1DP8A

Crystal structure of the nitric oxide bound fixl heme domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
b'PDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIXL PROTEIN
publication title New mechanistic insights from structural studies of the oxygen-sensing domain of Bradyrhizobium japonicum FixL.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Oxygen storage/transport
total genus 29
structure length 118
sequence length 118
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1999-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1dp8A00
3OLOA 4RQ9A 5EFWA 2VV7A 2B02A 2W27A 4E04A 4LRXC 2P7JA 4EETB 2PD8A 1GSXA 1DP8A 1TS8A 3LIEA 3CAXA 4WUJA 5TBMB 1EW0A 5TBMA 4MN6A 1N9OA 4JGOA 3HJKA 4EQ1A 2J80A 1T18A 2V0WA 5J7EA 1F98A 4I3JA 2VV6A 1T1CA 1N9NA 2L4RA 4GW9A 3C2WA 2BASA 5IU1A 1VB6A 3T50A 3UB7A 4EEUA 2OWJA 5KIZA 4JGQA 3K3DA 5F5YA 1DP9A 5HDDA 4EEPA 4M4XA 5F68A 4BBTA 1OTDA 4HHDA 4HP4A 2A24A 5AVFA 3LIAA 1XFNA 1OJ5A 3A0VA 1OTEA 4NXFA 4EESA 1S1YA 5IS1A 5HDSA 1XJ2A 5HDCA 3NHQA 1UGUA 3H9WA 4HH3A 3UE6A 4R70A 4LRYC 2D01A 3BWLA 5A8BA 1XJ3A 4BBVA 3F1OB 4I3AA 1N9LA 1UWPX 3F1OA 4KUOA 2I9VA 2V1BA 4HI4A 3FG8A 2H28A 2QWSA 4K08A 1LT0A 2ZOIA 3MQQA 2K7SA 3F1PB 4LPZA 3CLOA 1S1ZA 1GSWA 3F1PA 2V0UA 3H82B 2M1CA 3HJIA 2PYRA 4HH2A 3H82A 3PHYA 4GCZA 1OJGA 2V1AA 3MFXA 4GS9B 4LRZE 4R3AA 2PR5A 4GS9A 3MJQA 4L9EA 4HQAA 4BBUA 4LLOB 5J3WA 5F69A 4R6LA 2ZOHA 3LUQA 4I5SA 2CMNA 3LIBA 4WL9A 4NXEA 2QJ7A 4HJ6A 4WLAA 4KUKA 1MZUA 1S66L 2HV1A 1D06A 3UB8A 1V9YA 3K3CA 1OT9A 4H6JB 2PD7A 3LIDA 1V9ZA 5DJUA 1XFQA 3FC7A 1UWNX 3SW1A 5DJTA 3P7NA 2YKHA 4I39A 5G4YA 4DJ2A 5HD5A 4F3LB 1ODVA 3UB9A 4DJ3A 1TS7A 4HJ3A 4MN5A 4F3LA 3NJAA 4GHIB 4PKYA 3D72A 3ZQ5A 4I3IA 4GHIA 3NOTC 1JNUA 3E4OA 5HSQA 1KOUA 1BYWA 3GECA 5HWVA 3GDIA 3EWKA 3VE4A 1XJ4A 2L1MA 4EW7A 1X0OA 1S67L 2Z6CA 2PHYA 2VEAA 1F9IA 1WA9A 3BY9A 4HY8A 1T1BA 3MR0A 1OTBA 2JHEA 3IBRA 4XT2B 4NXBA 1P0ZA 5F6AA 3EEHA 4EERA 3H7WB 3F1NB 3MXQA 3H7WA 3F1NA 4L9GA 3CWFA 1S4SA 5J4EA 4HOIA 3LYXA 1LSXA 2KX6A 3IS2B 4YWZA 3RH8B 2JN7A 3RTYA 3G6OA 2D02A 4KQDA 1T1AA 4HP9A 2QJ5A 3IS2A 3UB6A 1DP6A 3NOPC 4I38A 2WKRA 5I5LA 4R38A 3A0SA 2ZBBA 3UMDA 3KX0X 3E4PA 1DRMA 5HZHA 2WKPA 4WN5A 5G4ZA 3VOLA 2INWA 4L9FA 4H6JA 1S4RA 3A0RA 1LSVA 3MQOA 4EXOA 4HJ4A 3NOUC 1D7EA 2GJ3A 2VV8A 3LIFA 2W0NA 5DKLA 4NXGA 4HNBA 2A24B 4B9OA 2OWHA 2YKFA 5HWTA 5AVEA 2VLGA 2PYPA 1Y28A 3ICYA 1LL8A 2PDRA 1XJ6A 3B33A 1GSVA 1OTAA 3LI8A 3UMEA 3BY8A 4JGRA 1TS6A 3VE3A 3PYPA 2QHKA 2Z6DA 5HWWA 1T19A 5DKKA 4HIAA 3LI9A 2QKPA 3C8CA 3LICA 1TS0A 3ULFA 1OTIA 2R78A 2V9AA 1OT6A 5HD3A 4PKYG 4JGPA 1NWZA 2OOLA 4XT2A 2WKQA 2EA9A 1LSWA 2PR6A 1P97A 2L0WA 1G28A 2KDKA 4WF0A 3E4QA
chains in the Genus database with same CATH superfamily
3N8LA 1W79A 1SKFA 3OLOA 3ISGA 5FQKA 1K0KA 4JBFA 4YNRA 5EOEA 3T4TA 4UAAA 3G4PA 3PBRA 1K57A 1TS8A 3LIEA 3CAXA 3OCNA 2HZ5A 2ZQ8A 3LCEA 4Y0TA 5HW3A 3GVBA 3HJKA 5AQAA 1PWGA 1RGYA 1K54A 2JC7A 4EQ1A 1Z6FA 2V0WA 2Y2OA 1DJBA 4LENA 3TG9A 3O86A 5L07A 4CLCC 3MF0A 4P6ZS 1IEMA 4PAUA 5EVIC 5KMWA 1HZOA 4G3VA 1PI4A 4KZ3A 2EX6A 3C2WA 3WRTA 3OBFA 3N7WA 4P6ZM 4X1MA 5MC7A 4Y2FA 3UB7A 3DW0A 1BLSA 4JGQA 2ZQAA 4EEPA 1OMEA 5F68A 3W8KA 1GHIA 4E3OA 5DTTA 1K55C 5CXWA 2VK3A 1XFNA 5FQ9A 1VM1A 5CHJA 4S2LA 4NXFA 1S1YA 3BYDA 5IS1A 2EWWA 3IF5A 1XJ2A 4UA6A 2HP5A 2VGLS 3WS1A 2D01A 3G34A 5A8BA 2W3GA 2J3TC 4JF4A 1JVJA 4S2KA 4I3AA 4X25A 1EI5A 2VGKA 4JPMA 4P85A 3MS6A 4KUOA 3SS3A 2V1BA 1TDLA 1ESIA 2Y59A 4S2IA 3DBAA 1W5DA 2OAP1 4KZ7A 4B4ZA 4LPZA 1NZOA 4EUVA 3CLOA 2XA7S 4O0PA 4OQGA 4OQIA 1MXOA 4N1XA 2WUQA 3P98A 3UPNA 2I72A 4HH2A 4E3JA 3PHYA 1EROA 4X53A 2OAQ1 3O3VA 4BL3A 1OJGA 2V1AA 3P09A 4GS9B 3BEBA 5G18A 5GLCA 4ZJ1A 4IJGA 3N4IA 1ZC2A 4L9EA 4HQAA 1BSGA 1MWRA 4E3IA 5CX7A 5J3WA 2P9VA 3V5MA 1PNEA 5EUAA 4GN2A 1IFQA 4DMZA 4IVIA 4KG5A 4Q0HA 3IX4A 1MZUA 4GZBA 3UB8A 5FQJA 1XA7A 3G2YA 1V9YA 3TSGA 1OT9A 4L0LA 4GB7A 4MLLA 3LIDA 5EE8A 5DTKA 1V9ZA 5GHZA 1YLTA 3HLCA 5CEDA 4RX3A 3GQZA 2O0YA 3W4OA 1IKGA 1NRJA 5G4YA 2W3FA 2HJ9C 1DJAA 4CLCA 5EVIA 3BLMA 2K2NA 2Z2MB 1IYOA 1KGEA 5HD5A 2FFYA 2XDMA 1ODVA 4U3TA 4DJ3A 5GL9A 2RL3A 1L0DA 4HJ3A 4KZ5A 4MN5A 4LCLA 4OQ0A 3NJAA 4R0QA 1TD5A 3KSHA 2W3DA 5FA7A 3Q7VB 4NEED 4Y7PA 4WZ5C 3ZNYA 4R23A 3NI9A 1BULA 4M3KA 1VEUB 1YKDA 1IELA 3BM6A 2HP9A 2WGWA 5HPIA 5HWVA 3VP0A 1K55A 3CZDA 1P9WA 2L1MA 5TFQA 1DJCA 4FUWA 3RFBA 2H0TA 1BZAA 4EW7A 1X0OA 1S67L 4GDBA 2Z6CA 5F1GA 1F9IA 1WA9A 2NUTC 3FZCA 3CHWP 4IUHA 2WKHA 4NXBA 1ONGA 1TDGA 5GLAA 4FOFA 3EEHA 2C5WB 3QP4A 1F2KA 5F1FA 2DNSA 4DRTA 2Y2QA 4R4RA 4Q0JA 5E2HA 3FKVA 3H7WA 3SH8A 3F1NA 1G5UA 4OLDA 2ZQ9A 4KZ9A 1S4SA 4PM5A 3MZFA 5J4EA 2ZL1A 1L0GA 5K5BA 2HF6A 1CQAA 1MWSA 3LFVA 4C6YA 1ZKJA 3N6IA 4LV0A 4OPZA 1FSYA 2EX8A 3IS2A 1DP6A 1D1JA 3NOPC 3VSKA 5I5LA 2BLSA 2Q9MA 3U2AA 3NC8A 3T4SA 3UDFA 3VOYA 3E98A 1K56A 3ZDJA 5HZHA 4MBKA 5HAQA 2WKPA 4LV3A 1MWTA 3AGDA 3IQAA 1TVFA 5FATA 4DKIA 1YPRA 2R9WA 3S22A 3NOUC 4X56A 3IF6C 1LLBA 4CLCD 2XSSA 1ZG6A 5DKLA 4NXGA 5EVID 3BFCA 3TW8A 4OPRA 4PHTA 3V3SA 3HBRA 1E3UA 4KZBA 4MEZA 3SZTA 4PM7A 3E2KA 1JWPA 4S2NC 3GTCA 3ICYA 5HAPA 3T1RA 1XP4A 3IWQA 4GD8A 4JGRA 3P01A 1N9BA 3C38A 4HBTA 1WYCA 4DDYA 2WKEA 2GNXA 4HIAA 4XXRA 2ZLYA 3LI9A 5A92A 1NXYA 5FDHA 5HD3A 4PKYG 1H0MA 4WZ5A 2XRNA 5FI2A 2NUPC 2OOLA 2EA9A 1LSWA 2PR6A 3MFDA 2JKRI 1HTZA 1LL9A 3HUNA 5EPHA 3GSGA 1N4OA 2FH5A 4OOLA 2VV7A 2W27A 4E04A 2P7JA 5GLDA 3WWXA 1K6SA 1NLYA 3N8RA 4EETB 5AQ7A 3PBNA 1YQSA 2G2WA 1DP8A 3IX3A 2X71A 5TBMB 1EW0A 3EGXC 4D2OA 3OZHA 4MN6A 4DXCA 1BUEA 2Y2MA 5CGSA 4MBHA 4JGOA 3C4PA 3QP1A 4E3NA 1CF0A 3AGEA 2J80A 4IEDA 4ZDXA 2ZC4B 5J7EA 2GDNA 4BJPA 2VV6A 3V67A 5TGFA 4UQIM 1N9NA 4KQRA 1CK3A 4GW9A 4EV4A 3CI6A 2H10A 4RYEA 5IU1A 1VB6A 1I5QA 5KIZA 3NIAA 1IYQA 4HP4A 3Q07A 4CLCB 2A24A 3UPOA 2HPBA 5EVIB 3V50A 4QWOA 1MPLA 4XUXA 5AVFA 4XUZA 2M7UA 3UDIA 1G6OA 4Y0OA 1OPXA 3GR2A 4IBRA 3FPVA 1OTEA 4FTXA 3O87A 4BD0A 1HD8A 3HLDA 3IF6A 3E0YA 4PMAA 3NHQA 1UGUA 1PZPA 3H9WA 4HH3A 4MBFA 2Y2IA 4UA7A 3UE6A 2XD5A 1ACFA 4WMCD 2PT7A 3IH8A 2WGWB 4ETXA 4S2NA 3F1OA 3EGDC 3ZCZA 2PBDP 4OP8A 1XGJA 3IHAA 2ZOIA 2ACGA 4HESA 2K7SA 1IYPA 3N8SA 3K2NA 1GSWA 3F1PA 4NKPA 2V0UA 1O7EA 3BFGA 1VQQA 3H82B 4X1LA 3RXXA 4DE3A 2Y2PA 3CG5A 2OLUA 5CHMA 3KO6A 3NY4A 2OSUA 3B42A 3MZDA 1LHYA 3MSHA 4GCZA 2ZC3B 4KG2A 3SH7A 2JBFA 2ZL1B 5AJGA 3NCKA 5FSRA 3T4JA 2A2LA 1HVBA 2EXBA 2UV0E 4BQMA 1M40A 3S7NA 4BBUA 4O01A 4LLOB 4R6LA 3HLFA 1RGZA 3CPTA 2O9BA 1FILA 4DDSA 2QJ7A 3HLWA 2W1RA 3OPRA 4HJ6A 4WLAA 2G2UA 4KENB 3HL9A 5I94A 3K3CA 4Y5FA 5E2EA 3ZG0A 3ZFZA 5HL1A 2Y79A 2Y8HA 1MY8A 1XFQA 2IWBA 5DJTA 2YKHA 3HREA 2XH9A 3LY3A 3OOVA 1I2SA 4R3BA 4DJ2A 4QB8A 2P04A 2WGIA 1F5MA 4JXSA 4F3LB 4RX2A 3L9KA 5E43A 2VX8A 4ARZB 4X6TA 3SS4A 3T4QA 4LGWA 2WKIA 3D72A 2JKRM 2J9OA 4GHIA 1JNUA 4ZBEA 3IH9A 5HSQA 1KOUA 2XLNA 3GECA 4LFUA 3EQUA 3LEZA 5J8XA 1E25A 4KZ4A 3UB5P 4EBPA 3UDXA 3DTEA 3IXDA 1PYYA 2WK0A 4EBLA 3MBZA 1FCMA 5DF8A 1XA1A 1T1BA 3MR0A 4R4SA 1S6RA 1J9MA 3VP4A 3Q81A 2P74A 4OOYA 4MDZA 2B5RA 3T4LA 5HX9A 1FCOA 4EERA 3MXQA 1YT4A 3MKFA 4OH0A 5DVAA 2HDSA 1NYYA 5BOHA 4EUZA 3PAEA 3QP6A 3DWZA 1G68A 3UNWA 3DTKA 5L8MA 2KX6A 1KVMA 1FOFA 2WAEA 4YWZA 3UE3A 2JN7A 4U0XA 1XXMA 3PBTA 1FR6A 1T1AA 1YLZA 2QJ5A 2VZWA 5KSCA 4WYYA 2X02A 3SOIA 3HUOA 2V1ZA 3HLEA 3ZVTA 1L2SA 5M1AA 2ZBBA 3NBLA 2KOIA 1HLUP 3M2JA 3RXWA 4FH2A 1RP5A 3KX0X 1MKIA 3E4PA 1DRMA 2XK1A 4Q0IA 3T4OA 5G4ZA 1ES3A 5GHYA 5TJJA 3VOLA 3LR3A 4H6JA 1IOUA 2MJ6A 3A0RA 2JCHA 3UPPA 1LI9A 2ZD8A 4EXOA 3D3OA 1YLYA 1PIOA 4HEFA 3NECA 5DFYA 1D7EA 4UA9A 1VHMA 2O9CA 3A3FA 1XX2A 1CJFA 2GJ3A 3LIFA 4X69A 2XGNA 2W0NA 1VETA 2A24B 2OWHA 5HWTA 2JE5A 4MCWA 4IHQA 1KE0A 1Y28A 1LL8A 1SZVA 1GSVA 1A0KA 3BRMA 3IF6B 2ZQ7A 2HDQA 4QPRA 3PYPA 2QHKA 3LR4A 3MZEA 4PPRA 4B93A 4GKUA 5DF7A 1ES2A 5M19A 3HCYA 1ERMA 2DMWA 1OTIA 2HP6A 2R78A 3WRZA 1OT6A 2XF3A 1ES4A 1PW1A 4E3MA 4XT2A 4YINA 2LB9A 2JKTI 2WKQA 4AFIA 1P97A 4OPYA 1PZOA 2L0WA 2KDKA 3QP5A 2R9XA 4KZ6A 2HDUA 2GX5A 3CJMA 5M18A 4S2JA 4X68A 1SCWA 2B02A 4E3LA 4LRXC 1J3WA 4EQIA 2IA2A 4FSFA 1G6AA 4BL2A 3G35A 4GJ4A 4DXBA 4GDNA 2VKSA 3FWLA 3IWOA 1YAXA 5E2FA 5DTSA 4H8RA 4IUKA 3MQ0A 3WS2A 3C7UA 1RCJA 3G30A 2WGVA 1T18A 1F98A 2EX9A 3WS0A 1H8YA 2Y2NA 3JPUA 2J9PA 1GHPA 2VA0A 1KE3A 1T1CA 4Y3IA 3ZYTA 2Q0OA 2L4RA 4JF6A 1QMEA 5TR7A 3HVFA 3T50A 4EEUA 4OONA 2OWJA 5AQBA 3S7QA 3K3DA 4Z9QA 1DP9A 4P6BA 1SHVA 4HHDA 4BBTA 2M7VA 2V2FF 4JLFA 2H0YA 4Z1WA 4U0TA 3GMWA 5DF9A 1W7FA 4G3WA 3NULA 2Z2LB 3LIAA 4X55A 1OJ5A 5F83A 3A0VA 3IBJA 4UHUA 1GA9A 1K4FA 1GCEA 4EESA 3QHYA 3G31A 5HDCA 1PI5A 3LR0A 3BFFA 4K0WA 3C4OA 5A91A 1STZA 3LGOA 3M6HA 1EWZA 5IHVA 2ZQCA 4R70A 2HJEA 4LRYC 4OQHA 3BFDA 3BWLA 3NDEA 1XJ3A 4BBVA 5CEBA 5JYOA 3JYIA 1UWPX 4KG6A 4ZRRA 1CEGA 3TE8A 5FEGA 4HI4A 2ZMAA 2QWSA 4K08A 2ZM8A 2WYXA 2ZMVA 3S7OA 2J3TD 2W3HA 4R3JA 1CI8A 1S0WA 2M1CA 3BLSA 4ZJ2A 3FKWA 1L0FA 5L09A 5FAQA 3OPHA 2J8YA 1YSPA 3DWKA 4LRZE 2OLVA 2PR5A 4GS9A 3MJQA 2V8FA 2QZ6A 1XKZA 4S2MA 4DE1A 5EVEA 2P9VB 2G7UA 4UQIS 4CQHA 3VFHA 4S2OA 2HGVA 4OP5A 3EOIA 3LR5A 1K56D 4WL9A 4NXEA 3D9YA 4BD1A 3DTMA 4K0XA 1KGFA 2ZJ9A 3GRJA 4WBGA 4KUKA 4F94A 5FAPA 1S66L 3R7WA 3CITA 3ITBA 1PFLA 4E6WA 4H6JB 4Y13A 5CTNA 2PD7A 1XGIA 5DJUA 4ZJ3A 1IYSA 4CLCE 1UWNX 3JVVA 2B18A 3UN7A 5HARA 3C30A 1E3UD 4EU0A 1W8QA 2XFSA 3A3JA 5KZHA 5CGXA 2A3UA 3M2KA 3MKEA 3IHBA 5CRFA 3C5AA 1YLPA 1PRQA 2KLIA 1NZUA 4PKYA 2JKTM 3ZQ5A 2PU2A 2GZAA 4GOGA 3OPPA 3Q7VA 3E4OA 3FV7A 1ZTUA 1YLJA 1IKIA 4EWFA 3OC2A 3V39A 4A5RA 5FL3A 3KSGA 4UEYA 2Q9NA 1ZHHB 4O8GA 5EVLA 1FR1A 5A93A 2BTFP 1SKOA 2IWCA 3BY9A 1GHMA 4LCMA 2ZC7A 3T1XA 5E2GA 4XT2B 3KYQA 1P0ZA 4II7A 3PR6A 5F6AA 2XD1A 4P0MA 1W63Q 3H7WB 4DE0A 3F1NB 4O7DA 2B95A 3UO9A 2RCXA 2Y4AA 1NRFA 4C75A 4L9GA 3CWFA 1LL5A 4HOIA 4GD6A 1PW8A 2IWDA 3IS2B 2Y2KA 3RH8B 3IX8A 3RTYA 3DTIA 1L3LA 4HP9A 5FQIA 3MXRA 3BQAA 1Q2QA 2JKGA 1M6KA 3RJUA 4R38A 3FPWA 4DF6A 5D3OA 3A0SA 1W8YA 3ZG5A 2C6WB 4QJGA 5EV0A 1BLCA 3IWIA 3B47A 4WN5A 1O07A 2INWA 1NJ4A 2ZC5B 3HLBA 1AWIA 2WZXA 5FQMA 3UE0A 2J3WA 4KQQA 4WEKA 4HJ4A 3TOIA 5FEFA 1SDNA 5IT5A 1ZG4A 2VV8A 3JVUA 5CECA 4N92A 4B9OA 3BFEA 4ME4A 1K25A 4Y0UA 2VLGA 2PYPA 3EQVA 2EX2A 3PBQA 3S4XA 3U4LP 4BWIA 1P9RA 2PDRA 1XJ6A 1OTAA 3BY8A 4IVKA 1TS6A 4NG2A 3VE3A 4ETZA 4DN0A 2QMIA 2Z6DA 5HWWA 1T19A 2XFTA 5DKKA 3HUMA 3BECA 3WS5A 4CJNA 3M6BA 2H5SA 2W1TA 3VMAA 1TS0A 3ULFA 4PM9A 2ZM2A 1JTDA 2VGLM 1NY0A 3Q82A 3V3RA 4JGPA 5A90A 1YSQA 5FDSA 2WZZA 1AXBA 3PBSA 3Q7ZA 5CTMA 3E4QA 4RQ9A 3T12B 5EFWA 2O99A 4WM9A 2XA7M 3DAVA 3LEQA 1DY6A 3CUEC 4Q8IA 2PD8A 1GSXA 5GHXA 1GA0A 3VP1A 1WYBA 1NLZA 4WUJA 1H3QA 4CPKA 2V8CA 5TBMA 3ZG9B 4QHCA 1N9OA 2Y91A 3W4PA 2PU4A 1FQGA 2FFFB 4I3JA 2OV5A 3ITAA 4GNUA 3IXGA 3R7WB 4QY6A 5FAOA 2HDRA 2BASA 3W2ZA 3A3DA 2K31A 3OCLA 3T1SA 1FCNA 5FI6A 5KSHA 3SS5A 5F5YA 5HDDA 4M4XA 1U60A 1OTDA 3UE1A 3ZG8B 1Y54A 1CI9A 3VFFA 4MMNA 1MBLA 2Y2GA 4ZTKA 5C5KA 3O5YA 5HDSA 3T1QB 1MWUA 3S1YA 3BJNA 4WELA 1BLPA 1Y4OA 5F82A 2QYBA 4RA7A 2DCFA 3QP2A 3G32A 1FSWA 3D4FA 4QD4A 4OOMA 5JYPA 3F1OB 1N9LA 1L0EA 4EBNA 3EEAA 5EOOA 2I9VA 4R1GA 3FG8A 2H28A 4OPQA 1LT0A 1SKOB 1TF1A 3MQQA 4YOFA 1BT5A 2ZC6B 3F1PB 2V20A 4K91A 1S1ZA 4YFMA 1I2WA 5EM1A 3G2ZA 5L10A 2BG1A 3HJIA 3VSLA 2PYRA 3E2LA 3H82A 1JTGA 4LV1A 3T4KA 2XROA 1Z09A 1FIKA 5FI7A 4C3QA 3MFXA 4FCFA 3GV9A 4R3AA 3O88A 3HLGA 4OLGA 4N9KA 3CPTB 3R4KA 4BMWA 4ID4A 4BLMA 5F69A 1YMSA 2ZOHA 3LUQA 4I5SA 2CMNA 4JXGA 3LIBA 5CGWA 5EECA 5EM0A 3CUEA 4S2PA 1C3BA 4NETA 1H8MA 4JKTA 2HV1A 1D06A 4E3KA 5DFXA 1K4EA 1KGGA 4HBUA 3FC7A 3SW1A 2PRFA 4QY5A 4ZAMA 3P7NA 4I39A 1NYMA 2ZQDA 4QU3A 1LI0A 1W63M 3UB9A 1ALQA 1ERQA 1TS7A 4BENA 4DE2A 4F3LA 3A3EA 5HPFA 3IXBA 2ZMFA 4GHIB 4ARZA 4I3IA 2UWXA 3NOTC 1BTLA 4P87A 5CHUA 1BYWA 3L7HA 3WS4A 3GDIA 3EWKA 3NDGA 3VE4A 1XJ4A 4WMCA 3VP3A 1K6RA 3ZHHA 4G3KA 4KZAA 2XQZA 2W1TB 2PHYA 3A3IA 2VEAA 2Y2JA 3ZG7B 4HY8A 1ESUA 2A49A 4FH4A 4B4XA 1K57C 2EXAA 1OTBA 1KE4A 2FZ0A 2JHEA 3IBRA 1KDWA 4KQOA 2WADA 2ZM0A 4LV2A 4FD8A 3TJZC 2Y2HA 3QNCA 1KVLA 1MKMA 5LBRA 2CC1A 1K54C 1YLWA 3MMHA 3MXSA 3VP2A 5FASA 4GLQA 4ESPA 1H5XA 2P08A 4JXWA 1YM1A 4RVAA 5HL6A 3LYXA 1LSXA 4WEJA 4JF5A 3CMZA 4OKPA 1WE4A 2JKFA 2J7VA 3G6OA 2D02A 4KQDA 1H8ZA 3UB6A 4B88A 3VOZA 5CERA 3S7PA 4I38A 2WKRA 1QMFA 3IT9A 4PM6A 3PXPA 1CEFA 4N1HA 3IXHA 3BQ8A 3PTEA 4NK3A 4KZ8A 3W4QA 3BW6A 4JXVA 3UMDA 4D60A 1XPBA 2XR0A 4PM8A 4IBXA 2E8JA 4L9FA 4MNRA 2LB5A 2WAFA 3QP8A 4Y17A 3ZVWA 5U47A 1SDEA 1S4RA 1Q2PA 1ONHA 3KYZA 1LSVA 3MQOA 2E8IA 5GLBA 5HFOA 3LY4A 1K38A 3KSFA 1VETB 2W3EA 5HAIA 5AQ9A 3AGFA 2AVXA 3UY6A 3PAGA 4HNBA 2YKFA 3B3XA 1YMXA 5FQQA 2QPNA 5AVEA 1MC0A 2DRWA 3B33A 3VV4A 2PAVP 3LI8A 3UMEA 3KSIA 3KYEA 5L2FA 1PWCA 1VEUA 1JWVA 2EFUA 3QNBA 4OVDA 2Y2LA 2X01A 4WZ4A 3Q1FA 2EFXA 4Y15A 1ES5A 3PBOA 2QKPA 3C8CA 3LICA 3TRCA 1JWZA 3ZNTA 1TEMA 3SH9A 4E6XA 2O9AA 1PWDA 2V9AA 2VGJA 2XEPA 4N9LA 2PBYA 3C7VA 1KDSA 1BLHA 1NWZA 2VJWA 3I7JA 3ZGAB 2Y55A 1E4DA 3LO7A 2EWVA 1G28A 4WF0A 3FYZA 3OPLA 4MN7A
chains in the Genus database with same CATH topology
2GX5A 3OLOA 4RQ9A 5EFWA 2O99A 4YNRA 2FH5A 4OOLA 3T4TA 2VV7A 2B02A 2W27A 2XA7M 4E04A 4LRXC 2P7JA 1NLYA 4EETB 2IA2A 3PBNA 3PBRA 4FSFA 3CUEC 2PD8A 1GSXA 1DP8A 1TS8A 3LIEA 3CAXA 4GJ4A 1NLZA 4WUJA 5TBMB 1H3QA 2VKSA 1EW0A 3EGXC 1YAXA 3OCNA 5TBMA 4MN6A 1N9OA 4JGOA 4IUKA 3MQ0A 3HJKA 4EQ1A 2J80A 1T18A 2V0WA 5J7EA 1F98A 4CLCC 4I3JA 3MF0A 4BJPA 2VV6A 4P6ZS 2VA0A 4PAUA 1T1CA 3V67A 4Y3IA 3ZYTA 4UQIM 1N9NA 2L4RA 4G3VA 4GW9A 3R7WB 3C2WA 3CI6A 3OBFA 2BASA 4P6ZM 5IU1A 3W2ZA 1VB6A 5MC7A 4Y2FA 3T50A 3UB7A 2K31A 3OCLA 4EEUA 2OWJA 5KIZA 3S7QA 4JGQA 5KSHA 3K3DA 5F5YA 1DP9A 5HDDA 4EEPA 4M4XA 5F68A 4BBTA 1OTDA 4HHDA 4HP4A 2M7VA 4CLCB 2A24A 4Z1WA 5DF9A 5AVFA 4G3WA 2M7UA 3LIAA 1G6OA 1XFNA 1OJ5A 1OPXA 4MMNA 3A0VA 3IBJA 3FPVA 1OTEA 4NXFA 4EESA 1S1YA 5IS1A 2EWWA 5C5KA 3O5YA 5HDSA 1XJ2A 5HDCA 3E0YA 3LR0A 3NHQA 1UGUA 3BJNA 3H9WA 4WELA 4HH3A 1STZA 3UE6A 2QYBA 4R70A 2VGLS 2HJEA 4LRYC 2D01A 2PT7A 3BWLA 5A8BA 2W3GA 2J3TC 4OOMA 1XJ3A 4BBVA 4ETXA 3F1OB 4I3AA 1N9LA 1UWPX 4ZRRA 3EEAA 3F1OA 4KUOA 2I9VA 3EGDC 3TE8A 2V1BA 4HI4A 3FG8A 2H28A 2QWSA 4K08A 3DBAA 2ZMVA 3S7OA 1LT0A 2ZOIA 1TF1A 3MQQA 2OAP1 4YOFA 2J3TD 2K7SA 3F1PB 4LPZA 4EUVA 3CLOA 2XA7S 4O0PA 1S1ZA 3K2NA 1GSWA 3F1PA 4NKPA 2V0UA 2W3HA 3H82B 2M1CA 3HJIA 2PYRA 4HH2A 3H82A 3KO6A 3B42A 3PHYA 3T4KA 4GCZA 2XROA 2OAQ1 1OJGA 1YSPA 2V1AA 3MFXA 4GS9B 4LRZE 5AJGA 4R3AA 2PR5A 4GS9A 3MJQA 3T4JA 2A2LA 4IJGA 4L9EA 3S7NA 4HQAA 4BBUA 2G7UA 3R4KA 4O01A 4UQIS 5CX7A 4BMWA 4CQHA 2HGVA 4LLOB 5J3WA 5F69A 4R6LA 2ZOHA 3LUQA 4I5SA 3EOIA 3LR5A 2CMNA 3LIBA 4WL9A 2O9BA 4NXEA 3CUEA 2QJ7A 2W1RA 1IFQA 4DMZA 4HJ6A 4WLAA 4KUKA 4Q0HA 1H8MA 1MZUA 1S66L 3R7WA 2HV1A 1D06A 3CITA 3UB8A 1V9YA 3K3CA 1OT9A 4H6JB 4L0LA 4Y5FA 5DFXA 2PD7A 3LIDA 2Y79A 1V9ZA 2Y8HA 5DJUA 1XFQA 3FC7A 4CLCE 1UWNX 3JVVA 3SW1A 2B18A 5DJTA 2O0YA 3P7NA 2YKHA 1NRJA 4I39A 5G4YA 2W3FA 2HJ9C 4CLCA 3OOVA 3C30A 4EU0A 4DJ2A 2K2NA 2P04A 1F5MA 1W63M 5HD5A 4F3LB 1ODVA 3UB9A 4DJ3A 1TS7A 4HJ3A 4MN5A 4F3LA 5HPFA 2ZMFA 3NJAA 1TD5A 2VX8A 3KSHA 4ARZB 2W3DA 4GHIB 2KLIA 3T4QA 4PKYA 2JKTM 3D72A 3ZQ5A 4ARZA 2JKRM 4I3IA 4NEED 4GHIA 2GZAA 3NOTC 1JNUA 3E4OA 5HSQA 1YKDA 1KOUA 1BYWA 1ZTUA 3GECA 5HPIA 5HWVA 3EQUA 3GDIA 3OC2A 3EWKA 3VE4A 1XJ4A 5FL3A 3KSGA 1P9WA 2L1MA 4UEYA 1ZHHB 4G3KA 4O8GA 3RFBA 2W1TB 4EW7A 1X0OA 1S67L 2Z6CA 2PHYA 2VEAA 1F9IA 1WA9A 2NUTC 3BY9A 4HY8A 4IUHA 1T1BA 3MR0A 1OTBA 2FZ0A 2JHEA 3IBRA 4XT2B 4NXBA 3KYQA 4KQOA 1P0ZA 4II7A 3PR6A 4MDZA 5F6AA 4FOFA 3EEHA 3T4LA 4EERA 1W63Q 3H7WB 3F1NB 3MXQA 3TJZC 4Q0JA 3H7WA 3F1NA 1MKMA 5LBRA 3MMHA 4L9GA 3CWFA 4GLQA 1S4SA 2P08A 5J4EA 4HOIA 5HL6A 5K5BA 3LYXA 5L8MA 1LSXA 2KX6A 2HF6A 4WEJA 3LFVA 3IS2B 4YWZA 3RH8B 3UE3A 2JN7A 3RTYA 3PBTA 3G6OA 2D02A 4KQDA 1T1AA 4HP9A 2QJ5A 2VZWA 3IS2A 3UB6A 3BQAA 1DP6A 3NOPC 3S7PA 4I38A 2WKRA 5I5LA 4R38A 3FPWA 3PXPA 3A0SA 3BQ8A 3U2AA 2ZBBA 2KOIA 3BW6A 3T4SA 3UMDA 3KX0X 3E4PA 1DRMA 3E98A 5HZHA 4Q0IA 3B47A 3T4OA 2WKPA 4WN5A 5G4ZA 5TJJA 2INWA 4L9FA 3VOLA 3LR3A 2LB5A 4H6JA 1IOUA 1S4RA 2MJ6A 3KYZA 3A0RA 1LSVA 3MQOA 2J3WA 4EXOA 3D3OA 4WEKA 4HJ4A 3NOUC 3KSFA 5DFYA 1D7EA 5IT5A 1VHMA 2W3EA 2O9CA 2GJ3A 2VV8A 3LIFA 4CLCD 2XSSA 3JVUA 2W0NA 5DKLA 4NXGA 4HNBA 2A24B 3TW8A 4B9OA 2OWHA 4PHTA 2YKFA 4ME4A 5HWTA 5AVEA 4MCWA 1MC0A 2VLGA 2PYPA 4IHQA 3EQVA 3PBQA 1Y28A 3ICYA 4BWIA 1LL8A 1P9RA 2PDRA 1XJ6A 3B33A 3VV4A 1GSVA 1OTAA 3LI8A 3UMEA 3BY8A 3KSIA 4JGRA 3P01A 1TS6A 3VE3A 4ETZA 4DN0A 4QPRA 3C38A 3PYPA 2QHKA 3LR4A 2Z6DA 5HWWA 1T19A 5DKKA 4B93A 2GNXA 4HIAA 3HCYA 3LI9A 3PBOA 2W1TA 2QKPA 3C8CA 3LICA 3TRCA 1TS0A 3ULFA 2DMWA 1OTIA 2VGLM 2O9AA 2R78A 2V9AA 1OT6A 5HD3A 4PKYG 2XRNA 2NUPC 4JGPA 1NWZA 2VJWA 2OOLA 4XT2A 1YSQA 2LB9A 2JKTI 2WKQA 2EA9A 1LSWA 2PR6A 2JKRI 1P97A 4AFIA 2L0WA 2EWVA 1G28A 2KDKA 4WF0A 3PBSA 3E4QA 4MN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OLO A;  4RQ9 A;  5EFW A;  2VV7 A;  2B02 A;  2W27 A;  4E04 A;  4LRX C;  2P7J A;  4EET B;  2PD8 A;  1GSX A;  1DP8 A;  1TS8 A;  3LIE A;  3CAX A;  4WUJ A;  5TBM B;  1EW0 A;  5TBM A;  4MN6 A;  1N9O A;  4JGO A;  3HJK A;  4EQ1 A;  2J80 A;  1T18 A;  2V0W A;  5J7E A;  1F98 A;  4I3J A;  2VV6 A;  1T1C A;  1N9N A;  2L4R A;  4GW9 A;  3C2W A;  2BAS A;  5IU1 A;  1VB6 A;  3T50 A;  3UB7 A;  4EEU A;  2OWJ A;  5KIZ A;  4JGQ A;  3K3D A;  5F5Y A;  1DP9 A;  5HDD A;  4EEP A;  4M4X A;  5F68 A;  4BBT A;  1OTD A;  4HHD A;  4HP4 A;  2A24 A;  5AVF A;  3LIA A;  1XFN A;  1OJ5 A;  3A0V A;  1OTE A;  4NXF A;  4EES A;  1S1Y A;  5IS1 A;  5HDS A;  1XJ2 A;  5HDC A;  3NHQ A;  1UGU A;  3H9W A;  4HH3 A;  3UE6 A;  4R70 A;  4LRY C;  2D01 A;  3BWL A;  5A8B A;  1XJ3 A;  4BBV A;  3F1O B;  4I3A A;  1N9L A;  1UWP X;  3F1O A;  4KUO A;  2I9V A;  2V1B A;  4HI4 A;  3FG8 A;  2H28 A;  2QWS A;  4K08 A;  1LT0 A;  2ZOI A;  3MQQ A;  2K7S A;  3F1P B;  4LPZ A;  3CLO A;  1S1Z A;  1GSW A;  3F1P A;  2V0U A;  3H82 B;  2M1C A;  3HJI A;  2PYR A;  4HH2 A;  3H82 A;  3PHY A;  4GCZ A;  1OJG A;  2V1A A;  3MFX A;  4GS9 B;  4LRZ E;  4R3A A;  2PR5 A;  4GS9 A;  3MJQ A;  4L9E A;  4HQA A;  4BBU A;  4LLO B;  5J3W A;  5F69 A;  4R6L A;  2ZOH A;  3LUQ A;  4I5S A;  2CMN A;  3LIB A;  4WL9 A;  4NXE A;  2QJ7 A;  4HJ6 A;  4WLA A;  4KUK A;  1MZU A;  1S66 L;  2HV1 A;  1D06 A;  3UB8 A;  1V9Y A;  3K3C A;  1OT9 A;  4H6J B;  2PD7 A;  3LID A;  1V9Z A;  5DJU A;  1XFQ A;  3FC7 A;  1UWN X;  3SW1 A;  5DJT A;  3P7N A;  2YKH A;  4I39 A;  5G4Y A;  4DJ2 A;  5HD5 A;  4F3L B;  1ODV A;  3UB9 A;  4DJ3 A;  1TS7 A;  4HJ3 A;  4MN5 A;  4F3L A;  3NJA A;  4GHI B;  4PKY A;  3D72 A;  3ZQ5 A;  4I3I A;  4GHI A;  3NOT C;  1JNU A;  3E4O A;  5HSQ A;  1KOU A;  1BYW A;  3GEC A;  5HWV A;  3GDI A;  3EWK A;  3VE4 A;  1XJ4 A;  2L1M A;  4EW7 A;  1X0O A;  1S67 L;  2Z6C A;  2PHY A;  2VEA A;  1F9I A;  1WA9 A;  3BY9 A;  4HY8 A;  1T1B A;  3MR0 A;  1OTB A;  2JHE A;  3IBR A;  4XT2 B;  4NXB A;  1P0Z A;  5F6A A;  3EEH A;  4EER A;  3H7W B;  3F1N B;  3MXQ A;  3H7W A;  3F1N A;  4L9G A;  3CWF A;  1S4S A;  5J4E A;  4HOI A;  3LYX A;  1LSX A;  2KX6 A;  3IS2 B;  4YWZ A;  3RH8 B;  2JN7 A;  3RTY A;  3G6O A;  2D02 A;  4KQD A;  1T1A A;  4HP9 A;  2QJ5 A;  3IS2 A;  3UB6 A;  1DP6 A;  3NOP C;  4I38 A;  2WKR A;  5I5L A;  4R38 A;  3A0S A;  2ZBB A;  3UMD A;  3KX0 X;  3E4P A;  1DRM A;  5HZH A;  2WKP A;  4WN5 A;  5G4Z A;  3VOL A;  2INW A;  4L9F A;  4H6J A;  1S4R A;  3A0R A;  1LSV A;  3MQO A;  4EXO A;  4HJ4 A;  3NOU C;  1D7E A;  2GJ3 A;  2VV8 A;  3LIF A;  2W0N A;  5DKL A;  4NXG A;  4HNB A;  2A24 B;  4B9O A;  2OWH A;  2YKF A;  5HWT A;  5AVE A;  2VLG A;  2PYP A;  1Y28 A;  3ICY A;  1LL8 A;  2PDR A;  1XJ6 A;  3B33 A;  1GSV A;  1OTA A;  3LI8 A;  3UME A;  3BY8 A;  4JGR A;  1TS6 A;  3VE3 A;  3PYP A;  2QHK A;  2Z6D A;  5HWW A;  1T19 A;  5DKK A;  4HIA A;  3LI9 A;  2QKP A;  3C8C A;  3LIC A;  1TS0 A;  3ULF A;  1OTI A;  2R78 A;  2V9A A;  1OT6 A;  5HD3 A;  4PKY G;  4JGP A;  1NWZ A;  2OOL A;  4XT2 A;  2WKQ A;  2EA9 A;  1LSW A;  2PR6 A;  1P97 A;  2L0W A;  1G28 A;  2KDK A;  4WF0 A;  3E4Q A; 
#chains in the Genus database with same CATH topology
 3N8L A;  1W79 A;  1SKF A;  3OLO A;  3ISG A;  5FQK A;  1K0K A;  4JBF A;  4YNR A;  5EOE A;  3T4T A;  4UAA A;  3G4P A;  3PBR A;  1K57 A;  1TS8 A;  3LIE A;  3CAX A;  3OCN A;  2HZ5 A;  2ZQ8 A;  3LCE A;  4Y0T A;  5HW3 A;  3GVB A;  3HJK A;  5AQA A;  1PWG A;  1RGY A;  1K54 A;  2JC7 A;  4EQ1 A;  1Z6F A;  2V0W A;  2Y2O A;  1DJB A;  4LEN A;  3TG9 A;  3O86 A;  5L07 A;  4CLC C;  3MF0 A;  4P6Z S;  1IEM A;  4PAU A;  5EVI C;  5KMW A;  1HZO A;  4G3V A;  1PI4 A;  4KZ3 A;  2EX6 A;  3C2W A;  3WRT A;  3OBF A;  3N7W A;  4P6Z M;  4X1M A;  5MC7 A;  4Y2F A;  3UB7 A;  3DW0 A;  1BLS A;  4JGQ A;  2ZQA A;  4EEP A;  1OME A;  5F68 A;  3W8K A;  1GHI A;  4E3O A;  5DTT A;  1K55 C;  5CXW A;  2VK3 A;  1XFN A;  5FQ9 A;  1VM1 A;  5CHJ A;  4S2L A;  4NXF A;  1S1Y A;  3BYD A;  5IS1 A;  2EWW A;  3IF5 A;  1XJ2 A;  4UA6 A;  2HP5 A;  2VGL S;  3WS1 A;  2D01 A;  3G34 A;  5A8B A;  2W3G A;  2J3T C;  4JF4 A;  1JVJ A;  4S2K A;  4I3A A;  4X25 A;  1EI5 A;  2VGK A;  4JPM A;  4P85 A;  3MS6 A;  4KUO A;  3SS3 A;  2V1B A;  1TDL A;  1ESI A;  2Y59 A;  4S2I A;  3DBA A;  1W5D A;  2OAP 1;  4KZ7 A;  4B4Z A;  4LPZ A;  1NZO A;  4EUV A;  3CLO A;  2XA7 S;  4O0P A;  4OQG A;  4OQI A;  1MXO A;  4N1X A;  2WUQ A;  3P98 A;  3UPN A;  2I72 A;  4HH2 A;  4E3J A;  3PHY A;  1ERO A;  4X53 A;  2OAQ 1;  3O3V A;  4BL3 A;  1OJG A;  2V1A A;  3P09 A;  4GS9 B;  3BEB A;  5G18 A;  5GLC A;  4ZJ1 A;  4IJG A;  3N4I A;  1ZC2 A;  4L9E A;  4HQA A;  1BSG A;  1MWR A;  4E3I A;  5CX7 A;  5J3W A;  2P9V A;  3V5M A;  1PNE A;  5EUA A;  4GN2 A;  1IFQ A;  4DMZ A;  4IVI A;  4KG5 A;  4Q0H A;  3IX4 A;  1MZU A;  4GZB A;  3UB8 A;  5FQJ A;  1XA7 A;  3G2Y A;  1V9Y A;  3TSG A;  1OT9 A;  4L0L A;  4GB7 A;  4MLL A;  3LID A;  5EE8 A;  5DTK A;  1V9Z A;  5GHZ A;  1YLT A;  3HLC A;  5CED A;  4RX3 A;  3GQZ A;  2O0Y A;  3W4O A;  1IKG A;  1NRJ A;  5G4Y A;  2W3F A;  2HJ9 C;  1DJA A;  4CLC A;  5EVI A;  3BLM A;  2K2N A;  2Z2M B;  1IYO A;  1KGE A;  5HD5 A;  2FFY A;  2XDM A;  1ODV A;  4U3T A;  4DJ3 A;  5GL9 A;  2RL3 A;  1L0D A;  4HJ3 A;  4KZ5 A;  4MN5 A;  4LCL A;  4OQ0 A;  3NJA A;  4R0Q A;  1TD5 A;  3KSH A;  2W3D A;  5FA7 A;  3Q7V B;  4NEE D;  4Y7P A;  4WZ5 C;  3ZNY A;  4R23 A;  3NI9 A;  1BUL A;  4M3K A;  1VEU B;  1YKD A;  1IEL A;  3BM6 A;  2HP9 A;  2WGW A;  5HPI A;  5HWV A;  3VP0 A;  1K55 A;  3CZD A;  1P9W A;  2L1M A;  5TFQ A;  1DJC A;  4FUW A;  3RFB A;  2H0T A;  1BZA A;  4EW7 A;  1X0O A;  1S67 L;  4GDB A;  2Z6C A;  5F1G A;  1F9I A;  1WA9 A;  2NUT C;  3FZC A;  3CHW P;  4IUH A;  2WKH A;  4NXB A;  1ONG A;  1TDG A;  5GLA A;  4FOF A;  3EEH A;  2C5W B;  3QP4 A;  1F2K A;  5F1F A;  2DNS A;  4DRT A;  2Y2Q A;  4R4R A;  4Q0J A;  5E2H A;  3FKV A;  3H7W A;  3SH8 A;  3F1N A;  1G5U A;  4OLD A;  2ZQ9 A;  4KZ9 A;  1S4S A;  4PM5 A;  3MZF A;  5J4E A;  2ZL1 A;  1L0G A;  5K5B A;  2HF6 A;  1CQA A;  1MWS A;  3LFV A;  4C6Y A;  1ZKJ A;  3N6I A;  4LV0 A;  4OPZ A;  1FSY A;  2EX8 A;  3IS2 A;  1DP6 A;  1D1J A;  3NOP C;  3VSK A;  5I5L A;  2BLS A;  2Q9M A;  3U2A A;  3NC8 A;  3T4S A;  3UDF A;  3VOY A;  3E98 A;  1K56 A;  3ZDJ A;  5HZH A;  4MBK A;  5HAQ A;  2WKP A;  4LV3 A;  1MWT A;  3AGD A;  3IQA A;  1TVF A;  5FAT A;  4DKI A;  1YPR A;  2R9W A;  3S22 A;  3NOU C;  4X56 A;  3IF6 C;  1LLB A;  4CLC D;  2XSS A;  1ZG6 A;  5DKL A;  4NXG A;  5EVI D;  3BFC A;  3TW8 A;  4OPR A;  4PHT A;  3V3S A;  3HBR A;  1E3U A;  4KZB A;  4MEZ A;  3SZT A;  4PM7 A;  3E2K A;  1JWP A;  4S2N C;  3GTC A;  3ICY A;  5HAP A;  3T1R A;  1XP4 A;  3IWQ A;  4GD8 A;  4JGR A;  3P01 A;  1N9B A;  3C38 A;  4HBT A;  1WYC A;  4DDY A;  2WKE A;  2GNX A;  4HIA A;  4XXR A;  2ZLY A;  3LI9 A;  5A92 A;  1NXY A;  5FDH A;  5HD3 A;  4PKY G;  1H0M A;  4WZ5 A;  2XRN A;  5FI2 A;  2NUP C;  2OOL A;  2EA9 A;  1LSW A;  2PR6 A;  3MFD A;  2JKR I;  1HTZ A;  1LL9 A;  3HUN A;  5EPH A;  3GSG A;  1N4O A;  2FH5 A;  4OOL A;  2VV7 A;  2W27 A;  4E04 A;  2P7J A;  5GLD A;  3WWX A;  1K6S A;  1NLY A;  3N8R A;  4EET B;  5AQ7 A;  3PBN A;  1YQS A;  2G2W A;  1DP8 A;  3IX3 A;  2X71 A;  5TBM B;  1EW0 A;  3EGX C;  4D2O A;  3OZH A;  4MN6 A;  4DXC A;  1BUE A;  2Y2M A;  5CGS A;  4MBH A;  4JGO A;  3C4P A;  3QP1 A;  4E3N A;  1CF0 A;  3AGE A;  2J80 A;  4IED A;  4ZDX A;  2ZC4 B;  5J7E A;  2GDN A;  4BJP A;  2VV6 A;  3V67 A;  5TGF A;  4UQI M;  1N9N A;  4KQR A;  1CK3 A;  4GW9 A;  4EV4 A;  3CI6 A;  2H10 A;  4RYE A;  5IU1 A;  1VB6 A;  1I5Q A;  5KIZ A;  3NIA A;  1IYQ A;  4HP4 A;  3Q07 A;  4CLC B;  2A24 A;  3UPO A;  2HPB A;  5EVI B;  3V50 A;  4QWO A;  1MPL A;  4XUX A;  5AVF A;  4XUZ A;  2M7U A;  3UDI A;  1G6O A;  4Y0O A;  1OPX A;  3GR2 A;  4IBR A;  3FPV A;  1OTE A;  4FTX A;  3O87 A;  4BD0 A;  1HD8 A;  3HLD A;  3IF6 A;  3E0Y A;  4PMA A;  3NHQ A;  1UGU A;  1PZP A;  3H9W A;  4HH3 A;  4MBF A;  2Y2I A;  4UA7 A;  3UE6 A;  2XD5 A;  1ACF A;  4WMC D;  2PT7 A;  3IH8 A;  2WGW B;  4ETX A;  4S2N A;  3F1O A;  3EGD C;  3ZCZ A;  2PBD P;  4OP8 A;  1XGJ A;  3IHA A;  2ZOI A;  2ACG A;  4HES A;  2K7S A;  1IYP A;  3N8S A;  3K2N A;  1GSW A;  3F1P A;  4NKP A;  2V0U A;  1O7E A;  3BFG A;  1VQQ A;  3H82 B;  4X1L A;  3RXX A;  4DE3 A;  2Y2P A;  3CG5 A;  2OLU A;  5CHM A;  3KO6 A;  3NY4 A;  2OSU A;  3B42 A;  3MZD A;  1LHY A;  3MSH A;  4GCZ A;  2ZC3 B;  4KG2 A;  3SH7 A;  2JBF A;  2ZL1 B;  5AJG A;  3NCK A;  5FSR A;  3T4J A;  2A2L A;  1HVB A;  2EXB A;  2UV0 E;  4BQM A;  1M40 A;  3S7N A;  4BBU A;  4O01 A;  4LLO B;  4R6L A;  3HLF A;  1RGZ A;  3CPT A;  2O9B A;  1FIL A;  4DDS A;  2QJ7 A;  3HLW A;  2W1R A;  3OPR A;  4HJ6 A;  4WLA A;  2G2U A;  4KEN B;  3HL9 A;  5I94 A;  3K3C A;  4Y5F A;  5E2E A;  3ZG0 A;  3ZFZ A;  5HL1 A;  2Y79 A;  2Y8H A;  1MY8 A;  1XFQ A;  2IWB A;  5DJT A;  2YKH A;  3HRE A;  2XH9 A;  3LY3 A;  3OOV A;  1I2S A;  4R3B A;  4DJ2 A;  4QB8 A;  2P04 A;  2WGI A;  1F5M A;  4JXS A;  4F3L B;  4RX2 A;  3L9K A;  5E43 A;  2VX8 A;  4ARZ B;  4X6T A;  3SS4 A;  3T4Q A;  4LGW A;  2WKI A;  3D72 A;  2JKR M;  2J9O A;  4GHI A;  1JNU A;  4ZBE A;  3IH9 A;  5HSQ A;  1KOU A;  2XLN A;  3GEC A;  4LFU A;  3EQU A;  3LEZ A;  5J8X A;  1E25 A;  4KZ4 A;  3UB5 P;  4EBP A;  3UDX A;  3DTE A;  3IXD A;  1PYY A;  2WK0 A;  4EBL A;  3MBZ A;  1FCM A;  5DF8 A;  1XA1 A;  1T1B A;  3MR0 A;  4R4S A;  1S6R A;  1J9M A;  3VP4 A;  3Q81 A;  2P74 A;  4OOY A;  4MDZ A;  2B5R A;  3T4L A;  5HX9 A;  1FCO A;  4EER A;  3MXQ A;  1YT4 A;  3MKF A;  4OH0 A;  5DVA A;  2HDS A;  1NYY A;  5BOH A;  4EUZ A;  3PAE A;  3QP6 A;  3DWZ A;  1G68 A;  3UNW A;  3DTK A;  5L8M A;  2KX6 A;  1KVM A;  1FOF A;  2WAE A;  4YWZ A;  3UE3 A;  2JN7 A;  4U0X A;  1XXM A;  3PBT A;  1FR6 A;  1T1A A;  1YLZ A;  2QJ5 A;  2VZW A;  5KSC A;  4WYY A;  2X02 A;  3SOI A;  3HUO A;  2V1Z A;  3HLE A;  3ZVT A;  1L2S A;  5M1A A;  2ZBB A;  3NBL A;  2KOI A;  1HLU P;  3M2J A;  3RXW A;  4FH2 A;  1RP5 A;  3KX0 X;  1MKI A;  3E4P A;  1DRM A;  2XK1 A;  4Q0I A;  3T4O A;  5G4Z A;  1ES3 A;  5GHY A;  5TJJ A;  3VOL A;  3LR3 A;  4H6J A;  1IOU A;  2MJ6 A;  3A0R A;  2JCH A;  3UPP A;  1LI9 A;  2ZD8 A;  4EXO A;  3D3O A;  1YLY A;  1PIO A;  4HEF A;  3NEC A;  5DFY A;  1D7E A;  4UA9 A;  1VHM A;  2O9C A;  3A3F A;  1XX2 A;  1CJF A;  2GJ3 A;  3LIF A;  4X69 A;  2XGN A;  2W0N A;  1VET A;  2A24 B;  2OWH A;  5HWT A;  2JE5 A;  4MCW A;  4IHQ A;  1KE0 A;  1Y28 A;  1LL8 A;  1SZV A;  1GSV A;  1A0K A;  3BRM A;  3IF6 B;  2ZQ7 A;  2HDQ A;  4QPR A;  3PYP A;  2QHK A;  3LR4 A;  3MZE A;  4PPR A;  4B93 A;  4GKU A;  5DF7 A;  1ES2 A;  5M19 A;  3HCY A;  1ERM A;  2DMW A;  1OTI A;  2HP6 A;  2R78 A;  3WRZ A;  1OT6 A;  2XF3 A;  1ES4 A;  1PW1 A;  4E3M A;  4XT2 A;  4YIN A;  2LB9 A;  2JKT I;  2WKQ A;  4AFI A;  1P97 A;  4OPY A;  1PZO A;  2L0W A;  2KDK A;  3QP5 A;  2R9X A;  4KZ6 A;  2HDU A;  2GX5 A;  3CJM A;  5M18 A;  4S2J A;  4X68 A;  1SCW A;  2B02 A;  4E3L A;  4LRX C;  1J3W A;  4EQI A;  2IA2 A;  4FSF A;  1G6A A;  4BL2 A;  3G35 A;  4GJ4 A;  4DXB A;  4GDN A;  2VKS A;  3FWL A;  3IWO A;  1YAX A;  5E2F A;  5DTS A;  4H8R A;  4IUK A;  3MQ0 A;  3WS2 A;  3C7U A;  1RCJ A;  3G30 A;  2WGV A;  1T18 A;  1F98 A;  2EX9 A;  3WS0 A;  1H8Y A;  2Y2N A;  3JPU A;  2J9P A;  1GHP A;  2VA0 A;  1KE3 A;  1T1C A;  4Y3I A;  3ZYT A;  2Q0O A;  2L4R A;  4JF6 A;  1QME A;  5TR7 A;  3HVF A;  3T50 A;  4EEU A;  4OON A;  2OWJ A;  5AQB A;  3S7Q A;  3K3D A;  4Z9Q A;  1DP9 A;  4P6B A;  1SHV A;  4HHD A;  4BBT A;  2M7V A;  2V2F F;  4JLF A;  2H0Y A;  4Z1W A;  4U0T A;  3GMW A;  5DF9 A;  1W7F A;  4G3W A;  3NUL A;  2Z2L B;  3LIA A;  4X55 A;  1OJ5 A;  5F83 A;  3A0V A;  3IBJ A;  4UHU A;  1GA9 A;  1K4F A;  1GCE A;  4EES A;  3QHY A;  3G31 A;  5HDC A;  1PI5 A;  3LR0 A;  3BFF A;  4K0W A;  3C4O A;  5A91 A;  1STZ A;  3LGO A;  3M6H A;  1EWZ A;  5IHV A;  2ZQC A;  4R70 A;  2HJE A;  4LRY C;  4OQH A;  3BFD A;  3BWL A;  3NDE A;  1XJ3 A;  4BBV A;  5CEB A;  5JYO A;  3JYI A;  1UWP X;  4KG6 A;  4ZRR A;  1CEG A;  3TE8 A;  5FEG A;  4HI4 A;  2ZMA A;  2QWS A;  4K08 A;  2ZM8 A;  2WYX A;  2ZMV A;  3S7O A;  2J3T D;  2W3H A;  4R3J A;  1CI8 A;  1S0W A;  2M1C A;  3BLS A;  4ZJ2 A;  3FKW A;  1L0F A;  5L09 A;  5FAQ A;  3OPH A;  2J8Y A;  1YSP A;  3DWK A;  4LRZ E;  2OLV A;  2PR5 A;  4GS9 A;  3MJQ A;  2V8F A;  2QZ6 A;  1XKZ A;  4S2M A;  4DE1 A;  5EVE A;  2P9V B;  2G7U A;  4UQI S;  4CQH A;  3VFH A;  4S2O A;  2HGV A;  4OP5 A;  3EOI A;  3LR5 A;  1K56 D;  4WL9 A;  4NXE A;  3D9Y A;  4BD1 A;  3DTM A;  4K0X A;  1KGF A;  2ZJ9 A;  3GRJ A;  4WBG A;  4KUK A;  4F94 A;  5FAP A;  1S66 L;  3R7W A;  3CIT A;  3ITB A;  1PFL A;  4E6W A;  4H6J B;  4Y13 A;  5CTN A;  2PD7 A;  1XGI A;  5DJU A;  4ZJ3 A;  1IYS A;  4CLC E;  1UWN X;  3JVV A;  2B18 A;  3UN7 A;  5HAR A;  3C30 A;  1E3U D;  4EU0 A;  1W8Q A;  2XFS A;  3A3J A;  5KZH A;  5CGX A;  2A3U A;  3M2K A;  3MKE A;  3IHB A;  5CRF A;  3C5A A;  1YLP A;  1PRQ A;  2KLI A;  1NZU A;  4PKY A;  2JKT M;  3ZQ5 A;  2PU2 A;  2GZA A;  4GOG A;  3OPP A;  3Q7V A;  3E4O A;  3FV7 A;  1ZTU A;  1YLJ A;  1IKI A;  4EWF A;  3OC2 A;  3V39 A;  4A5R A;  5FL3 A;  3KSG A;  4UEY A;  2Q9N A;  1ZHH B;  4O8G A;  5EVL A;  1FR1 A;  5A93 A;  2BTF P;  1SKO A;  2IWC A;  3BY9 A;  1GHM A;  4LCM A;  2ZC7 A;  3T1X A;  5E2G A;  4XT2 B;  3KYQ A;  1P0Z A;  4II7 A;  3PR6 A;  5F6A A;  2XD1 A;  4P0M A;  1W63 Q;  3H7W B;  4DE0 A;  3F1N B;  4O7D A;  2B95 A;  3UO9 A;  2RCX A;  2Y4A A;  1NRF A;  4C75 A;  4L9G A;  3CWF A;  1LL5 A;  4HOI A;  4GD6 A;  1PW8 A;  2IWD A;  3IS2 B;  2Y2K A;  3RH8 B;  3IX8 A;  3RTY A;  3DTI A;  1L3L A;  4HP9 A;  5FQI A;  3MXR A;  3BQA A;  1Q2Q A;  2JKG A;  1M6K A;  3RJU A;  4R38 A;  3FPW A;  4DF6 A;  5D3O A;  3A0S A;  1W8Y A;  3ZG5 A;  2C6W B;  4QJG A;  5EV0 A;  1BLC A;  3IWI A;  3B47 A;  4WN5 A;  1O07 A;  2INW A;  1NJ4 A;  2ZC5 B;  3HLB A;  1AWI A;  2WZX A;  5FQM A;  3UE0 A;  2J3W A;  4KQQ A;  4WEK A;  4HJ4 A;  3TOI A;  5FEF A;  1SDN A;  5IT5 A;  1ZG4 A;  2VV8 A;  3JVU A;  5CEC A;  4N92 A;  4B9O A;  3BFE A;  4ME4 A;  1K25 A;  4Y0U A;  2VLG A;  2PYP A;  3EQV A;  2EX2 A;  3PBQ A;  3S4X A;  3U4L P;  4BWI A;  1P9R A;  2PDR A;  1XJ6 A;  1OTA A;  3BY8 A;  4IVK A;  1TS6 A;  4NG2 A;  3VE3 A;  4ETZ A;  4DN0 A;  2QMI A;  2Z6D A;  5HWW A;  1T19 A;  2XFT A;  5DKK A;  3HUM A;  3BEC A;  3WS5 A;  4CJN A;  3M6B A;  2H5S A;  2W1T A;  3VMA A;  1TS0 A;  3ULF A;  4PM9 A;  2ZM2 A;  1JTD A;  2VGL M;  1NY0 A;  3Q82 A;  3V3R A;  4JGP A;  5A90 A;  1YSQ A;  5FDS A;  2WZZ A;  1AXB A;  3PBS A;  3Q7Z A;  5CTM A;  3E4Q A;  4RQ9 A;  3T12 B;  5EFW A;  2O99 A;  4WM9 A;  2XA7 M;  3DAV A;  3LEQ A;  1DY6 A;  3CUE C;  4Q8I A;  2PD8 A;  1GSX A;  5GHX A;  1GA0 A;  3VP1 A;  1WYB A;  1NLZ A;  4WUJ A;  1H3Q A;  4CPK A;  2V8C A;  5TBM A;  3ZG9 B;  4QHC A;  1N9O A;  2Y91 A;  3W4P A;  2PU4 A;  1FQG A;  2FFF B;  4I3J A;  2OV5 A;  3ITA A;  4GNU A;  3IXG A;  3R7W B;  4QY6 A;  5FAO A;  2HDR A;  2BAS A;  3W2Z A;  3A3D A;  2K31 A;  3OCL A;  3T1S A;  1FCN A;  5FI6 A;  5KSH A;  3SS5 A;  5F5Y A;  5HDD A;  4M4X A;  1U60 A;  1OTD A;  3UE1 A;  3ZG8 B;  1Y54 A;  1CI9 A;  3VFF A;  4MMN A;  1MBL A;  2Y2G A;  4ZTK A;  5C5K A;  3O5Y A;  5HDS A;  3T1Q B;  1MWU A;  3S1Y A;  3BJN A;  4WEL A;  1BLP A;  1Y4O A;  5F82 A;  2QYB A;  4RA7 A;  2DCF A;  3QP2 A;  3G32 A;  1FSW A;  3D4F A;  4QD4 A;  4OOM A;  5JYP A;  3F1O B;  1N9L A;  1L0E A;  4EBN A;  3EEA A;  5EOO A;  2I9V A;  4R1G A;  3FG8 A;  2H28 A;  4OPQ A;  1LT0 A;  1SKO B;  1TF1 A;  3MQQ A;  4YOF A;  1BT5 A;  2ZC6 B;  3F1P B;  2V20 A;  4K91 A;  1S1Z A;  4YFM A;  1I2W A;  5EM1 A;  3G2Z A;  5L10 A;  2BG1 A;  3HJI A;  3VSL A;  2PYR A;  3E2L A;  3H82 A;  1JTG A;  4LV1 A;  3T4K A;  2XRO A;  1Z09 A;  1FIK A;  5FI7 A;  4C3Q A;  3MFX A;  4FCF A;  3GV9 A;  4R3A A;  3O88 A;  3HLG A;  4OLG A;  4N9K A;  3CPT B;  3R4K A;  4BMW A;  4ID4 A;  4BLM A;  5F69 A;  1YMS A;  2ZOH A;  3LUQ A;  4I5S A;  2CMN A;  4JXG A;  3LIB A;  5CGW A;  5EEC A;  5EM0 A;  3CUE A;  4S2P A;  1C3B A;  4NET A;  1H8M A;  4JKT A;  2HV1 A;  1D06 A;  4E3K A;  5DFX A;  1K4E A;  1KGG A;  4HBU A;  3FC7 A;  3SW1 A;  2PRF A;  4QY5 A;  4ZAM A;  3P7N A;  4I39 A;  1NYM A;  2ZQD A;  4QU3 A;  1LI0 A;  1W63 M;  3UB9 A;  1ALQ A;  1ERQ A;  1TS7 A;  4BEN A;  4DE2 A;  4F3L A;  3A3E A;  5HPF A;  3IXB A;  2ZMF A;  4GHI B;  4ARZ A;  4I3I A;  2UWX A;  3NOT C;  1BTL A;  4P87 A;  5CHU A;  1BYW A;  3L7H A;  3WS4 A;  3GDI A;  3EWK A;  3NDG A;  3VE4 A;  1XJ4 A;  4WMC A;  3VP3 A;  1K6R A;  3ZHH A;  4G3K A;  4KZA A;  2XQZ A;  2W1T B;  2PHY A;  3A3I A;  2VEA A;  2Y2J A;  3ZG7 B;  4HY8 A;  1ESU A;  2A49 A;  4FH4 A;  4B4X A;  1K57 C;  2EXA A;  1OTB A;  1KE4 A;  2FZ0 A;  2JHE A;  3IBR A;  1KDW A;  4KQO A;  2WAD A;  2ZM0 A;  4LV2 A;  4FD8 A;  3TJZ C;  2Y2H A;  3QNC A;  1KVL A;  1MKM A;  5LBR A;  2CC1 A;  1K54 C;  1YLW A;  3MMH A;  3MXS A;  3VP2 A;  5FAS A;  4GLQ A;  4ESP A;  1H5X A;  2P08 A;  4JXW A;  1YM1 A;  4RVA A;  5HL6 A;  3LYX A;  1LSX A;  4WEJ A;  4JF5 A;  3CMZ A;  4OKP A;  1WE4 A;  2JKF A;  2J7V A;  3G6O A;  2D02 A;  4KQD A;  1H8Z A;  3UB6 A;  4B88 A;  3VOZ A;  5CER A;  3S7P A;  4I38 A;  2WKR A;  1QMF A;  3IT9 A;  4PM6 A;  3PXP A;  1CEF A;  4N1H A;  3IXH A;  3BQ8 A;  3PTE A;  4NK3 A;  4KZ8 A;  3W4Q A;  3BW6 A;  4JXV A;  3UMD A;  4D60 A;  1XPB A;  2XR0 A;  4PM8 A;  4IBX A;  2E8J A;  4L9F A;  4MNR A;  2LB5 A;  2WAF A;  3QP8 A;  4Y17 A;  3ZVW A;  5U47 A;  1SDE A;  1S4R A;  1Q2P A;  1ONH A;  3KYZ A;  1LSV A;  3MQO A;  2E8I A;  5GLB A;  5HFO A;  3LY4 A;  1K38 A;  3KSF A;  1VET B;  2W3E A;  5HAI A;  5AQ9 A;  3AGF A;  2AVX A;  3UY6 A;  3PAG A;  4HNB A;  2YKF A;  3B3X A;  1YMX A;  5FQQ A;  2QPN A;  5AVE A;  1MC0 A;  2DRW A;  3B33 A;  3VV4 A;  2PAV P;  3LI8 A;  3UME A;  3KSI A;  3KYE A;  5L2F A;  1PWC A;  1VEU A;  1JWV A;  2EFU A;  3QNB A;  4OVD A;  2Y2L A;  2X01 A;  4WZ4 A;  3Q1F A;  2EFX A;  4Y15 A;  1ES5 A;  3PBO A;  2QKP A;  3C8C A;  3LIC A;  3TRC A;  1JWZ A;  3ZNT A;  1TEM A;  3SH9 A;  4E6X A;  2O9A A;  1PWD A;  2V9A A;  2VGJ A;  2XEP A;  4N9L A;  2PBY A;  3C7V A;  1KDS A;  1BLH A;  1NWZ A;  2VJW A;  3I7J A;  3ZGA B;  2Y55 A;  1E4D A;  3LO7 A;  2EWV A;  1G28 A;  4WF0 A;  3FYZ A;  3OPL A;  4MN7 A; 
#chains in the Genus database with same CATH homology
 2GX5 A;  3OLO A;  4RQ9 A;  5EFW A;  2O99 A;  4YNR A;  2FH5 A;  4OOL A;  3T4T A;  2VV7 A;  2B02 A;  2W27 A;  2XA7 M;  4E04 A;  4LRX C;  2P7J A;  1NLY A;  4EET B;  2IA2 A;  3PBN A;  3PBR A;  4FSF A;  3CUE C;  2PD8 A;  1GSX A;  1DP8 A;  1TS8 A;  3LIE A;  3CAX A;  4GJ4 A;  1NLZ A;  4WUJ A;  5TBM B;  1H3Q A;  2VKS A;  1EW0 A;  3EGX C;  1YAX A;  3OCN A;  5TBM A;  4MN6 A;  1N9O A;  4JGO A;  4IUK A;  3MQ0 A;  3HJK A;  4EQ1 A;  2J80 A;  1T18 A;  2V0W A;  5J7E A;  1F98 A;  4CLC C;  4I3J A;  3MF0 A;  4BJP A;  2VV6 A;  4P6Z S;  2VA0 A;  4PAU A;  1T1C A;  3V67 A;  4Y3I A;  3ZYT A;  4UQI M;  1N9N A;  2L4R A;  4G3V A;  4GW9 A;  3R7W B;  3C2W A;  3CI6 A;  3OBF A;  2BAS A;  4P6Z M;  5IU1 A;  3W2Z A;  1VB6 A;  5MC7 A;  4Y2F A;  3T50 A;  3UB7 A;  2K31 A;  3OCL A;  4EEU A;  2OWJ A;  5KIZ A;  3S7Q A;  4JGQ A;  5KSH A;  3K3D A;  5F5Y A;  1DP9 A;  5HDD A;  4EEP A;  4M4X A;  5F68 A;  4BBT A;  1OTD A;  4HHD A;  4HP4 A;  2M7V A;  4CLC B;  2A24 A;  4Z1W A;  5DF9 A;  5AVF A;  4G3W A;  2M7U A;  3LIA A;  1G6O A;  1XFN A;  1OJ5 A;  1OPX A;  4MMN A;  3A0V A;  3IBJ A;  3FPV A;  1OTE A;  4NXF A;  4EES A;  1S1Y A;  5IS1 A;  2EWW A;  5C5K A;  3O5Y A;  5HDS A;  1XJ2 A;  5HDC A;  3E0Y A;  3LR0 A;  3NHQ A;  1UGU A;  3BJN A;  3H9W A;  4WEL A;  4HH3 A;  1STZ A;  3UE6 A;  2QYB A;  4R70 A;  2VGL S;  2HJE A;  4LRY C;  2D01 A;  2PT7 A;  3BWL A;  5A8B A;  2W3G A;  2J3T C;  4OOM A;  1XJ3 A;  4BBV A;  4ETX A;  3F1O B;  4I3A A;  1N9L A;  1UWP X;  4ZRR A;  3EEA A;  3F1O A;  4KUO A;  2I9V A;  3EGD C;  3TE8 A;  2V1B A;  4HI4 A;  3FG8 A;  2H28 A;  2QWS A;  4K08 A;  3DBA A;  2ZMV A;  3S7O A;  1LT0 A;  2ZOI A;  1TF1 A;  3MQQ A;  2OAP 1;  4YOF A;  2J3T D;  2K7S A;  3F1P B;  4LPZ A;  4EUV A;  3CLO A;  2XA7 S;  4O0P A;  1S1Z A;  3K2N A;  1GSW A;  3F1P A;  4NKP A;  2V0U A;  2W3H A;  3H82 B;  2M1C A;  3HJI A;  2PYR A;  4HH2 A;  3H82 A;  3KO6 A;  3B42 A;  3PHY A;  3T4K A;  4GCZ A;  2XRO A;  2OAQ 1;  1OJG A;  1YSP A;  2V1A A;  3MFX A;  4GS9 B;  4LRZ E;  5AJG A;  4R3A A;  2PR5 A;  4GS9 A;  3MJQ A;  3T4J A;  2A2L A;  4IJG A;  4L9E A;  3S7N A;  4HQA A;  4BBU A;  2G7U A;  3R4K A;  4O01 A;  4UQI S;  5CX7 A;  4BMW A;  4CQH A;  2HGV A;  4LLO B;  5J3W A;  5F69 A;  4R6L A;  2ZOH A;  3LUQ A;  4I5S A;  3EOI A;  3LR5 A;  2CMN A;  3LIB A;  4WL9 A;  2O9B A;  4NXE A;  3CUE A;  2QJ7 A;  2W1R A;  1IFQ A;  4DMZ A;  4HJ6 A;  4WLA A;  4KUK A;  4Q0H A;  1H8M A;  1MZU A;  1S66 L;  3R7W A;  2HV1 A;  1D06 A;  3CIT A;  3UB8 A;  1V9Y A;  3K3C A;  1OT9 A;  4H6J B;  4L0L A;  4Y5F A;  5DFX A;  2PD7 A;  3LID A;  2Y79 A;  1V9Z A;  2Y8H A;  5DJU A;  1XFQ A;  3FC7 A;  4CLC E;  1UWN X;  3JVV A;  3SW1 A;  2B18 A;  5DJT A;  2O0Y A;  3P7N A;  2YKH A;  1NRJ A;  4I39 A;  5G4Y A;  2W3F A;  2HJ9 C;  4CLC A;  3OOV A;  3C30 A;  4EU0 A;  4DJ2 A;  2K2N A;  2P04 A;  1F5M A;  1W63 M;  5HD5 A;  4F3L B;  1ODV A;  3UB9 A;  4DJ3 A;  1TS7 A;  4HJ3 A;  4MN5 A;  4F3L A;  5HPF A;  2ZMF A;  3NJA A;  1TD5 A;  2VX8 A;  3KSH A;  4ARZ B;  2W3D A;  4GHI B;  2KLI A;  3T4Q A;  4PKY A;  2JKT M;  3D72 A;  3ZQ5 A;  4ARZ A;  2JKR M;  4I3I A;  4NEE D;  4GHI A;  2GZA A;  3NOT C;  1JNU A;  3E4O A;  5HSQ A;  1YKD A;  1KOU A;  1BYW A;  1ZTU A;  3GEC A;  5HPI A;  5HWV A;  3EQU A;  3GDI A;  3OC2 A;  3EWK A;  3VE4 A;  1XJ4 A;  5FL3 A;  3KSG A;  1P9W A;  2L1M A;  4UEY A;  1ZHH B;  4G3K A;  4O8G A;  3RFB A;  2W1T B;  4EW7 A;  1X0O A;  1S67 L;  2Z6C A;  2PHY A;  2VEA A;  1F9I A;  1WA9 A;  2NUT C;  3BY9 A;  4HY8 A;  4IUH A;  1T1B A;  3MR0 A;  1OTB A;  2FZ0 A;  2JHE A;  3IBR A;  4XT2 B;  4NXB A;  3KYQ A;  4KQO A;  1P0Z A;  4II7 A;  3PR6 A;  4MDZ A;  5F6A A;  4FOF A;  3EEH A;  3T4L A;  4EER A;  1W63 Q;  3H7W B;  3F1N B;  3MXQ A;  3TJZ C;  4Q0J A;  3H7W A;  3F1N A;  1MKM A;  5LBR A;  3MMH A;  4L9G A;  3CWF A;  4GLQ A;  1S4S A;  2P08 A;  5J4E A;  4HOI A;  5HL6 A;  5K5B A;  3LYX A;  5L8M A;  1LSX A;  2KX6 A;  2HF6 A;  4WEJ A;  3LFV A;  3IS2 B;  4YWZ A;  3RH8 B;  3UE3 A;  2JN7 A;  3RTY A;  3PBT A;  3G6O A;  2D02 A;  4KQD A;  1T1A A;  4HP9 A;  2QJ5 A;  2VZW A;  3IS2 A;  3UB6 A;  3BQA A;  1DP6 A;  3NOP C;  3S7P A;  4I38 A;  2WKR A;  5I5L A;  4R38 A;  3FPW A;  3PXP A;  3A0S A;  3BQ8 A;  3U2A A;  2ZBB A;  2KOI A;  3BW6 A;  3T4S A;  3UMD A;  3KX0 X;  3E4P A;  1DRM A;  3E98 A;  5HZH A;  4Q0I A;  3B47 A;  3T4O A;  2WKP A;  4WN5 A;  5G4Z A;  5TJJ A;  2INW A;  4L9F A;  3VOL A;  3LR3 A;  2LB5 A;  4H6J A;  1IOU A;  1S4R A;  2MJ6 A;  3KYZ A;  3A0R A;  1LSV A;  3MQO A;  2J3W A;  4EXO A;  3D3O A;  4WEK A;  4HJ4 A;  3NOU C;  3KSF A;  5DFY A;  1D7E A;  5IT5 A;  1VHM A;  2W3E A;  2O9C A;  2GJ3 A;  2VV8 A;  3LIF A;  4CLC D;  2XSS A;  3JVU A;  2W0N A;  5DKL A;  4NXG A;  4HNB A;  2A24 B;  3TW8 A;  4B9O A;  2OWH A;  4PHT A;  2YKF A;  4ME4 A;  5HWT A;  5AVE A;  4MCW A;  1MC0 A;  2VLG A;  2PYP A;  4IHQ A;  3EQV A;  3PBQ A;  1Y28 A;  3ICY A;  4BWI A;  1LL8 A;  1P9R A;  2PDR A;  1XJ6 A;  3B33 A;  3VV4 A;  1GSV A;  1OTA A;  3LI8 A;  3UME A;  3BY8 A;  3KSI A;  4JGR A;  3P01 A;  1TS6 A;  3VE3 A;  4ETZ A;  4DN0 A;  4QPR A;  3C38 A;  3PYP A;  2QHK A;  3LR4 A;  2Z6D A;  5HWW A;  1T19 A;  5DKK A;  4B93 A;  2GNX A;  4HIA A;  3HCY A;  3LI9 A;  3PBO A;  2W1T A;  2QKP A;  3C8C A;  3LIC A;  3TRC A;  1TS0 A;  3ULF A;  2DMW A;  1OTI A;  2VGL M;  2O9A A;  2R78 A;  2V9A A;  1OT6 A;  5HD3 A;  4PKY G;  2XRN A;  2NUP C;  4JGP A;  1NWZ A;  2VJW A;  2OOL A;  4XT2 A;  1YSQ A;  2LB9 A;  2JKT I;  2WKQ A;  2EA9 A;  1LSW A;  2PR6 A;  2JKR I;  1P97 A;  4AFI A;  2L0W A;  2EWV A;  1G28 A;  2KDK A;  4WF0 A;  3PBS A;  3E4Q A;  4MN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...