1ERQA

X-ray crystal structure of tem-1 beta lactamase in complex with a designed boronic acid inhibitor (1r)-1-acetamido-2-(3-carboxy-2-hydroxyphenyl)ethyl boronic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TEM-1 BETA-LACTAMASE
publication title Structure-based design guides the improved efficacy of deacylation transition state analogue inhibitors of TEM-1 beta-Lactamase(,).
pubmed doi rcsb
source organism Escherichia coli
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1erqA00
5A91A 2V1ZA 4IVKA 4K0WA 3OCNA 4OOLA 5FASA 4FCFA 5A93A 1LI0A 4UA6A 1PI5A 3WRTA 1BT5A 1M40A 4OPYA 3WS2A 5CHJA 5DF9A 3ZGAB 2X01A 4UAAA 3V3RA 4WM9A 1RGYA 4DDSA 4WMCA 5JYPA 1YT4A 4OPZA 3UE1A 2HP5A 4HEFA 1MBLA 2V2FF 3NBLA 5CTNA 2XFSA 2EFXA 4RX2A 3ZCZA 3FV7A 2ZLYA 3V39A 4NETA 4KENB 1ERQA 4PM5A 3CMZA 3IWQA 2XQZA 3LY4A 1XGIA 1ESIA 3AGEA 1K55C 4KG2A 4OKPA 2GDNA 4Y0UA 4PM6A 3WS5A 4PM7A 4JF5A 5KZHA 4P6BA 2Y2GA 3N7WA 3N8LA 2Y4AA 4KG6A 4ID4A 4S2PA 3ZNTA 4OPQA 1FR6A 1YLJA 1IEMA 3IH8A 5EPHA 3BFEA 5FATA 2X02A 1K4EA 3OPRA 5EVLA 2WAFA 4GD8A 4Y0OA 3GVBA 1Z6FA 2DRWA 3UDFA 1TEMA 3VFFA 4QY6A 5HAQA 5CXWA 1K25A 4OH0A 1XP4A 3M6BA 5FDHA 2Y2OA 5F83A 5AQ7A 1BLSA 3GRJA 4ZAMA 1PI4A 4WZ5A 2WZXA 2PU4A 1K54C 1BSGA 4DDYA 4Y7PA 1RGZA 1YLTA 3UY6A 4EBPA 4LV3A 2G2UA 3HUMA 3IF6C 4F94A 3UE3A 3V3SA 3HLWA 4R3JA 2ZC5B 2Q9NA 5DTSA 5HX9A 4MBFA 4NK3A 3D4FA 3UDXA 4B4XA 1JTGA 3FWLA 3M6HA 2EX6A 5E43A 5EVIC 3WS0A 4EQIA 4S2NA 1YLZA 5CERA 2H5SA 3ITAA 1KVLA 1XPBA 1MWRA 3A3EA 4S2MA 3SS5A 4S2JA 4K0XA 4JXVA 1C3BA 1N4OA 2QZ6A 2Y2MA 3GV9A 1M6KA 1KE3A 1KDSA 1WE4A 2EX2A 3NDGA 3ZVTA 4GOGA 3RXXA 1L2SA 5U47A 1AXBA 1BZAA 4KZ7A 4FSFA 5E2EA 5A92A 5KSCA 3G34A 2ZMAA 4LENA 1XKZA 5FQMA 4BENA 4E3MA 2OSUA 2Y2IA 4FH4A 1KVMA 1N9BA 1MWTA 2E8IA 3Q7ZA 3BYDA 4BD0A 3GTCA 3E2LA 1BULA 2XLNA 1ES3A 3FKWA 4ZJ2A 3CZDA 4BLMA 4OQIA 4CJNA 3BLMA 3SH9A 1CI8A 4QHCA 5FQJA 4R1GA 1IKIA 1E3UA 3BFCA 4RX3A 4N92A 3WWXA 1IELA 3PTEA 5I94A 3MXSA 3VMAA 1SDNA 1PWDA 2JE5A 3P09A 4H8RA 5AQAA 2WKIA 5FI7A 1NZUA 3LEZA 4KQQA 4HBTA 1DJAA 3MZFA 1VM1A 2Y59A 2XFTA 3QNCA 3IXHA 4L0LA 3C4OA 2ZQAA 4JXWA 4MLLA 4N9KA 4S2OA 3W4OA 5CGSA 5HW3A 1MY8A 3IQAA 3NDEA 4E3LA 2A49A 1PW1A 2EFUA 2Y55A 1PW8A 3FKVA 3HLCA 1E25A 3IWIA 2PBYA 5GHXA 3IF5A 3PAGA 3I7JA 4FH2A 2JBFA 4PMAA 2I72A 2Z2MB 4KQRA 2B5RA 4B4ZA 3BECA 5KMWA 3N6IA 4LCMA 1JVJA 3LCEA 3UDIA 2OLVA 4FD8A 2ZC4B 1W5DA 1ESUA 5M18A 2ZQ8A 5CEBA 1KGFA 2WGIA 1U60A 1BLPA 3UE0A 5G18A 2XEPA 4WEKA 3MKEA 5TR7A 3C7VA 3C5AA 2Y2NA 4P87A 3ITBA 1JWVA 4KZ4A 1HTZA 1IYPA 3PBOA 1CK3A 4CPKA 1WYCA 3BEBA 3HUNA 4XUXA 2EX9A 3A3DA 4KZ3A 1I2WA 1H8YA 5E2HA 4QB8A 3OZHA 1HVBA 2WGVA 1O7EA 2FFYA 3BFDA 3BLSA 3DWZA 3O86A 1GHPA 2UWXA 3O88A 4OOYA 5GL9A 1K56D 1NYYA 5CHUA 1W8QA 5TFQA 2DCFA 3OCLA 1KGEA 4OP8A 4WELA 3TOIA 2WKEA 1ZKJA 3S1YA 1NXYA 3VSLA 1CI9A 2P74A 3HUOA 3Q81A 3Q7VB 2IWBA 5M19A 4IBXA 1L0DA 4JXGA 1XA1A 3HLGA 4X53A 4DF6A 4WBGA 3Q7VA 1W7FA 1FCOA 1MWUA 2V20A 2Y2HA 1MWSA 4WZ5C 3AGFA 1LHYA 5FAPA 1ALQA 4HBUA 4KZ6A 5EVID 1ZG4A 3RXWA 4E3OA 2FFFB 3C7UA 5FAQA 3PBNA 4ZBEA 3A3FA 3MBZA 4N1HA 1MKIA 3HLDA 5AQ9A 2EXAA 3MZDA 2OV5A 3IHBA 3VP2A 4Q8IA 5FI2A 4OP5A 2J8YA 2Y2PA 1SKFA 4X55A 2OLUA 3VP4A 1L0EA 5A90A 4O7DA 5D3OA 4C6YA 3GSGA 4S2NC 1NY0A 3DW0A 4S2IA 1VQQA 4IEDA 3IT9A 2WZZA 4N9LA 1JWZA 1E4DA 5CGWA 1ES5A 2H10A 2Z2LB 1GA0A 2Y91A 3E2KA 4MNRA 4QY5A 2HDQA 1TVFA 1YMSA 1FSWA 1K57A 3P98A 4P85A 4XUZA 5L2FA 2ZQCA 5FSRA 1GHMA 5GLAA 4GD6A 3O87A 4R23A 3VP0A 2Y2KA 5HL1A 4X69A 1YLWA 1WYBA 3AGDA 4PPRA 3ZHHA 3W8KA 1O07A 1IYQA 1FQGA 4KZBA 2HDSA 2JC7A 5TGFA 2RCXA 1ZG6A 4KZAA 4JLFA 3SH7A 3G2ZA 4X56A 5BOHA 4DE0A 5J8XA 3A3IA 3ZNYA 1G68A 2BLSA 3OPHA 5F82A 2XDMA 5DF7A 3ZG8B 4EWFA 1EROA 3OPPA 3ZG5A 1JWPA 1DJCA 2BG1A 2HPBA 4QU3A 1SHVA 3CJMA 3N4IA 1XA7A 1K6RA 4OPRA 3S4XA 4BL3A 1XX2A 2ZQDA 4E3IA 2RL3A 4EUZA 5CHMA 3SOIA 5GLDA 1IYOA 3UPNA 4WYYA 4Z9QA 4WMCD 3HVFA 1J9MA 4N1XA 4ZJ1A 4U0TA 4E6XA 1YLPA 3ZG0A 3S22A 3C4PA 2ZC6B 1H8ZA 1KGGA 5CEDA 3LO7A 4LV1A 4KZ5A 3QHYA 4C3QA 4GDNA 5HAIA 1FOFA 3PBRA 4GZBA 1PIOA 2H0YA 3BFFA 3G30A 2VGKA 3TSGA 5IHVA 3V50A 3PBTA 3ZVWA 1IKGA 1L0FA 3SH8A 3HLFA 4YINA 2X71A 2CC1A 5EOEA 1YMXA 4MEZA 4YFMA 3OC2A 3MKFA 1PWCA 1PYYA 1SCWA 2ZQ7A 4DE3A 4OLGA 4GNUA 3QNBA 4HESA 4M3KA 4P0MA 4DE2A 4OQHA 4Y0TA 2WADA 3BFGA 3IHAA 2WYXA 2HP6A 5GLCA 4JXSA 2C5WB 4WZ4A 1KE4A 5EE8A 1IYSA 1KDWA 2ZD8A 2ZJ9A 3Q07A 5FQ9A 1PWGA 3NY4A 4GB7A 2XGNA 4ZJ3A 4R0QA 3WS1A 3O3VA 3CG5A 4IVIA 3ZDJA 5DF8A 3HREA 3JYIA 5JYOA 1K4FA 1JTDA 4MBKA 2ZM2A 2WGWB 5FI6A 1TDLA 2HP9A 5EUAA 3ISGA 2PU2A 3UNWA 4C75A 5AQBA 3MFDA 4DRTA 4E3KA 4E3JA 4GKUA 4EBLA 2WGWA 1TDGA 2QMIA 3N8RA 2R9XA 2VGJA 4KZ9A 3EQUA 5CRFA 4E3NA 1YQSA 2WAEA 2JCHA 2EX8A 1XXMA 2C6WB 4QD4A 2HDRA 3ZG7B 2XR0A 4JF4A 4UA7A 4GDBA 4BD1A 4BJPA 3NIAA 2IWDA 4PM9A 5GLBA 3IWOA 2H0TA 1HZOA 1NRFA 3SS3A 3V5MA 1S6RA 4MBHA 3GMWA 1PZOA 4BL2A 3DTMA 5GHZA 4DKIA 2XH9A 1NYMA 1EI5A 3PAEA 4R4SA 1W8YA 1K55A 3M2KA 3W4QA 1LI9A 1S0WA 3FZCA 4X68A 4R4RA 1LL5A 5DVAA 4D2OA 1RP5A 1FR1A 1ONHA 1GCEA 5DTTA 2G2WA 1XGJA 4S2KA 3MZEA 3Q1FA 5EOOA 4PM8A 4LCLA 3UN7A 3MXRA 3Q82A 3UO9A 4WEJA 4KZ8A 1YLYA 2DNSA 1L0GA 3W4PA 1Y54A 4OOMA 5E2FA 4DXBA 4JKTA 3G4PA 4JPMA 3B3XA 5HFOA 1NJ4A 3LY3A 5F1FA 3VOZA 1K38A 2Y2JA 2ZM8A 3BRMA 2Y2LA 1FSYA 1K57C 2WKHA 3G35A 3IXDA 4LV0A 3TG9A 4S2LA 2XD5A 4RYEA 5CGXA 1K56A 5E2GA 1G6AA 4RVAA 1E3UD 5EECA 3VP1A 1DY6A 3NCKA 3OPLA 1CEFA 5M1AA 3VFHA 1K54A 3WRZA 1EWZA 4R3BA 1ONGA 2XK1A 3IH9A 1YM1A 3IF6B 1QMFA 3IXGA 3IF6A 1SDEA 4OVDA 5HAPA 1NZOA 2ZC3B 2IWCA 2R9WA 5GHYA 4OQGA 4A5RA 5EVIB 4K91A 1RCJA 1Q2QA 4EV4A 1DJBA 3GQZA 4OLDA 1MPLA 3WS4A 1QMEA 5EVIA 4BQMA 3UPOA 4GN2A 5F1GA 3EQVA 4ZDXA 2XD1A 3PBQA 3ZG9B 1GHIA 3UPPA 3ZFZA 4B88A 3RJUA 1ES4A 1I5QA 2QPNA 1KE0A 3HLBA 1ZC2A 3HLEA 1GA9A 2EXBA 4IBRA 2WUQA 3HL9A 5FA7A 4DXCA 1CEGA 1BTLA 5DTKA 1HD8A 4U0XA 1OMEA 1I2SA 2P9VB 3N8SA 1BLCA 4X6TA 3NC8A 3VP3A 5FQIA 1MXOA 4QJGA 4UHUA 2P9VA 3NI9A 4EBNA 1BLHA 2A3UA 2J9OA 1W79A 2WK0A 1BUEA 1K6SA 2J7VA 2HDUA 3SS4A 4ZTKA 2Y2QA 5FAOA 2J9PA 4LV2A 3FYZA 4RA7A 1ES2A 3A3JA 5FQKA 3BM6A 4U3TA 1LL9A 1H5XA 1PZPA 4JBFA 4E6WA 3PBSA 5HARA 5CECA 4XXRA 4DE1A 3HBRA 3G31A 3IXBA 4KQOA 2ZM0A 4KG5A 4OQ0A 2Q9MA 1FCMA 2ZQ9A 2ZC7A 5CTMA 2XF3A 3DWKA 5KSHA 3G2YA 3VSKA 3G32A 1FCNA 4UA9A 4OONA 1Q2PA 3GR2A 4JF6A 3M2JA 1LLBA 1ERMA 3VOYA 5FQQA
chains in the Genus database with same CATH superfamily
2B02A 1T1CA 3LICA 1YSPA 4UA6A 3WRTA 1M40A 1PNEA 3MJQA 2X01A 4UAAA 1CQAA 1YT4A 4GS9A 1MBLA 2XFSA 4RX2A 3H82A 4NETA 4PM5A 3CMZA 4LFUA 1JNUA 3PHYA 1ESIA 2GDNA 4PM6A 3WS5A 4JF5A 3ULFA 3T12B 5TBMB 2Y8HA 2Y4AA 4KG6A 4S2PA 3ZNTA 3IH8A 5EPHA 2O9BA 5EVLA 3UB6A 1H0MA 2BASA 3VFFA 3S7QA 5FDHA 3KSFA 4HNBA 5CX7A 1BLSA 1BSGA 4Y7PA 1YLTA 1VHMA 4LV3A 1LSXA 3IF6C 3UE3A 4Y15A 5I5LA 3MMHA 2H5SA 4L9GA 2A24B 1XPBA 1MWRA 4S2MA 1S4SA 3SS5A 4HH3A 1M6KA 4GHIA 2VGLS 4FSFA 5E2EA 4NXBA 5EM1A 3Q7ZA 3BQ8A 3BYDA 3T1SA 1BULA 2XLNA 2V0UA 2PT7A 3D3OA 4MN5A 1XJ4A 3BLMA 3SH9A 1CI8A 5FQJA 3LR3A 4RX3A 3HCYA 3MXSA 2ZMFA 1PWDA 2JE5A 2WKIA 3LEZA 4KQQA 4HI4A 1VM1A 4S2OA 5AQAA 3IXHA 3VE4A 4FUWA 3W4OA 2XRNA 3DTIA 4E3LA 2EFUA 3HLCA 4NEED 1E25A 4NXEA 3KSGA 1FILA 2JBFA 2GZAA 2VA0A 2B5RA 5KMWA 1OJ5A 2OLVA 4HJ4A 1W5DA 3KX0X 5CEBA 1U60A 2M7VA 3C7VA 1F5MA 1UWNX 5HPIA 1LT0A 3PBOA 5L8MA 1WYCA 5E2HA 2EX9A 4QB8A 4BMWA 2JHEA 2O9AA 3BFDA 3R7WB 4OOYA 1K56D 5CHUA 1W8QA 3OCLA 4OP8A 4Y13A 1V9ZA 3VSLA 1NXYA 2DMWA 4IBXA 4WBGA 3Q7VA 2V0WA 5LBRA 2INWA 2WKPA 3QP5A 2Y2HA 3CPTA 2KOIA 3AGFA 4E3OA 4HBUA 3C7UA 1W63M 4O01A 3A3FA 3MBZA 4Q8IA 1D7EA 4D60A 3EEAA 2W1RA 2J8YA 1SKFA 3NJAA 5D3OA 4S2NC 3IT9A 3F1NA 4HH2A 3E98A 1JWZA 3C8CA 2JKTI 2QWSA 2Y91A 4MNRA 1TVFA 1K57A 4EEPA 5GLAA 1DRMA 1LSWA 1XFQA 4I39A 3LUQA 4Y2FA 4GW9A 4EERA 3EEHA 1ZG6A 4KZAA 3A3IA 3ZNYA 4HQAA 2VGLM 5F82A 5DF7A 3OPPA 3ZG5A 3U4LP 4R3AA 2XROA 3ZYTA 5IT5A 4QU3A 3CJMA 4OPRA 3N4IA 5GLDA 3UPNA 4WMCD 4NKPA 1YLPA 1KGGA 4KZ5A 4C3QA 1PRQA 1X0OA 2EWWA 2H0YA 3G30A 4WN5A 2VGKA 5IHVA 3LFVA 3PBTA 1IKGA 3KSIA 1TF1A 4YINA 5EOEA 4MEZA 4YFMA 3OC2A 3MKFA 1TS0A 1LL8A 2ZBBA 3C30A 5EVEA 4HESA 4GJ4A 4M3KA 4P0MA 4DE2A 4OQHA 4Y0TA 3BFGA 2WYXA 1IYSA 3GDIA 3O3VA 3CG5A 2HJEA 5DF8A 1S4RA 4UEYA 5EV0A 5JYOA 2ZL1B 4ME4A 2VLGA 3NOUC 5FI6A 5EUAA 2W3GA 3ISGA 4E3JA 2L4RA 4KZ9A 5IS1A 4CLCE 4E04A 2JCHA 4QD4A 2HDRA 2XR0A 4BJPA 2UV0E 2E8JA 1SKOA 5GLBA 1HZOA 1NRFA 3V5MA 2I9VA 4PKYA 4DKIA 1L3LA 5FEFA 3FZCA 1S0WA 4D2OA 1S1ZA 4M4XA 1PFLA 5DTTA 4ARZA 2P7JA 3MZEA 2FH5A 3Q1FA 2EA9A 1L0GA 5E2FA 4DXBA 4JPMA 4LPZA 2W1TA 3B3XA 1NJ4A 1CF0A 3VOZA 3BRMA 2Y2JA 2ZM8A 3TG9A 3G35A 4LV0A 2W3FA 4RYEA 5DFXA 4CLCA 2KDKA 3BQAA 4HOIA 1QMFA 2K7SA 5HSQA 4OVDA 4R6LA 4A5RA 1Q2QA 1DJBA 1QMEA 5EVIA 4ZDXA 3D72A 2XD1A 3B47A 4BWIA 1GHIA 1KOUA 4B88A 4YWZA 1I5QA 3HLBA 2QHKA 2EXBA 2OWHA 1CEGA 5DTKA 2P9VB 3N8SA 5FQIA 1MXOA 1BLHA 1BUEA 1K6SA 1T18A 3LYXA 4ZTKA 2Y2QA 3VV4A 5FAOA 4HIAA 1J3WA 4EESA 3A3JA 4YOFA 2EWVA 2JKTM 3PBSA 5CECA 4XXRA 3G31A 2ZM0A 5HD3A 4OQ0A 2XF3A 4MDZA 3G2YA 3VSKA 2R78A 3GR2A 4PAUA 5HDSA 5A91A 2V1ZA 2JKRI 4OOLA 5FASA 2PD7A 1LI0A 3V3RA 4WM9A 4Z1WA 4DDSA 3DAVA 2M7UA 1T1BA 4OPZA 3NBLA 4JGRA 2J3TD 2VV6A 3FV7A 4KENB 3AGEA 4F3LB 4PM7A 4P6BA 4CLCD 4OPQA 1FR6A 1YLJA 1IEMA 4O0PA 3BFEA 1K4EA 3OPRA 2GJ3A 2Y79A 4G3KA 2WAFA 4GD8A 4Y0OA 1Z6FA 5CXWA 5F69A 5AQ7A 2YKFA 4ZAMA 4WZ5A 3UMDA 4HJ6A 4ZRRA 3MFXA 3UY6A 3F1PA 1ACFA 2J3WA 4F94A 3DTKA 3F1NB 4R3JA 1MKMA 2ZC5B 4NK3A 3UDXA 4B4XA 3FWLA 2LB5A 5E43A 2AVXA 3QP1A 1YLZA 3ITAA 1KVLA 1TS7A 3A3EA 4X1LA 3E0YA 4JXVA 4WF0A 1N4OA 2Y2MA 3GV9A 1KE3A 4H6JB 3RXXA 5U47A 3CWFA 1BZAA 5KSCA 4LENA 5FQMA 4E3MA 1N9BA 1MWTA 3MR0A 1ODVA 3GTCA 3E2LA 1T1AA 4DN0A 5J4EA 3A0VA 4QHCA 4Y3IA 1E3UA 3BFCA 3ICYA 3WWXA 4N92A 4AFIA 3ZQ5A 1F98A 3P09A 2PR6A 1IFQA 3O5YA 4B93A 2V8FA 4L0LA 2XFTA 1N9LA 4XT2B 5HW3A 3IQAA 3CITA 2Z6DA 2A49A 4DJ3A 1PW1A 3FKVA 3IF5A 3PAGA 4FH2A 1YKDA 4PMAA 1OTAA 2I72A 3CUEA 2QJ7A 4KQRA 4LCMA 3UDIA 5M18A 3H7WB 1KGFA 4WLAA 3VOLA 4I3JA 5TR7A 1XJ2A 3ITBA 1JWVA 5DFYA 3HUNA 3A3DA 3OZHA 3DWZA 1VETA 3T4QA 1NYYA 3IX8A 2DCFA 4WELA 1CI9A 2IWBA 4JXGA 4DF6A 1Y28A 4LGWA 1W7FA 1MWUA 2W3DA 2V20A 1VEUB 1MZUA 1F9IA 4ZBEA 1MKIA 3HLDA 5AQ9A 3MZDA 4LRZE 4OP5A 2OLUA 4FTXA 5A90A 1WA9A 3BJNA 4C6YA 2JKRM 1BYWA 1NY0A 3GSGA 1VQQA 4N9LA 3QP8A 1E4DA 4O8GA 1ES5A 2Z2LB 2HDQA 3P98A 1FSWA 4XUZA 1GHMA 4R23A 2Y2KA 1WYBA 4PPRA 3W8KA 1O07A 2HDSA 4JLFA 3G2ZA 1YPRA 5BOHA 3OPHA 2P08A 3LGOA 2XDMA 3K3DA 2JKGA 2BG1A 1SHVA 5CHMA 5DJUA 4Z9QA 4KUOA 1J9MA 3K3CA 2PYRA 3ZG0A 3S22A 3C4PA 2ZC6B 3LO7A 3QP6A 5HAIA 4ETXA 2PDRA 2LB9A 3UE6A 3TSGA 1L0FA 2CC1A 3T1QB 1N9NA 2K2NA 3CLOA 1MC0A 2Z6CA 4EETB 1G5UA 1PWCA 2ZQ7A 4DE3A 4GNUA 3G6OA 2WADA 1OJGA 5GLCA 1KE4A 3TJZC 5F68A 1PWGA 3TRCA 2Q0OA 4IVIA 3JYIA 3P7NA 1K4FA 4BBTA 5FL3A 2WGWB 4C75A 2PU2A 5AQBA 3MFDA 4GKUA 4E3NA 2V1BA 4K08A 2WAEA 1XXMA 2C6WB 4JF4A 4GDBA 1YAXA 2IWDA 4PM9A 4Q0HA 5K5BA 3GMWA 2WKRA 4R4SA 1FR1A 4Y5FA 3UB9A 4PM8A 4LCLA 3UO9A 4WEJA 3S7PA 4OOMA 4KQDA 4MN6A 2GNXA 3G4PA 3TW8A 5HFOA 3LY3A 2HJ9C 3KYEA 3RTYA 3KYZA 1OPXA 5E2GA 4RVAA 1DY6A 4HY8A 3LR5A 1ONGA 2XK1A 1YM1A 3IF6A 3MS6A 3F1OA 2ZC3B 2IWCA 4EV4A 3GQZA 3NHQA 3EQVA 5J3WA 2QPNA 1ZC2A 2WUQA 4DXCA 1BTLA 1HD8A 1I2SA 3C2WA 4X6TA 3EOIA 4NG2A 3NI9A 4EBNA 2J9OA 1TS8A 1VB6A 1GSXA 2QKPA 4DMZA 5FQKA 4U3TA 2O0YA 1H5XA 1PZPA 4E6WA 3NULA 3HBRA 4I38A 1FCMA 2ZQ9A 5CTMA 4IHQA 1FCNA 4OONA 3V67A 4JF6A 3M2JA 1LLBA 3VOYA 4EXOA 1OTEA 3OCNA 3IS2A 4BBUA 4EEUA 1PI5A 3WS2A 1BT5A 4OPYA 5DF9A 3ZGAB 4GS9B 1P9WA 1RGYA 5JYPA 3CI6A 5TJJA 3B42A 3H82B 5CTNA 3V39A 4ESPA 1ERQA 4RQ9A 3LY4A 1K55C 4OKPA 1S67L 4Y0UA 2O9CA 3LIDA 2Y2GA 3GECA 2JN7A 2XSSA 3C38A 5TBMA 5FATA 1LSVA 4IUHA 1P97A 2DRWA 3UDFA 1TEMA 5HAQA 1K25A 1XP4A 2Y2OA 3NECA 2P04A 4NXFA 2WZXA 2PU4A 1K54C 3BWLA 3HUMA 4X1MA 3BY8A 5HZHA 4LRYC 3V3SA 5DTSA 2NUTC 3D4FA 1JTGA 3VE3A 3M6HA 3UB5P 3WS0A 4S2NA 5CERA 1UGUA 4WL9A 2JKFA 4S2JA 4GHIB 1KDSA 2EX2A 1SZVA 4GOGA 4KZ7A 3LEQA 5A92A 3UB7A 3EGXC 3L9KA 2ZMAA 1XKZA 2OSUA 4BD0A 3R4KA 1ES3A 1ZTUA 4ZJ2A 3CZDA 4OQIA 4CJNA 2GX5A 4R1GA 1IKIA 1W63Q 1SDNA 4H8RA 1NZUA 3MZFA 2Y59A 2O99A 2ZQAA 4N9KA 2Y55A 3H9WA 2G7UA 2PBYA 5GHXA 3TE8A 3KSHA 2YKHA 4B4ZA 3BECA 2NUPC 1JVJA 2WGIA 4G3VA 1BLPA 3UE0A 2XEPA 4WEKA 2PRFA 3C5AA 2Y2NA 3PYPA 4R70A 1IYPA 1CK3A 3BEBA 2CMNA 1I2WA 1H8YA 3RH8B 4EUVA 2WGVA 3O86A 3BLSA 2KX6A 5HD5A 3O88A 3MQ0A 3R7WA 1ZKJA 3Q7VB 2XA7S 2HGVA 3HUOA 5M19A 1L0DA 1XA1A 3HLGA 4X53A 1OTBA 2QJ5A 3CPTB 4X25A 1MWSA 1ALQA 4KZ6A 5EVID 3PBNA 3E4PA 1EW0A 3IHBA 3VP2A 5FI2A 3QP2A 4QWOA 3VP4A 1L0EA 3EGDC 4IEDA 1S66L 2W27A 2H10A 1GA0A 3E2KA 5L09A 2BTFP 1YMSA 4P85A 5L2FA 1G28A 2ZQCA 5FSRA 4Q0IA 1CJFA 4R38A 3VP0A 5HL1A 4X69A 2PYPA 5HDDA 3AGDA 1IYQA 3KO6A 1FQGA 2JC7A 3LIBA 5TGFA 2D01A 2RCXA 1D06A 5DJTA 4DE0A 5J8XA 1P9RA 2PAVP 3NOPC 5J7EA 1EROA 4UQIS 1DJCA 2HPBA 3MQOA 4E3IA 1XA7A 3S4XA 4BL3A 2ZQDA 3S7NA 3SOIA 5FEGA 5DKLA 3HVFA 5EM0A 4HP4A 4U0TA 4E6XA 1H8ZA 5CEDA 4WUJA 2VZWA 3PBRA 1PIOA 3V50A 2X71A 4PHTA 1YMXA 4NXGA 4JGPA 1PYYA 3A0SA 2WKQA 3S7OA 2PBDP 1AWIA 4WZ4A 2C5WB 2QYBA 5FQ9A 2XGNA 3ZDJA 3HREA 1JTDA 4MMNA 1TDLA 3UNWA 4E3KA 4LLOB 2ZL1A 4DJ2A 1TDGA 3N8RA 1YQSA 1D1JA 1SKOB 4UA7A 3IX3A 2H0TA 3SS3A 4MBHA 1PZOA 2ZMVA 4BL2A 3DTMA 5GHZA 2XH9A 3P01A 1W8YA 3M2KA 3W4QA 4R4RA 1LL5A 2XA7M 4ARZB 4KUKA 2G2WA 1OTDA 1XGJA 3Q82A 3BY9A 1N9OA 4KZ8A 2W1TB 3QP4A 1Y54A 4I3AA 4B9OA 2OAP1 1TD5A 2OWJA 5DKKA 1K38A 1FSYA 1K57C 2WKHA 2XD5A 4YNRA 5CGXA 4MN7A 1K56A 4CLCB 3VP1A 5EECA 1E3UD 3VFHA 3MQQA 1EWZA 3IXGA 1NZOA 3LR4A 2R9WA 3T4JA 5EVIB 4K91A 1NLZA 4OLDA 3UPOA 3EWKA 3PBQA 2KLIA 4II7A 3ZG9B 1ES4A 3NOTC 4ETZA 1GA9A 4IBRA 3HL9A 1IOUA 5FA7A 4U0XA 1OMEA 1BLCA 5HL6A 3HJKA 4UQIM 2IA2A 4UHUA 2P9VA 3OBFA 2A3UA 2VK3A 2VEAA 2B18A 2WK0A 2J7VA 5F6AA 3SS4A 3FYZA 1ES2A 3BM6A 1LL9A 4JBFA 3IXBA 3FG8A 3MF0A 1OTIA 3DWKA 5KSHA 3G32A 4UA9A 2OOLA 3K2NA 3FPWA 1ERMA 5EFWA 1STZA 5FQQA 4K0WA 2L1MA 2M1CA 4IVKA 2PR5A 4FOFA 4Y17A 4L9FA 4FCFA 5A93A 3D9YA 5CHJA 4MCWA 1H8MA 3FPVA 4WMCA 3UE1A 2HP5A 4HEFA 2V2FF 3UB8A 3MSHA 2EFXA 2W3HA 3ZCZA 2ZLYA 1H3QA 1NLYA 3IWQA 2XQZA 3W2ZA 1XGIA 3LIAA 4KG2A 3T1XA 5KZHA 4F3LA 3DBAA 3PXPA 3N7WA 3N8LA 4ID4A 2X02A 5HDCA 2J3TC 2V8CA 3GVBA 1DP6A 4QY6A 4OH0A 3M6BA 5F83A 3GRJA 1PI4A 3F1PB 4CLCC 4DDYA 1A0KA 5IU1A 1RGZA 4EBPA 1XJ3A 2G2UA 3HLWA 5HX9A 2Q9NA 4MBFA 2EX6A 4HJ3A 5EVIC 4EQIA 5L10A 3T4KA 4K0XA 5AJGA 1C3BA 3LR0A 2QZ6A 3T4LA 1WE4A 3ZVTA 3NDGA 3E4OA 1L2SA 4H6JA 1AXBA 1F2KA 3G34A 4BENA 2VKSA 2Y2IA 4I3IA 4FH4A 1KVMA 2FZ0A 2E8IA 3FKWA 4BLMA 3T1RA 1NWZA 3T50A 1IELA 3PTEA 5I94A 3VMAA 3T4OA 5KIZA 3UMEA 3LIFA 5FI7A 4HBTA 1DJAA 4MLLA 3QNCA 3C4OA 4JXWA 2OAQ1 1G6OA 5CGSA 1MY8A 2V1AA 4XT2A 3NDEA 2PD8A 3IWIA 1PW8A 3I7JA 3FC7A 1GSVA 2Z2MB 3N6IA 1OT9A 3LCEA 4FD8A 2ZOHA 2ZC4B 1V9YA 1ESUA 2ZQ8A 5HWTA 5G18A 3SW1A 3H7WA 3MKEA 4P87A 4KZ4A 1HTZA 4CPKA 4XUXA 4KZ3A 1VETB 3B33A 1HVBA 1O7EA 2ACGA 2FFYA 1GHPA 2UWXA 5GL9A 5HWVA 5TFQA 1KGEA 3TOIA 2WKEA 3S1YA 2P74A 3Q81A 1FCOA 3T4SA 1K0KA 4WZ5C 1LHYA 5FAPA 3RXWA 1ZG4A 2FFFB 2VJWA 5FAQA 1VEUA 4N1HA 2EXAA 2OV5A 2Y2PA 4BBVA 4X55A 4EU0A 4O7DA 3DW0A 4S2IA 3MXQA 2A2LA 2WZZA 3PR6A 4HP9A 3CHWP 5CGWA 2A24A 4P6ZS 1XFNA 4QY5A 5G4YA 4GD6A 3O87A 1YLWA 3LI8A 4EW7A 3ZHHA 4Q0JA 4HHDA 4KZBA 3SH7A 4X56A 4LRXC 2HV1A 2VV8A 1G68A 2BLSA 3E4QA 3RFBA 1DP9A 5L07A 3ZG8B 4EWFA 4CQHA 5C5KA 5AVEA 1JWPA 1K6RA 2HF6A 1XX2A 4L9EA 2H28A 2RL3A 4EUZA 1IYOA 5A8BA 4WYYA 2W0NA 4N1XA 4ZJ1A 5G4ZA 4EQ1A 4LV1A 3QHYA 4GDNA 4GLQA 1FOFA 4GZBA 3BFFA 3L7HA 3CUEC 2VV7A 3ZVWA 3SH8A 1Z09A 3HLFA 3JVVA 1DP8A 1SCWA 5HPFA 4OLGA 3U2AA 3QNBA 2V9AA 2K31A 3OLOA 5HWWA 3T4TA 3IHAA 2HP6A 2HZ5A 4JXSA 5EE8A 1Y4OA 1KDWA 2ZD8A 2ZJ9A 3Q07A 1HLUP 3NY4A 4GB7A 4ZJ3A 1FIKA 4GCZA 4R0QA 3WS1A 2W3EA 3HJIA 4MBKA 2ZOIA 2ZM2A 1YSQA 1T19A 2HP9A 1OT6A 4DRTA 4EBLA 3LIEA 2WGWA 2QMIA 2R9XA 2VGJA 5CRFA 3EQUA 2EX8A 2L0WA 3ZG7B 4BD1A 3NIAA 3IWOA 3LI9A 5F5YA 1S6RA 3A0RA 1NYMA 1EI5A 3PAEA 4G3WA 1K55A 1LI9A 4X68A 5DVAA 1RP5A 1ONHA 1GCEA 2MJ6A 4PKYG 3IX4A 4S2KA 5EOOA 3IBJA 3UN7A 3MXRA 1YLYA 2DNSA 3W4PA 4JGQA 4JKTA 5F1FA 4JGOA 1TS6A 2Y2LA 3IXDA 3KYQA 2B95A 4S2LA 1P0ZA 1NRJA 1G6AA 3NCKA 3OPLA 1CEFA 5M1AA 1K54A 3WRZA 4R3BA 3IH9A 3IF6B 3F1OB 1S1YA 1SDEA 5HAPA 3SZTA 5GHYA 4OQGA 5AVFA 1RCJA 4P6ZM 1MPLA 3WS4A 3IS2B 4BQMA 4GN2A 5F1GA 3ZFZA 3UPPA 2J80A 3RJUA 1KE0A 1ZHHB 3HLEA 1GSWA 3BW6A 1XJ6A 1UWPX 2VX8A 3NC8A 3VP3A 4QJGA 5FDSA 4I5SA 1W79A 2HDUA 4QPRA 2J9PA 4LV2A 4RA7A 3DTEA 5MC7A 4IJGA 5HARA 2D02A 4KQOA 4DE1A 3IBRA 2PHYA 4KG5A 3OOVA 2Q9MA 2ZC7A 3JVUA 3CAXA 4IUKA 1Q2PA 3JPUA
chains in the Genus database with same CATH topology
5A91A 2V1ZA 4IVKA 4K0WA 3OCNA 4OOLA 5FASA 4FCFA 5A93A 1LI0A 4UA6A 1PI5A 3WRTA 1BT5A 1M40A 4OPYA 3WS2A 5CHJA 5DF9A 3ZGAB 2X01A 4UAAA 3V3RA 4WM9A 1RGYA 4DDSA 4WMCA 5JYPA 1YT4A 4OPZA 3UE1A 2HP5A 4HEFA 1MBLA 2V2FF 3NBLA 5CTNA 2XFSA 2EFXA 4RX2A 3ZCZA 3FV7A 2ZLYA 3V39A 4NETA 4KENB 1ERQA 4PM5A 3CMZA 3IWQA 2XQZA 3LY4A 1XGIA 1ESIA 3AGEA 1K55C 4KG2A 4OKPA 2GDNA 4Y0UA 4PM6A 3WS5A 4PM7A 4JF5A 5KZHA 4P6BA 2Y2GA 3N7WA 3N8LA 2Y4AA 4KG6A 4ID4A 4S2PA 3ZNTA 4OPQA 1FR6A 1YLJA 1IEMA 3IH8A 5EPHA 3BFEA 5FATA 2X02A 1K4EA 3OPRA 5EVLA 2WAFA 4GD8A 4Y0OA 3GVBA 1Z6FA 2DRWA 3UDFA 1TEMA 3VFFA 4QY6A 5HAQA 5CXWA 1K25A 4OH0A 1XP4A 3M6BA 5FDHA 2Y2OA 5F83A 5AQ7A 1BLSA 3GRJA 4ZAMA 1PI4A 4WZ5A 2WZXA 2PU4A 1K54C 1BSGA 4DDYA 4Y7PA 1RGZA 1YLTA 3UY6A 4EBPA 4LV3A 2G2UA 3HUMA 3IF6C 4F94A 3UE3A 3V3SA 3HLWA 4R3JA 2ZC5B 2Q9NA 5DTSA 5HX9A 4MBFA 4NK3A 3D4FA 3UDXA 4B4XA 1JTGA 3FWLA 3M6HA 2EX6A 5E43A 5EVIC 3WS0A 4EQIA 4S2NA 1YLZA 5CERA 2H5SA 3ITAA 1KVLA 1XPBA 1MWRA 3A3EA 4S2MA 3SS5A 4S2JA 4K0XA 4JXVA 1C3BA 1N4OA 2QZ6A 2Y2MA 3GV9A 1M6KA 1KE3A 1KDSA 1WE4A 2EX2A 3NDGA 3ZVTA 4GOGA 3RXXA 1L2SA 5U47A 1AXBA 1BZAA 4KZ7A 4FSFA 5E2EA 5A92A 5KSCA 3G34A 2ZMAA 4LENA 1XKZA 5FQMA 4BENA 4E3MA 2OSUA 2Y2IA 4FH4A 1KVMA 1N9BA 1MWTA 2E8IA 3Q7ZA 3BYDA 4BD0A 3GTCA 3E2LA 1BULA 2XLNA 1ES3A 3FKWA 4ZJ2A 3CZDA 4BLMA 4OQIA 4CJNA 3BLMA 3SH9A 1CI8A 4QHCA 5FQJA 4R1GA 1IKIA 1E3UA 3BFCA 4RX3A 4N92A 3WWXA 1IELA 3PTEA 5I94A 3MXSA 3VMAA 1SDNA 1PWDA 2JE5A 3P09A 4H8RA 5AQAA 2WKIA 5FI7A 1NZUA 3LEZA 4KQQA 4HBTA 1DJAA 3MZFA 1VM1A 2Y59A 2XFTA 3QNCA 3IXHA 4L0LA 3C4OA 2ZQAA 4JXWA 4MLLA 4N9KA 4S2OA 3W4OA 5CGSA 5HW3A 1MY8A 3IQAA 3NDEA 4E3LA 2A49A 1PW1A 2EFUA 2Y55A 1PW8A 3FKVA 3HLCA 1E25A 3IWIA 2PBYA 5GHXA 3IF5A 3PAGA 3I7JA 4FH2A 2JBFA 4PMAA 2I72A 2Z2MB 4KQRA 2B5RA 4B4ZA 3BECA 5KMWA 3N6IA 4LCMA 1JVJA 3LCEA 3UDIA 2OLVA 4FD8A 2ZC4B 1W5DA 1ESUA 5M18A 2ZQ8A 5CEBA 1KGFA 2WGIA 1U60A 1BLPA 3UE0A 5G18A 2XEPA 4WEKA 3MKEA 5TR7A 3C7VA 3C5AA 2Y2NA 4P87A 3ITBA 1JWVA 4KZ4A 1HTZA 1IYPA 3PBOA 1CK3A 4CPKA 1WYCA 3BEBA 3HUNA 4XUXA 2EX9A 3A3DA 4KZ3A 1I2WA 1H8YA 5E2HA 4QB8A 3OZHA 1HVBA 2WGVA 1O7EA 2FFYA 3BFDA 3BLSA 3DWZA 3O86A 1GHPA 2UWXA 3O88A 4OOYA 5GL9A 1K56D 1NYYA 5CHUA 1W8QA 5TFQA 2DCFA 3OCLA 1KGEA 4OP8A 4WELA 3TOIA 2WKEA 1ZKJA 3S1YA 1NXYA 3VSLA 1CI9A 2P74A 3HUOA 3Q81A 3Q7VB 2IWBA 5M19A 4IBXA 1L0DA 4JXGA 1XA1A 3HLGA 4X53A 4DF6A 4WBGA 3Q7VA 1W7FA 1FCOA 1MWUA 2V20A 2Y2HA 1MWSA 4WZ5C 3AGFA 1LHYA 5FAPA 1ALQA 4HBUA 4KZ6A 5EVID 1ZG4A 3RXWA 4E3OA 2FFFB 3C7UA 5FAQA 3PBNA 4ZBEA 3A3FA 3MBZA 4N1HA 1MKIA 3HLDA 5AQ9A 2EXAA 3MZDA 2OV5A 3IHBA 3VP2A 4Q8IA 5FI2A 4OP5A 2J8YA 2Y2PA 1SKFA 4X55A 2OLUA 3VP4A 1L0EA 5A90A 4O7DA 5D3OA 4C6YA 3GSGA 4S2NC 1NY0A 3DW0A 4S2IA 1VQQA 4IEDA 3IT9A 2WZZA 4N9LA 1JWZA 1E4DA 5CGWA 1ES5A 2H10A 2Z2LB 1GA0A 2Y91A 3E2KA 4MNRA 4QY5A 2HDQA 1TVFA 1YMSA 1FSWA 1K57A 3P98A 4P85A 4XUZA 5L2FA 2ZQCA 5FSRA 1GHMA 5GLAA 4GD6A 3O87A 4R23A 3VP0A 2Y2KA 5HL1A 4X69A 1YLWA 1WYBA 3AGDA 4PPRA 3ZHHA 3W8KA 1O07A 1IYQA 1FQGA 4KZBA 2HDSA 2JC7A 5TGFA 2RCXA 1ZG6A 4KZAA 4JLFA 3SH7A 3G2ZA 4X56A 5BOHA 4DE0A 5J8XA 3A3IA 3ZNYA 1G68A 2BLSA 3OPHA 5F82A 2XDMA 5DF7A 3ZG8B 4EWFA 1EROA 3OPPA 3ZG5A 1JWPA 1DJCA 2BG1A 2HPBA 4QU3A 1SHVA 3CJMA 3N4IA 1XA7A 1K6RA 4OPRA 3S4XA 4BL3A 1XX2A 2ZQDA 4E3IA 2RL3A 4EUZA 5CHMA 3SOIA 5GLDA 1IYOA 3UPNA 4WYYA 4Z9QA 4WMCD 3HVFA 1J9MA 4N1XA 4ZJ1A 4U0TA 4E6XA 1YLPA 3ZG0A 3S22A 3C4PA 2ZC6B 1H8ZA 1KGGA 5CEDA 3LO7A 4LV1A 4KZ5A 3QHYA 4C3QA 4GDNA 5HAIA 1FOFA 3PBRA 4GZBA 1PIOA 2H0YA 3BFFA 3G30A 2VGKA 3TSGA 5IHVA 3V50A 3PBTA 3ZVWA 1IKGA 1L0FA 3SH8A 3HLFA 4YINA 2X71A 2CC1A 5EOEA 1YMXA 4MEZA 4YFMA 3OC2A 3MKFA 1PWCA 1PYYA 1SCWA 2ZQ7A 4DE3A 4OLGA 4GNUA 3QNBA 4HESA 4M3KA 4P0MA 4DE2A 4OQHA 4Y0TA 2WADA 3BFGA 3IHAA 2WYXA 2HP6A 5GLCA 4JXSA 2C5WB 4WZ4A 1KE4A 5EE8A 1IYSA 1KDWA 2ZD8A 2ZJ9A 3Q07A 5FQ9A 1PWGA 3NY4A 4GB7A 2XGNA 4ZJ3A 4R0QA 3WS1A 3O3VA 3CG5A 4IVIA 3ZDJA 5DF8A 3HREA 3JYIA 5JYOA 1K4FA 1JTDA 4MBKA 2ZM2A 2WGWB 5FI6A 1TDLA 2HP9A 5EUAA 3ISGA 2PU2A 3UNWA 4C75A 5AQBA 3MFDA 4DRTA 4E3KA 4E3JA 4GKUA 4EBLA 2WGWA 1TDGA 2QMIA 3N8RA 2R9XA 2VGJA 4KZ9A 3EQUA 5CRFA 4E3NA 1YQSA 2WAEA 2JCHA 2EX8A 1XXMA 2C6WB 4QD4A 2HDRA 3ZG7B 2XR0A 4JF4A 4UA7A 4GDBA 4BD1A 4BJPA 3NIAA 2IWDA 4PM9A 5GLBA 3IWOA 2H0TA 1HZOA 1NRFA 3SS3A 3V5MA 1S6RA 4MBHA 3GMWA 1PZOA 4BL2A 3DTMA 5GHZA 4DKIA 2XH9A 1NYMA 1EI5A 3PAEA 4R4SA 1W8YA 1K55A 3M2KA 3W4QA 1LI9A 1S0WA 3FZCA 4X68A 4R4RA 1LL5A 5DVAA 4D2OA 1RP5A 1FR1A 1ONHA 1GCEA 5DTTA 2G2WA 1XGJA 4S2KA 3MZEA 3Q1FA 5EOOA 4PM8A 4LCLA 3UN7A 3MXRA 3Q82A 3UO9A 4WEJA 4KZ8A 1YLYA 2DNSA 1L0GA 3W4PA 1Y54A 4OOMA 5E2FA 4DXBA 4JKTA 3G4PA 4JPMA 3B3XA 5HFOA 1NJ4A 3LY3A 5F1FA 3VOZA 1K38A 2Y2JA 2ZM8A 3BRMA 2Y2LA 1FSYA 1K57C 2WKHA 3G35A 3IXDA 4LV0A 3TG9A 4S2LA 2XD5A 4RYEA 5CGXA 1K56A 5E2GA 1G6AA 4RVAA 1E3UD 5EECA 3VP1A 1DY6A 3NCKA 3OPLA 1CEFA 5M1AA 3VFHA 1K54A 3WRZA 1EWZA 4R3BA 1ONGA 2XK1A 3IH9A 1YM1A 3IF6B 1QMFA 3IXGA 3IF6A 1SDEA 4OVDA 5HAPA 1NZOA 2ZC3B 2IWCA 2R9WA 5GHYA 4OQGA 4A5RA 5EVIB 4K91A 1RCJA 1Q2QA 4EV4A 1DJBA 3GQZA 4OLDA 1MPLA 3WS4A 1QMEA 5EVIA 4BQMA 3UPOA 4GN2A 5F1GA 3EQVA 4ZDXA 2XD1A 3PBQA 3ZG9B 1GHIA 3UPPA 3ZFZA 4B88A 3RJUA 1ES4A 1I5QA 2QPNA 1KE0A 3HLBA 1ZC2A 3HLEA 1GA9A 2EXBA 4IBRA 2WUQA 3HL9A 5FA7A 4DXCA 1CEGA 1BTLA 5DTKA 1HD8A 4U0XA 1OMEA 1I2SA 2P9VB 3N8SA 1BLCA 4X6TA 3NC8A 3VP3A 5FQIA 1MXOA 4QJGA 4UHUA 2P9VA 3NI9A 4EBNA 1BLHA 2A3UA 2J9OA 1W79A 2WK0A 1BUEA 1K6SA 2J7VA 2HDUA 3SS4A 4ZTKA 2Y2QA 5FAOA 2J9PA 4LV2A 3FYZA 4RA7A 1ES2A 3A3JA 5FQKA 3BM6A 4U3TA 1LL9A 1H5XA 1PZPA 4JBFA 4E6WA 3PBSA 5HARA 5CECA 4XXRA 4DE1A 3HBRA 3G31A 3IXBA 4KQOA 2ZM0A 4KG5A 4OQ0A 2Q9MA 1FCMA 2ZQ9A 2ZC7A 5CTMA 2XF3A 3DWKA 5KSHA 3G2YA 3VSKA 3G32A 1FCNA 4UA9A 4OONA 1Q2PA 3GR2A 4JF6A 3M2JA 1LLBA 1ERMA 3VOYA 5FQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A91 A;  2V1Z A;  4IVK A;  4K0W A;  3OCN A;  4OOL A;  5FAS A;  4FCF A;  5A93 A;  1LI0 A;  4UA6 A;  1PI5 A;  3WRT A;  1BT5 A;  1M40 A;  4OPY A;  3WS2 A;  5CHJ A;  5DF9 A;  3ZGA B;  2X01 A;  4UAA A;  3V3R A;  4WM9 A;  1RGY A;  4DDS A;  4WMC A;  5JYP A;  1YT4 A;  4OPZ A;  3UE1 A;  2HP5 A;  4HEF A;  1MBL A;  2V2F F;  3NBL A;  5CTN A;  2XFS A;  2EFX A;  4RX2 A;  3ZCZ A;  3FV7 A;  2ZLY A;  3V39 A;  4NET A;  4KEN B;  1ERQ A;  4PM5 A;  3CMZ A;  3IWQ A;  2XQZ A;  3LY4 A;  1XGI A;  1ESI A;  3AGE A;  1K55 C;  4KG2 A;  4OKP A;  2GDN A;  4Y0U A;  4PM6 A;  3WS5 A;  4PM7 A;  4JF5 A;  5KZH A;  4P6B A;  2Y2G A;  3N7W A;  3N8L A;  2Y4A A;  4KG6 A;  4ID4 A;  4S2P A;  3ZNT A;  4OPQ A;  1FR6 A;  1YLJ A;  1IEM A;  3IH8 A;  5EPH A;  3BFE A;  5FAT A;  2X02 A;  1K4E A;  3OPR A;  5EVL A;  2WAF A;  4GD8 A;  4Y0O A;  3GVB A;  1Z6F A;  2DRW A;  3UDF A;  1TEM A;  3VFF A;  4QY6 A;  5HAQ A;  5CXW A;  1K25 A;  4OH0 A;  1XP4 A;  3M6B A;  5FDH A;  2Y2O A;  5F83 A;  5AQ7 A;  1BLS A;  3GRJ A;  4ZAM A;  1PI4 A;  4WZ5 A;  2WZX A;  2PU4 A;  1K54 C;  1BSG A;  4DDY A;  4Y7P A;  1RGZ A;  1YLT A;  3UY6 A;  4EBP A;  4LV3 A;  2G2U A;  3HUM A;  3IF6 C;  4F94 A;  3UE3 A;  3V3S A;  3HLW A;  4R3J A;  2ZC5 B;  2Q9N A;  5DTS A;  5HX9 A;  4MBF A;  4NK3 A;  3D4F A;  3UDX A;  4B4X A;  1JTG A;  3FWL A;  3M6H A;  2EX6 A;  5E43 A;  5EVI C;  3WS0 A;  4EQI A;  4S2N A;  1YLZ A;  5CER A;  2H5S A;  3ITA A;  1KVL A;  1XPB A;  1MWR A;  3A3E A;  4S2M A;  3SS5 A;  4S2J A;  4K0X A;  4JXV A;  1C3B A;  1N4O A;  2QZ6 A;  2Y2M A;  3GV9 A;  1M6K A;  1KE3 A;  1KDS A;  1WE4 A;  2EX2 A;  3NDG A;  3ZVT A;  4GOG A;  3RXX A;  1L2S A;  5U47 A;  1AXB A;  1BZA A;  4KZ7 A;  4FSF A;  5E2E A;  5A92 A;  5KSC A;  3G34 A;  2ZMA A;  4LEN A;  1XKZ A;  5FQM A;  4BEN A;  4E3M A;  2OSU A;  2Y2I A;  4FH4 A;  1KVM A;  1N9B A;  1MWT A;  2E8I A;  3Q7Z A;  3BYD A;  4BD0 A;  3GTC A;  3E2L A;  1BUL A;  2XLN A;  1ES3 A;  3FKW A;  4ZJ2 A;  3CZD A;  4BLM A;  4OQI A;  4CJN A;  3BLM A;  3SH9 A;  1CI8 A;  4QHC A;  5FQJ A;  4R1G A;  1IKI A;  1E3U A;  3BFC A;  4RX3 A;  4N92 A;  3WWX A;  1IEL A;  3PTE A;  5I94 A;  3MXS A;  3VMA A;  1SDN A;  1PWD A;  2JE5 A;  3P09 A;  4H8R A;  5AQA A;  2WKI A;  5FI7 A;  1NZU A;  3LEZ A;  4KQQ A;  4HBT A;  1DJA A;  3MZF A;  1VM1 A;  2Y59 A;  2XFT A;  3QNC A;  3IXH A;  4L0L A;  3C4O A;  2ZQA A;  4JXW A;  4MLL A;  4N9K A;  4S2O A;  3W4O A;  5CGS A;  5HW3 A;  1MY8 A;  3IQA A;  3NDE A;  4E3L A;  2A49 A;  1PW1 A;  2EFU A;  2Y55 A;  1PW8 A;  3FKV A;  3HLC A;  1E25 A;  3IWI A;  2PBY A;  5GHX A;  3IF5 A;  3PAG A;  3I7J A;  4FH2 A;  2JBF A;  4PMA A;  2I72 A;  2Z2M B;  4KQR A;  2B5R A;  4B4Z A;  3BEC A;  5KMW A;  3N6I A;  4LCM A;  1JVJ A;  3LCE A;  3UDI A;  2OLV A;  4FD8 A;  2ZC4 B;  1W5D A;  1ESU A;  5M18 A;  2ZQ8 A;  5CEB A;  1KGF A;  2WGI A;  1U60 A;  1BLP A;  3UE0 A;  5G18 A;  2XEP A;  4WEK A;  3MKE A;  5TR7 A;  3C7V A;  3C5A A;  2Y2N A;  4P87 A;  3ITB A;  1JWV A;  4KZ4 A;  1HTZ A;  1IYP A;  3PBO A;  1CK3 A;  4CPK A;  1WYC A;  3BEB A;  3HUN A;  4XUX A;  2EX9 A;  3A3D A;  4KZ3 A;  1I2W A;  1H8Y A;  5E2H A;  4QB8 A;  3OZH A;  1HVB A;  2WGV A;  1O7E A;  2FFY A;  3BFD A;  3BLS A;  3DWZ A;  3O86 A;  1GHP A;  2UWX A;  3O88 A;  4OOY A;  5GL9 A;  1K56 D;  1NYY A;  5CHU A;  1W8Q A;  5TFQ A;  2DCF A;  3OCL A;  1KGE A;  4OP8 A;  4WEL A;  3TOI A;  2WKE A;  1ZKJ A;  3S1Y A;  1NXY A;  3VSL A;  1CI9 A;  2P74 A;  3HUO A;  3Q81 A;  3Q7V B;  2IWB A;  5M19 A;  4IBX A;  1L0D A;  4JXG A;  1XA1 A;  3HLG A;  4X53 A;  4DF6 A;  4WBG A;  3Q7V A;  1W7F A;  1FCO A;  1MWU A;  2V20 A;  2Y2H A;  1MWS A;  4WZ5 C;  3AGF A;  1LHY A;  5FAP A;  1ALQ A;  4HBU A;  4KZ6 A;  5EVI D;  1ZG4 A;  3RXW A;  4E3O A;  2FFF B;  3C7U A;  5FAQ A;  3PBN A;  4ZBE A;  3A3F A;  3MBZ A;  4N1H A;  1MKI A;  3HLD A;  5AQ9 A;  2EXA A;  3MZD A;  2OV5 A;  3IHB A;  3VP2 A;  4Q8I A;  5FI2 A;  4OP5 A;  2J8Y A;  2Y2P A;  1SKF A;  4X55 A;  2OLU A;  3VP4 A;  1L0E A;  5A90 A;  4O7D A;  5D3O A;  4C6Y A;  3GSG A;  4S2N C;  1NY0 A;  3DW0 A;  4S2I A;  1VQQ A;  4IED A;  3IT9 A;  2WZZ A;  4N9L A;  1JWZ A;  1E4D A;  5CGW A;  1ES5 A;  2H10 A;  2Z2L B;  1GA0 A;  2Y91 A;  3E2K A;  4MNR A;  4QY5 A;  2HDQ A;  1TVF A;  1YMS A;  1FSW A;  1K57 A;  3P98 A;  4P85 A;  4XUZ A;  5L2F A;  2ZQC A;  5FSR A;  1GHM A;  5GLA A;  4GD6 A;  3O87 A;  4R23 A;  3VP0 A;  2Y2K A;  5HL1 A;  4X69 A;  1YLW A;  1WYB A;  3AGD A;  4PPR A;  3ZHH A;  3W8K A;  1O07 A;  1IYQ A;  1FQG A;  4KZB A;  2HDS A;  2JC7 A;  5TGF A;  2RCX A;  1ZG6 A;  4KZA A;  4JLF A;  3SH7 A;  3G2Z A;  4X56 A;  5BOH A;  4DE0 A;  5J8X A;  3A3I A;  3ZNY A;  1G68 A;  2BLS A;  3OPH A;  5F82 A;  2XDM A;  5DF7 A;  3ZG8 B;  4EWF A;  1ERO A;  3OPP A;  3ZG5 A;  1JWP A;  1DJC A;  2BG1 A;  2HPB A;  4QU3 A;  1SHV A;  3CJM A;  3N4I A;  1XA7 A;  1K6R A;  4OPR A;  3S4X A;  4BL3 A;  1XX2 A;  2ZQD A;  4E3I A;  2RL3 A;  4EUZ A;  5CHM A;  3SOI A;  5GLD A;  1IYO A;  3UPN A;  4WYY A;  4Z9Q A;  4WMC D;  3HVF A;  1J9M A;  4N1X A;  4ZJ1 A;  4U0T A;  4E6X A;  1YLP A;  3ZG0 A;  3S22 A;  3C4P A;  2ZC6 B;  1H8Z A;  1KGG A;  5CED A;  3LO7 A;  4LV1 A;  4KZ5 A;  3QHY A;  4C3Q A;  4GDN A;  5HAI A;  1FOF A;  3PBR A;  4GZB A;  1PIO A;  2H0Y A;  3BFF A;  3G30 A;  2VGK A;  3TSG A;  5IHV A;  3V50 A;  3PBT A;  3ZVW A;  1IKG A;  1L0F A;  3SH8 A;  3HLF A;  4YIN A;  2X71 A;  2CC1 A;  5EOE A;  1YMX A;  4MEZ A;  4YFM A;  3OC2 A;  3MKF A;  1PWC A;  1PYY A;  1SCW A;  2ZQ7 A;  4DE3 A;  4OLG A;  4GNU A;  3QNB A;  4HES A;  4M3K A;  4P0M A;  4DE2 A;  4OQH A;  4Y0T A;  2WAD A;  3BFG A;  3IHA A;  2WYX A;  2HP6 A;  5GLC A;  4JXS A;  2C5W B;  4WZ4 A;  1KE4 A;  5EE8 A;  1IYS A;  1KDW A;  2ZD8 A;  2ZJ9 A;  3Q07 A;  5FQ9 A;  1PWG A;  3NY4 A;  4GB7 A;  2XGN A;  4ZJ3 A;  4R0Q A;  3WS1 A;  3O3V A;  3CG5 A;  4IVI A;  3ZDJ A;  5DF8 A;  3HRE A;  3JYI A;  5JYO A;  1K4F A;  1JTD A;  4MBK A;  2ZM2 A;  2WGW B;  5FI6 A;  1TDL A;  2HP9 A;  5EUA A;  3ISG A;  2PU2 A;  3UNW A;  4C75 A;  5AQB A;  3MFD A;  4DRT A;  4E3K A;  4E3J A;  4GKU A;  4EBL A;  2WGW A;  1TDG A;  2QMI A;  3N8R A;  2R9X A;  2VGJ A;  4KZ9 A;  3EQU A;  5CRF A;  4E3N A;  1YQS A;  2WAE A;  2JCH A;  2EX8 A;  1XXM A;  2C6W B;  4QD4 A;  2HDR A;  3ZG7 B;  2XR0 A;  4JF4 A;  4UA7 A;  4GDB A;  4BD1 A;  4BJP A;  3NIA A;  2IWD A;  4PM9 A;  5GLB A;  3IWO A;  2H0T A;  1HZO A;  1NRF A;  3SS3 A;  3V5M A;  1S6R A;  4MBH A;  3GMW A;  1PZO A;  4BL2 A;  3DTM A;  5GHZ A;  4DKI A;  2XH9 A;  1NYM A;  1EI5 A;  3PAE A;  4R4S A;  1W8Y A;  1K55 A;  3M2K A;  3W4Q A;  1LI9 A;  1S0W A;  3FZC A;  4X68 A;  4R4R A;  1LL5 A;  5DVA A;  4D2O A;  1RP5 A;  1FR1 A;  1ONH A;  1GCE A;  5DTT A;  2G2W A;  1XGJ A;  4S2K A;  3MZE A;  3Q1F A;  5EOO A;  4PM8 A;  4LCL A;  3UN7 A;  3MXR A;  3Q82 A;  3UO9 A;  4WEJ A;  4KZ8 A;  1YLY A;  2DNS A;  1L0G A;  3W4P A;  1Y54 A;  4OOM A;  5E2F A;  4DXB A;  4JKT A;  3G4P A;  4JPM A;  3B3X A;  5HFO A;  1NJ4 A;  3LY3 A;  5F1F A;  3VOZ A;  1K38 A;  2Y2J A;  2ZM8 A;  3BRM A;  2Y2L A;  1FSY A;  1K57 C;  2WKH A;  3G35 A;  3IXD A;  4LV0 A;  3TG9 A;  4S2L A;  2XD5 A;  4RYE A;  5CGX A;  1K56 A;  5E2G A;  1G6A A;  4RVA A;  1E3U D;  5EEC A;  3VP1 A;  1DY6 A;  3NCK A;  3OPL A;  1CEF A;  5M1A A;  3VFH A;  1K54 A;  3WRZ A;  1EWZ A;  4R3B A;  1ONG A;  2XK1 A;  3IH9 A;  1YM1 A;  3IF6 B;  1QMF A;  3IXG A;  3IF6 A;  1SDE A;  4OVD A;  5HAP A;  1NZO A;  2ZC3 B;  2IWC A;  2R9W A;  5GHY A;  4OQG A;  4A5R A;  5EVI B;  4K91 A;  1RCJ A;  1Q2Q A;  4EV4 A;  1DJB A;  3GQZ A;  4OLD A;  1MPL A;  3WS4 A;  1QME A;  5EVI A;  4BQM A;  3UPO A;  4GN2 A;  5F1G A;  3EQV A;  4ZDX A;  2XD1 A;  3PBQ A;  3ZG9 B;  1GHI A;  3UPP A;  3ZFZ A;  4B88 A;  3RJU A;  1ES4 A;  1I5Q A;  2QPN A;  1KE0 A;  3HLB A;  1ZC2 A;  3HLE A;  1GA9 A;  2EXB A;  4IBR A;  2WUQ A;  3HL9 A;  5FA7 A;  4DXC A;  1CEG A;  1BTL A;  5DTK A;  1HD8 A;  4U0X A;  1OME A;  1I2S A;  2P9V B;  3N8S A;  1BLC A;  4X6T A;  3NC8 A;  3VP3 A;  5FQI A;  1MXO A;  4QJG A;  4UHU A;  2P9V A;  3NI9 A;  4EBN A;  1BLH A;  2A3U A;  2J9O A;  1W79 A;  2WK0 A;  1BUE A;  1K6S A;  2J7V A;  2HDU A;  3SS4 A;  4ZTK A;  2Y2Q A;  5FAO A;  2J9P A;  4LV2 A;  3FYZ A;  4RA7 A;  1ES2 A;  3A3J A;  5FQK A;  3BM6 A;  4U3T A;  1LL9 A;  1H5X A;  1PZP A;  4JBF A;  4E6W A;  3PBS A;  5HAR A;  5CEC A;  4XXR A;  4DE1 A;  3HBR A;  3G31 A;  3IXB A;  4KQO A;  2ZM0 A;  4KG5 A;  4OQ0 A;  2Q9M A;  1FCM A;  2ZQ9 A;  2ZC7 A;  5CTM A;  2XF3 A;  3DWK A;  5KSH A;  3G2Y A;  3VSK A;  3G32 A;  1FCN A;  4UA9 A;  4OON A;  1Q2P A;  3GR2 A;  4JF6 A;  3M2J A;  1LLB A;  1ERM A;  3VOY A;  5FQQ A; 
#chains in the Genus database with same CATH topology
 2B02 A;  1T1C A;  3LIC A;  1YSP A;  4UA6 A;  3WRT A;  1M40 A;  1PNE A;  3MJQ A;  2X01 A;  4UAA A;  1CQA A;  1YT4 A;  4GS9 A;  1MBL A;  2XFS A;  4RX2 A;  3H82 A;  4NET A;  4PM5 A;  3CMZ A;  4LFU A;  1JNU A;  3PHY A;  1ESI A;  2GDN A;  4PM6 A;  3WS5 A;  4JF5 A;  3ULF A;  3T12 B;  5TBM B;  2Y8H A;  2Y4A A;  4KG6 A;  4S2P A;  3ZNT A;  3IH8 A;  5EPH A;  2O9B A;  5EVL A;  3UB6 A;  1H0M A;  2BAS A;  3VFF A;  3S7Q A;  5FDH A;  3KSF A;  4HNB A;  5CX7 A;  1BLS A;  1BSG A;  4Y7P A;  1YLT A;  1VHM A;  4LV3 A;  1LSX A;  3IF6 C;  3UE3 A;  4Y15 A;  5I5L A;  3MMH A;  2H5S A;  4L9G A;  2A24 B;  1XPB A;  1MWR A;  4S2M A;  1S4S A;  3SS5 A;  4HH3 A;  1M6K A;  4GHI A;  2VGL S;  4FSF A;  5E2E A;  4NXB A;  5EM1 A;  3Q7Z A;  3BQ8 A;  3BYD A;  3T1S A;  1BUL A;  2XLN A;  2V0U A;  2PT7 A;  3D3O A;  4MN5 A;  1XJ4 A;  3BLM A;  3SH9 A;  1CI8 A;  5FQJ A;  3LR3 A;  4RX3 A;  3HCY A;  3MXS A;  2ZMF A;  1PWD A;  2JE5 A;  2WKI A;  3LEZ A;  4KQQ A;  4HI4 A;  1VM1 A;  4S2O A;  5AQA A;  3IXH A;  3VE4 A;  4FUW A;  3W4O A;  2XRN A;  3DTI A;  4E3L A;  2EFU A;  3HLC A;  4NEE D;  1E25 A;  4NXE A;  3KSG A;  1FIL A;  2JBF A;  2GZA A;  2VA0 A;  2B5R A;  5KMW A;  1OJ5 A;  2OLV A;  4HJ4 A;  1W5D A;  3KX0 X;  5CEB A;  1U60 A;  2M7V A;  3C7V A;  1F5M A;  1UWN X;  5HPI A;  1LT0 A;  3PBO A;  5L8M A;  1WYC A;  5E2H A;  2EX9 A;  4QB8 A;  4BMW A;  2JHE A;  2O9A A;  3BFD A;  3R7W B;  4OOY A;  1K56 D;  5CHU A;  1W8Q A;  3OCL A;  4OP8 A;  4Y13 A;  1V9Z A;  3VSL A;  1NXY A;  2DMW A;  4IBX A;  4WBG A;  3Q7V A;  2V0W A;  5LBR A;  2INW A;  2WKP A;  3QP5 A;  2Y2H A;  3CPT A;  2KOI A;  3AGF A;  4E3O A;  4HBU A;  3C7U A;  1W63 M;  4O01 A;  3A3F A;  3MBZ A;  4Q8I A;  1D7E A;  4D60 A;  3EEA A;  2W1R A;  2J8Y A;  1SKF A;  3NJA A;  5D3O A;  4S2N C;  3IT9 A;  3F1N A;  4HH2 A;  3E98 A;  1JWZ A;  3C8C A;  2JKT I;  2QWS A;  2Y91 A;  4MNR A;  1TVF A;  1K57 A;  4EEP A;  5GLA A;  1DRM A;  1LSW A;  1XFQ A;  4I39 A;  3LUQ A;  4Y2F A;  4GW9 A;  4EER A;  3EEH A;  1ZG6 A;  4KZA A;  3A3I A;  3ZNY A;  4HQA A;  2VGL M;  5F82 A;  5DF7 A;  3OPP A;  3ZG5 A;  3U4L P;  4R3A A;  2XRO A;  3ZYT A;  5IT5 A;  4QU3 A;  3CJM A;  4OPR A;  3N4I A;  5GLD A;  3UPN A;  4WMC D;  4NKP A;  1YLP A;  1KGG A;  4KZ5 A;  4C3Q A;  1PRQ A;  1X0O A;  2EWW A;  2H0Y A;  3G30 A;  4WN5 A;  2VGK A;  5IHV A;  3LFV A;  3PBT A;  1IKG A;  3KSI A;  1TF1 A;  4YIN A;  5EOE A;  4MEZ A;  4YFM A;  3OC2 A;  3MKF A;  1TS0 A;  1LL8 A;  2ZBB A;  3C30 A;  5EVE A;  4HES A;  4GJ4 A;  4M3K A;  4P0M A;  4DE2 A;  4OQH A;  4Y0T A;  3BFG A;  2WYX A;  1IYS A;  3GDI A;  3O3V A;  3CG5 A;  2HJE A;  5DF8 A;  1S4R A;  4UEY A;  5EV0 A;  5JYO A;  2ZL1 B;  4ME4 A;  2VLG A;  3NOU C;  5FI6 A;  5EUA A;  2W3G A;  3ISG A;  4E3J A;  2L4R A;  4KZ9 A;  5IS1 A;  4CLC E;  4E04 A;  2JCH A;  4QD4 A;  2HDR A;  2XR0 A;  4BJP A;  2UV0 E;  2E8J A;  1SKO A;  5GLB A;  1HZO A;  1NRF A;  3V5M A;  2I9V A;  4PKY A;  4DKI A;  1L3L A;  5FEF A;  3FZC A;  1S0W A;  4D2O A;  1S1Z A;  4M4X A;  1PFL A;  5DTT A;  4ARZ A;  2P7J A;  3MZE A;  2FH5 A;  3Q1F A;  2EA9 A;  1L0G A;  5E2F A;  4DXB A;  4JPM A;  4LPZ A;  2W1T A;  3B3X A;  1NJ4 A;  1CF0 A;  3VOZ A;  3BRM A;  2Y2J A;  2ZM8 A;  3TG9 A;  3G35 A;  4LV0 A;  2W3F A;  4RYE A;  5DFX A;  4CLC A;  2KDK A;  3BQA A;  4HOI A;  1QMF A;  2K7S A;  5HSQ A;  4OVD A;  4R6L A;  4A5R A;  1Q2Q A;  1DJB A;  1QME A;  5EVI A;  4ZDX A;  3D72 A;  2XD1 A;  3B47 A;  4BWI A;  1GHI A;  1KOU A;  4B88 A;  4YWZ A;  1I5Q A;  3HLB A;  2QHK A;  2EXB A;  2OWH A;  1CEG A;  5DTK A;  2P9V B;  3N8S A;  5FQI A;  1MXO A;  1BLH A;  1BUE A;  1K6S A;  1T18 A;  3LYX A;  4ZTK A;  2Y2Q A;  3VV4 A;  5FAO A;  4HIA A;  1J3W A;  4EES A;  3A3J A;  4YOF A;  2EWV A;  2JKT M;  3PBS A;  5CEC A;  4XXR A;  3G31 A;  2ZM0 A;  5HD3 A;  4OQ0 A;  2XF3 A;  4MDZ A;  3G2Y A;  3VSK A;  2R78 A;  3GR2 A;  4PAU A;  5HDS A;  5A91 A;  2V1Z A;  2JKR I;  4OOL A;  5FAS A;  2PD7 A;  1LI0 A;  3V3R A;  4WM9 A;  4Z1W A;  4DDS A;  3DAV A;  2M7U A;  1T1B A;  4OPZ A;  3NBL A;  4JGR A;  2J3T D;  2VV6 A;  3FV7 A;  4KEN B;  3AGE A;  4F3L B;  4PM7 A;  4P6B A;  4CLC D;  4OPQ A;  1FR6 A;  1YLJ A;  1IEM A;  4O0P A;  3BFE A;  1K4E A;  3OPR A;  2GJ3 A;  2Y79 A;  4G3K A;  2WAF A;  4GD8 A;  4Y0O A;  1Z6F A;  5CXW A;  5F69 A;  5AQ7 A;  2YKF A;  4ZAM A;  4WZ5 A;  3UMD A;  4HJ6 A;  4ZRR A;  3MFX A;  3UY6 A;  3F1P A;  1ACF A;  2J3W A;  4F94 A;  3DTK A;  3F1N B;  4R3J A;  1MKM A;  2ZC5 B;  4NK3 A;  3UDX A;  4B4X A;  3FWL A;  2LB5 A;  5E43 A;  2AVX A;  3QP1 A;  1YLZ A;  3ITA A;  1KVL A;  1TS7 A;  3A3E A;  4X1L A;  3E0Y A;  4JXV A;  4WF0 A;  1N4O A;  2Y2M A;  3GV9 A;  1KE3 A;  4H6J B;  3RXX A;  5U47 A;  3CWF A;  1BZA A;  5KSC A;  4LEN A;  5FQM A;  4E3M A;  1N9B A;  1MWT A;  3MR0 A;  1ODV A;  3GTC A;  3E2L A;  1T1A A;  4DN0 A;  5J4E A;  3A0V A;  4QHC A;  4Y3I A;  1E3U A;  3BFC A;  3ICY A;  3WWX A;  4N92 A;  4AFI A;  3ZQ5 A;  1F98 A;  3P09 A;  2PR6 A;  1IFQ A;  3O5Y A;  4B93 A;  2V8F A;  4L0L A;  2XFT A;  1N9L A;  4XT2 B;  5HW3 A;  3IQA A;  3CIT A;  2Z6D A;  2A49 A;  4DJ3 A;  1PW1 A;  3FKV A;  3IF5 A;  3PAG A;  4FH2 A;  1YKD A;  4PMA A;  1OTA A;  2I72 A;  3CUE A;  2QJ7 A;  4KQR A;  4LCM A;  3UDI A;  5M18 A;  3H7W B;  1KGF A;  4WLA A;  3VOL A;  4I3J A;  5TR7 A;  1XJ2 A;  3ITB A;  1JWV A;  5DFY A;  3HUN A;  3A3D A;  3OZH A;  3DWZ A;  1VET A;  3T4Q A;  1NYY A;  3IX8 A;  2DCF A;  4WEL A;  1CI9 A;  2IWB A;  4JXG A;  4DF6 A;  1Y28 A;  4LGW A;  1W7F A;  1MWU A;  2W3D A;  2V20 A;  1VEU B;  1MZU A;  1F9I A;  4ZBE A;  1MKI A;  3HLD A;  5AQ9 A;  3MZD A;  4LRZ E;  4OP5 A;  2OLU A;  4FTX A;  5A90 A;  1WA9 A;  3BJN A;  4C6Y A;  2JKR M;  1BYW A;  1NY0 A;  3GSG A;  1VQQ A;  4N9L A;  3QP8 A;  1E4D A;  4O8G A;  1ES5 A;  2Z2L B;  2HDQ A;  3P98 A;  1FSW A;  4XUZ A;  1GHM A;  4R23 A;  2Y2K A;  1WYB A;  4PPR A;  3W8K A;  1O07 A;  2HDS A;  4JLF A;  3G2Z A;  1YPR A;  5BOH A;  3OPH A;  2P08 A;  3LGO A;  2XDM A;  3K3D A;  2JKG A;  2BG1 A;  1SHV A;  5CHM A;  5DJU A;  4Z9Q A;  4KUO A;  1J9M A;  3K3C A;  2PYR A;  3ZG0 A;  3S22 A;  3C4P A;  2ZC6 B;  3LO7 A;  3QP6 A;  5HAI A;  4ETX A;  2PDR A;  2LB9 A;  3UE6 A;  3TSG A;  1L0F A;  2CC1 A;  3T1Q B;  1N9N A;  2K2N A;  3CLO A;  1MC0 A;  2Z6C A;  4EET B;  1G5U A;  1PWC A;  2ZQ7 A;  4DE3 A;  4GNU A;  3G6O A;  2WAD A;  1OJG A;  5GLC A;  1KE4 A;  3TJZ C;  5F68 A;  1PWG A;  3TRC A;  2Q0O A;  4IVI A;  3JYI A;  3P7N A;  1K4F A;  4BBT A;  5FL3 A;  2WGW B;  4C75 A;  2PU2 A;  5AQB A;  3MFD A;  4GKU A;  4E3N A;  2V1B A;  4K08 A;  2WAE A;  1XXM A;  2C6W B;  4JF4 A;  4GDB A;  1YAX A;  2IWD A;  4PM9 A;  4Q0H A;  5K5B A;  3GMW A;  2WKR A;  4R4S A;  1FR1 A;  4Y5F A;  3UB9 A;  4PM8 A;  4LCL A;  3UO9 A;  4WEJ A;  3S7P A;  4OOM A;  4KQD A;  4MN6 A;  2GNX A;  3G4P A;  3TW8 A;  5HFO A;  3LY3 A;  2HJ9 C;  3KYE A;  3RTY A;  3KYZ A;  1OPX A;  5E2G A;  4RVA A;  1DY6 A;  4HY8 A;  3LR5 A;  1ONG A;  2XK1 A;  1YM1 A;  3IF6 A;  3MS6 A;  3F1O A;  2ZC3 B;  2IWC A;  4EV4 A;  3GQZ A;  3NHQ A;  3EQV A;  5J3W A;  2QPN A;  1ZC2 A;  2WUQ A;  4DXC A;  1BTL A;  1HD8 A;  1I2S A;  3C2W A;  4X6T A;  3EOI A;  4NG2 A;  3NI9 A;  4EBN A;  2J9O A;  1TS8 A;  1VB6 A;  1GSX A;  2QKP A;  4DMZ A;  5FQK A;  4U3T A;  2O0Y A;  1H5X A;  1PZP A;  4E6W A;  3NUL A;  3HBR A;  4I38 A;  1FCM A;  2ZQ9 A;  5CTM A;  4IHQ A;  1FCN A;  4OON A;  3V67 A;  4JF6 A;  3M2J A;  1LLB A;  3VOY A;  4EXO A;  1OTE A;  3OCN A;  3IS2 A;  4BBU A;  4EEU A;  1PI5 A;  3WS2 A;  1BT5 A;  4OPY A;  5DF9 A;  3ZGA B;  4GS9 B;  1P9W A;  1RGY A;  5JYP A;  3CI6 A;  5TJJ A;  3B42 A;  3H82 B;  5CTN A;  3V39 A;  4ESP A;  1ERQ A;  4RQ9 A;  3LY4 A;  1K55 C;  4OKP A;  1S67 L;  4Y0U A;  2O9C A;  3LID A;  2Y2G A;  3GEC A;  2JN7 A;  2XSS A;  3C38 A;  5TBM A;  5FAT A;  1LSV A;  4IUH A;  1P97 A;  2DRW A;  3UDF A;  1TEM A;  5HAQ A;  1K25 A;  1XP4 A;  2Y2O A;  3NEC A;  2P04 A;  4NXF A;  2WZX A;  2PU4 A;  1K54 C;  3BWL A;  3HUM A;  4X1M A;  3BY8 A;  5HZH A;  4LRY C;  3V3S A;  5DTS A;  2NUT C;  3D4F A;  1JTG A;  3VE3 A;  3M6H A;  3UB5 P;  3WS0 A;  4S2N A;  5CER A;  1UGU A;  4WL9 A;  2JKF A;  4S2J A;  4GHI B;  1KDS A;  2EX2 A;  1SZV A;  4GOG A;  4KZ7 A;  3LEQ A;  5A92 A;  3UB7 A;  3EGX C;  3L9K A;  2ZMA A;  1XKZ A;  2OSU A;  4BD0 A;  3R4K A;  1ES3 A;  1ZTU A;  4ZJ2 A;  3CZD A;  4OQI A;  4CJN A;  2GX5 A;  4R1G A;  1IKI A;  1W63 Q;  1SDN A;  4H8R A;  1NZU A;  3MZF A;  2Y59 A;  2O99 A;  2ZQA A;  4N9K A;  2Y55 A;  3H9W A;  2G7U A;  2PBY A;  5GHX A;  3TE8 A;  3KSH A;  2YKH A;  4B4Z A;  3BEC A;  2NUP C;  1JVJ A;  2WGI A;  4G3V A;  1BLP A;  3UE0 A;  2XEP A;  4WEK A;  2PRF A;  3C5A A;  2Y2N A;  3PYP A;  4R70 A;  1IYP A;  1CK3 A;  3BEB A;  2CMN A;  1I2W A;  1H8Y A;  3RH8 B;  4EUV A;  2WGV A;  3O86 A;  3BLS A;  2KX6 A;  5HD5 A;  3O88 A;  3MQ0 A;  3R7W A;  1ZKJ A;  3Q7V B;  2XA7 S;  2HGV A;  3HUO A;  5M19 A;  1L0D A;  1XA1 A;  3HLG A;  4X53 A;  1OTB A;  2QJ5 A;  3CPT B;  4X25 A;  1MWS A;  1ALQ A;  4KZ6 A;  5EVI D;  3PBN A;  3E4P A;  1EW0 A;  3IHB A;  3VP2 A;  5FI2 A;  3QP2 A;  4QWO A;  3VP4 A;  1L0E A;  3EGD C;  4IED A;  1S66 L;  2W27 A;  2H10 A;  1GA0 A;  3E2K A;  5L09 A;  2BTF P;  1YMS A;  4P85 A;  5L2F A;  1G28 A;  2ZQC A;  5FSR A;  4Q0I A;  1CJF A;  4R38 A;  3VP0 A;  5HL1 A;  4X69 A;  2PYP A;  5HDD A;  3AGD A;  1IYQ A;  3KO6 A;  1FQG A;  2JC7 A;  3LIB A;  5TGF A;  2D01 A;  2RCX A;  1D06 A;  5DJT A;  4DE0 A;  5J8X A;  1P9R A;  2PAV P;  3NOP C;  5J7E A;  1ERO A;  4UQI S;  1DJC A;  2HPB A;  3MQO A;  4E3I A;  1XA7 A;  3S4X A;  4BL3 A;  2ZQD A;  3S7N A;  3SOI A;  5FEG A;  5DKL A;  3HVF A;  5EM0 A;  4HP4 A;  4U0T A;  4E6X A;  1H8Z A;  5CED A;  4WUJ A;  2VZW A;  3PBR A;  1PIO A;  3V50 A;  2X71 A;  4PHT A;  1YMX A;  4NXG A;  4JGP A;  1PYY A;  3A0S A;  2WKQ A;  3S7O A;  2PBD P;  1AWI A;  4WZ4 A;  2C5W B;  2QYB A;  5FQ9 A;  2XGN A;  3ZDJ A;  3HRE A;  1JTD A;  4MMN A;  1TDL A;  3UNW A;  4E3K A;  4LLO B;  2ZL1 A;  4DJ2 A;  1TDG A;  3N8R A;  1YQS A;  1D1J A;  1SKO B;  4UA7 A;  3IX3 A;  2H0T A;  3SS3 A;  4MBH A;  1PZO A;  2ZMV A;  4BL2 A;  3DTM A;  5GHZ A;  2XH9 A;  3P01 A;  1W8Y A;  3M2K A;  3W4Q A;  4R4R A;  1LL5 A;  2XA7 M;  4ARZ B;  4KUK A;  2G2W A;  1OTD A;  1XGJ A;  3Q82 A;  3BY9 A;  1N9O A;  4KZ8 A;  2W1T B;  3QP4 A;  1Y54 A;  4I3A A;  4B9O A;  2OAP 1;  1TD5 A;  2OWJ A;  5DKK A;  1K38 A;  1FSY A;  1K57 C;  2WKH A;  2XD5 A;  4YNR A;  5CGX A;  4MN7 A;  1K56 A;  4CLC B;  3VP1 A;  5EEC A;  1E3U D;  3VFH A;  3MQQ A;  1EWZ A;  3IXG A;  1NZO A;  3LR4 A;  2R9W A;  3T4J A;  5EVI B;  4K91 A;  1NLZ A;  4OLD A;  3UPO A;  3EWK A;  3PBQ A;  2KLI A;  4II7 A;  3ZG9 B;  1ES4 A;  3NOT C;  4ETZ A;  1GA9 A;  4IBR A;  3HL9 A;  1IOU A;  5FA7 A;  4U0X A;  1OME A;  1BLC A;  5HL6 A;  3HJK A;  4UQI M;  2IA2 A;  4UHU A;  2P9V A;  3OBF A;  2A3U A;  2VK3 A;  2VEA A;  2B18 A;  2WK0 A;  2J7V A;  5F6A A;  3SS4 A;  3FYZ A;  1ES2 A;  3BM6 A;  1LL9 A;  4JBF A;  3IXB A;  3FG8 A;  3MF0 A;  1OTI A;  3DWK A;  5KSH A;  3G32 A;  4UA9 A;  2OOL A;  3K2N A;  3FPW A;  1ERM A;  5EFW A;  1STZ A;  5FQQ A;  4K0W A;  2L1M A;  2M1C A;  4IVK A;  2PR5 A;  4FOF A;  4Y17 A;  4L9F A;  4FCF A;  5A93 A;  3D9Y A;  5CHJ A;  4MCW A;  1H8M A;  3FPV A;  4WMC A;  3UE1 A;  2HP5 A;  4HEF A;  2V2F F;  3UB8 A;  3MSH A;  2EFX A;  2W3H A;  3ZCZ A;  2ZLY A;  1H3Q A;  1NLY A;  3IWQ A;  2XQZ A;  3W2Z A;  1XGI A;  3LIA A;  4KG2 A;  3T1X A;  5KZH A;  4F3L A;  3DBA A;  3PXP A;  3N7W A;  3N8L A;  4ID4 A;  2X02 A;  5HDC A;  2J3T C;  2V8C A;  3GVB A;  1DP6 A;  4QY6 A;  4OH0 A;  3M6B A;  5F83 A;  3GRJ A;  1PI4 A;  3F1P B;  4CLC C;  4DDY A;  1A0K A;  5IU1 A;  1RGZ A;  4EBP A;  1XJ3 A;  2G2U A;  3HLW A;  5HX9 A;  2Q9N A;  4MBF A;  2EX6 A;  4HJ3 A;  5EVI C;  4EQI A;  5L10 A;  3T4K A;  4K0X A;  5AJG A;  1C3B A;  3LR0 A;  2QZ6 A;  3T4L A;  1WE4 A;  3ZVT A;  3NDG A;  3E4O A;  1L2S A;  4H6J A;  1AXB A;  1F2K A;  3G34 A;  4BEN A;  2VKS A;  2Y2I A;  4I3I A;  4FH4 A;  1KVM A;  2FZ0 A;  2E8I A;  3FKW A;  4BLM A;  3T1R A;  1NWZ A;  3T50 A;  1IEL A;  3PTE A;  5I94 A;  3VMA A;  3T4O A;  5KIZ A;  3UME A;  3LIF A;  5FI7 A;  4HBT A;  1DJA A;  4MLL A;  3QNC A;  3C4O A;  4JXW A;  2OAQ 1;  1G6O A;  5CGS A;  1MY8 A;  2V1A A;  4XT2 A;  3NDE A;  2PD8 A;  3IWI A;  1PW8 A;  3I7J A;  3FC7 A;  1GSV A;  2Z2M B;  3N6I A;  1OT9 A;  3LCE A;  4FD8 A;  2ZOH A;  2ZC4 B;  1V9Y A;  1ESU A;  2ZQ8 A;  5HWT A;  5G18 A;  3SW1 A;  3H7W A;  3MKE A;  4P87 A;  4KZ4 A;  1HTZ A;  4CPK A;  4XUX A;  4KZ3 A;  1VET B;  3B33 A;  1HVB A;  1O7E A;  2ACG A;  2FFY A;  1GHP A;  2UWX A;  5GL9 A;  5HWV A;  5TFQ A;  1KGE A;  3TOI A;  2WKE A;  3S1Y A;  2P74 A;  3Q81 A;  1FCO A;  3T4S A;  1K0K A;  4WZ5 C;  1LHY A;  5FAP A;  3RXW A;  1ZG4 A;  2FFF B;  2VJW A;  5FAQ A;  1VEU A;  4N1H A;  2EXA A;  2OV5 A;  2Y2P A;  4BBV A;  4X55 A;  4EU0 A;  4O7D A;  3DW0 A;  4S2I A;  3MXQ A;  2A2L A;  2WZZ A;  3PR6 A;  4HP9 A;  3CHW P;  5CGW A;  2A24 A;  4P6Z S;  1XFN A;  4QY5 A;  5G4Y A;  4GD6 A;  3O87 A;  1YLW A;  3LI8 A;  4EW7 A;  3ZHH A;  4Q0J A;  4HHD A;  4KZB A;  3SH7 A;  4X56 A;  4LRX C;  2HV1 A;  2VV8 A;  1G68 A;  2BLS A;  3E4Q A;  3RFB A;  1DP9 A;  5L07 A;  3ZG8 B;  4EWF A;  4CQH A;  5C5K A;  5AVE A;  1JWP A;  1K6R A;  2HF6 A;  1XX2 A;  4L9E A;  2H28 A;  2RL3 A;  4EUZ A;  1IYO A;  5A8B A;  4WYY A;  2W0N A;  4N1X A;  4ZJ1 A;  5G4Z A;  4EQ1 A;  4LV1 A;  3QHY A;  4GDN A;  4GLQ A;  1FOF A;  4GZB A;  3BFF A;  3L7H A;  3CUE C;  2VV7 A;  3ZVW A;  3SH8 A;  1Z09 A;  3HLF A;  3JVV A;  1DP8 A;  1SCW A;  5HPF A;  4OLG A;  3U2A A;  3QNB A;  2V9A A;  2K31 A;  3OLO A;  5HWW A;  3T4T A;  3IHA A;  2HP6 A;  2HZ5 A;  4JXS A;  5EE8 A;  1Y4O A;  1KDW A;  2ZD8 A;  2ZJ9 A;  3Q07 A;  1HLU P;  3NY4 A;  4GB7 A;  4ZJ3 A;  1FIK A;  4GCZ A;  4R0Q A;  3WS1 A;  2W3E A;  3HJI A;  4MBK A;  2ZOI A;  2ZM2 A;  1YSQ A;  1T19 A;  2HP9 A;  1OT6 A;  4DRT A;  4EBL A;  3LIE A;  2WGW A;  2QMI A;  2R9X A;  2VGJ A;  5CRF A;  3EQU A;  2EX8 A;  2L0W A;  3ZG7 B;  4BD1 A;  3NIA A;  3IWO A;  3LI9 A;  5F5Y A;  1S6R A;  3A0R A;  1NYM A;  1EI5 A;  3PAE A;  4G3W A;  1K55 A;  1LI9 A;  4X68 A;  5DVA A;  1RP5 A;  1ONH A;  1GCE A;  2MJ6 A;  4PKY G;  3IX4 A;  4S2K A;  5EOO A;  3IBJ A;  3UN7 A;  3MXR A;  1YLY A;  2DNS A;  3W4P A;  4JGQ A;  4JKT A;  5F1F A;  4JGO A;  1TS6 A;  2Y2L A;  3IXD A;  3KYQ A;  2B95 A;  4S2L A;  1P0Z A;  1NRJ A;  1G6A A;  3NCK A;  3OPL A;  1CEF A;  5M1A A;  1K54 A;  3WRZ A;  4R3B A;  3IH9 A;  3IF6 B;  3F1O B;  1S1Y A;  1SDE A;  5HAP A;  3SZT A;  5GHY A;  4OQG A;  5AVF A;  1RCJ A;  4P6Z M;  1MPL A;  3WS4 A;  3IS2 B;  4BQM A;  4GN2 A;  5F1G A;  3ZFZ A;  3UPP A;  2J80 A;  3RJU A;  1KE0 A;  1ZHH B;  3HLE A;  1GSW A;  3BW6 A;  1XJ6 A;  1UWP X;  2VX8 A;  3NC8 A;  3VP3 A;  4QJG A;  5FDS A;  4I5S A;  1W79 A;  2HDU A;  4QPR A;  2J9P A;  4LV2 A;  4RA7 A;  3DTE A;  5MC7 A;  4IJG A;  5HAR A;  2D02 A;  4KQO A;  4DE1 A;  3IBR A;  2PHY A;  4KG5 A;  3OOV A;  2Q9M A;  2ZC7 A;  3JVU A;  3CAX A;  4IUK A;  1Q2P A;  3JPU A; 
#chains in the Genus database with same CATH homology
 5A91 A;  2V1Z A;  4IVK A;  4K0W A;  3OCN A;  4OOL A;  5FAS A;  4FCF A;  5A93 A;  1LI0 A;  4UA6 A;  1PI5 A;  3WRT A;  1BT5 A;  1M40 A;  4OPY A;  3WS2 A;  5CHJ A;  5DF9 A;  3ZGA B;  2X01 A;  4UAA A;  3V3R A;  4WM9 A;  1RGY A;  4DDS A;  4WMC A;  5JYP A;  1YT4 A;  4OPZ A;  3UE1 A;  2HP5 A;  4HEF A;  1MBL A;  2V2F F;  3NBL A;  5CTN A;  2XFS A;  2EFX A;  4RX2 A;  3ZCZ A;  3FV7 A;  2ZLY A;  3V39 A;  4NET A;  4KEN B;  1ERQ A;  4PM5 A;  3CMZ A;  3IWQ A;  2XQZ A;  3LY4 A;  1XGI A;  1ESI A;  3AGE A;  1K55 C;  4KG2 A;  4OKP A;  2GDN A;  4Y0U A;  4PM6 A;  3WS5 A;  4PM7 A;  4JF5 A;  5KZH A;  4P6B A;  2Y2G A;  3N7W A;  3N8L A;  2Y4A A;  4KG6 A;  4ID4 A;  4S2P A;  3ZNT A;  4OPQ A;  1FR6 A;  1YLJ A;  1IEM A;  3IH8 A;  5EPH A;  3BFE A;  5FAT A;  2X02 A;  1K4E A;  3OPR A;  5EVL A;  2WAF A;  4GD8 A;  4Y0O A;  3GVB A;  1Z6F A;  2DRW A;  3UDF A;  1TEM A;  3VFF A;  4QY6 A;  5HAQ A;  5CXW A;  1K25 A;  4OH0 A;  1XP4 A;  3M6B A;  5FDH A;  2Y2O A;  5F83 A;  5AQ7 A;  1BLS A;  3GRJ A;  4ZAM A;  1PI4 A;  4WZ5 A;  2WZX A;  2PU4 A;  1K54 C;  1BSG A;  4DDY A;  4Y7P A;  1RGZ A;  1YLT A;  3UY6 A;  4EBP A;  4LV3 A;  2G2U A;  3HUM A;  3IF6 C;  4F94 A;  3UE3 A;  3V3S A;  3HLW A;  4R3J A;  2ZC5 B;  2Q9N A;  5DTS A;  5HX9 A;  4MBF A;  4NK3 A;  3D4F A;  3UDX A;  4B4X A;  1JTG A;  3FWL A;  3M6H A;  2EX6 A;  5E43 A;  5EVI C;  3WS0 A;  4EQI A;  4S2N A;  1YLZ A;  5CER A;  2H5S A;  3ITA A;  1KVL A;  1XPB A;  1MWR A;  3A3E A;  4S2M A;  3SS5 A;  4S2J A;  4K0X A;  4JXV A;  1C3B A;  1N4O A;  2QZ6 A;  2Y2M A;  3GV9 A;  1M6K A;  1KE3 A;  1KDS A;  1WE4 A;  2EX2 A;  3NDG A;  3ZVT A;  4GOG A;  3RXX A;  1L2S A;  5U47 A;  1AXB A;  1BZA A;  4KZ7 A;  4FSF A;  5E2E A;  5A92 A;  5KSC A;  3G34 A;  2ZMA A;  4LEN A;  1XKZ A;  5FQM A;  4BEN A;  4E3M A;  2OSU A;  2Y2I A;  4FH4 A;  1KVM A;  1N9B A;  1MWT A;  2E8I A;  3Q7Z A;  3BYD A;  4BD0 A;  3GTC A;  3E2L A;  1BUL A;  2XLN A;  1ES3 A;  3FKW A;  4ZJ2 A;  3CZD A;  4BLM A;  4OQI A;  4CJN A;  3BLM A;  3SH9 A;  1CI8 A;  4QHC A;  5FQJ A;  4R1G A;  1IKI A;  1E3U A;  3BFC A;  4RX3 A;  4N92 A;  3WWX A;  1IEL A;  3PTE A;  5I94 A;  3MXS A;  3VMA A;  1SDN A;  1PWD A;  2JE5 A;  3P09 A;  4H8R A;  5AQA A;  2WKI A;  5FI7 A;  1NZU A;  3LEZ A;  4KQQ A;  4HBT A;  1DJA A;  3MZF A;  1VM1 A;  2Y59 A;  2XFT A;  3QNC A;  3IXH A;  4L0L A;  3C4O A;  2ZQA A;  4JXW A;  4MLL A;  4N9K A;  4S2O A;  3W4O A;  5CGS A;  5HW3 A;  1MY8 A;  3IQA A;  3NDE A;  4E3L A;  2A49 A;  1PW1 A;  2EFU A;  2Y55 A;  1PW8 A;  3FKV A;  3HLC A;  1E25 A;  3IWI A;  2PBY A;  5GHX A;  3IF5 A;  3PAG A;  3I7J A;  4FH2 A;  2JBF A;  4PMA A;  2I72 A;  2Z2M B;  4KQR A;  2B5R A;  4B4Z A;  3BEC A;  5KMW A;  3N6I A;  4LCM A;  1JVJ A;  3LCE A;  3UDI A;  2OLV A;  4FD8 A;  2ZC4 B;  1W5D A;  1ESU A;  5M18 A;  2ZQ8 A;  5CEB A;  1KGF A;  2WGI A;  1U60 A;  1BLP A;  3UE0 A;  5G18 A;  2XEP A;  4WEK A;  3MKE A;  5TR7 A;  3C7V A;  3C5A A;  2Y2N A;  4P87 A;  3ITB A;  1JWV A;  4KZ4 A;  1HTZ A;  1IYP A;  3PBO A;  1CK3 A;  4CPK A;  1WYC A;  3BEB A;  3HUN A;  4XUX A;  2EX9 A;  3A3D A;  4KZ3 A;  1I2W A;  1H8Y A;  5E2H A;  4QB8 A;  3OZH A;  1HVB A;  2WGV A;  1O7E A;  2FFY A;  3BFD A;  3BLS A;  3DWZ A;  3O86 A;  1GHP A;  2UWX A;  3O88 A;  4OOY A;  5GL9 A;  1K56 D;  1NYY A;  5CHU A;  1W8Q A;  5TFQ A;  2DCF A;  3OCL A;  1KGE A;  4OP8 A;  4WEL A;  3TOI A;  2WKE A;  1ZKJ A;  3S1Y A;  1NXY A;  3VSL A;  1CI9 A;  2P74 A;  3HUO A;  3Q81 A;  3Q7V B;  2IWB A;  5M19 A;  4IBX A;  1L0D A;  4JXG A;  1XA1 A;  3HLG A;  4X53 A;  4DF6 A;  4WBG A;  3Q7V A;  1W7F A;  1FCO A;  1MWU A;  2V20 A;  2Y2H A;  1MWS A;  4WZ5 C;  3AGF A;  1LHY A;  5FAP A;  1ALQ A;  4HBU A;  4KZ6 A;  5EVI D;  1ZG4 A;  3RXW A;  4E3O A;  2FFF B;  3C7U A;  5FAQ A;  3PBN A;  4ZBE A;  3A3F A;  3MBZ A;  4N1H A;  1MKI A;  3HLD A;  5AQ9 A;  2EXA A;  3MZD A;  2OV5 A;  3IHB A;  3VP2 A;  4Q8I A;  5FI2 A;  4OP5 A;  2J8Y A;  2Y2P A;  1SKF A;  4X55 A;  2OLU A;  3VP4 A;  1L0E A;  5A90 A;  4O7D A;  5D3O A;  4C6Y A;  3GSG A;  4S2N C;  1NY0 A;  3DW0 A;  4S2I A;  1VQQ A;  4IED A;  3IT9 A;  2WZZ A;  4N9L A;  1JWZ A;  1E4D A;  5CGW A;  1ES5 A;  2H10 A;  2Z2L B;  1GA0 A;  2Y91 A;  3E2K A;  4MNR A;  4QY5 A;  2HDQ A;  1TVF A;  1YMS A;  1FSW A;  1K57 A;  3P98 A;  4P85 A;  4XUZ A;  5L2F A;  2ZQC A;  5FSR A;  1GHM A;  5GLA A;  4GD6 A;  3O87 A;  4R23 A;  3VP0 A;  2Y2K A;  5HL1 A;  4X69 A;  1YLW A;  1WYB A;  3AGD A;  4PPR A;  3ZHH A;  3W8K A;  1O07 A;  1IYQ A;  1FQG A;  4KZB A;  2HDS A;  2JC7 A;  5TGF A;  2RCX A;  1ZG6 A;  4KZA A;  4JLF A;  3SH7 A;  3G2Z A;  4X56 A;  5BOH A;  4DE0 A;  5J8X A;  3A3I A;  3ZNY A;  1G68 A;  2BLS A;  3OPH A;  5F82 A;  2XDM A;  5DF7 A;  3ZG8 B;  4EWF A;  1ERO A;  3OPP A;  3ZG5 A;  1JWP A;  1DJC A;  2BG1 A;  2HPB A;  4QU3 A;  1SHV A;  3CJM A;  3N4I A;  1XA7 A;  1K6R A;  4OPR A;  3S4X A;  4BL3 A;  1XX2 A;  2ZQD A;  4E3I A;  2RL3 A;  4EUZ A;  5CHM A;  3SOI A;  5GLD A;  1IYO A;  3UPN A;  4WYY A;  4Z9Q A;  4WMC D;  3HVF A;  1J9M A;  4N1X A;  4ZJ1 A;  4U0T A;  4E6X A;  1YLP A;  3ZG0 A;  3S22 A;  3C4P A;  2ZC6 B;  1H8Z A;  1KGG A;  5CED A;  3LO7 A;  4LV1 A;  4KZ5 A;  3QHY A;  4C3Q A;  4GDN A;  5HAI A;  1FOF A;  3PBR A;  4GZB A;  1PIO A;  2H0Y A;  3BFF A;  3G30 A;  2VGK A;  3TSG A;  5IHV A;  3V50 A;  3PBT A;  3ZVW A;  1IKG A;  1L0F A;  3SH8 A;  3HLF A;  4YIN A;  2X71 A;  2CC1 A;  5EOE A;  1YMX A;  4MEZ A;  4YFM A;  3OC2 A;  3MKF A;  1PWC A;  1PYY A;  1SCW A;  2ZQ7 A;  4DE3 A;  4OLG A;  4GNU A;  3QNB A;  4HES A;  4M3K A;  4P0M A;  4DE2 A;  4OQH A;  4Y0T A;  2WAD A;  3BFG A;  3IHA A;  2WYX A;  2HP6 A;  5GLC A;  4JXS A;  2C5W B;  4WZ4 A;  1KE4 A;  5EE8 A;  1IYS A;  1KDW A;  2ZD8 A;  2ZJ9 A;  3Q07 A;  5FQ9 A;  1PWG A;  3NY4 A;  4GB7 A;  2XGN A;  4ZJ3 A;  4R0Q A;  3WS1 A;  3O3V A;  3CG5 A;  4IVI A;  3ZDJ A;  5DF8 A;  3HRE A;  3JYI A;  5JYO A;  1K4F A;  1JTD A;  4MBK A;  2ZM2 A;  2WGW B;  5FI6 A;  1TDL A;  2HP9 A;  5EUA A;  3ISG A;  2PU2 A;  3UNW A;  4C75 A;  5AQB A;  3MFD A;  4DRT A;  4E3K A;  4E3J A;  4GKU A;  4EBL A;  2WGW A;  1TDG A;  2QMI A;  3N8R A;  2R9X A;  2VGJ A;  4KZ9 A;  3EQU A;  5CRF A;  4E3N A;  1YQS A;  2WAE A;  2JCH A;  2EX8 A;  1XXM A;  2C6W B;  4QD4 A;  2HDR A;  3ZG7 B;  2XR0 A;  4JF4 A;  4UA7 A;  4GDB A;  4BD1 A;  4BJP A;  3NIA A;  2IWD A;  4PM9 A;  5GLB A;  3IWO A;  2H0T A;  1HZO A;  1NRF A;  3SS3 A;  3V5M A;  1S6R A;  4MBH A;  3GMW A;  1PZO A;  4BL2 A;  3DTM A;  5GHZ A;  4DKI A;  2XH9 A;  1NYM A;  1EI5 A;  3PAE A;  4R4S A;  1W8Y A;  1K55 A;  3M2K A;  3W4Q A;  1LI9 A;  1S0W A;  3FZC A;  4X68 A;  4R4R A;  1LL5 A;  5DVA A;  4D2O A;  1RP5 A;  1FR1 A;  1ONH A;  1GCE A;  5DTT A;  2G2W A;  1XGJ A;  4S2K A;  3MZE A;  3Q1F A;  5EOO A;  4PM8 A;  4LCL A;  3UN7 A;  3MXR A;  3Q82 A;  3UO9 A;  4WEJ A;  4KZ8 A;  1YLY A;  2DNS A;  1L0G A;  3W4P A;  1Y54 A;  4OOM A;  5E2F A;  4DXB A;  4JKT A;  3G4P A;  4JPM A;  3B3X A;  5HFO A;  1NJ4 A;  3LY3 A;  5F1F A;  3VOZ A;  1K38 A;  2Y2J A;  2ZM8 A;  3BRM A;  2Y2L A;  1FSY A;  1K57 C;  2WKH A;  3G35 A;  3IXD A;  4LV0 A;  3TG9 A;  4S2L A;  2XD5 A;  4RYE A;  5CGX A;  1K56 A;  5E2G A;  1G6A A;  4RVA A;  1E3U D;  5EEC A;  3VP1 A;  1DY6 A;  3NCK A;  3OPL A;  1CEF A;  5M1A A;  3VFH A;  1K54 A;  3WRZ A;  1EWZ A;  4R3B A;  1ONG A;  2XK1 A;  3IH9 A;  1YM1 A;  3IF6 B;  1QMF A;  3IXG A;  3IF6 A;  1SDE A;  4OVD A;  5HAP A;  1NZO A;  2ZC3 B;  2IWC A;  2R9W A;  5GHY A;  4OQG A;  4A5R A;  5EVI B;  4K91 A;  1RCJ A;  1Q2Q A;  4EV4 A;  1DJB A;  3GQZ A;  4OLD A;  1MPL A;  3WS4 A;  1QME A;  5EVI A;  4BQM A;  3UPO A;  4GN2 A;  5F1G A;  3EQV A;  4ZDX A;  2XD1 A;  3PBQ A;  3ZG9 B;  1GHI A;  3UPP A;  3ZFZ A;  4B88 A;  3RJU A;  1ES4 A;  1I5Q A;  2QPN A;  1KE0 A;  3HLB A;  1ZC2 A;  3HLE A;  1GA9 A;  2EXB A;  4IBR A;  2WUQ A;  3HL9 A;  5FA7 A;  4DXC A;  1CEG A;  1BTL A;  5DTK A;  1HD8 A;  4U0X A;  1OME A;  1I2S A;  2P9V B;  3N8S A;  1BLC A;  4X6T A;  3NC8 A;  3VP3 A;  5FQI A;  1MXO A;  4QJG A;  4UHU A;  2P9V A;  3NI9 A;  4EBN A;  1BLH A;  2A3U A;  2J9O A;  1W79 A;  2WK0 A;  1BUE A;  1K6S A;  2J7V A;  2HDU A;  3SS4 A;  4ZTK A;  2Y2Q A;  5FAO A;  2J9P A;  4LV2 A;  3FYZ A;  4RA7 A;  1ES2 A;  3A3J A;  5FQK A;  3BM6 A;  4U3T A;  1LL9 A;  1H5X A;  1PZP A;  4JBF A;  4E6W A;  3PBS A;  5HAR A;  5CEC A;  4XXR A;  4DE1 A;  3HBR A;  3G31 A;  3IXB A;  4KQO A;  2ZM0 A;  4KG5 A;  4OQ0 A;  2Q9M A;  1FCM A;  2ZQ9 A;  2ZC7 A;  5CTM A;  2XF3 A;  3DWK A;  5KSH A;  3G2Y A;  3VSK A;  3G32 A;  1FCN A;  4UA9 A;  4OON A;  1Q2P A;  3GR2 A;  4JF6 A;  3M2J A;  1LLB A;  1ERM A;  3VOY A;  5FQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...