1DP8A

Crystal structure of the nitric oxide bound fixl heme domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
PDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New mechanistic insights from structural studies of the oxygen-sensing domain of Bradyrhizobium japonicum FixL.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Oxygen storage/transport
molecule keywords FIXL PROTEIN
total genus 29
structure length 118
sequence length 118
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1999-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1dp8A00
3E4QA 2A24A 1TS7A 1N9LA 4XT2A 5F5YA 1T1CA 3H82B 4HOIA 4JGPA 1DRMA 1T19A 3ICYA 2B02A 3IS2A 4LPZA 5AVEA 3RH8B 3CAXA 3CWFA 2V0UA 4HI4A 2D02A 4HP9A 4EEPA 3E4OA 3MR0A 3BWLA 1F9IA 1P97A 4L9EA 4R38A 1EW0A 3B33A 3GDIA 4HIAA 3IBRA 4GS9B 4KUOA 4R3AA 4NXEA 4WN5A 3VE4A 4B9OA 3NHQA 3SW1A 2KX6A 1UWPX 4NXBA 1F98A 3BY9A 2PYRA 3NOUC 4GHIB 1LT0A 4HJ4A 5DJTA 3MQQA 4I3AA 1LSXA 3VOLA 4KUKA 1GSXA 3LIAA 4JGRA 3EEHA 3F1OB 1KOUA 1D06A 4R6LA 3E4PA 2A24B 2QJ7A 2YKFA 2L0WA 3A0RA 3C8CA 3LYXA 4XT2B 2VV6A 4KQDA 5TBMA 4K08A 4I38A 4WL9A 3P7NA 3H82A 1OTBA 1S4RA 5HD3A 5IU1A 1T18A 4HH2A 5DKLA 1BYWA 5HWWA 1P0ZA 2WKRA 4H6JA 2OWJA 2PR6A 5F69A 5HZHA 2J80A 4M4XA 2P7JA 3LICA 3LIFA 4MN6A 1JNUA 2D01A 3HJKA 4GHIA 1OJGA 1OTDA 1ODVA 1N9NA 3CLOA 3G6OA 3H7WA 3MFXA 3FC7A 3OLOA 5HDSA 5F68A 1DP9A 5DKKA 2PDRA 3PHYA 4E04A 2EA9A 4BBUA 2V0WA 3A0VA 1GSVA 4JGOA 4F3LA 1TS0A 4HJ6A 5TBMB 5AVFA 4BBTA 5IS1A 3LIDA 2PD8A 1XJ6A 2INWA 2V9AA 2OWHA 2Z6DA 3K3DA 4MN5A 3F1NB 5J3WA 3LIEA 4WUJA 3ULFA 2JN7A 3IS2B 3KX0X 4DJ3A 1D7EA 4EXOA 4LRYC 2I9VA 2WKPA 3FG8A 3LUQA 3NJAA 4HNBA 4WF0A 5I5LA 3H7WB 1Y28A 3MJQA 4NXGA 1S4SA 4I5SA 1UWNX 2M1CA 2V1BA 3LIBA 1XJ2A 4I3JA 3GECA 4PKYG 2WKQA 2QWSA 2ZOHA 4YWZA 1XFQA 3T50A 2QHKA 4EEUA 3K3CA 3MXQA 2L4RA 1XFNA 2PD7A 2OOLA 2QKPA 5HDCA 3UB8A 1LSVA 4EETB 2GJ3A 1LSWA 5G4YA 4L9GA 3MQOA 1S1YA 1G28A 2YKHA 4NXFA 1X0OA 1N9OA 1OT6A 2K7SA 1S66L 1GSWA 2VV8A 2Z6CA 3LI8A 4JGQA 4HHDA 4R70A 2JHEA 2W27A 3UB6A 2V1AA 3HJIA 5J4EA 2PHYA 3F1NA 4GCZA 2VV7A 4HH3A 5HWTA 4HP4A 4EQ1A 4H6JB 2W0NA 2R78A 4L9FA 3UB9A 2PYPA 4I39A 2L1MA 2H28A 3C2WA 1TS6A 5DJUA 1OTAA 3A0SA 3RTYA 4EW7A 4I3IA 2ZOIA 1LL8A 2VLGA 4LRXC 3F1PA 2ZBBA 4BBVA 3ZQ5A 4F3LB 2BASA 5F6AA 1V9ZA 2PR5A 5HWVA 4HY8A 1T1AA 1MZUA 1XJ4A 5HDDA 5EFWA 4LRZE 4HQAA 3UB7A 3UMDA 5KIZA 2QJ5A 3F1OA 1XJ3A 1T1BA 1VB6A 1OTIA 1OTEA 3EWKA 3VE3A 4HJ3A 5HSQA 1WA9A 3H9WA 1DP8A 3D72A 1S67L 3LI9A 1TS8A 4GW9A 4EERA 2HV1A 5J7EA 1OT9A 2VEAA 5G4ZA 2CMNA 5A8BA 4LLOB 3PYPA 4WLAA 3BY8A 4GS9A 4PKYA 4RQ9A 4DJ2A 2KDKA 1UGUA 5HD5A 3UE6A 1V9YA 3NOTC 1S1ZA 3F1PB 3UMEA 3NOPC 1DP6A 1OJ5A 4EESA 1NWZA
chains in the Genus database with same CATH superfamily
4ARZB 3DAVA 4O8GA 4HOIA 1XX2A 3DTEA 2HDSA 4GS9B 4B9OA 1NRFA 1NY0A 1UWPX 2PYRA 3NOUC 3CJMA 3RJUA 1F2KA 5CHJA 3KSFA 2UV0E 4UAAA 5IU1A 3N4IA 4P0MA 5DVAA 3BM6A 4MDZA 1K6RA 3TE8A 3UDXA 1OTDA 2K31A 1CI8A 3Q81A 3C5AA 1XKZA 1E25A 4M3KA 1K4EA 4ID4A 5DF9A 2QMIA 5FI6A 4ZJ2A 3KX0X 3M6HA 4N92A 1E4DA 2Q9MA 1PWDA 1RP5A 3E2LA 2ZC3B 3O5YA 3LIBA 5DTSA 3N8RA 3L9KA 2XD5A 4HHDA 1PW8A 3TW8A 1H5XA 2ZQCA 2ZC6B 3VMAA 3FKVA 1W63M 3DTMA 2C5WB 3G34A 5DF8A 5KSHA 1NLYA 3PBRA 1H3QA 3QP6A 1Y54A 5GLDA 1MZUA 5EFWA 4LRZE 3T12B 2QYBA 2WYXA 1BLCA 1CEFA 2Y2PA 4S2IA 3O3VA 3LFVA 1PI4A 4DMZA 4LLOB 4GS9A 3NULA 5CGSA 3IH9A 3MQ0A 4X53A 3E4QA 5FDHA 1N9LA 2LB5A 3NIAA 5EPHA 1LL5A 2B02A 4JXSA 1EWZA 3BWLA 2JBFA 2HF6A 3GDIA 5HAIA 3HL9A 3QP1A 5DJTA 2Q0OA 3EEHA 4DDSA 2L0WA 2VV6A 3E98A 2BG1A 2G2WA 4OKPA 1A0KA 2ZL1A 1CK3A 4R38A 2PU4A 2WGWB 3CLOA 1YSPA 3WS5A 5CHMA 3QHYA 5M18A 1ZC2A 4S2NC 1TS0A 5EOOA 5TGFA 2Z2MB 3NC8A 2Z6DA 3LIEA 5CEBA 4OPZA 3IS2B 1D7EA 3GR2A 5CERA 1VM1A 4CLCA 3EQUA 3ZHHA 1Y28A 2JKGA 4QD4A 1AXBA 2Q9NA 2JKRM 2W1TA 1IELA 5GHXA 3QP2A 2CC1A 4DN0A 4R3JA 2Z6CA 3LI8A 5AQBA 5F1FA 5CGWA 1JTGA 4BD1A 1IYSA 1W5DA 3G31A 3HLCA 2VGLM 4O7DA 1K6SA 1JWVA 4Y0TA 3EWKA 4B93A 3ZYTA 4CJNA 1K56D 3LI9A 2CMNA 3G30A 1DJCA 1M6KA 1I5QA 3AGDA 4JF6A 3T1XA 3B33A 4HIAA 3IBRA 3GVBA 1ES4A 4GHIB 1K57C 3S7NA 3MQQA 4EBNA 3C7VA 2B18A 1YLYA 1L0DA 1DJAA 4GNUA 5KSCA 4NK3A 4WL9A 3P7NA 3HUOA 3S7QA 5M19A 2WKRA 4H6JA 2J80A 1YLPA 4MN6A 4Y0UA 5HL6A 3QP8A 5EECA 1LLBA 1FCNA 4LENA 4P6ZM 4MNRA 4U3TA 2Y2KA 2HDRA 4KG5A 5LBRA 1HLUP 3U2AA 3FG8A 3MZDA 1K55A 4O01A 3H7WB 3TSGA 1AWIA 1IEMA 2ZOHA 4ZAMA 3N6IA 2PD7A 2X01A 1LSWA 4IBRA 2YKHA 2W3GA 2J3TD 3UB6A 1L0EA 1NLZA 1FCMA 1FR6A 3S22A 2JCHA 2XDMA 3NY4A 1G6AA 4B88A 1TDGA 3WS1A 2ZOIA 2C6WB 2HZ5A 4F3LB 5HAPA 5AQ9A 3IWIA 4KG2A 1VB6A 1KGFA 3V50A 1EROA 3UB5P 2GDNA 2AVXA 3LO7A 2R9WA 4NETA 1HD8A 2XQZA 1BUEA 1UGUA 4LCMA 5HD5A 1V9YA 4K0WA 4N1XA 3V67A 1ONGA 4BJPA 1KE3A 4IUHA 3D4FA 3HLBA 3ZG5A 5GHYA 3V5MA 3ZFZA 3DTKA 3OZHA 4HJ4A 2W1TB 3MS6A 4BL3A 4KUKA 4Y15A 1KOUA 4GB7A 5CGXA 1K55C 5E2FA 5E2EA 4Y2FA 3SH8A 5HWWA 1GCEA 1LI9A 1F5MA 3EOIA 4ZTKA 1YMSA 3UPOA 1GSVA 4DDYA 1J3WA 1PWGA 5C5KA 2WZZA 1DY6A 2XSSA 3R4KA 4LCLA 4RA7A 5FQJA 4QJGA 4OOLA 1VETB 3UN7A 1YPRA 4WELA 4KZ6A 3BLSA 2EWWA 3EQVA 4WZ4A 5FEFA 5G4YA 1LHYA 2Y2HA 2ZQ9A 2P08A 3F1NA 2JKTM 4I39A 3C2WA 3DBAA 2H0YA 3VFHA 1I2WA 1QMEA 4OP5A 4KZ7A 3UDIA 1WA9A 2OAQ1 1S67L 3UY6A 3W4PA 1RCJA 4GOGA 4EERA 1JWZA 5G4ZA 4Y0OA 1IFQA 3V39A 4L0LA 1SZVA 3LR5A 1OJ5A 4GZBA 5F5YA 3TJZC 2MJ6A 1T1CA 2XLNA 1T19A 4S2LA 4H8RA 3LY3A 1MPLA 4X56A 3S1YA 2V8CA 4MEZA 1K54A 1LSXA 4UEYA 4IHQA 2W1RA 5KZHA 3B3XA 3GMWA 5GL9A 2A24B 3G2ZA 4GLQA 5G18A 2VGJA 5F1GA 2ZMFA 5HL1A 1P0ZA 3ISGA 4UQIM 5AQ7A 2E8IA 5CTMA 2XK1A 4BBUA 3A0VA 5CECA 4MBHA 4AFIA 2KLIA 4MN5A 4Q0HA 2V20A 4R23A 3T4KA 3UE1A 2XA7S 5EVIB 2RL3A 4ETXA 1YT4A 4QWOA 2R9XA 3BEBA 4DE1A 1IYOA 3PTEA 3MJQA 4ZJ1A 3T1QB 2M1CA 1KE0A 5E2HA 2JC7A 3MQOA 3A3EA 5CXWA 3IXDA 4JGQA 2OSUA 5J4EA 3O88A 2HJ9C 2KOIA 3I7JA 1PW1A 5DTKA 1ERMA 3ITAA 5TR7A 3LR4A 5F6AA 3JPUA 3IF5A 3S4XA 3G4PA 4C75A 5HX9A 2B5RA 3DWKA 2J9PA 2ZQ8A 3PBOA 4WMCA 1NYYA 4FH4A 1ZG6A 3BY8A 3Q1FA 3NDGA 4EEPA 4YNRA 1NWZA 1IKGA 1KVMA 4P6BA 4QY6A 3UPNA 4HI4A 3RFBA 3L7HA 3VE4A 4HESA 3D9YA 4E3OA 1F98A 3NBLA 3NCKA 4IVIA 1H8MA 1PNEA 4R6LA 2GNXA 2QJ7A 4N9KA 3WRTA 4UHUA 1Z09A 5FAPA 1IYQA 3G6OA 3DWZA 5F68A 4F3LA 4HJ6A 2J8YA 1PZPA 2PD8A 3C4OA 1K54C 4GJ4A 4II7A 3ZG8B 2ZQDA 4KZ4A 5FAQA 5J8XA 2I9VA 3NJAA 4R3BA 1LI0A 4KQRA 1OMEA 1XJ2A 2WKQA 4Q0IA 2FFYA 4XUZA 4RYEA 2J7VA 4LGWA 4FSFA 1CF0A 2VJWA 5D3OA 3T4SA 4L9FA 3UB9A 5FSRA 3W2ZA 2H0TA 3V3SA 4WEJA 2HDUA 5HARA 1NRJA 1GHIA 4E3IA 2NUTC 1XP4A 5HWVA 1KGGA 4OQ0A 4S2JA 4GKUA 4U0XA 4X25A 3H9WA 3PAEA 4NKPA 4FCFA 1TS8A 2P9VB 3WWXA 1YM1A 4RQ9A 1P9RA 4X69A 4MLLA 3F1PB 3IF6C 1ACFA 4XT2A 3OPPA 3MKFA 4WZ5C 4DXBA 1G6OA 1ESIA 3CMZA 1OPXA 3BQ8A 3N7WA 4Y17A 1NYMA 4IEDA 1H8ZA 1SKFA 1FQGA 1ZTUA 3RXWA 1TVFA 3PBSA 3FYZA 3LYXA 4GN2A 4Q8IA 4LV1A 4K91A 2EX2A 3HCYA 3PBNA 2OWJA 2PR6A 1MKMA 1ONHA 4ZBEA 1O7EA 1YLWA 5FQQA 4ETZA 3VOLA 2DCFA 2PDRA 3LGOA 1GA0A 5FQIA 4CLCD 1BZAA 3S7PA 3B47A 3UMEA 2EXBA 4EWFA 2Y2LA 4WEKA 5I5LA 3UE0A 4NXGA 4PHTA 3GSGA 3EGXC 3HREA 3AGEA 2OAP1 4P6ZS 1RGYA 3BJNA 2W27A 3QP4A 1G5UA 4CPKA 4OPQA 4I3IA 5JYPA 3F1PA 1SKOA 1W79A 4KZBA 5E2GA 4OPRA 3CG5A 3PXPA 4DRTA 4Q0JA 4GW9A 4OQHA 2ZLYA 3PYPA 2A49A 3JVVA 2A24A 3BFFA 5FASA 1O07A 3H82B 4PM7A 4LPZA 4FTXA 2VGLS 1IOUA 2XROA 1G68A 4KUOA 3SW1A 3NHQA 4NXBA 5GLBA 2ZM0A 4JGRA 4EU0A 4EBPA 3OPLA 4KQDA 4R4SA 3W4QA 2ZMVA 1BYWA 3ZG0A 5F69A 4HBTA 3LICA 1L0FA 4BL2A 3O87A 5HDSA 3OLOA 1SDEA 5A91A 1KDSA 2WAFA 3MXRA 2FH5A 3ULFA 3BFGA 2PBYA 2EFUA 1SHVA 3CHWP 3FV7A 3WS4A 2WGVA 1D1JA 1K25A 2QWSA 3IX8A 5CEDA 3MXQA 3T4TA 2HP9A 2GJ3A 5FAOA 3MMHA 1VEUA 1G28A 2ZD8A 1XA7A 1PZOA 2PAVP 4KG6A 3R7WA 3IBJA 3Q7ZA 1ZG4A 4HP4A 4PM8A 2PYPA 4BENA 1VQQA 1OTAA 3A0SA 2ZC4B 2UWXA 1T1AA 5KIZA 3F1OA 1ES5A 4IBXA 2M7VA 3VP3A 1OTEA 2EWVA 1DP8A 3IX3A 5A90A 2DRWA 3CI6A 2Y2MA 2ZJ9A 2WGIA 1YAXA 4G3WA 2WKEA 2VX8A 4RX3A 3KYQA 4KENB 4EV4A 3NECA 3HUNA 4EUZA 4R3AA 4UQIS 4NXEA 1PRQA 4KZ5A 3TG9A 4GDNA 4OLDA 1LT0A 2HDQA 1MC0A 1D06A 4IUKA 3IXGA 5TBMA 1MBLA 5F82A 3HBRA 1OTBA 1T18A 4P87A 4Y7PA 4KQOA 2FZ0A 2G7UA 4XUXA 2O9CA 4N9LA 2D01A 4GHIA 1ODVA 3FPVA 1MWSA 3MFXA 5EOEA 3IHBA 3FC7A 2EA9A 3IF6A 5TBMB 2Y2QA 1TD5A 4PM5A 4O0PA 5EVLA 2VKSA 3K3DA 2B95A 4NG2A 5J3WA 5I94A 2NUPC 2O0YA 2VA0A 2XF3A 3LUQA 3KYEA 4WF0A 3FZCA 3VFFA 5EVEA 3WRZA 4FD8A 4PKYG 4KZ3A 3T50A 2WK0A 3K3CA 2ZC7A 4EETB 1X0OA 4ARZA 5HAQA 5FQMA 2P74A 4D2OA 3HJIA 4GCZA 4KQQA 2VV7A 4EQ1A 5GLAA 2Y2JA 5DF7A 5FL3A 2Y2IA 4WM9A 4CLCC 2ZBBA 3SZTA 2HP5A 4HQAA 4QPRA 2QJ5A 3VE3A 4QB8A 1HVBA 4BQMA 4S2MA 5J7EA 5A8BA 3UE6A 2J9OA 2XRNA 3M2JA 3NOPC 4WMCD 3QNCA 3OCNA 3IS2A 3RH8B 3CAXA 4R4RA 4OVDA 3HLWA 2I72A 2FFFB 4Z9QA 4B4ZA 2Y2OA 3U4LP 4MBFA 1ES3A 3KYZA 4K08A 1Z6FA 1W8QA 4HH2A 4JBFA 3LCEA 4M4XA 2IWCA 2HPBA 3PHYA 3IH8A 4B4XA 4DE0A 2EFXA 5AJGA 2GX5A 4IJGA 2JKFA 4LRYC 3S7OA 4BD0A 1JTDA 1S4SA 1MWTA 3OPHA 1LSVA 3EEAA 1MY8A 1K56A 2X71A 3BFDA 2PU2A 4ZRRA 4ME4A 4H6JB 3A3FA 2R78A 1VETA 4EUVA 1ES2A 4G3VA 3ZG7B 3SH9A 5FI7A 4OOYA 1BSGA 2X02A 4PPRA 2RCXA 3HLGA 4EBLA 3D3OA 1KGEA 3P09A 5M1AA 4DXCA 3JYIA 5JYOA 4YINA 2LB9A 3UPPA 2HJEA 3CWFA 5EE8A 2D02A 1WYCA 2JE5A 4BLMA 4E3NA 4OPYA 1EI5A 1ZKJA 2ZQAA 4WN5A 3LIAA 2H5SA 3C8CA 4LV3A 4DF6A 4CLCB 4I38A 4E3MA 2Y79A 1S4RA 3KSHA 5HZHA 3LIFA 1BULA 5HPFA 2Z2LB 4KZ8A 4WUJA 3FKWA 3VV4A 2WKPA 1FOFA 5DTTA 3Q7VB 2BLSA 4OP8A 4YWZA 4EEUA 2QHKA 4PM9A 2VK3A 4C3QA 5FI2A 2Y59A 1OT6A 1GSWA 3MKEA 1W7FA 5FQ9A 4HH3A 1SCWA 4D60A 2OLVA 4JPMA 5EM1A 2L1MA 5DJUA 1YQSA 5CRFA 2Y2GA 2VLGA 1YLTA 1FCOA 2ZQ7A 4BBVA 3ZQ5A 1V9ZA 3BW6A 3EGDC 4HY8A 5HDDA 2ACGA 1VHMA 3SS3A 3R7WB 3D72A 4PMAA 5FATA 5EV0A 3BLMA 3VP4A 2KDKA 2A2LA 3NOTC 4MCWA 4DKIA 2W3DA 1DRMA 2IA2A 4E6XA 4QHCA 3CPTB 2V0UA 1YSQA 4GDBA 3VP1A 1I2SA 4S2KA 3A0RA 4JXVA 1BLSA 3W4OA 5HD3A 3DTIA 1KVLA 3BQAA 1NJ4A 5EVIA 3UE3A 3HJKA 3PBTA 3E0YA 1YLJA 4E3LA 4BMWA 5U47A 3BFCA 3A3IA 3LIDA 1XJ6A 2INWA 5A93A 3F1NB 1PI5A 2EX8A 2PRFA 4JKTA 4RVAA 4ZJ3A 1UWNX 2V1BA 4I3JA 3GECA 3LY4A 2L4RA 3OC2A 3T1SA 4KZAA 4FH2A 4E3JA 1Q2QA 2VV8A 3GV9A 5FEGA 4GD8A 1FILA 3TOIA 3LEZA 3O86A 2XFTA 4OH0A 2OV5A 2HP6A 2PT7A 2WGWA 2XFSA 4YFMA 2ZM2A 3KSIA 3Q07A 2E8JA 3OOVA 3IX4A 1CJFA 3JVUA 4MBKA 2HV1A 3UDFA 3C38A 3FPWA 4X55A 1BLHA 4JXWA 4N1HA 4EESA 4JXGA 3CUEA 3GRJA 3ITBA 4DE2A 5DKKA 2O99A 4G3KA 3ZVWA 4QY5A 3KO6A 2OLUA 3ZCZA 2W3HA 3UO9A 5EVID 3M2KA 4OQIA 3VP0A 5EUAA 1RGZA 5K5BA 2EX9A 1S6RA 1YMXA 2W3EA 2HGVA 3ZNTA 4X1LA 5E43A 1XA1A 4PKYA 2PBDP 3OCLA 4LV0A 3C4PA 1L2SA 1MWUA 3G35A 4LV2A 1U60A 4PAUA 1K0KA 1K57A 3PAGA 3LEQA 2V1ZA 3MFDA 2JN7A 4DJ3A 1KDWA 3BYDA 1N9BA 3CITA 5L10A 1XFQA 2IWBA 1DJBA 2QKPA 3PR6A 3ZDJA 4WYYA 2H10A 3N8SA 2O9BA 4R70A 5CTNA 2EXAA 3MZFA 4UA9A 4ZDXA 3RXXA 1W8YA 4KZ9A 1TS6A 2BTFP 1HTZA 3SOIA 4Y13A 1LL9A 1C3BA 1XJ4A 3LR3A 3IXHA 1YLZA 5HSQA 2A3UA 5CHUA 2QZ6A 5DFXA 2GZAA 3KSGA 2VEAA 3IHAA 3P98A 4WLAA 4R0QA 4DJ2A 3P01A 2IWDA 1WYBA 3IXBA 3QNBA 1NZUA 4IVKA 4Z1WA 3ICYA 3SS5A 4E3KA 1YKDA 3T4QA 3MR0A 3T4JA 4P85A 2W3FA 1BT5A 3SS4A 4EQIA 2KX6A 2XA7M 4OOMA 1QMFA 4I3AA 3OPRA 1M40A 4Y5FA 3FWLA 4XT2B 1PFLA 3C7UA 4S2NA 1Q2PA 2VGKA 4JLFA 2DNSA 3H82A 3A3JA 4RX2A 2P9VA 1JNUA 4E6WA 4QU3A 3H7WA 2ZM8A 3MSHA 3PBQA 4E04A 1FSWA 3HLDA 5AVFA 1K4FA 2WKHA 5EVIC 3BRMA 4EXOA 5HPIA 4HNBA 4UA6A 2ZL1B 1GHMA 3ZG9B 4S2PA 1ESUA 1XGJA 3UB8A 2OOLA 3A3DA 4NEED 2ZC5B 1K38A 2V8FA 1N9OA 2K7SA 2JHEA 4UA7A 3Q7VA 1PWCA 2PHYA 5HWTA 4XXRA 1ALQA 4HBUA 2H28A 2K2NA 3T4OA 3UMDA 2XD1A 4WZ5A 1TDLA 3UB7A 1T1BA 1OTIA 4YOFA 3M6BA 1MXOA 1TEMA 4HJ3A 5FDSA 3QP5A 1ZHHB 5HW3A 1TF1A 4A5RA 1W63Q 2XR0A 2Y55A 1H8YA 1L3LA 1CQAA 1E3UD 3SH7A 3IF6B 1SKOB 3WS0A 5GLCA 4S2OA 5GHZA 3BFEA 3HVFA 5AVEA 3ZVTA 4OONA 4L9EA 1P97A 2V2FF 5L8MA 3WS2A 1KE4A 4FUWA 1Y4OA 2JKRI 1MWRA 4OLGA 5L09A 4PM6A 3B42A 1JWPA 3K2NA 3NI9A 1GSXA 5TFQA 4X6TA 1H0MA 2YKFA 3DW0A 2G2UA 1OJGA 1P9WA 2EX6A 3AGFA 3T4LA 1VEUB 1FSYA 4BBTA 5IS1A 2V9AA 2J3WA 2OWHA 4MMNA 4R1GA 3IT9A 3MZEA 5MC7A 1HZOA 3G2YA 3GQZA 1IYPA 4Y3IA 4L9GA 1S1YA 2Y4AA 4CLCE 4BWIA 4FOFA 1S66L 1IKIA 4X1MA 3GTCA 1CI9A 2WUQA 1SDNA 3MF0A 4EW7A 4LFUA 3RTYA 2P04A 1LL8A 4WBGA 4ESPA 2JKTI 2XEPA 1XJ3A 4JF5A 2XH9A 5CX7A 3LR0A 3HLFA 1J9MA 5TJJA 5HFOA 5F83A 1OT9A 3T1RA 1S1ZA 2J3TC 1TS7A 4HEFA 3CZDA 4JGPA 3VSKA 1L0GA 5A92A 4OQGA 3VOZA 3VSLA 4HP9A 3E4OA 2WZXA 3W8KA 1F9IA 3N8LA 1EW0A 2ZMAA 3VP2A 3IQAA 5KMWA 1XXMA 3BY9A 1NXYA 3BECA 4DE3A 2XGNA 3F1OB 3E4PA 2O9AA 1FIKA 4F94A 3Q82A 1GHPA 1PYYA 5DKLA 1FR1A 2P7JA 1BLPA 1N9NA 3V3RA 1DP9A 3OBFA 2V0WA 4JGOA 5IHVA 4C6YA 5EM0A 1XGIA 1GA9A 2WKIA 5L2FA 2Y2NA 4X68A 4CQHA 3MBZA 3C30A 5FQKA 3NDEA 3MXSA 4I5SA 3HLEA 1XPBA 1E3UA 3HUMA 1WE4A 2Y91A 5HDCA 1XFNA 1N4OA 5L07A 4NXFA 5AQAA 2M7UA 3G32A 3VOYA 2V1AA 2Y8HA 5DFYA 2W0NA 3CUEC 4U0TA 5BOHA 1JVJA 2WADA 4LRXC 3E2KA 3ZNYA 2WAEA 3IWQA 1MKIA 2BASA 2PR5A 1ERQA 3ZGAB 3CPTA 3TRCA 1STZA 4JF4A 2VZWA 2QPNA 3UNWA 1CEGA 3IWOA 5FA7A 1PIOA 1NZOA 5IT5A 4K0XA 1S0WA 2DMWA 4GD6A 1BTLA 4MN7A 1DP6A
chains in the Genus database with same CATH topology
4ARZB 3TJZC 5F5YA 2MJ6A 1T1CA 4O8GA 4HOIA 1T19A 3CUEA 5DKKA 2O99A 4GS9B 4R3AA 4UQIS 4NXEA 4B9OA 4G3KA 1UWPX 3KO6A 2W3HA 2PYRA 3NOUC 1LT0A 1LSXA 4UEYA 4IHQA 1MC0A 2W1RA 1D06A 4IUKA 3KSFA 2A24B 5TBMA 4GLQA 5K5BA 5IU1A 1OTBA 1T18A 2W3EA 2HGVA 2ZMFA 1P0ZA 4KQOA 2FZ0A 2G7UA 4MDZA 2O9CA 4UQIM 4PKYA 3TE8A 2D01A 4GHIA 1OTDA 1ODVA 2K31A 3MFXA 3FPVA 3FC7A 3OCLA 2EA9A 4BBUA 3A0VA 5TBMB 4AFIA 1TD5A 4PAUA 2KLIA 4O0PA 5DF9A 2VKSA 3K3DA 4MN5A 4Q0HA 5J3WA 3T4KA 2JN7A 3KX0X 4DJ3A 2NUPC 2O0YA 2XA7S 2VA0A 4ETXA 3LUQA 4WF0A 3MJQA 3O5YA 2M1CA 3CITA 3LIBA 4PKYG 3T50A 1XFQA 3K3CA 2QKPA 3PR6A 4EETB 3MQOA 2O9BA 1X0OA 4ARZA 4R70A 4JGQA 4HHDA 3HJIA 5J4EA 4GCZA 2HJ9C 3TW8A 2KOIA 2VV7A 4EQ1A 5FL3A 1W63M 1TS6A 4CLCC 5KSHA 1NLYA 2ZBBA 3LR4A 3PBRA 1H3QA 5F6AA 1MZUA 1XJ4A 5EFWA 4LRZE 4HQAA 2QYBA 4QPRA 2QJ5A 3LR3A 3VE3A 5HSQA 3PBOA 5DFXA 2GZAA 3KSGA 3LFVA 5J7EA 2VEAA 5A8BA 4DMZA 4LLOB 4WLAA 3BY8A 4GS9A 4DJ2A 3P01A 3UE6A 2XRNA 3MQ0A 4EEPA 3NOPC 4YNRA 4Z1WA 1NWZA 3E4QA 1N9LA 2LB5A 3OCNA 3ICYA 2B02A 3IS2A 1YKDA 3RH8B 3CAXA 4HI4A 3RFBA 3T4QA 3MR0A 3T4JA 3BWLA 2W3FA 2HF6A 3GDIA 3VE4A 2KX6A 2XA7M 4OOMA 1F98A 5DJTA 4I3AA 1H8MA 4Y5FA 3EEHA 4R6LA 2GNXA 2QJ7A 4XT2B 2L0WA 3KYZA 2VV6A 3E98A 4K08A 3H82A 4HH2A 4M4XA 4R38A 1JNUA 3CLOA 1YSPA 3G6OA 3H7WA 5F68A 3PBQA 3PHYA 4E04A 4F3LA 1TS0A 4HJ6A 5AVFA 2PD8A 2Z6DA 5AJGA 2GX5A 3LIEA 4IJGA 4GJ4A 4II7A 3IS2B 1D7EA 4EXOA 5HPIA 4LRYC 4CLCA 2I9VA 4HNBA 3EQUA 3NJAA 3S7OA 1Y28A 1S4SA 1XJ2A 2WKQA 4Q0IA 3UB8A 2OOLA 2JKRM 2W1TA 4NEED 1LSVA 3EEAA 4DN0A 4FSFA 1N9OA 2K7SA 2Z6CA 3LI8A 2JHEA 2PHYA 4ZRRA 2VJWA 4ME4A 5HWTA 3T4SA 4H6JB 2R78A 4L9FA 3UB9A 3W2ZA 4WEJA 2H28A 4EUVA 2K2NA 1NRJA 3T4OA 2VGLM 4G3VA 2NUTC 5HWVA 3UMDA 3UB7A 1T1BA 1OTIA 4YOFA 3EWKA 4HJ3A 4B93A 3H9WA 3ZYTA 1ZHHB 3LI9A 1TF1A 4NKPA 1W63Q 3D3OA 1TS8A 2CMNA 4RQ9A 1P9RA 3F1PB 4XT2A 5AVEA 2LB9A 1G6OA 2HJEA 3CWFA 2D02A 4L9EA 1P97A 1OPXA 3BQ8A 3B33A 5L8MA 4HIAA 3IBRA 4WN5A 2JKRI 4GHIB 1ZTUA 3B42A 3S7NA 3MQQA 3K2NA 1GSXA 3LIAA 2B18A 3PBSA 3C8CA 2YKFA 3LYXA 4CLCB 4I38A 4WL9A 3P7NA 2Y79A 1S4RA 3KSHA 3S7QA 3HCYA 2WKRA 3PBNA 4H6JA 2OWJA 2PR6A 1MKMA 5HZHA 2J80A 4MN6A 3LIFA 4ETZA 1OJGA 3VOLA 5HL6A 5HPFA 1P9WA 2PDRA 3T4LA 4P6ZM 4BBTA 5IS1A 4CLCD 2V9AA 2J3WA 2OWHA 3S7PA 3B47A 3UMEA 4WUJA 4MMNA 5LBRA 3U2AA 3VV4A 2WKPA 3FG8A 4WEKA 4O01A 5I5LA 3H7WB 4NXGA 4PHTA 3EGXC 2ZOHA 4YWZA 4EEUA 2QHKA 5MC7A 2PD7A 2OAP1 4P6ZS 1LSWA 4Y3IA 4L9GA 1S1YA 2YKHA 4CLCE 4BWIA 3BJNA 2W3GA 4FOFA 1OT6A 1S66L 1GSWA 2J3TD 2W27A 3UB6A 1NLZA 4HH3A 2L1MA 3MF0A 4EW7A 5DJUA 3RTYA 2P04A 4I3IA 2ZOIA 1LL8A 2VLGA 3F1PA 4BBVA 3ZQ5A 2JKTI 4F3LB 1V9ZA 3BW6A 3EGDC 4HY8A 5HDDA 1VHMA 1XJ3A 3PXPA 1VB6A 5CX7A 3LR0A 3R7WB 3D72A 4Q0JA 5TJJA 4GW9A 1OT9A 3PYPA 2KDKA 1UGUA 5HD5A 2A2LA 1V9YA 3NOTC 1S1ZA 4MCWA 3JVVA 2J3TC 2A24A 1TS7A 3V67A 2W3DA 3H82B 4JGPA 4BJPA 1DRMA 2IA2A 4IUHA 4LPZA 2VGLS 2V0UA 4HP9A 1YSQA 3E4OA 1IOUA 1F9IA 1EW0A 2XROA 4KUOA 3SW1A 3NHQA 4NXBA 3BY9A 4HJ4A 2W1TB 4KUKA 4JGRA 3F1OB 1KOUA 3E4PA 2O9AA 3A0RA 4EU0A 4KQDA 2ZMVA 4Y2FA 5HD3A 5DKLA 1BYWA 5HWWA 3BQAA 5F69A 3UE3A 2P7JA 3LICA 3HJKA 1F5MA 1N9NA 3EOIA 5HDSA 3PBTA 3E0YA 3OLOA 1DP9A 3OBFA 2V0WA 4BMWA 1GSVA 4JGOA 3LIDA 1XJ6A 2INWA 3F1NB 2FH5A 3ULFA 5C5KA 2XSSA 3R4KA 4CQHA 3C30A 4OOLA 4WELA 4I5SA 1UWNX 2V1BA 4I3JA 3GECA 2QWSA 3MXQA 3OC2A 2L4RA 1XFNA 5HDCA 2EWWA 3T4TA 3EQVA 2GJ3A 5G4YA 3MMHA 1G28A 4NXFA 2VV8A 2M7UA 3R7WA 2P08A 2V1AA 3IBJA 3F1NA 2Y8HA 4HP4A 5DFYA 2W0NA 3CUEC 2JKTM 2PT7A 2PYPA 4I39A 3C2WA 1OTAA 3A0SA 3DBAA 4LRXC 2BASA 2PR5A 3KSIA 1T1AA 5KIZA 3F1OA 2M7VA 3TRCA 1OTEA 3OOVA 1STZA 2EWVA 1WA9A 2OAQ1 1DP8A 2VZWA 4EESA 1S67L 3JVUA 4EERA 2HV1A 3CI6A 5G4ZA 5IT5A 3C38A 3FPWA 1YAXA 4G3WA 1IFQA 4L0LA 2VX8A 2DMWA 3LR5A 4MN7A 1DP6A 1OJ5A 3KYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E4Q A;  2A24 A;  1TS7 A;  1N9L A;  4XT2 A;  5F5Y A;  1T1C A;  3H82 B;  4HOI A;  4JGP A;  1DRM A;  1T19 A;  3ICY A;  2B02 A;  3IS2 A;  4LPZ A;  5AVE A;  3RH8 B;  3CAX A;  3CWF A;  2V0U A;  4HI4 A;  2D02 A;  4HP9 A;  4EEP A;  3E4O A;  3MR0 A;  3BWL A;  1F9I A;  1P97 A;  4L9E A;  4R38 A;  1EW0 A;  3B33 A;  3GDI A;  4HIA A;  3IBR A;  4GS9 B;  4KUO A;  4R3A A;  4NXE A;  4WN5 A;  3VE4 A;  4B9O A;  3NHQ A;  3SW1 A;  2KX6 A;  1UWP X;  4NXB A;  1F98 A;  3BY9 A;  2PYR A;  3NOU C;  4GHI B;  1LT0 A;  4HJ4 A;  5DJT A;  3MQQ A;  4I3A A;  1LSX A;  3VOL A;  4KUK A;  1GSX A;  3LIA A;  4JGR A;  3EEH A;  3F1O B;  1KOU A;  1D06 A;  4R6L A;  3E4P A;  2A24 B;  2QJ7 A;  2YKF A;  2L0W A;  3A0R A;  3C8C A;  3LYX A;  4XT2 B;  2VV6 A;  4KQD A;  5TBM A;  4K08 A;  4I38 A;  4WL9 A;  3P7N A;  3H82 A;  1OTB A;  1S4R A;  5HD3 A;  5IU1 A;  1T18 A;  4HH2 A;  5DKL A;  1BYW A;  5HWW A;  1P0Z A;  2WKR A;  4H6J A;  2OWJ A;  2PR6 A;  5F69 A;  5HZH A;  2J80 A;  4M4X A;  2P7J A;  3LIC A;  3LIF A;  4MN6 A;  1JNU A;  2D01 A;  3HJK A;  4GHI A;  1OJG A;  1OTD A;  1ODV A;  1N9N A;  3CLO A;  3G6O A;  3H7W A;  3MFX A;  3FC7 A;  3OLO A;  5HDS A;  5F68 A;  1DP9 A;  5DKK A;  2PDR A;  3PHY A;  4E04 A;  2EA9 A;  4BBU A;  2V0W A;  3A0V A;  1GSV A;  4JGO A;  4F3L A;  1TS0 A;  4HJ6 A;  5TBM B;  5AVF A;  4BBT A;  5IS1 A;  3LID A;  2PD8 A;  1XJ6 A;  2INW A;  2V9A A;  2OWH A;  2Z6D A;  3K3D A;  4MN5 A;  3F1N B;  5J3W A;  3LIE A;  4WUJ A;  3ULF A;  2JN7 A;  3IS2 B;  3KX0 X;  4DJ3 A;  1D7E A;  4EXO A;  4LRY C;  2I9V A;  2WKP A;  3FG8 A;  3LUQ A;  3NJA A;  4HNB A;  4WF0 A;  5I5L A;  3H7W B;  1Y28 A;  3MJQ A;  4NXG A;  1S4S A;  4I5S A;  1UWN X;  2M1C A;  2V1B A;  3LIB A;  1XJ2 A;  4I3J A;  3GEC A;  4PKY G;  2WKQ A;  2QWS A;  2ZOH A;  4YWZ A;  1XFQ A;  3T50 A;  2QHK A;  4EEU A;  3K3C A;  3MXQ A;  2L4R A;  1XFN A;  2PD7 A;  2OOL A;  2QKP A;  5HDC A;  3UB8 A;  1LSV A;  4EET B;  2GJ3 A;  1LSW A;  5G4Y A;  4L9G A;  3MQO A;  1S1Y A;  1G28 A;  2YKH A;  4NXF A;  1X0O A;  1N9O A;  1OT6 A;  2K7S A;  1S66 L;  1GSW A;  2VV8 A;  2Z6C A;  3LI8 A;  4JGQ A;  4HHD A;  4R70 A;  2JHE A;  2W27 A;  3UB6 A;  2V1A A;  3HJI A;  5J4E A;  2PHY A;  3F1N A;  4GCZ A;  2VV7 A;  4HH3 A;  5HWT A;  4HP4 A;  4EQ1 A;  4H6J B;  2W0N A;  2R78 A;  4L9F A;  3UB9 A;  2PYP A;  4I39 A;  2L1M A;  2H28 A;  3C2W A;  1TS6 A;  5DJU A;  1OTA A;  3A0S A;  3RTY A;  4EW7 A;  4I3I A;  2ZOI A;  1LL8 A;  2VLG A;  4LRX C;  3F1P A;  2ZBB A;  4BBV A;  3ZQ5 A;  4F3L B;  2BAS A;  5F6A A;  1V9Z A;  2PR5 A;  5HWV A;  4HY8 A;  1T1A A;  1MZU A;  1XJ4 A;  5HDD A;  5EFW A;  4LRZ E;  4HQA A;  3UB7 A;  3UMD A;  5KIZ A;  2QJ5 A;  3F1O A;  1XJ3 A;  1T1B A;  1VB6 A;  1OTI A;  1OTE A;  3EWK A;  3VE3 A;  4HJ3 A;  5HSQ A;  1WA9 A;  3H9W A;  1DP8 A;  3D72 A;  1S67 L;  3LI9 A;  1TS8 A;  4GW9 A;  4EER A;  2HV1 A;  5J7E A;  1OT9 A;  2VEA A;  5G4Z A;  2CMN A;  5A8B A;  4LLO B;  3PYP A;  4WLA A;  3BY8 A;  4GS9 A;  4PKY A;  4RQ9 A;  4DJ2 A;  2KDK A;  1UGU A;  5HD5 A;  3UE6 A;  1V9Y A;  3NOT C;  1S1Z A;  3F1P B;  3UME A;  3NOP C;  1DP6 A;  1OJ5 A;  4EES A;  1NWZ A; 
#chains in the Genus database with same CATH topology
 4ARZ B;  3DAV A;  4O8G A;  4HOI A;  1XX2 A;  3DTE A;  2HDS A;  4GS9 B;  4B9O A;  1NRF A;  1NY0 A;  1UWP X;  2PYR A;  3NOU C;  3CJM A;  3RJU A;  1F2K A;  5CHJ A;  3KSF A;  2UV0 E;  4UAA A;  5IU1 A;  3N4I A;  4P0M A;  5DVA A;  3BM6 A;  4MDZ A;  1K6R A;  3TE8 A;  3UDX A;  1OTD A;  2K31 A;  1CI8 A;  3Q81 A;  3C5A A;  1XKZ A;  1E25 A;  4M3K A;  1K4E A;  4ID4 A;  5DF9 A;  2QMI A;  5FI6 A;  4ZJ2 A;  3KX0 X;  3M6H A;  4N92 A;  1E4D A;  2Q9M A;  1PWD A;  1RP5 A;  3E2L A;  2ZC3 B;  3O5Y A;  3LIB A;  5DTS A;  3N8R A;  3L9K A;  2XD5 A;  4HHD A;  1PW8 A;  3TW8 A;  1H5X A;  2ZQC A;  2ZC6 B;  3VMA A;  3FKV A;  1W63 M;  3DTM A;  2C5W B;  3G34 A;  5DF8 A;  5KSH A;  1NLY A;  3PBR A;  1H3Q A;  3QP6 A;  1Y54 A;  5GLD A;  1MZU A;  5EFW A;  4LRZ E;  3T12 B;  2QYB A;  2WYX A;  1BLC A;  1CEF A;  2Y2P A;  4S2I A;  3O3V A;  3LFV A;  1PI4 A;  4DMZ A;  4LLO B;  4GS9 A;  3NUL A;  5CGS A;  3IH9 A;  3MQ0 A;  4X53 A;  3E4Q A;  5FDH A;  1N9L A;  2LB5 A;  3NIA A;  5EPH A;  1LL5 A;  2B02 A;  4JXS A;  1EWZ A;  3BWL A;  2JBF A;  2HF6 A;  3GDI A;  5HAI A;  3HL9 A;  3QP1 A;  5DJT A;  2Q0O A;  3EEH A;  4DDS A;  2L0W A;  2VV6 A;  3E98 A;  2BG1 A;  2G2W A;  4OKP A;  1A0K A;  2ZL1 A;  1CK3 A;  4R38 A;  2PU4 A;  2WGW B;  3CLO A;  1YSP A;  3WS5 A;  5CHM A;  3QHY A;  5M18 A;  1ZC2 A;  4S2N C;  1TS0 A;  5EOO A;  5TGF A;  2Z2M B;  3NC8 A;  2Z6D A;  3LIE A;  5CEB A;  4OPZ A;  3IS2 B;  1D7E A;  3GR2 A;  5CER A;  1VM1 A;  4CLC A;  3EQU A;  3ZHH A;  1Y28 A;  2JKG A;  4QD4 A;  1AXB A;  2Q9N A;  2JKR M;  2W1T A;  1IEL A;  5GHX A;  3QP2 A;  2CC1 A;  4DN0 A;  4R3J A;  2Z6C A;  3LI8 A;  5AQB A;  5F1F A;  5CGW A;  1JTG A;  4BD1 A;  1IYS A;  1W5D A;  3G31 A;  3HLC A;  2VGL M;  4O7D A;  1K6S A;  1JWV A;  4Y0T A;  3EWK A;  4B93 A;  3ZYT A;  4CJN A;  1K56 D;  3LI9 A;  2CMN A;  3G30 A;  1DJC A;  1M6K A;  1I5Q A;  3AGD A;  4JF6 A;  3T1X A;  3B33 A;  4HIA A;  3IBR A;  3GVB A;  1ES4 A;  4GHI B;  1K57 C;  3S7N A;  3MQQ A;  4EBN A;  3C7V A;  2B18 A;  1YLY A;  1L0D A;  1DJA A;  4GNU A;  5KSC A;  4NK3 A;  4WL9 A;  3P7N A;  3HUO A;  3S7Q A;  5M19 A;  2WKR A;  4H6J A;  2J80 A;  1YLP A;  4MN6 A;  4Y0U A;  5HL6 A;  3QP8 A;  5EEC A;  1LLB A;  1FCN A;  4LEN A;  4P6Z M;  4MNR A;  4U3T A;  2Y2K A;  2HDR A;  4KG5 A;  5LBR A;  1HLU P;  3U2A A;  3FG8 A;  3MZD A;  1K55 A;  4O01 A;  3H7W B;  3TSG A;  1AWI A;  1IEM A;  2ZOH A;  4ZAM A;  3N6I A;  2PD7 A;  2X01 A;  1LSW A;  4IBR A;  2YKH A;  2W3G A;  2J3T D;  3UB6 A;  1L0E A;  1NLZ A;  1FCM A;  1FR6 A;  3S22 A;  2JCH A;  2XDM A;  3NY4 A;  1G6A A;  4B88 A;  1TDG A;  3WS1 A;  2ZOI A;  2C6W B;  2HZ5 A;  4F3L B;  5HAP A;  5AQ9 A;  3IWI A;  4KG2 A;  1VB6 A;  1KGF A;  3V50 A;  1ERO A;  3UB5 P;  2GDN A;  2AVX A;  3LO7 A;  2R9W A;  4NET A;  1HD8 A;  2XQZ A;  1BUE A;  1UGU A;  4LCM A;  5HD5 A;  1V9Y A;  4K0W A;  4N1X A;  3V67 A;  1ONG A;  4BJP A;  1KE3 A;  4IUH A;  3D4F A;  3HLB A;  3ZG5 A;  5GHY A;  3V5M A;  3ZFZ A;  3DTK A;  3OZH A;  4HJ4 A;  2W1T B;  3MS6 A;  4BL3 A;  4KUK A;  4Y15 A;  1KOU A;  4GB7 A;  5CGX A;  1K55 C;  5E2F A;  5E2E A;  4Y2F A;  3SH8 A;  5HWW A;  1GCE A;  1LI9 A;  1F5M A;  3EOI A;  4ZTK A;  1YMS A;  3UPO A;  1GSV A;  4DDY A;  1J3W A;  1PWG A;  5C5K A;  2WZZ A;  1DY6 A;  2XSS A;  3R4K A;  4LCL A;  4RA7 A;  5FQJ A;  4QJG A;  4OOL A;  1VET B;  3UN7 A;  1YPR A;  4WEL A;  4KZ6 A;  3BLS A;  2EWW A;  3EQV A;  4WZ4 A;  5FEF A;  5G4Y A;  1LHY A;  2Y2H A;  2ZQ9 A;  2P08 A;  3F1N A;  2JKT M;  4I39 A;  3C2W A;  3DBA A;  2H0Y A;  3VFH A;  1I2W A;  1QME A;  4OP5 A;  4KZ7 A;  3UDI A;  1WA9 A;  2OAQ 1;  1S67 L;  3UY6 A;  3W4P A;  1RCJ A;  4GOG A;  4EER A;  1JWZ A;  5G4Z A;  4Y0O A;  1IFQ A;  3V39 A;  4L0L A;  1SZV A;  3LR5 A;  1OJ5 A;  4GZB A;  5F5Y A;  3TJZ C;  2MJ6 A;  1T1C A;  2XLN A;  1T19 A;  4S2L A;  4H8R A;  3LY3 A;  1MPL A;  4X56 A;  3S1Y A;  2V8C A;  4MEZ A;  1K54 A;  1LSX A;  4UEY A;  4IHQ A;  2W1R A;  5KZH A;  3B3X A;  3GMW A;  5GL9 A;  2A24 B;  3G2Z A;  4GLQ A;  5G18 A;  2VGJ A;  5F1G A;  2ZMF A;  5HL1 A;  1P0Z A;  3ISG A;  4UQI M;  5AQ7 A;  2E8I A;  5CTM A;  2XK1 A;  4BBU A;  3A0V A;  5CEC A;  4MBH A;  4AFI A;  2KLI A;  4MN5 A;  4Q0H A;  2V20 A;  4R23 A;  3T4K A;  3UE1 A;  2XA7 S;  5EVI B;  2RL3 A;  4ETX A;  1YT4 A;  4QWO A;  2R9X A;  3BEB A;  4DE1 A;  1IYO A;  3PTE A;  3MJQ A;  4ZJ1 A;  3T1Q B;  2M1C A;  1KE0 A;  5E2H A;  2JC7 A;  3MQO A;  3A3E A;  5CXW A;  3IXD A;  4JGQ A;  2OSU A;  5J4E A;  3O88 A;  2HJ9 C;  2KOI A;  3I7J A;  1PW1 A;  5DTK A;  1ERM A;  3ITA A;  5TR7 A;  3LR4 A;  5F6A A;  3JPU A;  3IF5 A;  3S4X A;  3G4P A;  4C75 A;  5HX9 A;  2B5R A;  3DWK A;  2J9P A;  2ZQ8 A;  3PBO A;  4WMC A;  1NYY A;  4FH4 A;  1ZG6 A;  3BY8 A;  3Q1F A;  3NDG A;  4EEP A;  4YNR A;  1NWZ A;  1IKG A;  1KVM A;  4P6B A;  4QY6 A;  3UPN A;  4HI4 A;  3RFB A;  3L7H A;  3VE4 A;  4HES A;  3D9Y A;  4E3O A;  1F98 A;  3NBL A;  3NCK A;  4IVI A;  1H8M A;  1PNE A;  4R6L A;  2GNX A;  2QJ7 A;  4N9K A;  3WRT A;  4UHU A;  1Z09 A;  5FAP A;  1IYQ A;  3G6O A;  3DWZ A;  5F68 A;  4F3L A;  4HJ6 A;  2J8Y A;  1PZP A;  2PD8 A;  3C4O A;  1K54 C;  4GJ4 A;  4II7 A;  3ZG8 B;  2ZQD A;  4KZ4 A;  5FAQ A;  5J8X A;  2I9V A;  3NJA A;  4R3B A;  1LI0 A;  4KQR A;  1OME A;  1XJ2 A;  2WKQ A;  4Q0I A;  2FFY A;  4XUZ A;  4RYE A;  2J7V A;  4LGW A;  4FSF A;  1CF0 A;  2VJW A;  5D3O A;  3T4S A;  4L9F A;  3UB9 A;  5FSR A;  3W2Z A;  2H0T A;  3V3S A;  4WEJ A;  2HDU A;  5HAR A;  1NRJ A;  1GHI A;  4E3I A;  2NUT C;  1XP4 A;  5HWV A;  1KGG A;  4OQ0 A;  4S2J A;  4GKU A;  4U0X A;  4X25 A;  3H9W A;  3PAE A;  4NKP A;  4FCF A;  1TS8 A;  2P9V B;  3WWX A;  1YM1 A;  4RQ9 A;  1P9R A;  4X69 A;  4MLL A;  3F1P B;  3IF6 C;  1ACF A;  4XT2 A;  3OPP A;  3MKF A;  4WZ5 C;  4DXB A;  1G6O A;  1ESI A;  3CMZ A;  1OPX A;  3BQ8 A;  3N7W A;  4Y17 A;  1NYM A;  4IED A;  1H8Z A;  1SKF A;  1FQG A;  1ZTU A;  3RXW A;  1TVF A;  3PBS A;  3FYZ A;  3LYX A;  4GN2 A;  4Q8I A;  4LV1 A;  4K91 A;  2EX2 A;  3HCY A;  3PBN A;  2OWJ A;  2PR6 A;  1MKM A;  1ONH A;  4ZBE A;  1O7E A;  1YLW A;  5FQQ A;  4ETZ A;  3VOL A;  2DCF A;  2PDR A;  3LGO A;  1GA0 A;  5FQI A;  4CLC D;  1BZA A;  3S7P A;  3B47 A;  3UME A;  2EXB A;  4EWF A;  2Y2L A;  4WEK A;  5I5L A;  3UE0 A;  4NXG A;  4PHT A;  3GSG A;  3EGX C;  3HRE A;  3AGE A;  2OAP 1;  4P6Z S;  1RGY A;  3BJN A;  2W27 A;  3QP4 A;  1G5U A;  4CPK A;  4OPQ A;  4I3I A;  5JYP A;  3F1P A;  1SKO A;  1W79 A;  4KZB A;  5E2G A;  4OPR A;  3CG5 A;  3PXP A;  4DRT A;  4Q0J A;  4GW9 A;  4OQH A;  2ZLY A;  3PYP A;  2A49 A;  3JVV A;  2A24 A;  3BFF A;  5FAS A;  1O07 A;  3H82 B;  4PM7 A;  4LPZ A;  4FTX A;  2VGL S;  1IOU A;  2XRO A;  1G68 A;  4KUO A;  3SW1 A;  3NHQ A;  4NXB A;  5GLB A;  2ZM0 A;  4JGR A;  4EU0 A;  4EBP A;  3OPL A;  4KQD A;  4R4S A;  3W4Q A;  2ZMV A;  1BYW A;  3ZG0 A;  5F69 A;  4HBT A;  3LIC A;  1L0F A;  4BL2 A;  3O87 A;  5HDS A;  3OLO A;  1SDE A;  5A91 A;  1KDS A;  2WAF A;  3MXR A;  2FH5 A;  3ULF A;  3BFG A;  2PBY A;  2EFU A;  1SHV A;  3CHW P;  3FV7 A;  3WS4 A;  2WGV A;  1D1J A;  1K25 A;  2QWS A;  3IX8 A;  5CED A;  3MXQ A;  3T4T A;  2HP9 A;  2GJ3 A;  5FAO A;  3MMH A;  1VEU A;  1G28 A;  2ZD8 A;  1XA7 A;  1PZO A;  2PAV P;  4KG6 A;  3R7W A;  3IBJ A;  3Q7Z A;  1ZG4 A;  4HP4 A;  4PM8 A;  2PYP A;  4BEN A;  1VQQ A;  1OTA A;  3A0S A;  2ZC4 B;  2UWX A;  1T1A A;  5KIZ A;  3F1O A;  1ES5 A;  4IBX A;  2M7V A;  3VP3 A;  1OTE A;  2EWV A;  1DP8 A;  3IX3 A;  5A90 A;  2DRW A;  3CI6 A;  2Y2M A;  2ZJ9 A;  2WGI A;  1YAX A;  4G3W A;  2WKE A;  2VX8 A;  4RX3 A;  3KYQ A;  4KEN B;  4EV4 A;  3NEC A;  3HUN A;  4EUZ A;  4R3A A;  4UQI S;  4NXE A;  1PRQ A;  4KZ5 A;  3TG9 A;  4GDN A;  4OLD A;  1LT0 A;  2HDQ A;  1MC0 A;  1D06 A;  4IUK A;  3IXG A;  5TBM A;  1MBL A;  5F82 A;  3HBR A;  1OTB A;  1T18 A;  4P87 A;  4Y7P A;  4KQO A;  2FZ0 A;  2G7U A;  4XUX A;  2O9C A;  4N9L A;  2D01 A;  4GHI A;  1ODV A;  3FPV A;  1MWS A;  3MFX A;  5EOE A;  3IHB A;  3FC7 A;  2EA9 A;  3IF6 A;  5TBM B;  2Y2Q A;  1TD5 A;  4PM5 A;  4O0P A;  5EVL A;  2VKS A;  3K3D A;  2B95 A;  4NG2 A;  5J3W A;  5I94 A;  2NUP C;  2O0Y A;  2VA0 A;  2XF3 A;  3LUQ A;  3KYE A;  4WF0 A;  3FZC A;  3VFF A;  5EVE A;  3WRZ A;  4FD8 A;  4PKY G;  4KZ3 A;  3T50 A;  2WK0 A;  3K3C A;  2ZC7 A;  4EET B;  1X0O A;  4ARZ A;  5HAQ A;  5FQM A;  2P74 A;  4D2O A;  3HJI A;  4GCZ A;  4KQQ A;  2VV7 A;  4EQ1 A;  5GLA A;  2Y2J A;  5DF7 A;  5FL3 A;  2Y2I A;  4WM9 A;  4CLC C;  2ZBB A;  3SZT A;  2HP5 A;  4HQA A;  4QPR A;  2QJ5 A;  3VE3 A;  4QB8 A;  1HVB A;  4BQM A;  4S2M A;  5J7E A;  5A8B A;  3UE6 A;  2J9O A;  2XRN A;  3M2J A;  3NOP C;  4WMC D;  3QNC A;  3OCN A;  3IS2 A;  3RH8 B;  3CAX A;  4R4R A;  4OVD A;  3HLW A;  2I72 A;  2FFF B;  4Z9Q A;  4B4Z A;  2Y2O A;  3U4L P;  4MBF A;  1ES3 A;  3KYZ A;  4K08 A;  1Z6F A;  1W8Q A;  4HH2 A;  4JBF A;  3LCE A;  4M4X A;  2IWC A;  2HPB A;  3PHY A;  3IH8 A;  4B4X A;  4DE0 A;  2EFX A;  5AJG A;  2GX5 A;  4IJG A;  2JKF A;  4LRY C;  3S7O A;  4BD0 A;  1JTD A;  1S4S A;  1MWT A;  3OPH A;  1LSV A;  3EEA A;  1MY8 A;  1K56 A;  2X71 A;  3BFD A;  2PU2 A;  4ZRR A;  4ME4 A;  4H6J B;  3A3F A;  2R78 A;  1VET A;  4EUV A;  1ES2 A;  4G3V A;  3ZG7 B;  3SH9 A;  5FI7 A;  4OOY A;  1BSG A;  2X02 A;  4PPR A;  2RCX A;  3HLG A;  4EBL A;  3D3O A;  1KGE A;  3P09 A;  5M1A A;  4DXC A;  3JYI A;  5JYO A;  4YIN A;  2LB9 A;  3UPP A;  2HJE A;  3CWF A;  5EE8 A;  2D02 A;  1WYC A;  2JE5 A;  4BLM A;  4E3N A;  4OPY A;  1EI5 A;  1ZKJ A;  2ZQA A;  4WN5 A;  3LIA A;  2H5S A;  3C8C A;  4LV3 A;  4DF6 A;  4CLC B;  4I38 A;  4E3M A;  2Y79 A;  1S4R A;  3KSH A;  5HZH A;  3LIF A;  1BUL A;  5HPF A;  2Z2L B;  4KZ8 A;  4WUJ A;  3FKW A;  3VV4 A;  2WKP A;  1FOF A;  5DTT A;  3Q7V B;  2BLS A;  4OP8 A;  4YWZ A;  4EEU A;  2QHK A;  4PM9 A;  2VK3 A;  4C3Q A;  5FI2 A;  2Y59 A;  1OT6 A;  1GSW A;  3MKE A;  1W7F A;  5FQ9 A;  4HH3 A;  1SCW A;  4D60 A;  2OLV A;  4JPM A;  5EM1 A;  2L1M A;  5DJU A;  1YQS A;  5CRF A;  2Y2G A;  2VLG A;  1YLT A;  1FCO A;  2ZQ7 A;  4BBV A;  3ZQ5 A;  1V9Z A;  3BW6 A;  3EGD C;  4HY8 A;  5HDD A;  2ACG A;  1VHM A;  3SS3 A;  3R7W B;  3D72 A;  4PMA A;  5FAT A;  5EV0 A;  3BLM A;  3VP4 A;  2KDK A;  2A2L A;  3NOT C;  4MCW A;  4DKI A;  2W3D A;  1DRM A;  2IA2 A;  4E6X A;  4QHC A;  3CPT B;  2V0U A;  1YSQ A;  4GDB A;  3VP1 A;  1I2S A;  4S2K A;  3A0R A;  4JXV A;  1BLS A;  3W4O A;  5HD3 A;  3DTI A;  1KVL A;  3BQA A;  1NJ4 A;  5EVI A;  3UE3 A;  3HJK A;  3PBT A;  3E0Y A;  1YLJ A;  4E3L A;  4BMW A;  5U47 A;  3BFC A;  3A3I A;  3LID A;  1XJ6 A;  2INW A;  5A93 A;  3F1N B;  1PI5 A;  2EX8 A;  2PRF A;  4JKT A;  4RVA A;  4ZJ3 A;  1UWN X;  2V1B A;  4I3J A;  3GEC A;  3LY4 A;  2L4R A;  3OC2 A;  3T1S A;  4KZA A;  4FH2 A;  4E3J A;  1Q2Q A;  2VV8 A;  3GV9 A;  5FEG A;  4GD8 A;  1FIL A;  3TOI A;  3LEZ A;  3O86 A;  2XFT A;  4OH0 A;  2OV5 A;  2HP6 A;  2PT7 A;  2WGW A;  2XFS A;  4YFM A;  2ZM2 A;  3KSI A;  3Q07 A;  2E8J A;  3OOV A;  3IX4 A;  1CJF A;  3JVU A;  4MBK A;  2HV1 A;  3UDF A;  3C38 A;  3FPW A;  4X55 A;  1BLH A;  4JXW A;  4N1H A;  4EES A;  4JXG A;  3CUE A;  3GRJ A;  3ITB A;  4DE2 A;  5DKK A;  2O99 A;  4G3K A;  3ZVW A;  4QY5 A;  3KO6 A;  2OLU A;  3ZCZ A;  2W3H A;  3UO9 A;  5EVI D;  3M2K A;  4OQI A;  3VP0 A;  5EUA A;  1RGZ A;  5K5B A;  2EX9 A;  1S6R A;  1YMX A;  2W3E A;  2HGV A;  3ZNT A;  4X1L A;  5E43 A;  1XA1 A;  4PKY A;  2PBD P;  3OCL A;  4LV0 A;  3C4P A;  1L2S A;  1MWU A;  3G35 A;  4LV2 A;  1U60 A;  4PAU A;  1K0K A;  1K57 A;  3PAG A;  3LEQ A;  2V1Z A;  3MFD A;  2JN7 A;  4DJ3 A;  1KDW A;  3BYD A;  1N9B A;  3CIT A;  5L10 A;  1XFQ A;  2IWB A;  1DJB A;  2QKP A;  3PR6 A;  3ZDJ A;  4WYY A;  2H10 A;  3N8S A;  2O9B A;  4R70 A;  5CTN A;  2EXA A;  3MZF A;  4UA9 A;  4ZDX A;  3RXX A;  1W8Y A;  4KZ9 A;  1TS6 A;  2BTF P;  1HTZ A;  3SOI A;  4Y13 A;  1LL9 A;  1C3B A;  1XJ4 A;  3LR3 A;  3IXH A;  1YLZ A;  5HSQ A;  2A3U A;  5CHU A;  2QZ6 A;  5DFX A;  2GZA A;  3KSG A;  2VEA A;  3IHA A;  3P98 A;  4WLA A;  4R0Q A;  4DJ2 A;  3P01 A;  2IWD A;  1WYB A;  3IXB A;  3QNB A;  1NZU A;  4IVK A;  4Z1W A;  3ICY A;  3SS5 A;  4E3K A;  1YKD A;  3T4Q A;  3MR0 A;  3T4J A;  4P85 A;  2W3F A;  1BT5 A;  3SS4 A;  4EQI A;  2KX6 A;  2XA7 M;  4OOM A;  1QMF A;  4I3A A;  3OPR A;  1M40 A;  4Y5F A;  3FWL A;  4XT2 B;  1PFL A;  3C7U A;  4S2N A;  1Q2P A;  2VGK A;  4JLF A;  2DNS A;  3H82 A;  3A3J A;  4RX2 A;  2P9V A;  1JNU A;  4E6W A;  4QU3 A;  3H7W A;  2ZM8 A;  3MSH A;  3PBQ A;  4E04 A;  1FSW A;  3HLD A;  5AVF A;  1K4F A;  2WKH A;  5EVI C;  3BRM A;  4EXO A;  5HPI A;  4HNB A;  4UA6 A;  2ZL1 B;  1GHM A;  3ZG9 B;  4S2P A;  1ESU A;  1XGJ A;  3UB8 A;  2OOL A;  3A3D A;  4NEE D;  2ZC5 B;  1K38 A;  2V8F A;  1N9O A;  2K7S A;  2JHE A;  4UA7 A;  3Q7V A;  1PWC A;  2PHY A;  5HWT A;  4XXR A;  1ALQ A;  4HBU A;  2H28 A;  2K2N A;  3T4O A;  3UMD A;  2XD1 A;  4WZ5 A;  1TDL A;  3UB7 A;  1T1B A;  1OTI A;  4YOF A;  3M6B A;  1MXO A;  1TEM A;  4HJ3 A;  5FDS A;  3QP5 A;  1ZHH B;  5HW3 A;  1TF1 A;  4A5R A;  1W63 Q;  2XR0 A;  2Y55 A;  1H8Y A;  1L3L A;  1CQA A;  1E3U D;  3SH7 A;  3IF6 B;  1SKO B;  3WS0 A;  5GLC A;  4S2O A;  5GHZ A;  3BFE A;  3HVF A;  5AVE A;  3ZVT A;  4OON A;  4L9E A;  1P97 A;  2V2F F;  5L8M A;  3WS2 A;  1KE4 A;  4FUW A;  1Y4O A;  2JKR I;  1MWR A;  4OLG A;  5L09 A;  4PM6 A;  3B42 A;  1JWP A;  3K2N A;  3NI9 A;  1GSX A;  5TFQ A;  4X6T A;  1H0M A;  2YKF A;  3DW0 A;  2G2U A;  1OJG A;  1P9W A;  2EX6 A;  3AGF A;  3T4L A;  1VEU B;  1FSY A;  4BBT A;  5IS1 A;  2V9A A;  2J3W A;  2OWH A;  4MMN A;  4R1G A;  3IT9 A;  3MZE A;  5MC7 A;  1HZO A;  3G2Y A;  3GQZ A;  1IYP A;  4Y3I A;  4L9G A;  1S1Y A;  2Y4A A;  4CLC E;  4BWI A;  4FOF A;  1S66 L;  1IKI A;  4X1M A;  3GTC A;  1CI9 A;  2WUQ A;  1SDN A;  3MF0 A;  4EW7 A;  4LFU A;  3RTY A;  2P04 A;  1LL8 A;  4WBG A;  4ESP A;  2JKT I;  2XEP A;  1XJ3 A;  4JF5 A;  2XH9 A;  5CX7 A;  3LR0 A;  3HLF A;  1J9M A;  5TJJ A;  5HFO A;  5F83 A;  1OT9 A;  3T1R A;  1S1Z A;  2J3T C;  1TS7 A;  4HEF A;  3CZD A;  4JGP A;  3VSK A;  1L0G A;  5A92 A;  4OQG A;  3VOZ A;  3VSL A;  4HP9 A;  3E4O A;  2WZX A;  3W8K A;  1F9I A;  3N8L A;  1EW0 A;  2ZMA A;  3VP2 A;  3IQA A;  5KMW A;  1XXM A;  3BY9 A;  1NXY A;  3BEC A;  4DE3 A;  2XGN A;  3F1O B;  3E4P A;  2O9A A;  1FIK A;  4F94 A;  3Q82 A;  1GHP A;  1PYY A;  5DKL A;  1FR1 A;  2P7J A;  1BLP A;  1N9N A;  3V3R A;  1DP9 A;  3OBF A;  2V0W A;  4JGO A;  5IHV A;  4C6Y A;  5EM0 A;  1XGI A;  1GA9 A;  2WKI A;  5L2F A;  2Y2N A;  4X68 A;  4CQH A;  3MBZ A;  3C30 A;  5FQK A;  3NDE A;  3MXS A;  4I5S A;  3HLE A;  1XPB A;  1E3U A;  3HUM A;  1WE4 A;  2Y91 A;  5HDC A;  1XFN A;  1N4O A;  5L07 A;  4NXF A;  5AQA A;  2M7U A;  3G32 A;  3VOY A;  2V1A A;  2Y8H A;  5DFY A;  2W0N A;  3CUE C;  4U0T A;  5BOH A;  1JVJ A;  2WAD A;  4LRX C;  3E2K A;  3ZNY A;  2WAE A;  3IWQ A;  1MKI A;  2BAS A;  2PR5 A;  1ERQ A;  3ZGA B;  3CPT A;  3TRC A;  1STZ A;  4JF4 A;  2VZW A;  2QPN A;  3UNW A;  1CEG A;  3IWO A;  5FA7 A;  1PIO A;  1NZO A;  5IT5 A;  4K0X A;  1S0W A;  2DMW A;  4GD6 A;  1BTL A;  4MN7 A;  1DP6 A; 
#chains in the Genus database with same CATH homology
 4ARZ B;  3TJZ C;  5F5Y A;  2MJ6 A;  1T1C A;  4O8G A;  4HOI A;  1T19 A;  3CUE A;  5DKK A;  2O99 A;  4GS9 B;  4R3A A;  4UQI S;  4NXE A;  4B9O A;  4G3K A;  1UWP X;  3KO6 A;  2W3H A;  2PYR A;  3NOU C;  1LT0 A;  1LSX A;  4UEY A;  4IHQ A;  1MC0 A;  2W1R A;  1D06 A;  4IUK A;  3KSF A;  2A24 B;  5TBM A;  4GLQ A;  5K5B A;  5IU1 A;  1OTB A;  1T18 A;  2W3E A;  2HGV A;  2ZMF A;  1P0Z A;  4KQO A;  2FZ0 A;  2G7U A;  4MDZ A;  2O9C A;  4UQI M;  4PKY A;  3TE8 A;  2D01 A;  4GHI A;  1OTD A;  1ODV A;  2K31 A;  3MFX A;  3FPV A;  3FC7 A;  3OCL A;  2EA9 A;  4BBU A;  3A0V A;  5TBM B;  4AFI A;  1TD5 A;  4PAU A;  2KLI A;  4O0P A;  5DF9 A;  2VKS A;  3K3D A;  4MN5 A;  4Q0H A;  5J3W A;  3T4K A;  2JN7 A;  3KX0 X;  4DJ3 A;  2NUP C;  2O0Y A;  2XA7 S;  2VA0 A;  4ETX A;  3LUQ A;  4WF0 A;  3MJQ A;  3O5Y A;  2M1C A;  3CIT A;  3LIB A;  4PKY G;  3T50 A;  1XFQ A;  3K3C A;  2QKP A;  3PR6 A;  4EET B;  3MQO A;  2O9B A;  1X0O A;  4ARZ A;  4R70 A;  4JGQ A;  4HHD A;  3HJI A;  5J4E A;  4GCZ A;  2HJ9 C;  3TW8 A;  2KOI A;  2VV7 A;  4EQ1 A;  5FL3 A;  1W63 M;  1TS6 A;  4CLC C;  5KSH A;  1NLY A;  2ZBB A;  3LR4 A;  3PBR A;  1H3Q A;  5F6A A;  1MZU A;  1XJ4 A;  5EFW A;  4LRZ E;  4HQA A;  2QYB A;  4QPR A;  2QJ5 A;  3LR3 A;  3VE3 A;  5HSQ A;  3PBO A;  5DFX A;  2GZA A;  3KSG A;  3LFV A;  5J7E A;  2VEA A;  5A8B A;  4DMZ A;  4LLO B;  4WLA A;  3BY8 A;  4GS9 A;  4DJ2 A;  3P01 A;  3UE6 A;  2XRN A;  3MQ0 A;  4EEP A;  3NOP C;  4YNR A;  4Z1W A;  1NWZ A;  3E4Q A;  1N9L A;  2LB5 A;  3OCN A;  3ICY A;  2B02 A;  3IS2 A;  1YKD A;  3RH8 B;  3CAX A;  4HI4 A;  3RFB A;  3T4Q A;  3MR0 A;  3T4J A;  3BWL A;  2W3F A;  2HF6 A;  3GDI A;  3VE4 A;  2KX6 A;  2XA7 M;  4OOM A;  1F98 A;  5DJT A;  4I3A A;  1H8M A;  4Y5F A;  3EEH A;  4R6L A;  2GNX A;  2QJ7 A;  4XT2 B;  2L0W A;  3KYZ A;  2VV6 A;  3E98 A;  4K08 A;  3H82 A;  4HH2 A;  4M4X A;  4R38 A;  1JNU A;  3CLO A;  1YSP A;  3G6O A;  3H7W A;  5F68 A;  3PBQ A;  3PHY A;  4E04 A;  4F3L A;  1TS0 A;  4HJ6 A;  5AVF A;  2PD8 A;  2Z6D A;  5AJG A;  2GX5 A;  3LIE A;  4IJG A;  4GJ4 A;  4II7 A;  3IS2 B;  1D7E A;  4EXO A;  5HPI A;  4LRY C;  4CLC A;  2I9V A;  4HNB A;  3EQU A;  3NJA A;  3S7O A;  1Y28 A;  1S4S A;  1XJ2 A;  2WKQ A;  4Q0I A;  3UB8 A;  2OOL A;  2JKR M;  2W1T A;  4NEE D;  1LSV A;  3EEA A;  4DN0 A;  4FSF A;  1N9O A;  2K7S A;  2Z6C A;  3LI8 A;  2JHE A;  2PHY A;  4ZRR A;  2VJW A;  4ME4 A;  5HWT A;  3T4S A;  4H6J B;  2R78 A;  4L9F A;  3UB9 A;  3W2Z A;  4WEJ A;  2H28 A;  4EUV A;  2K2N A;  1NRJ A;  3T4O A;  2VGL M;  4G3V A;  2NUT C;  5HWV A;  3UMD A;  3UB7 A;  1T1B A;  1OTI A;  4YOF A;  3EWK A;  4HJ3 A;  4B93 A;  3H9W A;  3ZYT A;  1ZHH B;  3LI9 A;  1TF1 A;  4NKP A;  1W63 Q;  3D3O A;  1TS8 A;  2CMN A;  4RQ9 A;  1P9R A;  3F1P B;  4XT2 A;  5AVE A;  2LB9 A;  1G6O A;  2HJE A;  3CWF A;  2D02 A;  4L9E A;  1P97 A;  1OPX A;  3BQ8 A;  3B33 A;  5L8M A;  4HIA A;  3IBR A;  4WN5 A;  2JKR I;  4GHI B;  1ZTU A;  3B42 A;  3S7N A;  3MQQ A;  3K2N A;  1GSX A;  3LIA A;  2B18 A;  3PBS A;  3C8C A;  2YKF A;  3LYX A;  4CLC B;  4I38 A;  4WL9 A;  3P7N A;  2Y79 A;  1S4R A;  3KSH A;  3S7Q A;  3HCY A;  2WKR A;  3PBN A;  4H6J A;  2OWJ A;  2PR6 A;  1MKM A;  5HZH A;  2J80 A;  4MN6 A;  3LIF A;  4ETZ A;  1OJG A;  3VOL A;  5HL6 A;  5HPF A;  1P9W A;  2PDR A;  3T4L A;  4P6Z M;  4BBT A;  5IS1 A;  4CLC D;  2V9A A;  2J3W A;  2OWH A;  3S7P A;  3B47 A;  3UME A;  4WUJ A;  4MMN A;  5LBR A;  3U2A A;  3VV4 A;  2WKP A;  3FG8 A;  4WEK A;  4O01 A;  5I5L A;  3H7W B;  4NXG A;  4PHT A;  3EGX C;  2ZOH A;  4YWZ A;  4EEU A;  2QHK A;  5MC7 A;  2PD7 A;  2OAP 1;  4P6Z S;  1LSW A;  4Y3I A;  4L9G A;  1S1Y A;  2YKH A;  4CLC E;  4BWI A;  3BJN A;  2W3G A;  4FOF A;  1OT6 A;  1S66 L;  1GSW A;  2J3T D;  2W27 A;  3UB6 A;  1NLZ A;  4HH3 A;  2L1M A;  3MF0 A;  4EW7 A;  5DJU A;  3RTY A;  2P04 A;  4I3I A;  2ZOI A;  1LL8 A;  2VLG A;  3F1P A;  4BBV A;  3ZQ5 A;  2JKT I;  4F3L B;  1V9Z A;  3BW6 A;  3EGD C;  4HY8 A;  5HDD A;  1VHM A;  1XJ3 A;  3PXP A;  1VB6 A;  5CX7 A;  3LR0 A;  3R7W B;  3D72 A;  4Q0J A;  5TJJ A;  4GW9 A;  1OT9 A;  3PYP A;  2KDK A;  1UGU A;  5HD5 A;  2A2L A;  1V9Y A;  3NOT C;  1S1Z A;  4MCW A;  3JVV A;  2J3T C;  2A24 A;  1TS7 A;  3V67 A;  2W3D A;  3H82 B;  4JGP A;  4BJP A;  1DRM A;  2IA2 A;  4IUH A;  4LPZ A;  2VGL S;  2V0U A;  4HP9 A;  1YSQ A;  3E4O A;  1IOU A;  1F9I A;  1EW0 A;  2XRO A;  4KUO A;  3SW1 A;  3NHQ A;  4NXB A;  3BY9 A;  4HJ4 A;  2W1T B;  4KUK A;  4JGR A;  3F1O B;  1KOU A;  3E4P A;  2O9A A;  3A0R A;  4EU0 A;  4KQD A;  2ZMV A;  4Y2F A;  5HD3 A;  5DKL A;  1BYW A;  5HWW A;  3BQA A;  5F69 A;  3UE3 A;  2P7J A;  3LIC A;  3HJK A;  1F5M A;  1N9N A;  3EOI A;  5HDS A;  3PBT A;  3E0Y A;  3OLO A;  1DP9 A;  3OBF A;  2V0W A;  4BMW A;  1GSV A;  4JGO A;  3LID A;  1XJ6 A;  2INW A;  3F1N B;  2FH5 A;  3ULF A;  5C5K A;  2XSS A;  3R4K A;  4CQH A;  3C30 A;  4OOL A;  4WEL A;  4I5S A;  1UWN X;  2V1B A;  4I3J A;  3GEC A;  2QWS A;  3MXQ A;  3OC2 A;  2L4R A;  1XFN A;  5HDC A;  2EWW A;  3T4T A;  3EQV A;  2GJ3 A;  5G4Y A;  3MMH A;  1G28 A;  4NXF A;  2VV8 A;  2M7U A;  3R7W A;  2P08 A;  2V1A A;  3IBJ A;  3F1N A;  2Y8H A;  4HP4 A;  5DFY A;  2W0N A;  3CUE C;  2JKT M;  2PT7 A;  2PYP A;  4I39 A;  3C2W A;  1OTA A;  3A0S A;  3DBA A;  4LRX C;  2BAS A;  2PR5 A;  3KSI A;  1T1A A;  5KIZ A;  3F1O A;  2M7V A;  3TRC A;  1OTE A;  3OOV A;  1STZ A;  2EWV A;  1WA9 A;  2OAQ 1;  1DP8 A;  2VZW A;  4EES A;  1S67 L;  3JVU A;  4EER A;  2HV1 A;  3CI6 A;  5G4Z A;  5IT5 A;  3C38 A;  3FPW A;  1YAX A;  4G3W A;  1IFQ A;  4L0L A;  2VX8 A;  2DMW A;  3LR5 A;  4MN7 A;  1DP6 A;  1OJ5 A;  3KYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...