1DP8A

Crystal structure of the nitric oxide bound fixl heme domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
PDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxygen storage/transport
molecule keywords FIXL PROTEIN
publication title New mechanistic insights from structural studies of the oxygen-sensing domain of Bradyrhizobium japonicum FixL.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 29
structure length 118
sequence length 118
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1999-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1dp8A00
3EEHA 1TS7A 1EW0A 3UB8A 4MN6A 1Y28A 3HJIA 4F3LB 2I9VA 1BYWA 4R3AA 3K3DA 1ODVA 5HZHA 5HD5A 5HDDA 2KDKA 3LIAA 5EFWA 3KX0X 5TBMB 3UB7A 4H6JB 4PKYG 4WN5A 3A0VA 2KX6A 5HDSA 4HIAA 5IU1A 2V1AA 5J7EA 4HH2A 3C2WA 3K3CA 4K08A 4R70A 1F98A 3E4QA 4RQ9A 2H28A 1DRMA 2V1BA 5AVEA 1S67L 3B33A 2W27A 1S66L 3RTYA 3LI9A 4GS9B 4PKYA 4E04A 5J3WA 1UGUA 2A24A 5AVFA 4JGPA 4DJ3A 1P0ZA 4I3IA 3IS2A 1S4SA 4LRZE 2K7SA 3F1OB 3FC7A 4DJ2A 2YKFA 4B9OA 3CWFA 2PDRA 2V0WA 4BBUA 4KUKA 4NXBA 1T19A 1N9LA 2ZOHA 1LT0A 1XJ2A 1F9IA 3MQOA 3ULFA 2VEAA 4HQAA 4LLOB 2L0WA 2PD8A 1TS6A 5F68A 1JNUA 3E4OA 4HP4A 2V0UA 3LIDA 4LRYC 5DKLA 4WLAA 3NJAA 1XJ3A 2VLGA 2ZBBA 4R38A 3D72A 4HOIA 4I38A 4MN5A 4KUOA 3GECA 4HHDA 3MXQA 3H7WA 1OTEA 1OTDA 2VV6A 2QJ7A 4EESA 5KIZA 3UE6A 4WF0A 5F69A 5I5LA 2L4RA 1OJGA 2JHEA 1MZUA 3NOTC 1VB6A 4EERA 1N9NA 2QWSA 4F3LA 3LIBA 5F6AA 1TS8A 5DKKA 2M1CA 3A0SA 3FG8A 1DP8A 4EETB 2A24B 4I39A 2JN7A 3VE4A 1T1BA 2D01A 1LSXA 5F5YA 3CLOA 4JGQA 1V9YA 4YWZA 4EEPA 5HSQA 2P7JA 3F1NA 2WKPA 4HNBA 5TBMA 4H6JA 4NXGA 4JGRA 4NXFA 1XJ4A 3LYXA 3RH8B 3H82B 2WKRA 4WL9A 2ZOIA 4HH3A 1DP6A 2R78A 3F1PB 1N9OA 1NWZA 4XT2B 2YKHA 2OOLA 4I3JA 4GHIA 2GJ3A 1LL8A 4M4XA 1X0OA 3E4PA 3OLOA 4GS9A 2EA9A 2L1MA 3SW1A 2QHKA 4GCZA 2WKQA 1UWPX 2VV7A 3MR0A 3P7NA 3ZQ5A 3LUQA 3VOLA 1WA9A 3F1OA 3BWLA 4L9GA 1OTAA 5IS1A 1LSWA 5HDCA 1S4RA 3NHQA 4LRXC 3H9WA 5G4ZA 2W0NA 1OT9A 3LIFA 2PR5A 3T50A 1G28A 2VV8A 2PR6A 3UB6A 2BASA 5G4YA 2OWHA 3A0RA 1P97A 3LI8A 1LSVA 3PHYA 3UMEA 3EWKA 1OTIA 3LIEA 4NXEA 1GSXA 1S1ZA 5HWVA 1XFQA 5DJTA 4L9FA 4EQ1A 2Z6DA 4KQDA 5HD3A 3F1NB 5J4EA 5DJUA 2PHYA 2OWJA 3BY8A 3NOUC 4GW9A 4HJ3A 1DP9A 1T1CA 4BBTA 2INWA 3IS2B 4EW7A 3UB9A 2PD7A 2QJ5A 1UWNX 4GHIB 2HV1A 3LICA 4JGOA 5A8BA 3ICYA 1T18A 3GDIA 4HJ4A 1D7EA 3CAXA 4LPZA 3BY9A 2Z6CA 3MFXA 1XFNA 4I5SA 3UMDA 4I3AA 2PYRA 4EEUA 1T1AA 3HJKA 2V9AA 4BBVA 2B02A 2PYPA 1GSVA 1OTBA 1TS0A 3MQQA 4L9EA 2D02A 1D06A 4WUJA 2CMNA 1OJ5A 3NOPC 3MJQA 4HP9A 1V9ZA 3IBRA 2QKPA 2J80A 4EXOA 1KOUA 3G6OA 5HWTA 1OT6A 3H7WB 3H82A 3C8CA 1S1YA 5HWWA 1GSWA 3F1PA 3PYPA 4R6LA 4XT2A 4HJ6A 4HI4A 4HY8A 3VE3A 1XJ6A
chains in the Genus database with same CATH superfamily
1VQQA 1EW0A 3UB8A 5CXWA 4MN6A 2UWXA 2ZQAA 2EWWA 1Y28A 4X1MA 3KSFA 4XUXA 4Y0TA 3OC2A 2C6WB 1BYWA 5FAOA 1STZA 2JKTM 4UA7A 4DDYA 3PBOA 5J8XA 2P9VA 2JKRI 3WS1A 2J9OA 5E43A 4KZ5A 3IT9A 3AGFA 4MBFA 3B42A 4MNRA 4EUZA 2J7VA 1KGEA 2DCFA 3R7WB 3EGDC 1GA9A 2IWCA 1VM1A 3BYDA 1NXYA 3IX3A 4HH2A 4KZ4A 5M18A 3ZGAB 1F98A 3UDIA 4RQ9A 4WZ4A 2H28A 1SHVA 1K57C 2Y2MA 4QWOA 1VHMA 4EBPA 5DVAA 4ETXA 3LR3A 1S67L 4UA9A 4UQIS 2UV0E 2PBYA 3LI9A 3MMHA 2J3TC 2ZM2A 1KE4A 2WGWB 3VP1A 3CUEC 3DWKA 4JGPA 2EWVA 3LEQA 2A49A 4I3IA 3T1RA 1PWGA 3BRMA 1WE4A 3V3SA 3FZCA 2PAVP 4DJ2A 2Y2KA 4R1GA 2PDRA 2V0WA 4NXBA 1T19A 5FATA 5GL9A 5HFOA 1LT0A 1XJ2A 4GNUA 3MQOA 2ZQ7A 5M19A 5E2EA 3LEZA 3BFCA 4JF6A 3WWXA 1H8YA 3I7JA 3GV9A 4WLAA 4KG2A 4GDNA 2ZBBA 1ES4A 1TD5A 2W3HA 4I38A 4MN5A 1JWZA 3IX8A 2XDMA 1Z6FA 4HHDA 1FCOA 3JVVA 1L0GA 2JC7A 2G2WA 4LV1A 4JXVA 2WYXA 3SZTA 3BFDA 4OP8A 1P9WA 2B5RA 4X1LA 2QJ7A 4GOGA 3OPLA 4BQMA 2C5WB 4WF0A 3HL9A 1WYBA 5F69A 2BG1A 5FQ9A 5HX9A 3C4OA 2LB5A 1VB6A 1PYYA 3CPTB 1XA1A 2RL3A 4E3NA 2QWSA 1Y4OA 4WMCA 4F3LA 3P09A 3T1QB 3BECA 1TS8A 3N8RA 5DKKA 3LY4A 2FFYA 3W2ZA 5G18A 4I39A 3VE4A 3BLSA 4E3OA 1ESIA 1PZPA 4R0QA 3S7PA 2Y8HA 3BFEA 4JXWA 1ES2A 4OP5A 5AQ9A 4EEPA 3IQAA 3UN7A 4Y13A 4BL2A 1MY8A 5TBMA 1K0KA 1Z09A 1NYMA 1K55A 1KVMA 3LYXA 3H82B 3NECA 4E6XA 3G31A 2XLNA 4HH3A 2R78A 1HD8A 3M2JA 4G3WA 1S0WA 4S2PA 1JTDA 2YKHA 3IWOA 4OPZA 4RX3A 2GJ3A 5EOEA 5GLBA 3G30A 3IH9A 5EVEA 4LV3A 4X53A 2NUTC 3LCEA 4QY5A 3FKWA 2WGIA 1UWPX 3WS4A 3C7UA 2H5SA 3MR0A 4MBHA 5FEGA 2P9VB 1MKIA 3E2LA 1KVLA 3V39A 2JKFA 4NK3A 2OLVA 1LL5A 2JKRM 2ZL1B 4CLCD 3H9WA 5G4ZA 4DMZA 1OT9A 1VETA 4O7DA 2PR5A 3A3JA 3KO6A 1FIKA 5CX7A 1MWSA 2WKIA 4E3LA 3VSKA 1D1JA 1LL9A 1P97A 1K57A 1LLBA 4II7A 4KZ6A 2XROA 3PHYA 4LGWA 1BSGA 3D3OA 1OTIA 1GHIA 5JYOA 4OOMA 5HWVA 1XFQA 2I72A 3CUEA 5DJTA 5FI6A 4L9FA 4EQ1A 4Z9QA 4UA6A 3FV7A 4X56A 5J4EA 2VJWA 3TRCA 2OWJA 3BY8A 1DJCA 3TG9A 2HDSA 2PD7A 5HAIA 2QJ5A 3QP4A 3NC8A 1PI4A 2Z2LB 4O8GA 5HPIA 3R7WA 1K38A 1ES5A 2ACGA 3LICA 1H5XA 3KSIA 3VOZA 1PW8A 2HDUA 3SS3A 1Y54A 2Q9NA 4HJ4A 4LPZA 2BLSA 1XFNA 3BJNA 4A5RA 1BLSA 2PYRA 2ZC4B 1T1AA 1PW1A 3ZG8B 2V9AA 2PYPA 2KLIA 4MN7A 2DRWA 2P04A 2WGWA 2HGVA 2BTFP 3OPRA 4EQIA 1OJ5A 3MJQA 4HBUA 3ZYTA 3Q7VA 3IXHA 4EXOA 5HWTA 1OT6A 3CITA 1PNEA 1IKIA 4FUWA 1NLZA 3C38A 1EWZA 2E8JA 5EVIC 1TF1A 3F1PA 5FQIA 3HBRA 2KOIA 1MKMA 3OCLA 4GDBA 3A3EA 4UHUA 1NRJA 4IBRA 2W3DA 2XA7M 1MBLA 3MSHA 4F3LB 4Q0IA 2IWDA 2I9VA 3S1YA 3DAVA 3KSGA 1KDSA 4ZAMA 2PT7A 1YMXA 3K3DA 1ODVA 5HZHA 1P9RA 3BFGA 4X6TA 3IHBA 3ZVWA 5FQJA 1TVFA 5HDDA 2KDKA 4OLDA 2PBDP 4UQIM 5TBMB 3UB7A 5GHZA 3JPUA 4WN5A 3A0VA 4ZBEA 5E2FA 4HIAA 2V1AA 3T4JA 4DXBA 5J7EA 1BLPA 4PMAA 3E4QA 4MMNA 4ID4A 4EV4A 1DRMA 2Z2MB 5JYPA 3CPTA 4D2OA 4N1HA 4DRTA 2Y2NA 4ARZB 1G68A 2NUPC 3VV4A 3RTYA 4IJGA 2WK0A 3A3IA 2H0YA 5AVFA 3IF5A 4R4SA 3O3VA 5CRFA 4E3KA 3CJMA 4LRZE 2K7SA 1GA0A 4X69A 3T12B 3B3XA 1PZOA 2XD1A 2O99A 2EFUA 4FH2A 1FCMA 1FSWA 2Q0OA 1ZC2A 1M40A 1N9LA 4IVKA 3UO9A 1F9IA 1VETB 4U3TA 3ULFA 3OPHA 4M3KA 4DE1A 2OSUA 3ITAA 1MC0A 1JNUA 4HP4A 2V0UA 1SKOB 4Q8IA 4CJNA 3SH8A 4S2NA 4Y2FA 1YQSA 4WYYA 2VGLS 1L0FA 5C5KA 4HOIA 4BLMA 4K91A 4OLGA 3Q1FA 3TE8A 5GHYA 5DF9A 1YT4A 3S7QA 3C5AA 2Y55A 4G3KA 2DMWA 1OTDA 1FR6A 3B47A 1J3WA 2HF6A 2XA7S 3O87A 3T4QA 3N7WA 3G32A 2ZL1A 1OJGA 1MZUA 2EX9A 2Y2GA 3W4PA 4C6YA 4EERA 3QP2A 1YAXA 4QPRA 3C4PA 3N4IA 3P01A 2M1CA 3A0SA 1MPLA 1DP8A 3FG8A 4EETB 3DTIA 4KQQA 4O01A 4C3QA 4UEYA 1T1BA 2D01A 5F5YA 4BL3A 1E25A 4JGQA 4HESA 4HEFA 1QMFA 5EECA 4KZ3A 4Y5FA 2GX5A 4U0XA 4WEJA 4JLFA 2A2LA 3BEBA 1L0EA 3Q7VB 1YLYA 1L2SA 4O0PA 2ZC7A 1ZTUA 3T1SA 1C3BA 4KZ7A 5EVIA 1K56A 4L0LA 3F1PB 1DJAA 4CPKA 4GB7A 2OOLA 3BLMA 3W8KA 4I3JA 1K6SA 1ZHHB 1BTLA 1XGJA 1SDNA 4R23A 1CEFA 3FYZA 5CHMA 3BM6A 3GR2A 1X0OA 5MC7A 1O7EA 5FQQA 2QHKA 1PWDA 2WKQA 5BOHA 3GQZA 1RGYA 3P7NA 1H3QA 3ZQ5A 4DDSA 3RXWA 2PU2A 5FQKA 3C7VA 2ZMAA 5IS1A 1LSWA 3N8LA 1PWCA 2J9PA 3OPPA 2W0NA 3LIFA 2O9BA 1JTGA 2OLUA 4OQ0A 5AQBA 3T50A 5DF8A 1A0KA 2PR6A 2OWHA 4GZBA 2ZM8A 3A0RA 2PRFA 1JWVA 2Y4AA 2VGJA 4EBLA 4ETZA 4OPRA 3IWIA 2HDRA 1LSVA 5F83A 3T4OA 1LHYA 3EWKA 2B95A 2M7VA 3SH7A 3LIEA 4KQOA 4Q0HA 2FZ0A 2W1RA 4QU3A 4YINA 3ZG5A 4QD4A 2H0TA 1BLHA 3GMWA 3IHAA 2Y59A 1K6RA 2Y2PA 4HJ3A 1T1CA 2INWA 1TDLA 3A3DA 3FPVA 5EM1A 1PIOA 3HUNA 3UE3A 5FASA 2ZQDA 4S2JA 2R9WA 2OAP1 4Z1WA 4GHIB 2HV1A 4OOLA 5A8BA 1GHMA 1XXMA 3MZFA 2HJEA 1D7EA 1O07A 4OQGA 2Z6CA 3MFXA 4JKTA 5AQ7A 5TR7A 3UMDA 4QJGA 1XX2A 3FPWA 4DE2A 4EEUA 2ZD8A 4ARZA 3MQQA 3IXDA 3HLCA 1IYPA 3MF0A 4WUJA 2WAEA 3JYIA 5L09A 1KDWA 3IBRA 1KOUA 3Q82A 5FAQA 1BLCA 3SOIA 1L3LA 3IWQA 3PYPA 3CMZA 4HI4A 4HBTA 4HY8A 3VE3A 4BENA 3WRZA 3EEHA 4B4ZA 1TS7A 3W4QA 3T1XA 2AVXA 1RP5A 3SS4A 2J3WA 3HJIA 1MWUA 4YNRA 3PR6A 1SKOA 3OBFA 4B4XA 1OMEA 4B88A 4LENA 4ZRRA 2FFFB 4R3AA 3EQVA 1XP4A 3S7OA 3NY4A 1ONHA 3FKVA 2XFSA 2K31A 2Y2OA 4PM7A 1NZUA 5A91A 5HD5A 2Y2IA 5EOOA 1XKZA 3LIAA 2HP5A 2GNXA 4FOFA 1YKDA 4GKUA 1NY0A 5CTMA 3ZVTA 4CLCE 1CEGA 4PKYG 3MKFA 1IOUA 4WZ5C 3HCYA 1FOFA 5HDSA 5DFYA 3IF6C 1G6OA 1H8MA 4GLQA 5GHXA 1W63Q 5TFQA 5EVIB 3ITBA 3PBSA 4N9KA 1LI0A 3C2WA 3K3CA 1MWRA 4R70A 1G5UA 4KZBA 1E3UA 2V1BA 2Y2JA 3L7HA 3UB5P 5EPHA 4ZDXA 1OPXA 4WMCD 3B33A 2GZAA 5CEDA 4YOFA 1HVBA 1N9BA 3ZCZA 3HLWA 4E04A 5J3WA 1G6AA 5I94A 5KSCA 4ZJ1A 4P87A 3G35A 4WBGA 4DJ3A 1EROA 2XSSA 3PBTA 3IS2A 3VP2A 1J9MA 2DNSA 5E2HA 1ALQA 1FILA 3FC7A 2QYBA 5LBRA 2YKFA 3M6BA 3JVUA 3CWFA 4YFMA 2VGLM 3QP6A 4KUKA 4S2MA 1RGZA 3DBAA 2O9AA 2ZQ8A 3HLBA 1SCWA 1IELA 4HQAA 2CC1A 5DTTA 4PHTA 1TS6A 3DTEA 5K5BA 4RVAA 3LIDA 3T4SA 4LRYC 2VKSA 5FSRA 2XR0A 1CF0A 3ZDJA 3UY6A 3GECA 4IUKA 3TJZC 2OAQ1 2WKEA 3LR4A 4CLCC 5FAPA 2RCXA 4C75A 4ME4A 4QHCA 2VV6A 1YLTA 5KMWA 4EESA 5KIZA 2W3EA 4MBKA 3UE6A 1W8YA 3QNCA 2WUQA 3DTKA 5I5LA 2L4RA 1RCJA 1CI9A 2VGKA 5FDHA 4GN2A 3NOTC 1K54C 3Q07A 5FI7A 3GRJA 3OOVA 2XK1A 5HW3A 3LIBA 2Y79A 1YLPA 4ZJ3A 3K2NA 3G2ZA 1CQAA 1HTZA 3UE0A 4F94A 2A24B 1SZVA 2JN7A 4P0MA 5CHJA 2HDQA 3LR0A 3CLOA 1V9YA 2A3UA 1NJ4A 5DTKA 5A92A 4KZ9A 3KYQA 2P7JA 4WELA 4S2OA 4K0WA 4H6JA 4OQHA 3RXXA 4GJ4A 3HVFA 3BQ8A 2WKRA 1HZOA 1F2KA 3UPPA 5EUAA 2JBFA 2ZMFA 2V20A 2ZMVA 5GLCA 4BWIA 5E2GA 3LFVA 4CQHA 1XGIA 4GHIA 4GD8A 4WEKA 1ZKJA 5DF7A 4N1XA 3AGEA 2HP6A 3NBLA 4M4XA 3E4PA 3PBNA 4GS9A 2L1MA 4E3MA 1YPRA 4WM9A 3ZFZA 2EXAA 1IYOA 2VV7A 2Q9MA 3AGDA 5FL3A 2QZ6A 3LUQA 3IXBA 3GVBA 1WA9A 3F1OA 1ONGA 3ZG9B 4L9GA 1OTAA 3VP4A 4IVIA 5AQAA 4NEED 3W4OA 4E6WA 4OH0A 3WS2A 5EE8A 1IEMA 1NRFA 1K4EA 2JCHA 3MZEA 3IBJA 3PBQA 4PPRA 4WZ5A 3EQUA 4LFUA 3VSLA 1Q2PA 3IF6A 3Q81A 4PM6A 3MXRA 3LO7A 1H8ZA 2VV8A 2OV5A 1CJFA 2WGVA 3E2KA 5U47A 2XEPA 5FI2A 1IFQA 2ZQ9A 1S6RA 4S2IA 4QB8A 3UMEA 4NXEA 4U0TA 1S1ZA 3LGOA 4S2LA 2K2NA 4KQDA 3F1NB 3PAGA 4PM8A 3NOUC 4P85A 1ES3A 3MZDA 4BBTA 3IS2B 4D60A 4EW7A 1YMSA 5EV0A 3GTCA 2P08A 3U4LP 2O0YA 4FCFA 4FTXA 4BMWA 4DN0A 2LB9A 4LV2A 2X01A 1PI5A 5AJGA 3N8SA 3ICYA 2VA0A 1T18A 3GDIA 3MKEA 4Y3IA 3KYZA 3CAXA 3NI9A 3BY9A 1CK3A 2B18A 3V67A 4IBXA 4KQRA 4I3AA 3G4PA 1ZG4A 5CGWA 2FH5A 3HJKA 3OCNA 4BBVA 1NYYA 3QNBA 3EEAA 1GSVA 1OTBA 1TS0A 3S22A 1NZOA 1PFLA 4L9EA 4Y0OA 1KE3A 2D02A 4JF5A 4R4RA 3IX4A 1D06A 3TOIA 4BD1A 5IT5A 3NOPC 4JBFA 3UPNA 2X02A 3BQAA 1VEUB 4CLCA 2J80A 2W1TA 3G6OA 1FR1A 4XUZA 3C8CA 4S2KA 4BJPA 1S1YA 4Y0UA 2ZM0A 3DWZA 1GSWA 3V3RA 2XFTA 2GDNA 4NG2A 1K25A 2VK3A 4XT2A 1W5DA 4HJ6A 4B93A 3G2YA 1YSQA 1BT5A 3E0YA 1XJ6A 4KG5A 1K54A 1I5QA 1PRQA 4AFIA 4DF6A 3HLEA 5IHVA 2ZC5B 1XPBA 3O86A 3RJUA 4EU0A 3L9KA 2ZC6B 1LI9A 2HZ5A 1EI5A 3MBZA 4P6BA 4FD8A 1NLYA 3DW0A 1W79A 4FH4A 5EFWA 4H8RA 3KX0X 2M7UA 3PBRA 4H6JB 2XGNA 1MWTA 2KX6A 2EX8A 1ZG6A 5IU1A 3UDFA 3QHYA 5DFXA 2E8IA 4K08A 3T4LA 3PXPA 2MJ6A 4MLLA 5AVEA 4IEDA 1TEMA 2Y2HA 1E4DA 4BD0A 5TJJA 2IA2A 2P74A 1MXOA 2Y91A 3NDGA 1SDEA 4ESPA 5HPFA 2W27A 2IWBA 1S66L 1JWPA 4Q0JA 1W7FA 4IHQA 4GS9B 4PKYA 4X55A 4DE0A 3HUOA 4FSFA 1UGUA 4E3IA 2A24A 3V5MA 4EBNA 4XXRA 5FDSA 3CI6A 3N6IA 3S7NA 1P0ZA 3NULA 1K4FA 1ERQA 3NCKA 4LV0A 1S4SA 2ZC3B 3F1OB 3UDXA 4ZTKA 4Y17A 4B9OA 2EFXA 4BBUA 3SH9A 4K0XA 1DJBA 2ZOHA 3IH8A 3IF6B 2VEAA 5EVID 1K56D 3LR5A 4LLOB 2L0WA 2PD8A 5F68A 5HARA 3E4OA 1SKFA 2V1ZA 5CGSA 1DY6A 5F1GA 2VZWA 5DKLA 3NJAA 1XJ3A 2JE5A 2VLGA 3QP8A 4R38A 3D72A 3ZG0A 1HLUP 1KGGA 2XF3A 4KUOA 3MXQA 1KGFA 3H7WA 3CG5A 1GCEA 1OTEA 2W3FA 5A93A 1XA7A 1YSPA 5GLDA 1L0DA 3T4TA 2WKHA 3E98A 2G2UA 1YLWA 4LCLA 3WS5A 3MQ0A 3VFHA 5L8MA 3PTEA 3G34A 3FWLA 2JHEA 3DTMA 4X68A 4S2NC 3ZNTA 3TW8A 4OOYA 4OPQA 5GLAA 1N9NA 2JKTI 5L2FA 3UNWA 5TGFA 1JVJA 5F6AA 4RX2A 1BUEA 1FQGA 4KENB 3CZDA 4N92A 1H0MA 3KSHA 5EM0A 3EGXC 3PAEA 3P98A 3C30A 3TSGA 4RYEA 1LSXA 2XRNA 4LCMA 2VX8A 5F82A 3NIAA 1U60A 1ESUA 2X71A 2R9XA 4EUVA 3WS0A 2W3GA 4YWZA 5HSQA 4PAUA 3F1NA 3D9YA 2WKPA 4HNBA 5A90A 2QPNA 5CERA 4NXGA 4JGRA 4NXFA 3ISGA 4CLCB 2W1TB 1XJ4A 3RH8B 4P6ZM 4WL9A 3HLGA 1KE0A 2ZOIA 1CI8A 2Y2LA 1DP6A 1ERMA 1FCNA 1N9OA 1NWZA 5FQMA 1IYSA 5HAPA 4ZJ2A 5DTSA 4JPMA 4XT2B 4R3JA 1I2WA 3BW6A 5L07A 5KSHA 3VP3A 1FSYA 4Y7PA 2JKGA 1LL8A 4KG6A 1WYCA 3S4XA 2V8CA 3OLOA 4KZ8A 5FA7A 2G7UA 2EA9A 3MXSA 3ZNYA 4QY6A 3SW1A 4GCZA 2WZZA 1BZAA 1AWIA 1BULA 5D3OA 3VOLA 4E3JA 1IKGA 5CEBA 3BWLA 5HDCA 3ZHHA 1S4RA 5CECA 3T4KA 4NETA 3RFBA 1VEUA 3NHQA 1W63M 4LRXC 2XH9A 2O9CA 3VMAA 2PU4A 4EWFA 3LY3A 3UE1A 3O88A 1G28A 3QP5A 2WAFA 4RA7A 2BASA 3UB6A 5G4YA 3HLFA 4JXGA 4MEZA 3WRTA 1W8QA 2J8YA 3M2KA 3SS5A 3EOIA 1I2SA 3VFFA 3LI8A 2V2FF 5HL6A 2ZQCA 4NKPA 5F1FA 3ZG7B 2Y2QA 4OQIA 1Q2QA 2EX2A 1YLZA 1GSXA 3HLDA 2EXBA 3M6HA 2Z6DA 4KZAA 5HD3A 2XD5A 2WZXA 4MCWA 5DJUA 3R4KA 3U2AA 4R3BA 3QP1A 2PHYA 3UPOA 4GW9A 1DP9A 4Y15A 3UB9A 3KYEA 1IYQA 2J3TD 4X25A 5CGXA 1ACFA 3A3FA 5EVLA 3V50A 1UWNX 5L10A 4GD6A 2ZJ9A 4IUHA 4JGOA 1YLJA 1N4OA 4PM5A 5HL1A 2H10A 5KZHA 3HUMA 3Q7ZA 2EX6A 4PM9A 2QMIA 4OKPA 1QMEA 3CHWP 1E3UD 4I5SA 4JF4A 4DXCA 4OVDA 3VOYA 1M6KA 4DE3A 4DKIA 3MS6A 4UAAA 3O5YA 3MFDA 5HAQA 2V8FA 2B02A 3VP0A 4OPYA 2HPBA 2XQZA 2ZLYA 3OZHA 4P6ZS 5CHUA 3BFFA 2CMNA 5M1AA 4HP9A 4MDZA 1F5MA 1V9ZA 4G3VA 2QKPA 3NDEA 2HP9A 2HJ9C 1YM1A 1TDGA 3D4FA 3H7WB 3H82A 1K55C 5FEFA 5HWWA 4JXSA 3IXGA 3HREA 1AXBA 5CTNA 4R6LA 1GHPA 4OONA 4N9LA 2WADA 3GSGA
chains in the Genus database with same CATH topology
3EEHA 1TS7A 1EW0A 3UB8A 4AFIA 4MN6A 2EWWA 1Y28A 2J3WA 3HJIA 3KSFA 4YNRA 4F3LB 4Q0IA 3OC2A 2I9VA 1BYWA 3PR6A 3OBFA 1STZA 3KSGA 4ZRRA 4EU0A 2JKTM 2PT7A 4R3AA 3K3DA 1ODVA 3EQVA 1P9RA 3PBOA 5HZHA 2JKRI 3S7OA 2K31A 1NLYA 5HD5A 3B42A 5HDDA 2KDKA 3LIAA 5EFWA 3KX0X 2GNXA 2M7UA 4FOFA 3PBRA 1YKDA 4UQIM 5TBMB 3UB7A 4H6JB 4CLCE 3R7WB 3EGDC 4PKYG 4WN5A 3A0VA 1IOUA 3HCYA 2KX6A 5HDSA 5DFYA 4HIAA 1G6OA 1H8MA 4GLQA 5IU1A 1W63Q 2V1AA 3T4JA 5J7EA 5DFXA 3PBSA 4HH2A 3C2WA 3K3CA 4K08A 4R70A 1F98A 3T4LA 3E4QA 4MMNA 4RQ9A 2H28A 3PXPA 1DRMA 2MJ6A 2V1BA 1VHMA 5AVEA 4ETXA 3LR3A 5TJJA 1S67L 1OPXA 2IA2A 4ARZB 3B33A 5HPFA 2W27A 4UQIS 2GZAA 1S66L 4YOFA 4Q0JA 2NUPC 3VV4A 3RTYA 3LI9A 3MMHA 4IHQA 2J3TC 4GS9B 4IJGA 4PKYA 4E04A 4FSFA 3CUEC 5J3WA 1UGUA 2A24A 5AVFA 4JGPA 2EWVA 3CI6A 3S7NA 4DJ3A 1P0ZA 2XSSA 4I3IA 3PBTA 3IS2A 1S4SA 4LRZE 2K7SA 3F1OB 3FC7A 4DJ2A 2QYBA 5LBRA 2YKFA 4B9OA 3JVUA 3CWFA 2PDRA 2O99A 2VGLM 2V0WA 4KUKA 4BBUA 4NXBA 3DBAA 1T19A 1N9LA 2ZOHA 1LT0A 2O9AA 1XJ2A 1F9IA 3MQOA 3ULFA 2VEAA 3LR5A 4HQAA 4LLOB 4PHTA 2L0WA 2PD8A 1MC0A 1TS6A 5F68A 1JNUA 3E4OA 4HP4A 5K5BA 2V0UA 3LIDA 3T4SA 4LRYC 2VKSA 2VZWA 4Y2FA 5DKLA 4WLAA 3NJAA 1XJ3A 2VLGA 2ZBBA 1TD5A 2VGLS 5C5KA 4R38A 3D72A 4HOIA 2W3HA 4I38A 4MN5A 3TE8A 4KUOA 3GECA 5DF9A 4IUKA 4HHDA 3JVVA 3TJZC 3S7QA 2OAQ1 3MXQA 3LR4A 4CLCC 3H7WA 4G3KA 4ME4A 1OTEA 2DMWA 1OTDA 2W3FA 3B47A 1P9WA 2VV6A 1YSPA 2QJ7A 3T4TA 4EESA 5KIZA 2W3EA 3E98A 2HF6A 3UE6A 2XA7S 4WF0A 3MQ0A 5L8MA 5F69A 3T4QA 5I5LA 2L4RA 1OJGA 2JHEA 1MZUA 2LB5A 3NOTC 3TW8A 1VB6A 4EERA 3OOVA 1N9NA 2JKTI 2QWSA 1YAXA 4QPRA 4F3LA 3LIBA 2Y79A 5F6AA 3P01A 3K2NA 1TS8A 3KSHA 5DKKA 3EGXC 2M1CA 3A0SA 3FG8A 1DP8A 3W2ZA 2A24B 3C30A 4EETB 4I39A 4O01A 2JN7A 3VE4A 4UEYA 1T1BA 2D01A 1LSXA 2XRNA 3LR0A 5F5YA 2VX8A 3CLOA 4JGQA 3S7PA 1V9YA 2Y8HA 4Y5FA 2GX5A 4EUVA 2W3GA 4YWZA 4WEJA 4EEPA 5HSQA 4PAUA 3KYQA 2P7JA 3F1NA 4WELA 2WKPA 4HNBA 5TBMA 4H6JA 2A2LA 4GJ4A 4NXGA 4JGRA 4NXFA 4CLCB 2W1TB 4O0PA 3BQ8A 1XJ4A 1ZTUA 3LYXA 3RH8B 4P6ZM 3H82B 2WKRA 4WL9A 2ZOIA 4HH3A 1DP6A 2R78A 4L0LA 3F1PB 4G3WA 1N9OA 1NWZA 2ZMFA 2ZMVA 4BWIA 4XT2B 2YKHA 3LFVA 4CQHA 2OOLA 4I3JA 3BW6A 4GHIA 5KSHA 1ZHHB 2GJ3A 4WEKA 1LL8A 4M4XA 1X0OA 3E4PA 3OLOA 3PBNA 4GS9A 5MC7A 2G7UA 2EA9A 2L1MA 3SW1A 2NUTC 2QHKA 4GCZA 2WKQA 1UWPX 2VV7A 5FL3A 3MR0A 3P7NA 1H3QA 3ZQ5A 3LUQA 3VOLA 1WA9A 3F1OA 3BWLA 4L9GA 1OTAA 5IS1A 1LSWA 5HDCA 1S4RA 4NEED 3T4KA 3RFBA 2JKRM 3IBJA 3NHQA 3PBQA 1W63M 4LRXC 4CLCD 3H9WA 5G4ZA 2W0NA 4DMZA 1OT9A 3EQUA 3LIFA 2O9CA 2O9BA 2PR5A 3KO6A 3T50A 1G28A 2VV8A 5CX7A 2PR6A 3UB6A 2BASA 5G4YA 2OWHA 3A0RA 1P97A 4II7A 3EOIA 1IFQA 4ETZA 3LI8A 1LSVA 5HL6A 2XROA 4NKPA 3T4OA 3PHYA 3UMEA 3EWKA 3D3OA 1OTIA 2M7VA 3LIEA 4KQOA 4NXEA 2FZ0A 2W1RA 1GSXA 4Q0HA 4OOMA 1S1ZA 5HWVA 1XFQA 5DJTA 3CUEA 4L9FA 4EQ1A 2K2NA 2Z6DA 4KQDA 5HD3A 3F1NB 5J4EA 4MCWA 5DJUA 3R4KA 2VJWA 3U2AA 2PHYA 3TRCA 2OWJA 3BY8A 3NOUC 4GW9A 4HJ3A 1DP9A 1T1CA 4BBTA 2INWA 3IS2B 4EW7A 3UB9A 3FPVA 3UE3A 2P08A 2PD7A 2O0YA 2J3TD 2QJ5A 4BMWA 4DN0A 2OAP1 2LB9A 4O8GA 1UWNX 5HPIA 3R7WA 4Z1WA 4IUHA 4GHIB 5AJGA 2HV1A 4OOLA 3LICA 4JGOA 5A8BA 3KSIA 3ICYA 2VA0A 1T18A 3GDIA 4Y3IA 2HJEA 4HJ4A 3KYZA 1D7EA 3CAXA 4LPZA 3BY9A 2Z6CA 2B18A 3MFXA 1XFNA 3V67A 4I5SA 3UMDA 3BJNA 4I3AA 3FPWA 2PYRA 4EEUA 1T1AA 2FH5A 3HJKA 4ARZA 3O5YA 3OCNA 2V9AA 4BBVA 2B02A 2PYPA 2KLIA 1GSVA 1OTBA 1TS0A 3EEAA 4MN7A 3MQQA 2P04A 4L9EA 3MF0A 2D02A 2HGVA 1D06A 4P6ZS 4WUJA 5IT5A 2CMNA 1OJ5A 3NOPC 3MJQA 4HP9A 4MDZA 1F5MA 3ZYTA 1V9ZA 4G3VA 3IBRA 3BQAA 2QKPA 4CLCA 2J80A 4EXOA 2W1TA 1KOUA 3G6OA 5HWTA 2HJ9C 1OT6A 3CITA 3H7WB 3H82A 3C8CA 1NLZA 3C38A 4BJPA 1S1YA 5HWWA 1GSWA 1TF1A 3F1PA 3PYPA 2KOIA 1MKMA 4R6LA 3OCLA 4XT2A 4HJ6A 4B93A 4HI4A 1YSQA 4HY8A 3VE3A 3E0YA 1XJ6A 1NRJA 2W3DA 2XA7M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EEH A;  1TS7 A;  1EW0 A;  3UB8 A;  4MN6 A;  1Y28 A;  3HJI A;  4F3L B;  2I9V A;  1BYW A;  4R3A A;  3K3D A;  1ODV A;  5HZH A;  5HD5 A;  5HDD A;  2KDK A;  3LIA A;  5EFW A;  3KX0 X;  5TBM B;  3UB7 A;  4H6J B;  4PKY G;  4WN5 A;  3A0V A;  2KX6 A;  5HDS A;  4HIA A;  5IU1 A;  2V1A A;  5J7E A;  4HH2 A;  3C2W A;  3K3C A;  4K08 A;  4R70 A;  1F98 A;  3E4Q A;  4RQ9 A;  2H28 A;  1DRM A;  2V1B A;  5AVE A;  1S67 L;  3B33 A;  2W27 A;  1S66 L;  3RTY A;  3LI9 A;  4GS9 B;  4PKY A;  4E04 A;  5J3W A;  1UGU A;  2A24 A;  5AVF A;  4JGP A;  4DJ3 A;  1P0Z A;  4I3I A;  3IS2 A;  1S4S A;  4LRZ E;  2K7S A;  3F1O B;  3FC7 A;  4DJ2 A;  2YKF A;  4B9O A;  3CWF A;  2PDR A;  2V0W A;  4BBU A;  4KUK A;  4NXB A;  1T19 A;  1N9L A;  2ZOH A;  1LT0 A;  1XJ2 A;  1F9I A;  3MQO A;  3ULF A;  2VEA A;  4HQA A;  4LLO B;  2L0W A;  2PD8 A;  1TS6 A;  5F68 A;  1JNU A;  3E4O A;  4HP4 A;  2V0U A;  3LID A;  4LRY C;  5DKL A;  4WLA A;  3NJA A;  1XJ3 A;  2VLG A;  2ZBB A;  4R38 A;  3D72 A;  4HOI A;  4I38 A;  4MN5 A;  4KUO A;  3GEC A;  4HHD A;  3MXQ A;  3H7W A;  1OTE A;  1OTD A;  2VV6 A;  2QJ7 A;  4EES A;  5KIZ A;  3UE6 A;  4WF0 A;  5F69 A;  5I5L A;  2L4R A;  1OJG A;  2JHE A;  1MZU A;  3NOT C;  1VB6 A;  4EER A;  1N9N A;  2QWS A;  4F3L A;  3LIB A;  5F6A A;  1TS8 A;  5DKK A;  2M1C A;  3A0S A;  3FG8 A;  1DP8 A;  4EET B;  2A24 B;  4I39 A;  2JN7 A;  3VE4 A;  1T1B A;  2D01 A;  1LSX A;  5F5Y A;  3CLO A;  4JGQ A;  1V9Y A;  4YWZ A;  4EEP A;  5HSQ A;  2P7J A;  3F1N A;  2WKP A;  4HNB A;  5TBM A;  4H6J A;  4NXG A;  4JGR A;  4NXF A;  1XJ4 A;  3LYX A;  3RH8 B;  3H82 B;  2WKR A;  4WL9 A;  2ZOI A;  4HH3 A;  1DP6 A;  2R78 A;  3F1P B;  1N9O A;  1NWZ A;  4XT2 B;  2YKH A;  2OOL A;  4I3J A;  4GHI A;  2GJ3 A;  1LL8 A;  4M4X A;  1X0O A;  3E4P A;  3OLO A;  4GS9 A;  2EA9 A;  2L1M A;  3SW1 A;  2QHK A;  4GCZ A;  2WKQ A;  1UWP X;  2VV7 A;  3MR0 A;  3P7N A;  3ZQ5 A;  3LUQ A;  3VOL A;  1WA9 A;  3F1O A;  3BWL A;  4L9G A;  1OTA A;  5IS1 A;  1LSW A;  5HDC A;  1S4R A;  3NHQ A;  4LRX C;  3H9W A;  5G4Z A;  2W0N A;  1OT9 A;  3LIF A;  2PR5 A;  3T50 A;  1G28 A;  2VV8 A;  2PR6 A;  3UB6 A;  2BAS A;  5G4Y A;  2OWH A;  3A0R A;  1P97 A;  3LI8 A;  1LSV A;  3PHY A;  3UME A;  3EWK A;  1OTI A;  3LIE A;  4NXE A;  1GSX A;  1S1Z A;  5HWV A;  1XFQ A;  5DJT A;  4L9F A;  4EQ1 A;  2Z6D A;  4KQD A;  5HD3 A;  3F1N B;  5J4E A;  5DJU A;  2PHY A;  2OWJ A;  3BY8 A;  3NOU C;  4GW9 A;  4HJ3 A;  1DP9 A;  1T1C A;  4BBT A;  2INW A;  3IS2 B;  4EW7 A;  3UB9 A;  2PD7 A;  2QJ5 A;  1UWN X;  4GHI B;  2HV1 A;  3LIC A;  4JGO A;  5A8B A;  3ICY A;  1T18 A;  3GDI A;  4HJ4 A;  1D7E A;  3CAX A;  4LPZ A;  3BY9 A;  2Z6C A;  3MFX A;  1XFN A;  4I5S A;  3UMD A;  4I3A A;  2PYR A;  4EEU A;  1T1A A;  3HJK A;  2V9A A;  4BBV A;  2B02 A;  2PYP A;  1GSV A;  1OTB A;  1TS0 A;  3MQQ A;  4L9E A;  2D02 A;  1D06 A;  4WUJ A;  2CMN A;  1OJ5 A;  3NOP C;  3MJQ A;  4HP9 A;  1V9Z A;  3IBR A;  2QKP A;  2J80 A;  4EXO A;  1KOU A;  3G6O A;  5HWT A;  1OT6 A;  3H7W B;  3H82 A;  3C8C A;  1S1Y A;  5HWW A;  1GSW A;  3F1P A;  3PYP A;  4R6L A;  4XT2 A;  4HJ6 A;  4HI4 A;  4HY8 A;  3VE3 A;  1XJ6 A; 
#chains in the Genus database with same CATH topology
 1VQQ A;  1EW0 A;  3UB8 A;  5CXW A;  4MN6 A;  2UWX A;  2ZQA A;  2EWW A;  1Y28 A;  4X1M A;  3KSF A;  4XUX A;  4Y0T A;  3OC2 A;  2C6W B;  1BYW A;  5FAO A;  1STZ A;  2JKT M;  4UA7 A;  4DDY A;  3PBO A;  5J8X A;  2P9V A;  2JKR I;  3WS1 A;  2J9O A;  5E43 A;  4KZ5 A;  3IT9 A;  3AGF A;  4MBF A;  3B42 A;  4MNR A;  4EUZ A;  2J7V A;  1KGE A;  2DCF A;  3R7W B;  3EGD C;  1GA9 A;  2IWC A;  1VM1 A;  3BYD A;  1NXY A;  3IX3 A;  4HH2 A;  4KZ4 A;  5M18 A;  3ZGA B;  1F98 A;  3UDI A;  4RQ9 A;  4WZ4 A;  2H28 A;  1SHV A;  1K57 C;  2Y2M A;  4QWO A;  1VHM A;  4EBP A;  5DVA A;  4ETX A;  3LR3 A;  1S67 L;  4UA9 A;  4UQI S;  2UV0 E;  2PBY A;  3LI9 A;  3MMH A;  2J3T C;  2ZM2 A;  1KE4 A;  2WGW B;  3VP1 A;  3CUE C;  3DWK A;  4JGP A;  2EWV A;  3LEQ A;  2A49 A;  4I3I A;  3T1R A;  1PWG A;  3BRM A;  1WE4 A;  3V3S A;  3FZC A;  2PAV P;  4DJ2 A;  2Y2K A;  4R1G A;  2PDR A;  2V0W A;  4NXB A;  1T19 A;  5FAT A;  5GL9 A;  5HFO A;  1LT0 A;  1XJ2 A;  4GNU A;  3MQO A;  2ZQ7 A;  5M19 A;  5E2E A;  3LEZ A;  3BFC A;  4JF6 A;  3WWX A;  1H8Y A;  3I7J A;  3GV9 A;  4WLA A;  4KG2 A;  4GDN A;  2ZBB A;  1ES4 A;  1TD5 A;  2W3H A;  4I38 A;  4MN5 A;  1JWZ A;  3IX8 A;  2XDM A;  1Z6F A;  4HHD A;  1FCO A;  3JVV A;  1L0G A;  2JC7 A;  2G2W A;  4LV1 A;  4JXV A;  2WYX A;  3SZT A;  3BFD A;  4OP8 A;  1P9W A;  2B5R A;  4X1L A;  2QJ7 A;  4GOG A;  3OPL A;  4BQM A;  2C5W B;  4WF0 A;  3HL9 A;  1WYB A;  5F69 A;  2BG1 A;  5FQ9 A;  5HX9 A;  3C4O A;  2LB5 A;  1VB6 A;  1PYY A;  3CPT B;  1XA1 A;  2RL3 A;  4E3N A;  2QWS A;  1Y4O A;  4WMC A;  4F3L A;  3P09 A;  3T1Q B;  3BEC A;  1TS8 A;  3N8R A;  5DKK A;  3LY4 A;  2FFY A;  3W2Z A;  5G18 A;  4I39 A;  3VE4 A;  3BLS A;  4E3O A;  1ESI A;  1PZP A;  4R0Q A;  3S7P A;  2Y8H A;  3BFE A;  4JXW A;  1ES2 A;  4OP5 A;  5AQ9 A;  4EEP A;  3IQA A;  3UN7 A;  4Y13 A;  4BL2 A;  1MY8 A;  5TBM A;  1K0K A;  1Z09 A;  1NYM A;  1K55 A;  1KVM A;  3LYX A;  3H82 B;  3NEC A;  4E6X A;  3G31 A;  2XLN A;  4HH3 A;  2R78 A;  1HD8 A;  3M2J A;  4G3W A;  1S0W A;  4S2P A;  1JTD A;  2YKH A;  3IWO A;  4OPZ A;  4RX3 A;  2GJ3 A;  5EOE A;  5GLB A;  3G30 A;  3IH9 A;  5EVE A;  4LV3 A;  4X53 A;  2NUT C;  3LCE A;  4QY5 A;  3FKW A;  2WGI A;  1UWP X;  3WS4 A;  3C7U A;  2H5S A;  3MR0 A;  4MBH A;  5FEG A;  2P9V B;  1MKI A;  3E2L A;  1KVL A;  3V39 A;  2JKF A;  4NK3 A;  2OLV A;  1LL5 A;  2JKR M;  2ZL1 B;  4CLC D;  3H9W A;  5G4Z A;  4DMZ A;  1OT9 A;  1VET A;  4O7D A;  2PR5 A;  3A3J A;  3KO6 A;  1FIK A;  5CX7 A;  1MWS A;  2WKI A;  4E3L A;  3VSK A;  1D1J A;  1LL9 A;  1P97 A;  1K57 A;  1LLB A;  4II7 A;  4KZ6 A;  2XRO A;  3PHY A;  4LGW A;  1BSG A;  3D3O A;  1OTI A;  1GHI A;  5JYO A;  4OOM A;  5HWV A;  1XFQ A;  2I72 A;  3CUE A;  5DJT A;  5FI6 A;  4L9F A;  4EQ1 A;  4Z9Q A;  4UA6 A;  3FV7 A;  4X56 A;  5J4E A;  2VJW A;  3TRC A;  2OWJ A;  3BY8 A;  1DJC A;  3TG9 A;  2HDS A;  2PD7 A;  5HAI A;  2QJ5 A;  3QP4 A;  3NC8 A;  1PI4 A;  2Z2L B;  4O8G A;  5HPI A;  3R7W A;  1K38 A;  1ES5 A;  2ACG A;  3LIC A;  1H5X A;  3KSI A;  3VOZ A;  1PW8 A;  2HDU A;  3SS3 A;  1Y54 A;  2Q9N A;  4HJ4 A;  4LPZ A;  2BLS A;  1XFN A;  3BJN A;  4A5R A;  1BLS A;  2PYR A;  2ZC4 B;  1T1A A;  1PW1 A;  3ZG8 B;  2V9A A;  2PYP A;  2KLI A;  4MN7 A;  2DRW A;  2P04 A;  2WGW A;  2HGV A;  2BTF P;  3OPR A;  4EQI A;  1OJ5 A;  3MJQ A;  4HBU A;  3ZYT A;  3Q7V A;  3IXH A;  4EXO A;  5HWT A;  1OT6 A;  3CIT A;  1PNE A;  1IKI A;  4FUW A;  1NLZ A;  3C38 A;  1EWZ A;  2E8J A;  5EVI C;  1TF1 A;  3F1P A;  5FQI A;  3HBR A;  2KOI A;  1MKM A;  3OCL A;  4GDB A;  3A3E A;  4UHU A;  1NRJ A;  4IBR A;  2W3D A;  2XA7 M;  1MBL A;  3MSH A;  4F3L B;  4Q0I A;  2IWD A;  2I9V A;  3S1Y A;  3DAV A;  3KSG A;  1KDS A;  4ZAM A;  2PT7 A;  1YMX A;  3K3D A;  1ODV A;  5HZH A;  1P9R A;  3BFG A;  4X6T A;  3IHB A;  3ZVW A;  5FQJ A;  1TVF A;  5HDD A;  2KDK A;  4OLD A;  2PBD P;  4UQI M;  5TBM B;  3UB7 A;  5GHZ A;  3JPU A;  4WN5 A;  3A0V A;  4ZBE A;  5E2F A;  4HIA A;  2V1A A;  3T4J A;  4DXB A;  5J7E A;  1BLP A;  4PMA A;  3E4Q A;  4MMN A;  4ID4 A;  4EV4 A;  1DRM A;  2Z2M B;  5JYP A;  3CPT A;  4D2O A;  4N1H A;  4DRT A;  2Y2N A;  4ARZ B;  1G68 A;  2NUP C;  3VV4 A;  3RTY A;  4IJG A;  2WK0 A;  3A3I A;  2H0Y A;  5AVF A;  3IF5 A;  4R4S A;  3O3V A;  5CRF A;  4E3K A;  3CJM A;  4LRZ E;  2K7S A;  1GA0 A;  4X69 A;  3T12 B;  3B3X A;  1PZO A;  2XD1 A;  2O99 A;  2EFU A;  4FH2 A;  1FCM A;  1FSW A;  2Q0O A;  1ZC2 A;  1M40 A;  1N9L A;  4IVK A;  3UO9 A;  1F9I A;  1VET B;  4U3T A;  3ULF A;  3OPH A;  4M3K A;  4DE1 A;  2OSU A;  3ITA A;  1MC0 A;  1JNU A;  4HP4 A;  2V0U A;  1SKO B;  4Q8I A;  4CJN A;  3SH8 A;  4S2N A;  4Y2F A;  1YQS A;  4WYY A;  2VGL S;  1L0F A;  5C5K A;  4HOI A;  4BLM A;  4K91 A;  4OLG A;  3Q1F A;  3TE8 A;  5GHY A;  5DF9 A;  1YT4 A;  3S7Q A;  3C5A A;  2Y55 A;  4G3K A;  2DMW A;  1OTD A;  1FR6 A;  3B47 A;  1J3W A;  2HF6 A;  2XA7 S;  3O87 A;  3T4Q A;  3N7W A;  3G32 A;  2ZL1 A;  1OJG A;  1MZU A;  2EX9 A;  2Y2G A;  3W4P A;  4C6Y A;  4EER A;  3QP2 A;  1YAX A;  4QPR A;  3C4P A;  3N4I A;  3P01 A;  2M1C A;  3A0S A;  1MPL A;  1DP8 A;  3FG8 A;  4EET B;  3DTI A;  4KQQ A;  4O01 A;  4C3Q A;  4UEY A;  1T1B A;  2D01 A;  5F5Y A;  4BL3 A;  1E25 A;  4JGQ A;  4HES A;  4HEF A;  1QMF A;  5EEC A;  4KZ3 A;  4Y5F A;  2GX5 A;  4U0X A;  4WEJ A;  4JLF A;  2A2L A;  3BEB A;  1L0E A;  3Q7V B;  1YLY A;  1L2S A;  4O0P A;  2ZC7 A;  1ZTU A;  3T1S A;  1C3B A;  4KZ7 A;  5EVI A;  1K56 A;  4L0L A;  3F1P B;  1DJA A;  4CPK A;  4GB7 A;  2OOL A;  3BLM A;  3W8K A;  4I3J A;  1K6S A;  1ZHH B;  1BTL A;  1XGJ A;  1SDN A;  4R23 A;  1CEF A;  3FYZ A;  5CHM A;  3BM6 A;  3GR2 A;  1X0O A;  5MC7 A;  1O7E A;  5FQQ A;  2QHK A;  1PWD A;  2WKQ A;  5BOH A;  3GQZ A;  1RGY A;  3P7N A;  1H3Q A;  3ZQ5 A;  4DDS A;  3RXW A;  2PU2 A;  5FQK A;  3C7V A;  2ZMA A;  5IS1 A;  1LSW A;  3N8L A;  1PWC A;  2J9P A;  3OPP A;  2W0N A;  3LIF A;  2O9B A;  1JTG A;  2OLU A;  4OQ0 A;  5AQB A;  3T50 A;  5DF8 A;  1A0K A;  2PR6 A;  2OWH A;  4GZB A;  2ZM8 A;  3A0R A;  2PRF A;  1JWV A;  2Y4A A;  2VGJ A;  4EBL A;  4ETZ A;  4OPR A;  3IWI A;  2HDR A;  1LSV A;  5F83 A;  3T4O A;  1LHY A;  3EWK A;  2B95 A;  2M7V A;  3SH7 A;  3LIE A;  4KQO A;  4Q0H A;  2FZ0 A;  2W1R A;  4QU3 A;  4YIN A;  3ZG5 A;  4QD4 A;  2H0T A;  1BLH A;  3GMW A;  3IHA A;  2Y59 A;  1K6R A;  2Y2P A;  4HJ3 A;  1T1C A;  2INW A;  1TDL A;  3A3D A;  3FPV A;  5EM1 A;  1PIO A;  3HUN A;  3UE3 A;  5FAS A;  2ZQD A;  4S2J A;  2R9W A;  2OAP 1;  4Z1W A;  4GHI B;  2HV1 A;  4OOL A;  5A8B A;  1GHM A;  1XXM A;  3MZF A;  2HJE A;  1D7E A;  1O07 A;  4OQG A;  2Z6C A;  3MFX A;  4JKT A;  5AQ7 A;  5TR7 A;  3UMD A;  4QJG A;  1XX2 A;  3FPW A;  4DE2 A;  4EEU A;  2ZD8 A;  4ARZ A;  3MQQ A;  3IXD A;  3HLC A;  1IYP A;  3MF0 A;  4WUJ A;  2WAE A;  3JYI A;  5L09 A;  1KDW A;  3IBR A;  1KOU A;  3Q82 A;  5FAQ A;  1BLC A;  3SOI A;  1L3L A;  3IWQ A;  3PYP A;  3CMZ A;  4HI4 A;  4HBT A;  4HY8 A;  3VE3 A;  4BEN A;  3WRZ A;  3EEH A;  4B4Z A;  1TS7 A;  3W4Q A;  3T1X A;  2AVX A;  1RP5 A;  3SS4 A;  2J3W A;  3HJI A;  1MWU A;  4YNR A;  3PR6 A;  1SKO A;  3OBF A;  4B4X A;  1OME A;  4B88 A;  4LEN A;  4ZRR A;  2FFF B;  4R3A A;  3EQV A;  1XP4 A;  3S7O A;  3NY4 A;  1ONH A;  3FKV A;  2XFS A;  2K31 A;  2Y2O A;  4PM7 A;  1NZU A;  5A91 A;  5HD5 A;  2Y2I A;  5EOO A;  1XKZ A;  3LIA A;  2HP5 A;  2GNX A;  4FOF A;  1YKD A;  4GKU A;  1NY0 A;  5CTM A;  3ZVT A;  4CLC E;  1CEG A;  4PKY G;  3MKF A;  1IOU A;  4WZ5 C;  3HCY A;  1FOF A;  5HDS A;  5DFY A;  3IF6 C;  1G6O A;  1H8M A;  4GLQ A;  5GHX A;  1W63 Q;  5TFQ A;  5EVI B;  3ITB A;  3PBS A;  4N9K A;  1LI0 A;  3C2W A;  3K3C A;  1MWR A;  4R70 A;  1G5U A;  4KZB A;  1E3U A;  2V1B A;  2Y2J A;  3L7H A;  3UB5 P;  5EPH A;  4ZDX A;  1OPX A;  4WMC D;  3B33 A;  2GZA A;  5CED A;  4YOF A;  1HVB A;  1N9B A;  3ZCZ A;  3HLW A;  4E04 A;  5J3W A;  1G6A A;  5I94 A;  5KSC A;  4ZJ1 A;  4P87 A;  3G35 A;  4WBG A;  4DJ3 A;  1ERO A;  2XSS A;  3PBT A;  3IS2 A;  3VP2 A;  1J9M A;  2DNS A;  5E2H A;  1ALQ A;  1FIL A;  3FC7 A;  2QYB A;  5LBR A;  2YKF A;  3M6B A;  3JVU A;  3CWF A;  4YFM A;  2VGL M;  3QP6 A;  4KUK A;  4S2M A;  1RGZ A;  3DBA A;  2O9A A;  2ZQ8 A;  3HLB A;  1SCW A;  1IEL A;  4HQA A;  2CC1 A;  5DTT A;  4PHT A;  1TS6 A;  3DTE A;  5K5B A;  4RVA A;  3LID A;  3T4S A;  4LRY C;  2VKS A;  5FSR A;  2XR0 A;  1CF0 A;  3ZDJ A;  3UY6 A;  3GEC A;  4IUK A;  3TJZ C;  2OAQ 1;  2WKE A;  3LR4 A;  4CLC C;  5FAP A;  2RCX A;  4C75 A;  4ME4 A;  4QHC A;  2VV6 A;  1YLT A;  5KMW A;  4EES A;  5KIZ A;  2W3E A;  4MBK A;  3UE6 A;  1W8Y A;  3QNC A;  2WUQ A;  3DTK A;  5I5L A;  2L4R A;  1RCJ A;  1CI9 A;  2VGK A;  5FDH A;  4GN2 A;  3NOT C;  1K54 C;  3Q07 A;  5FI7 A;  3GRJ A;  3OOV A;  2XK1 A;  5HW3 A;  3LIB A;  2Y79 A;  1YLP A;  4ZJ3 A;  3K2N A;  3G2Z A;  1CQA A;  1HTZ A;  3UE0 A;  4F94 A;  2A24 B;  1SZV A;  2JN7 A;  4P0M A;  5CHJ A;  2HDQ A;  3LR0 A;  3CLO A;  1V9Y A;  2A3U A;  1NJ4 A;  5DTK A;  5A92 A;  4KZ9 A;  3KYQ A;  2P7J A;  4WEL A;  4S2O A;  4K0W A;  4H6J A;  4OQH A;  3RXX A;  4GJ4 A;  3HVF A;  3BQ8 A;  2WKR A;  1HZO A;  1F2K A;  3UPP A;  5EUA A;  2JBF A;  2ZMF A;  2V20 A;  2ZMV A;  5GLC A;  4BWI A;  5E2G A;  3LFV A;  4CQH A;  1XGI A;  4GHI A;  4GD8 A;  4WEK A;  1ZKJ A;  5DF7 A;  4N1X A;  3AGE A;  2HP6 A;  3NBL A;  4M4X A;  3E4P A;  3PBN A;  4GS9 A;  2L1M A;  4E3M A;  1YPR A;  4WM9 A;  3ZFZ A;  2EXA A;  1IYO A;  2VV7 A;  2Q9M A;  3AGD A;  5FL3 A;  2QZ6 A;  3LUQ A;  3IXB A;  3GVB A;  1WA9 A;  3F1O A;  1ONG A;  3ZG9 B;  4L9G A;  1OTA A;  3VP4 A;  4IVI A;  5AQA A;  4NEE D;  3W4O A;  4E6W A;  4OH0 A;  3WS2 A;  5EE8 A;  1IEM A;  1NRF A;  1K4E A;  2JCH A;  3MZE A;  3IBJ A;  3PBQ A;  4PPR A;  4WZ5 A;  3EQU A;  4LFU A;  3VSL A;  1Q2P A;  3IF6 A;  3Q81 A;  4PM6 A;  3MXR A;  3LO7 A;  1H8Z A;  2VV8 A;  2OV5 A;  1CJF A;  2WGV A;  3E2K A;  5U47 A;  2XEP A;  5FI2 A;  1IFQ A;  2ZQ9 A;  1S6R A;  4S2I A;  4QB8 A;  3UME A;  4NXE A;  4U0T A;  1S1Z A;  3LGO A;  4S2L A;  2K2N A;  4KQD A;  3F1N B;  3PAG A;  4PM8 A;  3NOU C;  4P85 A;  1ES3 A;  3MZD A;  4BBT A;  3IS2 B;  4D60 A;  4EW7 A;  1YMS A;  5EV0 A;  3GTC A;  2P08 A;  3U4L P;  2O0Y A;  4FCF A;  4FTX A;  4BMW A;  4DN0 A;  2LB9 A;  4LV2 A;  2X01 A;  1PI5 A;  5AJG A;  3N8S A;  3ICY A;  2VA0 A;  1T18 A;  3GDI A;  3MKE A;  4Y3I A;  3KYZ A;  3CAX A;  3NI9 A;  3BY9 A;  1CK3 A;  2B18 A;  3V67 A;  4IBX A;  4KQR A;  4I3A A;  3G4P A;  1ZG4 A;  5CGW A;  2FH5 A;  3HJK A;  3OCN A;  4BBV A;  1NYY A;  3QNB A;  3EEA A;  1GSV A;  1OTB A;  1TS0 A;  3S22 A;  1NZO A;  1PFL A;  4L9E A;  4Y0O A;  1KE3 A;  2D02 A;  4JF5 A;  4R4R A;  3IX4 A;  1D06 A;  3TOI A;  4BD1 A;  5IT5 A;  3NOP C;  4JBF A;  3UPN A;  2X02 A;  3BQA A;  1VEU B;  4CLC A;  2J80 A;  2W1T A;  3G6O A;  1FR1 A;  4XUZ A;  3C8C A;  4S2K A;  4BJP A;  1S1Y A;  4Y0U A;  2ZM0 A;  3DWZ A;  1GSW A;  3V3R A;  2XFT A;  2GDN A;  4NG2 A;  1K25 A;  2VK3 A;  4XT2 A;  1W5D A;  4HJ6 A;  4B93 A;  3G2Y A;  1YSQ A;  1BT5 A;  3E0Y A;  1XJ6 A;  4KG5 A;  1K54 A;  1I5Q A;  1PRQ A;  4AFI A;  4DF6 A;  3HLE A;  5IHV A;  2ZC5 B;  1XPB A;  3O86 A;  3RJU A;  4EU0 A;  3L9K A;  2ZC6 B;  1LI9 A;  2HZ5 A;  1EI5 A;  3MBZ A;  4P6B A;  4FD8 A;  1NLY A;  3DW0 A;  1W79 A;  4FH4 A;  5EFW A;  4H8R A;  3KX0 X;  2M7U A;  3PBR A;  4H6J B;  2XGN A;  1MWT A;  2KX6 A;  2EX8 A;  1ZG6 A;  5IU1 A;  3UDF A;  3QHY A;  5DFX A;  2E8I A;  4K08 A;  3T4L A;  3PXP A;  2MJ6 A;  4MLL A;  5AVE A;  4IED A;  1TEM A;  2Y2H A;  1E4D A;  4BD0 A;  5TJJ A;  2IA2 A;  2P74 A;  1MXO A;  2Y91 A;  3NDG A;  1SDE A;  4ESP A;  5HPF A;  2W27 A;  2IWB A;  1S66 L;  1JWP A;  4Q0J A;  1W7F A;  4IHQ A;  4GS9 B;  4PKY A;  4X55 A;  4DE0 A;  3HUO A;  4FSF A;  1UGU A;  4E3I A;  2A24 A;  3V5M A;  4EBN A;  4XXR A;  5FDS A;  3CI6 A;  3N6I A;  3S7N A;  1P0Z A;  3NUL A;  1K4F A;  1ERQ A;  3NCK A;  4LV0 A;  1S4S A;  2ZC3 B;  3F1O B;  3UDX A;  4ZTK A;  4Y17 A;  4B9O A;  2EFX A;  4BBU A;  3SH9 A;  4K0X A;  1DJB A;  2ZOH A;  3IH8 A;  3IF6 B;  2VEA A;  5EVI D;  1K56 D;  3LR5 A;  4LLO B;  2L0W A;  2PD8 A;  5F68 A;  5HAR A;  3E4O A;  1SKF A;  2V1Z A;  5CGS A;  1DY6 A;  5F1G A;  2VZW A;  5DKL A;  3NJA A;  1XJ3 A;  2JE5 A;  2VLG A;  3QP8 A;  4R38 A;  3D72 A;  3ZG0 A;  1HLU P;  1KGG A;  2XF3 A;  4KUO A;  3MXQ A;  1KGF A;  3H7W A;  3CG5 A;  1GCE A;  1OTE A;  2W3F A;  5A93 A;  1XA7 A;  1YSP A;  5GLD A;  1L0D A;  3T4T A;  2WKH A;  3E98 A;  2G2U A;  1YLW A;  4LCL A;  3WS5 A;  3MQ0 A;  3VFH A;  5L8M A;  3PTE A;  3G34 A;  3FWL A;  2JHE A;  3DTM A;  4X68 A;  4S2N C;  3ZNT A;  3TW8 A;  4OOY A;  4OPQ A;  5GLA A;  1N9N A;  2JKT I;  5L2F A;  3UNW A;  5TGF A;  1JVJ A;  5F6A A;  4RX2 A;  1BUE A;  1FQG A;  4KEN B;  3CZD A;  4N92 A;  1H0M A;  3KSH A;  5EM0 A;  3EGX C;  3PAE A;  3P98 A;  3C30 A;  3TSG A;  4RYE A;  1LSX A;  2XRN A;  4LCM A;  2VX8 A;  5F82 A;  3NIA A;  1U60 A;  1ESU A;  2X71 A;  2R9X A;  4EUV A;  3WS0 A;  2W3G A;  4YWZ A;  5HSQ A;  4PAU A;  3F1N A;  3D9Y A;  2WKP A;  4HNB A;  5A90 A;  2QPN A;  5CER A;  4NXG A;  4JGR A;  4NXF A;  3ISG A;  4CLC B;  2W1T B;  1XJ4 A;  3RH8 B;  4P6Z M;  4WL9 A;  3HLG A;  1KE0 A;  2ZOI A;  1CI8 A;  2Y2L A;  1DP6 A;  1ERM A;  1FCN A;  1N9O A;  1NWZ A;  5FQM A;  1IYS A;  5HAP A;  4ZJ2 A;  5DTS A;  4JPM A;  4XT2 B;  4R3J A;  1I2W A;  3BW6 A;  5L07 A;  5KSH A;  3VP3 A;  1FSY A;  4Y7P A;  2JKG A;  1LL8 A;  4KG6 A;  1WYC A;  3S4X A;  2V8C A;  3OLO A;  4KZ8 A;  5FA7 A;  2G7U A;  2EA9 A;  3MXS A;  3ZNY A;  4QY6 A;  3SW1 A;  4GCZ A;  2WZZ A;  1BZA A;  1AWI A;  1BUL A;  5D3O A;  3VOL A;  4E3J A;  1IKG A;  5CEB A;  3BWL A;  5HDC A;  3ZHH A;  1S4R A;  5CEC A;  3T4K A;  4NET A;  3RFB A;  1VEU A;  3NHQ A;  1W63 M;  4LRX C;  2XH9 A;  2O9C A;  3VMA A;  2PU4 A;  4EWF A;  3LY3 A;  3UE1 A;  3O88 A;  1G28 A;  3QP5 A;  2WAF A;  4RA7 A;  2BAS A;  3UB6 A;  5G4Y A;  3HLF A;  4JXG A;  4MEZ A;  3WRT A;  1W8Q A;  2J8Y A;  3M2K A;  3SS5 A;  3EOI A;  1I2S A;  3VFF A;  3LI8 A;  2V2F F;  5HL6 A;  2ZQC A;  4NKP A;  5F1F A;  3ZG7 B;  2Y2Q A;  4OQI A;  1Q2Q A;  2EX2 A;  1YLZ A;  1GSX A;  3HLD A;  2EXB A;  3M6H A;  2Z6D A;  4KZA A;  5HD3 A;  2XD5 A;  2WZX A;  4MCW A;  5DJU A;  3R4K A;  3U2A A;  4R3B A;  3QP1 A;  2PHY A;  3UPO A;  4GW9 A;  1DP9 A;  4Y15 A;  3UB9 A;  3KYE A;  1IYQ A;  2J3T D;  4X25 A;  5CGX A;  1ACF A;  3A3F A;  5EVL A;  3V50 A;  1UWN X;  5L10 A;  4GD6 A;  2ZJ9 A;  4IUH A;  4JGO A;  1YLJ A;  1N4O A;  4PM5 A;  5HL1 A;  2H10 A;  5KZH A;  3HUM A;  3Q7Z A;  2EX6 A;  4PM9 A;  2QMI A;  4OKP A;  1QME A;  3CHW P;  1E3U D;  4I5S A;  4JF4 A;  4DXC A;  4OVD A;  3VOY A;  1M6K A;  4DE3 A;  4DKI A;  3MS6 A;  4UAA A;  3O5Y A;  3MFD A;  5HAQ A;  2V8F A;  2B02 A;  3VP0 A;  4OPY A;  2HPB A;  2XQZ A;  2ZLY A;  3OZH A;  4P6Z S;  5CHU A;  3BFF A;  2CMN A;  5M1A A;  4HP9 A;  4MDZ A;  1F5M A;  1V9Z A;  4G3V A;  2QKP A;  3NDE A;  2HP9 A;  2HJ9 C;  1YM1 A;  1TDG A;  3D4F A;  3H7W B;  3H82 A;  1K55 C;  5FEF A;  5HWW A;  4JXS A;  3IXG A;  3HRE A;  1AXB A;  5CTN A;  4R6L A;  1GHP A;  4OON A;  4N9L A;  2WAD A;  3GSG A; 
#chains in the Genus database with same CATH homology
 3EEH A;  1TS7 A;  1EW0 A;  3UB8 A;  4AFI A;  4MN6 A;  2EWW A;  1Y28 A;  2J3W A;  3HJI A;  3KSF A;  4YNR A;  4F3L B;  4Q0I A;  3OC2 A;  2I9V A;  1BYW A;  3PR6 A;  3OBF A;  1STZ A;  3KSG A;  4ZRR A;  4EU0 A;  2JKT M;  2PT7 A;  4R3A A;  3K3D A;  1ODV A;  3EQV A;  1P9R A;  3PBO A;  5HZH A;  2JKR I;  3S7O A;  2K31 A;  1NLY A;  5HD5 A;  3B42 A;  5HDD A;  2KDK A;  3LIA A;  5EFW A;  3KX0 X;  2GNX A;  2M7U A;  4FOF A;  3PBR A;  1YKD A;  4UQI M;  5TBM B;  3UB7 A;  4H6J B;  4CLC E;  3R7W B;  3EGD C;  4PKY G;  4WN5 A;  3A0V A;  1IOU A;  3HCY A;  2KX6 A;  5HDS A;  5DFY A;  4HIA A;  1G6O A;  1H8M A;  4GLQ A;  5IU1 A;  1W63 Q;  2V1A A;  3T4J A;  5J7E A;  5DFX A;  3PBS A;  4HH2 A;  3C2W A;  3K3C A;  4K08 A;  4R70 A;  1F98 A;  3T4L A;  3E4Q A;  4MMN A;  4RQ9 A;  2H28 A;  3PXP A;  1DRM A;  2MJ6 A;  2V1B A;  1VHM A;  5AVE A;  4ETX A;  3LR3 A;  5TJJ A;  1S67 L;  1OPX A;  2IA2 A;  4ARZ B;  3B33 A;  5HPF A;  2W27 A;  4UQI S;  2GZA A;  1S66 L;  4YOF A;  4Q0J A;  2NUP C;  3VV4 A;  3RTY A;  3LI9 A;  3MMH A;  4IHQ A;  2J3T C;  4GS9 B;  4IJG A;  4PKY A;  4E04 A;  4FSF A;  3CUE C;  5J3W A;  1UGU A;  2A24 A;  5AVF A;  4JGP A;  2EWV A;  3CI6 A;  3S7N A;  4DJ3 A;  1P0Z A;  2XSS A;  4I3I A;  3PBT A;  3IS2 A;  1S4S A;  4LRZ E;  2K7S A;  3F1O B;  3FC7 A;  4DJ2 A;  2QYB A;  5LBR A;  2YKF A;  4B9O A;  3JVU A;  3CWF A;  2PDR A;  2O99 A;  2VGL M;  2V0W A;  4KUK A;  4BBU A;  4NXB A;  3DBA A;  1T19 A;  1N9L A;  2ZOH A;  1LT0 A;  2O9A A;  1XJ2 A;  1F9I A;  3MQO A;  3ULF A;  2VEA A;  3LR5 A;  4HQA A;  4LLO B;  4PHT A;  2L0W A;  2PD8 A;  1MC0 A;  1TS6 A;  5F68 A;  1JNU A;  3E4O A;  4HP4 A;  5K5B A;  2V0U A;  3LID A;  3T4S A;  4LRY C;  2VKS A;  2VZW A;  4Y2F A;  5DKL A;  4WLA A;  3NJA A;  1XJ3 A;  2VLG A;  2ZBB A;  1TD5 A;  2VGL S;  5C5K A;  4R38 A;  3D72 A;  4HOI A;  2W3H A;  4I38 A;  4MN5 A;  3TE8 A;  4KUO A;  3GEC A;  5DF9 A;  4IUK A;  4HHD A;  3JVV A;  3TJZ C;  3S7Q A;  2OAQ 1;  3MXQ A;  3LR4 A;  4CLC C;  3H7W A;  4G3K A;  4ME4 A;  1OTE A;  2DMW A;  1OTD A;  2W3F A;  3B47 A;  1P9W A;  2VV6 A;  1YSP A;  2QJ7 A;  3T4T A;  4EES A;  5KIZ A;  2W3E A;  3E98 A;  2HF6 A;  3UE6 A;  2XA7 S;  4WF0 A;  3MQ0 A;  5L8M A;  5F69 A;  3T4Q A;  5I5L A;  2L4R A;  1OJG A;  2JHE A;  1MZU A;  2LB5 A;  3NOT C;  3TW8 A;  1VB6 A;  4EER A;  3OOV A;  1N9N A;  2JKT I;  2QWS A;  1YAX A;  4QPR A;  4F3L A;  3LIB A;  2Y79 A;  5F6A A;  3P01 A;  3K2N A;  1TS8 A;  3KSH A;  5DKK A;  3EGX C;  2M1C A;  3A0S A;  3FG8 A;  1DP8 A;  3W2Z A;  2A24 B;  3C30 A;  4EET B;  4I39 A;  4O01 A;  2JN7 A;  3VE4 A;  4UEY A;  1T1B A;  2D01 A;  1LSX A;  2XRN A;  3LR0 A;  5F5Y A;  2VX8 A;  3CLO A;  4JGQ A;  3S7P A;  1V9Y A;  2Y8H A;  4Y5F A;  2GX5 A;  4EUV A;  2W3G A;  4YWZ A;  4WEJ A;  4EEP A;  5HSQ A;  4PAU A;  3KYQ A;  2P7J A;  3F1N A;  4WEL A;  2WKP A;  4HNB A;  5TBM A;  4H6J A;  2A2L A;  4GJ4 A;  4NXG A;  4JGR A;  4NXF A;  4CLC B;  2W1T B;  4O0P A;  3BQ8 A;  1XJ4 A;  1ZTU A;  3LYX A;  3RH8 B;  4P6Z M;  3H82 B;  2WKR A;  4WL9 A;  2ZOI A;  4HH3 A;  1DP6 A;  2R78 A;  4L0L A;  3F1P B;  4G3W A;  1N9O A;  1NWZ A;  2ZMF A;  2ZMV A;  4BWI A;  4XT2 B;  2YKH A;  3LFV A;  4CQH A;  2OOL A;  4I3J A;  3BW6 A;  4GHI A;  5KSH A;  1ZHH B;  2GJ3 A;  4WEK A;  1LL8 A;  4M4X A;  1X0O A;  3E4P A;  3OLO A;  3PBN A;  4GS9 A;  5MC7 A;  2G7U A;  2EA9 A;  2L1M A;  3SW1 A;  2NUT C;  2QHK A;  4GCZ A;  2WKQ A;  1UWP X;  2VV7 A;  5FL3 A;  3MR0 A;  3P7N A;  1H3Q A;  3ZQ5 A;  3LUQ A;  3VOL A;  1WA9 A;  3F1O A;  3BWL A;  4L9G A;  1OTA A;  5IS1 A;  1LSW A;  5HDC A;  1S4R A;  4NEE D;  3T4K A;  3RFB A;  2JKR M;  3IBJ A;  3NHQ A;  3PBQ A;  1W63 M;  4LRX C;  4CLC D;  3H9W A;  5G4Z A;  2W0N A;  4DMZ A;  1OT9 A;  3EQU A;  3LIF A;  2O9C A;  2O9B A;  2PR5 A;  3KO6 A;  3T50 A;  1G28 A;  2VV8 A;  5CX7 A;  2PR6 A;  3UB6 A;  2BAS A;  5G4Y A;  2OWH A;  3A0R A;  1P97 A;  4II7 A;  3EOI A;  1IFQ A;  4ETZ A;  3LI8 A;  1LSV A;  5HL6 A;  2XRO A;  4NKP A;  3T4O A;  3PHY A;  3UME A;  3EWK A;  3D3O A;  1OTI A;  2M7V A;  3LIE A;  4KQO A;  4NXE A;  2FZ0 A;  2W1R A;  1GSX A;  4Q0H A;  4OOM A;  1S1Z A;  5HWV A;  1XFQ A;  5DJT A;  3CUE A;  4L9F A;  4EQ1 A;  2K2N A;  2Z6D A;  4KQD A;  5HD3 A;  3F1N B;  5J4E A;  4MCW A;  5DJU A;  3R4K A;  2VJW A;  3U2A A;  2PHY A;  3TRC A;  2OWJ A;  3BY8 A;  3NOU C;  4GW9 A;  4HJ3 A;  1DP9 A;  1T1C A;  4BBT A;  2INW A;  3IS2 B;  4EW7 A;  3UB9 A;  3FPV A;  3UE3 A;  2P08 A;  2PD7 A;  2O0Y A;  2J3T D;  2QJ5 A;  4BMW A;  4DN0 A;  2OAP 1;  2LB9 A;  4O8G A;  1UWN X;  5HPI A;  3R7W A;  4Z1W A;  4IUH A;  4GHI B;  5AJG A;  2HV1 A;  4OOL A;  3LIC A;  4JGO A;  5A8B A;  3KSI A;  3ICY A;  2VA0 A;  1T18 A;  3GDI A;  4Y3I A;  2HJE A;  4HJ4 A;  3KYZ A;  1D7E A;  3CAX A;  4LPZ A;  3BY9 A;  2Z6C A;  2B18 A;  3MFX A;  1XFN A;  3V67 A;  4I5S A;  3UMD A;  3BJN A;  4I3A A;  3FPW A;  2PYR A;  4EEU A;  1T1A A;  2FH5 A;  3HJK A;  4ARZ A;  3O5Y A;  3OCN A;  2V9A A;  4BBV A;  2B02 A;  2PYP A;  2KLI A;  1GSV A;  1OTB A;  1TS0 A;  3EEA A;  4MN7 A;  3MQQ A;  2P04 A;  4L9E A;  3MF0 A;  2D02 A;  2HGV A;  1D06 A;  4P6Z S;  4WUJ A;  5IT5 A;  2CMN A;  1OJ5 A;  3NOP C;  3MJQ A;  4HP9 A;  4MDZ A;  1F5M A;  3ZYT A;  1V9Z A;  4G3V A;  3IBR A;  3BQA A;  2QKP A;  4CLC A;  2J80 A;  4EXO A;  2W1T A;  1KOU A;  3G6O A;  5HWT A;  2HJ9 C;  1OT6 A;  3CIT A;  3H7W B;  3H82 A;  3C8C A;  1NLZ A;  3C38 A;  4BJP A;  1S1Y A;  5HWW A;  1GSW A;  1TF1 A;  3F1P A;  3PYP A;  2KOI A;  1MKM A;  4R6L A;  3OCL A;  4XT2 A;  4HJ6 A;  4B93 A;  4HI4 A;  1YSQ A;  4HY8 A;  3VE3 A;  3E0Y A;  1XJ6 A;  1NRJ A;  2W3D A;  2XA7 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...