1ERQA

X-ray crystal structure of tem-1 beta lactamase in complex with a designed boronic acid inhibitor (1r)-1-acetamido-2-(3-carboxy-2-hydroxyphenyl)ethyl boronic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design guides the improved efficacy of deacylation transition state analogue inhibitors of TEM-1 beta-Lactamase(,).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords TEM-1 BETA-LACTAMASE
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1erqA00
1QMEA 4A5RA 4LCMA 3AGDA 3UN7A 1IKIA 4DE3A 4K0WA 3V3SA 2WK0A 3BFDA 2XD5A 2HP5A 5FQJA 3VP1A 5KSCA 3G4PA 5TR7A 4N92A 2JBFA 1EWZA 3NDGA 3NDEA 5HARA 2IWBA 4BD1A 3JYIA 1W8QA 4UA6A 4PMAA 3DW0A 3IT9A 4JF4A 2ZJ9A 4RVAA 1CI8A 4ZTKA 3V39A 1ERQA 3IF6B 1XP4A 5A93A 4KG2A 4OP8A 2X71A 3WS0A 1FQGA 3ZG9B 5DF7A 2XGNA 1BUEA 1K57C 4OOYA 5DF9A 4CJNA 2XDMA 4R0QA 2X02A 4GOGA 5GHYA 1ESIA 1N9BA 2XK1A 4IBXA 2J7VA 1ES2A 5DTSA 4JKTA 3SH9A 1LLBA 3BYDA 3V3RA 1LL5A 1C3BA 1H5XA 4WZ5A 2Q9NA 4OPZA 1W79A 4JF5A 5E2FA 1JWVA 5EE8A 5FAOA 1FOFA 3BECA 2WZXA 3GQZA 4R1GA 1MWSA 1WE4A 1TEMA 1IKGA 3ITBA 3NBLA 1L0EA 4P85A 1L0GA 1ESUA 1LL9A 4X68A 4Q8IA 3N4IA 4BL3A 4Y0OA 4O7DA 2XFTA 5F1GA 4MBKA 1PI5A 4S2NC 3CMZA 3SH8A 3SOIA 5I94A 4OPYA 2WAFA 4JLFA 4S2JA 5HL1A 1RCJA 2Y2GA 4WYYA 5E2HA 3WRTA 1HTZA 5HW3A 3LY4A 3OCLA 1K55C 5CGWA 5DVAA 5EUAA 3GSGA 2XEPA 3OPLA 2IWCA 4U0TA 4KZ8A 1CK3A 1YQSA 1L0DA 3HBRA 2HPBA 3IF6A 1FR6A 3IWQA 3PBOA 1SCWA 5EVIA 5A90A 4JXWA 1YLZA 2WGWB 4JF6A 4FH2A 5FAQA 1K4FA 3FWLA 3BLSA 4ZJ2A 3HLDA 3PBNA 5F1FA 3NY4A 3ZG5A 2PU4A 2Y2OA 3P09A 3TG9A 5FI2A 3IXDA 2FFFB 2ZM2A 2A3UA 3IXHA 4E6WA 5TGFA 3OPRA 4DDYA 4DF6A 4E3JA 2ZC3B 1K38A 4DE1A 2R9WA 1DJBA 4WEJA 5E2GA 4X56A 5GHZA 3A3JA 5D3OA 3M2KA 4XUZA 4F94A 5CEDA 4KZAA 3SS3A 2Z2LB 4S2NA 1E3UD 2OLUA 5EVLA 4OOLA 1DJCA 4JXGA 3VP2A 1GCEA 3HVFA 3HUMA 3MZFA 3HLFA 1XGIA 5CTNA 3TOIA 3LEZA 4OQGA 3IHBA 2EX9A 4ZJ1A 2UWXA 4YFMA 3ZHHA 3EQVA 3S4XA 3CJMA 3CZDA 1CEGA 3WS4A 2HDUA 1EROA 4X55A 2X01A 1E3UA 2V20A 5FDHA 3O86A 1PW1A 4OKPA 1K25A 2Y2HA 1GA0A 1EI5A 5GLCA 5CERA 4GD8A 3PBTA 1I2WA 1K57A 4L0LA 3VP3A 2ZQDA 1TDLA 2XQZA 1K54C 3IH8A 3IWOA 4QHCA 4WZ5C 3W4OA 1OMEA 4S2LA 1IYPA 2P9VA 3NIAA 3PTEA 3FKWA 5GHXA 3Q7VB 4X53A 4DE2A 1I2SA 3M2JA 3PBRA 2Q9MA 4IEDA 1W8YA 1YM1A 3G2ZA 2PBYA 3DWKA 4EQIA 1K54A 1XX2A 4KG5A 4R4RA 3O88A 4RX2A 1JWZA 3PBQA 4LV0A 5CHJA 2ZQ8A 1G68A 4BD0A 1HVBA 4KQQA 2I72A 2ZMAA 3C5AA 3WWXA 3GRJA 1K56A 4GD6A 5GLBA 4X69A 4E3IA 3AGFA 1IYSA 4R3BA 1JWPA 4HESA 3MZDA 4GKUA 4KG6A 3A3FA 3BFEA 4KZ7A 1WYBA 3Q82A 4Y7PA 3VP0A 5FASA 1K6SA 1VM1A 4EV4A 2A49A 1FSYA 1NY0A 3GV9A 5EVID 1YLYA 2C5WB 2ZQ7A 1GHPA 3IF5A 2ZD8A 3NI9A 4KZ6A 4DRTA 2ZQAA 5J8XA 5EOOA 3W4QA 3D4FA 3LO7A 2QMIA 1Z6FA 1MWUA 4K0XA 5FQMA 5KMWA 4BENA 3HL9A 2ZLYA 3O3VA 3WRZA 4LV2A 4N1XA 4KZBA 2WKHA 4LV3A 4RA7A 1BLPA 1IEMA 4NK3A 4N1HA 3ISGA 1DY6A 3VOYA 5KZHA 2WKIA 2Y2MA 1PZOA 3HREA 1MKIA 1W7FA 2H5SA 4WMCA 1DJAA 1H8ZA 3MKEA 4B4XA 4DKIA 2EXAA 2XFSA 1CI9A 4RX3A 3A3DA 5AQAA 2RCXA 4B88A 5E43A 4HEFA 3RJUA 4BLMA 3ZG7B 1KDSA 1XA7A 3NCKA 1IYOA 1SHVA 2V1ZA 2WGVA 3M6BA 4FD8A 4PM9A 4EBNA 4OVDA 5CXWA 2E8IA 1ES3A 1N4OA 2ZM8A 1PW8A 4OONA 2HP9A 1LI9A 4OPQA 2Y55A 3GTCA 3HLGA 3Q07A 3Q81A 4OP5A 3VSKA 4GZBA 2EX2A 4JXVA 1YMSA 4PM8A 4MNRA 4BJPA 4OQIA 1QMFA 2XR0A 3VFHA 4P87A 4WM9A 4E3LA 1KGFA 3G30A 3HLEA 4PM6A 5EVIB 5A92A 2GDNA 2OV5A 5CECA 3ZCZA 2EFUA 2EX6A 3BFFA 1PI4A 1JVJA 1NYYA 4ZAMA 1FCOA 3ZNTA 3MXSA 2XD1A 1G6AA 1NJ4A 1Y54A 3MKFA 1YT4A 4JXSA 3E2LA 2ZM0A 2H10A 1J9MA 2V2FF 2Z2MB 3OPHA 4UAAA 4WZ4A 3UPPA 4HBUA 2C6WB 1ZC2A 3HLBA 3LCEA 4E3OA 3OCNA 3IWIA 5HAIA 1BLCA 1NRFA 3C4OA 1U60A 4ZDXA 1LHYA 4QU3A 4UA9A 3RXWA 4P6BA 5FA7A 1HZOA 5CTMA 3ZGAB 1S0WA 4GN2A 3B3XA 1MY8A 4B4ZA 1VQQA 2ZC5B 5GLDA 1KDWA 3N8LA 3VSLA 1M40A 3DTMA 4KZ4A 4R4SA 3BM6A 1YLTA 4QB8A 4DXBA 4MBHA 1KVMA 1NXYA 4S2PA 2OSUA 3OPPA 3IHAA 4LENA 2RL3A 1ONHA 2JE5A 3FV7A 3M6HA 1SDEA 3AGEA 4Z9QA 4NETA 2XLNA 3IQAA 1S6RA 3PAEA 1MBLA 1KE3A 1PYYA 3BLMA 4XXRA 2WYXA 3IF6C 4UA7A 5CGSA 1KE0A 4EBLA 3A3EA 1TDGA 1TVFA 5TFQA 3G31A 3N8RA 2R9XA 5A91A 1BLSA 5FQIA 4OQ0A 1K55A 3PAGA 1KE4A 2EXBA 4XUXA 3W8KA 1ALQA 1BZAA 2QZ6A 1PWDA 4WMCD 1XKZA 3UDXA 5M19A 5FI6A 3RXXA 2Y2KA 2BLSA 5FQKA 1MPLA 3VOZA 2ZQ9A 2WZZA 1AXBA 1KVLA 4E3MA 3ZVWA 3VMAA 1SDNA 1PZPA 3VP4A 4FH4A 4DDSA 1ES5A 5FQQA 2HP6A 2P9VB 4EBPA 1E4DA 5GL9A 3A3IA 3V50A 3MXRA 1ONGA 1RGZA 1Q2QA 3S22A 2VGJA 5CHMA 1BT5A 2Y59A 4OOMA 5L2FA 4ID4A 5DTTA 1CEFA 1ZG4A 3UE0A 4DE0A 2EFXA 4WELA 3UDIA 3EQUA 5FATA 4C6YA 3NC8A 3WS2A 2XH9A 5DTKA 3G34A 2Y2JA 3HUOA 1XA1A 2Y2PA 4KZ5A 1I5QA 4KZ9A 4S2IA 1ZG6A 5FQ9A 3BFCA 3IH9A 4U0XA 1PWCA 2ZC6B 3UE1A 4DXCA 2Y2LA 1SKFA 2G2WA 4D2OA 4OQHA 2J8YA 4EWFA 3Q7VA 4KENB 1Q2PA 3TSGA 3UO9A 1FR1A 3BEBA 4MBFA 4ZBEA 4Y0UA 1FSWA 1NYMA 1PIOA 5AQ9A 1O07A 1ZKJA 3GMWA 2QPNA 2WADA 5BOHA 1IELA 1YMXA 3C7VA 4ZJ3A 4KQRA 4MLLA 4BQMA 3MFDA 3WS1A 3BFGA 5AQ7A 5HAPA 2Y2NA 2IWDA 4WEKA 4GDBA 3BRMA 5G18A 2ZQCA 1KGGA 4FSFA 4LV1A 3Q7ZA 4YINA 2B5RA 4GB7A 5EPHA 1RGYA 4IVKA 5EOEA 3QHYA 4K91A 1L0FA 4CPKA 4PPRA 2DRWA 2HDQA 4PM7A 3O87A 3UDFA 5CGXA 4H8RA 4GNUA 1YLPA 1L2SA 4WBGA 3PBSA 2H0TA 1K4EA 5HX9A 4HBTA 2WUQA 4JPMA 3ZVTA 2CC1A 2J9OA 5M1AA 2WGWA 3G35A 3W4PA 4FCFA 5HAQA 3S1YA 2JC7A 3UPNA 2HDSA 3MZEA 1GA9A 5IHVA 1FCMA 1MWTA 1W5DA 3C7UA 3P98A 1MWRA 5EVIC 1YLJA 1M6KA 1XGJA 4U3TA 4S2MA 3ZDJA 2VGKA 4QD4A 1KGEA 3G2YA 3IXBA 4E3NA 4S2OA 3UPOA 4P0MA 3ZFZA 3QNCA 4UHUA 3FYZA 4X6TA 5DF8A 5JYPA 5F83A 2Y2QA 2WAEA 3IXGA 4R23A 4E6XA 5JYOA 1BLHA 1O7EA 2ZC4B 2OLVA 3GVBA 1JTDA 3HLCA 3UNWA 1NZUA 3N6IA 2H0YA 4LCLA 3Q1FA 4OLGA 3LY3A 2PU2A 4IVIA 1GHIA 4EUZA 1JTGA 3I7JA 3SH7A 2Y4AA 4PM5A 4GDNA 1PWGA 5F82A 5HFOA 4OH0A 3DWZA 1XXMA 4N9KA 4QY6A 2WKEA 3HLWA 3OC2A 3SS4A 2DCFA 4M3KA 1ERMA 1XPBA 2Y91A 1H8YA 1YLWA 5M18A 4JBFA 1RP5A 3ITAA 4S2KA 4C3QA 2Y2IA 1IYQA 1ES4A 3FZCA 2BG1A 3QNBA 5E2EA 5AQBA 1K6RA 2G2UA 2ZC7A 1HD8A 2JCHA 2P74A 3N8SA 3OZHA 1K56D 4MEZA 3ZG8B 3UY6A 1BTLA 5U47A 3UE3A 5CHUA 3SS5A 5CRFA 4QJGA 5CEBA 4KZ3A 2J9PA 5GLAA 2EX8A 1BULA 4C75A 3C4PA 4R3JA 2DNSA 4E3KA 3WS5A 4Y0TA 5FSRA 1LI0A 1WYCA 5KSHA 4OLDA 3MBZA 3N7WA 1NZOA 3HUNA 4N9LA 4IBRA 2XF3A 3CG5A 3VFFA 1GHMA 3E2KA 1E25A 3GR2A 2FFYA 2WGIA 3FKVA 3G32A 1FCNA 4OPRA 1BSGA 4RYEA 4QY5A 5FAPA 3ZNYA 5EECA 3V5MA 2HDRA 3ZG0A 1MXOA 4BL2A 4KQOA 5FI7A
chains in the Genus database with same CATH superfamily
1H8MA 2VK3A 2WK0A 2P08A 1H0MA 2XD5A 4LGWA 5KSCA 5F5YA 5TR7A 2V1AA 2QJ7A 3NDGA 3NDEA 3IT9A 3E4OA 1XP4A 1TF1A 5DF7A 2XGNA 1BUEA 4OOYA 4CJNA 2XDMA 2XK1A 3JPUA 1LL5A 1H5XA 4DJ2A 2Q9NA 4OPZA 5EE8A 1FOFA 3BECA 5HARA 1S66L 1TEMA 1JNUA 2W1RA 2XFTA 4MBKA 3SOIA 3TRCA 4OPYA 2BASA 3LY4A 3OCLA 1K55C 5EUAA 1YQSA 3IWQA 4JGPA 4EUVA 5EVIA 3FPWA 5A90A 1YLZA 2R78A 4Q0IA 3G6OA 3EWKA 3PHYA 5F1FA 3NY4A 2VX8A 2PU4A 4I5SA 3A0VA 3H9WA 3IXDA 4Q0HA 5FI2A 3IXHA 2EWWA 1KOUA 4LFUA 2ZC3B 2HF6A 4XT2B 3KSIA 5D3OA 3M2KA 4F94A 3T4SA 5CEDA 4EW7A 1DJCA 3BWLA 4JXGA 3HVFA 4LRXC 4GJ4A 3UB8A 3TOIA 3LEZA 2EX9A 4F3LA 3CJMA 3CZDA 3RH8B 2X01A 2V20A 3LGOA 4OKPA 3PBTA 1I2WA 4EERA 1TDLA 2XQZA 3LIEA 3VE4A 3IWOA 2J3TD 2P9VA 4DE2A 3M2JA 1W8YA 2VEAA 3DTKA 2DMWA 4KG5A 3O88A 1TS0A 3KYEA 2HJ9C 2PYPA 4BD0A 1HVBA 2LB5A 2QKPA 2ZMAA 3AGFA 4EU0A 1D7EA 4KG6A 1WYBA 2KDKA 1VM1A 4JGRA 4Y2FA 3IBRA 2CMNA 5EVID 2C5WB 2ZQ7A 2A24A 3LO7A 2QHKA 4K0XA 3UB7A 3CPTA 3GECA 4LV2A 2WKHA 3H82A 1DY6A 5KZHA 2NUTC 4KUOA 4WMCA 2O9AA 3UMEA 1OTIA 3ZG7B 4X25A 1VEUA 2WGVA 3NCKA 3M6BA 5CXWA 1N9LA 2E8IA 1PW8A 2HP9A 4OPQA 4OP5A 5AVFA 4GZBA 2EX2A 4JXVA 5EFWA 4BJPA 3EGXC 3MSHA 3D72A 4IJGA 1PFLA 3O5YA 4PM6A 5EVIB 5I5LA 5A92A 3E0YA 5DKKA 2W3DA 2OV5A 2EFUA 3BFFA 4LLOB 3S7NA 1T19A 1FCOA 1NJ4A 4JXSA 1K0KA 1F5MA 2ZM0A 2V2FF 2Z2MB 4WZ4A 4ZDXA 4UA9A 2FH5A 3B3XA 1KDWA 2JKRM 3N8LA 1M40A 1YLTA 3R4KA 2OSUA 3DBAA 1ODVA 1ONHA 4D60A 2JE5A 2ZL1A 3VE3A 1SDEA 4NETA 5HPFA 1KE3A 4P6ZM 4UA7A 3LIAA 2J80A 5TFQA 3N8RA 4OQ0A 1K55A 3PAGA 2QZ6A 1XKZA 3UDXA 5FI6A 2Y2KA 3IBJA 4HP9A 4Y13A 1KVLA 3LIBA 4EBPA 4K08A 3K2NA 1E4DA 3V50A 3T4OA 3S22A 4OOMA 4ID4A 5DTTA 1CEFA 1ZG4A 3UE0A 3HCYA 3NC8A 3WS2A 2XH9A 3HUOA 2Y2PA 4KZ9A 3IH9A 2ZC6B 3F1OA 4DXCA 1ACFA 2G2WA 5FEFA 4D2OA 1PNEA 5HDSA 1UWNX 3UO9A 4MBFA 1FSWA 2VKSA 4HH2A 3QP4A 4BQMA 3WS1A 4Y5FA 3BFGA 2Y2NA 3TW8A 4GDBA 2IA2A 2ZQCA 1KGGA 4YINA 2PHYA 1L0FA 2HDQA 3UDFA 2W3FA 2XSSA 2PD8A 3PBSA 2H0TA 5HX9A 2WKQA 2D01A 2J9OA 3QP2A 2VGLS 1XJ6A 2WGWA 2PR6A 1GA9A 5IHVA 3KYZA 3C7UA 1XGJA 1D1JA 4U3TA 2JKFA 3EEHA 4E3NA 3ZFZA 2PD7A 5DF8A 2Y2QA 4R23A 5JYOA 3UNWA 1NZUA 4LCLA 3Q1FA 2PU2A 3SH7A 1OJ5A 2A2LA 2Y4AA 1PWGA 5F82A 2NUPC 2P7JA 4N9KA 3TJZC 1XPBA 1YLWA 4C3QA 1DP8A 1ES4A 5E2EA 5CEBA 3UY6A 1BTLA 5U47A 1N9OA 5CRFA 3SS5A 4KZ3A 2J9PA 5GLAA 3BY9A 1BULA 2DNSA 3PR6A 3MBZA 3N7WA 3KO6A 1NZOA 4I3IA 4IBRA 3CUEC 4BBTA 2W3GA 2VJWA 1E25A 1BYWA 2FFYA 2WGIA 3G32A 1FCNA 3HJKA 2JKTI 5FAPA 5EECA 2L0WA 4BL2A 4A5RA 4LCMA 3AGDA 3UN7A 4K0WA 3LIFA 2HP5A 5FQJA 2WKRA 4ARZA 1OJGA 2JBFA 1EWZA 4M4XA 4O0PA 3DW0A 2Z6CA 4Y3IA 4JF4A 4ZTKA 3V39A 1ERQA 3KSFA 3S7PA 4OP8A 2X71A 1FQGA 1K57C 2X02A 1ESIA 5DTSA 4JKTA 3SH9A 3V3RA 3BYDA 1C3BA 4WZ5A 1A0KA 1IKGA 1L0EA 5HPIA 1ESUA 1LL9A 4X68A 3N4IA 1LT0A 4BL3A 4O7DA 3S7OA 4S2NC 3SH8A 4JLFA 2GX5A 3WRTA 5HW3A 3LYXA 5DVAA 5DFXA 3GSGA 2XEPA 3OPLA 4P6ZS 4L9FA 4U0TA 4JXWA 2WGWB 4JF6A 4FH2A 1VETB 3FWLA 3HLDA 3PBNA 2Y2OA 3A0SA 2A3UA 5TGFA 3OPRA 4G3WA 4E3JA 4DE1A 3SZTA 1DJBA 2AVXA 3P7NA 4X56A 1STZA 4CLCA 3QP5A 1E3UD 2OLUA 1GCEA 3HUMA 3WS4A 1CEGA 4WUJA 3IX4A 4IHQA 1EROA 4MMNA 1E3UA 3O86A 1PW1A 3ICYA 5EM0A 5CERA 4L0LA 2J3TC 3UE6A 4QHCA 3W4OA 4WZ5C 4S2LA 1IYPA 5MC7A 3F1PA 5GHXA 1MC0A 3Q7VB 4IUKA 3PBRA 3G2ZA 2GZAA 1K54A 1XX2A 4RX2A 2ZQ8A 1G68A 4KQQA 2I72A 4HQAA 3W2ZA 1K56A 1ZHHB 4E3IA 3A3FA 3BFEA 4HJ4A 1K6SA 2K2NA 4EV4A 2A49A 1FSYA 1YLYA 4FUWA 1GHPA 3T1QB 2ZQAA 5EOOA 3W4QA 1Z6FA 2EA9A 1MWUA 5KMWA 1S4SA 4BENA 1H3QA 3E4QA 3O3VA 3WRZA 3T4TA 4II7A 1V9YA 4N1HA 5J7EA 2WKIA 2XA7S 3HREA 1MKIA 3UB9A 2H5SA 1H8ZA 3MKEA 4B4XA 4NXFA 5TBMB 4DKIA 2EXAA 2PDRA 5AVEA 3A3DA 5AQAA 2RCXA 5F6AA 5E43A 4HEFA 1XA7A 2V1ZA 3KYQA 3LI8A 4OVDA 5IS1A 2ZM8A 2PAVP 1LL8A 3FC7A 3GTCA 3HLGA 4L9EA 1F2KA 1YMSA 4PM8A 4BMWA 2O0YA 3LI9A 1QMFA 2XR0A 3LUQA 2V0UA 5DKLA 4HH3A 3H82B 3GDIA 4E3LA 3IS2B 2VZWA 2EX6A 5J4EA 1NYYA 2B95A 3MKFA 2VLGA 4I3AA 1J9MA 2C6WB 4CLCD 1ZC2A 3MS6A 1NRFA 3C4OA 1U60A 4QU3A 3ZGAB 1S0WA 4GN2A 4B4ZA 1VQQA 2ZC5B 3ULFA 5HD3A 3BM6A 4QB8A 4DXBA 4MBHA 1NXYA 4S2PA 3B33A 3IHAA 4LENA 2RL3A 3FV7A 4Z9QA 3AGEA 3IQAA 1S6RA 4EBNA 2Y79A 1PYYA 5CGSA 4EBLA 1KE0A 3KX0X 1TDGA 1TVFA 2R9XA 3NJAA 1BLSA 1YKDA 2LB9A 1KE4A 3OLOA 1ALQA 4NKPA 5L09A 1SZVA 2BLSA 2W27A 2UV0E 4E3MA 3T4LA 1SDNA 1ES5A 3LR5A 2E8JA 1VB6A 4KUKA 1Q2QA 5CHMA 4WELA 3UDIA 5FATA 4C6YA 3FG8A 4ESPA 1XA1A 2V9AA 4GCZA 3QP1A 5FQ9A 1ZG6A 3BFCA 3MQ0A 1L3LA 1PWCA 1SKFA 4OQHA 2J8YA 4EEPA 3MF0A 4MN7A 1PIOA 3H7WA 4EESA 4CLCC 5BOHA 4IUHA 4ZJ3A 4KQRA 4MLLA 4HI4A 4WEKA 4GB7A 5EOEA 3QHYA 4K91A 1MZUA 4PPRA 2DRWA 3NOTC 4QPRA 5HL6A 3CHWP 5CGXA 3SW1A 5F69A 1YLPA 1L2SA 4HBTA 2WUQA 4JPMA 2CC1A 5F68A 5M1AA 3G35A 3W4PA 5HAQA 2HDSA 2J3WA 3MZEA 1FCMA 4QWOA 3KSHA 5EVIC 1LSVA 4HIAA 3IXBA 3FYZA 2GJ3A 5HZHA 2WAEA 2O9BA 3IXGA 2ZC4B 2OLVA 3GVBA 3K3CA 3N6IA 3MMHA 2H0YA 3U4LP 2JKGA 3TE8A 1GHIA 4EUZA 4GDNA 1YSPA 1AWIA 4OH0A 2I9VA 2M7UA 3SS4A 3HLWA 1P97A 2M7VA 4S2KA 4GS9A 5G4ZA 1IYQA 3FZCA 3NHQA 4LRZE 1K6RA 2PBDP 3E98A 4MEZA 1X0OA 1FIKA 4Y15A 3UE3A 5CHUA 3QP6A 4NXGA 4C75A 4R3JA 3UMDA 1LI0A 1LSXA 1SKOB 3C30A 3F1NB 3BY8A 1GSWA 4ZRRA 4N9LA 1F9IA 3CG5A 3VFFA 3CPTB 2W3HA 4OPRA 4RYEA 4QY5A 3V5MA 3ZG0A 3A3IA 5FI7A 3DTIA 1XJ4A 4DE3A 3V3SA 2KOIA 4FTXA 2MJ6A 4G3KA 3JVUA 2IWBA 2V8CA 4R38A 5HDCA 1W8QA 2FZ0A 4LPZA 3IF6B 3WS0A 5DF9A 2OWHA 1TS7A 2B18A 1LLBA 5EV0A 2QYBA 1JWVA 4UQIS 2JN7A 2V1BA 2WZXA 3GQZA 3ZQ5A 3ITBA 3NBLA 4R70A 4Q8IA 4Y0OA 4WLAA 5F1GA 4CLCE 3CMZA 5I94A 1RCJA 2Y2GA 4DJ3A 4E04A 5CGWA 2V8FA 2Z6DA 2IWCA 4KZ8A 1L0DA 3HBRA 2HPBA 3IF6A 1OT9A 4MCWA 4HJ3A 5FAQA 1K4FA 4ZJ2A 2VV8A 3MXQA 3P09A 4HY8A 5HDDA 4BBVA 4E6WA 4BBUA 4DDYA 4DF6A 1K38A 2R9WA 4FOFA 4WEJA 2Q0OA 5GHZA 4XUZA 1J3WA 4KZAA 3SS3A 4S2NA 5EVLA 4OOLA 4YOFA 1WA9A 4EEUA 3T50A 3HLFA 1XGIA 4OQGA 3IHBA 2UWXA 4MN5A 5C5KA 3S4XA 4X55A 5EVEA 4EXOA 1K25A 2Y2HA 5GLCA 1K57A 1VHMA 3CLOA 4Z1WA 1K54C 3IH8A 3F1OB 4NXEA 3EOIA 4X53A 1I2SA 2Q9MA 1YM1A 3NECA 2PBYA 4EQIA 3T4QA 2W1TA 1JWZA 3PBQA 4I38A 5CHJA 3EGDC 4RQ9A 3C5AA 3GRJA 4O8GA 4R3BA 1JWPA 4HESA 4KZ7A 3Q82A 3VP0A 5FASA 2WKPA 1NY0A 3GV9A 3NI9A 3IF5A 2ZD8A 4KZ6A 1GSVA 1PRQA 3R7WB 5J8XA 3CWFA 5HWWA 2QMIA 5FQMA 3HL9A 2ZLYA 4KZBA 2XROA 1TD5A 4RA7A 1IEMA 2KX6A 2Y2MA 4KQDA 4YWZA 1W7FA 1DJAA 2XA7M 5IT5A 4B88A 3RJUA 1SHVA 3DAVA 2HJEA 3CITA 1ES3A 3JVVA 2ZMFA 1LI9A 3Q07A 2OWJA 3Q81A 3VSKA 1DP6A 1IOUA 3BJNA 4MNRA 1NLZA 4PKYG 4I3JA 3OBFA 1NRJA 3HLEA 2O9CA 5HWTA 5AJGA 4PKYA 3ZCZA 1IFQA 1JVJA 1PI4A 1T1AA 4ZAMA 2XD1A 1YT4A 3OPHA 3MQQA 1SKOA 4UAAA 3UPPA 3HLBA 3LCEA 1CJFA 3OCNA 3IWIA 4UQIM 1BLCA 5HAIA 1LHYA 1HZOA 5CTMA 4PHTA 1MY8A 5GLDA 3VSLA 4KZ4A 4R4SA 4F3LB 3OPPA 3C38A 4ARZB 1Y4OA 3CI6A 3BQ8A 2XLNA 4H6JB 1MBLA 3F1NA 3BLMA 2WYXA 3IF6C 3G31A 3IS2A 3W8KA 1PWDA 4WMCD 5M19A 3RXXA 5LBRA 1S4RA 1MPLA 2ZQ9A 2BTFP 2WZZA 1AXBA 4NG2A 2D02A 2W0NA 3VP4A 5FQQA 1T1CA 1W63Q 2Y59A 2W1TB 5L2FA 2EFXA 3EQUA 2K31A 2KLIA 5L10A 3G34A 4R6LA 1I5QA 4B9OA 4S2IA 4Y17A 4U0XA 2Y2LA 4EWFA 4KENB 1Q2PA 4JGOA 3BQAA 1FR1A 3BEBA 3BW6A 4Y0UA 1NYMA 1O07A 1ZKJA 3MFDA 5AQ7A 1VETA 5G18A 4FSFA 3T1SA 3Q7ZA 5TBMA 2B5RA 1RGYA 1P0ZA 1G6OA 2P04A 3L7HA 4PM7A 3IX3A 4H8RA 2EWVA 4WBGA 1K4EA 3ZVTA 2VV6A 4NEED 2O99A 3T1XA 4FCFA 3S1YA 2JC7A 1W5DA 1F98A 1YLJA 4WF0A 4S2MA 3ZDJA 2VGKA 1KGEA 4P0MA 2Y8HA 3QNCA 4ETXA 5JYPA 5F83A 5FDSA 3L9KA 4E6XA 2PRFA 1BLHA 3IX8A 2ZBBA 1VEUB 1OTDA 4XT2A 2JKRI 1TS8A 1JTGA 3I7JA 4JGQA 5HFOA 2XRNA 3OC2A 4M3KA 5M18A 1P9RA 1RP5A 4I39A 1XFQA 3ITAA 2Y2IA 4X1MA 1P9WA 2G2UA 1CF0A 2JCHA 2P74A 3N8SA 3HJIA 3OZHA 1K56D 4HNBA 1W63M 3ZG8B 2OOLA 3CAXA 2EX8A 3C4PA 5IU1A 3WS5A 2B02A 5FSRA 1WYCA 5KSHA 4OLDA 4DMZA 2OAP1 3FKVA 4Q0JA 1MXOA 4KQOA 1QMEA 1IKIA 3BFDA 3VP1A 4EETB 1HLUP 3G4PA 3KSGA 4N92A 2H28A 5DFYA 3S7QA 4BD1A 3JYIA 4UA6A 3B42A 4PMAA 2HV1A 2ZJ9A 1CI8A 4RVAA 3EEAA 5CX7A 4R3AA 1UGUA 5A93A 4KG2A 5DJUA 2ZOIA 3ZG9B 1ZTUA 4R0QA 4GOGA 4AFIA 5FL3A 5GHYA 3K3DA 3H7WB 1N9BA 4IBXA 2J7VA 1Y28A 1ES2A 2ZOHA 1NWZA 1V9ZA 1UWPX 1W79A 3D9YA 4JF5A 5E2FA 5FAOA 3E4PA 4R1GA 1MWSA 1WE4A 1L0GA 4P85A 5DJTA 4BWIA 1D06A 5J3WA 2JKTM 1PI5A 1OTBA 3MFXA 2WAFA 4S2JA 1DRMA 5HL1A 4WYYA 5E2HA 1HTZA 1Z09A 1CK3A 3PBOA 1FR6A 1SCWA 2YKHA 3QP8A 3VV4A 3V67A 3BLSA 3ZG5A 1MKMA 4ME4A 5HD5A 1EW0A 3TG9A 3A0RA 2FFFB 2ZM2A 4ETZA 3ZYTA 5E2GA 3A3JA 3T1RA 1CQAA 2Z2LB 2M1CA 3LR4A 3VP2A 5G4YA 3MZFA 3LEQA 5CTNA 4GS9B 3NULA 4ZJ1A 4YFMA 2ZMVA 3ZHHA 2GNXA 2VGLM 3EQVA 2HDUA 2V0WA 1G5UA 5FDHA 2G7UA 1GA0A 1EI5A 4GD8A 1S67L 1GSXA 2ZQDA 3VP3A 1OMEA 3NIAA 3PTEA 3FKWA 1YSQA 3MQOA 4IEDA 3DWKA 2QJ5A 1S1ZA 4R4RA 2QWSA 3D3OA 4LV0A 5L8MA 3WWXA 5HWVA 4GD6A 4GHIA 5GLBA 4X69A 3LICA 1IYSA 2JHEA 3MZDA 4GKUA 3LIDA 4Y7PA 4DRTA 3T4JA 2VA0A 3D4FA 4GLQA 2PT7A 5TJJA 3MJQA 4N1XA 4LV3A 2L1MA 1BLPA 4NK3A 1S1YA 3ISGA 3VOYA 1PZOA 1YAXA 2XFSA 1XJ2A 1CI9A 4RX3A 4BLMA 1KDSA 1IYOA 4FD8A 4PM9A 1N4OA 4OONA 2Y55A 2L4RA 3R7WA 3UB5P 1T18A 4WL9A 2ZL1B 4OQIA 4MN6A 4PAUA 5FEGA 3VFHA 4P87A 4WM9A 1KGFA 3G30A 3U2AA 2GDNA 5CECA 3CUEA 3ZNTA 3MXSA 1G6AA 1Y54A 1OTAA 3E2LA 2H10A 4CLCB 4GW9A 1N9NA 3T4KA 4HBUA 4E3OA 1T1BA 3RXWA 4P6BA 1XJ3A 5FA7A 4NXBA 1YPRA 2INWA 3DTMA 1KVMA 3M6HA 3RTYA 3PAEA 4XXRA 1FILA 3A3EA 1OTEA 5A91A 5FQIA 2EXBA 4XUXA 1BZAA 5FQKA 3VOZA 5EM1A 3ZVWA 3VMAA 1PZPA 2HZ5A 4FH4A 4DDSA 2HP6A 2P9VB 3VOLA 5GL9A 3MXRA 1ONGA 4HOIA 3UB6A 1RGZA 4CQHA 2VGJA 1BT5A 4HJ6A 4DE0A 5KIZA 4L9GA 3OOVA 4YNRA 5DTKA 2Y2JA 4KZ5A 4UEYA 4B93A 3UE1A 3B47A 3LR3A 3P01A 3Q7VA 4HP4A 5K5BA 3TSGA 4HHDA 4G3VA 2A24B 4ZBEA 3PYPA 5AQ9A 3DTEA 3GMWA 2QPNA 2WADA 4O01A 1IELA 1YMXA 3C7VA 3MR0A 5HAPA 2IWDA 3BRMA 4WN5A 4LV1A 1DP9A 5EPHA 4IVKA 3LR0A 4CPKA 3O87A 1LSWA 1G28A 4GNUA 5L07A 2PR5A 4MDZA 4DN0A 1NLYA 3C2WA 2HGVA 3NOPC 3UPNA 1MWTA 2PYRA 3P98A 1MWRA 1M6KA 4QD4A 3G2YA 4S2OA 3UPOA 4UHUA 4X6TA 2OAQ1 1O7EA 3T12B 3HLCA 1JTDA 3PXPA 1OT6A 4OLGA 5HSQA 3LY3A 4IVIA 4PM5A 3DWZA 1XXMA 4QY6A 2WKEA 2DCFA 4X1LA 2ACGA 1ERMA 2Y91A 1H8YA 4JBFA 2VV7A 2BG1A 3LFVA 3QNBA 5AQBA 1HD8A 2ZC7A 3NOUC 3FPVA 4QJGA 4H6JA 3RFBA 4E3KA 4Y0TA 2YKFA 1XFNA 2W3EA 4EQ1A 3F1PB 3HUNA 1OPXA 2XF3A 5A8BA 1GHMA 3E2KA 3GR2A 3C8CA 4GHIB 4LRYC 1BSGA 1TS6A 3ZNYA 2K7SA 2HDRA
chains in the Genus database with same CATH topology
1QMEA 4A5RA 4LCMA 3AGDA 3UN7A 1IKIA 4DE3A 4K0WA 3V3SA 2WK0A 3BFDA 2XD5A 2HP5A 5FQJA 3VP1A 5KSCA 3G4PA 5TR7A 4N92A 2JBFA 1EWZA 3NDGA 3NDEA 5HARA 2IWBA 4BD1A 3JYIA 1W8QA 4UA6A 4PMAA 3DW0A 3IT9A 4JF4A 2ZJ9A 4RVAA 1CI8A 4ZTKA 3V39A 1ERQA 3IF6B 1XP4A 5A93A 4KG2A 4OP8A 2X71A 3WS0A 1FQGA 3ZG9B 5DF7A 2XGNA 1BUEA 1K57C 4OOYA 5DF9A 4CJNA 2XDMA 4R0QA 2X02A 4GOGA 5GHYA 1ESIA 1N9BA 2XK1A 4IBXA 2J7VA 1ES2A 5DTSA 4JKTA 3SH9A 1LLBA 3BYDA 3V3RA 1LL5A 1C3BA 1H5XA 4WZ5A 2Q9NA 4OPZA 1W79A 4JF5A 5E2FA 1JWVA 5EE8A 5FAOA 1FOFA 3BECA 2WZXA 3GQZA 4R1GA 1MWSA 1WE4A 1TEMA 1IKGA 3ITBA 3NBLA 1L0EA 4P85A 1L0GA 1ESUA 1LL9A 4X68A 4Q8IA 3N4IA 4BL3A 4Y0OA 4O7DA 2XFTA 5F1GA 4MBKA 1PI5A 4S2NC 3CMZA 3SH8A 3SOIA 5I94A 4OPYA 2WAFA 4JLFA 4S2JA 5HL1A 1RCJA 2Y2GA 4WYYA 5E2HA 3WRTA 1HTZA 5HW3A 3LY4A 3OCLA 1K55C 5CGWA 5DVAA 5EUAA 3GSGA 2XEPA 3OPLA 2IWCA 4U0TA 4KZ8A 1CK3A 1YQSA 1L0DA 3HBRA 2HPBA 3IF6A 1FR6A 3IWQA 3PBOA 1SCWA 5EVIA 5A90A 4JXWA 1YLZA 2WGWB 4JF6A 4FH2A 5FAQA 1K4FA 3FWLA 3BLSA 4ZJ2A 3HLDA 3PBNA 5F1FA 3NY4A 3ZG5A 2PU4A 2Y2OA 3P09A 3TG9A 5FI2A 3IXDA 2FFFB 2ZM2A 2A3UA 3IXHA 4E6WA 5TGFA 3OPRA 4DDYA 4DF6A 4E3JA 2ZC3B 1K38A 4DE1A 2R9WA 1DJBA 4WEJA 5E2GA 4X56A 5GHZA 3A3JA 5D3OA 3M2KA 4XUZA 4F94A 5CEDA 4KZAA 3SS3A 2Z2LB 4S2NA 1E3UD 2OLUA 5EVLA 4OOLA 1DJCA 4JXGA 3VP2A 1GCEA 3HVFA 3HUMA 3MZFA 3HLFA 1XGIA 5CTNA 3TOIA 3LEZA 4OQGA 3IHBA 2EX9A 4ZJ1A 2UWXA 4YFMA 3ZHHA 3EQVA 3S4XA 3CJMA 3CZDA 1CEGA 3WS4A 2HDUA 1EROA 4X55A 2X01A 1E3UA 2V20A 5FDHA 3O86A 1PW1A 4OKPA 1K25A 2Y2HA 1GA0A 1EI5A 5GLCA 5CERA 4GD8A 3PBTA 1I2WA 1K57A 4L0LA 3VP3A 2ZQDA 1TDLA 2XQZA 1K54C 3IH8A 3IWOA 4QHCA 4WZ5C 3W4OA 1OMEA 4S2LA 1IYPA 2P9VA 3NIAA 3PTEA 3FKWA 5GHXA 3Q7VB 4X53A 4DE2A 1I2SA 3M2JA 3PBRA 2Q9MA 4IEDA 1W8YA 1YM1A 3G2ZA 2PBYA 3DWKA 4EQIA 1K54A 1XX2A 4KG5A 4R4RA 3O88A 4RX2A 1JWZA 3PBQA 4LV0A 5CHJA 2ZQ8A 1G68A 4BD0A 1HVBA 4KQQA 2I72A 2ZMAA 3C5AA 3WWXA 3GRJA 1K56A 4GD6A 5GLBA 4X69A 4E3IA 3AGFA 1IYSA 4R3BA 1JWPA 4HESA 3MZDA 4GKUA 4KG6A 3A3FA 3BFEA 4KZ7A 1WYBA 3Q82A 4Y7PA 3VP0A 5FASA 1K6SA 1VM1A 4EV4A 2A49A 1FSYA 1NY0A 3GV9A 5EVID 1YLYA 2C5WB 2ZQ7A 1GHPA 3IF5A 2ZD8A 3NI9A 4KZ6A 4DRTA 2ZQAA 5J8XA 5EOOA 3W4QA 3D4FA 3LO7A 2QMIA 1Z6FA 1MWUA 4K0XA 5FQMA 5KMWA 4BENA 3HL9A 2ZLYA 3O3VA 3WRZA 4LV2A 4N1XA 4KZBA 2WKHA 4LV3A 4RA7A 1BLPA 1IEMA 4NK3A 4N1HA 3ISGA 1DY6A 3VOYA 5KZHA 2WKIA 2Y2MA 1PZOA 3HREA 1MKIA 1W7FA 2H5SA 4WMCA 1DJAA 1H8ZA 3MKEA 4B4XA 4DKIA 2EXAA 2XFSA 1CI9A 4RX3A 3A3DA 5AQAA 2RCXA 4B88A 5E43A 4HEFA 3RJUA 4BLMA 3ZG7B 1KDSA 1XA7A 3NCKA 1IYOA 1SHVA 2V1ZA 2WGVA 3M6BA 4FD8A 4PM9A 4EBNA 4OVDA 5CXWA 2E8IA 1ES3A 1N4OA 2ZM8A 1PW8A 4OONA 2HP9A 1LI9A 4OPQA 2Y55A 3GTCA 3HLGA 3Q07A 3Q81A 4OP5A 3VSKA 4GZBA 2EX2A 4JXVA 1YMSA 4PM8A 4MNRA 4BJPA 4OQIA 1QMFA 2XR0A 3VFHA 4P87A 4WM9A 4E3LA 1KGFA 3G30A 3HLEA 4PM6A 5EVIB 5A92A 2GDNA 2OV5A 5CECA 3ZCZA 2EFUA 2EX6A 3BFFA 1PI4A 1JVJA 1NYYA 4ZAMA 1FCOA 3ZNTA 3MXSA 2XD1A 1G6AA 1NJ4A 1Y54A 3MKFA 1YT4A 4JXSA 3E2LA 2ZM0A 2H10A 1J9MA 2V2FF 2Z2MB 3OPHA 4UAAA 4WZ4A 3UPPA 4HBUA 2C6WB 1ZC2A 3HLBA 3LCEA 4E3OA 3OCNA 3IWIA 5HAIA 1BLCA 1NRFA 3C4OA 1U60A 4ZDXA 1LHYA 4QU3A 4UA9A 3RXWA 4P6BA 5FA7A 1HZOA 5CTMA 3ZGAB 1S0WA 4GN2A 3B3XA 1MY8A 4B4ZA 1VQQA 2ZC5B 5GLDA 1KDWA 3N8LA 3VSLA 1M40A 3DTMA 4KZ4A 4R4SA 3BM6A 1YLTA 4QB8A 4DXBA 4MBHA 1KVMA 1NXYA 4S2PA 2OSUA 3OPPA 3IHAA 4LENA 2RL3A 1ONHA 2JE5A 3FV7A 3M6HA 1SDEA 3AGEA 4Z9QA 4NETA 2XLNA 3IQAA 1S6RA 3PAEA 1MBLA 1KE3A 1PYYA 3BLMA 4XXRA 2WYXA 3IF6C 4UA7A 5CGSA 1KE0A 4EBLA 3A3EA 1TDGA 1TVFA 5TFQA 3G31A 3N8RA 2R9XA 5A91A 1BLSA 5FQIA 4OQ0A 1K55A 3PAGA 1KE4A 2EXBA 4XUXA 3W8KA 1ALQA 1BZAA 2QZ6A 1PWDA 4WMCD 1XKZA 3UDXA 5M19A 5FI6A 3RXXA 2Y2KA 2BLSA 5FQKA 1MPLA 3VOZA 2ZQ9A 2WZZA 1AXBA 1KVLA 4E3MA 3ZVWA 3VMAA 1SDNA 1PZPA 3VP4A 4FH4A 4DDSA 1ES5A 5FQQA 2HP6A 2P9VB 4EBPA 1E4DA 5GL9A 3A3IA 3V50A 3MXRA 1ONGA 1RGZA 1Q2QA 3S22A 2VGJA 5CHMA 1BT5A 2Y59A 4OOMA 5L2FA 4ID4A 5DTTA 1CEFA 1ZG4A 3UE0A 4DE0A 2EFXA 4WELA 3UDIA 3EQUA 5FATA 4C6YA 3NC8A 3WS2A 2XH9A 5DTKA 3G34A 2Y2JA 3HUOA 1XA1A 2Y2PA 4KZ5A 1I5QA 4KZ9A 4S2IA 1ZG6A 5FQ9A 3BFCA 3IH9A 4U0XA 1PWCA 2ZC6B 3UE1A 4DXCA 2Y2LA 1SKFA 2G2WA 4D2OA 4OQHA 2J8YA 4EWFA 3Q7VA 4KENB 1Q2PA 3TSGA 3UO9A 1FR1A 3BEBA 4MBFA 4ZBEA 4Y0UA 1FSWA 1NYMA 1PIOA 5AQ9A 1O07A 1ZKJA 3GMWA 2QPNA 2WADA 5BOHA 1IELA 1YMXA 3C7VA 4ZJ3A 4KQRA 4MLLA 4BQMA 3MFDA 3WS1A 3BFGA 5AQ7A 5HAPA 2Y2NA 2IWDA 4WEKA 4GDBA 3BRMA 5G18A 2ZQCA 1KGGA 4FSFA 4LV1A 3Q7ZA 4YINA 2B5RA 4GB7A 5EPHA 1RGYA 4IVKA 5EOEA 3QHYA 4K91A 1L0FA 4CPKA 4PPRA 2DRWA 2HDQA 4PM7A 3O87A 3UDFA 5CGXA 4H8RA 4GNUA 1YLPA 1L2SA 4WBGA 3PBSA 2H0TA 1K4EA 5HX9A 4HBTA 2WUQA 4JPMA 3ZVTA 2CC1A 2J9OA 5M1AA 2WGWA 3G35A 3W4PA 4FCFA 5HAQA 3S1YA 2JC7A 3UPNA 2HDSA 3MZEA 1GA9A 5IHVA 1FCMA 1MWTA 1W5DA 3C7UA 3P98A 1MWRA 5EVIC 1YLJA 1M6KA 1XGJA 4U3TA 4S2MA 3ZDJA 2VGKA 4QD4A 1KGEA 3G2YA 3IXBA 4E3NA 4S2OA 3UPOA 4P0MA 3ZFZA 3QNCA 4UHUA 3FYZA 4X6TA 5DF8A 5JYPA 5F83A 2Y2QA 2WAEA 3IXGA 4R23A 4E6XA 5JYOA 1BLHA 1O7EA 2ZC4B 2OLVA 3GVBA 1JTDA 3HLCA 3UNWA 1NZUA 3N6IA 2H0YA 4LCLA 3Q1FA 4OLGA 3LY3A 2PU2A 4IVIA 1GHIA 4EUZA 1JTGA 3I7JA 3SH7A 2Y4AA 4PM5A 4GDNA 1PWGA 5F82A 5HFOA 4OH0A 3DWZA 1XXMA 4N9KA 4QY6A 2WKEA 3HLWA 3OC2A 3SS4A 2DCFA 4M3KA 1ERMA 1XPBA 2Y91A 1H8YA 1YLWA 5M18A 4JBFA 1RP5A 3ITAA 4S2KA 4C3QA 2Y2IA 1IYQA 1ES4A 3FZCA 2BG1A 3QNBA 5E2EA 5AQBA 1K6RA 2G2UA 2ZC7A 1HD8A 2JCHA 2P74A 3N8SA 3OZHA 1K56D 4MEZA 3ZG8B 3UY6A 1BTLA 5U47A 3UE3A 5CHUA 3SS5A 5CRFA 4QJGA 5CEBA 4KZ3A 2J9PA 5GLAA 2EX8A 1BULA 4C75A 3C4PA 4R3JA 2DNSA 4E3KA 3WS5A 4Y0TA 5FSRA 1LI0A 1WYCA 5KSHA 4OLDA 3MBZA 3N7WA 1NZOA 3HUNA 4N9LA 4IBRA 2XF3A 3CG5A 3VFFA 1GHMA 3E2KA 1E25A 3GR2A 2FFYA 2WGIA 3FKVA 3G32A 1FCNA 4OPRA 1BSGA 4RYEA 4QY5A 5FAPA 3ZNYA 5EECA 3V5MA 2HDRA 3ZG0A 1MXOA 4BL2A 4KQOA 5FI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QME A;  4A5R A;  4LCM A;  3AGD A;  3UN7 A;  1IKI A;  4DE3 A;  4K0W A;  3V3S A;  2WK0 A;  3BFD A;  2XD5 A;  2HP5 A;  5FQJ A;  3VP1 A;  5KSC A;  3G4P A;  5TR7 A;  4N92 A;  2JBF A;  1EWZ A;  3NDG A;  3NDE A;  5HAR A;  2IWB A;  4BD1 A;  3JYI A;  1W8Q A;  4UA6 A;  4PMA A;  3DW0 A;  3IT9 A;  4JF4 A;  2ZJ9 A;  4RVA A;  1CI8 A;  4ZTK A;  3V39 A;  1ERQ A;  3IF6 B;  1XP4 A;  5A93 A;  4KG2 A;  4OP8 A;  2X71 A;  3WS0 A;  1FQG A;  3ZG9 B;  5DF7 A;  2XGN A;  1BUE A;  1K57 C;  4OOY A;  5DF9 A;  4CJN A;  2XDM A;  4R0Q A;  2X02 A;  4GOG A;  5GHY A;  1ESI A;  1N9B A;  2XK1 A;  4IBX A;  2J7V A;  1ES2 A;  5DTS A;  4JKT A;  3SH9 A;  1LLB A;  3BYD A;  3V3R A;  1LL5 A;  1C3B A;  1H5X A;  4WZ5 A;  2Q9N A;  4OPZ A;  1W79 A;  4JF5 A;  5E2F A;  1JWV A;  5EE8 A;  5FAO A;  1FOF A;  3BEC A;  2WZX A;  3GQZ A;  4R1G A;  1MWS A;  1WE4 A;  1TEM A;  1IKG A;  3ITB A;  3NBL A;  1L0E A;  4P85 A;  1L0G A;  1ESU A;  1LL9 A;  4X68 A;  4Q8I A;  3N4I A;  4BL3 A;  4Y0O A;  4O7D A;  2XFT A;  5F1G A;  4MBK A;  1PI5 A;  4S2N C;  3CMZ A;  3SH8 A;  3SOI A;  5I94 A;  4OPY A;  2WAF A;  4JLF A;  4S2J A;  5HL1 A;  1RCJ A;  2Y2G A;  4WYY A;  5E2H A;  3WRT A;  1HTZ A;  5HW3 A;  3LY4 A;  3OCL A;  1K55 C;  5CGW A;  5DVA A;  5EUA A;  3GSG A;  2XEP A;  3OPL A;  2IWC A;  4U0T A;  4KZ8 A;  1CK3 A;  1YQS A;  1L0D A;  3HBR A;  2HPB A;  3IF6 A;  1FR6 A;  3IWQ A;  3PBO A;  1SCW A;  5EVI A;  5A90 A;  4JXW A;  1YLZ A;  2WGW B;  4JF6 A;  4FH2 A;  5FAQ A;  1K4F A;  3FWL A;  3BLS A;  4ZJ2 A;  3HLD A;  3PBN A;  5F1F A;  3NY4 A;  3ZG5 A;  2PU4 A;  2Y2O A;  3P09 A;  3TG9 A;  5FI2 A;  3IXD A;  2FFF B;  2ZM2 A;  2A3U A;  3IXH A;  4E6W A;  5TGF A;  3OPR A;  4DDY A;  4DF6 A;  4E3J A;  2ZC3 B;  1K38 A;  4DE1 A;  2R9W A;  1DJB A;  4WEJ A;  5E2G A;  4X56 A;  5GHZ A;  3A3J A;  5D3O A;  3M2K A;  4XUZ A;  4F94 A;  5CED A;  4KZA A;  3SS3 A;  2Z2L B;  4S2N A;  1E3U D;  2OLU A;  5EVL A;  4OOL A;  1DJC A;  4JXG A;  3VP2 A;  1GCE A;  3HVF A;  3HUM A;  3MZF A;  3HLF A;  1XGI A;  5CTN A;  3TOI A;  3LEZ A;  4OQG A;  3IHB A;  2EX9 A;  4ZJ1 A;  2UWX A;  4YFM A;  3ZHH A;  3EQV A;  3S4X A;  3CJM A;  3CZD A;  1CEG A;  3WS4 A;  2HDU A;  1ERO A;  4X55 A;  2X01 A;  1E3U A;  2V20 A;  5FDH A;  3O86 A;  1PW1 A;  4OKP A;  1K25 A;  2Y2H A;  1GA0 A;  1EI5 A;  5GLC A;  5CER A;  4GD8 A;  3PBT A;  1I2W A;  1K57 A;  4L0L A;  3VP3 A;  2ZQD A;  1TDL A;  2XQZ A;  1K54 C;  3IH8 A;  3IWO A;  4QHC A;  4WZ5 C;  3W4O A;  1OME A;  4S2L A;  1IYP A;  2P9V A;  3NIA A;  3PTE A;  3FKW A;  5GHX A;  3Q7V B;  4X53 A;  4DE2 A;  1I2S A;  3M2J A;  3PBR A;  2Q9M A;  4IED A;  1W8Y A;  1YM1 A;  3G2Z A;  2PBY A;  3DWK A;  4EQI A;  1K54 A;  1XX2 A;  4KG5 A;  4R4R A;  3O88 A;  4RX2 A;  1JWZ A;  3PBQ A;  4LV0 A;  5CHJ A;  2ZQ8 A;  1G68 A;  4BD0 A;  1HVB A;  4KQQ A;  2I72 A;  2ZMA A;  3C5A A;  3WWX A;  3GRJ A;  1K56 A;  4GD6 A;  5GLB A;  4X69 A;  4E3I A;  3AGF A;  1IYS A;  4R3B A;  1JWP A;  4HES A;  3MZD A;  4GKU A;  4KG6 A;  3A3F A;  3BFE A;  4KZ7 A;  1WYB A;  3Q82 A;  4Y7P A;  3VP0 A;  5FAS A;  1K6S A;  1VM1 A;  4EV4 A;  2A49 A;  1FSY A;  1NY0 A;  3GV9 A;  5EVI D;  1YLY A;  2C5W B;  2ZQ7 A;  1GHP A;  3IF5 A;  2ZD8 A;  3NI9 A;  4KZ6 A;  4DRT A;  2ZQA A;  5J8X A;  5EOO A;  3W4Q A;  3D4F A;  3LO7 A;  2QMI A;  1Z6F A;  1MWU A;  4K0X A;  5FQM A;  5KMW A;  4BEN A;  3HL9 A;  2ZLY A;  3O3V A;  3WRZ A;  4LV2 A;  4N1X A;  4KZB A;  2WKH A;  4LV3 A;  4RA7 A;  1BLP A;  1IEM A;  4NK3 A;  4N1H A;  3ISG A;  1DY6 A;  3VOY A;  5KZH A;  2WKI A;  2Y2M A;  1PZO A;  3HRE A;  1MKI A;  1W7F A;  2H5S A;  4WMC A;  1DJA A;  1H8Z A;  3MKE A;  4B4X A;  4DKI A;  2EXA A;  2XFS A;  1CI9 A;  4RX3 A;  3A3D A;  5AQA A;  2RCX A;  4B88 A;  5E43 A;  4HEF A;  3RJU A;  4BLM A;  3ZG7 B;  1KDS A;  1XA7 A;  3NCK A;  1IYO A;  1SHV A;  2V1Z A;  2WGV A;  3M6B A;  4FD8 A;  4PM9 A;  4EBN A;  4OVD A;  5CXW A;  2E8I A;  1ES3 A;  1N4O A;  2ZM8 A;  1PW8 A;  4OON A;  2HP9 A;  1LI9 A;  4OPQ A;  2Y55 A;  3GTC A;  3HLG A;  3Q07 A;  3Q81 A;  4OP5 A;  3VSK A;  4GZB A;  2EX2 A;  4JXV A;  1YMS A;  4PM8 A;  4MNR A;  4BJP A;  4OQI A;  1QMF A;  2XR0 A;  3VFH A;  4P87 A;  4WM9 A;  4E3L A;  1KGF A;  3G30 A;  3HLE A;  4PM6 A;  5EVI B;  5A92 A;  2GDN A;  2OV5 A;  5CEC A;  3ZCZ A;  2EFU A;  2EX6 A;  3BFF A;  1PI4 A;  1JVJ A;  1NYY A;  4ZAM A;  1FCO A;  3ZNT A;  3MXS A;  2XD1 A;  1G6A A;  1NJ4 A;  1Y54 A;  3MKF A;  1YT4 A;  4JXS A;  3E2L A;  2ZM0 A;  2H10 A;  1J9M A;  2V2F F;  2Z2M B;  3OPH A;  4UAA A;  4WZ4 A;  3UPP A;  4HBU A;  2C6W B;  1ZC2 A;  3HLB A;  3LCE A;  4E3O A;  3OCN A;  3IWI A;  5HAI A;  1BLC A;  1NRF A;  3C4O A;  1U60 A;  4ZDX A;  1LHY A;  4QU3 A;  4UA9 A;  3RXW A;  4P6B A;  5FA7 A;  1HZO A;  5CTM A;  3ZGA B;  1S0W A;  4GN2 A;  3B3X A;  1MY8 A;  4B4Z A;  1VQQ A;  2ZC5 B;  5GLD A;  1KDW A;  3N8L A;  3VSL A;  1M40 A;  3DTM A;  4KZ4 A;  4R4S A;  3BM6 A;  1YLT A;  4QB8 A;  4DXB A;  4MBH A;  1KVM A;  1NXY A;  4S2P A;  2OSU A;  3OPP A;  3IHA A;  4LEN A;  2RL3 A;  1ONH A;  2JE5 A;  3FV7 A;  3M6H A;  1SDE A;  3AGE A;  4Z9Q A;  4NET A;  2XLN A;  3IQA A;  1S6R A;  3PAE A;  1MBL A;  1KE3 A;  1PYY A;  3BLM A;  4XXR A;  2WYX A;  3IF6 C;  4UA7 A;  5CGS A;  1KE0 A;  4EBL A;  3A3E A;  1TDG A;  1TVF A;  5TFQ A;  3G31 A;  3N8R A;  2R9X A;  5A91 A;  1BLS A;  5FQI A;  4OQ0 A;  1K55 A;  3PAG A;  1KE4 A;  2EXB A;  4XUX A;  3W8K A;  1ALQ A;  1BZA A;  2QZ6 A;  1PWD A;  4WMC D;  1XKZ A;  3UDX A;  5M19 A;  5FI6 A;  3RXX A;  2Y2K A;  2BLS A;  5FQK A;  1MPL A;  3VOZ A;  2ZQ9 A;  2WZZ A;  1AXB A;  1KVL A;  4E3M A;  3ZVW A;  3VMA A;  1SDN A;  1PZP A;  3VP4 A;  4FH4 A;  4DDS A;  1ES5 A;  5FQQ A;  2HP6 A;  2P9V B;  4EBP A;  1E4D A;  5GL9 A;  3A3I A;  3V50 A;  3MXR A;  1ONG A;  1RGZ A;  1Q2Q A;  3S22 A;  2VGJ A;  5CHM A;  1BT5 A;  2Y59 A;  4OOM A;  5L2F A;  4ID4 A;  5DTT A;  1CEF A;  1ZG4 A;  3UE0 A;  4DE0 A;  2EFX A;  4WEL A;  3UDI A;  3EQU A;  5FAT A;  4C6Y A;  3NC8 A;  3WS2 A;  2XH9 A;  5DTK A;  3G34 A;  2Y2J A;  3HUO A;  1XA1 A;  2Y2P A;  4KZ5 A;  1I5Q A;  4KZ9 A;  4S2I A;  1ZG6 A;  5FQ9 A;  3BFC A;  3IH9 A;  4U0X A;  1PWC A;  2ZC6 B;  3UE1 A;  4DXC A;  2Y2L A;  1SKF A;  2G2W A;  4D2O A;  4OQH A;  2J8Y A;  4EWF A;  3Q7V A;  4KEN B;  1Q2P A;  3TSG A;  3UO9 A;  1FR1 A;  3BEB A;  4MBF A;  4ZBE A;  4Y0U A;  1FSW A;  1NYM A;  1PIO A;  5AQ9 A;  1O07 A;  1ZKJ A;  3GMW A;  2QPN A;  2WAD A;  5BOH A;  1IEL A;  1YMX A;  3C7V A;  4ZJ3 A;  4KQR A;  4MLL A;  4BQM A;  3MFD A;  3WS1 A;  3BFG A;  5AQ7 A;  5HAP A;  2Y2N A;  2IWD A;  4WEK A;  4GDB A;  3BRM A;  5G18 A;  2ZQC A;  1KGG A;  4FSF A;  4LV1 A;  3Q7Z A;  4YIN A;  2B5R A;  4GB7 A;  5EPH A;  1RGY A;  4IVK A;  5EOE A;  3QHY A;  4K91 A;  1L0F A;  4CPK A;  4PPR A;  2DRW A;  2HDQ A;  4PM7 A;  3O87 A;  3UDF A;  5CGX A;  4H8R A;  4GNU A;  1YLP A;  1L2S A;  4WBG A;  3PBS A;  2H0T A;  1K4E A;  5HX9 A;  4HBT A;  2WUQ A;  4JPM A;  3ZVT A;  2CC1 A;  2J9O A;  5M1A A;  2WGW A;  3G35 A;  3W4P A;  4FCF A;  5HAQ A;  3S1Y A;  2JC7 A;  3UPN A;  2HDS A;  3MZE A;  1GA9 A;  5IHV A;  1FCM A;  1MWT A;  1W5D A;  3C7U A;  3P98 A;  1MWR A;  5EVI C;  1YLJ A;  1M6K A;  1XGJ A;  4U3T A;  4S2M A;  3ZDJ A;  2VGK A;  4QD4 A;  1KGE A;  3G2Y A;  3IXB A;  4E3N A;  4S2O A;  3UPO A;  4P0M A;  3ZFZ A;  3QNC A;  4UHU A;  3FYZ A;  4X6T A;  5DF8 A;  5JYP A;  5F83 A;  2Y2Q A;  2WAE A;  3IXG A;  4R23 A;  4E6X A;  5JYO A;  1BLH A;  1O7E A;  2ZC4 B;  2OLV A;  3GVB A;  1JTD A;  3HLC A;  3UNW A;  1NZU A;  3N6I A;  2H0Y A;  4LCL A;  3Q1F A;  4OLG A;  3LY3 A;  2PU2 A;  4IVI A;  1GHI A;  4EUZ A;  1JTG A;  3I7J A;  3SH7 A;  2Y4A A;  4PM5 A;  4GDN A;  1PWG A;  5F82 A;  5HFO A;  4OH0 A;  3DWZ A;  1XXM A;  4N9K A;  4QY6 A;  2WKE A;  3HLW A;  3OC2 A;  3SS4 A;  2DCF A;  4M3K A;  1ERM A;  1XPB A;  2Y91 A;  1H8Y A;  1YLW A;  5M18 A;  4JBF A;  1RP5 A;  3ITA A;  4S2K A;  4C3Q A;  2Y2I A;  1IYQ A;  1ES4 A;  3FZC A;  2BG1 A;  3QNB A;  5E2E A;  5AQB A;  1K6R A;  2G2U A;  2ZC7 A;  1HD8 A;  2JCH A;  2P74 A;  3N8S A;  3OZH A;  1K56 D;  4MEZ A;  3ZG8 B;  3UY6 A;  1BTL A;  5U47 A;  3UE3 A;  5CHU A;  3SS5 A;  5CRF A;  4QJG A;  5CEB A;  4KZ3 A;  2J9P A;  5GLA A;  2EX8 A;  1BUL A;  4C75 A;  3C4P A;  4R3J A;  2DNS A;  4E3K A;  3WS5 A;  4Y0T A;  5FSR A;  1LI0 A;  1WYC A;  5KSH A;  4OLD A;  3MBZ A;  3N7W A;  1NZO A;  3HUN A;  4N9L A;  4IBR A;  2XF3 A;  3CG5 A;  3VFF A;  1GHM A;  3E2K A;  1E25 A;  3GR2 A;  2FFY A;  2WGI A;  3FKV A;  3G32 A;  1FCN A;  4OPR A;  1BSG A;  4RYE A;  4QY5 A;  5FAP A;  3ZNY A;  5EEC A;  3V5M A;  2HDR A;  3ZG0 A;  1MXO A;  4BL2 A;  4KQO A;  5FI7 A; 
#chains in the Genus database with same CATH topology
 1H8M A;  2VK3 A;  2WK0 A;  2P08 A;  1H0M A;  2XD5 A;  4LGW A;  5KSC A;  5F5Y A;  5TR7 A;  2V1A A;  2QJ7 A;  3NDG A;  3NDE A;  3IT9 A;  3E4O A;  1XP4 A;  1TF1 A;  5DF7 A;  2XGN A;  1BUE A;  4OOY A;  4CJN A;  2XDM A;  2XK1 A;  3JPU A;  1LL5 A;  1H5X A;  4DJ2 A;  2Q9N A;  4OPZ A;  5EE8 A;  1FOF A;  3BEC A;  5HAR A;  1S66 L;  1TEM A;  1JNU A;  2W1R A;  2XFT A;  4MBK A;  3SOI A;  3TRC A;  4OPY A;  2BAS A;  3LY4 A;  3OCL A;  1K55 C;  5EUA A;  1YQS A;  3IWQ A;  4JGP A;  4EUV A;  5EVI A;  3FPW A;  5A90 A;  1YLZ A;  2R78 A;  4Q0I A;  3G6O A;  3EWK A;  3PHY A;  5F1F A;  3NY4 A;  2VX8 A;  2PU4 A;  4I5S A;  3A0V A;  3H9W A;  3IXD A;  4Q0H A;  5FI2 A;  3IXH A;  2EWW A;  1KOU A;  4LFU A;  2ZC3 B;  2HF6 A;  4XT2 B;  3KSI A;  5D3O A;  3M2K A;  4F94 A;  3T4S A;  5CED A;  4EW7 A;  1DJC A;  3BWL A;  4JXG A;  3HVF A;  4LRX C;  4GJ4 A;  3UB8 A;  3TOI A;  3LEZ A;  2EX9 A;  4F3L A;  3CJM A;  3CZD A;  3RH8 B;  2X01 A;  2V20 A;  3LGO A;  4OKP A;  3PBT A;  1I2W A;  4EER A;  1TDL A;  2XQZ A;  3LIE A;  3VE4 A;  3IWO A;  2J3T D;  2P9V A;  4DE2 A;  3M2J A;  1W8Y A;  2VEA A;  3DTK A;  2DMW A;  4KG5 A;  3O88 A;  1TS0 A;  3KYE A;  2HJ9 C;  2PYP A;  4BD0 A;  1HVB A;  2LB5 A;  2QKP A;  2ZMA A;  3AGF A;  4EU0 A;  1D7E A;  4KG6 A;  1WYB A;  2KDK A;  1VM1 A;  4JGR A;  4Y2F A;  3IBR A;  2CMN A;  5EVI D;  2C5W B;  2ZQ7 A;  2A24 A;  3LO7 A;  2QHK A;  4K0X A;  3UB7 A;  3CPT A;  3GEC A;  4LV2 A;  2WKH A;  3H82 A;  1DY6 A;  5KZH A;  2NUT C;  4KUO A;  4WMC A;  2O9A A;  3UME A;  1OTI A;  3ZG7 B;  4X25 A;  1VEU A;  2WGV A;  3NCK A;  3M6B A;  5CXW A;  1N9L A;  2E8I A;  1PW8 A;  2HP9 A;  4OPQ A;  4OP5 A;  5AVF A;  4GZB A;  2EX2 A;  4JXV A;  5EFW A;  4BJP A;  3EGX C;  3MSH A;  3D72 A;  4IJG A;  1PFL A;  3O5Y A;  4PM6 A;  5EVI B;  5I5L A;  5A92 A;  3E0Y A;  5DKK A;  2W3D A;  2OV5 A;  2EFU A;  3BFF A;  4LLO B;  3S7N A;  1T19 A;  1FCO A;  1NJ4 A;  4JXS A;  1K0K A;  1F5M A;  2ZM0 A;  2V2F F;  2Z2M B;  4WZ4 A;  4ZDX A;  4UA9 A;  2FH5 A;  3B3X A;  1KDW A;  2JKR M;  3N8L A;  1M40 A;  1YLT A;  3R4K A;  2OSU A;  3DBA A;  1ODV A;  1ONH A;  4D60 A;  2JE5 A;  2ZL1 A;  3VE3 A;  1SDE A;  4NET A;  5HPF A;  1KE3 A;  4P6Z M;  4UA7 A;  3LIA A;  2J80 A;  5TFQ A;  3N8R A;  4OQ0 A;  1K55 A;  3PAG A;  2QZ6 A;  1XKZ A;  3UDX A;  5FI6 A;  2Y2K A;  3IBJ A;  4HP9 A;  4Y13 A;  1KVL A;  3LIB A;  4EBP A;  4K08 A;  3K2N A;  1E4D A;  3V50 A;  3T4O A;  3S22 A;  4OOM A;  4ID4 A;  5DTT A;  1CEF A;  1ZG4 A;  3UE0 A;  3HCY A;  3NC8 A;  3WS2 A;  2XH9 A;  3HUO A;  2Y2P A;  4KZ9 A;  3IH9 A;  2ZC6 B;  3F1O A;  4DXC A;  1ACF A;  2G2W A;  5FEF A;  4D2O A;  1PNE A;  5HDS A;  1UWN X;  3UO9 A;  4MBF A;  1FSW A;  2VKS A;  4HH2 A;  3QP4 A;  4BQM A;  3WS1 A;  4Y5F A;  3BFG A;  2Y2N A;  3TW8 A;  4GDB A;  2IA2 A;  2ZQC A;  1KGG A;  4YIN A;  2PHY A;  1L0F A;  2HDQ A;  3UDF A;  2W3F A;  2XSS A;  2PD8 A;  3PBS A;  2H0T A;  5HX9 A;  2WKQ A;  2D01 A;  2J9O A;  3QP2 A;  2VGL S;  1XJ6 A;  2WGW A;  2PR6 A;  1GA9 A;  5IHV A;  3KYZ A;  3C7U A;  1XGJ A;  1D1J A;  4U3T A;  2JKF A;  3EEH A;  4E3N A;  3ZFZ A;  2PD7 A;  5DF8 A;  2Y2Q A;  4R23 A;  5JYO A;  3UNW A;  1NZU A;  4LCL A;  3Q1F A;  2PU2 A;  3SH7 A;  1OJ5 A;  2A2L A;  2Y4A A;  1PWG A;  5F82 A;  2NUP C;  2P7J A;  4N9K A;  3TJZ C;  1XPB A;  1YLW A;  4C3Q A;  1DP8 A;  1ES4 A;  5E2E A;  5CEB A;  3UY6 A;  1BTL A;  5U47 A;  1N9O A;  5CRF A;  3SS5 A;  4KZ3 A;  2J9P A;  5GLA A;  3BY9 A;  1BUL A;  2DNS A;  3PR6 A;  3MBZ A;  3N7W A;  3KO6 A;  1NZO A;  4I3I A;  4IBR A;  3CUE C;  4BBT A;  2W3G A;  2VJW A;  1E25 A;  1BYW A;  2FFY A;  2WGI A;  3G32 A;  1FCN A;  3HJK A;  2JKT I;  5FAP A;  5EEC A;  2L0W A;  4BL2 A;  4A5R A;  4LCM A;  3AGD A;  3UN7 A;  4K0W A;  3LIF A;  2HP5 A;  5FQJ A;  2WKR A;  4ARZ A;  1OJG A;  2JBF A;  1EWZ A;  4M4X A;  4O0P A;  3DW0 A;  2Z6C A;  4Y3I A;  4JF4 A;  4ZTK A;  3V39 A;  1ERQ A;  3KSF A;  3S7P A;  4OP8 A;  2X71 A;  1FQG A;  1K57 C;  2X02 A;  1ESI A;  5DTS A;  4JKT A;  3SH9 A;  3V3R A;  3BYD A;  1C3B A;  4WZ5 A;  1A0K A;  1IKG A;  1L0E A;  5HPI A;  1ESU A;  1LL9 A;  4X68 A;  3N4I A;  1LT0 A;  4BL3 A;  4O7D A;  3S7O A;  4S2N C;  3SH8 A;  4JLF A;  2GX5 A;  3WRT A;  5HW3 A;  3LYX A;  5DVA A;  5DFX A;  3GSG A;  2XEP A;  3OPL A;  4P6Z S;  4L9F A;  4U0T A;  4JXW A;  2WGW B;  4JF6 A;  4FH2 A;  1VET B;  3FWL A;  3HLD A;  3PBN A;  2Y2O A;  3A0S A;  2A3U A;  5TGF A;  3OPR A;  4G3W A;  4E3J A;  4DE1 A;  3SZT A;  1DJB A;  2AVX A;  3P7N A;  4X56 A;  1STZ A;  4CLC A;  3QP5 A;  1E3U D;  2OLU A;  1GCE A;  3HUM A;  3WS4 A;  1CEG A;  4WUJ A;  3IX4 A;  4IHQ A;  1ERO A;  4MMN A;  1E3U A;  3O86 A;  1PW1 A;  3ICY A;  5EM0 A;  5CER A;  4L0L A;  2J3T C;  3UE6 A;  4QHC A;  3W4O A;  4WZ5 C;  4S2L A;  1IYP A;  5MC7 A;  3F1P A;  5GHX A;  1MC0 A;  3Q7V B;  4IUK A;  3PBR A;  3G2Z A;  2GZA A;  1K54 A;  1XX2 A;  4RX2 A;  2ZQ8 A;  1G68 A;  4KQQ A;  2I72 A;  4HQA A;  3W2Z A;  1K56 A;  1ZHH B;  4E3I A;  3A3F A;  3BFE A;  4HJ4 A;  1K6S A;  2K2N A;  4EV4 A;  2A49 A;  1FSY A;  1YLY A;  4FUW A;  1GHP A;  3T1Q B;  2ZQA A;  5EOO A;  3W4Q A;  1Z6F A;  2EA9 A;  1MWU A;  5KMW A;  1S4S A;  4BEN A;  1H3Q A;  3E4Q A;  3O3V A;  3WRZ A;  3T4T A;  4II7 A;  1V9Y A;  4N1H A;  5J7E A;  2WKI A;  2XA7 S;  3HRE A;  1MKI A;  3UB9 A;  2H5S A;  1H8Z A;  3MKE A;  4B4X A;  4NXF A;  5TBM B;  4DKI A;  2EXA A;  2PDR A;  5AVE A;  3A3D A;  5AQA A;  2RCX A;  5F6A A;  5E43 A;  4HEF A;  1XA7 A;  2V1Z A;  3KYQ A;  3LI8 A;  4OVD A;  5IS1 A;  2ZM8 A;  2PAV P;  1LL8 A;  3FC7 A;  3GTC A;  3HLG A;  4L9E A;  1F2K A;  1YMS A;  4PM8 A;  4BMW A;  2O0Y A;  3LI9 A;  1QMF A;  2XR0 A;  3LUQ A;  2V0U A;  5DKL A;  4HH3 A;  3H82 B;  3GDI A;  4E3L A;  3IS2 B;  2VZW A;  2EX6 A;  5J4E A;  1NYY A;  2B95 A;  3MKF A;  2VLG A;  4I3A A;  1J9M A;  2C6W B;  4CLC D;  1ZC2 A;  3MS6 A;  1NRF A;  3C4O A;  1U60 A;  4QU3 A;  3ZGA B;  1S0W A;  4GN2 A;  4B4Z A;  1VQQ A;  2ZC5 B;  3ULF A;  5HD3 A;  3BM6 A;  4QB8 A;  4DXB A;  4MBH A;  1NXY A;  4S2P A;  3B33 A;  3IHA A;  4LEN A;  2RL3 A;  3FV7 A;  4Z9Q A;  3AGE A;  3IQA A;  1S6R A;  4EBN A;  2Y79 A;  1PYY A;  5CGS A;  4EBL A;  1KE0 A;  3KX0 X;  1TDG A;  1TVF A;  2R9X A;  3NJA A;  1BLS A;  1YKD A;  2LB9 A;  1KE4 A;  3OLO A;  1ALQ A;  4NKP A;  5L09 A;  1SZV A;  2BLS A;  2W27 A;  2UV0 E;  4E3M A;  3T4L A;  1SDN A;  1ES5 A;  3LR5 A;  2E8J A;  1VB6 A;  4KUK A;  1Q2Q A;  5CHM A;  4WEL A;  3UDI A;  5FAT A;  4C6Y A;  3FG8 A;  4ESP A;  1XA1 A;  2V9A A;  4GCZ A;  3QP1 A;  5FQ9 A;  1ZG6 A;  3BFC A;  3MQ0 A;  1L3L A;  1PWC A;  1SKF A;  4OQH A;  2J8Y A;  4EEP A;  3MF0 A;  4MN7 A;  1PIO A;  3H7W A;  4EES A;  4CLC C;  5BOH A;  4IUH A;  4ZJ3 A;  4KQR A;  4MLL A;  4HI4 A;  4WEK A;  4GB7 A;  5EOE A;  3QHY A;  4K91 A;  1MZU A;  4PPR A;  2DRW A;  3NOT C;  4QPR A;  5HL6 A;  3CHW P;  5CGX A;  3SW1 A;  5F69 A;  1YLP A;  1L2S A;  4HBT A;  2WUQ A;  4JPM A;  2CC1 A;  5F68 A;  5M1A A;  3G35 A;  3W4P A;  5HAQ A;  2HDS A;  2J3W A;  3MZE A;  1FCM A;  4QWO A;  3KSH A;  5EVI C;  1LSV A;  4HIA A;  3IXB A;  3FYZ A;  2GJ3 A;  5HZH A;  2WAE A;  2O9B A;  3IXG A;  2ZC4 B;  2OLV A;  3GVB A;  3K3C A;  3N6I A;  3MMH A;  2H0Y A;  3U4L P;  2JKG A;  3TE8 A;  1GHI A;  4EUZ A;  4GDN A;  1YSP A;  1AWI A;  4OH0 A;  2I9V A;  2M7U A;  3SS4 A;  3HLW A;  1P97 A;  2M7V A;  4S2K A;  4GS9 A;  5G4Z A;  1IYQ A;  3FZC A;  3NHQ A;  4LRZ E;  1K6R A;  2PBD P;  3E98 A;  4MEZ A;  1X0O A;  1FIK A;  4Y15 A;  3UE3 A;  5CHU A;  3QP6 A;  4NXG A;  4C75 A;  4R3J A;  3UMD A;  1LI0 A;  1LSX A;  1SKO B;  3C30 A;  3F1N B;  3BY8 A;  1GSW A;  4ZRR A;  4N9L A;  1F9I A;  3CG5 A;  3VFF A;  3CPT B;  2W3H A;  4OPR A;  4RYE A;  4QY5 A;  3V5M A;  3ZG0 A;  3A3I A;  5FI7 A;  3DTI A;  1XJ4 A;  4DE3 A;  3V3S A;  2KOI A;  4FTX A;  2MJ6 A;  4G3K A;  3JVU A;  2IWB A;  2V8C A;  4R38 A;  5HDC A;  1W8Q A;  2FZ0 A;  4LPZ A;  3IF6 B;  3WS0 A;  5DF9 A;  2OWH A;  1TS7 A;  2B18 A;  1LLB A;  5EV0 A;  2QYB A;  1JWV A;  4UQI S;  2JN7 A;  2V1B A;  2WZX A;  3GQZ A;  3ZQ5 A;  3ITB A;  3NBL A;  4R70 A;  4Q8I A;  4Y0O A;  4WLA A;  5F1G A;  4CLC E;  3CMZ A;  5I94 A;  1RCJ A;  2Y2G A;  4DJ3 A;  4E04 A;  5CGW A;  2V8F A;  2Z6D A;  2IWC A;  4KZ8 A;  1L0D A;  3HBR A;  2HPB A;  3IF6 A;  1OT9 A;  4MCW A;  4HJ3 A;  5FAQ A;  1K4F A;  4ZJ2 A;  2VV8 A;  3MXQ A;  3P09 A;  4HY8 A;  5HDD A;  4BBV A;  4E6W A;  4BBU A;  4DDY A;  4DF6 A;  1K38 A;  2R9W A;  4FOF A;  4WEJ A;  2Q0O A;  5GHZ A;  4XUZ A;  1J3W A;  4KZA A;  3SS3 A;  4S2N A;  5EVL A;  4OOL A;  4YOF A;  1WA9 A;  4EEU A;  3T50 A;  3HLF A;  1XGI A;  4OQG A;  3IHB A;  2UWX A;  4MN5 A;  5C5K A;  3S4X A;  4X55 A;  5EVE A;  4EXO A;  1K25 A;  2Y2H A;  5GLC A;  1K57 A;  1VHM A;  3CLO A;  4Z1W A;  1K54 C;  3IH8 A;  3F1O B;  4NXE A;  3EOI A;  4X53 A;  1I2S A;  2Q9M A;  1YM1 A;  3NEC A;  2PBY A;  4EQI A;  3T4Q A;  2W1T A;  1JWZ A;  3PBQ A;  4I38 A;  5CHJ A;  3EGD C;  4RQ9 A;  3C5A A;  3GRJ A;  4O8G A;  4R3B A;  1JWP A;  4HES A;  4KZ7 A;  3Q82 A;  3VP0 A;  5FAS A;  2WKP A;  1NY0 A;  3GV9 A;  3NI9 A;  3IF5 A;  2ZD8 A;  4KZ6 A;  1GSV A;  1PRQ A;  3R7W B;  5J8X A;  3CWF A;  5HWW A;  2QMI A;  5FQM A;  3HL9 A;  2ZLY A;  4KZB A;  2XRO A;  1TD5 A;  4RA7 A;  1IEM A;  2KX6 A;  2Y2M A;  4KQD A;  4YWZ A;  1W7F A;  1DJA A;  2XA7 M;  5IT5 A;  4B88 A;  3RJU A;  1SHV A;  3DAV A;  2HJE A;  3CIT A;  1ES3 A;  3JVV A;  2ZMF A;  1LI9 A;  3Q07 A;  2OWJ A;  3Q81 A;  3VSK A;  1DP6 A;  1IOU A;  3BJN A;  4MNR A;  1NLZ A;  4PKY G;  4I3J A;  3OBF A;  1NRJ A;  3HLE A;  2O9C A;  5HWT A;  5AJG A;  4PKY A;  3ZCZ A;  1IFQ A;  1JVJ A;  1PI4 A;  1T1A A;  4ZAM A;  2XD1 A;  1YT4 A;  3OPH A;  3MQQ A;  1SKO A;  4UAA A;  3UPP A;  3HLB A;  3LCE A;  1CJF A;  3OCN A;  3IWI A;  4UQI M;  1BLC A;  5HAI A;  1LHY A;  1HZO A;  5CTM A;  4PHT A;  1MY8 A;  5GLD A;  3VSL A;  4KZ4 A;  4R4S A;  4F3L B;  3OPP A;  3C38 A;  4ARZ B;  1Y4O A;  3CI6 A;  3BQ8 A;  2XLN A;  4H6J B;  1MBL A;  3F1N A;  3BLM A;  2WYX A;  3IF6 C;  3G31 A;  3IS2 A;  3W8K A;  1PWD A;  4WMC D;  5M19 A;  3RXX A;  5LBR A;  1S4R A;  1MPL A;  2ZQ9 A;  2BTF P;  2WZZ A;  1AXB A;  4NG2 A;  2D02 A;  2W0N A;  3VP4 A;  5FQQ A;  1T1C A;  1W63 Q;  2Y59 A;  2W1T B;  5L2F A;  2EFX A;  3EQU A;  2K31 A;  2KLI A;  5L10 A;  3G34 A;  4R6L A;  1I5Q A;  4B9O A;  4S2I A;  4Y17 A;  4U0X A;  2Y2L A;  4EWF A;  4KEN B;  1Q2P A;  4JGO A;  3BQA A;  1FR1 A;  3BEB A;  3BW6 A;  4Y0U A;  1NYM A;  1O07 A;  1ZKJ A;  3MFD A;  5AQ7 A;  1VET A;  5G18 A;  4FSF A;  3T1S A;  3Q7Z A;  5TBM A;  2B5R A;  1RGY A;  1P0Z A;  1G6O A;  2P04 A;  3L7H A;  4PM7 A;  3IX3 A;  4H8R A;  2EWV A;  4WBG A;  1K4E A;  3ZVT A;  2VV6 A;  4NEE D;  2O99 A;  3T1X A;  4FCF A;  3S1Y A;  2JC7 A;  1W5D A;  1F98 A;  1YLJ A;  4WF0 A;  4S2M A;  3ZDJ A;  2VGK A;  1KGE A;  4P0M A;  2Y8H A;  3QNC A;  4ETX A;  5JYP A;  5F83 A;  5FDS A;  3L9K A;  4E6X A;  2PRF A;  1BLH A;  3IX8 A;  2ZBB A;  1VEU B;  1OTD A;  4XT2 A;  2JKR I;  1TS8 A;  1JTG A;  3I7J A;  4JGQ A;  5HFO A;  2XRN A;  3OC2 A;  4M3K A;  5M18 A;  1P9R A;  1RP5 A;  4I39 A;  1XFQ A;  3ITA A;  2Y2I A;  4X1M A;  1P9W A;  2G2U A;  1CF0 A;  2JCH A;  2P74 A;  3N8S A;  3HJI A;  3OZH A;  1K56 D;  4HNB A;  1W63 M;  3ZG8 B;  2OOL A;  3CAX A;  2EX8 A;  3C4P A;  5IU1 A;  3WS5 A;  2B02 A;  5FSR A;  1WYC A;  5KSH A;  4OLD A;  4DMZ A;  2OAP 1;  3FKV A;  4Q0J A;  1MXO A;  4KQO A;  1QME A;  1IKI A;  3BFD A;  3VP1 A;  4EET B;  1HLU P;  3G4P A;  3KSG A;  4N92 A;  2H28 A;  5DFY A;  3S7Q A;  4BD1 A;  3JYI A;  4UA6 A;  3B42 A;  4PMA A;  2HV1 A;  2ZJ9 A;  1CI8 A;  4RVA A;  3EEA A;  5CX7 A;  4R3A A;  1UGU A;  5A93 A;  4KG2 A;  5DJU A;  2ZOI A;  3ZG9 B;  1ZTU A;  4R0Q A;  4GOG A;  4AFI A;  5FL3 A;  5GHY A;  3K3D A;  3H7W B;  1N9B A;  4IBX A;  2J7V A;  1Y28 A;  1ES2 A;  2ZOH A;  1NWZ A;  1V9Z A;  1UWP X;  1W79 A;  3D9Y A;  4JF5 A;  5E2F A;  5FAO A;  3E4P A;  4R1G A;  1MWS A;  1WE4 A;  1L0G A;  4P85 A;  5DJT A;  4BWI A;  1D06 A;  5J3W A;  2JKT M;  1PI5 A;  1OTB A;  3MFX A;  2WAF A;  4S2J A;  1DRM A;  5HL1 A;  4WYY A;  5E2H A;  1HTZ A;  1Z09 A;  1CK3 A;  3PBO A;  1FR6 A;  1SCW A;  2YKH A;  3QP8 A;  3VV4 A;  3V67 A;  3BLS A;  3ZG5 A;  1MKM A;  4ME4 A;  5HD5 A;  1EW0 A;  3TG9 A;  3A0R A;  2FFF B;  2ZM2 A;  4ETZ A;  3ZYT A;  5E2G A;  3A3J A;  3T1R A;  1CQA A;  2Z2L B;  2M1C A;  3LR4 A;  3VP2 A;  5G4Y A;  3MZF A;  3LEQ A;  5CTN A;  4GS9 B;  3NUL A;  4ZJ1 A;  4YFM A;  2ZMV A;  3ZHH A;  2GNX A;  2VGL M;  3EQV A;  2HDU A;  2V0W A;  1G5U A;  5FDH A;  2G7U A;  1GA0 A;  1EI5 A;  4GD8 A;  1S67 L;  1GSX A;  2ZQD A;  3VP3 A;  1OME A;  3NIA A;  3PTE A;  3FKW A;  1YSQ A;  3MQO A;  4IED A;  3DWK A;  2QJ5 A;  1S1Z A;  4R4R A;  2QWS A;  3D3O A;  4LV0 A;  5L8M A;  3WWX A;  5HWV A;  4GD6 A;  4GHI A;  5GLB A;  4X69 A;  3LIC A;  1IYS A;  2JHE A;  3MZD A;  4GKU A;  3LID A;  4Y7P A;  4DRT A;  3T4J A;  2VA0 A;  3D4F A;  4GLQ A;  2PT7 A;  5TJJ A;  3MJQ A;  4N1X A;  4LV3 A;  2L1M A;  1BLP A;  4NK3 A;  1S1Y A;  3ISG A;  3VOY A;  1PZO A;  1YAX A;  2XFS A;  1XJ2 A;  1CI9 A;  4RX3 A;  4BLM A;  1KDS A;  1IYO A;  4FD8 A;  4PM9 A;  1N4O A;  4OON A;  2Y55 A;  2L4R A;  3R7W A;  3UB5 P;  1T18 A;  4WL9 A;  2ZL1 B;  4OQI A;  4MN6 A;  4PAU A;  5FEG A;  3VFH A;  4P87 A;  4WM9 A;  1KGF A;  3G30 A;  3U2A A;  2GDN A;  5CEC A;  3CUE A;  3ZNT A;  3MXS A;  1G6A A;  1Y54 A;  1OTA A;  3E2L A;  2H10 A;  4CLC B;  4GW9 A;  1N9N A;  3T4K A;  4HBU A;  4E3O A;  1T1B A;  3RXW A;  4P6B A;  1XJ3 A;  5FA7 A;  4NXB A;  1YPR A;  2INW A;  3DTM A;  1KVM A;  3M6H A;  3RTY A;  3PAE A;  4XXR A;  1FIL A;  3A3E A;  1OTE A;  5A91 A;  5FQI A;  2EXB A;  4XUX A;  1BZA A;  5FQK A;  3VOZ A;  5EM1 A;  3ZVW A;  3VMA A;  1PZP A;  2HZ5 A;  4FH4 A;  4DDS A;  2HP6 A;  2P9V B;  3VOL A;  5GL9 A;  3MXR A;  1ONG A;  4HOI A;  3UB6 A;  1RGZ A;  4CQH A;  2VGJ A;  1BT5 A;  4HJ6 A;  4DE0 A;  5KIZ A;  4L9G A;  3OOV A;  4YNR A;  5DTK A;  2Y2J A;  4KZ5 A;  4UEY A;  4B93 A;  3UE1 A;  3B47 A;  3LR3 A;  3P01 A;  3Q7V A;  4HP4 A;  5K5B A;  3TSG A;  4HHD A;  4G3V A;  2A24 B;  4ZBE A;  3PYP A;  5AQ9 A;  3DTE A;  3GMW A;  2QPN A;  2WAD A;  4O01 A;  1IEL A;  1YMX A;  3C7V A;  3MR0 A;  5HAP A;  2IWD A;  3BRM A;  4WN5 A;  4LV1 A;  1DP9 A;  5EPH A;  4IVK A;  3LR0 A;  4CPK A;  3O87 A;  1LSW A;  1G28 A;  4GNU A;  5L07 A;  2PR5 A;  4MDZ A;  4DN0 A;  1NLY A;  3C2W A;  2HGV A;  3NOP C;  3UPN A;  1MWT A;  2PYR A;  3P98 A;  1MWR A;  1M6K A;  4QD4 A;  3G2Y A;  4S2O A;  3UPO A;  4UHU A;  4X6T A;  2OAQ 1;  1O7E A;  3T12 B;  3HLC A;  1JTD A;  3PXP A;  1OT6 A;  4OLG A;  5HSQ A;  3LY3 A;  4IVI A;  4PM5 A;  3DWZ A;  1XXM A;  4QY6 A;  2WKE A;  2DCF A;  4X1L A;  2ACG A;  1ERM A;  2Y91 A;  1H8Y A;  4JBF A;  2VV7 A;  2BG1 A;  3LFV A;  3QNB A;  5AQB A;  1HD8 A;  2ZC7 A;  3NOU C;  3FPV A;  4QJG A;  4H6J A;  3RFB A;  4E3K A;  4Y0T A;  2YKF A;  1XFN A;  2W3E A;  4EQ1 A;  3F1P B;  3HUN A;  1OPX A;  2XF3 A;  5A8B A;  1GHM A;  3E2K A;  3GR2 A;  3C8C A;  4GHI B;  4LRY C;  1BSG A;  1TS6 A;  3ZNY A;  2K7S A;  2HDR A; 
#chains in the Genus database with same CATH homology
 1QME A;  4A5R A;  4LCM A;  3AGD A;  3UN7 A;  1IKI A;  4DE3 A;  4K0W A;  3V3S A;  2WK0 A;  3BFD A;  2XD5 A;  2HP5 A;  5FQJ A;  3VP1 A;  5KSC A;  3G4P A;  5TR7 A;  4N92 A;  2JBF A;  1EWZ A;  3NDG A;  3NDE A;  5HAR A;  2IWB A;  4BD1 A;  3JYI A;  1W8Q A;  4UA6 A;  4PMA A;  3DW0 A;  3IT9 A;  4JF4 A;  2ZJ9 A;  4RVA A;  1CI8 A;  4ZTK A;  3V39 A;  1ERQ A;  3IF6 B;  1XP4 A;  5A93 A;  4KG2 A;  4OP8 A;  2X71 A;  3WS0 A;  1FQG A;  3ZG9 B;  5DF7 A;  2XGN A;  1BUE A;  1K57 C;  4OOY A;  5DF9 A;  4CJN A;  2XDM A;  4R0Q A;  2X02 A;  4GOG A;  5GHY A;  1ESI A;  1N9B A;  2XK1 A;  4IBX A;  2J7V A;  1ES2 A;  5DTS A;  4JKT A;  3SH9 A;  1LLB A;  3BYD A;  3V3R A;  1LL5 A;  1C3B A;  1H5X A;  4WZ5 A;  2Q9N A;  4OPZ A;  1W79 A;  4JF5 A;  5E2F A;  1JWV A;  5EE8 A;  5FAO A;  1FOF A;  3BEC A;  2WZX A;  3GQZ A;  4R1G A;  1MWS A;  1WE4 A;  1TEM A;  1IKG A;  3ITB A;  3NBL A;  1L0E A;  4P85 A;  1L0G A;  1ESU A;  1LL9 A;  4X68 A;  4Q8I A;  3N4I A;  4BL3 A;  4Y0O A;  4O7D A;  2XFT A;  5F1G A;  4MBK A;  1PI5 A;  4S2N C;  3CMZ A;  3SH8 A;  3SOI A;  5I94 A;  4OPY A;  2WAF A;  4JLF A;  4S2J A;  5HL1 A;  1RCJ A;  2Y2G A;  4WYY A;  5E2H A;  3WRT A;  1HTZ A;  5HW3 A;  3LY4 A;  3OCL A;  1K55 C;  5CGW A;  5DVA A;  5EUA A;  3GSG A;  2XEP A;  3OPL A;  2IWC A;  4U0T A;  4KZ8 A;  1CK3 A;  1YQS A;  1L0D A;  3HBR A;  2HPB A;  3IF6 A;  1FR6 A;  3IWQ A;  3PBO A;  1SCW A;  5EVI A;  5A90 A;  4JXW A;  1YLZ A;  2WGW B;  4JF6 A;  4FH2 A;  5FAQ A;  1K4F A;  3FWL A;  3BLS A;  4ZJ2 A;  3HLD A;  3PBN A;  5F1F A;  3NY4 A;  3ZG5 A;  2PU4 A;  2Y2O A;  3P09 A;  3TG9 A;  5FI2 A;  3IXD A;  2FFF B;  2ZM2 A;  2A3U A;  3IXH A;  4E6W A;  5TGF A;  3OPR A;  4DDY A;  4DF6 A;  4E3J A;  2ZC3 B;  1K38 A;  4DE1 A;  2R9W A;  1DJB A;  4WEJ A;  5E2G A;  4X56 A;  5GHZ A;  3A3J A;  5D3O A;  3M2K A;  4XUZ A;  4F94 A;  5CED A;  4KZA A;  3SS3 A;  2Z2L B;  4S2N A;  1E3U D;  2OLU A;  5EVL A;  4OOL A;  1DJC A;  4JXG A;  3VP2 A;  1GCE A;  3HVF A;  3HUM A;  3MZF A;  3HLF A;  1XGI A;  5CTN A;  3TOI A;  3LEZ A;  4OQG A;  3IHB A;  2EX9 A;  4ZJ1 A;  2UWX A;  4YFM A;  3ZHH A;  3EQV A;  3S4X A;  3CJM A;  3CZD A;  1CEG A;  3WS4 A;  2HDU A;  1ERO A;  4X55 A;  2X01 A;  1E3U A;  2V20 A;  5FDH A;  3O86 A;  1PW1 A;  4OKP A;  1K25 A;  2Y2H A;  1GA0 A;  1EI5 A;  5GLC A;  5CER A;  4GD8 A;  3PBT A;  1I2W A;  1K57 A;  4L0L A;  3VP3 A;  2ZQD A;  1TDL A;  2XQZ A;  1K54 C;  3IH8 A;  3IWO A;  4QHC A;  4WZ5 C;  3W4O A;  1OME A;  4S2L A;  1IYP A;  2P9V A;  3NIA A;  3PTE A;  3FKW A;  5GHX A;  3Q7V B;  4X53 A;  4DE2 A;  1I2S A;  3M2J A;  3PBR A;  2Q9M A;  4IED A;  1W8Y A;  1YM1 A;  3G2Z A;  2PBY A;  3DWK A;  4EQI A;  1K54 A;  1XX2 A;  4KG5 A;  4R4R A;  3O88 A;  4RX2 A;  1JWZ A;  3PBQ A;  4LV0 A;  5CHJ A;  2ZQ8 A;  1G68 A;  4BD0 A;  1HVB A;  4KQQ A;  2I72 A;  2ZMA A;  3C5A A;  3WWX A;  3GRJ A;  1K56 A;  4GD6 A;  5GLB A;  4X69 A;  4E3I A;  3AGF A;  1IYS A;  4R3B A;  1JWP A;  4HES A;  3MZD A;  4GKU A;  4KG6 A;  3A3F A;  3BFE A;  4KZ7 A;  1WYB A;  3Q82 A;  4Y7P A;  3VP0 A;  5FAS A;  1K6S A;  1VM1 A;  4EV4 A;  2A49 A;  1FSY A;  1NY0 A;  3GV9 A;  5EVI D;  1YLY A;  2C5W B;  2ZQ7 A;  1GHP A;  3IF5 A;  2ZD8 A;  3NI9 A;  4KZ6 A;  4DRT A;  2ZQA A;  5J8X A;  5EOO A;  3W4Q A;  3D4F A;  3LO7 A;  2QMI A;  1Z6F A;  1MWU A;  4K0X A;  5FQM A;  5KMW A;  4BEN A;  3HL9 A;  2ZLY A;  3O3V A;  3WRZ A;  4LV2 A;  4N1X A;  4KZB A;  2WKH A;  4LV3 A;  4RA7 A;  1BLP A;  1IEM A;  4NK3 A;  4N1H A;  3ISG A;  1DY6 A;  3VOY A;  5KZH A;  2WKI A;  2Y2M A;  1PZO A;  3HRE A;  1MKI A;  1W7F A;  2H5S A;  4WMC A;  1DJA A;  1H8Z A;  3MKE A;  4B4X A;  4DKI A;  2EXA A;  2XFS A;  1CI9 A;  4RX3 A;  3A3D A;  5AQA A;  2RCX A;  4B88 A;  5E43 A;  4HEF A;  3RJU A;  4BLM A;  3ZG7 B;  1KDS A;  1XA7 A;  3NCK A;  1IYO A;  1SHV A;  2V1Z A;  2WGV A;  3M6B A;  4FD8 A;  4PM9 A;  4EBN A;  4OVD A;  5CXW A;  2E8I A;  1ES3 A;  1N4O A;  2ZM8 A;  1PW8 A;  4OON A;  2HP9 A;  1LI9 A;  4OPQ A;  2Y55 A;  3GTC A;  3HLG A;  3Q07 A;  3Q81 A;  4OP5 A;  3VSK A;  4GZB A;  2EX2 A;  4JXV A;  1YMS A;  4PM8 A;  4MNR A;  4BJP A;  4OQI A;  1QMF A;  2XR0 A;  3VFH A;  4P87 A;  4WM9 A;  4E3L A;  1KGF A;  3G30 A;  3HLE A;  4PM6 A;  5EVI B;  5A92 A;  2GDN A;  2OV5 A;  5CEC A;  3ZCZ A;  2EFU A;  2EX6 A;  3BFF A;  1PI4 A;  1JVJ A;  1NYY A;  4ZAM A;  1FCO A;  3ZNT A;  3MXS A;  2XD1 A;  1G6A A;  1NJ4 A;  1Y54 A;  3MKF A;  1YT4 A;  4JXS A;  3E2L A;  2ZM0 A;  2H10 A;  1J9M A;  2V2F F;  2Z2M B;  3OPH A;  4UAA A;  4WZ4 A;  3UPP A;  4HBU A;  2C6W B;  1ZC2 A;  3HLB A;  3LCE A;  4E3O A;  3OCN A;  3IWI A;  5HAI A;  1BLC A;  1NRF A;  3C4O A;  1U60 A;  4ZDX A;  1LHY A;  4QU3 A;  4UA9 A;  3RXW A;  4P6B A;  5FA7 A;  1HZO A;  5CTM A;  3ZGA B;  1S0W A;  4GN2 A;  3B3X A;  1MY8 A;  4B4Z A;  1VQQ A;  2ZC5 B;  5GLD A;  1KDW A;  3N8L A;  3VSL A;  1M40 A;  3DTM A;  4KZ4 A;  4R4S A;  3BM6 A;  1YLT A;  4QB8 A;  4DXB A;  4MBH A;  1KVM A;  1NXY A;  4S2P A;  2OSU A;  3OPP A;  3IHA A;  4LEN A;  2RL3 A;  1ONH A;  2JE5 A;  3FV7 A;  3M6H A;  1SDE A;  3AGE A;  4Z9Q A;  4NET A;  2XLN A;  3IQA A;  1S6R A;  3PAE A;  1MBL A;  1KE3 A;  1PYY A;  3BLM A;  4XXR A;  2WYX A;  3IF6 C;  4UA7 A;  5CGS A;  1KE0 A;  4EBL A;  3A3E A;  1TDG A;  1TVF A;  5TFQ A;  3G31 A;  3N8R A;  2R9X A;  5A91 A;  1BLS A;  5FQI A;  4OQ0 A;  1K55 A;  3PAG A;  1KE4 A;  2EXB A;  4XUX A;  3W8K A;  1ALQ A;  1BZA A;  2QZ6 A;  1PWD A;  4WMC D;  1XKZ A;  3UDX A;  5M19 A;  5FI6 A;  3RXX A;  2Y2K A;  2BLS A;  5FQK A;  1MPL A;  3VOZ A;  2ZQ9 A;  2WZZ A;  1AXB A;  1KVL A;  4E3M A;  3ZVW A;  3VMA A;  1SDN A;  1PZP A;  3VP4 A;  4FH4 A;  4DDS A;  1ES5 A;  5FQQ A;  2HP6 A;  2P9V B;  4EBP A;  1E4D A;  5GL9 A;  3A3I A;  3V50 A;  3MXR A;  1ONG A;  1RGZ A;  1Q2Q A;  3S22 A;  2VGJ A;  5CHM A;  1BT5 A;  2Y59 A;  4OOM A;  5L2F A;  4ID4 A;  5DTT A;  1CEF A;  1ZG4 A;  3UE0 A;  4DE0 A;  2EFX A;  4WEL A;  3UDI A;  3EQU A;  5FAT A;  4C6Y A;  3NC8 A;  3WS2 A;  2XH9 A;  5DTK A;  3G34 A;  2Y2J A;  3HUO A;  1XA1 A;  2Y2P A;  4KZ5 A;  1I5Q A;  4KZ9 A;  4S2I A;  1ZG6 A;  5FQ9 A;  3BFC A;  3IH9 A;  4U0X A;  1PWC A;  2ZC6 B;  3UE1 A;  4DXC A;  2Y2L A;  1SKF A;  2G2W A;  4D2O A;  4OQH A;  2J8Y A;  4EWF A;  3Q7V A;  4KEN B;  1Q2P A;  3TSG A;  3UO9 A;  1FR1 A;  3BEB A;  4MBF A;  4ZBE A;  4Y0U A;  1FSW A;  1NYM A;  1PIO A;  5AQ9 A;  1O07 A;  1ZKJ A;  3GMW A;  2QPN A;  2WAD A;  5BOH A;  1IEL A;  1YMX A;  3C7V A;  4ZJ3 A;  4KQR A;  4MLL A;  4BQM A;  3MFD A;  3WS1 A;  3BFG A;  5AQ7 A;  5HAP A;  2Y2N A;  2IWD A;  4WEK A;  4GDB A;  3BRM A;  5G18 A;  2ZQC A;  1KGG A;  4FSF A;  4LV1 A;  3Q7Z A;  4YIN A;  2B5R A;  4GB7 A;  5EPH A;  1RGY A;  4IVK A;  5EOE A;  3QHY A;  4K91 A;  1L0F A;  4CPK A;  4PPR A;  2DRW A;  2HDQ A;  4PM7 A;  3O87 A;  3UDF A;  5CGX A;  4H8R A;  4GNU A;  1YLP A;  1L2S A;  4WBG A;  3PBS A;  2H0T A;  1K4E A;  5HX9 A;  4HBT A;  2WUQ A;  4JPM A;  3ZVT A;  2CC1 A;  2J9O A;  5M1A A;  2WGW A;  3G35 A;  3W4P A;  4FCF A;  5HAQ A;  3S1Y A;  2JC7 A;  3UPN A;  2HDS A;  3MZE A;  1GA9 A;  5IHV A;  1FCM A;  1MWT A;  1W5D A;  3C7U A;  3P98 A;  1MWR A;  5EVI C;  1YLJ A;  1M6K A;  1XGJ A;  4U3T A;  4S2M A;  3ZDJ A;  2VGK A;  4QD4 A;  1KGE A;  3G2Y A;  3IXB A;  4E3N A;  4S2O A;  3UPO A;  4P0M A;  3ZFZ A;  3QNC A;  4UHU A;  3FYZ A;  4X6T A;  5DF8 A;  5JYP A;  5F83 A;  2Y2Q A;  2WAE A;  3IXG A;  4R23 A;  4E6X A;  5JYO A;  1BLH A;  1O7E A;  2ZC4 B;  2OLV A;  3GVB A;  1JTD A;  3HLC A;  3UNW A;  1NZU A;  3N6I A;  2H0Y A;  4LCL A;  3Q1F A;  4OLG A;  3LY3 A;  2PU2 A;  4IVI A;  1GHI A;  4EUZ A;  1JTG A;  3I7J A;  3SH7 A;  2Y4A A;  4PM5 A;  4GDN A;  1PWG A;  5F82 A;  5HFO A;  4OH0 A;  3DWZ A;  1XXM A;  4N9K A;  4QY6 A;  2WKE A;  3HLW A;  3OC2 A;  3SS4 A;  2DCF A;  4M3K A;  1ERM A;  1XPB A;  2Y91 A;  1H8Y A;  1YLW A;  5M18 A;  4JBF A;  1RP5 A;  3ITA A;  4S2K A;  4C3Q A;  2Y2I A;  1IYQ A;  1ES4 A;  3FZC A;  2BG1 A;  3QNB A;  5E2E A;  5AQB A;  1K6R A;  2G2U A;  2ZC7 A;  1HD8 A;  2JCH A;  2P74 A;  3N8S A;  3OZH A;  1K56 D;  4MEZ A;  3ZG8 B;  3UY6 A;  1BTL A;  5U47 A;  3UE3 A;  5CHU A;  3SS5 A;  5CRF A;  4QJG A;  5CEB A;  4KZ3 A;  2J9P A;  5GLA A;  2EX8 A;  1BUL A;  4C75 A;  3C4P A;  4R3J A;  2DNS A;  4E3K A;  3WS5 A;  4Y0T A;  5FSR A;  1LI0 A;  1WYC A;  5KSH A;  4OLD A;  3MBZ A;  3N7W A;  1NZO A;  3HUN A;  4N9L A;  4IBR A;  2XF3 A;  3CG5 A;  3VFF A;  1GHM A;  3E2K A;  1E25 A;  3GR2 A;  2FFY A;  2WGI A;  3FKV A;  3G32 A;  1FCN A;  4OPR A;  1BSG A;  4RYE A;  4QY5 A;  5FAP A;  3ZNY A;  5EEC A;  3V5M A;  2HDR A;  3ZG0 A;  1MXO A;  4BL2 A;  4KQO A;  5FI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...