXD A;  1DY6 A;  1XPB A;  3ZVW A;  4LV1 A;  3W4O A;  1FCM A;  2P74 A;  2Y2N A;  3RJU A;  2Y2K A;  1YLP A;  5E2E A;  2H10 A;  4QB8 A;  4YFM A;  3QHY A;  1LI0 A;  3VP3 A;  3G4P A;  2B5R A;  3HLB A;  1BLS A;  3ZCZ A;  4OLD A;  4RYE A;  5FQ9 A;  2WK0 A;  5EVI D;  1H8Z A;  1BSG A;  4IVI A;  3S22 A;  2HPB A;  4OKP A;  3Q7V A;  1RCJ A;  5HAP A;  3MKE A;  1K57 A;  2Y91 A;  3BEB A;  2BG1 A;  4A5R A;  3PBS A;  3BRM A;  1N9B A;  1YMX A;  5DF7 A;  5HAQ A;  2C5W B;  1RGY A;  2Z2L B;  3ZGA B;  4P85 A;  4DE3 A;  4KQO A;  4XXR A;  3IH9 A;  3HLF A;  5F82 A;  3BM6 A;  1MPL A;  4KQR A;  2QMI A;  2V20 A;  3NCK A;  4KQQ A;  2DNS A;  2JC7 A;  5EPH A;  2IWB A;  4CJN A;  2ZLY A;  5AQB A;  4C3Q A;  4OON A;  5FQM A;  1MXO A;  3IF6 C;  1KDW A;  1YLW A;  2WKH A;  1IYQ A;  5F83 A;  1NJ4 A;  1XKZ A;  4UA6 A;  4IBX A;  1TDG A;  4WEK A;  4XUZ A;  1CK3 A;  4OPR A;  4ZDX A;  3HUN A;  3W8K A;  3ZG5 A;  3FKW A;  4R23 A;  1NYM A;  2HDS A;  5GLD A;  3DWK A;  1IKI A;  1KE4 A;  2J9P A;  5AQ7 A;  1VQQ A;  4ZJ3 A;  1JWZ A;  2ZQ9 A;  1XP4 A;  3P98 A;  4B88 A;  4KG5 A;  3M2K A;  4K0X A;  4MBH A;  3Q1F A;  3UPN A;  3O3V A;  4HBU A;  3LEZ A;  1YMS A;  3UN7 A;  1K4F A;  4LCL A;  1IKG A;  3MBZ A;  1JTD A;  4OP8 A;  2EX8 A;  4X56 A;  4X6T A;  2X01 A;  4GD6 A;  2ZM0 A;  1BLP A;  3D4F A;  1U60 A;  4FH2 A;  1DJA A;  3UE0 A;  3ISG A;  4E3N A;  2Q9N A;  3ITB A;  1PI5 A;  1I5Q A;  5A90 A;  5FAS A;  3C4O A;  4BD0 A;  2R9X A;  3N8S A;  4X68 A;  5D3O A;  3HLC A;  3PBO A;  3VFH A;  3MZE A;  4EBN A;  4S2N C;  2Y2L A;  3NDE A;  4JKT A;  4EBL A;  4ZJ1 A;  1XA1 A;  1PI4 A;  3DWZ A;  5EE8 A;  2H0Y A;  4S2L A;  1FR6 A;  4EWF A;  3G2Y A;  3GVB A;  1EWZ A;  1K38 A;  3G32 A;  5E2G A;  5EOE A;  5BOH A;  4DXB A;  3DW0 A;  1Y54 A;  2E8I A;  5FI7 A;  3WRT A;  5CED A;  2CC1 A;  4LV2 A;  1K56 A;  1XGI A;  4N9K A;  4UA9 A;  3WS5 A;  4F94 A;  1KVL A;  3CG5 A;  2EX2 A;  2Y59 A;  3MXR A;  4N92 A;  3N8R A;  4M3K A;  4R1G A;  1FR1 A;  5CRF A;  1ERO A;  3E2K A;  3BFD A;  2XEP A;  3V5M A;  4S2P A;  5EVL A;  1IEM A;  1LI9 A;  5CGS A;  1PZO A;  4KZ9 A;  3VP2 A;  4OQH A;  1IYP A;  4UHU A;  2ZC3 B;  3LY3 A;  4WEJ A;  3SH7 A;  1FCN A;  2ZQC A;  4OOL A;  1BT5 A;  4GKU A;  4JBF A;  3EQU A;  1W7F A;  4X69 A;  4HBT A;  2X71 A;  4IVK A;  3FV7 A;  3M6B A;  4BD1 A;  3UY6 A;  4E3I A;  2Q9M A;  1HTZ A;  5HW3 A;  1ES3 A;  4E3J A;  3IXH A;  1G68 A;  4Y0O A;  2Z2M B;  1CI8 A;  1PW1 A;  5M1A A;  4E3L A;  2Y2M A;  2EFX A;  5FA7 A;  3UPO A;  3IF6 B;  3HBR A;  2XH9 A;  2G2W A;  1NY0 A;  1FOF A;  1YLT A;  2BLS A;  2VGK A;  4GD8 A;  2DCF A;  1K54 C;  3HVF A;  3NY4 A;  1K6R A;  1RGZ A;  4H8R A;  5HX9 A;  2PBY A;  4WBG A;  1K55 A;  1MWT A;  4RA7 A;  1BUL A;  4ID4 A;  1K6S A;  1KDS A;  2QZ6 A;  3IXB A;  1HZO A;  1TVF A;  1LHY A;  2HP9 A;  2ZJ9 A;  1XXM A;  1AXB A;  1GHP A;  2JCH A;  3PBT A;  5AQ9 A;  5FQI A;  1IEL A;  3ZG8 B;  3ZG0 A;  1FSW A;  1K56 D;  4N9L A;  2EXB A;  5EEC A;  1RP5 A;  4RX3 A;  2WGI A;  2ZC4 B;  4Y7P A;  1YLZ A;  1GA9 A;  2Y2J A;  4OQI A;  4OQ0 A;  5FAP A;  5FAT A;  3OPL A;  3SH8 A;  2DRW A;  2QPN A;  3QNB A;  1TDL A;  4QHC A;  3VOZ A;  3W4Q A;  3NDG A;  3O86 A;  2ZD8 A;  3ZG7 B;  3ZNY A;  4FD8 A;  3PBN A;  5CGX A;  1NRF A;  5TFQ A;  3WS2 A;  1PYY A;  4LEN A;  1O07 A;  4QY6 A;  1QMF A;  3A3F A;  3GR2 A;  3IQA A;  4WZ5 C;  5GHX A;  4E3M A;  5FQJ A;  2OLU A;  1SKF A;  4DKI A;  2J7V A;  1GCE A;  1SHV A;  3BFC A;  1M6K A;  3V39 A;  3ZVT A;  4E3O A;  2Y2G A;  2Y2P A;  3Q07 A;  1ERQ A;  4GNU A;  4KZ8 A;  3N6I A;  4LV3 A;  2XD5 A;  3IF6 A;  4OP5 A;  4OOM A;  1H8Y A;  3C7V A;  3LY4 A;  4B4Z A;  3VFF A;  1PWC A;  4MBF A;  4FSF A;  5L2F A;  2A49 A;  5CXW A;  1W5D A;  1K4E A;  2EX6 A;  5G18 A;  1G6A A;  4KZ6 A;  2JBF A;  4BL2 A;  1L0G A;  5CHJ A;  3V3S A;  3SS5 A;  1BUE A;  3DTM A;  4L0L A;  4DDY A;  3FYZ A;  5E2F A;  1XA7 A;  4IBR A;  4PPR A;  4E6W A;  5CHM A;  3UPP A;  5J8X A;  2Y2H A;  1GHM A;  2XDM A;  4JPM A;  5KSH A;  2EXA A;  4RVA A;  3VMA A;  4PM6 A;  4IED A;  3NI9 A;  3A3J A;  3ZHH A;  4R3J A;  1E25 A;  3A3E A;  2Y55 A;  3IWI A;  4PM9 A;  3HUO A;  1MWR A;  1YT4 A;  2WKI A;  4KG6 A;  3BLM A;  1XX2 A;  1ES5 A;  4JXG A;  4GOG A;  2PU4 A;  4ZJ2 A;  3HLD A;  1KE0 A;  3FKV A;  3Q81 A;  1EI5 A;  5FAQ A;  1MWS A;  4R4R A;  1MY8 A;  5GHZ A;  2FFF B;  1YLJ A;  4S2N A;  2XFT A;  5KSC A;  5FI2 A;  3PAE A;  4S2M A;  1XGJ A;  3G31 A;  4EBP A;  1KE3 A;  3JYI A;  3ZFZ A;  4S2K A;  2HP5 A;  1PW8 A;  2Y2I A;  3GSG A;  3ITA A;  3TOI A;  4GDN A;  3P09 A;  3CMZ A;  2WKE A;  4JF5 A;  1SDE A;  3C5A A;  4NET A;  3ZDJ A;  4BEN A;  2WAF A;  4BL3 A;  3WS4 A;  5DF8 A;  2Y4A A;  4ZBE A;  1LLB A;  3G30 A;  4OPQ A;  1PWD A;  4JF6 A;  5HFO A;  4E6X A;  2ZQ8 A;  5FI6 A;  5DTK A;  4Q8I A;  5CER A;  5JYO A;  4DE0 A;  3IWQ A;  3SOI A;  2J8Y A;  1CI9 A;  3MXS A;  4BLM A;  3MZD A;  1L0D A;  1W8Y A;  2H5S A;  3OZH A;  3UDF A;  3WS0 A;  5EVI C;  4DDS A;  4KZ5 A;  1C3B A;  2Y2Q A;  1KVM A;  1NZO A;  4QY5 A;  3SS3 A;  2ZQD A;  5M19 A;  3WRZ A;  4C6Y A;  2EX9 A;  3PAG A;  4R4S A;  4XUX A;  5CHU A;  5F1F A;  4PM7 A;  1FCO A;  2XFS A;  4GB7 A;  4JLF A;  1J9M A;  3SH9 A;  2XQZ A;  3OCN A;  4D2O A;  1E4D A;  5CEB A;  2HDQ A;  1ONG A;  4WYY A;  1PWG A;  4R0Q A;  4MBK A;  4BQM A;  3B3X A;  5A91 A;  2P9V B;  4EQI A;  3BFF A;  1FQG A;  4HES A;  2EFU A;  1S6R A;  4S2O A;  5AQA A;  5HAI A;  3VOY A;  3BFG A;  4FH4 A;  4OPZ A;  5CTM A;  4C75 A;  2ZMA A;  4O7D A;  3BEC A;  5FQQ A;  1LL5 A;  2HDR A;  1E3U A;  5M18 A;  3I7J A;  3UNW A;  2R9W A;  1M40 A;  3O88 A;  3HRE A;  3S1Y A;  3N8L A;  1K54 A;  4JXW A;  2ZQA A;  1MWU A;  4P87 A;  4UAA A;  4QJG A;  2OSU A;  2V2F F;  2ZM2 A;  2ZM8 A;  3IXG A;  4QD4 A;  3PBR A;  1PZP A;  4E3K A;  2WZZ A;  3HUM A;  2OLV A;  3UO9 A;  2WYX A;  2XD1 A;  1JTG A;  2XR0 A;  3IWO A;  3MKF A;  5FQK A;  1W79 A;  3TG9 A;  4Y0T A;  2WUQ A;  2RCX A;  2J9O A;  2XLN A;  4DRT A;  3MFD A;  3SS4 A;  5U47 A;  3GRJ A;  3N7W A;  2PU2 A;  1JWP A;  4R3B A;  3V3R A;  4KZ4 A;  4P0M A;  3WWX A;  1ESI A;  1DJC A;  1L0F A;  3OCL A;  1K57 C;  4KZA A;  5GL9 A;  2HP6 A;  4K0W A;  3ZNT A;  3UDI A;  3O87 A;  4CPK A;  3AGD A;  5KZH A;  1I2S A;  3BLS A;  1WYC A;  3PBQ A;  4Z9Q A;  1ES2 A;  1KGG A;  2OV5 A;  3VP1 A;  1GA0 A;  5GLA A;  3VP4 A;  4MLL A;  2WZX A;  3M2J A;  1SCW A;  2C6W B;  4S2I A;  4P6B A;  4WZ5 A;  2P9V A;  3BYD A;  4K91 A;  3HLE A;  4FCF A;  1Z6F A;  3Q82 A;  3CZD A;  1Q2Q A;  2H0T A;  4GN2 A;  1OME A;  3NC8 A;  3TSG A;  3BFE A;  1DJB A;  1ES4 A;  1YLY A;  1E3U D;  4JXV A;  3UDX A;  5CEC A;  5F1G A;  5HAR A;  4PM5 A;  2I72 A;  2WGV A;  1FSY A;  3N4I A;  1ZG4 A;  1BLC A;  5IHV A;  1CEF A;  1H5X A;  1YM1 A;  2VGJ A;  2HDU A;  3IF5 A;  3IHA A;  3OPP A;  5EVI B;  5FSR A;  3VSL A;  4ZTK A;  1HVB A;  3M6H A;  3A3I A;  4LV0 A;  3C4P A;  1ZC2 A;  4MEZ A;  3UE3 A;  3OC2 A;  1MBL A;  3HLW A;  5I94 A;  1S0W A;  4U0T A;  5EOO A;  4KZ7 A;  1ESU A;  2FFY A;  2GDN A;  2XGN A;  2ZC6 B;  3FWL A;  4GZB A;  2RL3 A;  5CGW A;  2ZC7 A;  2XK1 A;  1L0E A;  3CJM A;  1I2W A;  1ONH A;  1YQS A;  1VM1 A;  3IT9 A;  1JWV A;  3IHB A;  4QU3 A;  5DVA A;  3LO7 A;  4EUZ A;  4MNR A;  4OPY A;  5TR7 A;  3G34 A;  4JF4 A;  3GQZ A;  3ZG9 B;  4OLG A;  3NBL A;  1K25 A;  3GV9 A;  1IYS A;  4X53 A;  4X55 A;  1KGF A;  1KGE A;  5GLB A;  4DE1 A;  3AGE A;  4OVD A;  3LCE A;  4OH0 A;  5TGF A;  4B4X A;  3IH8 A;  1GHI A;  2WAE A;  4UA7 A;  1ERM A;  5GHY A;  4WMC A;  2IWD A;  5A92 A;  3RXX A;  4LCM A;  1ZKJ A;  4EV4 A;  3AGF A;  1PIO A;  4DXC A;  2WGW B;  2UWX A;  2Y2O A;  3G2Z A;  4PM8 A;  2A3U A;  3W4P A;  3OPH A;  4KZ3 A;  4Y0U A;  1WE4 A;  4WM9 A;  2XF3 A;  5DTS A;  2WAD A;  4BJP A;  4KG2 A;  1LL9 A;  3E2L A;  4ZAM A;  1QME A;  3FZC A;  3GMW A;  4DF6 A;  1ZG6 A;  1L2S A;  1JVJ A;  4PMA A;  2V1Z A;  3UE1 A;  4OOY A;  2G2U A;  3HLG A;  3QNC A;  4WEL A;  1NXY A;  1SDN A;  5EVI A;  5DTT A;  5FAO A;  5JYP A;  2IWC A;  3Q7V B;  3VSK A;  3RXW A;  3GTC A;  3EQV A;  4U0X A;  1BZA A;  3S4X A;  1BTL A;  3PTE A;  4GDB A;  4S2J A;  5EUA A;  4N1H A;  5A93 A;  5E2H A;  1N4O A;  5DF9 A;  1HD8 A;  4KZB A;  5KMW A;  5E43 A; 
#chains in the Genus database with same CATH topology
 3NIA A;  3QP2 A;  4EU0 A;  4DN0 A;  4HEF A;  4L9G A;  4Z1W A;  4BBU A;  3CLO A;  3MZF A;  4H6J A;  4WMC D;  1S1Z A;  1K55 C;  3JVV A;  3VP0 A;  3VOL A;  1XFQ A;  3UB8 A;  3F1N A;  3LI8 A;  3JVU A;  4LRZ E;  4LRY C;  4NEE D;  3G4P A;  2B5R A;  3HLB A;  4RYE A;  4GS9 B;  3S22 A;  4OKP A;  3Q7V A;  5HDD A;  1K57 A;  3BEB A;  3P7N A;  5DF7 A;  4Y2F A;  2C5W B;  4DE3 A;  4XXR A;  2I9V A;  3BY8 A;  2QMI A;  3NCK A;  4KQQ A;  2JC7 A;  3D3O A;  1V9Y A;  2GX5 A;  1HLU P;  5FQM A;  3MR0 A;  1YLW A;  5F83 A;  1IYQ A;  4UA6 A;  1TDG A;  4WEK A;  4XUZ A;  4LLO B;  3W8K A;  3ZG5 A;  1TF1 A;  3FKW A;  2ZOH A;  4R23 A;  1G28 A;  3DWK A;  1IKI A;  3IBJ A;  2EWV A;  3UB5 P;  4B88 A;  4NXF A;  4HP4 A;  1KOU A;  3UPN A;  3O3V A;  1FIK A;  3UN7 A;  1G6O A;  5HWW A;  1JTD A;  4X56 A;  3UE0 A;  3D4F A;  4KUO A;  3ITB A;  5A90 A;  5FAS A;  4BD0 A;  2R9X A;  2ZMF A;  2VGL S;  5D3O A;  3NDE A;  4ZJ1 A;  3PXP A;  5EE8 A;  3DWZ A;  4S2L A;  5BOH A;  3DW0 A;  1Y54 A;  5L07 A;  4LV2 A;  3MMH A;  4N9K A;  1KVL A;  2QJ5 A;  2EX2 A;  3MXR A;  2GJ3 A;  4M3K A;  1ERO A;  3E2K A;  3MJQ A;  4S2P A;  1LI9 A;  5CGS A;  4KZ9 A;  4II7 A;  4WEJ A;  1FCN A;  1LSW A;  4X69 A;  3VV4 A;  5HW3 A;  4E3J A;  3IXH A;  4HI4 A;  3C8C A;  1PW1 A;  2O9A A;  4E3L A;  2H28 A;  2G2W A;  1XJ6 A;  1NY0 A;  1K0K A;  4GD8 A;  1K54 C;  3HVF A;  1P9W A;  1VEU A;  2A24 B;  3HJI A;  2QWS A;  4CLC C;  2QZ6 A;  4CQH A;  1H8M A;  1GHP A;  5AQ9 A;  2QKP A;  2WGI A;  4QWO A;  1GA9 A;  3CHW P;  3MSH A;  4OQI A;  5FAP A;  3SH8 A;  1YPR A;  2QPN A;  4QHC A;  3D72 A;  2ZD8 A;  4FD8 A;  5CGX A;  1PYY A;  4LEN A;  4E3M A;  4WZ5 C;  1QMF A;  3GR2 A;  5FQJ A;  4MDZ A;  1SKF A;  3DBA A;  4DKI A;  2J7V A;  2J80 A;  3S7N A;  1SHV A;  3BFC A;  1P97 A;  4Y3I A;  3ZVT A;  2Y2P A;  4E3O A;  3R4K A;  4X1M A;  2XD5 A;  4OOM A;  2QYB A;  2VLG A;  2A49 A;  5CXW A;  1K4E A;  3EEH A;  4IHQ A;  1G6A A;  1XJ2 A;  2GNX A;  2VEA A;  3DTE A;  3DTM A;  2P04 A;  4DDY A;  5E2F A;  5KSH A;  1GHM A;  2XDM A;  2W3D A;  4RVA A;  4I39 A;  4R3J A;  1YSQ A;  3HUO A;  2PRF A;  5G4Z A;  1ES5 A;  2W1T B;  4ZJ2 A;  3PYP A;  3Q81 A;  4L9F A;  5I5L A;  4IUH A;  4S2N A;  3PAE A;  1KE3 A;  3JYI A;  1PW8 A;  3ITA A;  3H82 A;  1SKO A;  3P09 A;  4CLC B;  4BEN A;  2WAF A;  4ZBE A;  5HFO A;  4LRX C;  2ZQ8 A;  2O99 A;  5FEF A;  3MZD A;  5EVI C;  4DDS A;  4KZ5 A;  1C3B A;  5M19 A;  1KVM A;  1NZO A;  3TJZ C;  3TW8 A;  5CHU A;  4XUX A;  1FCO A;  2XFS A;  3L9K A;  2YKF A;  4D2O A;  2V8C A;  1MZU A;  3BQ8 A;  3F1O A;  1PWG A;  3CUE C;  4EQ1 A;  4BQM A;  2PD8 A;  3VOY A;  3T4S A;  1LL5 A;  3JPU A;  1NRJ A;  5M18 A;  2ZMV A;  1W63 Q;  4I3I A;  3O88 A;  3HRE A;  3PHY A;  3N8L A;  4JXW A;  3U4L P;  4E04 A;  1MWU A;  5TBM B;  4I5S A;  2OSU A;  2V2F F;  1PZP A;  4E3K A;  2WZZ A;  2WYX A;  3ULF A;  3BQA A;  3IWO A;  5FQK A;  2INW A;  3CAX A;  2XLN A;  4LGW A;  1IFQ A;  3SS4 A;  5U47 A;  4P0M A;  3KSI A;  1ESI A;  1DJC A;  2VK3 A;  3OCL A;  4KZA A;  3ZNT A;  3AGD A;  2GZA A;  1I2S A;  4Q0H A;  1ES2 A;  3UB6 A;  1GA0 A;  3VP4 A;  2WZX A;  5DKK A;  3HLE A;  1MKM A;  3Q82 A;  4PAU A;  2H0T A;  1OME A;  3TSG A;  3BFE A;  4JXV A;  1E3U D;  5F1G A;  1P0Z A;  5IHV A;  4O0P A;  1FSY A;  3N4I A;  1CEF A;  3IF5 A;  3IHA A;  5EVI B;  1HVB A;  4LV0 A;  5L8M A;  3UE3 A;  1ESU A;  5CGW A;  3VE4 A;  1L0E A;  1ONH A;  1VM1 A;  1IOU A;  5DVA A;  3LO7 A;  2P7J A;  2B18 A;  3E4O A;  4JF4 A;  5K5B A;  3ZG9 B;  4OLG A;  1K25 A;  1IYS A;  5HZH A;  4X53 A;  4X55 A;  4WLA A;  3AGE A;  5FEG A;  4B4X A;  2WAE A;  4WMC A;  2P08 A;  2PDR A;  4LCM A;  5HD5 A;  4GS9 A;  3AGF A;  1WA9 A;  2HV1 A;  2Q0O A;  2PYR A;  4WM9 A;  2R78 A;  5MC7 A;  2VGL M;  3GMW A;  3R7W A;  1L2S A;  1JVJ A;  2M1C A;  1SDN A;  4ARZ B;  5JYP A;  3FPW A;  3S4X A;  3PTE A;  3HJK A;  1N4O A;  2B02 A;  5DF9 A;  2J3T C;  1NZU A;  1W8Q A;  4YIN A;  1IYO A;  2X02 A;  4NKP A;  1CEG A;  3OPR A;  4GLQ A;  1O7E A;  1OJ5 A;  1TEM A;  5FDH A;  4N1X A;  5CTN A;  3T1S A;  4OQG A;  4NK3 A;  3HL9 A;  3LR3 A;  3DTI A;  3QP6 A;  2ZQ7 A;  2KX6 A;  1UWP X;  2WKQ A;  3NEC A;  2WGW A;  3IXD A;  1DY6 A;  1XPB A;  3ZVW A;  4LV1 A;  1FCM A;  3T4T A;  2P74 A;  1AWI A;  3E0Y A;  5E2E A;  4QB8 A;  1BLS A;  3ZCZ A;  3VE3 A;  5FQ9 A;  2DMW A;  3IBR A;  1RCJ A;  3MKE A;  4A5R A;  1N9B A;  1YMX A;  1OTB A;  4CLC E;  2Z2L B;  4P85 A;  3HLF A;  3BM6 A;  1MPL A;  2JN7 A;  5EPH A;  5AQB A;  5IS1 A;  4C3Q A;  5DFY A;  3NJA A;  3IF6 C;  4Y13 A;  1KDW A;  2WKH A;  1NJ4 A;  4OPR A;  3HUN A;  3T50 A;  4EXO A;  1KE4 A;  2J9P A;  1VQQ A;  2L0W A;  3P98 A;  4MBH A;  1T1A A;  3Q1F A;  1YMS A;  1K4F A;  3MBZ A;  2EX8 A;  2X01 A;  4FH2 A;  1DJA A;  3ISG A;  4E3N A;  1PI5 A;  1Y28 A;  3HLC A;  3VFH A;  3MZE A;  2Y2L A;  3QP1 A;  2H0Y A;  4EWF A;  3GVB A;  1OTE A;  4DXB A;  5CED A;  2CC1 A;  1TS6 A;  2VX8 A;  4N92 A;  3N8R A;  3NOU C;  1IEM A;  1F2K A;  4OQH A;  1IYP A;  4UHU A;  2ZC3 B;  3SH7 A;  3K3C A;  1BT5 A;  4GKU A;  5L10 A;  3EQU A;  4IVK A;  4BD1 A;  3QP5 A;  4UQI S;  1TS0 A;  1Y4O A;  3MQ0 A;  2Q9M A;  1G68 A;  2Z2M B;  5M1A A;  1G5U A;  4AFI A;  2EFX A;  5FA7 A;  3IF6 B;  4GHI B;  5L09 A;  5F69 A;  4H8R A;  2Y8H A;  4WBG A;  1BUL A;  4ID4 A;  3IXB A;  1HZO A;  5J4E A;  3OBF A;  3NOP C;  2JCH A;  5FQI A;  3ZG8 B;  4HJ6 A;  1IEL A;  1K56 D;  2K2N A;  2V8F A;  2EXB A;  4RX3 A;  4LFU A;  2ZC4 B;  4Y7P A;  1F9I A;  1YKD A;  5FAT A;  4OQ0 A;  3W4Q A;  3NDG A;  2D02 A;  3ZG7 B;  4R3A A;  2VA0 A;  2JKF A;  5GHX A;  1MC0 A;  2YKH A;  3LR0 A;  1ERQ A;  3N6I A;  3OOV A;  3IX8 A;  3IS2 A;  2W0N A;  3MQQ A;  1PWC A;  5EVE A;  5L2F A;  2L1M A;  3E4Q A;  4KZ6 A;  3SS5 A;  1BUE A;  5TBM A;  4IBR A;  1GSV A;  1LSV A;  4PPR A;  5CHM A;  3T4J A;  4HHD A;  3VMA A;  4IED A;  3DTK A;  3A3E A;  1MWR A;  2V0W A;  4KG6 A;  1N9N A;  3FKV A;  1D06 A;  1EI5 A;  1MWS A;  3KO6 A;  1MY8 A;  5GHZ A;  2PR6 A;  1YLJ A;  2XFT A;  1VET B;  4PKY A;  4S2M A;  1XGJ A;  3G31 A;  3KSG A;  3LIE A;  4EBP A;  3ZFZ A;  2Y2I A;  3TOI A;  2WKE A;  4JF5 A;  3ZDJ A;  5IT5 A;  4BL3 A;  3T1R A;  3WS4 A;  3G30 A;  4E6X A;  4YNR A;  3F1P B;  5FDS A;  4Q8I A;  3IWQ A;  3SOI A;  4BLM A;  1CI9 A;  3MXS A;  1W8Y A;  2H5S A;  2Y2Q A;  3ZQ5 A;  2ZQD A;  3BW6 A;  2EX9 A;  3PAG A;  1ODV A;  3OCN A;  1T18 A;  3W2Z A;  3B33 A;  5A91 A;  2P9V B;  1FQG A;  4S2O A;  2VKS A;  4HP9 A;  4FH4 A;  4HNB A;  1Z09 A;  5FQQ A;  3BEC A;  1ZHH B;  4K08 A;  1E3U A;  2JKT I;  2R9W A;  1M40 A;  3B47 A;  4R38 A;  3IX3 A;  4DMZ A;  4P87 A;  4UAA A;  4XT2 B;  3ICY A;  1W63 M;  4Q0J A;  3IXG A;  2ZM8 A;  3PBR A;  3T1Q B;  3EGX C;  4MN6 A;  3UO9 A;  3MKF A;  1F98 A;  2RCX A;  3MFD A;  2ZBB A;  4R3B A;  1K57 C;  3BLS A;  3PBQ A;  4I38 A;  2OV5 A;  4MLL A;  3BJN A;  3T4L A;  4FCF A;  1F5M A;  4B93 A;  1S1Y A;  2E8J A;  4PM5 A;  1ZG4 A;  1BLC A;  1YM1 A;  1S67 L;  5FSR A;  4ZTK A;  3A3I A;  1ZC2 A;  3OC2 A;  1S0W A;  4U0T A;  4KZ7 A;  4CLC D;  3FWL A;  3E4P A;  3RH8 B;  1JWV A;  3IHB A;  4QU3 A;  4MNR A;  5TR7 A;  2ACG A;  3GQZ A;  5TJJ A;  5GLB A;  1KGF A;  4DE1 A;  4OVD A;  3LCE A;  4OH0 A;  3QP8 A;  1GHI A;  4H6J B;  4I3A A;  5GHY A;  2ZL1 B;  5A92 A;  5G4Y A;  2EA9 A;  1PIO A;  2A3U A;  3OPH A;  1WE4 A;  5DTS A;  2WAD A;  1YSP A;  5J7E A;  1ZG6 A;  2FH5 A;  5F68 A;  2G2U A;  3HLG A;  3QNC A;  4WEL A;  1NXY A;  3LR4 A;  3LGO A;  3Q7V B;  3L7H A;  4N1H A;  1XJ3 A;  5E2H A;  1HD8 A;  4Z9Q A;  4KZB A;  3CPT A;  4RX2 A;  3G35 A;  1XFN A;  1BLH A;  4I3J A;  2V1A A;  4MMN A;  2PT7 A;  1MKI A;  2JE5 A;  1P9R A;  3A3D A;  5GLC A;  3V50 A;  5DFX A;  3Q7Z A;  1XJ4 A;  1ALQ A;  1WYB A;  3WS1 A;  4DJ2 A;  5DKL A;  4JXS A;  2ZC5 B;  4UQI M;  4BWI A;  2V1B A;  1YAX A;  4F3L A;  4ZRR A;  3RJU A;  1YLP A;  4P6Z S;  4YFM A;  1LI0 A;  1CF0 A;  4L9E A;  3UB9 A;  1OTD A;  4OLD A;  5EVI D;  1BSG A;  4IVI A;  2HPB A;  2Y91 A;  2BG1 A;  3S7Q A;  3T1X A;  3BRM A;  3ZYT A;  4G3K A;  1RGY A;  3ZGA B;  1OPX A;  4WUJ A;  5F82 A;  2HF6 A;  4KQR A;  2V20 A;  2IWB A;  2ZLY A;  4HIA A;  2OWH A;  4OON A;  1H0M A;  2L4R A;  1MXO A;  1V9Z A;  1XKZ A;  4IBX A;  4ZDX A;  5HPF A;  3C38 A;  1NYM A;  2B95 A;  3RFB A;  4GHI A;  4MCW A;  5HDS A;  4ZJ3 A;  2ZQ9 A;  1XP4 A;  4K0X A;  3U2A A;  3UMD A;  4LCL A;  3PR6 A;  1BLP A;  1U60 A;  2Q9N A;  3C4O A;  3N8S A;  3LFV A;  3PBO A;  4EBN A;  4S2N C;  4JKT A;  2VV6 A;  1FR6 A;  2PHY A;  1K38 A;  3NUL A;  1K56 A;  3WS5 A;  4F94 A;  2Y59 A;  4R1G A;  1FR1 A;  3BFD A;  2PD7 A;  2XEP A;  5EVL A;  4BBV A;  1PZO A;  3VP2 A;  3LIA A;  3LY3 A;  3T4O A;  3UB7 A;  4JBF A;  2JKR I;  3FV7 A;  3UY6 A;  1DP8 A;  4E3I A;  5AVF A;  4Y0O A;  4WF0 A;  3HBR A;  2XH9 A;  5AVE A;  4Y5F A;  2BTF P;  3NY4 A;  1UGU A;  1K6R A;  4JGO A;  5HX9 A;  1K55 A;  2NUP C;  1D7E A;  1ZTU A;  4HY8 A;  3MXQ A;  2IA2 A;  2JKT M;  1TVF A;  4EEP A;  2ZJ9 A;  4HJ3 A;  1AXB A;  3PBT A;  3ZG0 A;  1FSW A;  4JGP A;  1RP5 A;  1S66 L;  3S7O A;  3F1P A;  4NXG A;  2Y2J A;  4UEY A;  3OPL A;  2DRW A;  3QNB A;  3ZNY A;  1NRF A;  5TFQ A;  3WS2 A;  3UE6 A;  2J3T D;  3A3F A;  1TS8 A;  3IQA A;  3KX0 X;  3H82 B;  1SKO B;  1GCE A;  4GW9 A;  2Y2G A;  2KDK A;  4KZ8 A;  4MN7 A;  2V0U A;  4OP5 A;  3C7V A;  4B4Z A;  2W3G A;  4FSF A;  2VV8 A;  2EX6 A;  5G18 A;  2A24 A;  2JBF A;  1L0G A;  5CHJ A;  4G3V A;  3F1O B;  3FYZ A;  4E6W A;  5J8X A;  2Y2H A;  4JPM A;  5F5Y A;  2VJW A;  5DJU A;  1E25 A;  4KQD A;  2Y55 A;  4PM9 A;  2WKI A;  3BLM A;  1XX2 A;  4Q0I A;  3HLD A;  1KE0 A;  1TS7 A;  2G7U A;  2OWJ A;  2FFF B;  5KSC A;  3EOI A;  4S2K A;  2HP5 A;  4GDN A;  4NET A;  4O8G A;  3SW1 A;  5DF8 A;  2XRN A;  1LLB A;  4OPQ A;  4JF6 A;  4G3W A;  5CER A;  5EFW A;  1LL8 A;  1L0D A;  5HDC A;  3OZH A;  3WS0 A;  5HL6 A;  3SS3 A;  2WKR A;  4QY5 A;  2HGV A;  4C6Y A;  4R4S A;  4PHT A;  5F1F A;  4PM7 A;  1NLY A;  4GB7 A;  2XA7 S;  3SH9 A;  2XQZ A;  2QHK A;  1E4D A;  1LT0 A;  2HDQ A;  3B3X A;  3BFF A;  4HES A;  2Z6C A;  2EFU A;  5AQA A;  5F6A A;  4Y15 A;  4ETX A;  3BFG A;  4O7D A;  2A2L A;  2D01 A;  2W1T A;  3I7J A;  5HWV A;  3S1Y A;  2W27 A;  1K54 A;  4D60 A;  2ZQA A;  5EM0 A;  4HQA A;  2ZL1 A;  4QJG A;  4QPR A;  4CLC A;  3HUM A;  2OLV A;  3B42 A;  2XD1 A;  1JTG A;  1W79 A;  2WUQ A;  2J9O A;  3C2W A;  2PU2 A;  1JWP A;  4KZ4 A;  3WWX A;  4HJ4 A;  3H7W B;  2HP6 A;  5HWT A;  3O87 A;  1WYC A;  3LEQ A;  3VP1 A;  4P6Z M;  5AJG A;  3M2J A;  1SCW A;  2C6W B;  3LIC A;  4P6B A;  1UWN X;  4S2I A;  4WZ5 A;  1Z6F A;  3CZD A;  2JHE A;  4GN2 A;  2K31 A;  3NC8 A;  3R7W B;  3MF0 A;  1ES4 A;  2O9C A;  5IU1 A;  2I72 A;  3RTY A;  3KYE A;  3VSL A;  4EES A;  3M6H A;  1MBL A;  3K3D A;  3HLW A;  5I94 A;  2PBD P;  2OAQ 1;  2GDN A;  2XGN A;  2ZC7 A;  4GCZ A;  1L3L A;  3EWK A;  5J3W A;  4OPY A;  4R6L A;  3G34 A;  2NUT C;  1S4S A;  3QP4 A;  3K2N A;  2W3F A;  3EGD C;  2V9A A;  1ERM A;  2IWD A;  3T4Q A;  3RXX A;  1ZKJ A;  2WGW B;  1GSX A;  3G2Z A;  3C30 A;  3W4P A;  3D9Y A;  2XF3 A;  1S4R A;  4KG2 A;  1LL9 A;  4BJP A;  3E2L A;  2OAP 1;  3LIF A;  1QME A;  4NXB A;  4DF6 A;  4X25 A;  4Y17 A;  2FZ0 A;  3UE1 A;  3CI6 A;  2PYP A;  5EVI A;  5DTT A;  2W3E A;  3O5Y A;  4HH2 A;  4R70 A;  5FAO A;  4EET B;  4FTX A;  1BZA A;  1BTL A;  3NOT C;  4S2J A;  4DJ3 A;  4RQ9 A;  1FIL A;  5KMW A;  4PKY G;  3LI9 A;  5LBR A;  3C7U A;  1NYY A;  2Z6D A;  1T1B A;  4KEN B;  1NLZ A;  3CUE A;  1OT6 A;  4GJ4 A;  4WZ4 A;  4ESP A;  5A8B A;  4U3T A;  2WKP A;  5HL1 A;  1T19 A;  5HSQ A;  2JKR M;  1Q2P A;  4DE2 A;  3IX4 A;  3FC7 A;  1DP9 A;  3W4O A;  1N9L A;  2Y2N A;  2Y2K A;  2H10 A;  3KSH A;  3QHY A;  3SZT A;  3VP3 A;  3A0V A;  2WK0 A;  1H8Z A;  3EEA A;  3FG8 A;  2W1R A;  5FL3 A;  4ARZ A;  5HAP A;  3PBS A;  5HAQ A;  4JGR A;  4KQO A;  3IH9 A;  2DNS A;  1ACF A;  4CJN A;  5HD3 A;  3P01 A;  4HOI A;  1CK3 A;  4FOF A;  1X0O A;  2PR5 A;  2HDS A;  5GLD A;  4WL9 A;  5AQ7 A;  4O01 A;  1JNU A;  1JWZ A;  4KG5 A;  3M2K A;  3MFX A;  4HBU A;  3V67 A;  3LEZ A;  1IKG A;  3UME A;  4FUW A;  4OP8 A;  2VV7 A;  4X6T A;  4GD6 A;  2ZM0 A;  4NXE A;  1I5Q A;  3CWF A;  1DP6 A;  2BAS A;  4X68 A;  4YOF A;  4EBL A;  1XA1 A;  1PI4 A;  3F1N B;  4HH3 A;  3G2Y A;  2XRO A;  1EWZ A;  2CMN A;  3CIT A;  3G32 A;  5E2G A;  2O0Y A;  5EOE A;  2E8I A;  1CQA A;  5FI7 A;  3WRT A;  4UA9 A;  1XGI A;  3MS6 A;  3CG5 A;  1LSX A;  2HZ5 A;  5CX7 A;  5CRF A;  3V5M A;  2QJ7 A;  2LB5 A;  2ZQC A;  4OOL A;  5HPI A;  4B9O A;  1W7F A;  4HBT A;  2X71 A;  3M6B A;  4MN5 A;  1HTZ A;  1ES3 A;  1CI8 A;  3BY9 A;  2Y2M A;  2XA7 M;  3UPO A;  3IS2 B;  1FOF A;  1YLT A;  2BLS A;  2VGK A;  1GSW A;  2DCF A;  4WN5 A;  1RGZ A;  2PBY A;  4RA7 A;  1MWT A;  1K6S A;  1KDS A;  2KLI A;  1LHY A;  2HP9 A;  1STZ A;  1XXM A;  4NG2 A;  4N9L A;  3HCY A;  5EEC A;  2M7U A;  5EM1 A;  5EV0 A;  1PRQ A;  1YLZ A;  4EUV A;  1CJF A;  1TDL A;  3VOZ A;  3DAV A;  3O86 A;  4JGQ A;  3PBN A;  2M7V A;  1A0K A;  1O07 A;  4QY6 A;  2VZW A;  2OLU A;  2KOI A;  5KIZ A;  1VB6 A;  3V39 A;  1M6K A;  3Q07 A;  1PFL A;  4GNU A;  4LV3 A;  3IF6 A;  1H8Y A;  1OTA A;  3LY4 A;  3VFF A;  4MBF A;  1W5D A;  4BL2 A;  3V3S A;  4L0L A;  4BMW A;  5DJT A;  1XA7 A;  3UPP A;  2EWW A;  2EXA A;  4PM6 A;  3MQO A;  2OOL A;  3NI9 A;  3A3J A;  3FPV A;  3ZHH A;  1PNE A;  3IWI A;  3TRC A;  1YT4 A;  4JXG A;  3KYQ A;  4GOG A;  2PU4 A;  1VEU B;  2UV0 E;  5FAQ A;  4R4R A;  1OJG A;  5FI2 A;  3H7W A;  3GSG A;  3CMZ A;  1SDE A;  3C5A A;  3KSF A;  2Y4A A;  1PWD A;  5FI6 A;  4IJG A;  5DTK A;  5JYO A;  4DE0 A;  4X1L A;  2J8Y A;  3UDF A;  3TE8 A;  3GDI A;  3WRZ A;  2PAV P;  1H3Q A;  4EEU A;  4JLF A;  1J9M A;  3LID A;  5CEB A;  4YWZ A;  4WYY A;  1ONG A;  4R0Q A;  4MBK A;  4EQI A;  5HAI A;  1S6R A;  3LYX A;  1DRM A;  4OPZ A;  5CTM A;  4C75 A;  2AVX A;  2ZMA A;  2HDR A;  3E98 A;  3OLO A;  3UNW A;  1OTI A;  2JKG A;  2HJE A;  1VET A;  1N9O A;  2ZM2 A;  4QD4 A;  1TD5 A;  4M4X A;  2XR0 A;  4Y0T A;  3TG9 A;  1BYW A;  3BWL A;  4DRT A;  3LUQ A;  3LR5 A;  5C5K A;  3GRJ A;  3N7W A;  3V3R A;  1OT9 A;  1VHM A;  2ZOI A;  4EER A;  2MJ6 A;  1L0F A;  2J3W A;  5GL9 A;  4K0W A;  4LPZ A;  3UDI A;  5KZH A;  4CPK A;  1T1C A;  4ME4 A;  1KGG A;  5GLA A;  3S7P A;  2XSS A;  4BBT A;  2P9V A;  3BYD A;  4K91 A;  3NHQ A;  1Q2Q A;  2O9B A;  1DJB A;  1YLY A;  3UDX A;  5CEC A;  5HAR A;  3A0R A;  1NWZ A;  2WGV A;  1H5X A;  2VGJ A;  2HDU A;  3A0S A;  3OPP A;  3T4K A;  2LB9 A;  4ETZ A;  4MEZ A;  3C4P A;  3LIB A;  3G6O A;  2W3H A;  4XT2 A;  5EOO A;  1SZV A;  4GZB A;  2FFY A;  2ZC6 B;  4KUK A;  2RL3 A;  2XK1 A;  3CJM A;  3CPT B;  1I2W A;  1YQS A;  3IT9 A;  4EUZ A;  3T12 B;  2HJ9 C;  3NBL A;  3KYZ A;  3GEC A;  1J3W A;  3GV9 A;  1KGE A;  5TGF A;  3IH8 A;  3H9W A;  4UA7 A;  4IUK A;  4EV4 A;  4DXC A;  2UWX A;  2Y2O A;  4PM8 A;  1D1J A;  4KZ3 A;  4Y0U A;  4F3L B;  4ZAM A;  3FZC A;  4PMA A;  2K7S A;  2V1Z A;  4OOY A;  1EW0 A;  2Y79 A;  2IWC A;  3VSK A;  3RXW A;  3GTC A;  3EQV A;  4U0X A;  5EUA A;  4EW7 A;  4GDB A;  5A93 A;  5E43 A; 
#chains in the Genus database with same CATH homology
 3C7U A;  1NYY A;  4RX2 A;  3G35 A;  3NIA A;  1NZU A;  4KEN B;  1W8Q A;  4YIN A;  1BLH A;  1IYO A;  4WZ4 A;  2X02 A;  1CEG A;  3OPR A;  4HEF A;  1O7E A;  4U3T A;  1TEM A;  5FDH A;  4N1X A;  5CTN A;  1MKI A;  5HL1 A;  2JE5 A;  4NK3 A;  4OQG A;  3A3D A;  3HL9 A;  5GLC A;  3MZF A;  3V50 A;  4WMC D;  2ZQ7 A;  3Q7Z A;  1ALQ A;  1WYB A;  3WS1 A;  4JXS A;  1K55 C;  1Q2P A;  2ZC5 B;  2WGW A;  4DE2 A;  3VP0 A;  3IXD A;  1DY6 A;  1XPB A;  3ZVW A;  4LV1 A;  3W4O A;  1FCM A;  2P74 A;  2Y2N A;  3RJU A;  2Y2K A;  1YLP A;  5E2E A;  2H10 A;  4QB8 A;  4YFM A;  3QHY A;  1LI0 A;  3VP3 A;  3G4P A;  2B5R A;  3HLB A;  1BLS A;  3ZCZ A;  4OLD A;  4RYE A;  5FQ9 A;  2WK0 A;  5EVI D;  1H8Z A;  1BSG A;  4IVI A;  3S22 A;  2HPB A;  4OKP A;  3Q7V A;  1RCJ A;  5HAP A;  3MKE A;  1K57 A;  2Y91 A;  3BEB A;  2BG1 A;  4A5R A;  3PBS A;  3BRM A;  1N9B A;  1YMX A;  5DF7 A;  5HAQ A;  2C5W B;  1RGY A;  2Z2L B;  3ZGA B;  4P85 A;  4DE3 A;  4KQO A;  4XXR A;  3IH9 A;  3HLF A;  5F82 A;  3BM6 A;  1MPL A;  4KQR A;  2QMI A;  2V20 A;  3NCK A;  4KQQ A;  2DNS A;  2JC7 A;  5EPH A;  2IWB A;  4CJN A;  2ZLY A;  5AQB A;  4C3Q A;  4OON A;  5FQM A;  1MXO A;  3IF6 C;  1KDW A;  1YLW A;  2WKH A;  1IYQ A;  5F83 A;  1NJ4 A;  1XKZ A;  4UA6 A;  4IBX A;  1TDG A;  4WEK A;  4XUZ A;  1CK3 A;  4OPR A;  4ZDX A;  3HUN A;  3W8K A;  3ZG5 A;  3FKW A;  4R23 A;  1NYM A;  2HDS A;  5GLD A;  3DWK A;  1IKI A;  1KE4 A;  2J9P A;  5AQ7 A;  1VQQ A;  4ZJ3 A;  1JWZ A;  2ZQ9 A;  1XP4 A;  3P98 A;  4B88 A;  4KG5 A;  3M2K A;  4K0X A;  4MBH A;  3Q1F A;  3UPN A;  3O3V A;  4HBU A;  3LEZ A;  1YMS A;  3UN7 A;  1K4F A;  4LCL A;  1IKG A;  3MBZ A;  1JTD A;  4OP8 A;  2EX8 A;  4X56 A;  4X6T A;  2X01 A;  4GD6 A;  2ZM0 A;  1BLP A;  3D4F A;  1U60 A;  4FH2 A;  1DJA A;  3UE0 A;  3ISG A;  4E3N A;  2Q9N A;  3ITB A;  1PI5 A;  1I5Q A;  5A90 A;  5FAS A;  3C4O A;  4BD0 A;  2R9X A;  3N8S A;  4X68 A;  5D3O A;  3HLC A;  3PBO A;  3VFH A;  3MZE A;  4EBN A;  4S2N C;  2Y2L A;  3NDE A;  4JKT A;  4EBL A;  4ZJ1 A;  1XA1 A;  1PI4 A;  3DWZ A;  5EE8 A;  2H0Y A;  4S2L A;  1FR6 A;  4EWF A;  3G2Y A;  3GVB A;  1EWZ A;  1K38 A;  3G32 A;  5E2G A;  5EOE A;  5BOH A;  4DXB A;  3DW0 A;  1Y54 A;  2E8I A;  5FI7 A;  3WRT A;  5CED A;  2CC1 A;  4LV2 A;  1K56 A;  1XGI A;  4N9K A;  4UA9 A;  3WS5 A;  4F94 A;  1KVL A;  3CG5 A;  2EX2 A;  2Y59 A;  3MXR A;  4N92 A;  3N8R A;  4M3K A;  4R1G A;  1FR1 A;  5CRF A;  1ERO A;  3E2K A;  3BFD A;  2XEP A;  3V5M A;  4S2P A;  5EVL A;  1IEM A;  1LI9 A;  5CGS A;  1PZO A;  4KZ9 A;  3VP2 A;  4OQH A;  1IYP A;  4UHU A;  2ZC3 B;  3LY3 A;  4WEJ A;  3SH7 A;  1FCN A;  2ZQC A;  4OOL A;  1BT5 A;  4GKU A;  4JBF A;  3EQU A;  1W7F A;  4X69 A;  4HBT A;  2X71 A;  4IVK A;  3FV7 A;  3M6B A;  4BD1 A;  3UY6 A;  4E3I A;  2Q9M A;  1HTZ A;  5HW3 A;  1ES3 A;  4E3J A;  3IXH A;  1G68 A;  4Y0O A;  2Z2M B;  1CI8 A;  1PW1 A;  5M1A A;  4E3L A;  2Y2M A;  2EFX A;  5FA7 A;  3UPO A;  3IF6 B;  3HBR A;  2XH9 A;  2G2W A;  1NY0 A;  1FOF A;  1YLT A;  2BLS A;  2VGK A;  4GD8 A;  2DCF A;  1K54 C;  3HVF A;  3NY4 A;  1K6R A;  1RGZ A;  4H8R A;  5HX9 A;  2PBY A;  4WBG A;  1K55 A;  1MWT A;  4RA7 A;  1BUL A;  4ID4 A;  1K6S A;  1KDS A;  2QZ6 A;  3IXB A;  1HZO A;  1TVF A;  1LHY A;  2HP9 A;  2ZJ9 A;  1XXM A;  1AXB A;  1GHP A;  2JCH A;  3PBT A;  5AQ9 A;  5FQI A;  1IEL A;  3ZG8 B;  3ZG0 A;  1FSW A;  1K56 D;  4N9L A;  2EXB A;  5EEC A;  1RP5 A;  4RX3 A;  2WGI A;  2ZC4 B;  4Y7P A;  1YLZ A;  1GA9 A;  2Y2J A;  4OQI A;  4OQ0 A;  5FAP A;  5FAT A;  3OPL A;  3SH8 A;  2DRW A;  2QPN A;  3QNB A;  1TDL A;  4QHC A;  3VOZ A;  3W4Q A;  3NDG A;  3O86 A;  2ZD8 A;  3ZG7 B;  3ZNY A;  4FD8 A;  3PBN A;  5CGX A;  1NRF A;  5TFQ A;  3WS2 A;  1PYY A;  4LEN A;  1O07 A;  4QY6 A;  1QMF A;  3A3F A;  3GR2 A;  3IQA A;  4WZ5 C;  5GHX A;  4E3M A;  5FQJ A;  2OLU A;  1SKF A;  4DKI A;  2J7V A;  1GCE A;  1SHV A;  3BFC A;  1M6K A;  3V39 A;  3ZVT A;  4E3O A;  2Y2G A;  2Y2P A;  3Q07 A;  1ERQ A;  4GNU A;  4KZ8 A;  3N6I A;  4LV3 A;  2XD5 A;  3IF6 A;  4OP5 A;  4OOM A;  1H8Y A;  3C7V A;  3LY4 A;  4B4Z A;  3VFF A;  1PWC A;  4MBF A;  4FSF A;  5L2F A;  2A49 A;  5CXW A;  1W5D A;  1K4E A;  2EX6 A;  5G18 A;  1G6A A;  4KZ6 A;  2JBF A;  4BL2 A;  1L0G A;  5CHJ A;  3V3S A;  3SS5 A;  1BUE A;  3DTM A;  4L0L A;  4DDY A;  3FYZ A;  5E2F A;  1XA7 A;  4IBR A;  4PPR A;  4E6W A;  5CHM A;  3UPP A;  5J8X A;  2Y2H A;  1GHM A;  2XDM A;  4JPM A;  5KSH A;  2EXA A;  4RVA A;  3VMA A;  4PM6 A;  4IED A;  3NI9 A;  3A3J A;  3ZHH A;  4R3J A;  1E25 A;  3A3E A;  2Y55 A;  3IWI A;  4PM9 A;  3HUO A;  1MWR A;  1YT4 A;  2WKI A;  4KG6 A;  3BLM A;  1XX2 A;  1ES5 A;  4JXG A;  4GOG A;  2PU4 A;  4ZJ2 A;  3HLD A;  1KE0 A;  3FKV A;  3Q81 A;  1EI5 A;  5FAQ A;  1MWS A;  4R4R A;  1MY8 A;  5GHZ A;  2FFF B;  1YLJ A;  4S2N A;  2XFT A;  5KSC A;  5FI2 A;  3PAE A;  4S2M A;  1XGJ A;  3G31 A;  4EBP A;  1KE3 A;  3JYI A;  3ZFZ A;  4S2K A;  2HP5 A;  1PW8 A;  2Y2I A;  3GSG A;  3ITA A;  3TOI A;  4GDN A;  3P09 A;  3CMZ A;  2WKE A;  4JF5 A;  1SDE A;  3C5A A;  4NET A;  3ZDJ A;  4BEN A;  2WAF A;  4BL3 A;  3WS4 A;  5DF8 A;  2Y4A A;  4ZBE A;  1LLB A;  3G30 A;  4OPQ A;  1PWD A;  4JF6 A;  5HFO A;  4E6X A;  2ZQ8 A;  5FI6 A;  5DTK A;  4Q8I A;  5CER A;  5JYO A;  4DE0 A;  3IWQ A;  3SOI A;  2J8Y A;  1CI9 A;  3MXS A;  4BLM A;  3MZD A;  1L0D A;  1W8Y A;  2H5S A;  3OZH A;  3UDF A;  3WS0 A;  5EVI C;  4DDS A;  4KZ5 A;  1C3B A;  2Y2Q A;  1KVM A;  1NZO A;  4QY5 A;  3SS3 A;  2ZQD A;  5M19 A;  3WRZ A;  4C6Y A;  2EX9 A;  3PAG A;  4R4S A;  4XUX A;  5CHU A;  5F1F A;  4PM7 A;  1FCO A;  2XFS A;  4GB7 A;  4JLF A;  1J9M A;  3SH9 A;  2XQZ A;  3OCN A;  4D2O A;  1E4D A;  5CEB A;  2HDQ A;  1ONG A;  4WYY A;  1PWG A;  4R0Q A;  4MBK A;  4BQM A;  3B3X A;  5A91 A;  2P9V B;  4EQI A;  3BFF A;  1FQG A;  4HES A;  2EFU A;  1S6R A;  4S2O A;  5AQA A;  5HAI A;  3VOY A;  3BFG A;  4FH4 A;  4OPZ A;  5CTM A;  4C75 A;  2ZMA A;  4O7D A;  3BEC A;  5FQQ A;  1LL5 A;  2HDR A;  1E3U A;  5M18 A;  3I7J A;  3UNW A;  2R9W A;  1M40 A;  3O88 A;  3HRE A;  3S1Y A;  3N8L A;  1K54 A;  4JXW A;  2ZQA A;  1MWU A;  4P87 A;  4UAA A;  4QJG A;  2OSU A;  2V2F F;  2ZM2 A;  2ZM8 A;  3IXG A;  4QD4 A;  3PBR A;  1PZP A;  4E3K A;  2WZZ A;  3HUM A;  2OLV A;  3UO9 A;  2WYX A;  2XD1 A;  1JTG A;  2XR0 A;  3IWO A;  3MKF A;  5FQK A;  1W79 A;  3TG9 A;  4Y0T A;  2WUQ A;  2RCX A;  2J9O A;  2XLN A;  4DRT A;  3MFD A;  3SS4 A;  5U47 A;  3GRJ A;  3N7W A;  2PU2 A;  1JWP A;  4R3B A;  3V3R A;  4KZ4 A;  4P0M A;  3WWX A;  1ESI A;  1DJC A;  1L0F A;  3OCL A;  1K57 C;  4KZA A;  5GL9 A;  2HP6 A;  4K0W A;  3ZNT A;  3UDI A;  3O87 A;  4CPK A;  3AGD A;  5KZH A;  1I2S A;  3BLS A;  1WYC A;  3PBQ A;  4Z9Q A;  1ES2 A;  1KGG A;  2OV5 A;  3VP1 A;  1GA0 A;  5GLA A;  3VP4 A;  4MLL A;  2WZX A;  3M2J A;  1SCW A;  2C6W B;  4S2I A;  4P6B A;  4WZ5 A;  2P9V A;  3BYD A;  4K91 A;  3HLE A;  4FCF A;  1Z6F A;  3Q82 A;  3CZD A;  1Q2Q A;  2H0T A;  4GN2 A;  1OME A;  3NC8 A;  3TSG A;  3BFE A;  1DJB A;  1ES4 A;  1YLY A;  1E3U D;  4JXV A;  3UDX A;  5CEC A;  5F1G A;  5HAR A;  4PM5 A;  2I72 A;  2WGV A;  1FSY A;  3N4I A;  1ZG4 A;  1BLC A;  5IHV A;  1CEF A;  1H5X A;  1YM1 A;  2VGJ A;  2HDU A;  3IF5 A;  3IHA A;  3OPP A;  5EVI B;  5FSR A;  3VSL A;  4ZTK A;  1HVB A;  3M6H A;  3A3I A;  4LV0 A;  3C4P A;  1ZC2 A;  4MEZ A;  3UE3 A;  3OC2 A;  1MBL A;  3HLW A;  5I94 A;  1S0W A;  4U0T A;  5EOO A;  4KZ7 A;  1ESU A;  2FFY A;  2GDN A;  2XGN A;  2ZC6 B;  3FWL A;  4GZB A;  2RL3 A;  5CGW A;  2ZC7 A;  2XK1 A;  1L0E A;  3CJM A;  1I2W A;  1ONH A;  1YQS A;  1VM1 A;  3IT9 A;  1JWV A;  3IHB A;  4QU3 A;  5DVA A;  3LO7 A;  4EUZ A;  4MNR A;  4OPY A;  5TR7 A;  3G34 A;  4JF4 A;  3GQZ A;  3ZG9 B;  4OLG A;  3NBL A;  1K25 A;  3GV9 A;  1IYS A;  4X53 A;  4X55 A;  1KGF A;  1KGE A;  5GLB A;  4DE1 A;  3AGE A;  4OVD A;  3LCE A;  4OH0 A;  5TGF A;  4B4X A;  3IH8 A;  1GHI A;  2WAE A;  4UA7 A;  1ERM A;  5GHY A;  4WMC A;  2IWD A;  5A92 A;  3RXX A;  4LCM A;  1ZKJ A;  4EV4 A;  3AGF A;  1PIO A;  4DXC A;  2WGW B;  2UWX A;  2Y2O A;  3G2Z A;  4PM8 A;  2A3U A;  3W4P A;  3OPH A;  4KZ3 A;  4Y0U A;  1WE4 A;  4WM9 A;  2XF3 A;  5DTS A;  2WAD A;  4BJP A;  4KG2 A;  1LL9 A;  3E2L A;  4ZAM A;  1QME A;  3FZC A;  3GMW A;  4DF6 A;  1ZG6 A;  1L2S A;  1JVJ A;  4PMA A;  2V1Z A;  3UE1 A;  4OOY A;  2G2U A;  3HLG A;  3QNC A;  4WEL A;  1NXY A;  1SDN A;  5EVI A;  5DTT A;  5FAO A;  5JYP A;  2IWC A;  3Q7V B;  3VSK A;  3RXW A;  3GTC A;  3EQV A;  4U0X A;  1BZA A;  3S4X A;  1BTL A;  3PTE A;  4GDB A;  4S2J A;  5EUA A;  4N1H A;  5A93 A;  5E2H A;  1N4O A;  5DF9 A;  1HD8 A;  4KZB A;  5KMW A;  5E43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...