1ERQA

X-ray crystal structure of tem-1 beta lactamase in complex with a designed boronic acid inhibitor (1r)-1-acetamido-2-(3-carboxy-2-hydroxyphenyl)ethyl boronic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-1 BETA-LACTAMASE
publication title Structure-based design guides the improved efficacy of deacylation transition state analogue inhibitors of TEM-1 beta-Lactamase(,).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1erqA00
3ISGA 1BTLA 2J8YA 3JYIA 5FI6A 1L0FA 2ZQAA 1IYSA 3Q1FA 3SS4A 5HAPA 2WGIA 4DE0A 3Q07A 3WS4A 2A3UA 3MZDA 5FASA 4KQOA 1I5QA 3UPOA 3NY4A 4NK3A 1IYPA 1CK3A 4UA7A 2I72A 2HPBA 3HLWA 5CGXA 5E2HA 3ZVTA 4XUZA 1MKIA 1NZOA 4JXGA 5CXWA 2HDQA 1FQGA 2FFFB 2Y2KA 3UO9A 1N4OA 1NJ4A 3FYZA 3ITAA 4QHCA 1W5DA 3P09A 3ZG0A 4BL2A 1H5XA 1L2SA 1KE3A 1PI5A 4YINA 1K54A 3S4XA 5CEBA 2XLNA 1KVLA 2Y55A 4BD0A 4OQHA 1K25A 2BLSA 2XR0A 2Y2NA 2WGWB 1JWVA 1MY8A 2Y91A 4QU3A 4WBGA 4IBRA 3ZG5A 4YFMA 3FZCA 4WM9A 4ZJ1A 4WMCA 3BM6A 3HL9A 2HDUA 2FFYA 5CTNA 1HVBA 2XD1A 3BYDA 5CTMA 3NBLA 5E2FA 3HUNA 2ZC6B 4A5RA 3Q7VB 2ZLYA 3PAEA 3OPLA 5DVAA 1ONHA 4EBLA 4B88A 1K56D 3DWZA 4MBHA 3WS1A 3DTMA 4IVKA 3BECA 4LV0A 5JYPA 3MXRA 4MNRA 1JVJA 4X6TA 4X68A 3P98A 4GDBA 4OONA 2Q9NA 4JXWA 4OOYA 3GSGA 3IWQA 2EX8A 4K0WA 3A3FA 3EQVA 5FQ9A 1YM1A 4P6BA 2EXBA 2H5SA 2PU4A 1M6KA 4S2NA 4KZ8A 1MBLA 1PWCA 1SDEA 5CGSA 2VGKA 4LENA 4QJGA 4UA6A 5EVIA 3RXWA 3V39A 5A92A 5CGWA 1Q2QA 4HBTA 3DWKA 1LI0A 1KE4A 4RA7A 4PM7A 4UA9A 5JYOA 2IWDA 4S2MA 2P9VB 1PW8A 3NI9A 4HEFA 3OZHA 3UDIA 2GDNA 3SH9A 1SDNA 4NETA 5DF7A 4ZBEA 1W8YA 1OMEA 2P74A 2V20A 3DW0A 4FSFA 4S2PA 3UE1A 1QMFA 1IYOA 1JWPA 4F94A 5G18A 3ZNTA 4EBPA 3V50A 1FSWA 4KG6A 1H8YA 3GTCA 3OCNA 1G68A 1ZKJA 2J7VA 4D2OA 4N1HA 4Y7PA 1MWRA 5TGFA 2Y2MA 4WYYA 3W4QA 1KGFA 5TFQA 3OPRA 3CG5A 1FSYA 1XPBA 4WZ4A 1FCNA 1K6SA 4FCFA 5F83A 4BL3A 2WGWA 1IKIA 4DXBA 1ESIA 4OPQA 3WRTA 2WKHA 3N7WA 2Z2MB 5FI2A 1XGJA 4X53A 2PU2A 1K57C 3BFCA 3PBNA 3E2LA 3IXHA 3O3VA 3UNWA 4CJNA 4WEJA 5FAQA 4R4RA 2ZQ7A 3BLMA 2E8IA 1Y54A 3G32A 3UN7A 1KDWA 5EE8A 4PPRA 5D3OA 2WAEA 5GHZA 3HLGA 3HUOA 4R4SA 3PBTA 2B5RA 2DNSA 4XUXA 1KVMA 2XEPA 2G2WA 3VMAA 4N9KA 1HZOA 1EROA 4O7DA 4JF4A 1FCMA 3QHYA 4X55A 1K4FA 1ONGA 4JPMA 4P85A 4IVIA 4PM9A 3GMWA 5HAIA 4E3KA 3S22A 3SS5A 4M3KA 3VFFA 4DRTA 3MKFA 1PW1A 2JE5A 2ZQCA 5FSRA 1DY6A 2QZ6A 3BEBA 3OPPA 3LY3A 4K91A 4OP8A 1L0EA 3E2KA 1HTZA 1K38A 3G31A 3N8SA 4OQIA 1YLJA 3BRMA 1BLPA 1W79A 1LI9A 3SS3A 2P9VA 5HW3A 2Y2PA 1N9BA 4K0XA 2Y2IA 5DF9A 1ERMA 3CJMA 5FATA 3VP2A 3WWXA 4E3MA 1XXMA 1M40A 4GN2A 1BSGA 3UDXA 3MZEA 5FAOA 2V2FF 1BUEA 3ZG9B 1PI4A 3I7JA 2EX9A 2HP6A 2ZD8A 5DTSA 4X56A 3FV7A 5F82A 5GLDA 3ZDJA 2Y4AA 3C4OA 1GA0A 1J9MA 4OVDA 1RP5A 5CERA 4E3IA 1CI8A 5AQ9A 1PZOA 3Q7ZA 4KZ3A 1E3UD 1PWDA 1WYBA 4Q8IA 4R0QA 1DJCA 3IHBA 1K55C 2OLUA 3PAGA 5CHJA 1XA1A 5I94A 4LV2A 5CECA 4GOGA 1RCJA 2ZC7A 4PMAA 1BLHA 2DCFA 2PBYA 3WS0A 1EI5A 5DF8A 3IH9A 5FQMA 3MZFA 4KZBA 4PM8A 1BLSA 4R1GA 3VP4A 1ES5A 2ZM2A 1DJBA 2EFUA 4KQQA 1TDGA 4N92A 1K4EA 4RVAA 2WKIA 4L0LA 2CC1A 1BZAA 2HDRA 2HDSA 2ZM0A 2ZQ9A 1ZG4A 4RX3A 1YMSA 4JLFA 3ZNYA 3A3EA 2JCHA 3NIAA 5M18A 4ZAMA 4QD4A 3IXDA 4U0TA 1FCOA 4DE2A 1PWGA 2WGVA 5HFOA 1PYYA 2ZC5B 3FKVA 1NYYA 3IHAA 1L0GA 4ID4A 3HBRA 3ZG8B 1Q2PA 3LY4A 2ZJ9A 4E3NA 4E6WA 1IELA 3HREA 2HP5A 3VFHA 1W7FA 4Y0OA 5AQ7A 4KZ7A 3RXXA 4ZJ2A 1TEMA 5CEDA 3G4PA 2IWBA 4S2OA 4Y0UA 4E3JA 1CEGA 4MBFA 5E2GA 4DXCA 3BFEA 4DDSA 1MWSA 3PBSA 2WKEA 1LLBA 2QPNA 4S2IA 3WS5A 3FWLA 2R9XA 4BD1A 3HLEA 3HLCA 5U47A 3VSKA 2EXAA 4CPKA 4BLMA 4S2KA 3AGEA 1S0WA 1XKZA 5AQBA 3HUMA 1MXOA 3NC8A 1EWZA 3N8RA 5KMWA 1MWUA 3O88A 4H8RA 5TR7A 3O86A 3D4FA 5AQAA 4FD8A 4C6YA 4OLDA 4OPZA 3IWIA 3HLDA 3C5AA 4OOMA 4XXRA 1PZPA 3ZCZA 5EOEA 1KDSA 2Y2HA 3Q7VA 4DE3A 2H0YA 3MKEA 2VGJA 4QY6A 1YLWA 1K6RA 3IXGA 3LEZA 4WZ5C 3VP3A 5GL9A 1AXBA 3PBOA 4MBKA 5HL1A 5FQJA 5EECA 4DF6A 1XA7A 4OLGA 3NCKA 1ERQA 4EQIA 4OH0A 1HD8A 2EFXA 3MXSA 1GA9A 2X01A 3ZHHA 5KZHA 1U60A 1LL9A 1QMEA 1ES4A 4JXVA 2ZQ8A 3AGDA 3IF6C 4HESA 1SKFA 4WELA 1JWZA 3A3IA 1ZG6A 4UAAA 1WYCA 3VOYA 1XGIA 4IBXA 4EV4A 1I2SA 5A93A 5KSCA 2XFSA 4LCMA 2BG1A 5EUAA 4GB7A 1YLTA 5DTKA 2WAFA 1NZUA 2XDMA 2OV5A 3VP1A 1SHVA 5J8XA 5FQKA 4HBUA 1I2WA 1KE0A 3NDEA 4P87A 2ZMAA 5CHMA 2J9PA 3V5MA 3A3DA 2X02A 3CZDA 3WRZA 4EUZA 4P0MA 2WZXA 4RYEA 3UE0A 3PBQA 3V3SA 1BULA 2G2UA 2WZZA 1IEMA 1NXYA 1E3UA 1LL5A 3FKWA 4LV3A 4U0XA 3SOIA 1YLZA 2WK0A 3VP0A 5FQQA 1IKGA 5M19A 1G6AA 4JXSA 3HLFA 4BQMA 4MLLA 1FR1A 4KENB 2WUQA 4GNUA 1JTDA 3G35A 1CEFA 5HAQA 4C3QA 5GHYA 1GHIA 4JF6A 2OLVA 4DDYA 2HP9A 1GHPA 3AGFA 1CI9A 1O7EA 4ZTKA 1K55A 4KZ6A 4R23A 1PIOA 3MFDA 1K54C 1K56A 1E4DA 5CHUA 3WS2A 4OKPA 1Z6FA 4N9LA 1ES2A 2A49A 3SH7A 4OQ0A 3V3RA 4OPRA 2Y59A 1LHYA 3GQZA 3BFGA 5FQIA 1ES3A 4KZAA 5A90A 2JBFA 5E2EA 3M6BA 1YLYA 2ZM8A 3M2KA 4UHUA 4QY5A 2ZQDA 3UE3A 5FA7A 5GLBA 4GZBA 2XFTA 3GRJA 4DE1A 2IWCA 4EBNA 2JC7A 3ITBA 1YMXA 1FOFA 4JBFA 5M1AA 3VSLA 1XX2A 2XGNA 4WMCD 3ZGAB 4R3JA 3CMZA 4B4ZA 4BENA 5IHVA 3C7VA 3G30A 3G2YA 2R9WA 3IWOA 3IF6B 4KG2A 4KZ4A 3RJUA 5CRFA 3QNBA 1E25A 2ZC3B 5BOHA 3BFFA 3QNCA 3GVBA 4Y0TA 2XQZA 3IH8A 4OQGA 5HARA 3TG9A 1NYMA 3PBRA 2QMIA 3TSGA 4LCLA 1YLPA 3LCEA 3Q82A 1W8QA 4U3TA 1IYQA 1H8ZA 1TVFA 4S2NC 5DTTA 4JF5A 4GKUA 1FR6A 3HVFA 3IXBA 5EVIC 3VOZA 4JKTA 3OC2A 1YQSA 3NDGA 4KQRA 4MEZA 3SH8A 1KGGA 4BJPA 4E3OA 2DRWA 3Q81A 3EQUA 3W4PA 3IT9A 4FH2A 4FH4A 5EVID 5A91A 3GR2A 2WYXA 4PM5A 3M2JA 1L0DA 4EWFA 4N1XA 2EX2A 1ALQA 1SCWA 2Y2GA 3W4OA 1MWTA 5FDHA 2XF3A 4GD8A 1NRFA 4R3BA 5L2FA 3UDFA 3UPPA 1ESUA 1ZC2A 2Z2LB 5E43A 4C75A 5KSHA 3PTEA 3IQAA 4E6XA 1RGZA 2J9OA 5GHXA 4ZJ3A 5FAPA 4DKIA 3G2ZA 4B4XA 2Y2OA 3GV9A 3IF5A 1YT4A 1K57A 1XP4A 2X71A 2V1ZA 1WE4A 5GLAA 2RL3A 4IEDA 1BT5A 4KZ9A 4OPYA 3C7UA 4LV1A 3B3XA 2H0TA 5EVLA 5EOOA 2WADA 1GCEA 2ZC4B 3M6HA 4ZDXA 2XH9A 4KG5A 4X69A 4S2LA 1GHMA 4S2JA 4GDNA 2H10A 4WZ5A 3G34A 3TOIA 3OCLA 3O87A 5HX9A 3UPNA 1S6RA 4OP5A 4RX2A 4OOLA 4KZ5A 3BFDA 5F1GA 5EPHA 1DJAA 3N4IA 3ZFZA 3C4PA 1TDLA 2Y2LA 1VM1A 4GD6A 2C6WB 4WEKA 3ZVWA 3N6IA 3LO7A 1KGEA 2C5WB 5F1FA 3IF6A 4QB8A 3S1YA 3N8LA 4PM6A 2UWXA 1NY0A 3UY6A 2XK1A 1BLCA 1O07A 2XD5A 2RCXA 1RGYA 1MPLA 3A3JA 4E3LA 5FI7A 3BLSA 4Z9QA 1C3BA 2OSUA 5GLCA 1VQQA 2Y2QA 5EVIB 1JTGA 3MBZA 2EX6A 2Y2JA 2Q9MA 3ZG7B 3W8KA 3OPHA 3HLBA
chains in the Genus database with same CATH superfamily
2YKFA 3ISGA 4DJ3A 2PRFA 4CLCB 2W3EA 4KQOA 1IYPA 5FDSA 2PD8A 3ZVTA 4XUZA 2EA9A 5CXWA 2FFFB 3CPTA 3UB5P 4ARZB 3KSGA 5J4EA 1Z09A 1H5XA 2OAQ1 1PI5A 3S4XA 2XLNA 4EXOA 4OQHA 2BLSA 3RFBA 2Y2NA 3U2AA 3FZCA 3BM6A 2FFYA 1HVBA 5CTMA 3NBLA 3HUNA 2ZC6B 2W1TA 3Q7VB 2INWA 3OPLA 1JNUA 2VLGA 1K56D 2OOLA 3WS1A 4LV0A 3MXRA 4NXEA 4OONA 4JXWA 2EXBA 3UMDA 2PU4A 5HWWA 4KZ8A 1MBLA 4LENA 4QJGA 3RXWA 3V39A 3DWKA 4RA7A 4PM7A 4UA9A 2IWDA 4S2MA 1PW8A 4NETA 3UE1A 3CLOA 1QMFA 3LIFA 1ZTUA 1H8YA 1G68A 1MWRA 5HSQA 5TGFA 4WYYA 3A0SA 3OPRA 2WGWA 2QWSA 2WKHA 2Z2MB 1XGJA 4X53A 2PR5A 3C38A 3BFCA 3IXHA 1P9WA 3UNWA 1Y54A 1KDWA 5D3OA 2QYBA 4R4SA 3L7HA 2DNSA 3MF0A 2BASA 1EROA 4O7DA 4JPMA 2ACGA 4PM9A 4EEPA 4QWOA 5FSRA 2QZ6A 4K91A 4OP8A 1L0EA 1K38A 5TBMA 4G3WA 3BRMA 4ZRRA 1LI9A 2P9VA 2Y2PA 4K0XA 2W3GA 5DFXA 5DF9A 3CJMA 1BSGA 2V2FF 4X56A 3ZDJA 2Y4AA 4E3IA 4HJ6A 1CI8A 4UEYA 2B18A 4KZ3A 3MQQA 4R0QA 1K55C 2R78A 1N9NA 1RCJA 1T1BA 2XA7S 2PBYA 3WS0A 1VETB 5DF8A 3IH9A 3F1OA 5FQMA 1VHMA 1BLSA 4R1GA 1TDGA 1K4EA 4L0LA 2CC1A 1BZAA 2HDSA 1MC0A 1ZG4A 4JLFA 1G5UA 3ZNYA 2JCHA 3NIAA 2ZC5B 1NYYA 3ZG8B 3LIDA 2ZJ9A 2PT7A 1IELA 3T1XA 2HP5A 1IFQA 2MJ6A 4KZ7A 3G4PA 5HPFA 4S2OA 4Y0UA 4E3JA 1CEGA 4I3IA 1OPXA 3D9YA 3WS5A 3FWLA 2R9XA 2KOIA 2EXAA 3IBJA 2P08A 1S0WA 4HQAA 4YNRA 4EESA 2JHEA 3N8RA 4H8RA 3O5YA 3O86A 5AQAA 4OLDA 2ZL1B 3IWIA 3HLDA 1PZPA 2Y2HA 1XJ3A 5L10A 5IS1A 3MKEA 4KQDA 3DTEA 2BTFP 4MBKA 5EECA 4NEED 4YOFA 1ERQA 3IX4A 2Q0OA 4EQIA 4LRZE 2EFXA 5KZHA 1LL9A 1A0KA 4UAAA 1JWZA 1ZG6A 4GS9A 1WYCA 4GW9A 4IBXA 4EV4A 5A93A 2XFSA 3KYZA 5KIZA 2HV1A 1NZUA 2JKRM 1CJFA 1SHVA 1SKOB 5CHMA 2ZMAA 3CZDA 4EUZA 3GDIA 4X1LA 3KO6A 3SOIA 4U0XA 3FKWA 1YKDA 3OOVA 5FQQA 5CX7A 4BQMA 3NOTC 4MLLA 1FR1A 4KENB 3QP1A 3A0VA 3IBRA 4R6LA 5J7EA 3MQOA 4ZTKA 1K54C 1LHYA 3KX0X 2JBFA 5E2EA 1S4RA 4DE1A 1ZHHB 5M1AA 4JBFA 3BQAA 3DBAA 3C7VA 3G30A 3MJQA 3G2YA 4KG2A 5HD5A 4GHIB 3IX3A 3QNBA 1E25A 2ZMVA 3QNCA 3GVBA 4HNBA 4OQGA 3TG9A 1NYMA 3IS2B 1YLPA 3PYPA 4U3TA 2EWWA 1IYQA 3ZYTA 4JF5A 3IXBA 5EVIC 1KGGA 4LRXC 5C5KA 3Q81A 4WN5A 3S7OA 2WYXA 4PM5A 4N1XA 2EX2A 1ALQA 1SCWA 3EEAA 5E43A 3T1QB 3K3CA 2J9OA 4ZJ3A 4DKIA 3LR3A 1FILA 3IF5A 1K57A 2X71A 1WE4A 3QP5A 4LV1A 4BWIA 5EOOA 2WADA 3M6HA 4ZDXA 4S2JA 2HZ5A 1S6RA 2J3WA 4KZ5A 5F1GA 3ZQ5A 1DJAA 3LFVA 4GD6A 3F1NA 3T4KA 3LO7A 4Q0IA 2C5WB 4QB8A 3CUEA 3S1YA 4PM6A 1VEUB 2UWXA 3UY6A 2XK1A 3A3JA 1C3BA 5DJUA 2Y2QA 2QJ7A 4X1MA 1L0FA 2LB5A 3OPHA 1BTLA 5FI6A 1LSXA 3Q1FA 4L9FA 3LIEA 2A3UA 3MZDA 1AWIA 3LUQA 3NY4A 1XFQA 2HPBA 3HJIA 4JXGA 2HDQA 1FQGA 3P09A 4BL2A 1UWNX 4K08A 1KVLA 1YSPA 4H6JA 1LL8A 2XR0A 3PHYA 4WM9A 4WMCA 5CTNA 4YWZA 3BYDA 3UPOA 5E2FA 4A5RA 2ZLYA 3PAEA 1ONHA 3F1PA 4MBHA 3DWZA 2Y79A 3B42A 3U4LP 2NUTC 4BBVA 3QP6A 4GDBA 3C8CA 4OOYA 3IWQA 2PR6A 5DFYA 2VGLS 4EEUA 5CGSA 1PWCA 4GS9B 5CGWA 3H82A 4CQHA 3CWFA 4HEFA 3UDIA 1SDNA 2J80A 4ZBEA 4F94A 1S4SA 1IYOA 1JWPA 1OJGA 5G18A 5G4ZA 3PXPA 4N1HA 4HP4A 1OTIA 4GJ4A 2Y2MA 3W4QA 1KGFA 1IOUA 1FSYA 1XPBA 4WZ4A 4FCFA 5DKLA 4BL3A 4EU0A 3WRTA 3BWLA 2PU2A 3PBNA 4Y13A 2A24A 3O3VA 3UN7A 1GSXA 2WAEA 3HLGA 1KVMA 2G2WA 4N9KA 5F69A 1K4FA 1J3WA 5HAIA 3T12B 3S22A 3SS5A 1WA9A 5DJTA 4M3KA 3HCYA 3BEBA 2V0UA 2PBDP 1YLJA 1BLPA 1W79A 2L0WA 5HW3A 1N9BA 4RQ9A 2Y2IA 4E3MA 4HJ3A 1M40A 3UDXA 3ZG9B 1PI4A 3I7JA 5DTSA 3FV7A 2V1BA 5GLDA 1DRMA 3DAVA 1RP5A 3TRCA 1PZOA 4XT2A 2D02A 4Q8IA 3D72A 5G4YA 4X25A 3IHBA 3PAGA 2OLUA 1XA1A 5I94A 1OTEA 5CECA 1BLHA 3T50A 4LPZA 2V8FA 2ZM2A 5HDSA 3CAXA 4RVAA 4ZAMA 2VJWA 3IXDA 1NRJA 1FCOA 4DE2A 1PWGA 1YAXA 1K0KA 3IHAA 1CQAA 3LY4A 4MCWA 4MDZA 1YSQA 3EOIA 2Z6DA 5HZHA 4ZJ2A 4O01A 1MWSA 2WKEA 2VV7A 3HLEA 5U47A 1V9YA 2PYRA 3AGEA 3R7WA 3HUMA 3CI6A 5KMWA 1MWUA 5TR7A 3QP4A 5LBRA 1UGUA 4OPZA 2M7UA 1T19A 1F9IA 4XXRA 3ZCZA 1KDSA 3UB9A 2VGJA 5HPIA 4WLAA 4IHQA 4LGWA 5HL1A 2XRNA 5IU1A 5AJGA 2HJEA 4HP9A 4OH0A 2QKPA 1GA9A 1S1ZA 3ZHHA 1U60A 1NLYA 4JXVA 1P97A 2ZQ8A 3AGDA 4HESA 1SKFA 3VOYA 1I2SA 4JGPA 3LR0A 3LIBA 4GB7A 4M4XA 5DTKA 2WAFA 2H28A 4MMNA 4R38A 4LLOB 5EVEA 2XROA 1I2WA 1UWPX 1KE0A 3NDEA 4P87A 2ZOIA 3LYXA 4PHTA 3WRZA 2KX6A 1NLZA 2WZXA 4RYEA 3V3SA 4LV3A 2G2UA 2WZZA 1NXYA 1E3UA 2WK0A 3SW1A 3VP0A 1IKGA 1G6AA 1LSVA 4BBTA 4HIAA 3EGDC 3G35A 3E0YA 3LGOA 4C3QA 1GHIA 2QHKA 1GHPA 1O7EA 1K55A 3FPWA 1Y4OA 3QP2A 4N9LA 1ES2A 5TJJA 3BFGA 5FQIA 4ETXA 1OT6A 3M6BA 1YLYA 3T4TA 4UHUA 3H9WA 2A24B 4EBNA 1YMXA 1FOFA 4Q0JA 3VSLA 1XX2A 3ZGAB 1GSVA 4R3JA 3IWOA 3RJUA 3IF6B 5CRFA 2W1RA 2ZC3B 3T4JA 3BFFA 4IUKA 4Y0TA 3TSGA 2VGLM 1TVFA 4S2NC 1TD5A 3CHWP 4KQRA 2DRWA 3EQUA 3IT9A 1L0DA 4EWFA 2Y2GA 5HWTA 1YPRA 5L2FA 1ESUA 1ZC2A 2Z2LB 3P7NA 3TJZC 5KSHA 3FC7A 3CPTB 4E6XA 1MKMA 2L1MA 3G2ZA 2AVXA 2HGVA 4B4XA 3GV9A 5EV0A 4IEDA 4OPYA 3C7UA 1V9ZA 2XH9A 4S2LA 2H10A 4GLQA 3LIAA 2QJ5A 3UPNA 3T4LA 4OOLA 2W1TB 5EPHA 4O8GA 3ZFZA 3NOUC 1TDLA 2Y2LA 4WF0A 3N6IA 4NXFA 3NECA 1ODVA 1NY0A 2RCXA 2GJ3A 1MPLA 5FI7A 2ZMFA 4Z9QA 2JKGA 2OSUA 5GLCA 1VQQA 4R70A 5EM1A 1W63M 5AVFA 4P6ZS 2Y2JA 3ZG7B 4ETZA 3W8KA 3HLBA 2J8YA 2A2LA 3L9KA 4DE0A 5FASA 1I5QA 1CK3A 4UA7A 2I72A 5E2HA 2OAP1 3UB7A 2OWHA 3UB8A 3LR4A 3UO9A 1W63Q 1N4OA 1NJ4A 3ITAA 4QHCA 1W5DA 1KE3A 4YINA 1K54A 1F5MA 5CEBA 2UV0E 1K25A 4QU3A 2WGWB 1JWVA 1MY8A 2Y91A 4WBGA 4IBRA 3ZG5A 1OTBA 4F3LA 4WL9A 1X0OA 1G28A 3HL9A 5FL3A 3FPVA 3DTMA 3BECA 5JYPA 4MNRA 3CITA 5L07A 3P98A 3IX8A 2EX8A 3A3FA 5FQ9A 4P6BA 2O0YA 4G3KA 1MZUA 1SDEA 1TS8A 2VGKA 1STZA 5A92A 4UA6A 5EVIA 1LI0A 5TBMB 1KE4A 5JYOA 2P9VB 3NI9A 3JVVA 4CLCA 3SH9A 5DF7A 1W8YA 1OMEA 2P74A 2V20A 3DW0A 4FSFA 2JKRI 3ZNTA 4EBPA 5K5BA 1FSWA 5DKKA 2J7VA 3NHQA 4ARZA 4Y5FA 4L9EA 4EUVA 2V1AA 4DMZA 1N9OA 5TFQA 3CG5A 1FCNA 5F83A 2K2NA 4HOIA 2ZBBA 1IKIA 2O9AA 3VE4A 2W3FA 4OPQA 3N7WA 5FI2A 1S1YA 1K57C 2E8JA 3F1OB 4R4RA 2ZQ7A 5EE8A 4L9GA 5GHZA 3HUOA 2HF6A 2B5RA 2XEPA 1HZOA 4JF4A 4X55A 1ONGA 4IVIA 3GMWA 1DP8A 2GNXA 4HY8A 4DRTA 3MKFA 1PW1A 2ZQCA 3LY3A 3E2KA 1HTZA 3R4KA 1PRQA 3QP8A 3VP2A 3WWXA 4DN0A 1XXMA 5FAOA 3KSIA 4Z1WA 2HP6A 2VEAA 1J9MA 3GECA 4OVDA 5CERA 2O9CA 1PWDA 2PAVP 1DJCA 3LI9A 4LV2A 1XJ6A 2XA7M 2ZC7A 4ME4A 3MZFA 4KZBA 4PM8A 3VP4A 1ES5A 4N92A 1OJ5A 2HDRA 2ZM0A 3ICYA 2O9BA 2VX8A 2JKTI 3A3EA 2LB9A 5M18A 4QD4A 2WGVA 5HFOA 1PYYA 4E6WA 3HBRA 3LI8A 1Q2PA 5FEFA 3VFHA 3E4PA 5AQ7A 4BBUA 2EWVA 1TEMA 2JKFA 2IWBA 4WUJA 4MBFA 5E2GA 4DXCA 3LR5A 5F5YA 3PBSA 1LLBA 5MC7A 4S2IA 4BD1A 3VSKA 1OTAA 4CPKA 2Y8HA 3HJKA 1N9LA 1XKZA 1MXOA 2W27A 3O88A 2KDKA 1TS0A 3D4FA 2VZWA 3NJAA 4CLCD 3C5AA 4I5SA 4OOMA 3MR0A 3JVUA 1VETA 3V67A 1K6RA 3E98A 3LEZA 4WZ5C 1H3QA 5FQJA 1XA7A 3G6OA 3NCKA 2V8CA 1HD8A 3MXSA 5HD3A 2L4RA 3C30A 2X01A 3IF6C 4WELA 3A3IA 4LCMA 5EUAA 2XDMA 2OV5A 5J8XA 2DMWA 4HBUA 4HH2A 4P6ZM 3V5MA 2J9PA 3A3DA 2X02A 4EQ1A 4P0MA 3UE0A 3VMAA 3PBQA 4B4ZA 1T1CA 3DTKA 1YLZA 4JGOA 4JXSA 3W2ZA 5F68A 3HLFA 2WUQA 1JTDA 1CEFA 5GHYA 4JF6A 2OLVA 4DDYA 2HP9A 3AGFA 4KZ6A 3MFDA 2ZL1A 3WS2A 3SH7A 2A49A 3D3OA 3MFXA 3H7WA 4KZAA 5A90A 3M2KA 4QY5A 2ZQDA 5GLBA 4GZBA 4EW7A 2FZ0A 2IWCA 4I3JA 3MXQA 2XGNA 4WMCD 3VE3A 2NUPC 3CMZA 3F1NB 4BENA 5IHVA 4KZ4A 4D60A 2XQZA 5HARA 2QMIA 3Q82A 5DTTA 3HVFA 1SKOA 3OC2A 3VOLA 1YQSA 4MEZA 3SH8A 1BYWA 4E3OA 3BJNA 3T4QA 4FH4A 5A91A 3GR2A 3M2JA 3W4OA 1MWTA 1Y28A 2XF3A 5FDHA 4GD8A 4R3BA 1L3LA 3UDFA 2O99A 4C75A 3B33A 4IUHA 5GHXA 3KSFA 2Y2OA 1XP4A 2VKSA 4HI4A 2V1ZA 2PD7A 3FG8A 4H6JB 3K3DA 3B3XA 1GCEA 5EFWA 3TW8A 4GDNA 1FIKA 3G34A 3TOIA 3OCLA 4EETB 3O87A 4B93A 3A0RA 4MN6A 4OP5A 4RX2A 2J3TD 3F1PB 1LT0A 1H0MA 1VM1A 3ZVWA 3MQ0A 4GHIA 3N8LA 1BLCA 4IJGA 1RGYA 4E3LA 5AVEA 3IS2A 4I3AA 2B02A 1JTGA 2EX6A 4Y17A 1KOUA 3H82B 3JYIA 2ZQAA 1IYSA 3SS4A 5HAPA 2WGIA 5HDDA 3Q07A 3WS4A 4NK3A 5CGXA 3HLWA 3RH8B 4JGRA 1MKIA 1NZOA 2Y2KA 1NWZA 4EERA 3FYZA 5L09A 3ZG0A 1L2SA 2CMNA 2Y55A 4BD0A 4PAUA 5L8MA 4YFMA 3K2NA 4ZJ1A 2Z6CA 2HDUA 3EGXC 2XD1A 4NG2A 4EBLA 5DVAA 4B88A 4AFIA 4IVKA 1TS6A 1JVJA 4X6TA 2W3DA 1VEUA 4X68A 2Q9NA 3GSGA 1S66L 4K0WA 3EQVA 4QPRA 1YM1A 2H5SA 2JN7A 2G7UA 1F98A 1M6KA 4S2NA 3NULA 4PKYG 4JGQA 1Q2QA 4HBTA 2K31A 4I39A 3OZHA 2GDNA 4UQIS 4S2PA 4LRYC 3V50A 4KG6A 3GTCA 3OCNA 1ZKJA 1HLUP 4D2OA 4Y7PA 3RTYA 2IA2A 3MSHA 3BY8A 1D06A 4XT2B 1DP6A 2W0NA 4GCZA 1K6SA 2PYPA 4KUKA 3KSHA 4DXBA 1ESIA 2K7SA 4ESPA 1F2KA 3E2LA 4CJNA 4WEJA 5FAQA 3SZTA 3BLMA 2E8IA 3G32A 2M1CA 3E4OA 3H7WB 4PPRA 4NXGA 3UB6A 3BY9A 3PBTA 4XUXA 3VV4A 4HJ4A 3T1SA 1FCMA 3QHYA 4P85A 1CF0A 1XFNA 3UE6A 4E3KA 4DJ2A 1VB6A 3S7QA 2V0WA 3VFFA 2JE5A 1DY6A 1XJ4A 3OPPA 3G31A 3N8SA 4OQIA 2GZAA 3MMHA 3SS3A 2HJ9C 5EM0A 1ERMA 1PNEA 5FATA 4GN2A 3MZEA 3S7NA 1BUEA 2EX9A 2ZD8A 5F82A 3R7WB 3C4OA 3JPUA 1GA0A 3C2WA 2PDRA 5AQ9A 3Q7ZA 1E3UD 1WYBA 4HHDA 5CHJA 3TE8A 4GOGA 4PMAA 2DCFA 3MS6A 1EI5A 1T1AA 3UMEA 2ZOHA 4CLCE 3LICA 1DJBA 2EFUA 4KQQA 2OWJA 2WKIA 2ZQ9A 2WKQA 4RX3A 1YMSA 5HL6A 3DTIA 4NKPA 4U0TA 1P9RA 3S7PA 3T1RA 3FKVA 2D01A 1L0GA 4ID4A 4G3VA 4E3NA 4R3AA 3HREA 1W7FA 4Y0OA 5A8BA 3RXXA 1OTDA 5CEDA 3KYEA 2VA0A 3EWKA 4Y2FA 3BFEA 4DDSA 1D1JA 4I38A 2QPNA 2VV6A 3OBFA 3HLCA 3OLOA 4O0PA 4BLMA 4S2KA 3B47A 4CLCC 5AQBA 3NC8A 1EWZA 4MN5A 4FD8A 4C6YA 3LEQA 5J3WA 1S67L 1PFLA 4KUOA 5I5LA 5EOEA 1XJ2A 3Q7VA 4DE3A 2H0YA 4QY6A 2W3HA 1YLWA 3IXGA 3VP3A 5GL9A 1AXBA 3PBOA 2JKTM 3NOPC 2PHYA 4DF6A 1ACFA 4OLGA 2FH5A 2GX5A 1QMEA 1ES4A 2WKRA 3CUEC 1XGIA 5KSCA 1P0ZA 2BG1A 3E4QA 5HWVA 1YLTA 4B9OA 1TS7A 3VP1A 5FQKA 5IT5A 2XSSA 1BULA 1IEMA 1LL5A 1T18A 2P04A 5M19A 3P01A 4GNUA 5HAQA 4Y15A 1CI9A 4PKYA 4R23A 1PIOA 1K56A 1E4DA 5CHUA 4OKPA 1Z6FA 4OQ0A 3V3RA 4OPRA 2Y59A 3GQZA 1ES3A 2ZM8A 4Y3IA 3UE3A 5FA7A 1D7EA 2XFTA 3GRJA 2P7JA 2JC7A 2WKPA 3ITBA 2R9WA 5HDCA 4II7A 4E04A 4FTXA 5BOHA 1OT9A 3IH8A 3ULFA 5F6AA 3PBRA 4LCLA 3LCEA 1W8QA 1H8ZA 4GKUA 1FR6A 3EEHA 1EW0A 3VOZA 1H8MA 4JKTA 3NDGA 4BJPA 2YKHA 4FUWA 3T4SA 3W4PA 4FH2A 5EVID 4MN7A 2KLIA 1GSWA 2B95A 4UQIM 3BQ8A 1NRFA 3BW6A 3UPPA 3KYQA 4Q0HA 3PTEA 3IQAA 1RGZA 2I9VA 5FAPA 1YT4A 5GLAA 2RL3A 1BT5A 4KZ9A 5FEGA 2H0TA 5EVLA 3T4OA 2ZC4B 4KG5A 4X69A 1GHMA 4F3LB 2J3TC 4WZ5A 1TF1A 5HX9A 2M7VA 3BFDA 1LSWA 3N4IA 3C4PA 4FOFA 2C6WB 4WEKA 1G6OA 2VV8A 1DP9A 1KGEA 5F1FA 3IF6A 4HH3A 2V9AA 3PR6A 1SZVA 2VK3A 1O07A 2XD5A 3BLSA 4NXBA 4BMWA 4LFUA 5EVIB 3MBZA 2Q9MA
chains in the Genus database with same CATH topology
3ISGA 1BTLA 2J8YA 3JYIA 5FI6A 1L0FA 2ZQAA 1IYSA 3Q1FA 3SS4A 5HAPA 2WGIA 4DE0A 3Q07A 3WS4A 2A3UA 3MZDA 5FASA 4KQOA 1I5QA 3UPOA 3NY4A 4NK3A 1IYPA 1CK3A 4UA7A 2I72A 2HPBA 3HLWA 5CGXA 5E2HA 3ZVTA 4XUZA 1MKIA 1NZOA 4JXGA 5CXWA 2HDQA 1FQGA 2FFFB 2Y2KA 3UO9A 1N4OA 1NJ4A 3FYZA 3ITAA 4QHCA 1W5DA 3P09A 3ZG0A 4BL2A 1H5XA 1L2SA 1KE3A 1PI5A 4YINA 1K54A 3S4XA 5CEBA 2XLNA 1KVLA 2Y55A 4BD0A 4OQHA 1K25A 2BLSA 2XR0A 2Y2NA 2WGWB 1JWVA 1MY8A 2Y91A 4QU3A 4WBGA 4IBRA 3ZG5A 4YFMA 3FZCA 4WM9A 4ZJ1A 4WMCA 3BM6A 3HL9A 2HDUA 2FFYA 5CTNA 1HVBA 2XD1A 3BYDA 5CTMA 3NBLA 5E2FA 3HUNA 2ZC6B 4A5RA 3Q7VB 2ZLYA 3PAEA 3OPLA 5DVAA 1ONHA 4EBLA 4B88A 1K56D 3DWZA 4MBHA 3WS1A 3DTMA 4IVKA 3BECA 4LV0A 5JYPA 3MXRA 4MNRA 1JVJA 4X6TA 4X68A 3P98A 4GDBA 4OONA 2Q9NA 4JXWA 4OOYA 3GSGA 3IWQA 2EX8A 4K0WA 3A3FA 3EQVA 5FQ9A 1YM1A 4P6BA 2EXBA 2H5SA 2PU4A 1M6KA 4S2NA 4KZ8A 1MBLA 1PWCA 1SDEA 5CGSA 2VGKA 4LENA 4QJGA 4UA6A 5EVIA 3RXWA 3V39A 5A92A 5CGWA 1Q2QA 4HBTA 3DWKA 1LI0A 1KE4A 4RA7A 4PM7A 4UA9A 5JYOA 2IWDA 4S2MA 2P9VB 1PW8A 3NI9A 4HEFA 3OZHA 3UDIA 2GDNA 3SH9A 1SDNA 4NETA 5DF7A 4ZBEA 1W8YA 1OMEA 2P74A 2V20A 3DW0A 4FSFA 4S2PA 3UE1A 1QMFA 1IYOA 1JWPA 4F94A 5G18A 3ZNTA 4EBPA 3V50A 1FSWA 4KG6A 1H8YA 3GTCA 3OCNA 1G68A 1ZKJA 2J7VA 4D2OA 4N1HA 4Y7PA 1MWRA 5TGFA 2Y2MA 4WYYA 3W4QA 1KGFA 5TFQA 3OPRA 3CG5A 1FSYA 1XPBA 4WZ4A 1FCNA 1K6SA 4FCFA 5F83A 4BL3A 2WGWA 1IKIA 4DXBA 1ESIA 4OPQA 3WRTA 2WKHA 3N7WA 2Z2MB 5FI2A 1XGJA 4X53A 2PU2A 1K57C 3BFCA 3PBNA 3E2LA 3IXHA 3O3VA 3UNWA 4CJNA 4WEJA 5FAQA 4R4RA 2ZQ7A 3BLMA 2E8IA 1Y54A 3G32A 3UN7A 1KDWA 5EE8A 4PPRA 5D3OA 2WAEA 5GHZA 3HLGA 3HUOA 4R4SA 3PBTA 2B5RA 2DNSA 4XUXA 1KVMA 2XEPA 2G2WA 3VMAA 4N9KA 1HZOA 1EROA 4O7DA 4JF4A 1FCMA 3QHYA 4X55A 1K4FA 1ONGA 4JPMA 4P85A 4IVIA 4PM9A 3GMWA 5HAIA 4E3KA 3S22A 3SS5A 4M3KA 3VFFA 4DRTA 3MKFA 1PW1A 2JE5A 2ZQCA 5FSRA 1DY6A 2QZ6A 3BEBA 3OPPA 3LY3A 4K91A 4OP8A 1L0EA 3E2KA 1HTZA 1K38A 3G31A 3N8SA 4OQIA 1YLJA 3BRMA 1BLPA 1W79A 1LI9A 3SS3A 2P9VA 5HW3A 2Y2PA 1N9BA 4K0XA 2Y2IA 5DF9A 1ERMA 3CJMA 5FATA 3VP2A 3WWXA 4E3MA 1XXMA 1M40A 4GN2A 1BSGA 3UDXA 3MZEA 5FAOA 2V2FF 1BUEA 3ZG9B 1PI4A 3I7JA 2EX9A 2HP6A 2ZD8A 5DTSA 4X56A 3FV7A 5F82A 5GLDA 3ZDJA 2Y4AA 3C4OA 1GA0A 1J9MA 4OVDA 1RP5A 5CERA 4E3IA 1CI8A 5AQ9A 1PZOA 3Q7ZA 4KZ3A 1E3UD 1PWDA 1WYBA 4Q8IA 4R0QA 1DJCA 3IHBA 1K55C 2OLUA 3PAGA 5CHJA 1XA1A 5I94A 4LV2A 5CECA 4GOGA 1RCJA 2ZC7A 4PMAA 1BLHA 2DCFA 2PBYA 3WS0A 1EI5A 5DF8A 3IH9A 5FQMA 3MZFA 4KZBA 4PM8A 1BLSA 4R1GA 3VP4A 1ES5A 2ZM2A 1DJBA 2EFUA 4KQQA 1TDGA 4N92A 1K4EA 4RVAA 2WKIA 4L0LA 2CC1A 1BZAA 2HDRA 2HDSA 2ZM0A 2ZQ9A 1ZG4A 4RX3A 1YMSA 4JLFA 3ZNYA 3A3EA 2JCHA 3NIAA 5M18A 4ZAMA 4QD4A 3IXDA 4U0TA 1FCOA 4DE2A 1PWGA 2WGVA 5HFOA 1PYYA 2ZC5B 3FKVA 1NYYA 3IHAA 1L0GA 4ID4A 3HBRA 3ZG8B 1Q2PA 3LY4A 2ZJ9A 4E3NA 4E6WA 1IELA 3HREA 2HP5A 3VFHA 1W7FA 4Y0OA 5AQ7A 4KZ7A 3RXXA 4ZJ2A 1TEMA 5CEDA 3G4PA 2IWBA 4S2OA 4Y0UA 4E3JA 1CEGA 4MBFA 5E2GA 4DXCA 3BFEA 4DDSA 1MWSA 3PBSA 2WKEA 1LLBA 2QPNA 4S2IA 3WS5A 3FWLA 2R9XA 4BD1A 3HLEA 3HLCA 5U47A 3VSKA 2EXAA 4CPKA 4BLMA 4S2KA 3AGEA 1S0WA 1XKZA 5AQBA 3HUMA 1MXOA 3NC8A 1EWZA 3N8RA 5KMWA 1MWUA 3O88A 4H8RA 5TR7A 3O86A 3D4FA 5AQAA 4FD8A 4C6YA 4OLDA 4OPZA 3IWIA 3HLDA 3C5AA 4OOMA 4XXRA 1PZPA 3ZCZA 5EOEA 1KDSA 2Y2HA 3Q7VA 4DE3A 2H0YA 3MKEA 2VGJA 4QY6A 1YLWA 1K6RA 3IXGA 3LEZA 4WZ5C 3VP3A 5GL9A 1AXBA 3PBOA 4MBKA 5HL1A 5FQJA 5EECA 4DF6A 1XA7A 4OLGA 3NCKA 1ERQA 4EQIA 4OH0A 1HD8A 2EFXA 3MXSA 1GA9A 2X01A 3ZHHA 5KZHA 1U60A 1LL9A 1QMEA 1ES4A 4JXVA 2ZQ8A 3AGDA 3IF6C 4HESA 1SKFA 4WELA 1JWZA 3A3IA 1ZG6A 4UAAA 1WYCA 3VOYA 1XGIA 4IBXA 4EV4A 1I2SA 5A93A 5KSCA 2XFSA 4LCMA 2BG1A 5EUAA 4GB7A 1YLTA 5DTKA 2WAFA 1NZUA 2XDMA 2OV5A 3VP1A 1SHVA 5J8XA 5FQKA 4HBUA 1I2WA 1KE0A 3NDEA 4P87A 2ZMAA 5CHMA 2J9PA 3V5MA 3A3DA 2X02A 3CZDA 3WRZA 4EUZA 4P0MA 2WZXA 4RYEA 3UE0A 3PBQA 3V3SA 1BULA 2G2UA 2WZZA 1IEMA 1NXYA 1E3UA 1LL5A 3FKWA 4LV3A 4U0XA 3SOIA 1YLZA 2WK0A 3VP0A 5FQQA 1IKGA 5M19A 1G6AA 4JXSA 3HLFA 4BQMA 4MLLA 1FR1A 4KENB 2WUQA 4GNUA 1JTDA 3G35A 1CEFA 5HAQA 4C3QA 5GHYA 1GHIA 4JF6A 2OLVA 4DDYA 2HP9A 1GHPA 3AGFA 1CI9A 1O7EA 4ZTKA 1K55A 4KZ6A 4R23A 1PIOA 3MFDA 1K54C 1K56A 1E4DA 5CHUA 3WS2A 4OKPA 1Z6FA 4N9LA 1ES2A 2A49A 3SH7A 4OQ0A 3V3RA 4OPRA 2Y59A 1LHYA 3GQZA 3BFGA 5FQIA 1ES3A 4KZAA 5A90A 2JBFA 5E2EA 3M6BA 1YLYA 2ZM8A 3M2KA 4UHUA 4QY5A 2ZQDA 3UE3A 5FA7A 5GLBA 4GZBA 2XFTA 3GRJA 4DE1A 2IWCA 4EBNA 2JC7A 3ITBA 1YMXA 1FOFA 4JBFA 5M1AA 3VSLA 1XX2A 2XGNA 4WMCD 3ZGAB 4R3JA 3CMZA 4B4ZA 4BENA 5IHVA 3C7VA 3G30A 3G2YA 2R9WA 3IWOA 3IF6B 4KG2A 4KZ4A 3RJUA 5CRFA 3QNBA 1E25A 2ZC3B 5BOHA 3BFFA 3QNCA 3GVBA 4Y0TA 2XQZA 3IH8A 4OQGA 5HARA 3TG9A 1NYMA 3PBRA 2QMIA 3TSGA 4LCLA 1YLPA 3LCEA 3Q82A 1W8QA 4U3TA 1IYQA 1H8ZA 1TVFA 4S2NC 5DTTA 4JF5A 4GKUA 1FR6A 3HVFA 3IXBA 5EVIC 3VOZA 4JKTA 3OC2A 1YQSA 3NDGA 4KQRA 4MEZA 3SH8A 1KGGA 4BJPA 4E3OA 2DRWA 3Q81A 3EQUA 3W4PA 3IT9A 4FH2A 4FH4A 5EVID 5A91A 3GR2A 2WYXA 4PM5A 3M2JA 1L0DA 4EWFA 4N1XA 2EX2A 1ALQA 1SCWA 2Y2GA 3W4OA 1MWTA 5FDHA 2XF3A 4GD8A 1NRFA 4R3BA 5L2FA 3UDFA 3UPPA 1ESUA 1ZC2A 2Z2LB 5E43A 4C75A 5KSHA 3PTEA 3IQAA 4E6XA 1RGZA 2J9OA 5GHXA 4ZJ3A 5FAPA 4DKIA 3G2ZA 4B4XA 2Y2OA 3GV9A 3IF5A 1YT4A 1K57A 1XP4A 2X71A 2V1ZA 1WE4A 5GLAA 2RL3A 4IEDA 1BT5A 4KZ9A 4OPYA 3C7UA 4LV1A 3B3XA 2H0TA 5EVLA 5EOOA 2WADA 1GCEA 2ZC4B 3M6HA 4ZDXA 2XH9A 4KG5A 4X69A 4S2LA 1GHMA 4S2JA 4GDNA 2H10A 4WZ5A 3G34A 3TOIA 3OCLA 3O87A 5HX9A 3UPNA 1S6RA 4OP5A 4RX2A 4OOLA 4KZ5A 3BFDA 5F1GA 5EPHA 1DJAA 3N4IA 3ZFZA 3C4PA 1TDLA 2Y2LA 1VM1A 4GD6A 2C6WB 4WEKA 3ZVWA 3N6IA 3LO7A 1KGEA 2C5WB 5F1FA 3IF6A 4QB8A 3S1YA 3N8LA 4PM6A 2UWXA 1NY0A 3UY6A 2XK1A 1BLCA 1O07A 2XD5A 2RCXA 1RGYA 1MPLA 3A3JA 4E3LA 5FI7A 3BLSA 4Z9QA 1C3BA 2OSUA 5GLCA 1VQQA 2Y2QA 5EVIB 1JTGA 3MBZA 2EX6A 2Y2JA 2Q9MA 3ZG7B 3W8KA 3OPHA 3HLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ISG A;  1BTL A;  2J8Y A;  3JYI A;  5FI6 A;  1L0F A;  2ZQA A;  1IYS A;  3Q1F A;  3SS4 A;  5HAP A;  2WGI A;  4DE0 A;  3Q07 A;  3WS4 A;  2A3U A;  3MZD A;  5FAS A;  4KQO A;  1I5Q A;  3UPO A;  3NY4 A;  4NK3 A;  1IYP A;  1CK3 A;  4UA7 A;  2I72 A;  2HPB A;  3HLW A;  5CGX A;  5E2H A;  3ZVT A;  4XUZ A;  1MKI A;  1NZO A;  4JXG A;  5CXW A;  2HDQ A;  1FQG A;  2FFF B;  2Y2K A;  3UO9 A;  1N4O A;  1NJ4 A;  3FYZ A;  3ITA A;  4QHC A;  1W5D A;  3P09 A;  3ZG0 A;  4BL2 A;  1H5X A;  1L2S A;  1KE3 A;  1PI5 A;  4YIN A;  1K54 A;  3S4X A;  5CEB A;  2XLN A;  1KVL A;  2Y55 A;  4BD0 A;  4OQH A;  1K25 A;  2BLS A;  2XR0 A;  2Y2N A;  2WGW B;  1JWV A;  1MY8 A;  2Y91 A;  4QU3 A;  4WBG A;  4IBR A;  3ZG5 A;  4YFM A;  3FZC A;  4WM9 A;  4ZJ1 A;  4WMC A;  3BM6 A;  3HL9 A;  2HDU A;  2FFY A;  5CTN A;  1HVB A;  2XD1 A;  3BYD A;  5CTM A;  3NBL A;  5E2F A;  3HUN A;  2ZC6 B;  4A5R A;  3Q7V B;  2ZLY A;  3PAE A;  3OPL A;  5DVA A;  1ONH A;  4EBL A;  4B88 A;  1K56 D;  3DWZ A;  4MBH A;  3WS1 A;  3DTM A;  4IVK A;  3BEC A;  4LV0 A;  5JYP A;  3MXR A;  4MNR A;  1JVJ A;  4X6T A;  4X68 A;  3P98 A;  4GDB A;  4OON A;  2Q9N A;  4JXW A;  4OOY A;  3GSG A;  3IWQ A;  2EX8 A;  4K0W A;  3A3F A;  3EQV A;  5FQ9 A;  1YM1 A;  4P6B A;  2EXB A;  2H5S A;  2PU4 A;  1M6K A;  4S2N A;  4KZ8 A;  1MBL A;  1PWC A;  1SDE A;  5CGS A;  2VGK A;  4LEN A;  4QJG A;  4UA6 A;  5EVI A;  3RXW A;  3V39 A;  5A92 A;  5CGW A;  1Q2Q A;  4HBT A;  3DWK A;  1LI0 A;  1KE4 A;  4RA7 A;  4PM7 A;  4UA9 A;  5JYO A;  2IWD A;  4S2M A;  2P9V B;  1PW8 A;  3NI9 A;  4HEF A;  3OZH A;  3UDI A;  2GDN A;  3SH9 A;  1SDN A;  4NET A;  5DF7 A;  4ZBE A;  1W8Y A;  1OME A;  2P74 A;  2V20 A;  3DW0 A;  4FSF A;  4S2P A;  3UE1 A;  1QMF A;  1IYO A;  1JWP A;  4F94 A;  5G18 A;  3ZNT A;  4EBP A;  3V50 A;  1FSW A;  4KG6 A;  1H8Y A;  3GTC A;  3OCN A;  1G68 A;  1ZKJ A;  2J7V A;  4D2O A;  4N1H A;  4Y7P A;  1MWR A;  5TGF A;  2Y2M A;  4WYY A;  3W4Q A;  1KGF A;  5TFQ A;  3OPR A;  3CG5 A;  1FSY A;  1XPB A;  4WZ4 A;  1FCN A;  1K6S A;  4FCF A;  5F83 A;  4BL3 A;  2WGW A;  1IKI A;  4DXB A;  1ESI A;  4OPQ A;  3WRT A;  2WKH A;  3N7W A;  2Z2M B;  5FI2 A;  1XGJ A;  4X53 A;  2PU2 A;  1K57 C;  3BFC A;  3PBN A;  3E2L A;  3IXH A;  3O3V A;  3UNW A;  4CJN A;  4WEJ A;  5FAQ A;  4R4R A;  2ZQ7 A;  3BLM A;  2E8I A;  1Y54 A;  3G32 A;  3UN7 A;  1KDW A;  5EE8 A;  4PPR A;  5D3O A;  2WAE A;  5GHZ A;  3HLG A;  3HUO A;  4R4S A;  3PBT A;  2B5R A;  2DNS A;  4XUX A;  1KVM A;  2XEP A;  2G2W A;  3VMA A;  4N9K A;  1HZO A;  1ERO A;  4O7D A;  4JF4 A;  1FCM A;  3QHY A;  4X55 A;  1K4F A;  1ONG A;  4JPM A;  4P85 A;  4IVI A;  4PM9 A;  3GMW A;  5HAI A;  4E3K A;  3S22 A;  3SS5 A;  4M3K A;  3VFF A;  4DRT A;  3MKF A;  1PW1 A;  2JE5 A;  2ZQC A;  5FSR A;  1DY6 A;  2QZ6 A;  3BEB A;  3OPP A;  3LY3 A;  4K91 A;  4OP8 A;  1L0E A;  3E2K A;  1HTZ A;  1K38 A;  3G31 A;  3N8S A;  4OQI A;  1YLJ A;  3BRM A;  1BLP A;  1W79 A;  1LI9 A;  3SS3 A;  2P9V A;  5HW3 A;  2Y2P A;  1N9B A;  4K0X A;  2Y2I A;  5DF9 A;  1ERM A;  3CJM A;  5FAT A;  3VP2 A;  3WWX A;  4E3M A;  1XXM A;  1M40 A;  4GN2 A;  1BSG A;  3UDX A;  3MZE A;  5FAO A;  2V2F F;  1BUE A;  3ZG9 B;  1PI4 A;  3I7J A;  2EX9 A;  2HP6 A;  2ZD8 A;  5DTS A;  4X56 A;  3FV7 A;  5F82 A;  5GLD A;  3ZDJ A;  2Y4A A;  3C4O A;  1GA0 A;  1J9M A;  4OVD A;  1RP5 A;  5CER A;  4E3I A;  1CI8 A;  5AQ9 A;  1PZO A;  3Q7Z A;  4KZ3 A;  1E3U D;  1PWD A;  1WYB A;  4Q8I A;  4R0Q A;  1DJC A;  3IHB A;  1K55 C;  2OLU A;  3PAG A;  5CHJ A;  1XA1 A;  5I94 A;  4LV2 A;  5CEC A;  4GOG A;  1RCJ A;  2ZC7 A;  4PMA A;  1BLH A;  2DCF A;  2PBY A;  3WS0 A;  1EI5 A;  5DF8 A;  3IH9 A;  5FQM A;  3MZF A;  4KZB A;  4PM8 A;  1BLS A;  4R1G A;  3VP4 A;  1ES5 A;  2ZM2 A;  1DJB A;  2EFU A;  4KQQ A;  1TDG A;  4N92 A;  1K4E A;  4RVA A;  2WKI A;  4L0L A;  2CC1 A;  1BZA A;  2HDR A;  2HDS A;  2ZM0 A;  2ZQ9 A;  1ZG4 A;  4RX3 A;  1YMS A;  4JLF A;  3ZNY A;  3A3E A;  2JCH A;  3NIA A;  5M18 A;  4ZAM A;  4QD4 A;  3IXD A;  4U0T A;  1FCO A;  4DE2 A;  1PWG A;  2WGV A;  5HFO A;  1PYY A;  2ZC5 B;  3FKV A;  1NYY A;  3IHA A;  1L0G A;  4ID4 A;  3HBR A;  3ZG8 B;  1Q2P A;  3LY4 A;  2ZJ9 A;  4E3N A;  4E6W A;  1IEL A;  3HRE A;  2HP5 A;  3VFH A;  1W7F A;  4Y0O A;  5AQ7 A;  4KZ7 A;  3RXX A;  4ZJ2 A;  1TEM A;  5CED A;  3G4P A;  2IWB A;  4S2O A;  4Y0U A;  4E3J A;  1CEG A;  4MBF A;  5E2G A;  4DXC A;  3BFE A;  4DDS A;  1MWS A;  3PBS A;  2WKE A;  1LLB A;  2QPN A;  4S2I A;  3WS5 A;  3FWL A;  2R9X A;  4BD1 A;  3HLE A;  3HLC A;  5U47 A;  3VSK A;  2EXA A;  4CPK A;  4BLM A;  4S2K A;  3AGE A;  1S0W A;  1XKZ A;  5AQB A;  3HUM A;  1MXO A;  3NC8 A;  1EWZ A;  3N8R A;  5KMW A;  1MWU A;  3O88 A;  4H8R A;  5TR7 A;  3O86 A;  3D4F A;  5AQA A;  4FD8 A;  4C6Y A;  4OLD A;  4OPZ A;  3IWI A;  3HLD A;  3C5A A;  4OOM A;  4XXR A;  1PZP A;  3ZCZ A;  5EOE A;  1KDS A;  2Y2H A;  3Q7V A;  4DE3 A;  2H0Y A;  3MKE A;  2VGJ A;  4QY6 A;  1YLW A;  1K6R A;  3IXG A;  3LEZ A;  4WZ5 C;  3VP3 A;  5GL9 A;  1AXB A;  3PBO A;  4MBK A;  5HL1 A;  5FQJ A;  5EEC A;  4DF6 A;  1XA7 A;  4OLG A;  3NCK A;  1ERQ A;  4EQI A;  4OH0 A;  1HD8 A;  2EFX A;  3MXS A;  1GA9 A;  2X01 A;  3ZHH A;  5KZH A;  1U60 A;  1LL9 A;  1QME A;  1ES4 A;  4JXV A;  2ZQ8 A;  3AGD A;  3IF6 C;  4HES A;  1SKF A;  4WEL A;  1JWZ A;  3A3I A;  1ZG6 A;  4UAA A;  1WYC A;  3VOY A;  1XGI A;  4IBX A;  4EV4 A;  1I2S A;  5A93 A;  5KSC A;  2XFS A;  4LCM A;  2BG1 A;  5EUA A;  4GB7 A;  1YLT A;  5DTK A;  2WAF A;  1NZU A;  2XDM A;  2OV5 A;  3VP1 A;  1SHV A;  5J8X A;  5FQK A;  4HBU A;  1I2W A;  1KE0 A;  3NDE A;  4P87 A;  2ZMA A;  5CHM A;  2J9P A;  3V5M A;  3A3D A;  2X02 A;  3CZD A;  3WRZ A;  4EUZ A;  4P0M A;  2WZX A;  4RYE A;  3UE0 A;  3PBQ A;  3V3S A;  1BUL A;  2G2U A;  2WZZ A;  1IEM A;  1NXY A;  1E3U A;  1LL5 A;  3FKW A;  4LV3 A;  4U0X A;  3SOI A;  1YLZ A;  2WK0 A;  3VP0 A;  5FQQ A;  1IKG A;  5M19 A;  1G6A A;  4JXS A;  3HLF A;  4BQM A;  4MLL A;  1FR1 A;  4KEN B;  2WUQ A;  4GNU A;  1JTD A;  3G35 A;  1CEF A;  5HAQ A;  4C3Q A;  5GHY A;  1GHI A;  4JF6 A;  2OLV A;  4DDY A;  2HP9 A;  1GHP A;  3AGF A;  1CI9 A;  1O7E A;  4ZTK A;  1K55 A;  4KZ6 A;  4R23 A;  1PIO A;  3MFD A;  1K54 C;  1K56 A;  1E4D A;  5CHU A;  3WS2 A;  4OKP A;  1Z6F A;  4N9L A;  1ES2 A;  2A49 A;  3SH7 A;  4OQ0 A;  3V3R A;  4OPR A;  2Y59 A;  1LHY A;  3GQZ A;  3BFG A;  5FQI A;  1ES3 A;  4KZA A;  5A90 A;  2JBF A;  5E2E A;  3M6B A;  1YLY A;  2ZM8 A;  3M2K A;  4UHU A;  4QY5 A;  2ZQD A;  3UE3 A;  5FA7 A;  5GLB A;  4GZB A;  2XFT A;  3GRJ A;  4DE1 A;  2IWC A;  4EBN A;  2JC7 A;  3ITB A;  1YMX A;  1FOF A;  4JBF A;  5M1A A;  3VSL A;  1XX2 A;  2XGN A;  4WMC D;  3ZGA B;  4R3J A;  3CMZ A;  4B4Z A;  4BEN A;  5IHV A;  3C7V A;  3G30 A;  3G2Y A;  2R9W A;  3IWO A;  3IF6 B;  4KG2 A;  4KZ4 A;  3RJU A;  5CRF A;  3QNB A;  1E25 A;  2ZC3 B;  5BOH A;  3BFF A;  3QNC A;  3GVB A;  4Y0T A;  2XQZ A;  3IH8 A;  4OQG A;  5HAR A;  3TG9 A;  1NYM A;  3PBR A;  2QMI A;  3TSG A;  4LCL A;  1YLP A;  3LCE A;  3Q82 A;  1W8Q A;  4U3T A;  1IYQ A;  1H8Z A;  1TVF A;  4S2N C;  5DTT A;  4JF5 A;  4GKU A;  1FR6 A;  3HVF A;  3IXB A;  5EVI C;  3VOZ A;  4JKT A;  3OC2 A;  1YQS A;  3NDG A;  4KQR A;  4MEZ A;  3SH8 A;  1KGG A;  4BJP A;  4E3O A;  2DRW A;  3Q81 A;  3EQU A;  3W4P A;  3IT9 A;  4FH2 A;  4FH4 A;  5EVI D;  5A91 A;  3GR2 A;  2WYX A;  4PM5 A;  3M2J A;  1L0D A;  4EWF A;  4N1X A;  2EX2 A;  1ALQ A;  1SCW A;  2Y2G A;  3W4O A;  1MWT A;  5FDH A;  2XF3 A;  4GD8 A;  1NRF A;  4R3B A;  5L2F A;  3UDF A;  3UPP A;  1ESU A;  1ZC2 A;  2Z2L B;  5E43 A;  4C75 A;  5KSH A;  3PTE A;  3IQA A;  4E6X A;  1RGZ A;  2J9O A;  5GHX A;  4ZJ3 A;  5FAP A;  4DKI A;  3G2Z A;  4B4X A;  2Y2O A;  3GV9 A;  3IF5 A;  1YT4 A;  1K57 A;  1XP4 A;  2X71 A;  2V1Z A;  1WE4 A;  5GLA A;  2RL3 A;  4IED A;  1BT5 A;  4KZ9 A;  4OPY A;  3C7U A;  4LV1 A;  3B3X A;  2H0T A;  5EVL A;  5EOO A;  2WAD A;  1GCE A;  2ZC4 B;  3M6H A;  4ZDX A;  2XH9 A;  4KG5 A;  4X69 A;  4S2L A;  1GHM A;  4S2J A;  4GDN A;  2H10 A;  4WZ5 A;  3G34 A;  3TOI A;  3OCL A;  3O87 A;  5HX9 A;  3UPN A;  1S6R A;  4OP5 A;  4RX2 A;  4OOL A;  4KZ5 A;  3BFD A;  5F1G A;  5EPH A;  1DJA A;  3N4I A;  3ZFZ A;  3C4P A;  1TDL A;  2Y2L A;  1VM1 A;  4GD6 A;  2C6W B;  4WEK A;  3ZVW A;  3N6I A;  3LO7 A;  1KGE A;  2C5W B;  5F1F A;  3IF6 A;  4QB8 A;  3S1Y A;  3N8L A;  4PM6 A;  2UWX A;  1NY0 A;  3UY6 A;  2XK1 A;  1BLC A;  1O07 A;  2XD5 A;  2RCX A;  1RGY A;  1MPL A;  3A3J A;  4E3L A;  5FI7 A;  3BLS A;  4Z9Q A;  1C3B A;  2OSU A;  5GLC A;  1VQQ A;  2Y2Q A;  5EVI B;  1JTG A;  3MBZ A;  2EX6 A;  2Y2J A;  2Q9M A;  3ZG7 B;  3W8K A;  3OPH A;  3HLB A; 
#chains in the Genus database with same CATH topology
 2YKF A;  3ISG A;  4DJ3 A;  2PRF A;  4CLC B;  2W3E A;  4KQO A;  1IYP A;  5FDS A;  2PD8 A;  3ZVT A;  4XUZ A;  2EA9 A;  5CXW A;  2FFF B;  3CPT A;  3UB5 P;  4ARZ B;  3KSG A;  5J4E A;  1Z09 A;  1H5X A;  2OAQ 1;  1PI5 A;  3S4X A;  2XLN A;  4EXO A;  4OQH A;  2BLS A;  3RFB A;  2Y2N A;  3U2A A;  3FZC A;  3BM6 A;  2FFY A;  1HVB A;  5CTM A;  3NBL A;  3HUN A;  2ZC6 B;  2W1T A;  3Q7V B;  2INW A;  3OPL A;  1JNU A;  2VLG A;  1K56 D;  2OOL A;  3WS1 A;  4LV0 A;  3MXR A;  4NXE A;  4OON A;  4JXW A;  2EXB A;  3UMD A;  2PU4 A;  5HWW A;  4KZ8 A;  1MBL A;  4LEN A;  4QJG A;  3RXW A;  3V39 A;  3DWK A;  4RA7 A;  4PM7 A;  4UA9 A;  2IWD A;  4S2M A;  1PW8 A;  4NET A;  3UE1 A;  3CLO A;  1QMF A;  3LIF A;  1ZTU A;  1H8Y A;  1G68 A;  1MWR A;  5HSQ A;  5TGF A;  4WYY A;  3A0S A;  3OPR A;  2WGW A;  2QWS A;  2WKH A;  2Z2M B;  1XGJ A;  4X53 A;  2PR5 A;  3C38 A;  3BFC A;  3IXH A;  1P9W A;  3UNW A;  1Y54 A;  1KDW A;  5D3O A;  2QYB A;  4R4S A;  3L7H A;  2DNS A;  3MF0 A;  2BAS A;  1ERO A;  4O7D A;  4JPM A;  2ACG A;  4PM9 A;  4EEP A;  4QWO A;  5FSR A;  2QZ6 A;  4K91 A;  4OP8 A;  1L0E A;  1K38 A;  5TBM A;  4G3W A;  3BRM A;  4ZRR A;  1LI9 A;  2P9V A;  2Y2P A;  4K0X A;  2W3G A;  5DFX A;  5DF9 A;  3CJM A;  1BSG A;  2V2F F;  4X56 A;  3ZDJ A;  2Y4A A;  4E3I A;  4HJ6 A;  1CI8 A;  4UEY A;  2B18 A;  4KZ3 A;  3MQQ A;  4R0Q A;  1K55 C;  2R78 A;  1N9N A;  1RCJ A;  1T1B A;  2XA7 S;  2PBY A;  3WS0 A;  1VET B;  5DF8 A;  3IH9 A;  3F1O A;  5FQM A;  1VHM A;  1BLS A;  4R1G A;  1TDG A;  1K4E A;  4L0L A;  2CC1 A;  1BZA A;  2HDS A;  1MC0 A;  1ZG4 A;  4JLF A;  1G5U A;  3ZNY A;  2JCH A;  3NIA A;  2ZC5 B;  1NYY A;  3ZG8 B;  3LID A;  2ZJ9 A;  2PT7 A;  1IEL A;  3T1X A;  2HP5 A;  1IFQ A;  2MJ6 A;  4KZ7 A;  3G4P A;  5HPF A;  4S2O A;  4Y0U A;  4E3J A;  1CEG A;  4I3I A;  1OPX A;  3D9Y A;  3WS5 A;  3FWL A;  2R9X A;  2KOI A;  2EXA A;  3IBJ A;  2P08 A;  1S0W A;  4HQA A;  4YNR A;  4EES A;  2JHE A;  3N8R A;  4H8R A;  3O5Y A;  3O86 A;  5AQA A;  4OLD A;  2ZL1 B;  3IWI A;  3HLD A;  1PZP A;  2Y2H A;  1XJ3 A;  5L10 A;  5IS1 A;  3MKE A;  4KQD A;  3DTE A;  2BTF P;  4MBK A;  5EEC A;  4NEE D;  4YOF A;  1ERQ A;  3IX4 A;  2Q0O A;  4EQI A;  4LRZ E;  2EFX A;  5KZH A;  1LL9 A;  1A0K A;  4UAA A;  1JWZ A;  1ZG6 A;  4GS9 A;  1WYC A;  4GW9 A;  4IBX A;  4EV4 A;  5A93 A;  2XFS A;  3KYZ A;  5KIZ A;  2HV1 A;  1NZU A;  2JKR M;  1CJF A;  1SHV A;  1SKO B;  5CHM A;  2ZMA A;  3CZD A;  4EUZ A;  3GDI A;  4X1L A;  3KO6 A;  3SOI A;  4U0X A;  3FKW A;  1YKD A;  3OOV A;  5FQQ A;  5CX7 A;  4BQM A;  3NOT C;  4MLL A;  1FR1 A;  4KEN B;  3QP1 A;  3A0V A;  3IBR A;  4R6L A;  5J7E A;  3MQO A;  4ZTK A;  1K54 C;  1LHY A;  3KX0 X;  2JBF A;  5E2E A;  1S4R A;  4DE1 A;  1ZHH B;  5M1A A;  4JBF A;  3BQA A;  3DBA A;  3C7V A;  3G30 A;  3MJQ A;  3G2Y A;  4KG2 A;  5HD5 A;  4GHI B;  3IX3 A;  3QNB A;  1E25 A;  2ZMV A;  3QNC A;  3GVB A;  4HNB A;  4OQG A;  3TG9 A;  1NYM A;  3IS2 B;  1YLP A;  3PYP A;  4U3T A;  2EWW A;  1IYQ A;  3ZYT A;  4JF5 A;  3IXB A;  5EVI C;  1KGG A;  4LRX C;  5C5K A;  3Q81 A;  4WN5 A;  3S7O A;  2WYX A;  4PM5 A;  4N1X A;  2EX2 A;  1ALQ A;  1SCW A;  3EEA A;  5E43 A;  3T1Q B;  3K3C A;  2J9O A;  4ZJ3 A;  4DKI A;  3LR3 A;  1FIL A;  3IF5 A;  1K57 A;  2X71 A;  1WE4 A;  3QP5 A;  4LV1 A;  4BWI A;  5EOO A;  2WAD A;  3M6H A;  4ZDX A;  4S2J A;  2HZ5 A;  1S6R A;  2J3W A;  4KZ5 A;  5F1G A;  3ZQ5 A;  1DJA A;  3LFV A;  4GD6 A;  3F1N A;  3T4K A;  3LO7 A;  4Q0I A;  2C5W B;  4QB8 A;  3CUE A;  3S1Y A;  4PM6 A;  1VEU B;  2UWX A;  3UY6 A;  2XK1 A;  3A3J A;  1C3B A;  5DJU A;  2Y2Q A;  2QJ7 A;  4X1M A;  1L0F A;  2LB5 A;  3OPH A;  1BTL A;  5FI6 A;  1LSX A;  3Q1F A;  4L9F A;  3LIE A;  2A3U A;  3MZD A;  1AWI A;  3LUQ A;  3NY4 A;  1XFQ A;  2HPB A;  3HJI A;  4JXG A;  2HDQ A;  1FQG A;  3P09 A;  4BL2 A;  1UWN X;  4K08 A;  1KVL A;  1YSP A;  4H6J A;  1LL8 A;  2XR0 A;  3PHY A;  4WM9 A;  4WMC A;  5CTN A;  4YWZ A;  3BYD A;  3UPO A;  5E2F A;  4A5R A;  2ZLY A;  3PAE A;  1ONH A;  3F1P A;  4MBH A;  3DWZ A;  2Y79 A;  3B42 A;  3U4L P;  2NUT C;  4BBV A;  3QP6 A;  4GDB A;  3C8C A;  4OOY A;  3IWQ A;  2PR6 A;  5DFY A;  2VGL S;  4EEU A;  5CGS A;  1PWC A;  4GS9 B;  5CGW A;  3H82 A;  4CQH A;  3CWF A;  4HEF A;  3UDI A;  1SDN A;  2J80 A;  4ZBE A;  4F94 A;  1S4S A;  1IYO A;  1JWP A;  1OJG A;  5G18 A;  5G4Z A;  3PXP A;  4N1H A;  4HP4 A;  1OTI A;  4GJ4 A;  2Y2M A;  3W4Q A;  1KGF A;  1IOU A;  1FSY A;  1XPB A;  4WZ4 A;  4FCF A;  5DKL A;  4BL3 A;  4EU0 A;  3WRT A;  3BWL A;  2PU2 A;  3PBN A;  4Y13 A;  2A24 A;  3O3V A;  3UN7 A;  1GSX A;  2WAE A;  3HLG A;  1KVM A;  2G2W A;  4N9K A;  5F69 A;  1K4F A;  1J3W A;  5HAI A;  3T12 B;  3S22 A;  3SS5 A;  1WA9 A;  5DJT A;  4M3K A;  3HCY A;  3BEB A;  2V0U A;  2PBD P;  1YLJ A;  1BLP A;  1W79 A;  2L0W A;  5HW3 A;  1N9B A;  4RQ9 A;  2Y2I A;  4E3M A;  4HJ3 A;  1M40 A;  3UDX A;  3ZG9 B;  1PI4 A;  3I7J A;  5DTS A;  3FV7 A;  2V1B A;  5GLD A;  1DRM A;  3DAV A;  1RP5 A;  3TRC A;  1PZO A;  4XT2 A;  2D02 A;  4Q8I A;  3D72 A;  5G4Y A;  4X25 A;  3IHB A;  3PAG A;  2OLU A;  1XA1 A;  5I94 A;  1OTE A;  5CEC A;  1BLH A;  3T50 A;  4LPZ A;  2V8F A;  2ZM2 A;  5HDS A;  3CAX A;  4RVA A;  4ZAM A;  2VJW A;  3IXD A;  1NRJ A;  1FCO A;  4DE2 A;  1PWG A;  1YAX A;  1K0K A;  3IHA A;  1CQA A;  3LY4 A;  4MCW A;  4MDZ A;  1YSQ A;  3EOI A;  2Z6D A;  5HZH A;  4ZJ2 A;  4O01 A;  1MWS A;  2WKE A;  2VV7 A;  3HLE A;  5U47 A;  1V9Y A;  2PYR A;  3AGE A;  3R7W A;  3HUM A;  3CI6 A;  5KMW A;  1MWU A;  5TR7 A;  3QP4 A;  5LBR A;  1UGU A;  4OPZ A;  2M7U A;  1T19 A;  1F9I A;  4XXR A;  3ZCZ A;  1KDS A;  3UB9 A;  2VGJ A;  5HPI A;  4WLA A;  4IHQ A;  4LGW A;  5HL1 A;  2XRN A;  5IU1 A;  5AJG A;  2HJE A;  4HP9 A;  4OH0 A;  2QKP A;  1GA9 A;  1S1Z A;  3ZHH A;  1U60 A;  1NLY A;  4JXV A;  1P97 A;  2ZQ8 A;  3AGD A;  4HES A;  1SKF A;  3VOY A;  1I2S A;  4JGP A;  3LR0 A;  3LIB A;  4GB7 A;  4M4X A;  5DTK A;  2WAF A;  2H28 A;  4MMN A;  4R38 A;  4LLO B;  5EVE A;  2XRO A;  1I2W A;  1UWP X;  1KE0 A;  3NDE A;  4P87 A;  2ZOI A;  3LYX A;  4PHT A;  3WRZ A;  2KX6 A;  1NLZ A;  2WZX A;  4RYE A;  3V3S A;  4LV3 A;  2G2U A;  2WZZ A;  1NXY A;  1E3U A;  2WK0 A;  3SW1 A;  3VP0 A;  1IKG A;  1G6A A;  1LSV A;  4BBT A;  4HIA A;  3EGD C;  3G35 A;  3E0Y A;  3LGO A;  4C3Q A;  1GHI A;  2QHK A;  1GHP A;  1O7E A;  1K55 A;  3FPW A;  1Y4O A;  3QP2 A;  4N9L A;  1ES2 A;  5TJJ A;  3BFG A;  5FQI A;  4ETX A;  1OT6 A;  3M6B A;  1YLY A;  3T4T A;  4UHU A;  3H9W A;  2A24 B;  4EBN A;  1YMX A;  1FOF A;  4Q0J A;  3VSL A;  1XX2 A;  3ZGA B;  1GSV A;  4R3J A;  3IWO A;  3RJU A;  3IF6 B;  5CRF A;  2W1R A;  2ZC3 B;  3T4J A;  3BFF A;  4IUK A;  4Y0T A;  3TSG A;  2VGL M;  1TVF A;  4S2N C;  1TD5 A;  3CHW P;  4KQR A;  2DRW A;  3EQU A;  3IT9 A;  1L0D A;  4EWF A;  2Y2G A;  5HWT A;  1YPR A;  5L2F A;  1ESU A;  1ZC2 A;  2Z2L B;  3P7N A;  3TJZ C;  5KSH A;  3FC7 A;  3CPT B;  4E6X A;  1MKM A;  2L1M A;  3G2Z A;  2AVX A;  2HGV A;  4B4X A;  3GV9 A;  5EV0 A;  4IED A;  4OPY A;  3C7U A;  1V9Z A;  2XH9 A;  4S2L A;  2H10 A;  4GLQ A;  3LIA A;  2QJ5 A;  3UPN A;  3T4L A;  4OOL A;  2W1T B;  5EPH A;  4O8G A;  3ZFZ A;  3NOU C;  1TDL A;  2Y2L A;  4WF0 A;  3N6I A;  4NXF A;  3NEC A;  1ODV A;  1NY0 A;  2RCX A;  2GJ3 A;  1MPL A;  5FI7 A;  2ZMF A;  4Z9Q A;  2JKG A;  2OSU A;  5GLC A;  1VQQ A;  4R70 A;  5EM1 A;  1W63 M;  5AVF A;  4P6Z S;  2Y2J A;  3ZG7 B;  4ETZ A;  3W8K A;  3HLB A;  2J8Y A;  2A2L A;  3L9K A;  4DE0 A;  5FAS A;  1I5Q A;  1CK3 A;  4UA7 A;  2I72 A;  5E2H A;  2OAP 1;  3UB7 A;  2OWH A;  3UB8 A;  3LR4 A;  3UO9 A;  1W63 Q;  1N4O A;  1NJ4 A;  3ITA A;  4QHC A;  1W5D A;  1KE3 A;  4YIN A;  1K54 A;  1F5M A;  5CEB A;  2UV0 E;  1K25 A;  4QU3 A;  2WGW B;  1JWV A;  1MY8 A;  2Y91 A;  4WBG A;  4IBR A;  3ZG5 A;  1OTB A;  4F3L A;  4WL9 A;  1X0O A;  1G28 A;  3HL9 A;  5FL3 A;  3FPV A;  3DTM A;  3BEC A;  5JYP A;  4MNR A;  3CIT A;  5L07 A;  3P98 A;  3IX8 A;  2EX8 A;  3A3F A;  5FQ9 A;  4P6B A;  2O0Y A;  4G3K A;  1MZU A;  1SDE A;  1TS8 A;  2VGK A;  1STZ A;  5A92 A;  4UA6 A;  5EVI A;  1LI0 A;  5TBM B;  1KE4 A;  5JYO A;  2P9V B;  3NI9 A;  3JVV A;  4CLC A;  3SH9 A;  5DF7 A;  1W8Y A;  1OME A;  2P74 A;  2V20 A;  3DW0 A;  4FSF A;  2JKR I;  3ZNT A;  4EBP A;  5K5B A;  1FSW A;  5DKK A;  2J7V A;  3NHQ A;  4ARZ A;  4Y5F A;  4L9E A;  4EUV A;  2V1A A;  4DMZ A;  1N9O A;  5TFQ A;  3CG5 A;  1FCN A;  5F83 A;  2K2N A;  4HOI A;  2ZBB A;  1IKI A;  2O9A A;  3VE4 A;  2W3F A;  4OPQ A;  3N7W A;  5FI2 A;  1S1Y A;  1K57 C;  2E8J A;  3F1O B;  4R4R A;  2ZQ7 A;  5EE8 A;  4L9G A;  5GHZ A;  3HUO A;  2HF6 A;  2B5R A;  2XEP A;  1HZO A;  4JF4 A;  4X55 A;  1ONG A;  4IVI A;  3GMW A;  1DP8 A;  2GNX A;  4HY8 A;  4DRT A;  3MKF A;  1PW1 A;  2ZQC A;  3LY3 A;  3E2K A;  1HTZ A;  3R4K A;  1PRQ A;  3QP8 A;  3VP2 A;  3WWX A;  4DN0 A;  1XXM A;  5FAO A;  3KSI A;  4Z1W A;  2HP6 A;  2VEA A;  1J9M A;  3GEC A;  4OVD A;  5CER A;  2O9C A;  1PWD A;  2PAV P;  1DJC A;  3LI9 A;  4LV2 A;  1XJ6 A;  2XA7 M;  2ZC7 A;  4ME4 A;  3MZF A;  4KZB A;  4PM8 A;  3VP4 A;  1ES5 A;  4N92 A;  1OJ5 A;  2HDR A;  2ZM0 A;  3ICY A;  2O9B A;  2VX8 A;  2JKT I;  3A3E A;  2LB9 A;  5M18 A;  4QD4 A;  2WGV A;  5HFO A;  1PYY A;  4E6W A;  3HBR A;  3LI8 A;  1Q2P A;  5FEF A;  3VFH A;  3E4P A;  5AQ7 A;  4BBU A;  2EWV A;  1TEM A;  2JKF A;  2IWB A;  4WUJ A;  4MBF A;  5E2G A;  4DXC A;  3LR5 A;  5F5Y A;  3PBS A;  1LLB A;  5MC7 A;  4S2I A;  4BD1 A;  3VSK A;  1OTA A;  4CPK A;  2Y8H A;  3HJK A;  1N9L A;  1XKZ A;  1MXO A;  2W27 A;  3O88 A;  2KDK A;  1TS0 A;  3D4F A;  2VZW A;  3NJA A;  4CLC D;  3C5A A;  4I5S A;  4OOM A;  3MR0 A;  3JVU A;  1VET A;  3V67 A;  1K6R A;  3E98 A;  3LEZ A;  4WZ5 C;  1H3Q A;  5FQJ A;  1XA7 A;  3G6O A;  3NCK A;  2V8C A;  1HD8 A;  3MXS A;  5HD3 A;  2L4R A;  3C30 A;  2X01 A;  3IF6 C;  4WEL A;  3A3I A;  4LCM A;  5EUA A;  2XDM A;  2OV5 A;  5J8X A;  2DMW A;  4HBU A;  4HH2 A;  4P6Z M;  3V5M A;  2J9P A;  3A3D A;  2X02 A;  4EQ1 A;  4P0M A;  3UE0 A;  3VMA A;  3PBQ A;  4B4Z A;  1T1C A;  3DTK A;  1YLZ A;  4JGO A;  4JXS A;  3W2Z A;  5F68 A;  3HLF A;  2WUQ A;  1JTD A;  1CEF A;  5GHY A;  4JF6 A;  2OLV A;  4DDY A;  2HP9 A;  3AGF A;  4KZ6 A;  3MFD A;  2ZL1 A;  3WS2 A;  3SH7 A;  2A49 A;  3D3O A;  3MFX A;  3H7W A;  4KZA A;  5A90 A;  3M2K A;  4QY5 A;  2ZQD A;  5GLB A;  4GZB A;  4EW7 A;  2FZ0 A;  2IWC A;  4I3J A;  3MXQ A;  2XGN A;  4WMC D;  3VE3 A;  2NUP C;  3CMZ A;  3F1N B;  4BEN A;  5IHV A;  4KZ4 A;  4D60 A;  2XQZ A;  5HAR A;  2QMI A;  3Q82 A;  5DTT A;  3HVF A;  1SKO A;  3OC2 A;  3VOL A;  1YQS A;  4MEZ A;  3SH8 A;  1BYW A;  4E3O A;  3BJN A;  3T4Q A;  4FH4 A;  5A91 A;  3GR2 A;  3M2J A;  3W4O A;  1MWT A;  1Y28 A;  2XF3 A;  5FDH A;  4GD8 A;  4R3B A;  1L3L A;  3UDF A;  2O99 A;  4C75 A;  3B33 A;  4IUH A;  5GHX A;  3KSF A;  2Y2O A;  1XP4 A;  2VKS A;  4HI4 A;  2V1Z A;  2PD7 A;  3FG8 A;  4H6J B;  3K3D A;  3B3X A;  1GCE A;  5EFW A;  3TW8 A;  4GDN A;  1FIK A;  3G34 A;  3TOI A;  3OCL A;  4EET B;  3O87 A;  4B93 A;  3A0R A;  4MN6 A;  4OP5 A;  4RX2 A;  2J3T D;  3F1P B;  1LT0 A;  1H0M A;  1VM1 A;  3ZVW A;  3MQ0 A;  4GHI A;  3N8L A;  1BLC A;  4IJG A;  1RGY A;  4E3L A;  5AVE A;  3IS2 A;  4I3A A;  2B02 A;  1JTG A;  2EX6 A;  4Y17 A;  1KOU A;  3H82 B;  3JYI A;  2ZQA A;  1IYS A;  3SS4 A;  5HAP A;  2WGI A;  5HDD A;  3Q07 A;  3WS4 A;  4NK3 A;  5CGX A;  3HLW A;  3RH8 B;  4JGR A;  1MKI A;  1NZO A;  2Y2K A;  1NWZ A;  4EER A;  3FYZ A;  5L09 A;  3ZG0 A;  1L2S A;  2CMN A;  2Y55 A;  4BD0 A;  4PAU A;  5L8M A;  4YFM A;  3K2N A;  4ZJ1 A;  2Z6C A;  2HDU A;  3EGX C;  2XD1 A;  4NG2 A;  4EBL A;  5DVA A;  4B88 A;  4AFI A;  4IVK A;  1TS6 A;  1JVJ A;  4X6T A;  2W3D A;  1VEU A;  4X68 A;  2Q9N A;  3GSG A;  1S66 L;  4K0W A;  3EQV A;  4QPR A;  1YM1 A;  2H5S A;  2JN7 A;  2G7U A;  1F98 A;  1M6K A;  4S2N A;  3NUL A;  4PKY G;  4JGQ A;  1Q2Q A;  4HBT A;  2K31 A;  4I39 A;  3OZH A;  2GDN A;  4UQI S;  4S2P A;  4LRY C;  3V50 A;  4KG6 A;  3GTC A;  3OCN A;  1ZKJ A;  1HLU P;  4D2O A;  4Y7P A;  3RTY A;  2IA2 A;  3MSH A;  3BY8 A;  1D06 A;  4XT2 B;  1DP6 A;  2W0N A;  4GCZ A;  1K6S A;  2PYP A;  4KUK A;  3KSH A;  4DXB A;  1ESI A;  2K7S A;  4ESP A;  1F2K A;  3E2L A;  4CJN A;  4WEJ A;  5FAQ A;  3SZT A;  3BLM A;  2E8I A;  3G32 A;  2M1C A;  3E4O A;  3H7W B;  4PPR A;  4NXG A;  3UB6 A;  3BY9 A;  3PBT A;  4XUX A;  3VV4 A;  4HJ4 A;  3T1S A;  1FCM A;  3QHY A;  4P85 A;  1CF0 A;  1XFN A;  3UE6 A;  4E3K A;  4DJ2 A;  1VB6 A;  3S7Q A;  2V0W A;  3VFF A;  2JE5 A;  1DY6 A;  1XJ4 A;  3OPP A;  3G31 A;  3N8S A;  4OQI A;  2GZA A;  3MMH A;  3SS3 A;  2HJ9 C;  5EM0 A;  1ERM A;  1PNE A;  5FAT A;  4GN2 A;  3MZE A;  3S7N A;  1BUE A;  2EX9 A;  2ZD8 A;  5F82 A;  3R7W B;  3C4O A;  3JPU A;  1GA0 A;  3C2W A;  2PDR A;  5AQ9 A;  3Q7Z A;  1E3U D;  1WYB A;  4HHD A;  5CHJ A;  3TE8 A;  4GOG A;  4PMA A;  2DCF A;  3MS6 A;  1EI5 A;  1T1A A;  3UME A;  2ZOH A;  4CLC E;  3LIC A;  1DJB A;  2EFU A;  4KQQ A;  2OWJ A;  2WKI A;  2ZQ9 A;  2WKQ A;  4RX3 A;  1YMS A;  5HL6 A;  3DTI A;  4NKP A;  4U0T A;  1P9R A;  3S7P A;  3T1R A;  3FKV A;  2D01 A;  1L0G A;  4ID4 A;  4G3V A;  4E3N A;  4R3A A;  3HRE A;  1W7F A;  4Y0O A;  5A8B A;  3RXX A;  1OTD A;  5CED A;  3KYE A;  2VA0 A;  3EWK A;  4Y2F A;  3BFE A;  4DDS A;  1D1J A;  4I38 A;  2QPN A;  2VV6 A;  3OBF A;  3HLC A;  3OLO A;  4O0P A;  4BLM A;  4S2K A;  3B47 A;  4CLC C;  5AQB A;  3NC8 A;  1EWZ A;  4MN5 A;  4FD8 A;  4C6Y A;  3LEQ A;  5J3W A;  1S67 L;  1PFL A;  4KUO A;  5I5L A;  5EOE A;  1XJ2 A;  3Q7V A;  4DE3 A;  2H0Y A;  4QY6 A;  2W3H A;  1YLW A;  3IXG A;  3VP3 A;  5GL9 A;  1AXB A;  3PBO A;  2JKT M;  3NOP C;  2PHY A;  4DF6 A;  1ACF A;  4OLG A;  2FH5 A;  2GX5 A;  1QME A;  1ES4 A;  2WKR A;  3CUE C;  1XGI A;  5KSC A;  1P0Z A;  2BG1 A;  3E4Q A;  5HWV A;  1YLT A;  4B9O A;  1TS7 A;  3VP1 A;  5FQK A;  5IT5 A;  2XSS A;  1BUL A;  1IEM A;  1LL5 A;  1T18 A;  2P04 A;  5M19 A;  3P01 A;  4GNU A;  5HAQ A;  4Y15 A;  1CI9 A;  4PKY A;  4R23 A;  1PIO A;  1K56 A;  1E4D A;  5CHU A;  4OKP A;  1Z6F A;  4OQ0 A;  3V3R A;  4OPR A;  2Y59 A;  3GQZ A;  1ES3 A;  2ZM8 A;  4Y3I A;  3UE3 A;  5FA7 A;  1D7E A;  2XFT A;  3GRJ A;  2P7J A;  2JC7 A;  2WKP A;  3ITB A;  2R9W A;  5HDC A;  4II7 A;  4E04 A;  4FTX A;  5BOH A;  1OT9 A;  3IH8 A;  3ULF A;  5F6A A;  3PBR A;  4LCL A;  3LCE A;  1W8Q A;  1H8Z A;  4GKU A;  1FR6 A;  3EEH A;  1EW0 A;  3VOZ A;  1H8M A;  4JKT A;  3NDG A;  4BJP A;  2YKH A;  4FUW A;  3T4S A;  3W4P A;  4FH2 A;  5EVI D;  4MN7 A;  2KLI A;  1GSW A;  2B95 A;  4UQI M;  3BQ8 A;  1NRF A;  3BW6 A;  3UPP A;  3KYQ A;  4Q0H A;  3PTE A;  3IQA A;  1RGZ A;  2I9V A;  5FAP A;  1YT4 A;  5GLA A;  2RL3 A;  1BT5 A;  4KZ9 A;  5FEG A;  2H0T A;  5EVL A;  3T4O A;  2ZC4 B;  4KG5 A;  4X69 A;  1GHM A;  4F3L B;  2J3T C;  4WZ5 A;  1TF1 A;  5HX9 A;  2M7V A;  3BFD A;  1LSW A;  3N4I A;  3C4P A;  4FOF A;  2C6W B;  4WEK A;  1G6O A;  2VV8 A;  1DP9 A;  1KGE A;  5F1F A;  3IF6 A;  4HH3 A;  2V9A A;  3PR6 A;  1SZV A;  2VK3 A;  1O07 A;  2XD5 A;  3BLS A;  4NXB A;  4BMW A;  4LFU A;  5EVI B;  3MBZ A;  2Q9M A; 
#chains in the Genus database with same CATH homology
 3ISG A;  1BTL A;  2J8Y A;  3JYI A;  5FI6 A;  1L0F A;  2ZQA A;  1IYS A;  3Q1F A;  3SS4 A;  5HAP A;  2WGI A;  4DE0 A;  3Q07 A;  3WS4 A;  2A3U A;  3MZD A;  5FAS A;  4KQO A;  1I5Q A;  3UPO A;  3NY4 A;  4NK3 A;  1IYP A;  1CK3 A;  4UA7 A;  2I72 A;  2HPB A;  3HLW A;  5CGX A;  5E2H A;  3ZVT A;  4XUZ A;  1MKI A;  1NZO A;  4JXG A;  5CXW A;  2HDQ A;  1FQG A;  2FFF B;  2Y2K A;  3UO9 A;  1N4O A;  1NJ4 A;  3FYZ A;  3ITA A;  4QHC A;  1W5D A;  3P09 A;  3ZG0 A;  4BL2 A;  1H5X A;  1L2S A;  1KE3 A;  1PI5 A;  4YIN A;  1K54 A;  3S4X A;  5CEB A;  2XLN A;  1KVL A;  2Y55 A;  4BD0 A;  4OQH A;  1K25 A;  2BLS A;  2XR0 A;  2Y2N A;  2WGW B;  1JWV A;  1MY8 A;  2Y91 A;  4QU3 A;  4WBG A;  4IBR A;  3ZG5 A;  4YFM A;  3FZC A;  4WM9 A;  4ZJ1 A;  4WMC A;  3BM6 A;  3HL9 A;  2HDU A;  2FFY A;  5CTN A;  1HVB A;  2XD1 A;  3BYD A;  5CTM A;  3NBL A;  5E2F A;  3HUN A;  2ZC6 B;  4A5R A;  3Q7V B;  2ZLY A;  3PAE A;  3OPL A;  5DVA A;  1ONH A;  4EBL A;  4B88 A;  1K56 D;  3DWZ A;  4MBH A;  3WS1 A;  3DTM A;  4IVK A;  3BEC A;  4LV0 A;  5JYP A;  3MXR A;  4MNR A;  1JVJ A;  4X6T A;  4X68 A;  3P98 A;  4GDB A;  4OON A;  2Q9N A;  4JXW A;  4OOY A;  3GSG A;  3IWQ A;  2EX8 A;  4K0W A;  3A3F A;  3EQV A;  5FQ9 A;  1YM1 A;  4P6B A;  2EXB A;  2H5S A;  2PU4 A;  1M6K A;  4S2N A;  4KZ8 A;  1MBL A;  1PWC A;  1SDE A;  5CGS A;  2VGK A;  4LEN A;  4QJG A;  4UA6 A;  5EVI A;  3RXW A;  3V39 A;  5A92 A;  5CGW A;  1Q2Q A;  4HBT A;  3DWK A;  1LI0 A;  1KE4 A;  4RA7 A;  4PM7 A;  4UA9 A;  5JYO A;  2IWD A;  4S2M A;  2P9V B;  1PW8 A;  3NI9 A;  4HEF A;  3OZH A;  3UDI A;  2GDN A;  3SH9 A;  1SDN A;  4NET A;  5DF7 A;  4ZBE A;  1W8Y A;  1OME A;  2P74 A;  2V20 A;  3DW0 A;  4FSF A;  4S2P A;  3UE1 A;  1QMF A;  1IYO A;  1JWP A;  4F94 A;  5G18 A;  3ZNT A;  4EBP A;  3V50 A;  1FSW A;  4KG6 A;  1H8Y A;  3GTC A;  3OCN A;  1G68 A;  1ZKJ A;  2J7V A;  4D2O A;  4N1H A;  4Y7P A;  1MWR A;  5TGF A;  2Y2M A;  4WYY A;  3W4Q A;  1KGF A;  5TFQ A;  3OPR A;  3CG5 A;  1FSY A;  1XPB A;  4WZ4 A;  1FCN A;  1K6S A;  4FCF A;  5F83 A;  4BL3 A;  2WGW A;  1IKI A;  4DXB A;  1ESI A;  4OPQ A;  3WRT A;  2WKH A;  3N7W A;  2Z2M B;  5FI2 A;  1XGJ A;  4X53 A;  2PU2 A;  1K57 C;  3BFC A;  3PBN A;  3E2L A;  3IXH A;  3O3V A;  3UNW A;  4CJN A;  4WEJ A;  5FAQ A;  4R4R A;  2ZQ7 A;  3BLM A;  2E8I A;  1Y54 A;  3G32 A;  3UN7 A;  1KDW A;  5EE8 A;  4PPR A;  5D3O A;  2WAE A;  5GHZ A;  3HLG A;  3HUO A;  4R4S A;  3PBT A;  2B5R A;  2DNS A;  4XUX A;  1KVM A;  2XEP A;  2G2W A;  3VMA A;  4N9K A;  1HZO A;  1ERO A;  4O7D A;  4JF4 A;  1FCM A;  3QHY A;  4X55 A;  1K4F A;  1ONG A;  4JPM A;  4P85 A;  4IVI A;  4PM9 A;  3GMW A;  5HAI A;  4E3K A;  3S22 A;  3SS5 A;  4M3K A;  3VFF A;  4DRT A;  3MKF A;  1PW1 A;  2JE5 A;  2ZQC A;  5FSR A;  1DY6 A;  2QZ6 A;  3BEB A;  3OPP A;  3LY3 A;  4K91 A;  4OP8 A;  1L0E A;  3E2K A;  1HTZ A;  1K38 A;  3G31 A;  3N8S A;  4OQI A;  1YLJ A;  3BRM A;  1BLP A;  1W79 A;  1LI9 A;  3SS3 A;  2P9V A;  5HW3 A;  2Y2P A;  1N9B A;  4K0X A;  2Y2I A;  5DF9 A;  1ERM A;  3CJM A;  5FAT A;  3VP2 A;  3WWX A;  4E3M A;  1XXM A;  1M40 A;  4GN2 A;  1BSG A;  3UDX A;  3MZE A;  5FAO A;  2V2F F;  1BUE A;  3ZG9 B;  1PI4 A;  3I7J A;  2EX9 A;  2HP6 A;  2ZD8 A;  5DTS A;  4X56 A;  3FV7 A;  5F82 A;  5GLD A;  3ZDJ A;  2Y4A A;  3C4O A;  1GA0 A;  1J9M A;  4OVD A;  1RP5 A;  5CER A;  4E3I A;  1CI8 A;  5AQ9 A;  1PZO A;  3Q7Z A;  4KZ3 A;  1E3U D;  1PWD A;  1WYB A;  4Q8I A;  4R0Q A;  1DJC A;  3IHB A;  1K55 C;  2OLU A;  3PAG A;  5CHJ A;  1XA1 A;  5I94 A;  4LV2 A;  5CEC A;  4GOG A;  1RCJ A;  2ZC7 A;  4PMA A;  1BLH A;  2DCF A;  2PBY A;  3WS0 A;  1EI5 A;  5DF8 A;  3IH9 A;  5FQM A;  3MZF A;  4KZB A;  4PM8 A;  1BLS A;  4R1G A;  3VP4 A;  1ES5 A;  2ZM2 A;  1DJB A;  2EFU A;  4KQQ A;  1TDG A;  4N92 A;  1K4E A;  4RVA A;  2WKI A;  4L0L A;  2CC1 A;  1BZA A;  2HDR A;  2HDS A;  2ZM0 A;  2ZQ9 A;  1ZG4 A;  4RX3 A;  1YMS A;  4JLF A;  3ZNY A;  3A3E A;  2JCH A;  3NIA A;  5M18 A;  4ZAM A;  4QD4 A;  3IXD A;  4U0T A;  1FCO A;  4DE2 A;  1PWG A;  2WGV A;  5HFO A;  1PYY A;  2ZC5 B;  3FKV A;  1NYY A;  3IHA A;  1L0G A;  4ID4 A;  3HBR A;  3ZG8 B;  1Q2P A;  3LY4 A;  2ZJ9 A;  4E3N A;  4E6W A;  1IEL A;  3HRE A;  2HP5 A;  3VFH A;  1W7F A;  4Y0O A;  5AQ7 A;  4KZ7 A;  3RXX A;  4ZJ2 A;  1TEM A;  5CED A;  3G4P A;  2IWB A;  4S2O A;  4Y0U A;  4E3J A;  1CEG A;  4MBF A;  5E2G A;  4DXC A;  3BFE A;  4DDS A;  1MWS A;  3PBS A;  2WKE A;  1LLB A;  2QPN A;  4S2I A;  3WS5 A;  3FWL A;  2R9X A;  4BD1 A;  3HLE A;  3HLC A;  5U47 A;  3VSK A;  2EXA A;  4CPK A;  4BLM A;  4S2K A;  3AGE A;  1S0W A;  1XKZ A;  5AQB A;  3HUM A;  1MXO A;  3NC8 A;  1EWZ A;  3N8R A;  5KMW A;  1MWU A;  3O88 A;  4H8R A;  5TR7 A;  3O86 A;  3D4F A;  5AQA A;  4FD8 A;  4C6Y A;  4OLD A;  4OPZ A;  3IWI A;  3HLD A;  3C5A A;  4OOM A;  4XXR A;  1PZP A;  3ZCZ A;  5EOE A;  1KDS A;  2Y2H A;  3Q7V A;  4DE3 A;  2H0Y A;  3MKE A;  2VGJ A;  4QY6 A;  1YLW A;  1K6R A;  3IXG A;  3LEZ A;  4WZ5 C;  3VP3 A;  5GL9 A;  1AXB A;  3PBO A;  4MBK A;  5HL1 A;  5FQJ A;  5EEC A;  4DF6 A;  1XA7 A;  4OLG A;  3NCK A;  1ERQ A;  4EQI A;  4OH0 A;  1HD8 A;  2EFX A;  3MXS A;  1GA9 A;  2X01 A;  3ZHH A;  5KZH A;  1U60 A;  1LL9 A;  1QME A;  1ES4 A;  4JXV A;  2ZQ8 A;  3AGD A;  3IF6 C;  4HES A;  1SKF A;  4WEL A;  1JWZ A;  3A3I A;  1ZG6 A;  4UAA A;  1WYC A;  3VOY A;  1XGI A;  4IBX A;  4EV4 A;  1I2S A;  5A93 A;  5KSC A;  2XFS A;  4LCM A;  2BG1 A;  5EUA A;  4GB7 A;  1YLT A;  5DTK A;  2WAF A;  1NZU A;  2XDM A;  2OV5 A;  3VP1 A;  1SHV A;  5J8X A;  5FQK A;  4HBU A;  1I2W A;  1KE0 A;  3NDE A;  4P87 A;  2ZMA A;  5CHM A;  2J9P A;  3V5M A;  3A3D A;  2X02 A;  3CZD A;  3WRZ A;  4EUZ A;  4P0M A;  2WZX A;  4RYE A;  3UE0 A;  3PBQ A;  3V3S A;  1BUL A;  2G2U A;  2WZZ A;  1IEM A;  1NXY A;  1E3U A;  1LL5 A;  3FKW A;  4LV3 A;  4U0X A;  3SOI A;  1YLZ A;  2WK0 A;  3VP0 A;  5FQQ A;  1IKG A;  5M19 A;  1G6A A;  4JXS A;  3HLF A;  4BQM A;  4MLL A;  1FR1 A;  4KEN B;  2WUQ A;  4GNU A;  1JTD A;  3G35 A;  1CEF A;  5HAQ A;  4C3Q A;  5GHY A;  1GHI A;  4JF6 A;  2OLV A;  4DDY A;  2HP9 A;  1GHP A;  3AGF A;  1CI9 A;  1O7E A;  4ZTK A;  1K55 A;  4KZ6 A;  4R23 A;  1PIO A;  3MFD A;  1K54 C;  1K56 A;  1E4D A;  5CHU A;  3WS2 A;  4OKP A;  1Z6F A;  4N9L A;  1ES2 A;  2A49 A;  3SH7 A;  4OQ0 A;  3V3R A;  4OPR A;  2Y59 A;  1LHY A;  3GQZ A;  3BFG A;  5FQI A;  1ES3 A;  4KZA A;  5A90 A;  2JBF A;  5E2E A;  3M6B A;  1YLY A;  2ZM8 A;  3M2K A;  4UHU A;  4QY5 A;  2ZQD A;  3UE3 A;  5FA7 A;  5GLB A;  4GZB A;  2XFT A;  3GRJ A;  4DE1 A;  2IWC A;  4EBN A;  2JC7 A;  3ITB A;  1YMX A;  1FOF A;  4JBF A;  5M1A A;  3VSL A;  1XX2 A;  2XGN A;  4WMC D;  3ZGA B;  4R3J A;  3CMZ A;  4B4Z A;  4BEN A;  5IHV A;  3C7V A;  3G30 A;  3G2Y A;  2R9W A;  3IWO A;  3IF6 B;  4KG2 A;  4KZ4 A;  3RJU A;  5CRF A;  3QNB A;  1E25 A;  2ZC3 B;  5BOH A;  3BFF A;  3QNC A;  3GVB A;  4Y0T A;  2XQZ A;  3IH8 A;  4OQG A;  5HAR A;  3TG9 A;  1NYM A;  3PBR A;  2QMI A;  3TSG A;  4LCL A;  1YLP A;  3LCE A;  3Q82 A;  1W8Q A;  4U3T A;  1IYQ A;  1H8Z A;  1TVF A;  4S2N C;  5DTT A;  4JF5 A;  4GKU A;  1FR6 A;  3HVF A;  3IXB A;  5EVI C;  3VOZ A;  4JKT A;  3OC2 A;  1YQS A;  3NDG A;  4KQR A;  4MEZ A;  3SH8 A;  1KGG A;  4BJP A;  4E3O A;  2DRW A;  3Q81 A;  3EQU A;  3W4P A;  3IT9 A;  4FH2 A;  4FH4 A;  5EVI D;  5A91 A;  3GR2 A;  2WYX A;  4PM5 A;  3M2J A;  1L0D A;  4EWF A;  4N1X A;  2EX2 A;  1ALQ A;  1SCW A;  2Y2G A;  3W4O A;  1MWT A;  5FDH A;  2XF3 A;  4GD8 A;  1NRF A;  4R3B A;  5L2F A;  3UDF A;  3UPP A;  1ESU A;  1ZC2 A;  2Z2L B;  5E43 A;  4C75 A;  5KSH A;  3PTE A;  3IQA A;  4E6X A;  1RGZ A;  2J9O A;  5GHX A;  4ZJ3 A;  5FAP A;  4DKI A;  3G2Z A;  4B4X A;  2Y2O A;  3GV9 A;  3IF5 A;  1YT4 A;  1K57 A;  1XP4 A;  2X71 A;  2V1Z A;  1WE4 A;  5GLA A;  2RL3 A;  4IED A;  1BT5 A;  4KZ9 A;  4OPY A;  3C7U A;  4LV1 A;  3B3X A;  2H0T A;  5EVL A;  5EOO A;  2WAD A;  1GCE A;  2ZC4 B;  3M6H A;  4ZDX A;  2XH9 A;  4KG5 A;  4X69 A;  4S2L A;  1GHM A;  4S2J A;  4GDN A;  2H10 A;  4WZ5 A;  3G34 A;  3TOI A;  3OCL A;  3O87 A;  5HX9 A;  3UPN A;  1S6R A;  4OP5 A;  4RX2 A;  4OOL A;  4KZ5 A;  3BFD A;  5F1G A;  5EPH A;  1DJA A;  3N4I A;  3ZFZ A;  3C4P A;  1TDL A;  2Y2L A;  1VM1 A;  4GD6 A;  2C6W B;  4WEK A;  3ZVW A;  3N6I A;  3LO7 A;  1KGE A;  2C5W B;  5F1F A;  3IF6 A;  4QB8 A;  3S1Y A;  3N8L A;  4PM6 A;  2UWX A;  1NY0 A;  3UY6 A;  2XK1 A;  1BLC A;  1O07 A;  2XD5 A;  2RCX A;  1RGY A;  1MPL A;  3A3J A;  4E3L A;  5FI7 A;  3BLS A;  4Z9Q A;  1C3B A;  2OSU A;  5GLC A;  1VQQ A;  2Y2Q A;  5EVI B;  1JTG A;  3MBZ A;  2EX6 A;  2Y2J A;  2Q9M A;  3ZG7 B;  3W8K A;  3OPH A;  3HLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...