1DP8A

Crystal structure of the nitric oxide bound fixl heme domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
PDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New mechanistic insights from structural studies of the oxygen-sensing domain of Bradyrhizobium japonicum FixL.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Oxygen storage/transport
molecule keywords FIXL PROTEIN
total genus 29
structure length 118
sequence length 118
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1999-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1dp8A00
2KDKA 3K3DA 2EA9A 3ICYA 1BYWA 1OTDA 2M1CA 1N9OA 2I9VA 3GECA 3ZQ5A 2WKPA 3T50A 2PD8A 4HH3A 3A0RA 3NHQA 1T1AA 4I5SA 1OT9A 4H6JA 1EW0A 3MFXA 5TBMA 3UMEA 1OTIA 3C8CA 3CWFA 4GHIB 1OJGA 5AVEA 3MQOA 2A24B 1XJ2A 4KUKA 2V0WA 4PKYA 3BY8A 3VE3A 4NXEA 3NOUC 3IS2B 3BY9A 1S66L 1F9IA 2YKFA 5AVFA 4WN5A 5F68A 3UMDA 2HV1A 5HSQA 4GS9A 1LSXA 1V9ZA 3LI9A 3HJKA 2PDRA 3NOPC 2V9AA 5G4YA 5HZHA 1TS8A 5DJUA 5IS1A 3IBRA 2V1BA 5G4ZA 1N9NA 3P7NA 2QHKA 4LLOB 5HD5A 2VLGA 3LIAA 2PD7A 4LRZE 4EEPA 4B9OA 4HJ4A 3UB6A 1DP6A 2V0UA 4HI4A 1GSWA 3A0VA 4JGQA 3H7WB 3IS2A 1UWPX 2QJ7A 1D7EA 3ULFA 1XFQA 1Y28A 3EEHA 4GCZA 2QKPA 4KUOA 4I3JA 4PKYG 2A24A 4HJ6A 4LRYC 5KIZA 3F1OB 4GHIA 3LIEA 4EEUA 5TBMB 4EERA 4H6JB 3F1NA 2Z6CA 1OTBA 1S1ZA 2WKRA 3E4QA 2BASA 3EWKA 1G28A 2QWSA 3FC7A 2VEAA 3H9WA 4HP9A 1VB6A 2ZBBA 3B33A 1DRMA 3PHYA 4WLAA 5DKLA 3VE4A 4EQ1A 1GSVA 1TS7A 3LIDA 4L9GA 1XJ6A 2OOLA 4HHDA 2INWA 3UB9A 3LYXA 3UB7A 1UWNX 2WKQA 3FG8A 3E4OA 2VV8A 3F1PB 1NWZA 2ZOIA 4JGRA 4BBVA 4I38A 4NXFA 4L9FA 1OTAA 5HDDA 1WA9A 2K7SA 1KOUA 5HWTA 4EESA 1F98A 1OTEA 1OT6A 3F1PA 1TS0A 2KX6A 3H82B 4L9EA 3LUQA 4BBUA 4BBTA 4K08A 3RH8B 2YKHA 2D01A 4YWZA 4F3LB 5IU1A 4JGPA 2VV7A 2PYRA 3UE6A 2OWJA 4MN5A 1LSWA 3A0SA 4JGOA 5HDCA 4GS9B 5EFWA 4R38A 4E04A 2GJ3A 3F1NB 2OWHA 1DP8A 2QJ5A 4I3AA 3D72A 4HIAA 4I3IA 4EXOA 1TS6A 3F1OA 2JHEA 3LIFA 3K3CA 3PYPA 3E4PA 2Z6DA 5J7EA 4NXGA 3CAXA 4DJ3A 3LICA 4HJ3A 2L4RA 4R70A 3H7WA 4HQAA 2D02A 1LL8A 5F6AA 3OLOA 5J3WA 3RTYA 1MZUA 3LIBA 4WL9A 4HH2A 3MR0A 4HP4A 1XJ3A 4WF0A 2H28A 4HY8A 1UGUA 1T19A 3BWLA 2CMNA 2V1AA 1LSVA 1P0ZA 2W27A 3LI8A 5DJTA 5F69A 1X0OA 3CLOA 1GSXA 5A8BA 2PHYA 2W0NA 1V9YA 2L1MA 4NXBA 4DJ2A 1T1CA 2L0WA 3MQQA 2PYPA 5J4EA 4WUJA 2J80A 5HWVA 1S67L 1N9LA 5HWWA 1S4SA 1LT0A 4R6LA 4F3LA 1OJ5A 4LPZA 4M4XA 5F5YA 2PR6A 3MXQA 4HNBA 4I39A 3GDIA 4LRXC 2R78A 4MN6A 3VOLA 3C2WA 4EW7A 2JN7A 2ZOHA 1T1BA 3G6OA 3H82A 4R3AA 5I5LA 2B02A 2VV6A 1ODVA 4EETB 1XFNA 3KX0X 3SW1A 2P7JA 1S1YA 5DKKA 4HOIA 3NOTC 1DP9A 3MJQA 1S4RA 2PR5A 1D06A 4GW9A 4KQDA 4XT2B 1XJ4A 4RQ9A 1P97A 1T18A 4XT2A 5HDSA 5HD3A 3UB8A 1JNUA 3NJAA 3HJIA
chains in the Genus database with same CATH superfamily
4U3TA 2I9VA 3GRJA 5HPIA 4HH3A 2KLIA 1T1AA 4FH2A 3UMEA 3IWOA 5TBMA 3S7NA 4ZDXA 4NXEA 1W8QA 2EX9A 5L10A 1V9ZA 3ZGAB 3HJKA 5IS1A 1YLPA 2V1BA 1N9NA 5EM0A 4U0XA 4EEPA 2EXAA 3IBJA 1K56A 1TEMA 2QKPA 4PKYG 3PBRA 1IFQA 4EEUA 4X1MA 4WMCA 2ZBBA 2ZJ9A 5AQ7A 4FOFA 2OOLA 3TE8A 4QHCA 4ESPA 4JPMA 3CHWP 1KGEA 4ME4A 3IH9A 1F98A 5F1GA 1SKFA 3KSIA 3Q07A 5EVLA 3NECA 2W3GA 4CLCB 3KSFA 5EFWA 1SKOA 4KQOA 2O9BA 4HIAA 4X68A 5MC7A 3PBTA 1FILA 3HCYA 1H8ZA 1L0GA 4FTXA 3RTYA 2RL3A 4S2NC 3P01A 3BLSA 5M1AA 3MS6A 1KVMA 4C75A 4MLLA 2J3TD 3WS2A 3MXSA 4CLCA 4KZAA 1N9LA 1E3UA 4MBKA 2HDQA 4S2IA 3MKEA 3UY6A 2W1RA 3UDFA 2HJEA 5KZHA 4R4RA 2PAVP 5CTNA 1PNEA 4L0LA 3WS1A 3BY8A 4ZRRA 3UMDA 1H5XA 2BG1A 1XGIA 3BLMA 2EWVA 3QP6A 1OPXA 3IBRA 4OOMA 4LLOB 4EU0A 1ESUA 1A0KA 1YLTA 2I72A 4DDSA 5HAQA 1ES3A 2VK3A 5A90A 2CC1A 2VEAA 4HP9A 5DKLA 2Y2GA 3DW0A 2JC7A 1BLHA 3TRCA 3BQ8A 1HZOA 3OPPA 1OTEA 3F1PA 5AQBA 4ZJ1A 4QPRA 1ZTUA 5KMWA 3FV7A 2OWHA 1FOFA 3PBSA 4IBXA 2XQZA 3PYPA 2GDNA 4JKTA 5EOOA 2D02A 5F6AA 1IOUA 4HY8A 2XD5A 1YQSA 2VGJA 3FPWA 3T4KA 5A8BA 3HUMA 2J80A 2JKTI 2B5RA 5CHJA 3C2WA 2IWBA 2VV6A 2B18A 1QMFA 3JVUA 3PAGA 3GR2A 4Y2FA 3UB8A 3CUEC 1KDWA 3N8LA 1HTZA 2WK0A 4E3LA 1OT9A 1YSPA 1OTIA 2LB9A 3O86A 1OJGA 5JYOA 2A24B 5FDHA 3QNCA 3T1QB 2JCHA 2J3WA 5A93A 1GA0A 1LL9A 4PMAA 2ZLYA 3EEHA 2FZ0A 4B88A 4MBHA 1ZKJA 4EUZA 4H6JB 1BT5A 1OTBA 1TS7A 4L9GA 3Q81A 1SZVA 2K31A 4R4SA 3G4PA 2PBYA 2V1ZA 4HESA 2BLSA 3C5AA 3HUNA 2DMWA 3IX4A 4DN0A 4K08A 1JVJA 2VV7A 4K91A 4LV0A 1L0EA 3F1NB 4MEZA 3D72A 1EWZA 1BZAA 4DJ3A 3LICA 3CI6A 3H7WA 3BFDA 4BQMA 1JTDA 2V20A 3BWLA 3JYIA 4DJ2A 1T1CA 1VETB 1LT0A 2VGKA 5LBRA 4KZ6A 4Y0OA 2PRFA 4PM6A 3S1YA 3S4XA 5BOHA 1XP4A 4CLCC 1YLWA 5A92A 1OTDA 4KZ8A 3M2KA 2QZ6A 3L7HA 1NLZA 4WMCD 5AVEA 3QNBA 4ZAMA 2HDRA 3MQOA 3NBLA 4KUKA 2QMIA 3S7PA 5J8XA 1Q2PA 3O5YA 5CEBA 3LR3A 4B93A 1KDSA 5G4ZA 4B9OA 1PZPA 4ZJ2A 4JXSA 1KVLA 3ULFA 2ZD8A 4I3JA 3DAVA 4OQHA 3NI9A 3OBFA 5FAQA 4EERA 2H10A 1LL5A 4GN2A 5CXWA 3HLBA 1GSVA 2X01A 1HD8A 5E2FA 3UB7A 2E8JA 3W4OA 2W3DA 2PU2A 2ZQ8A 3LUQA 3IT9A 3VP0A 4LCLA 3UE6A 3D9YA 4EBLA 2OLUA 3MQ0A 3F1OA 1KE4A 4PAUA 4FSFA 2Q9MA 3CPTB 4O7DA 2L4RA 1PWGA 3SZTA 3MFDA 2XSSA 2HDUA 1FR6A 4IUHA 4QB8A 4KG5A 5M19A 2DNSA 4GJ4A 2XGNA 1GSXA 4PM5A 4OPQA 1HVBA 1M6KA 4HNBA 4LRXC 2JN7A 1S1YA 2Q0OA 4LFUA 3VP4A 3PBQA 3MJQA 2PR5A 4QJGA 3UDIA 3C7UA 1JNUA 1NRFA 2Y59A 5EPHA 3QP4A 5HAPA 5CTMA 5HFOA 4H6JA 3CWFA 2P04A 1AWIA 3NOUC 3OPRA 4IBRA 3WRTA 1MY8A 2XK1A 3BY9A 4MNRA 1ES2A 5HSQA 2J3TC 4DKIA 5U47A 1W7FA 5G4YA 2JKRM 2R9WA 3NULA 2KOIA 3FYZA 4BL3A 2QHKA 4LV3A 3KYZA 1J3WA 3C38A 5L09A 5EVIC 1DY6A 1GHIA 2XH9A 4P0MA 3LIEA 3VP2A 4S2NA 4UAAA 5GL9A 1YAXA 4BLMA 2EFXA 3AGFA 2E8IA 1WA9A 3GVBA 2BTFP 2WGIA 1TS0A 1H3QA 5IU1A 5E43A 1LSWA 2ZC7A 4Y0UA 5HDCA 5K5BA 1ESIA 2O0YA 2WADA 2EWWA 4IHQA 1P9RA 1NY0A 1BTLA 2XDMA 4HQAA 2K2NA 3FKWA 2FH5A 1KGFA 2HGVA 4GOGA 3VFFA 3NC8A 3ZNTA 1LSVA 3LY4A 4NXBA 2L0WA 5HW3A 4GD6A 3MZDA 4X6TA 3H82A 1YKDA 4FH4A 4ZJ3A 2W3FA 1DP9A 1S4RA 3ZG9B 2ZMFA 5GLBA 1VM1A 1P97A 4XUZA 4WYYA 3SS3A 3MZEA 3ZVWA 4DE2A 3NJAA 4JLFA 5FQMA 2KDKA 3K3DA 2P9VA 5FI2A 1G5UA 3ZQ5A 1RGZA 1PI5A 4I5SA 3M2JA 4MDZA 1PIOA 1KGGA 4BD1A 5FATA 1O07A 4GLQA 3NIAA 5F68A 3B42A 1GHPA 1MXOA 1PZOA 2V9AA 1TS8A 3IF6B 2VLGA 4ZBEA 4CLCE 2GNXA 4X25A 4NETA 4HI4A 5EVID 2J7VA 5HL1A 1Y28A 1K54C 1WYBA 4OPZA 3PXPA 3DTEA 2BASA 2W1TB 4U0TA 5EVEA 4WELA 3IXDA 1XA1A 2XRNA 1DJBA 1YLJA 2ZC5B 2KX6A 4BBTA 1XGJA 3CJMA 3SS5A 4MN7A 1MWSA 4DDYA 4GKUA 3LIFA 3K3CA 2PT7A 4D60A 4HJ3A 4LGWA 4GB7A 3IWIA 2WKEA 1H0MA 2H28A 4RVAA 4MMNA 2WGWA 4Z1WA 3TW8A 1I2WA 1G6OA 5HPFA 3TJZC 2PYPA 4OPRA 4G3WA 5HWVA 4I39A 3VOLA 1G68A 3R7WA 1XA7A 2Q9NA 3U4LP 3IH8A 4X69A 3ICYA 4CPKA 5FI6A 3UE0A 3CITA 2VGLS 1GHMA 3S22A 2XA7M 1S66L 5DFYA 1WYCA 4WM9A 2OSUA 3IHBA 4ZTKA 4RX2A 2J9OA 2ZQCA 4C6YA 3UB5P 5HARA 4RX3A 4HJ6A 2EX8A 3T4TA 3F1NA 1SKOB 1ZHHB 1YLZA 1IKIA 1CEFA 4WLAA 4KG6A 4OP5A 2HP9A 2ZM2A 1SHVA 4QWOA 1ES4A 2ZOIA 2VKSA 4P6ZS 4OLGA 5CGSA 3H82B 4CLCD 4F3LB 1PW8A 4JGOA 2GJ3A 3LCEA 4G3KA 1DP8A 3Q7VB 4BENA 2WGWB 4PM9A 1MC0A 2V2FF 4OLDA 5EM1A 3PBNA 2Y55A 2EX6A 4WF0A 5F82A 3Q1FA 4EV4A 3N4IA 4XXRA 1P0ZA 3LI8A 5F69A 1X0OA 1I5QA 2G2UA 1H8YA 4R0QA 1S4SA 3HUOA 4R6LA 4N9KA 2ZOHA 1TDGA 1K57C 2O9AA 3BW6A 3LEQA 3VFHA 4XT2B 1E4DA 3M6HA 2EA9A 4D2OA 3UE1A 3MF0A 4O8GA 4M3KA 5FL3A 3VOYA 3OOVA 4E3JA 3AGDA 5L2FA 3NOPC 1ES5A 1JWZA 2WKIA 3MKFA 4IVIA 2XF3A 1DP6A 3A0VA 1FCMA 1YMXA 1UWPX 4JXWA 4GCZA 2VZWA 5KIZA 3NCKA 1S1ZA 3P98A 5J7EA 2IA2A 5EVIB 4P85A 1ONHA 3FG8A 3F1PB 3E2LA 4I38A 3QP5A 2ZC6B 1W63Q 2X71A 3GQZA 4A5RA 3E98A 1K56D 2PYRA 3A3DA 1VEUA 4GNUA 4R38A 1LLBA 4E3IA 4CQHA 3QP1A 4Y0TA 1F5MA 2V8CA 4R70A 3EGXC 1DJCA 1LL8A 3FWLA 1L2SA 3OLOA 1PW1A 2FFYA 3IX3A 4E3OA 2ZQDA 4NK3A 2NUPC 2PU4A 5DJTA 1TD5A 1J9MA 2A2LA 3RXWA 3ITAA 1FSYA 3RFBA 5I5LA 3SW1A 4C3QA 4EETB 4EBPA 5CERA 2A49A 3IXHA 5FDSA 1DJAA 2ZL1A 4OQ0A 1NJ4A 2UV0E 2RCXA 2VX8A 2ZQ9A 3HJIA 1PI4A 3A3JA 4WEKA 2ZC4B 4QY6A 3U2AA 1XJ2A 4EWFA 3VMAA 3CUEA 3WRZA 1STZA 2H5SA 1L3LA 2JKRI 3CMZA 3MSHA 3EQVA 4JXGA 4UQIM 3W8KA 3I7JA 4KZ5A 1GSWA 4JGQA 3IS2A 1G6AA 3W4PA 3V67A 4LRYC 3RXXA 1G28A 2QWSA 2Y4AA 4Y13A 4DMZA 1U60A 2VV8A 5EE8A 5TFQA 5HWTA 3R7WB 2JKGA 2VJWA 1PFLA 2QYBA 2OWJA 3K2NA 4K0XA 3BFEA 3SOIA 4E04A 3UE3A 2WUQA 3TOIA 5FSRA 1FQGA 3KSHA 3LIBA 3PR6A 5A91A 2HJ9C 2ZQAA 3CPTA 3VP1A 3W4QA 2W3EA 1GA9A 2GZAA 1V9YA 5DF9A 3JVVA 3V3RA 4LPZA 3T4SA 4MN6A 2Y91A 5AJGA 5DTSA 4E6XA 3A3IA 1T18A 2XD1A 2ZL1B 1IELA 1N9BA 1BYWA 3NHQA 5DTTA 2WZXA 4YINA 1CI9A 3BRMA 5DF8A 1ERQA 4P6ZM 1P9WA 1Z6FA 5FA7A 5HD5A 4CJNA 1E25A 3DTKA 1AXBA 1PRQA 1C3BA 3H7WB 3C4OA 1W5DA 2UWXA 2Y2MA 1FR1A 1VHMA 3RJUA 1LI9A 3BFFA 2HP5A 2WKRA 1K6SA 4PKYA 5FAPA 5AQAA 5AVFA 2C6WB 4OQGA 1VB6A 3PHYA 4N9LA 3VE4A 2HP6A 3UB9A 1F2KA 1ZG6A 1XJ6A 4HHDA 3SH7A 4R3BA 1UWNX 3C4PA 3E4OA 4E3NA 4L9FA 2XFTA 3G30A 4K0WA 2XA7S 1W8YA 5TJJA 2HDSA 1HLUP 2JKTM 3ZG5A 2Y2IA 4E3KA 4I3AA 2QJ5A 1YLYA 4II7A 2HPBA 4NXGA 3B3XA 5CECA 1K0KA 5TR7A 1MZUA 4XUXA 5CX7A 3MR0A 2H0YA 3NY4A 4X55A 4GZBA 4N1HA 3R4KA 2G2WA 2WZZA 1VEUB 3EQUA 2R9XA 1FIKA 4M4XA 5TGFA 2R78A 1K6RA 3G34A 3G2YA 4IEDA 4R3AA 4QU3A 3BM6A 2M7UA 2XR0A 3QHYA 3WS0A 1NLYA 4HOIA 4KZBA 3BQAA 5EV0A 2O9CA 1S0WA 2WKPA 2GX5A 3N8SA 5GHYA 1EW0A 1MPLA 2V0WA 1YPRA 4NEED 2WAEA 1YMSA 2A3UA 4JBFA 1LSXA 3SH8A 4OOYA 4P87A 4DE1A 4Y7PA 1TDLA 5D3OA 2PD7A 3UB6A 2Y2JA 4FD8A 4YFMA 1IKGA 3G32A 3HREA 4KZ7A 3LR0A 3BFCA 1M40A 2FFFB 4IVKA 4IUKA 4JGRA 5FQJA 2ZM8A 4NXFA 5FQKA 3UN7A 1CJFA 1XPBA 1O7EA 2AVXA 4YNRA 3T4OA 4B4ZA 4EBNA 3T4QA 4ETXA 3UPPA 3BJNA 4X1LA 5FASA 4AFIA 2Z2LB 2DCFA 1FCOA 1BLSA 4F94A 1XJ3A 3EOIA 4S2LA 3LY3A 5IT5A 3P09A 2DRWA 3Q7VA 4R3JA 3T1RA 3IXBA 1L0FA 5J4EA 2JKFA 4DRTA 1CEGA 1CQAA 1XFNA 4PM7A 2OV5A 5M18A 4BWIA 1K55A 1Q2QA 4BD0A 4RQ9A 2M7VA 2W0NA 3V39A 4WZ5C 3HLDA 4GDNA 3PBOA 4N1XA 5HAIA 3IX8A 1Y4OA 3WWXA 3C30A 1SCWA 4LV1A 2HV1A 1H8MA 1YT4A 2G7UA 2XLNA 5DF7A 2J8YA 5HZHA 5EECA 5DJUA 1LI0A 3ZDJA 4OOLA 4HEFA 4UA7A 2J9PA 3DBAA 3EGDC 2EX2A 4KZ4A 1K25A 3GMWA 3C7VA 1MKIA 3G2ZA 5TBMB 5E2GA 2WAFA 1K4EA 3UNWA 1BSGA 3D3OA 5C5KA 2Y2HA 1W63M 4S2MA 2ACGA 2Y2QA 3NDGA 5HDDA 5FEFA 1I2SA 1KOUA 3ZNYA 4Z9QA 5HL6A 3GSGA 4E6WA 4YWZA 4JGPA 4GDBA 2HZ5A 1W79A 3A0SA 4LCMA 4EXOA 4P6BA 5J3WA 3DWZA 5GHZA 2X02A 3IF6A 1T19A 4R1GA 3T4JA 2W27A 3CLOA 3KYEA 2L1MA 3DTMA 4H8RA 4OVDA 4WUJA 5HWWA 4OONA 5F5YA 3ZG8B 2PR6A 3CG5A 3MXQA 1IYOA 4KQRA 5EUAA 3G6OA 2B02A 5CRFA 5GLAA 1NZUA 4HBTA 1YSQA 1D06A 5CHMA 4KQDA 1XJ4A 2P08A 5DFXA 1NZOA 5CEDA 2PD8A 2V8FA 3A0RA 3VSLA 3N7WA 2QPNA 3S7QA 1JTGA 2Y2OA 2YKFA 4WN5A 3V50A 3V5MA 1ACFA 1D1JA 3P7NA 4LENA 3HLWA 2Y79A 3FKVA 5AQ9A 4LRZE 3T1XA 1FCNA 3SH9A 1D7EA 1XFQA 3S7OA 3GTCA 2A24A 4BL2A 2Y2PA 4GS9A 1EROA 1NYYA 4S2JA 3L9KA 1ALQA 3KSGA 4KENB 4MBFA 4Y17A 4ID4A 1OTAA 5EOEA 2MJ6A 4G3VA 3O88A 4S2PA 1OT6A 4PHTA 4WZ5A 3RH8B 2YKHA 4X53A 3W2ZA 5EVIA 5DTKA 4UA6A 4I3IA 1LHYA 3E4PA 3T1SA 4UEYA 2Y8HA 4OH0A 3PTEA 5FAOA 4HP4A 4NG2A 1UGUA 1MWRA 2CMNA 1KE3A 3QP2A 1N4OA 3UO9A 3VSKA 4E3MA 4NKPA 4OPYA 1PWCA 3MXRA 3HLFA 2PHYA 4DXCA 5FQIA 2IWCA 1IEMA 1S67L 3ZG0A 2OAP1 3DTIA 4F3LA 3MMHA 1ODVA 4RYEA 3ZHHA 1YM1A 3VV4A 3IF6C 5HDSA 4WZ4A 4BMWA 4KQQA 1CI8A 3CZDA 4X56A 3GV9A 5IHVA 4FUWA 1K38A 2JE5A 1K55C 1F9IA 3B47A 4Y15A 3UDXA 3FZCA 4PM8A 1GCEA 5GLCA 1CF0A 1K4FA 4Y3IA 3G35A 3E0YA 3F1OB 4GHIA 3OC2A 2Z6CA 3E4QA 3EWKA 3FC7A 4S2OA 2P74A 1QMEA 1DRMA 1EI5A 3G31A 5JYPA 4IJGA 1SDEA 4PPRA 5L07A 3HVFA 4GD8A 4O01A 5GHXA 2W3HA 2D01A 1VQQA 2ZQ7A 1IYPA 3O87A 2WKHA 4GS9B 5DVAA 1MWTA 3HL9A 1CK3A 1PWDA 4OKPA 4FCFA 2JHEA 1NYMA 3CAXA 4UHUA 3ZCZA 1RGYA 1SDNA 5HX9A 4R23A 4HH2A 4BJPA 4EQIA 4Y5FA 3UPOA 4ARZA 1NXYA 2Y2KA 2V1AA 3MBZA 3HLGA 3MQQA 2ZMVA 3T4LA 3SS4A 3BFGA 1JWPA 5CGWA 1OJ5A 4JXVA 4QD4A 4EW7A 2OLVA 3VOZA 4KZ3A 5DKKA 1KE0A 4HBUA 3NOTC 4JF5A 5KSHA 3OPHA 4DE3A 2Y2NA 5CHUA 4LV2A 2HF6A 2XFSA 3PAEA 2M1CA 2ZM0A 3GECA 3OCLA 3M6BA 5G18A 5E2EA 3MFXA 3C8CA 3D4FA 3AGEA 2NUTC 3HLCA 3IS2B 3ZVTA 1MWUA 1IYSA 2PDRA 2IWDA 4ARZB 3OPLA 4KZ9A 3OZHA 4DXBA 3LIAA 4HJ4A 2XROA 3LR5A 4JF4A 4S2KA 4KUOA 3HBRA 2Y2LA 1PYYA 4EUVA 2C5WB 4YOFA 3KYQA 3TG9A 1BUEA 4Q8IA 3B33A 4EQ1A 5F83A 2INWA 3IQAA 1NWZA 3LR4A 4BBVA 4RA7A 4QY5A 2WGVA 3VP3A 3NDEA 2K7SA 4OP8A 4WEJA 1ZG4A 1TVFA 1RP5A 1K54A 3Q7ZA 3BYDA 2W1TA 1VETA 4MN5A 5E2HA 3LFVA 5L8MA 1MKMA 3TSGA 2O99A 1L0DA 4Q0JA 3OCNA 1WE4A 5FQ9A 4DE0A 3E2KA 3ITBA 3DWKA 1IYQA 2WYXA 3ZFZA 1NRJA 4WL9A 2XEPA 2Z2MB 3IHAA 3N6IA 5KSCA 4Q0HA 4N92A 3BECA 4OQIA 1Y54A 3V3SA 3JPUA 1T1BA 5FQQA 3LO7A 2P7JA 3O3VA 4MCWA 2P9VB 4Q0IA 3A3EA 1XKZA 4GW9A 2B95A 1RCJA 1N9OA 3T50A 1S6RA 2VGLM 1BLCA 3FPVA 4GHIB 1Z09A 4JF6A 3VE3A 5F1FA 3LGOA 2EXBA 3IF5A 3LI9A 3UPNA 4O0PA 1MBLA 2JBFA 1BLPA 3IXGA 3ZG7B 2V0UA 2ZC3B 2QJ7A 3QP8A 4DF6A 2VA0A 3T12B 4UA9A 1BULA 1XXMA 3H9WA 1ZC2A 3LIDA 3Q82A 4WBGA 4KG2A 3LYXA 2WKQA 3N8RA 2LB5A 4EESA 4L9EA 4BBUA 1ONGA 3A3FA 3BEBA 3HLEA 1JWVA 3MZFA 3WS4A 3ISGA 1OMEA 1TS6A 5FI7A 2H0TA 2Z6DA 5GLDA 4B4XA 3IWQA 1ERMA 1XX2A 5CGXA 1E3UD 2ZMAA 4ETZA 1TF1A 2EFUA 5FEGA 3KO6A 3LEZA 3GDIA 2PBDP 1K57A 3ZYTA 3KX0X 5I94A 1FSWA 4UQIS 2OAQ1 3EEAA 4XT2A 5HD3A 3WS5A
chains in the Genus database with same CATH topology
2I9VA 2PD8A 4WEKA 5HPIA 4HH3A 3A0RA 2KLIA 1T1AA 4H6JA 3UMEA 5TBMA 3S7NA 3CWFA 3U2AA 2P04A 1XJ2A 3S7QA 3CUEA 4NXEA 3NOUC 3BY9A 2YKFA 4WN5A 5HSQA 2J3TC 1STZA 1V9ZA 3HJKA 5G4YA 2JKRM 2KOIA 5IS1A 2V1BA 1N9NA 3P7NA 2JKRI 2QHKA 2Y79A 3KYZA 3EQVA 4LRZE 4EEPA 4UQIM 3C38A 3IBJA 1GSWA 4JGQA 3IS2A 1D7EA 1XFQA 3S7OA 2QKPA 3V67A 4PKYG 2A24A 3PBRA 4LRYC 3LIEA 1IFQA 4EEUA 4GS9A 1G28A 2QWSA 2ZBBA 4DMZA 4FOFA 2OOLA 3TE8A 1YAXA 3KSGA 2VV8A 1OTAA 4ME4A 1WA9A 2MJ6A 4G3VA 5HWTA 1F98A 3R7WB 1OT6A 1TS0A 4PHTA 3RH8B 2YKHA 2VJWA 1H3QA 5IU1A 3KSIA 3W2ZA 2W3GA 2QYBA 2OWJA 3K2NA 1LSWA 4CLCB 5HDCA 3KSFA 5K5BA 5EFWA 4KQOA 4E04A 2O9BA 4I3IA 4HIAA 3UE3A 5MC7A 3PBTA 3E4PA 3HCYA 2O0YA 4UEYA 2EWWA 4IHQA 1P9RA 2Y8HA 4HQAA 3KSHA 3RTYA 2K2NA 3LIBA 3PR6A 2FH5A 3P01A 2HGVA 4HP4A 2HJ9C 1UGUA 2CMNA 2W3EA 2GZAA 1LSVA 2J3TD 4NKPA 2PHYA 1V9YA 5DF9A 4NXBA 2L0WA 4CLCA 1S67L 3JVVA 1N9LA 2OAP1 4F3LA 4LPZA 3T4SA 4MN6A 3MMHA 3H82A 1YKDA 5AJGA 1ODVA 2W1RA 2W3FA 1DP9A 1S4RA 3VV4A 2ZMFA 5HDSA 1P97A 1T18A 3NJAA 2HJEA 2KDKA 3K3DA 4BMWA 1BYWA 3ZQ5A 3NHQA 4I5SA 4MDZA 4L0LA 3BY8A 4GLQA 4ZRRA 1F9IA 3B47A 3UMDA 5F68A 4P6ZM 3B42A 2EWVA 2V9AA 1P9WA 1TS8A 1OPXA 3IBRA 4OOMA 4LLOB 5HD5A 2VLGA 4CLCE 4EU0A 2GNXA 4HI4A 3H7WB 1Y28A 4Y3IA 3PXPA 1VHMA 3E0YA 3F1OB 4GHIA 3OC2A 2Z6CA 3E4QA 2WKRA 3EWKA 3FC7A 2BASA 4PKYA 5AVFA 2VEAA 4HP9A 1VB6A 3PHYA 2W1TB 1DRMA 5DKLA 3VE4A 4WELA 3UB9A 1XJ6A 4HHDA 1UWNX 3E4OA 2XRNA 3TRCA 3BQ8A 4IJGA 4L9FA 1OTEA 3F1PA 2KX6A 4BBTA 4O01A 2W3HA 2D01A 2XA7S 4QPRA 5TJJA 1ZTUA 2JKTM 4MN7A 4GS9B 4I3AA 2OWHA 2QJ5A 3PBSA 4II7A 2JHEA 3LIFA 3K3CA 3PYPA 2PT7A 4NXGA 3CAXA 4HJ3A 5F6AA 2D02A 1IOUA 1MZUA 4HH2A 3MR0A 5CX7A 4BJPA 2H28A 4HY8A 4Y5FA 3FPWA 3R4KA 4MMNA 4ARZA 4Z1WA 3TW8A 2V1AA 3T4KA 1G6OA 5HPFA 3TJZC 5A8BA 3EQUA 3MQQA 2ZMVA 2PYPA 3T4LA 2J80A 2JKTI 4G3WA 5HWVA 1OJ5A 4M4XA 4I39A 3VOLA 2R78A 4EW7A 3C2WA 4R3AA 2M7UA 3R7WA 2VV6A 2B18A 3JVUA 1NLYA 5DKKA 4HOIA 3NOTC 5KSHA 4Y2FA 3UB8A 3BQAA 3CUEC 2O9CA 2HF6A 3ICYA 2M1CA 3GECA 3OCLA 2WKPA 2GX5A 1OT9A 1EW0A 3MFXA 1YSPA 1OTIA 3C8CA 2LB9A 3CITA 1OJGA 2A24B 2V0WA 2VGLS 4NEED 2NUTC 3IS2B 2XA7M 1S66L 1LSXA 5DFYA 2PDRA 4ARZB 3LIAA 2J3WA 2PD7A 4HJ4A 3UB6A 2XROA 3LR5A 3EEHA 2FZ0A 4KUOA 4HJ6A 4EUVA 4YOFA 4H6JB 3F1NA 3T4TA 3KYQA 1OTBA 1ZHHB 3LR0A 4WLAA 3B33A 4EQ1A 1TS7A 4L9GA 2INWA 2K31A 4IUKA 1NWZA 2ZOIA 3LR4A 4JGRA 4BBVA 2VKSA 4NXFA 4P6ZS 2K7SA 2DMWA 4WEJA 4DN0A 3H82B 4K08A 4CLCD 4F3LB 2VV7A 2W1TA 4YNRA 3T4OA 5L8MA 4MN5A 3LFVA 4JGOA 1MKMA 2O99A 4Q0JA 3OCNA 2GJ3A 3F1NB 4G3KA 1DP8A 3D72A 3T4QA 4ETXA 4DJ3A 3BJNA 1MC0A 3LICA 4AFIA 3CI6A 3H7WA 1NRJA 4WL9A 3PBNA 1XJ3A 4WF0A 3EOIA 3BWLA 5IT5A 1P0ZA 3LI8A 5F69A 1X0OA 4DJ2A 1T1CA 5J4EA 4Q0HA 1S4SA 1LT0A 4R6LA 5LBRA 2ZOHA 1T1BA 1XFNA 2P7JA 4MCWA 4BWIA 2O9AA 4Q0IA 3BW6A 4GW9A 4XT2B 4RQ9A 2M7VA 2W0NA 4CLCC 2EA9A 1OTDA 1N9OA 3PBOA 3T50A 2VGLM 1NLZA 3FPVA 5AVEA 4GHIB 3MF0A 3MQOA 4O8GA 4KUKA 5FL3A 3C30A 3OOVA 3VE3A 3S7PA 3O5YA 2HV1A 1H8MA 2G7UA 3LI9A 3NOPC 5HZHA 3LR3A 5DJUA 4B93A 4O0PA 5G4ZA 4B9OA 1DP6A 2V0UA 4OOLA 3A0VA 3DBAA 1UWPX 3EGDC 2QJ7A 3ULFA 4GCZA 2VZWA 4I3JA 5KIZA 3OBFA 2VA0A 5TBMB 4EERA 1S1ZA 3H9WA 5J7EA 2IA2A 3D3OA 1GSVA 3LIDA 5C5KA 3LYXA 3UB7A 1W63M 2WKQA 3FG8A 3F1PB 4I38A 2LB5A 1W63Q 5HDDA 4EESA 1KOUA 2W3DA 4L9EA 3LUQA 5HL6A 4BBUA 3E98A 4YWZA 4JGPA 2PYRA 3UE6A 3A0SA 4R38A 4EXOA 4CQHA 3MQ0A 1TS6A 3F1OA 4PAUA 4FSFA 2Z6DA 1F5MA 2L4RA 4R70A 3EGXC 1LL8A 5J3WA 3OLOA 2XSSA 4IUHA 1T19A 2NUPC 4ETZA 1TF1A 3T4JA 2W27A 5DJTA 3CLOA 4GJ4A 1GSXA 1TD5A 2L1MA 4WUJA 3KO6A 2A2LA 5HWWA 3RFBA 5F5YA 2PR6A 3MXQA 4HNBA 4LRXC 3GDIA 2JN7A 5I5LA 3G6OA 3SW1A 3ZYTA 2B02A 4EETB 3KX0X 1S1YA 4UQIS 3PBQA 3MJQA 1YSQA 2OAQ1 2PR5A 1D06A 4KQDA 3EEAA 1XJ4A 2P08A 2VX8A 4XT2A 5HD3A 5DFXA 1JNUA 3HJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDK A;  3K3D A;  2EA9 A;  3ICY A;  1BYW A;  1OTD A;  2M1C A;  1N9O A;  2I9V A;  3GEC A;  3ZQ5 A;  2WKP A;  3T50 A;  2PD8 A;  4HH3 A;  3A0R A;  3NHQ A;  1T1A A;  4I5S A;  1OT9 A;  4H6J A;  1EW0 A;  3MFX A;  5TBM A;  3UME A;  1OTI A;  3C8C A;  3CWF A;  4GHI B;  1OJG A;  5AVE A;  3MQO A;  2A24 B;  1XJ2 A;  4KUK A;  2V0W A;  4PKY A;  3BY8 A;  3VE3 A;  4NXE A;  3NOU C;  3IS2 B;  3BY9 A;  1S66 L;  1F9I A;  2YKF A;  5AVF A;  4WN5 A;  5F68 A;  3UMD A;  2HV1 A;  5HSQ A;  4GS9 A;  1LSX A;  1V9Z A;  3LI9 A;  3HJK A;  2PDR A;  3NOP C;  2V9A A;  5G4Y A;  5HZH A;  1TS8 A;  5DJU A;  5IS1 A;  3IBR A;  2V1B A;  5G4Z A;  1N9N A;  3P7N A;  2QHK A;  4LLO B;  5HD5 A;  2VLG A;  3LIA A;  2PD7 A;  4LRZ E;  4EEP A;  4B9O A;  4HJ4 A;  3UB6 A;  1DP6 A;  2V0U A;  4HI4 A;  1GSW A;  3A0V A;  4JGQ A;  3H7W B;  3IS2 A;  1UWP X;  2QJ7 A;  1D7E A;  3ULF A;  1XFQ A;  1Y28 A;  3EEH A;  4GCZ A;  2QKP A;  4KUO A;  4I3J A;  4PKY G;  2A24 A;  4HJ6 A;  4LRY C;  5KIZ A;  3F1O B;  4GHI A;  3LIE A;  4EEU A;  5TBM B;  4EER A;  4H6J B;  3F1N A;  2Z6C A;  1OTB A;  1S1Z A;  2WKR A;  3E4Q A;  2BAS A;  3EWK A;  1G28 A;  2QWS A;  3FC7 A;  2VEA A;  3H9W A;  4HP9 A;  1VB6 A;  2ZBB A;  3B33 A;  1DRM A;  3PHY A;  4WLA A;  5DKL A;  3VE4 A;  4EQ1 A;  1GSV A;  1TS7 A;  3LID A;  4L9G A;  1XJ6 A;  2OOL A;  4HHD A;  2INW A;  3UB9 A;  3LYX A;  3UB7 A;  1UWN X;  2WKQ A;  3FG8 A;  3E4O A;  2VV8 A;  3F1P B;  1NWZ A;  2ZOI A;  4JGR A;  4BBV A;  4I38 A;  4NXF A;  4L9F A;  1OTA A;  5HDD A;  1WA9 A;  2K7S A;  1KOU A;  5HWT A;  4EES A;  1F98 A;  1OTE A;  1OT6 A;  3F1P A;  1TS0 A;  2KX6 A;  3H82 B;  4L9E A;  3LUQ A;  4BBU A;  4BBT A;  4K08 A;  3RH8 B;  2YKH A;  2D01 A;  4YWZ A;  4F3L B;  5IU1 A;  4JGP A;  2VV7 A;  2PYR A;  3UE6 A;  2OWJ A;  4MN5 A;  1LSW A;  3A0S A;  4JGO A;  5HDC A;  4GS9 B;  5EFW A;  4R38 A;  4E04 A;  2GJ3 A;  3F1N B;  2OWH A;  1DP8 A;  2QJ5 A;  4I3A A;  3D72 A;  4HIA A;  4I3I A;  4EXO A;  1TS6 A;  3F1O A;  2JHE A;  3LIF A;  3K3C A;  3PYP A;  3E4P A;  2Z6D A;  5J7E A;  4NXG A;  3CAX A;  4DJ3 A;  3LIC A;  4HJ3 A;  2L4R A;  4R70 A;  3H7W A;  4HQA A;  2D02 A;  1LL8 A;  5F6A A;  3OLO A;  5J3W A;  3RTY A;  1MZU A;  3LIB A;  4WL9 A;  4HH2 A;  3MR0 A;  4HP4 A;  1XJ3 A;  4WF0 A;  2H28 A;  4HY8 A;  1UGU A;  1T19 A;  3BWL A;  2CMN A;  2V1A A;  1LSV A;  1P0Z A;  2W27 A;  3LI8 A;  5DJT A;  5F69 A;  1X0O A;  3CLO A;  1GSX A;  5A8B A;  2PHY A;  2W0N A;  1V9Y A;  2L1M A;  4NXB A;  4DJ2 A;  1T1C A;  2L0W A;  3MQQ A;  2PYP A;  5J4E A;  4WUJ A;  2J80 A;  5HWV A;  1S67 L;  1N9L A;  5HWW A;  1S4S A;  1LT0 A;  4R6L A;  4F3L A;  1OJ5 A;  4LPZ A;  4M4X A;  5F5Y A;  2PR6 A;  3MXQ A;  4HNB A;  4I39 A;  3GDI A;  4LRX C;  2R78 A;  4MN6 A;  3VOL A;  3C2W A;  4EW7 A;  2JN7 A;  2ZOH A;  1T1B A;  3G6O A;  3H82 A;  4R3A A;  5I5L A;  2B02 A;  2VV6 A;  1ODV A;  4EET B;  1XFN A;  3KX0 X;  3SW1 A;  2P7J A;  1S1Y A;  5DKK A;  4HOI A;  3NOT C;  1DP9 A;  3MJQ A;  1S4R A;  2PR5 A;  1D06 A;  4GW9 A;  4KQD A;  4XT2 B;  1XJ4 A;  4RQ9 A;  1P97 A;  1T18 A;  4XT2 A;  5HDS A;  5HD3 A;  3UB8 A;  1JNU A;  3NJA A;  3HJI A; 
#chains in the Genus database with same CATH topology
 4U3T A;  2I9V A;  3GRJ A;  5HPI A;  4HH3 A;  2KLI A;  1T1A A;  4FH2 A;  3UME A;  3IWO A;  5TBM A;  3S7N A;  4ZDX A;  4NXE A;  1W8Q A;  2EX9 A;  5L10 A;  1V9Z A;  3ZGA B;  3HJK A;  5IS1 A;  1YLP A;  2V1B A;  1N9N A;  5EM0 A;  4U0X A;  4EEP A;  2EXA A;  3IBJ A;  1K56 A;  1TEM A;  2QKP A;  4PKY G;  3PBR A;  1IFQ A;  4EEU A;  4X1M A;  4WMC A;  2ZBB A;  2ZJ9 A;  5AQ7 A;  4FOF A;  2OOL A;  3TE8 A;  4QHC A;  4ESP A;  4JPM A;  3CHW P;  1KGE A;  4ME4 A;  3IH9 A;  1F98 A;  5F1G A;  1SKF A;  3KSI A;  3Q07 A;  5EVL A;  3NEC A;  2W3G A;  4CLC B;  3KSF A;  5EFW A;  1SKO A;  4KQO A;  2O9B A;  4HIA A;  4X68 A;  5MC7 A;  3PBT A;  1FIL A;  3HCY A;  1H8Z A;  1L0G A;  4FTX A;  3RTY A;  2RL3 A;  4S2N C;  3P01 A;  3BLS A;  5M1A A;  3MS6 A;  1KVM A;  4C75 A;  4MLL A;  2J3T D;  3WS2 A;  3MXS A;  4CLC A;  4KZA A;  1N9L A;  1E3U A;  4MBK A;  2HDQ A;  4S2I A;  3MKE A;  3UY6 A;  2W1R A;  3UDF A;  2HJE A;  5KZH A;  4R4R A;  2PAV P;  5CTN A;  1PNE A;  4L0L A;  3WS1 A;  3BY8 A;  4ZRR A;  3UMD A;  1H5X A;  2BG1 A;  1XGI A;  3BLM A;  2EWV A;  3QP6 A;  1OPX A;  3IBR A;  4OOM A;  4LLO B;  4EU0 A;  1ESU A;  1A0K A;  1YLT A;  2I72 A;  4DDS A;  5HAQ A;  1ES3 A;  2VK3 A;  5A90 A;  2CC1 A;  2VEA A;  4HP9 A;  5DKL A;  2Y2G A;  3DW0 A;  2JC7 A;  1BLH A;  3TRC A;  3BQ8 A;  1HZO A;  3OPP A;  1OTE A;  3F1P A;  5AQB A;  4ZJ1 A;  4QPR A;  1ZTU A;  5KMW A;  3FV7 A;  2OWH A;  1FOF A;  3PBS A;  4IBX A;  2XQZ A;  3PYP A;  2GDN A;  4JKT A;  5EOO A;  2D02 A;  5F6A A;  1IOU A;  4HY8 A;  2XD5 A;  1YQS A;  2VGJ A;  3FPW A;  3T4K A;  5A8B A;  3HUM A;  2J80 A;  2JKT I;  2B5R A;  5CHJ A;  3C2W A;  2IWB A;  2VV6 A;  2B18 A;  1QMF A;  3JVU A;  3PAG A;  3GR2 A;  4Y2F A;  3UB8 A;  3CUE C;  1KDW A;  3N8L A;  1HTZ A;  2WK0 A;  4E3L A;  1OT9 A;  1YSP A;  1OTI A;  2LB9 A;  3O86 A;  1OJG A;  5JYO A;  2A24 B;  5FDH A;  3QNC A;  3T1Q B;  2JCH A;  2J3W A;  5A93 A;  1GA0 A;  1LL9 A;  4PMA A;  2ZLY A;  3EEH A;  2FZ0 A;  4B88 A;  4MBH A;  1ZKJ A;  4EUZ A;  4H6J B;  1BT5 A;  1OTB A;  1TS7 A;  4L9G A;  3Q81 A;  1SZV A;  2K31 A;  4R4S A;  3G4P A;  2PBY A;  2V1Z A;  4HES A;  2BLS A;  3C5A A;  3HUN A;  2DMW A;  3IX4 A;  4DN0 A;  4K08 A;  1JVJ A;  2VV7 A;  4K91 A;  4LV0 A;  1L0E A;  3F1N B;  4MEZ A;  3D72 A;  1EWZ A;  1BZA A;  4DJ3 A;  3LIC A;  3CI6 A;  3H7W A;  3BFD A;  4BQM A;  1JTD A;  2V20 A;  3BWL A;  3JYI A;  4DJ2 A;  1T1C A;  1VET B;  1LT0 A;  2VGK A;  5LBR A;  4KZ6 A;  4Y0O A;  2PRF A;  4PM6 A;  3S1Y A;  3S4X A;  5BOH A;  1XP4 A;  4CLC C;  1YLW A;  5A92 A;  1OTD A;  4KZ8 A;  3M2K A;  2QZ6 A;  3L7H A;  1NLZ A;  4WMC D;  5AVE A;  3QNB A;  4ZAM A;  2HDR A;  3MQO A;  3NBL A;  4KUK A;  2QMI A;  3S7P A;  5J8X A;  1Q2P A;  3O5Y A;  5CEB A;  3LR3 A;  4B93 A;  1KDS A;  5G4Z A;  4B9O A;  1PZP A;  4ZJ2 A;  4JXS A;  1KVL A;  3ULF A;  2ZD8 A;  4I3J A;  3DAV A;  4OQH A;  3NI9 A;  3OBF A;  5FAQ A;  4EER A;  2H10 A;  1LL5 A;  4GN2 A;  5CXW A;  3HLB A;  1GSV A;  2X01 A;  1HD8 A;  5E2F A;  3UB7 A;  2E8J A;  3W4O A;  2W3D A;  2PU2 A;  2ZQ8 A;  3LUQ A;  3IT9 A;  3VP0 A;  4LCL A;  3UE6 A;  3D9Y A;  4EBL A;  2OLU A;  3MQ0 A;  3F1O A;  1KE4 A;  4PAU A;  4FSF A;  2Q9M A;  3CPT B;  4O7D A;  2L4R A;  1PWG A;  3SZT A;  3MFD A;  2XSS A;  2HDU A;  1FR6 A;  4IUH A;  4QB8 A;  4KG5 A;  5M19 A;  2DNS A;  4GJ4 A;  2XGN A;  1GSX A;  4PM5 A;  4OPQ A;  1HVB A;  1M6K A;  4HNB A;  4LRX C;  2JN7 A;  1S1Y A;  2Q0O A;  4LFU A;  3VP4 A;  3PBQ A;  3MJQ A;  2PR5 A;  4QJG A;  3UDI A;  3C7U A;  1JNU A;  1NRF A;  2Y59 A;  5EPH A;  3QP4 A;  5HAP A;  5CTM A;  5HFO A;  4H6J A;  3CWF A;  2P04 A;  1AWI A;  3NOU C;  3OPR A;  4IBR A;  3WRT A;  1MY8 A;  2XK1 A;  3BY9 A;  4MNR A;  1ES2 A;  5HSQ A;  2J3T C;  4DKI A;  5U47 A;  1W7F A;  5G4Y A;  2JKR M;  2R9W A;  3NUL A;  2KOI A;  3FYZ A;  4BL3 A;  2QHK A;  4LV3 A;  3KYZ A;  1J3W A;  3C38 A;  5L09 A;  5EVI C;  1DY6 A;  1GHI A;  2XH9 A;  4P0M A;  3LIE A;  3VP2 A;  4S2N A;  4UAA A;  5GL9 A;  1YAX A;  4BLM A;  2EFX A;  3AGF A;  2E8I A;  1WA9 A;  3GVB A;  2BTF P;  2WGI A;  1TS0 A;  1H3Q A;  5IU1 A;  5E43 A;  1LSW A;  2ZC7 A;  4Y0U A;  5HDC A;  5K5B A;  1ESI A;  2O0Y A;  2WAD A;  2EWW A;  4IHQ A;  1P9R A;  1NY0 A;  1BTL A;  2XDM A;  4HQA A;  2K2N A;  3FKW A;  2FH5 A;  1KGF A;  2HGV A;  4GOG A;  3VFF A;  3NC8 A;  3ZNT A;  1LSV A;  3LY4 A;  4NXB A;  2L0W A;  5HW3 A;  4GD6 A;  3MZD A;  4X6T A;  3H82 A;  1YKD A;  4FH4 A;  4ZJ3 A;  2W3F A;  1DP9 A;  1S4R A;  3ZG9 B;  2ZMF A;  5GLB A;  1VM1 A;  1P97 A;  4XUZ A;  4WYY A;  3SS3 A;  3MZE A;  3ZVW A;  4DE2 A;  3NJA A;  4JLF A;  5FQM A;  2KDK A;  3K3D A;  2P9V A;  5FI2 A;  1G5U A;  3ZQ5 A;  1RGZ A;  1PI5 A;  4I5S A;  3M2J A;  4MDZ A;  1PIO A;  1KGG A;  4BD1 A;  5FAT A;  1O07 A;  4GLQ A;  3NIA A;  5F68 A;  3B42 A;  1GHP A;  1MXO A;  1PZO A;  2V9A A;  1TS8 A;  3IF6 B;  2VLG A;  4ZBE A;  4CLC E;  2GNX A;  4X25 A;  4NET A;  4HI4 A;  5EVI D;  2J7V A;  5HL1 A;  1Y28 A;  1K54 C;  1WYB A;  4OPZ A;  3PXP A;  3DTE A;  2BAS A;  2W1T B;  4U0T A;  5EVE A;  4WEL A;  3IXD A;  1XA1 A;  2XRN A;  1DJB A;  1YLJ A;  2ZC5 B;  2KX6 A;  4BBT A;  1XGJ A;  3CJM A;  3SS5 A;  4MN7 A;  1MWS A;  4DDY A;  4GKU A;  3LIF A;  3K3C A;  2PT7 A;  4D60 A;  4HJ3 A;  4LGW A;  4GB7 A;  3IWI A;  2WKE A;  1H0M A;  2H28 A;  4RVA A;  4MMN A;  2WGW A;  4Z1W A;  3TW8 A;  1I2W A;  1G6O A;  5HPF A;  3TJZ C;  2PYP A;  4OPR A;  4G3W A;  5HWV A;  4I39 A;  3VOL A;  1G68 A;  3R7W A;  1XA7 A;  2Q9N A;  3U4L P;  3IH8 A;  4X69 A;  3ICY A;  4CPK A;  5FI6 A;  3UE0 A;  3CIT A;  2VGL S;  1GHM A;  3S22 A;  2XA7 M;  1S66 L;  5DFY A;  1WYC A;  4WM9 A;  2OSU A;  3IHB A;  4ZTK A;  4RX2 A;  2J9O A;  2ZQC A;  4C6Y A;  3UB5 P;  5HAR A;  4RX3 A;  4HJ6 A;  2EX8 A;  3T4T A;  3F1N A;  1SKO B;  1ZHH B;  1YLZ A;  1IKI A;  1CEF A;  4WLA A;  4KG6 A;  4OP5 A;  2HP9 A;  2ZM2 A;  1SHV A;  4QWO A;  1ES4 A;  2ZOI A;  2VKS A;  4P6Z S;  4OLG A;  5CGS A;  3H82 B;  4CLC D;  4F3L B;  1PW8 A;  4JGO A;  2GJ3 A;  3LCE A;  4G3K A;  1DP8 A;  3Q7V B;  4BEN A;  2WGW B;  4PM9 A;  1MC0 A;  2V2F F;  4OLD A;  5EM1 A;  3PBN A;  2Y55 A;  2EX6 A;  4WF0 A;  5F82 A;  3Q1F A;  4EV4 A;  3N4I A;  4XXR A;  1P0Z A;  3LI8 A;  5F69 A;  1X0O A;  1I5Q A;  2G2U A;  1H8Y A;  4R0Q A;  1S4S A;  3HUO A;  4R6L A;  4N9K A;  2ZOH A;  1TDG A;  1K57 C;  2O9A A;  3BW6 A;  3LEQ A;  3VFH A;  4XT2 B;  1E4D A;  3M6H A;  2EA9 A;  4D2O A;  3UE1 A;  3MF0 A;  4O8G A;  4M3K A;  5FL3 A;  3VOY A;  3OOV A;  4E3J A;  3AGD A;  5L2F A;  3NOP C;  1ES5 A;  1JWZ A;  2WKI A;  3MKF A;  4IVI A;  2XF3 A;  1DP6 A;  3A0V A;  1FCM A;  1YMX A;  1UWP X;  4JXW A;  4GCZ A;  2VZW A;  5KIZ A;  3NCK A;  1S1Z A;  3P98 A;  5J7E A;  2IA2 A;  5EVI B;  4P85 A;  1ONH A;  3FG8 A;  3F1P B;  3E2L A;  4I38 A;  3QP5 A;  2ZC6 B;  1W63 Q;  2X71 A;  3GQZ A;  4A5R A;  3E98 A;  1K56 D;  2PYR A;  3A3D A;  1VEU A;  4GNU A;  4R38 A;  1LLB A;  4E3I A;  4CQH A;  3QP1 A;  4Y0T A;  1F5M A;  2V8C A;  4R70 A;  3EGX C;  1DJC A;  1LL8 A;  3FWL A;  1L2S A;  3OLO A;  1PW1 A;  2FFY A;  3IX3 A;  4E3O A;  2ZQD A;  4NK3 A;  2NUP C;  2PU4 A;  5DJT A;  1TD5 A;  1J9M A;  2A2L A;  3RXW A;  3ITA A;  1FSY A;  3RFB A;  5I5L A;  3SW1 A;  4C3Q A;  4EET B;  4EBP A;  5CER A;  2A49 A;  3IXH A;  5FDS A;  1DJA A;  2ZL1 A;  4OQ0 A;  1NJ4 A;  2UV0 E;  2RCX A;  2VX8 A;  2ZQ9 A;  3HJI A;  1PI4 A;  3A3J A;  4WEK A;  2ZC4 B;  4QY6 A;  3U2A A;  1XJ2 A;  4EWF A;  3VMA A;  3CUE A;  3WRZ A;  1STZ A;  2H5S A;  1L3L A;  2JKR I;  3CMZ A;  3MSH A;  3EQV A;  4JXG A;  4UQI M;  3W8K A;  3I7J A;  4KZ5 A;  1GSW A;  4JGQ A;  3IS2 A;  1G6A A;  3W4P A;  3V67 A;  4LRY C;  3RXX A;  1G28 A;  2QWS A;  2Y4A A;  4Y13 A;  4DMZ A;  1U60 A;  2VV8 A;  5EE8 A;  5TFQ A;  5HWT A;  3R7W B;  2JKG A;  2VJW A;  1PFL A;  2QYB A;  2OWJ A;  3K2N A;  4K0X A;  3BFE A;  3SOI A;  4E04 A;  3UE3 A;  2WUQ A;  3TOI A;  5FSR A;  1FQG A;  3KSH A;  3LIB A;  3PR6 A;  5A91 A;  2HJ9 C;  2ZQA A;  3CPT A;  3VP1 A;  3W4Q A;  2W3E A;  1GA9 A;  2GZA A;  1V9Y A;  5DF9 A;  3JVV A;  3V3R A;  4LPZ A;  3T4S A;  4MN6 A;  2Y91 A;  5AJG A;  5DTS A;  4E6X A;  3A3I A;  1T18 A;  2XD1 A;  2ZL1 B;  1IEL A;  1N9B A;  1BYW A;  3NHQ A;  5DTT A;  2WZX A;  4YIN A;  1CI9 A;  3BRM A;  5DF8 A;  1ERQ A;  4P6Z M;  1P9W A;  1Z6F A;  5FA7 A;  5HD5 A;  4CJN A;  1E25 A;  3DTK A;  1AXB A;  1PRQ A;  1C3B A;  3H7W B;  3C4O A;  1W5D A;  2UWX A;  2Y2M A;  1FR1 A;  1VHM A;  3RJU A;  1LI9 A;  3BFF A;  2HP5 A;  2WKR A;  1K6S A;  4PKY A;  5FAP A;  5AQA A;  5AVF A;  2C6W B;  4OQG A;  1VB6 A;  3PHY A;  4N9L A;  3VE4 A;  2HP6 A;  3UB9 A;  1F2K A;  1ZG6 A;  1XJ6 A;  4HHD A;  3SH7 A;  4R3B A;  1UWN X;  3C4P A;  3E4O A;  4E3N A;  4L9F A;  2XFT A;  3G30 A;  4K0W A;  2XA7 S;  1W8Y A;  5TJJ A;  2HDS A;  1HLU P;  2JKT M;  3ZG5 A;  2Y2I A;  4E3K A;  4I3A A;  2QJ5 A;  1YLY A;  4II7 A;  2HPB A;  4NXG A;  3B3X A;  5CEC A;  1K0K A;  5TR7 A;  1MZU A;  4XUX A;  5CX7 A;  3MR0 A;  2H0Y A;  3NY4 A;  4X55 A;  4GZB A;  4N1H A;  3R4K A;  2G2W A;  2WZZ A;  1VEU B;  3EQU A;  2R9X A;  1FIK A;  4M4X A;  5TGF A;  2R78 A;  1K6R A;  3G34 A;  3G2Y A;  4IED A;  4R3A A;  4QU3 A;  3BM6 A;  2M7U A;  2XR0 A;  3QHY A;  3WS0 A;  1NLY A;  4HOI A;  4KZB A;  3BQA A;  5EV0 A;  2O9C A;  1S0W A;  2WKP A;  2GX5 A;  3N8S A;  5GHY A;  1EW0 A;  1MPL A;  2V0W A;  1YPR A;  4NEE D;  2WAE A;  1YMS A;  2A3U A;  4JBF A;  1LSX A;  3SH8 A;  4OOY A;  4P87 A;  4DE1 A;  4Y7P A;  1TDL A;  5D3O A;  2PD7 A;  3UB6 A;  2Y2J A;  4FD8 A;  4YFM A;  1IKG A;  3G32 A;  3HRE A;  4KZ7 A;  3LR0 A;  3BFC A;  1M40 A;  2FFF B;  4IVK A;  4IUK A;  4JGR A;  5FQJ A;  2ZM8 A;  4NXF A;  5FQK A;  3UN7 A;  1CJF A;  1XPB A;  1O7E A;  2AVX A;  4YNR A;  3T4O A;  4B4Z A;  4EBN A;  3T4Q A;  4ETX A;  3UPP A;  3BJN A;  4X1L A;  5FAS A;  4AFI A;  2Z2L B;  2DCF A;  1FCO A;  1BLS A;  4F94 A;  1XJ3 A;  3EOI A;  4S2L A;  3LY3 A;  5IT5 A;  3P09 A;  2DRW A;  3Q7V A;  4R3J A;  3T1R A;  3IXB A;  1L0F A;  5J4E A;  2JKF A;  4DRT A;  1CEG A;  1CQA A;  1XFN A;  4PM7 A;  2OV5 A;  5M18 A;  4BWI A;  1K55 A;  1Q2Q A;  4BD0 A;  4RQ9 A;  2M7V A;  2W0N A;  3V39 A;  4WZ5 C;  3HLD A;  4GDN A;  3PBO A;  4N1X A;  5HAI A;  3IX8 A;  1Y4O A;  3WWX A;  3C30 A;  1SCW A;  4LV1 A;  2HV1 A;  1H8M A;  1YT4 A;  2G7U A;  2XLN A;  5DF7 A;  2J8Y A;  5HZH A;  5EEC A;  5DJU A;  1LI0 A;  3ZDJ A;  4OOL A;  4HEF A;  4UA7 A;  2J9P A;  3DBA A;  3EGD C;  2EX2 A;  4KZ4 A;  1K25 A;  3GMW A;  3C7V A;  1MKI A;  3G2Z A;  5TBM B;  5E2G A;  2WAF A;  1K4E A;  3UNW A;  1BSG A;  3D3O A;  5C5K A;  2Y2H A;  1W63 M;  4S2M A;  2ACG A;  2Y2Q A;  3NDG A;  5HDD A;  5FEF A;  1I2S A;  1KOU A;  3ZNY A;  4Z9Q A;  5HL6 A;  3GSG A;  4E6W A;  4YWZ A;  4JGP A;  4GDB A;  2HZ5 A;  1W79 A;  3A0S A;  4LCM A;  4EXO A;  4P6B A;  5J3W A;  3DWZ A;  5GHZ A;  2X02 A;  3IF6 A;  1T19 A;  4R1G A;  3T4J A;  2W27 A;  3CLO A;  3KYE A;  2L1M A;  3DTM A;  4H8R A;  4OVD A;  4WUJ A;  5HWW A;  4OON A;  5F5Y A;  3ZG8 B;  2PR6 A;  3CG5 A;  3MXQ A;  1IYO A;  4KQR A;  5EUA A;  3G6O A;  2B02 A;  5CRF A;  5GLA A;  1NZU A;  4HBT A;  1YSQ A;  1D06 A;  5CHM A;  4KQD A;  1XJ4 A;  2P08 A;  5DFX A;  1NZO A;  5CED A;  2PD8 A;  2V8F A;  3A0R A;  3VSL A;  3N7W A;  2QPN A;  3S7Q A;  1JTG A;  2Y2O A;  2YKF A;  4WN5 A;  3V50 A;  3V5M A;  1ACF A;  1D1J A;  3P7N A;  4LEN A;  3HLW A;  2Y79 A;  3FKV A;  5AQ9 A;  4LRZ E;  3T1X A;  1FCN A;  3SH9 A;  1D7E A;  1XFQ A;  3S7O A;  3GTC A;  2A24 A;  4BL2 A;  2Y2P A;  4GS9 A;  1ERO A;  1NYY A;  4S2J A;  3L9K A;  1ALQ A;  3KSG A;  4KEN B;  4MBF A;  4Y17 A;  4ID4 A;  1OTA A;  5EOE A;  2MJ6 A;  4G3V A;  3O88 A;  4S2P A;  1OT6 A;  4PHT A;  4WZ5 A;  3RH8 B;  2YKH A;  4X53 A;  3W2Z A;  5EVI A;  5DTK A;  4UA6 A;  4I3I A;  1LHY A;  3E4P A;  3T1S A;  4UEY A;  2Y8H A;  4OH0 A;  3PTE A;  5FAO A;  4HP4 A;  4NG2 A;  1UGU A;  1MWR A;  2CMN A;  1KE3 A;  3QP2 A;  1N4O A;  3UO9 A;  3VSK A;  4E3M A;  4NKP A;  4OPY A;  1PWC A;  3MXR A;  3HLF A;  2PHY A;  4DXC A;  5FQI A;  2IWC A;  1IEM A;  1S67 L;  3ZG0 A;  2OAP 1;  3DTI A;  4F3L A;  3MMH A;  1ODV A;  4RYE A;  3ZHH A;  1YM1 A;  3VV4 A;  3IF6 C;  5HDS A;  4WZ4 A;  4BMW A;  4KQQ A;  1CI8 A;  3CZD A;  4X56 A;  3GV9 A;  5IHV A;  4FUW A;  1K38 A;  2JE5 A;  1K55 C;  1F9I A;  3B47 A;  4Y15 A;  3UDX A;  3FZC A;  4PM8 A;  1GCE A;  5GLC A;  1CF0 A;  1K4F A;  4Y3I A;  3G35 A;  3E0Y A;  3F1O B;  4GHI A;  3OC2 A;  2Z6C A;  3E4Q A;  3EWK A;  3FC7 A;  4S2O A;  2P74 A;  1QME A;  1DRM A;  1EI5 A;  3G31 A;  5JYP A;  4IJG A;  1SDE A;  4PPR A;  5L07 A;  3HVF A;  4GD8 A;  4O01 A;  5GHX A;  2W3H A;  2D01 A;  1VQQ A;  2ZQ7 A;  1IYP A;  3O87 A;  2WKH A;  4GS9 B;  5DVA A;  1MWT A;  3HL9 A;  1CK3 A;  1PWD A;  4OKP A;  4FCF A;  2JHE A;  1NYM A;  3CAX A;  4UHU A;  3ZCZ A;  1RGY A;  1SDN A;  5HX9 A;  4R23 A;  4HH2 A;  4BJP A;  4EQI A;  4Y5F A;  3UPO A;  4ARZ A;  1NXY A;  2Y2K A;  2V1A A;  3MBZ A;  3HLG A;  3MQQ A;  2ZMV A;  3T4L A;  3SS4 A;  3BFG A;  1JWP A;  5CGW A;  1OJ5 A;  4JXV A;  4QD4 A;  4EW7 A;  2OLV A;  3VOZ A;  4KZ3 A;  5DKK A;  1KE0 A;  4HBU A;  3NOT C;  4JF5 A;  5KSH A;  3OPH A;  4DE3 A;  2Y2N A;  5CHU A;  4LV2 A;  2HF6 A;  2XFS A;  3PAE A;  2M1C A;  2ZM0 A;  3GEC A;  3OCL A;  3M6B A;  5G18 A;  5E2E A;  3MFX A;  3C8C A;  3D4F A;  3AGE A;  2NUT C;  3HLC A;  3IS2 B;  3ZVT A;  1MWU A;  1IYS A;  2PDR A;  2IWD A;  4ARZ B;  3OPL A;  4KZ9 A;  3OZH A;  4DXB A;  3LIA A;  4HJ4 A;  2XRO A;  3LR5 A;  4JF4 A;  4S2K A;  4KUO A;  3HBR A;  2Y2L A;  1PYY A;  4EUV A;  2C5W B;  4YOF A;  3KYQ A;  3TG9 A;  1BUE A;  4Q8I A;  3B33 A;  4EQ1 A;  5F83 A;  2INW A;  3IQA A;  1NWZ A;  3LR4 A;  4BBV A;  4RA7 A;  4QY5 A;  2WGV A;  3VP3 A;  3NDE A;  2K7S A;  4OP8 A;  4WEJ A;  1ZG4 A;  1TVF A;  1RP5 A;  1K54 A;  3Q7Z A;  3BYD A;  2W1T A;  1VET A;  4MN5 A;  5E2H A;  3LFV A;  5L8M A;  1MKM A;  3TSG A;  2O99 A;  1L0D A;  4Q0J A;  3OCN A;  1WE4 A;  5FQ9 A;  4DE0 A;  3E2K A;  3ITB A;  3DWK A;  1IYQ A;  2WYX A;  3ZFZ A;  1NRJ A;  4WL9 A;  2XEP A;  2Z2M B;  3IHA A;  3N6I A;  5KSC A;  4Q0H A;  4N92 A;  3BEC A;  4OQI A;  1Y54 A;  3V3S A;  3JPU A;  1T1B A;  5FQQ A;  3LO7 A;  2P7J A;  3O3V A;  4MCW A;  2P9V B;  4Q0I A;  3A3E A;  1XKZ A;  4GW9 A;  2B95 A;  1RCJ A;  1N9O A;  3T50 A;  1S6R A;  2VGL M;  1BLC A;  3FPV A;  4GHI B;  1Z09 A;  4JF6 A;  3VE3 A;  5F1F A;  3LGO A;  2EXB A;  3IF5 A;  3LI9 A;  3UPN A;  4O0P A;  1MBL A;  2JBF A;  1BLP A;  3IXG A;  3ZG7 B;  2V0U A;  2ZC3 B;  2QJ7 A;  3QP8 A;  4DF6 A;  2VA0 A;  3T12 B;  4UA9 A;  1BUL A;  1XXM A;  3H9W A;  1ZC2 A;  3LID A;  3Q82 A;  4WBG A;  4KG2 A;  3LYX A;  2WKQ A;  3N8R A;  2LB5 A;  4EES A;  4L9E A;  4BBU A;  1ONG A;  3A3F A;  3BEB A;  3HLE A;  1JWV A;  3MZF A;  3WS4 A;  3ISG A;  1OME A;  1TS6 A;  5FI7 A;  2H0T A;  2Z6D A;  5GLD A;  4B4X A;  3IWQ A;  1ERM A;  1XX2 A;  5CGX A;  1E3U D;  2ZMA A;  4ETZ A;  1TF1 A;  2EFU A;  5FEG A;  3KO6 A;  3LEZ A;  3GDI A;  2PBD P;  1K57 A;  3ZYT A;  3KX0 X;  5I94 A;  1FSW A;  4UQI S;  2OAQ 1;  3EEA A;  4XT2 A;  5HD3 A;  3WS5 A; 
#chains in the Genus database with same CATH homology
 2I9V A;  2PD8 A;  4WEK A;  5HPI A;  4HH3 A;  3A0R A;  2KLI A;  1T1A A;  4H6J A;  3UME A;  5TBM A;  3S7N A;  3CWF A;  3U2A A;  2P04 A;  1XJ2 A;  3S7Q A;  3CUE A;  4NXE A;  3NOU C;  3BY9 A;  2YKF A;  4WN5 A;  5HSQ A;  2J3T C;  1STZ A;  1V9Z A;  3HJK A;  5G4Y A;  2JKR M;  2KOI A;  5IS1 A;  2V1B A;  1N9N A;  3P7N A;  2JKR I;  2QHK A;  2Y79 A;  3KYZ A;  3EQV A;  4LRZ E;  4EEP A;  4UQI M;  3C38 A;  3IBJ A;  1GSW A;  4JGQ A;  3IS2 A;  1D7E A;  1XFQ A;  3S7O A;  2QKP A;  3V67 A;  4PKY G;  2A24 A;  3PBR A;  4LRY C;  3LIE A;  1IFQ A;  4EEU A;  4GS9 A;  1G28 A;  2QWS A;  2ZBB A;  4DMZ A;  4FOF A;  2OOL A;  3TE8 A;  1YAX A;  3KSG A;  2VV8 A;  1OTA A;  4ME4 A;  1WA9 A;  2MJ6 A;  4G3V A;  5HWT A;  1F98 A;  3R7W B;  1OT6 A;  1TS0 A;  4PHT A;  3RH8 B;  2YKH A;  2VJW A;  1H3Q A;  5IU1 A;  3KSI A;  3W2Z A;  2W3G A;  2QYB A;  2OWJ A;  3K2N A;  1LSW A;  4CLC B;  5HDC A;  3KSF A;  5K5B A;  5EFW A;  4KQO A;  4E04 A;  2O9B A;  4I3I A;  4HIA A;  3UE3 A;  5MC7 A;  3PBT A;  3E4P A;  3HCY A;  2O0Y A;  4UEY A;  2EWW A;  4IHQ A;  1P9R A;  2Y8H A;  4HQA A;  3KSH A;  3RTY A;  2K2N A;  3LIB A;  3PR6 A;  2FH5 A;  3P01 A;  2HGV A;  4HP4 A;  2HJ9 C;  1UGU A;  2CMN A;  2W3E A;  2GZA A;  1LSV A;  2J3T D;  4NKP A;  2PHY A;  1V9Y A;  5DF9 A;  4NXB A;  2L0W A;  4CLC A;  1S67 L;  3JVV A;  1N9L A;  2OAP 1;  4F3L A;  4LPZ A;  3T4S A;  4MN6 A;  3MMH A;  3H82 A;  1YKD A;  5AJG A;  1ODV A;  2W1R A;  2W3F A;  1DP9 A;  1S4R A;  3VV4 A;  2ZMF A;  5HDS A;  1P97 A;  1T18 A;  3NJA A;  2HJE A;  2KDK A;  3K3D A;  4BMW A;  1BYW A;  3ZQ5 A;  3NHQ A;  4I5S A;  4MDZ A;  4L0L A;  3BY8 A;  4GLQ A;  4ZRR A;  1F9I A;  3B47 A;  3UMD A;  5F68 A;  4P6Z M;  3B42 A;  2EWV A;  2V9A A;  1P9W A;  1TS8 A;  1OPX A;  3IBR A;  4OOM A;  4LLO B;  5HD5 A;  2VLG A;  4CLC E;  4EU0 A;  2GNX A;  4HI4 A;  3H7W B;  1Y28 A;  4Y3I A;  3PXP A;  1VHM A;  3E0Y A;  3F1O B;  4GHI A;  3OC2 A;  2Z6C A;  3E4Q A;  2WKR A;  3EWK A;  3FC7 A;  2BAS A;  4PKY A;  5AVF A;  2VEA A;  4HP9 A;  1VB6 A;  3PHY A;  2W1T B;  1DRM A;  5DKL A;  3VE4 A;  4WEL A;  3UB9 A;  1XJ6 A;  4HHD A;  1UWN X;  3E4O A;  2XRN A;  3TRC A;  3BQ8 A;  4IJG A;  4L9F A;  1OTE A;  3F1P A;  2KX6 A;  4BBT A;  4O01 A;  2W3H A;  2D01 A;  2XA7 S;  4QPR A;  5TJJ A;  1ZTU A;  2JKT M;  4MN7 A;  4GS9 B;  4I3A A;  2OWH A;  2QJ5 A;  3PBS A;  4II7 A;  2JHE A;  3LIF A;  3K3C A;  3PYP A;  2PT7 A;  4NXG A;  3CAX A;  4HJ3 A;  5F6A A;  2D02 A;  1IOU A;  1MZU A;  4HH2 A;  3MR0 A;  5CX7 A;  4BJP A;  2H28 A;  4HY8 A;  4Y5F A;  3FPW A;  3R4K A;  4MMN A;  4ARZ A;  4Z1W A;  3TW8 A;  2V1A A;  3T4K A;  1G6O A;  5HPF A;  3TJZ C;  5A8B A;  3EQU A;  3MQQ A;  2ZMV A;  2PYP A;  3T4L A;  2J80 A;  2JKT I;  4G3W A;  5HWV A;  1OJ5 A;  4M4X A;  4I39 A;  3VOL A;  2R78 A;  4EW7 A;  3C2W A;  4R3A A;  2M7U A;  3R7W A;  2VV6 A;  2B18 A;  3JVU A;  1NLY A;  5DKK A;  4HOI A;  3NOT C;  5KSH A;  4Y2F A;  3UB8 A;  3BQA A;  3CUE C;  2O9C A;  2HF6 A;  3ICY A;  2M1C A;  3GEC A;  3OCL A;  2WKP A;  2GX5 A;  1OT9 A;  1EW0 A;  3MFX A;  1YSP A;  1OTI A;  3C8C A;  2LB9 A;  3CIT A;  1OJG A;  2A24 B;  2V0W A;  2VGL S;  4NEE D;  2NUT C;  3IS2 B;  2XA7 M;  1S66 L;  1LSX A;  5DFY A;  2PDR A;  4ARZ B;  3LIA A;  2J3W A;  2PD7 A;  4HJ4 A;  3UB6 A;  2XRO A;  3LR5 A;  3EEH A;  2FZ0 A;  4KUO A;  4HJ6 A;  4EUV A;  4YOF A;  4H6J B;  3F1N A;  3T4T A;  3KYQ A;  1OTB A;  1ZHH B;  3LR0 A;  4WLA A;  3B33 A;  4EQ1 A;  1TS7 A;  4L9G A;  2INW A;  2K31 A;  4IUK A;  1NWZ A;  2ZOI A;  3LR4 A;  4JGR A;  4BBV A;  2VKS A;  4NXF A;  4P6Z S;  2K7S A;  2DMW A;  4WEJ A;  4DN0 A;  3H82 B;  4K08 A;  4CLC D;  4F3L B;  2VV7 A;  2W1T A;  4YNR A;  3T4O A;  5L8M A;  4MN5 A;  3LFV A;  4JGO A;  1MKM A;  2O99 A;  4Q0J A;  3OCN A;  2GJ3 A;  3F1N B;  4G3K A;  1DP8 A;  3D72 A;  3T4Q A;  4ETX A;  4DJ3 A;  3BJN A;  1MC0 A;  3LIC A;  4AFI A;  3CI6 A;  3H7W A;  1NRJ A;  4WL9 A;  3PBN A;  1XJ3 A;  4WF0 A;  3EOI A;  3BWL A;  5IT5 A;  1P0Z A;  3LI8 A;  5F69 A;  1X0O A;  4DJ2 A;  1T1C A;  5J4E A;  4Q0H A;  1S4S A;  1LT0 A;  4R6L A;  5LBR A;  2ZOH A;  1T1B A;  1XFN A;  2P7J A;  4MCW A;  4BWI A;  2O9A A;  4Q0I A;  3BW6 A;  4GW9 A;  4XT2 B;  4RQ9 A;  2M7V A;  2W0N A;  4CLC C;  2EA9 A;  1OTD A;  1N9O A;  3PBO A;  3T50 A;  2VGL M;  1NLZ A;  3FPV A;  5AVE A;  4GHI B;  3MF0 A;  3MQO A;  4O8G A;  4KUK A;  5FL3 A;  3C30 A;  3OOV A;  3VE3 A;  3S7P A;  3O5Y A;  2HV1 A;  1H8M A;  2G7U A;  3LI9 A;  3NOP C;  5HZH A;  3LR3 A;  5DJU A;  4B93 A;  4O0P A;  5G4Z A;  4B9O A;  1DP6 A;  2V0U A;  4OOL A;  3A0V A;  3DBA A;  1UWP X;  3EGD C;  2QJ7 A;  3ULF A;  4GCZ A;  2VZW A;  4I3J A;  5KIZ A;  3OBF A;  2VA0 A;  5TBM B;  4EER A;  1S1Z A;  3H9W A;  5J7E A;  2IA2 A;  3D3O A;  1GSV A;  3LID A;  5C5K A;  3LYX A;  3UB7 A;  1W63 M;  2WKQ A;  3FG8 A;  3F1P B;  4I38 A;  2LB5 A;  1W63 Q;  5HDD A;  4EES A;  1KOU A;  2W3D A;  4L9E A;  3LUQ A;  5HL6 A;  4BBU A;  3E98 A;  4YWZ A;  4JGP A;  2PYR A;  3UE6 A;  3A0S A;  4R38 A;  4EXO A;  4CQH A;  3MQ0 A;  1TS6 A;  3F1O A;  4PAU A;  4FSF A;  2Z6D A;  1F5M A;  2L4R A;  4R70 A;  3EGX C;  1LL8 A;  5J3W A;  3OLO A;  2XSS A;  4IUH A;  1T19 A;  2NUP C;  4ETZ A;  1TF1 A;  3T4J A;  2W27 A;  5DJT A;  3CLO A;  4GJ4 A;  1GSX A;  1TD5 A;  2L1M A;  4WUJ A;  3KO6 A;  2A2L A;  5HWW A;  3RFB A;  5F5Y A;  2PR6 A;  3MXQ A;  4HNB A;  4LRX C;  3GDI A;  2JN7 A;  5I5L A;  3G6O A;  3SW1 A;  3ZYT A;  2B02 A;  4EET B;  3KX0 X;  1S1Y A;  4UQI S;  3PBQ A;  3MJQ A;  1YSQ A;  2OAQ 1;  2PR5 A;  1D06 A;  4KQD A;  3EEA A;  1XJ4 A;  2P08 A;  2VX8 A;  4XT2 A;  5HD3 A;  5DFX A;  1JNU A;  3HJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...