5FQIA

W229d and f290w mutant of the last common ancestor of gram-negative bacteria (gnca4) beta-lactamase class a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
ALSEQLAELEKRSGGRLGVAVLDTATGRRFGYRGDERFPMCSTFKALLAAAVLARVDQGKENLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITYSDNTAANLLLEALGGPAALTAFLRSIGDNVTRLDRWEPELNTAAPGDPRDTTTPAAMAATLRTLLLGDVLSPASRQQLVDWLIANKTGDKRLRAGLPADDRVGDKTGTGEHGTTNDIAVIWPPNRAPILVAVYLTESQVDADARDAVIAEVARLVVAAWHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GNCA4 LACTAMASE W229D AND F290W
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
total genus 100
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqiA00
4DE0A 4BD0A 4NETA 4QJGA 4OOLA 2DNSA 3PBNA 4KQRA 5FQKA 2Y2QA 3G30A 5EVIB 2DCFA 4FD8A 3VOYA 3NBLA 3VFHA 3HBRA 2EFXA 1GA0A 3GV9A 3S4XA 3SH7A 2JC7A 4EBLA 3TOIA 1ES5A 4BL2A 1K25A 1RGZA 3GSGA 1HVBA 1AXBA 3MBZA 4GDNA 4ZTKA 5HAIA 4U0XA 4IVIA 3WS0A 1K6SA 4OONA 4Q8IA 4KQQA 3ZNYA 3FKVA 3HVFA 4P6BA 1VM1A 2XFSA 2H10A 3OCNA 3IXHA 1IEMA 2ZQ8A 4WBGA 5CTNA 5FQ9A 1E25A 4P87A 1GA9A 3MZFA 2C6WB 1L0DA 1CEFA 1XXMA 2V2FF 2WADA 4P85A 5FQMA 4ZJ1A 4HESA 2VGJA 4WEKA 3IXBA 2ZQDA 3ZG7B 2XF3A 5FATA 1SDNA 5FAPA 3TSGA 2G2WA 5EVID 5GLBA 3V5MA 5HW3A 4GKUA 4RYEA 5FI7A 3P98A 4R3BA 1MXOA 1WYBA 3BLMA 1KDWA 2QPNA 1MKIA 5GLAA 4OOMA 4Y0OA 1M40A 3GQZA 5TFQA 1LI0A 4XUZA 3SS4A 5JYOA 4YINA 2HDUA 3Q7VB 3ZFZA 2DRWA 1MY8A 4WMCD 5GHZA 1MWTA 3IT9A 1H8ZA 2WYXA 3W4QA 4PPRA 5AQ9A 5KSCA 1XGJA 1L2SA 1IYSA 4E6WA 1CEGA 3N6IA 1K57A 4JF4A 3HLFA 2WGWB 4RVAA 1RGYA 1E4DA 2EX8A 2EXBA 2P9VA 1K54C 4GB7A 5GLCA 1GHPA 1BLPA 3FZCA 2ZQCA 1KGGA 3G31A 4LV1A 1I2SA 1ONGA 3ITAA 4QB8A 2HDQA 3UDIA 1RCJA 3VP3A 1YLYA 3CJMA 3VP2A 2ZM0A 3O87A 1O7EA 4OKPA 5EECA 3OPPA 3CG5A 4JXSA 4Y0TA 1Q2PA 1K56D 3G32A 2ZC4B 1KVMA 3M6HA 1K4FA 2Y2OA 2EXAA 2Y2PA 3FV7A 2J8YA 3BECA 4O7DA 4PM8A 1FCNA 3N8LA 2HP6A 5M1AA 5U47A 5HX9A 4EUZA 3BLSA 4N1XA 4E3OA 4MEZA 3A3IA 1RP5A 3V39A 3AGFA 5CEBA 1MWUA 1YLTA 5F82A 2X01A 2Y59A 3W8KA 4R0QA 1TDGA 4NK3A 3EQUA 3G35A 1XX2A 5FA7A 3SS5A 2A49A 1JTDA 4JXWA 4S2NA 1ZKJA 4BLMA 4WZ5C 4FCFA 4R23A 4JF6A 3UE3A 3DW0A 3P09A 4PM7A 4R4RA 1GCEA 5HAPA 2OLUA 2PU4A 3IF6A 3IXDA 4U0TA 1BUEA 2ZC7A 4X69A 3OPRA 3NDGA 3O3VA 4RA7A 2WAEA 4E3LA 1ONHA 3UE0A 4E3NA 4MLLA 3ISGA 5J8XA 1W7FA 1OMEA 4JXGA 2J9PA 3E2LA 1ALQA 5DVAA 2WKIA 5FI2A 2FFYA 4X56A 3Q82A 1XA1A 4A5RA 1ZC2A 5HL1A 1K57C 4WEJA 2Y2NA 2RL3A 4IVKA 4Z9QA 4QD4A 2R9XA 3OZHA 2OLVA 3WS1A 4BQMA 5BOHA 3PBSA 1M6KA 4LCMA 1NXYA 4R1GA 4KZBA 4KZ8A 1IELA 3HREA 4RX2A 5CHMA 1PWGA 1PWDA 2ZM2A 1FQGA 3G2ZA 4M3KA 1PW1A 2XK1A 3DWKA 1KGFA 3I7JA 4C6YA 5FDHA 3SOIA 1ERQA 5FASA 1MWSA 5EUAA 4EWFA 1KE0A 3UPNA 3ZG0A 3N4IA 3VP4A 4LV2A 2ZLYA 3B3XA 2ZQAA 1YT4A 1FCOA 3HUNA 4KZ6A 1IYQA 4OPQA 4OLDA 4KZ9A 1LL5A 4KZAA 4N9LA 4OPZA 4EBPA 1PI5A 4PM9A 4X68A 3DWZA 2X71A 4GD8A 4ZAMA 2P74A 1QMFA 4WZ5A 2HP5A 4GN2A 3LY4A 3NIAA 1DJAA 5CRFA 3N8SA 2XGNA 4KZ5A 1JTGA 4BENA 1MPLA 2ZJ9A 3G34A 4OQIA 3Q1FA 1S6RA 5EE8A 4OH0A 3OC2A 3IHBA 4S2JA 5FAOA 4S2NC 1PZPA 2HPBA 1IYOA 5F1FA 2XD5A 1FOFA 2IWDA 3VSLA 1YLZA 3IF6C 2PBYA 1CI8A 5L2FA 3BFGA 4H8RA 2WZXA 4C3QA 4DXCA 1KVLA 3M2JA 3N7WA 3VP0A 2P9VB 3ZCZA 1ES2A 1XKZA 1YMSA 2Y2MA 5AQ7A 3V50A 4B4XA 3V3SA 3HLDA 4LV3A 1BLSA 5CGSA 1LI9A 5DF7A 1BTLA 5E2EA 1KE3A 2R9WA 3IXGA 3O86A 1N4OA 1N9BA 5GLDA 3Q81A 4ZJ2A 3VP1A 2GDNA 3FYZA 1SCWA 2EFUA 2JE5A 1K4EA 1SHVA 1ES3A 1EI5A 3LO7A 2V1ZA 3AGDA 4GOGA 4FH4A 3C5AA 1YLPA 3BFFA 3PBQA 5DTSA 1W8YA 1I2WA 2Y55A 4JLFA 5E43A 3VOZA 4ZJ3A 5CERA 3C4OA 4MBHA 3C4PA 1WE4A 2WZZA 3HLEA 2Y2LA 4L0LA 4S2OA 1K55A 5CTMA 5FQQA 4IBXA 3HLGA 3GMWA 1TDLA 3WRZA 2HDRA 2Q9MA 1H8YA 1LHYA 4HBUA 3ZGAB 2HDSA 4WELA 1WYCA 2XFTA 4XXRA 5KZHA 3GTCA 3GVBA 4PM6A 4FH2A 3IHAA 3UDXA 2EX6A 3D4FA 1KE4A 3IF6B 3C7VA 2XLNA 1E3UA 3PAEA 4QU3A 3A3DA 5FQIA 4QY5A 2PU2A 4K91A 5M18A 1HD8A 3VMAA 1NYMA 1G68A 5CHUA 4ZDXA 3QNCA 5CEDA 2QZ6A 2WKHA 3MXRA 1QMEA 2ZQ7A 2OV5A 2H0YA 1ZG6A 1LLBA 2OSUA 5EOOA 4JF5A 2ZQ9A 3LY3A 2C5WB 3RXXA 4U3TA 1PI4A 3WS5A 4DKIA 1PYYA 3BEBA 2A3UA 5CHJA 2ZD8A 4DDSA 4KZ3A 5HFOA 4OQ0A 3UO9A 4OOYA 1DJCA 5I94A 1J9MA 3HLWA 3GRJA 5EOEA 4DE3A 2JCHA 4WZ4A 3BFDA 1FR1A 2E8IA 3OPHA 4D2OA 1BLCA 3ZG5A 1JWZA 3PAGA 2JBFA 5DTTA 1XPBA 1W8QA 4KZ7A 3G4PA 2H0TA 3WS4A 1YMXA 1MBLA 1KDSA 3NC8A 2WUQA 3OCLA 4HBTA 4OQHA 5CECA 4JXVA 1KGEA 4IEDA 5DTKA 4JPMA 3E2KA 1O07A 3SH9A 3EQVA 3VFFA 1FR6A 4BL3A 4JBFA 4K0XA 3UN7A 4GZBA 4R3JA 2CC1A 1BLHA 1ESIA 2HP9A 4S2IA 2J9OA 4N1HA 3JYIA 4YFMA 2B5RA 5EPHA 2WGVA 1ESUA 1JVJA 5HAQA 1JWVA 4E3MA 2WKEA 2XD1A 2Y2GA 4B88A 1K55C 2V20A 3WS2A 3BYDA 4EQIA 3WWXA 1L0EA 2XH9A 2Y4AA 4ZBEA 1XGIA 1XP4A 3UY6A 4OP8A 4LV0A 1MWRA 2FFFB 4S2MA 1ES4A 4DE1A 2Y2IA 1IKGA 1CK3A 1NYYA 3UDFA 1HZOA 1VQQA 1HTZA 3IF5A 3MKEA 4C75A 5TR7A 4Y7PA 4MNRA 3NI9A 2WK0A 3HLBA 5KSHA 1ERMA 5DF9A 4EV4A 2IWCA 5EVIA 4E6XA 1GHIA 4OLGA 1SKFA 1IKIA 3QHYA 3W4PA 3M6BA 3PBTA 4QY6A 3BFEA 1EWZA 2XQZA 4UHUA 4DRTA 3Q07A 3WRTA 5M19A 3ZVTA 4FSFA 5E2FA 5D3OA 4GNUA 1PWCA 1DJBA 4MBFA 4UAAA 4UA6A 4E3JA 4WMCA 5F83A 3V3RA 3ZG8B 5FI6A 4CJNA 2BG1A 2RCXA 1S0WA 1NZUA 3ITBA 1LL9A 2EX9A 1YLJA 1H5XA 3OPLA 4S2LA 3FWLA 4X53A 4XUXA 5GL9A 4DE2A 1FSYA 1PIOA 2H5SA 2EX2A 3AGEA 1FSWA 2WAFA 2Y91A 3GR2A 4JKTA 1SDEA 3UE1A 2Y2HA 1JWPA 3HL9A 4BD1A 3PTEA 1YM1A 3N8RA 3NDEA 4GDBA 4ID4A 4DDYA 3UPOA 4S2PA 1FCMA 3O88A 4N92A 1W5DA 1I5QA 2ZC5B 1C3BA 4KENB 4KG6A 1U60A 2ZC6B 4RX3A 3MXSA 2I72A 3Q7VA 2WGIA 4KG5A 3ZDJA 3DTMA 4EBNA 4DXBA 5A93A 2QMIA 2XDMA 1K56A 2ZMAA 1K38A 3MKFA 3BRMA 2IWBA 3QNBA 3W4OA 2X02A 1NZOA 1BSGA 3ZNTA 1DY6A 1W79A 2WGWA 2Z2LB 3A3FA 3C7UA 3BM6A 3IWIA 4Y0UA 3CMZA 3Q7ZA 1IYPA 3NCKA 4OPRA 4OP5A 3SH8A 5FSRA 1L0FA 1EROA 3IWOA 5G18A 3G2YA 3BFCA 3PBRA 4UA9A 5HARA 3ZVWA 3FKWA 4MBKA 4OPYA 5A90A 3LEZA 3VSKA 4N9KA 4P0MA 5GHXA 2Q9NA 1CI9A 1NRFA 3HUMA 1NJ4A 3UPPA 3HUOA 3MZEA 4HEFA 4X6TA 5EVIC 1BT5A 4LCLA 1G6AA 4F94A 3IH8A 2UWXA 3RJUA 4E3IA 5E2HA 1TVFA 1Y54A 3IH9A 2Z2MB 2VGKA 3M2KA 1E3UD 3ZG9B 3S1YA 4QHCA 4UA7A 3CZDA 1GHMA 3LCEA 5F1GA 4DF6A 5JYPA 1ZG4A 1Q2QA 1TEMA 4KZ4A 3HLCA 5IHVA 4CPKA 4X55A 1K6RA 2BLSA 3RXWA 5CXWA 4WYYA 1PW8A 4PMAA 3UNWA 1PZOA 4WM9A 5DF8A 5CGXA 3S22A 2Y2JA 5E2GA 4PM5A 3MFDA 4IBRA 1BULA 5GHYA 4LENA 1YLWA 3TG9A 4KG2A 2J7VA 1BZAA 5AQAA 5TGFA 2XEPA 4K0WA 1L0GA 4OVDA 3NY4A 5CGWA 5EVLA 3ZHHA 3SS3A 5FQJA 4B4ZA 2G2UA 4GD6A 4E3KA 1Z6FA 3A3JA 3MZDA 4R4SA 1K54A 3IQAA 4OQGA 2XR0A 2ZM8A 4S2KA 1NY0A 5AQBA 1YQSA 5A91A 2ZC3B 3A3EA 3PBOA 4KQOA 1XA7A 2Y2KA 4BJPA 5FAQA 5KMWA 3IWQA 5A92A
chains in the Genus database with same CATH superfamily
4NETA 3VE4A 2DNSA 3C2WA 4F3LB 5FQKA 1DP9A 2Y2QA 2O99A 3VOYA 3NBLA 2EFXA 1GA0A 2JN7A 1UGUA 4BL2A 1RGZA 1TS0A 3MMHA 4Q8IA 3HVFA 3KO6A 1VM1A 5EV0A 2ZQ8A 5FQ9A 1TS6A 4LRYC 1SDNA 5HW3A 4GKUA 4NKPA 1MKIA 1M40A 4XUZA 3Q7VB 2VK3A 2WYXA 3LR5A 1D1JA 4BWIA 4PPRA 1CEGA 1K57A 4B93A 4GB7A 5GLCA 5HZHA 1MC0A 3G31A 2G7UA 3VP2A 1O7EA 3OPPA 3CG5A 3E4QA 1Q2PA 3G32A 2ZC4B 3D9YA 3FV7A 2J8YA 3FC7A 3R4KA 4G3VA 4O7DA 1FCNA 2W1TA 5M1AA 4N1XA 3IX8A 4E3OA 5F5YA 5J4EA 3A3IA 2KDKA 5CEDA 1EW0A 1YLTA 5I5LA 2X01A 4WL9A 1P9WA 1TDGA 4NK3A 3EQUA 3G35A 2A49A 4WZ5C 2W3EA 3R7WB 3P09A 4R4RA 2OLUA 2PU4A 3IXDA 3UMEA 2INWA 3TJZC 1H0MA 3T4LA 3UE0A 4MLLA 2J9PA 3E2LA 2DMWA 2WKIA 4LGWA 4A5RA 3Q82A 1ZC2A 4IUKA 5HL1A 1K57C 4WEJA 2Y2NA 3A0SA 4IVKA 4BQMA 5BOHA 2OLVA 5AVFA 1M6KA 4LCMA 1NXYA 5CHMA 4HH2A 2ZM2A 3C8CA 1SKOA 4GCZA 1FQGA 4I3IA 4M3KA 2VGLM 4R38A 3LIBA 4OPQA 4OLDA 1LL5A 4N9LA 4NXGA 4X68A 3DWZA 1P97A 3QP8A 2P74A 3NIAA 3MQOA 1DJAA 4HQAA 4KZ5A 2XGNA 4BBVA 2ZJ9A 3Q1FA 1S6RA 4ME4A 3IHBA 2VGLS 3T1SA 2WKPA 3UB9A 2XD5A 3UB5P 1FOFA 2PBYA 1CI8A 1OTDA 3VP0A 3ZCZA 3MQQA 1YMSA 3V50A 3V3SA 3BY9A 3U2AA 1LI9A 2JKRM 5DF7A 3VP1A 1N9BA 1S1YA 1SCWA 3A0VA 1K4EA 4FH4A 2VLGA 1Y4OA 2W1TB 3VOZA 3C4OA 3JVUA 5HD5A 4IBXA 3EGXC 4UEYA 1TDLA 2Q9MA 1LHYA 4HBUA 5TJJA 2XFTA 4LLOB 1OPXA 4FH2A 2PD7A 4K91A 5M18A 4ZDXA 2OV5A 3RXXA 4U3TA 1PI4A 1PYYA 2A3UA 3PHYA 2ZD8A 3MQ0A 5HWVA 2O9AA 4LRXC 1FR1A 3OPHA 2V0UA 2R78A 3PAGA 5DTTA 1W8QA 3WS4A 1YMXA 5CECA 2WUQA 1KGEA 1DP8A 2V8CA 2W3HA 4JPMA 3MS6A 3VFFA 4BL3A 4EW7A 3UN7A 2VKSA 3OBFA 4N1HA 3D3OA 2B5RA 1JWVA 4E3MA 2XD1A 4B88A 2KX6A 3WS2A 1L0EA 4HI4A 3UY6A 4LV0A 2FFFB 1ES4A 1IKGA 3UDFA 1VQQA 1HTZA 4I3AA 3K3DA 5TR7A 2QWSA 1N9NA 5AJGA 2WK0A 3HLBA 5DF9A 5EVIA 1IKIA 3W4PA 3F1NA 3BFEA 5DJUA 4FSFA 2L0WA 4NXBA 4UAAA 3V3RA 4CJNA 3ITBA 1LL9A 1YLJA 3OPLA 3IX3A 4S2LA 5EM0A 4DE2A 5GL9A 2H5SA 2J3WA 3AGEA 1SDEA 2K31A 4RQ9A 4BD1A 1YM1A 3N8RA 2P08A 4GDBA 4MN6A 2GZAA 4S2PA 3O88A 2ZC5B 4KG6A 3RH8B 2ZC6B 3KSFA 5DKLA 3ZDJA 4EBNA 3MKFA 3BRMA 3W4OA 3E4PA 1DY6A 2Z2LB 2WGWA 3IWIA 3FPWA 3EOIA 3SH8A 4I38A 5G18A 2H28A 4KQDA 4UA9A 4GLQA 5A90A 1IOUA 5GHXA 4NXFA 1XJ2A 1NRFA 5EVIC 3DTIA 2E8JA 3HCYA 1Y54A 1E3UD 2UV0E 1G6OA 3E98A 3LCEA 5F1GA 1ZG4A 1TEMA 5IHVA 3NECA 1K6RA 2BLSA 2VX8A 4WYYA 5DF8A 5CGXA 2Y2JA 2VA0A 5E2GA 4EUVA 2HZ5A 5GHYA 3UE6A 1YLWA 4KG2A 2J7VA 3OLOA 5CGWA 3SS3A 4E3KA 3A3JA 1G28A 4EU0A 2O9CA 4OQGA 1T1AA 4EQ1A 5AQBA 1YQSA 1NLZA 2ZMVA 4PKYG 4DE0A 4QJGA 1V9YA 1W63Q 5EVIB 2DCFA 4PAUA 3CITA 3F1NB 2O0YA 4EBLA 3TOIA 2KOIA 1LSVA 4HP9A 1BYWA 4IVIA 2VJWA 1K6SA 4KQQA 4P6BA 2XFSA 2H10A 3JPUA 1E25A 4P87A 1GA9A 2GJ3A 3MZFA 2WADA 3IXBA 3ZG7B 2XF3A 3OOVA 5GLBA 3V5MA 4RYEA 3LYXA 3BLMA 1WYBA 4OOMA 2VV6A 3GQZA 1LI0A 5EM1A 3T4OA 1MWTA 3DTEA 2PHYA 3IT9A 3ULFA 1XGJA 1L2SA 1HLUP 3N6IA 3KSHA 2WGWB 2P9VA 4CLCD 3FZCA 3LUQA 2ZQCA 1KGGA 3ITAA 4QB8A 2HDQA 4II7A 3UDIA 1RCJA 2OOLA 2PYRA 3CJMA 2Y8HA 3O87A 5EECA 4Y0TA 1K56D 4AFIA 3JVVA 4PM8A 4WN5A 5U47A 5HX9A 4EUZA 1OTBA 5AVEA 3NOUC 5CEBA 3AGFA 1MWUA 2Y59A 3W8KA 4R0QA 3MFXA 2ZOHA 1XX2A 1Y28A 4R23A 1KOUA 4JGQA 4JF6A 5HAPA 4PM7A 1GCEA 3ZQ5A 3OPRA 3P7NA 4E3LA 1ONHA 3UMDA 1PNEA 4E3NA 1H3QA 5J8XA 4KUOA 4JXGA 1ALQA 5J7EA 2FFYA 1OJGA 4R70A 2CMNA 4Z9QA 2WKQA 2R9XA 3WS1A 4GJ4A 3PBSA 5J3WA 4KZ8A 3HREA 1PWGA 1PWDA 2JKTM 3G2ZA 1PW1A 2XK1A 3I7JA 3SOIA 5FASA 5EUAA 2HJEA 5FDSA 3UPNA 3ZG0A 1GSVA 4Y3IA 3VP4A 4LV2A 4HNBA 3B42A 4KZ6A 4KZAA 1PFLA 1PI5A 3LIFA 4PM9A 2X71A 4GD8A 4ZAMA 1STZA 4WZ5A 2HP5A 3LY4A 1JTGA 3G34A 4FOFA 3LR3A 3DTKA 3OC2A 1T18A 1WA9A 4FTXA 1K0KA 2IWDA 1YLZA 2Z6DA 2WZXA 4C3QA 4DXCA 2P9VB 5IT5A 3HLDA 1VEUA 1W63M 3IXGA 4WF0A 3K3CA 1T19A 2JE5A 3LO7A 2V1ZA 3AGDA 4GOGA 3C5AA 3CAXA 1UWPX 1W8YA 1I2WA 4I39A 5CERA 1WE4A 2WZZA 2LB5A 5F69A 1K55A 3EWKA 3H7WA 5F68A 3GTCA 2OWHA 5G4YA 2LB9A 5MC7A 4GS9A 3FG8A 3QNCA 2QZ6A 1TF1A 5HL6A 3L9KA 5HPFA 1ZG6A 3CWFA 5EOOA 3LY3A 2B18A 3UO9A 4OOYA 1DJCA 4DE3A 4WZ4A 3PYPA 1TD5A 1J3WA 3SZTA 4KZ7A 2H0TA 3SW1A 1MBLA 3BJNA 3E4OA 3OCLA 2B95A 5DTKA 4CLCC 3SH9A 2D02A 1FR6A 3CPTB 5FEFA 4K0XA 4R3JA 2GNXA 5KIZA 4G3KA 1L3LA 2WKEA 2Y2GA 1K55C 2V20A 3BYDA 3IBJA 3WWXA 4L9GA 4ZBEA 1XP4A 4OP8A 2J3TD 3G6OA 4D60A 4DE1A 1OT9A 1NYYA 4LRZE 1HZOA 3IF5A 4MNRA 3NI9A 4EV4A 2IWCA 4E6XA 1GHIA 4OLGA 2XA7M 1VEUB 3Q07A 3WRTA 5M19A 5E2FA 4GNUA 1DJBA 4E3JA 4UA6A 5F83A 5FI6A 2RCXA 1S0WA 4CLCB 2EX9A 4ESPA 2HF6A 1H5XA 2J80A 4XUXA 1FSYA 3QP1A 1CF0A 4R6LA 4JKTA 1H8MA 1JWPA 2Y2HA 3NDEA 2M1CA 3W2ZA 4ID4A 2V8FA 4N92A 4HJ3A 1I5QA 2XA7S 1C3BA 4KENB 2PR6A 2VEAA 3H7WB 4DN0A 3F1OA 4KG5A 4ARZA 3DTMA 3LICA 4XT2B 2QMIA 4FUWA 2PBDP 2PD8A 4Q0JA 1NZOA 2Q0OA 4GS9B 4Y0UA 4H6JA 3CMZA 3Q7ZA 4OPRA 1EROA 2OAQ1 3VE3A 3ZVWA 4MBKA 2HGVA 1OJ5A 2I9VA 3LEZA 4N9KA 4P0MA 4Y2FA 2Q9NA 3HUMA 1NJ4A 3UPPA 5DFYA 3MZEA 4X6TA 4HEFA 4LCLA 3RJUA 4E3IA 1TVFA 4MN7A 1D7EA 3BY8A 3S1YA 3CZDA 4DF6A 5JYPA 3T4TA 3HLCA 3RXWA 2PR5A 1OTAA 4PMAA 3UNWA 1PZOA 1LL8A 4B9OA 1MZUA 4WM9A 5IS1A 1XJ4A 1BULA 1BZAA 4K0WA 4OVDA 5EVLA 5FQJA 4B4ZA 2G2UA 3MZDA 1K54A 2Z6CA 2ZM8A 4S2KA 2W3DA 2ZC3B 3A3EA 4BJPA 4NG2A 2Y2KA 5KMWA 1OTEA 3IWQA 4G3WA 4BD0A 3PBNA 4KQRA 3G30A 3PR6A 4FD8A 3T12B 3S4XA 3SH7A 2JC7A 1ES5A 1K25A 4R3AA 2YKFA 1AXBA 3MBZA 4GDNA 5FEGA 3WS0A 3S7OA 3OCNA 2QHKA 5CTNA 5EVEA 1LSWA 1L0DA 1CEFA 1XXMA 2V2FF 2VGJA 4WEKA 3TSGA 5FAPA 4DJ3A 2G2WA 4R3BA 1MXOA 2NUPC 5GLAA 3LIDA 4YNRA 5JYOA 3F1OB 2HDUA 4YINA 3ZFZA 2DRWA 1MY8A 4WMCD 4ARZB 5DKKA 5KSCA 4E6WA 3T4KA 2B02A 4LFUA 3TRCA 4H6JB 4RVAA 1K54C 1GHPA 1BLPA 3FPVA 4LV1A 1I2SA 1YLYA 4P6ZM 4OKPA 2ZMFA 4JXSA 1D06A 1KVMA 4I3JA 2J3TC 2EXAA 2Y2PA 3H9WA 3BECA 4HY8A 4E04A 1RP5A 1TS7A 3BWLA 3V39A 3MJQA 2K2NA 5FA7A 2W0NA 4Y15A 3SS5A 3IX4A 4P6ZS 4S2NA 1ZKJA 1XJ6A 5HWWA 4FCFA 4EETB 3UE3A 3DW0A 3L7HA 4U0TA 1BUEA 2ZC7A 3O3VA 4RA7A 3BW6A 1S67L 3EGDC 1NRJA 2WAEA 4MDZA 1AWIA 3TW8A 1W7FA 5FI2A 4X56A 1XA1A 2XSSA 3S7PA 4QD4A 3OZHA 1DRMA 2FH5A 4KZBA 4PHTA 4RX2A 3CHWP 1SZVA 5F6AA 3DWKA 4C6YA 5HDDA 4MCWA 1ERQA 4EWFA 1KE0A 5L8MA 3QP4A 3N4IA 2ZLYA 4QWOA 2ZQAA 2HV1A 1YT4A 1FCOA 3HUNA 3KSIA 4KZ9A 4OPZA 4EBPA 3NULA 1QMFA 4GN2A 4BBUA 5CRFA 4BENA 4OQIA 5EE8A 4ETZA 1CJFA 4S2JA 5FAOA 4S2NC 2HPBA 5F1FA 3VSLA 5L2FA 4H8RA 2W27A 1FIKA 1F9IA 1XKZA 2Y2MA 5AQ7A 1BLSA 5CGSA 5E2EA 1N4OA 2VV7A 3Q81A 4QPRA 2GDNA 3FYZA 1EI5A 2A24A 3PBQA 4GHIA 3KYQA 4HP4A 3LIEA 5DTSA 4JLFA 5E43A 4ZJ3A 3C4PA 4MN5A 3HLEA 4ETXA 2AVXA 4S2OA 5FQQA 2XRNA 3HLGA 2ZOIA 3GMWA 3WRZA 3ZGAB 1H8YA 2HDSA 4XXRA 2PT7A 3GVBA 4PM6A 3UDXA 1V9ZA 2ZL1A 3C7VA 1E3UA 3CUEA 3PAEA 3T4JA 5FQIA 5DFXA 1G68A 1Z09A 1QMEA 4DJ2A 1LLBA 1NLYA 2OSUA 1YAXA 1ACFA 4JF5A 2L4RA 4UQIM 3WS5A 1S4RA 4DDSA 4KZ3A 5HFOA 4OQ0A 4I5SA 1J9MA 3HLWA 1T1BA 2JCHA 4EEPA 2E8IA 3A0RA 2JKRI 4EEUA 1BLCA 3ZG5A 2IA2A 2Y79A 2BASA 1YKDA 2JHEA 1KDSA 3T1XA 4IEDA 4WUJA 3KSGA 4GZBA 5HDCA 3KX0X 4MMNA 4UQIS 3JYIA 4YFMA 1T1CA 1S1ZA 3CPTA 1JVJA 3CLOA 3EEAA 5IU1A 4EQIA 2XH9A 2Y4AA 1XGIA 3DBAA 2D01A 4GW9A 4HJ4A 4Y7PA 5KSHA 3CUEC 1ERMA 1X0OA 3LI8A 1SKFA 3QHYA 4EESA 3M6BA 3PBTA 4QY6A 3ZVTA 5D3OA 1PWCA 3RTYA 5L07A 4HHDA 2BG1A 3T4QA 2A24B 4X53A 3FWLA 5TBMA 1PIOA 4GHIB 3QP6A 1FSWA 4X25A 2Y91A 3GR2A 4CLCA 3UE1A 3HL9A 3PTEA 3UPOA 1FCMA 2ACGA 4HOIA 3MXSA 2I72A 2WGIA 2ZBBA 4CQHA 5A93A 4DXBA 2XDMA 1K56A 1XFNA 2ZL1B 2X02A 3LGOA 3ZNTA 4XT2A 4DMZA 5HWTA 1IYPA 4OP5A 5FSRA 3G2YA 3BFCA 5HARA 3E0YA 4OPYA 3VSKA 4HH3A 1CI9A 1DP6A 2O9BA 1F2KA 3KYEA 1G6AA 4WLAA 3IH8A 2MJ6A 2UWXA 5E2HA 2VGKA 3ZG9B 4QHCA 2OWJA 1GHMA 4CPKA 3QP5A 4X55A 5FL3A 5CXWA 3B47A 4X1LA 3S22A 4IBRA 3HJKA 4LENA 2XEPA 4KUKA 1ZTUA 4GD6A 4R4SA 3IQAA 1NY0A 4Y17A 1G5UA 1GSXA 1XJ3A 3C38A 3PBOA 4OOLA 2EWWA 3NOTC 3VV4A 3VFHA 1GSWA 3HBRA 4EXOA 3GV9A 3MF0A 5A8BA 4Q0HA 2YKHA 3GSGA 1HVBA 4ZTKA 5HAIA 4U0XA 4OONA 4CLCE 3F1PA 3ZNYA 3FKVA 3EEHA 3IXHA 2JKGA 1IEMA 4WBGA 1VHMA 5TBMB 2C6WB 5FQMA 4ZJ1A 4P85A 4HESA 1YSPA 3KYZA 1P0ZA 2HJ9C 2ZQDA 5FATA 2W3FA 5EVID 1YSQA 3LI9A 5FI7A 3P98A 1KDWA 2QPNA 4Y0OA 1A0KA 5TFQA 3SS4A 5GHZA 2GX5A 1H8ZA 2FZ0A 2WKRA 3W4QA 5AQ9A 1IYSA 3MSHA 3HJIA 4JF4A 3HLFA 1RGYA 1E4DA 2EX8A 2EXBA 3LIAA 1VETA 1LT0A 4PKYA 2V9AA 3BQAA 1ONGA 3VP3A 1MKMA 3S7QA 2ZM0A 1IFQA 4K08A 3M6HA 1K4FA 4IJGA 2Y2OA 4YWZA 3V67A 3N8LA 2HP6A 3BLSA 4MEZA 5F82A 2OAP1 3PXPA 4JGRA 4JGOA 3UB8A 1JTDA 4JXWA 4BLMA 1NWZA 3O5YA 4O8GA 3IF6A 4X69A 2PRFA 3NDGA 1TS8A 2QJ5A 3CI6A 3ISGA 5CX7A 1OMEA 5DVAA 5K5BA 3GECA 5HD3A 1SKOB 2RL3A 4YOFA 4O0PA 4R1GA 1IELA 3IS2A 4Y5FA 1KGFA 3F1PB 1YPRA 5FDHA 1MWSA 3ZYTA 3B3XA 1IYQA 2PDRA 3BQ8A 1OTIA 4EERA 3N8SA 1MPLA 4OH0A 3VOLA 1PZPA 1IYOA 2M7UA 3DAVA 3IF6C 5HDSA 3BFGA 1KVLA 3M2JA 3N7WA 5L10A 5LBRA 1VETB 1ES2A 4B4XA 4LV3A 3LEQA 1BTLA 1KE3A 2R9WA 4O01A 3O86A 5GLDA 4ZJ2A 5L09A 4X1MA 3UB7A 2EFUA 1SHVA 1S4SA 1ES3A 1YLPA 3BFFA 2Y55A 2JKTI 2L1MA 5G4ZA 4MBHA 2Y2LA 4L0LA 5CTMA 1LSXA 2HDRA 4IUHA 4Z1WA 2V1AA 2EA9A 3T1RA 4WELA 1WYCA 3UB6A 5KZHA 3C30A 5HPIA 2QJ7A 3IHAA 2EX6A 2W1RA 1KE4A 3D4FA 3IF6B 2M7VA 2XLNA 1N9LA 1VB6A 4QU3A 3A3DA 4QY5A 2PU2A 1HD8A 3VMAA 1NYMA 1PRQA 5CHUA 2WKHA 3U4LP 3MXRA 1FILA 1OT6A 2ZQ7A 2H0YA 4BMWA 2ZQ9A 1XFQA 2C5WB 3H82A 4DKIA 3BEBA 5CHJA 4NXEA 3LR4A 5EOEA 5I94A 1F5MA 3GRJA 5EFWA 2KLIA 3BFDA 2PYPA 4D2OA 1JWZA 2JBFA 1XPBA 2P7JA 3G4PA 4L9EA 3IS2B 3D72A 3NC8A 4OQHA 4HBTA 1P9RA 4JXVA 3E2KA 1O07A 3EQVA 2V0WA 4JBFA 2CC1A 1BLHA 4L9FA 1ESIA 3MXQA 3NOPC 2HP9A 3T4SA 4S2IA 2J9OA 1S66L 5EPHA 2WGVA 3NJAA 1ESUA 5HAQA 5DJTA 1ODVA 1MWRA 4S2MA 2Y2IA 4HJ6A 5HSQA 1CK3A 3MKEA 4C75A 3RFBA 2JKFA 4F3LA 1JNUA 2K7SA 1EWZA 2XQZA 4UHUA 4DRTA 2QYBA 3NHQA 4M4XA 4MBFA 4WMCA 3TE8A 3ZG8B 3P01A 1NZUA 3S7NA 1F98A 2A2LA 2EX2A 3LFVA 2WAFA 4ZRRA 2P04A 3IBRA 4DDYA 1W5DA 3T50A 1CQAA 1U60A 3ICYA 4RX3A 3QP2A 3Q7VA 1N9OA 2ZMAA 1K38A 2W3GA 4IHQA 2IWBA 3QNBA 4NEED 1BSGA 1W79A 3A3FA 3C7UA 3BM6A 3NCKA 1L0FA 3IWOA 2V1BA 2VZWA 3PBRA 3FKWA 3H82B 4Q0IA 2PAVP 4Y13A 3HUOA 1BT5A 4F94A 5C5KA 2NUTC 3IH9A 2EWVA 2Z2MB 3M2KA 4UA7A 3LR0A 3B33A 1Q2QA 4KZ4A 3T1QB 2VV8A 2QKPA 2XROA 1PW8A 2BTFP 4PM5A 3MFDA 3MR0A 1UWNX 3TG9A 5AQAA 5TGFA 4JGPA 1L0GA 3R7WA 3GDIA 3NY4A 3ZHHA 1Z6FA 2XR0A 3K2NA 4HIAA 4BBTA 5A91A 4KQOA 1XA7A 5FAQA 4LPZA 5A92A 1ZHHB
chains in the Genus database with same CATH topology
4DE0A 4BD0A 4NETA 4QJGA 4OOLA 2DNSA 3PBNA 4KQRA 5FQKA 2Y2QA 3G30A 5EVIB 2DCFA 4FD8A 3VOYA 3NBLA 3VFHA 3HBRA 2EFXA 1GA0A 3GV9A 3S4XA 3SH7A 2JC7A 4EBLA 3TOIA 1ES5A 4BL2A 1K25A 1RGZA 3GSGA 1HVBA 1AXBA 3MBZA 4GDNA 4ZTKA 5HAIA 4U0XA 4IVIA 3WS0A 1K6SA 4OONA 4Q8IA 4KQQA 3ZNYA 3FKVA 3HVFA 4P6BA 1VM1A 2XFSA 2H10A 3OCNA 3IXHA 1IEMA 2ZQ8A 4WBGA 5CTNA 5FQ9A 1E25A 4P87A 1GA9A 3MZFA 2C6WB 1L0DA 1CEFA 1XXMA 2V2FF 2WADA 4P85A 5FQMA 4ZJ1A 4HESA 2VGJA 4WEKA 3IXBA 2ZQDA 3ZG7B 2XF3A 5FATA 1SDNA 5FAPA 3TSGA 2G2WA 5EVID 5GLBA 3V5MA 5HW3A 4GKUA 4RYEA 5FI7A 3P98A 4R3BA 1MXOA 1WYBA 3BLMA 1KDWA 2QPNA 1MKIA 5GLAA 4OOMA 4Y0OA 1M40A 3GQZA 5TFQA 1LI0A 4XUZA 3SS4A 5JYOA 4YINA 2HDUA 3Q7VB 3ZFZA 2DRWA 1MY8A 4WMCD 5GHZA 1MWTA 3IT9A 1H8ZA 2WYXA 3W4QA 4PPRA 5AQ9A 5KSCA 1XGJA 1L2SA 1IYSA 4E6WA 1CEGA 3N6IA 1K57A 4JF4A 3HLFA 2WGWB 4RVAA 1RGYA 1E4DA 2EX8A 2EXBA 2P9VA 1K54C 4GB7A 5GLCA 1GHPA 1BLPA 3FZCA 2ZQCA 1KGGA 3G31A 4LV1A 1I2SA 1ONGA 3ITAA 4QB8A 2HDQA 3UDIA 1RCJA 3VP3A 1YLYA 3CJMA 3VP2A 2ZM0A 3O87A 1O7EA 4OKPA 5EECA 3OPPA 3CG5A 4JXSA 4Y0TA 1Q2PA 1K56D 3G32A 2ZC4B 1KVMA 3M6HA 1K4FA 2Y2OA 2EXAA 2Y2PA 3FV7A 2J8YA 3BECA 4O7DA 4PM8A 1FCNA 3N8LA 2HP6A 5M1AA 5U47A 5HX9A 4EUZA 3BLSA 4N1XA 4E3OA 4MEZA 3A3IA 1RP5A 3V39A 3AGFA 5CEBA 1MWUA 1YLTA 5F82A 2X01A 2Y59A 3W8KA 4R0QA 1TDGA 4NK3A 3EQUA 3G35A 1XX2A 5FA7A 3SS5A 2A49A 1JTDA 4JXWA 4S2NA 1ZKJA 4BLMA 4WZ5C 4FCFA 4R23A 4JF6A 3UE3A 3DW0A 3P09A 4PM7A 4R4RA 1GCEA 5HAPA 2OLUA 2PU4A 3IF6A 3IXDA 4U0TA 1BUEA 2ZC7A 4X69A 3OPRA 3NDGA 3O3VA 4RA7A 2WAEA 4E3LA 1ONHA 3UE0A 4E3NA 4MLLA 3ISGA 5J8XA 1W7FA 1OMEA 4JXGA 2J9PA 3E2LA 1ALQA 5DVAA 2WKIA 5FI2A 2FFYA 4X56A 3Q82A 1XA1A 4A5RA 1ZC2A 5HL1A 1K57C 4WEJA 2Y2NA 2RL3A 4IVKA 4Z9QA 4QD4A 2R9XA 3OZHA 2OLVA 3WS1A 4BQMA 5BOHA 3PBSA 1M6KA 4LCMA 1NXYA 4R1GA 4KZBA 4KZ8A 1IELA 3HREA 4RX2A 5CHMA 1PWGA 1PWDA 2ZM2A 1FQGA 3G2ZA 4M3KA 1PW1A 2XK1A 3DWKA 1KGFA 3I7JA 4C6YA 5FDHA 3SOIA 1ERQA 5FASA 1MWSA 5EUAA 4EWFA 1KE0A 3UPNA 3ZG0A 3N4IA 3VP4A 4LV2A 2ZLYA 3B3XA 2ZQAA 1YT4A 1FCOA 3HUNA 4KZ6A 1IYQA 4OPQA 4OLDA 4KZ9A 1LL5A 4KZAA 4N9LA 4OPZA 4EBPA 1PI5A 4PM9A 4X68A 3DWZA 2X71A 4GD8A 4ZAMA 2P74A 1QMFA 4WZ5A 2HP5A 4GN2A 3LY4A 3NIAA 1DJAA 5CRFA 3N8SA 2XGNA 4KZ5A 1JTGA 4BENA 1MPLA 2ZJ9A 3G34A 4OQIA 3Q1FA 1S6RA 5EE8A 4OH0A 3OC2A 3IHBA 4S2JA 5FAOA 4S2NC 1PZPA 2HPBA 1IYOA 5F1FA 2XD5A 1FOFA 2IWDA 3VSLA 1YLZA 3IF6C 2PBYA 1CI8A 5L2FA 3BFGA 4H8RA 2WZXA 4C3QA 4DXCA 1KVLA 3M2JA 3N7WA 3VP0A 2P9VB 3ZCZA 1ES2A 1XKZA 1YMSA 2Y2MA 5AQ7A 3V50A 4B4XA 3V3SA 3HLDA 4LV3A 1BLSA 5CGSA 1LI9A 5DF7A 1BTLA 5E2EA 1KE3A 2R9WA 3IXGA 3O86A 1N4OA 1N9BA 5GLDA 3Q81A 4ZJ2A 3VP1A 2GDNA 3FYZA 1SCWA 2EFUA 2JE5A 1K4EA 1SHVA 1ES3A 1EI5A 3LO7A 2V1ZA 3AGDA 4GOGA 4FH4A 3C5AA 1YLPA 3BFFA 3PBQA 5DTSA 1W8YA 1I2WA 2Y55A 4JLFA 5E43A 3VOZA 4ZJ3A 5CERA 3C4OA 4MBHA 3C4PA 1WE4A 2WZZA 3HLEA 2Y2LA 4L0LA 4S2OA 1K55A 5CTMA 5FQQA 4IBXA 3HLGA 3GMWA 1TDLA 3WRZA 2HDRA 2Q9MA 1H8YA 1LHYA 4HBUA 3ZGAB 2HDSA 4WELA 1WYCA 2XFTA 4XXRA 5KZHA 3GTCA 3GVBA 4PM6A 4FH2A 3IHAA 3UDXA 2EX6A 3D4FA 1KE4A 3IF6B 3C7VA 2XLNA 1E3UA 3PAEA 4QU3A 3A3DA 5FQIA 4QY5A 2PU2A 4K91A 5M18A 1HD8A 3VMAA 1NYMA 1G68A 5CHUA 4ZDXA 3QNCA 5CEDA 2QZ6A 2WKHA 3MXRA 1QMEA 2ZQ7A 2OV5A 2H0YA 1ZG6A 1LLBA 2OSUA 5EOOA 4JF5A 2ZQ9A 3LY3A 2C5WB 3RXXA 4U3TA 1PI4A 3WS5A 4DKIA 1PYYA 3BEBA 2A3UA 5CHJA 2ZD8A 4DDSA 4KZ3A 5HFOA 4OQ0A 3UO9A 4OOYA 1DJCA 5I94A 1J9MA 3HLWA 3GRJA 5EOEA 4DE3A 2JCHA 4WZ4A 3BFDA 1FR1A 2E8IA 3OPHA 4D2OA 1BLCA 3ZG5A 1JWZA 3PAGA 2JBFA 5DTTA 1XPBA 1W8QA 4KZ7A 3G4PA 2H0TA 3WS4A 1YMXA 1MBLA 1KDSA 3NC8A 2WUQA 3OCLA 4HBTA 4OQHA 5CECA 4JXVA 1KGEA 4IEDA 5DTKA 4JPMA 3E2KA 1O07A 3SH9A 3EQVA 3VFFA 1FR6A 4BL3A 4JBFA 4K0XA 3UN7A 4GZBA 4R3JA 2CC1A 1BLHA 1ESIA 2HP9A 4S2IA 2J9OA 4N1HA 3JYIA 4YFMA 2B5RA 5EPHA 2WGVA 1ESUA 1JVJA 5HAQA 1JWVA 4E3MA 2WKEA 2XD1A 2Y2GA 4B88A 1K55C 2V20A 3WS2A 3BYDA 4EQIA 3WWXA 1L0EA 2XH9A 2Y4AA 4ZBEA 1XGIA 1XP4A 3UY6A 4OP8A 4LV0A 1MWRA 2FFFB 4S2MA 1ES4A 4DE1A 2Y2IA 1IKGA 1CK3A 1NYYA 3UDFA 1HZOA 1VQQA 1HTZA 3IF5A 3MKEA 4C75A 5TR7A 4Y7PA 4MNRA 3NI9A 2WK0A 3HLBA 5KSHA 1ERMA 5DF9A 4EV4A 2IWCA 5EVIA 4E6XA 1GHIA 4OLGA 1SKFA 1IKIA 3QHYA 3W4PA 3M6BA 3PBTA 4QY6A 3BFEA 1EWZA 2XQZA 4UHUA 4DRTA 3Q07A 3WRTA 5M19A 3ZVTA 4FSFA 5E2FA 5D3OA 4GNUA 1PWCA 1DJBA 4MBFA 4UAAA 4UA6A 4E3JA 4WMCA 5F83A 3V3RA 3ZG8B 5FI6A 4CJNA 2BG1A 2RCXA 1S0WA 1NZUA 3ITBA 1LL9A 2EX9A 1YLJA 1H5XA 3OPLA 4S2LA 3FWLA 4X53A 4XUXA 5GL9A 4DE2A 1FSYA 1PIOA 2H5SA 2EX2A 3AGEA 1FSWA 2WAFA 2Y91A 3GR2A 4JKTA 1SDEA 3UE1A 2Y2HA 1JWPA 3HL9A 4BD1A 3PTEA 1YM1A 3N8RA 3NDEA 4GDBA 4ID4A 4DDYA 3UPOA 4S2PA 1FCMA 3O88A 4N92A 1W5DA 1I5QA 2ZC5B 1C3BA 4KENB 4KG6A 1U60A 2ZC6B 4RX3A 3MXSA 2I72A 3Q7VA 2WGIA 4KG5A 3ZDJA 3DTMA 4EBNA 4DXBA 5A93A 2QMIA 2XDMA 1K56A 2ZMAA 1K38A 3MKFA 3BRMA 2IWBA 3QNBA 3W4OA 2X02A 1NZOA 1BSGA 3ZNTA 1DY6A 1W79A 2WGWA 2Z2LB 3A3FA 3C7UA 3BM6A 3IWIA 4Y0UA 3CMZA 3Q7ZA 1IYPA 3NCKA 4OPRA 4OP5A 3SH8A 5FSRA 1L0FA 1EROA 3IWOA 5G18A 3G2YA 3BFCA 3PBRA 4UA9A 5HARA 3ZVWA 3FKWA 4MBKA 4OPYA 5A90A 3LEZA 3VSKA 4N9KA 4P0MA 5GHXA 2Q9NA 1CI9A 1NRFA 3HUMA 1NJ4A 3UPPA 3HUOA 3MZEA 4HEFA 4X6TA 5EVIC 1BT5A 4LCLA 1G6AA 4F94A 3IH8A 2UWXA 3RJUA 4E3IA 5E2HA 1TVFA 1Y54A 3IH9A 2Z2MB 2VGKA 3M2KA 1E3UD 3ZG9B 3S1YA 4QHCA 4UA7A 3CZDA 1GHMA 3LCEA 5F1GA 4DF6A 5JYPA 1ZG4A 1Q2QA 1TEMA 4KZ4A 3HLCA 5IHVA 4CPKA 4X55A 1K6RA 2BLSA 3RXWA 5CXWA 4WYYA 1PW8A 4PMAA 3UNWA 1PZOA 4WM9A 5DF8A 5CGXA 3S22A 2Y2JA 5E2GA 4PM5A 3MFDA 4IBRA 1BULA 5GHYA 4LENA 1YLWA 3TG9A 4KG2A 2J7VA 1BZAA 5AQAA 5TGFA 2XEPA 4K0WA 1L0GA 4OVDA 3NY4A 5CGWA 5EVLA 3ZHHA 3SS3A 5FQJA 4B4ZA 2G2UA 4GD6A 4E3KA 1Z6FA 3A3JA 3MZDA 4R4SA 1K54A 3IQAA 4OQGA 2XR0A 2ZM8A 4S2KA 1NY0A 5AQBA 1YQSA 5A91A 2ZC3B 3A3EA 3PBOA 4KQOA 1XA7A 2Y2KA 4BJPA 5FAQA 5KMWA 3IWQA 5A92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DE0 A;  4BD0 A;  4NET A;  4QJG A;  4OOL A;  2DNS A;  3PBN A;  4KQR A;  5FQK A;  2Y2Q A;  3G30 A;  5EVI B;  2DCF A;  4FD8 A;  3VOY A;  3NBL A;  3VFH A;  3HBR A;  2EFX A;  1GA0 A;  3GV9 A;  3S4X A;  3SH7 A;  2JC7 A;  4EBL A;  3TOI A;  1ES5 A;  4BL2 A;  1K25 A;  1RGZ A;  3GSG A;  1HVB A;  1AXB A;  3MBZ A;  4GDN A;  4ZTK A;  5HAI A;  4U0X A;  4IVI A;  3WS0 A;  1K6S A;  4OON A;  4Q8I A;  4KQQ A;  3ZNY A;  3FKV A;  3HVF A;  4P6B A;  1VM1 A;  2XFS A;  2H10 A;  3OCN A;  3IXH A;  1IEM A;  2ZQ8 A;  4WBG A;  5CTN A;  5FQ9 A;  1E25 A;  4P87 A;  1GA9 A;  3MZF A;  2C6W B;  1L0D A;  1CEF A;  1XXM A;  2V2F F;  2WAD A;  4P85 A;  5FQM A;  4ZJ1 A;  4HES A;  2VGJ A;  4WEK A;  3IXB A;  2ZQD A;  3ZG7 B;  2XF3 A;  5FAT A;  1SDN A;  5FAP A;  3TSG A;  2G2W A;  5EVI D;  5GLB A;  3V5M A;  5HW3 A;  4GKU A;  4RYE A;  5FI7 A;  3P98 A;  4R3B A;  1MXO A;  1WYB A;  3BLM A;  1KDW A;  2QPN A;  1MKI A;  5GLA A;  4OOM A;  4Y0O A;  1M40 A;  3GQZ A;  5TFQ A;  1LI0 A;  4XUZ A;  3SS4 A;  5JYO A;  4YIN A;  2HDU A;  3Q7V B;  3ZFZ A;  2DRW A;  1MY8 A;  4WMC D;  5GHZ A;  1MWT A;  3IT9 A;  1H8Z A;  2WYX A;  3W4Q A;  4PPR A;  5AQ9 A;  5KSC A;  1XGJ A;  1L2S A;  1IYS A;  4E6W A;  1CEG A;  3N6I A;  1K57 A;  4JF4 A;  3HLF A;  2WGW B;  4RVA A;  1RGY A;  1E4D A;  2EX8 A;  2EXB A;  2P9V A;  1K54 C;  4GB7 A;  5GLC A;  1GHP A;  1BLP A;  3FZC A;  2ZQC A;  1KGG A;  3G31 A;  4LV1 A;  1I2S A;  1ONG A;  3ITA A;  4QB8 A;  2HDQ A;  3UDI A;  1RCJ A;  3VP3 A;  1YLY A;  3CJM A;  3VP2 A;  2ZM0 A;  3O87 A;  1O7E A;  4OKP A;  5EEC A;  3OPP A;  3CG5 A;  4JXS A;  4Y0T A;  1Q2P A;  1K56 D;  3G32 A;  2ZC4 B;  1KVM A;  3M6H A;  1K4F A;  2Y2O A;  2EXA A;  2Y2P A;  3FV7 A;  2J8Y A;  3BEC A;  4O7D A;  4PM8 A;  1FCN A;  3N8L A;  2HP6 A;  5M1A A;  5U47 A;  5HX9 A;  4EUZ A;  3BLS A;  4N1X A;  4E3O A;  4MEZ A;  3A3I A;  1RP5 A;  3V39 A;  3AGF A;  5CEB A;  1MWU A;  1YLT A;  5F82 A;  2X01 A;  2Y59 A;  3W8K A;  4R0Q A;  1TDG A;  4NK3 A;  3EQU A;  3G35 A;  1XX2 A;  5FA7 A;  3SS5 A;  2A49 A;  1JTD A;  4JXW A;  4S2N A;  1ZKJ A;  4BLM A;  4WZ5 C;  4FCF A;  4R23 A;  4JF6 A;  3UE3 A;  3DW0 A;  3P09 A;  4PM7 A;  4R4R A;  1GCE A;  5HAP A;  2OLU A;  2PU4 A;  3IF6 A;  3IXD A;  4U0T A;  1BUE A;  2ZC7 A;  4X69 A;  3OPR A;  3NDG A;  3O3V A;  4RA7 A;  2WAE A;  4E3L A;  1ONH A;  3UE0 A;  4E3N A;  4MLL A;  3ISG A;  5J8X A;  1W7F A;  1OME A;  4JXG A;  2J9P A;  3E2L A;  1ALQ A;  5DVA A;  2WKI A;  5FI2 A;  2FFY A;  4X56 A;  3Q82 A;  1XA1 A;  4A5R A;  1ZC2 A;  5HL1 A;  1K57 C;  4WEJ A;  2Y2N A;  2RL3 A;  4IVK A;  4Z9Q A;  4QD4 A;  2R9X A;  3OZH A;  2OLV A;  3WS1 A;  4BQM A;  5BOH A;  3PBS A;  1M6K A;  4LCM A;  1NXY A;  4R1G A;  4KZB A;  4KZ8 A;  1IEL A;  3HRE A;  4RX2 A;  5CHM A;  1PWG A;  1PWD A;  2ZM2 A;  1FQG A;  3G2Z A;  4M3K A;  1PW1 A;  2XK1 A;  3DWK A;  1KGF A;  3I7J A;  4C6Y A;  5FDH A;  3SOI A;  1ERQ A;  5FAS A;  1MWS A;  5EUA A;  4EWF A;  1KE0 A;  3UPN A;  3ZG0 A;  3N4I A;  3VP4 A;  4LV2 A;  2ZLY A;  3B3X A;  2ZQA A;  1YT4 A;  1FCO A;  3HUN A;  4KZ6 A;  1IYQ A;  4OPQ A;  4OLD A;  4KZ9 A;  1LL5 A;  4KZA A;  4N9L A;  4OPZ A;  4EBP A;  1PI5 A;  4PM9 A;  4X68 A;  3DWZ A;  2X71 A;  4GD8 A;  4ZAM A;  2P74 A;  1QMF A;  4WZ5 A;  2HP5 A;  4GN2 A;  3LY4 A;  3NIA A;  1DJA A;  5CRF A;  3N8S A;  2XGN A;  4KZ5 A;  1JTG A;  4BEN A;  1MPL A;  2ZJ9 A;  3G34 A;  4OQI A;  3Q1F A;  1S6R A;  5EE8 A;  4OH0 A;  3OC2 A;  3IHB A;  4S2J A;  5FAO A;  4S2N C;  1PZP A;  2HPB A;  1IYO A;  5F1F A;  2XD5 A;  1FOF A;  2IWD A;  3VSL A;  1YLZ A;  3IF6 C;  2PBY A;  1CI8 A;  5L2F A;  3BFG A;  4H8R A;  2WZX A;  4C3Q A;  4DXC A;  1KVL A;  3M2J A;  3N7W A;  3VP0 A;  2P9V B;  3ZCZ A;  1ES2 A;  1XKZ A;  1YMS A;  2Y2M A;  5AQ7 A;  3V50 A;  4B4X A;  3V3S A;  3HLD A;  4LV3 A;  1BLS A;  5CGS A;  1LI9 A;  5DF7 A;  1BTL A;  5E2E A;  1KE3 A;  2R9W A;  3IXG A;  3O86 A;  1N4O A;  1N9B A;  5GLD A;  3Q81 A;  4ZJ2 A;  3VP1 A;  2GDN A;  3FYZ A;  1SCW A;  2EFU A;  2JE5 A;  1K4E A;  1SHV A;  1ES3 A;  1EI5 A;  3LO7 A;  2V1Z A;  3AGD A;  4GOG A;  4FH4 A;  3C5A A;  1YLP A;  3BFF A;  3PBQ A;  5DTS A;  1W8Y A;  1I2W A;  2Y55 A;  4JLF A;  5E43 A;  3VOZ A;  4ZJ3 A;  5CER A;  3C4O A;  4MBH A;  3C4P A;  1WE4 A;  2WZZ A;  3HLE A;  2Y2L A;  4L0L A;  4S2O A;  1K55 A;  5CTM A;  5FQQ A;  4IBX A;  3HLG A;  3GMW A;  1TDL A;  3WRZ A;  2HDR A;  2Q9M A;  1H8Y A;  1LHY A;  4HBU A;  3ZGA B;  2HDS A;  4WEL A;  1WYC A;  2XFT A;  4XXR A;  5KZH A;  3GTC A;  3GVB A;  4PM6 A;  4FH2 A;  3IHA A;  3UDX A;  2EX6 A;  3D4F A;  1KE4 A;  3IF6 B;  3C7V A;  2XLN A;  1E3U A;  3PAE A;  4QU3 A;  3A3D A;  5FQI A;  4QY5 A;  2PU2 A;  4K91 A;  5M18 A;  1HD8 A;  3VMA A;  1NYM A;  1G68 A;  5CHU A;  4ZDX A;  3QNC A;  5CED A;  2QZ6 A;  2WKH A;  3MXR A;  1QME A;  2ZQ7 A;  2OV5 A;  2H0Y A;  1ZG6 A;  1LLB A;  2OSU A;  5EOO A;  4JF5 A;  2ZQ9 A;  3LY3 A;  2C5W B;  3RXX A;  4U3T A;  1PI4 A;  3WS5 A;  4DKI A;  1PYY A;  3BEB A;  2A3U A;  5CHJ A;  2ZD8 A;  4DDS A;  4KZ3 A;  5HFO A;  4OQ0 A;  3UO9 A;  4OOY A;  1DJC A;  5I94 A;  1J9M A;  3HLW A;  3GRJ A;  5EOE A;  4DE3 A;  2JCH A;  4WZ4 A;  3BFD A;  1FR1 A;  2E8I A;  3OPH A;  4D2O A;  1BLC A;  3ZG5 A;  1JWZ A;  3PAG A;  2JBF A;  5DTT A;  1XPB A;  1W8Q A;  4KZ7 A;  3G4P A;  2H0T A;  3WS4 A;  1YMX A;  1MBL A;  1KDS A;  3NC8 A;  2WUQ A;  3OCL A;  4HBT A;  4OQH A;  5CEC A;  4JXV A;  1KGE A;  4IED A;  5DTK A;  4JPM A;  3E2K A;  1O07 A;  3SH9 A;  3EQV A;  3VFF A;  1FR6 A;  4BL3 A;  4JBF A;  4K0X A;  3UN7 A;  4GZB A;  4R3J A;  2CC1 A;  1BLH A;  1ESI A;  2HP9 A;  4S2I A;  2J9O A;  4N1H A;  3JYI A;  4YFM A;  2B5R A;  5EPH A;  2WGV A;  1ESU A;  1JVJ A;  5HAQ A;  1JWV A;  4E3M A;  2WKE A;  2XD1 A;  2Y2G A;  4B88 A;  1K55 C;  2V20 A;  3WS2 A;  3BYD A;  4EQI A;  3WWX A;  1L0E A;  2XH9 A;  2Y4A A;  4ZBE A;  1XGI A;  1XP4 A;  3UY6 A;  4OP8 A;  4LV0 A;  1MWR A;  2FFF B;  4S2M A;  1ES4 A;  4DE1 A;  2Y2I A;  1IKG A;  1CK3 A;  1NYY A;  3UDF A;  1HZO A;  1VQQ A;  1HTZ A;  3IF5 A;  3MKE A;  4C75 A;  5TR7 A;  4Y7P A;  4MNR A;  3NI9 A;  2WK0 A;  3HLB A;  5KSH A;  1ERM A;  5DF9 A;  4EV4 A;  2IWC A;  5EVI A;  4E6X A;  1GHI A;  4OLG A;  1SKF A;  1IKI A;  3QHY A;  3W4P A;  3M6B A;  3PBT A;  4QY6 A;  3BFE A;  1EWZ A;  2XQZ A;  4UHU A;  4DRT A;  3Q07 A;  3WRT A;  5M19 A;  3ZVT A;  4FSF A;  5E2F A;  5D3O A;  4GNU A;  1PWC A;  1DJB A;  4MBF A;  4UAA A;  4UA6 A;  4E3J A;  4WMC A;  5F83 A;  3V3R A;  3ZG8 B;  5FI6 A;  4CJN A;  2BG1 A;  2RCX A;  1S0W A;  1NZU A;  3ITB A;  1LL9 A;  2EX9 A;  1YLJ A;  1H5X A;  3OPL A;  4S2L A;  3FWL A;  4X53 A;  4XUX A;  5GL9 A;  4DE2 A;  1FSY A;  1PIO A;  2H5S A;  2EX2 A;  3AGE A;  1FSW A;  2WAF A;  2Y91 A;  3GR2 A;  4JKT A;  1SDE A;  3UE1 A;  2Y2H A;  1JWP A;  3HL9 A;  4BD1 A;  3PTE A;  1YM1 A;  3N8R A;  3NDE A;  4GDB A;  4ID4 A;  4DDY A;  3UPO A;  4S2P A;  1FCM A;  3O88 A;  4N92 A;  1W5D A;  1I5Q A;  2ZC5 B;  1C3B A;  4KEN B;  4KG6 A;  1U60 A;  2ZC6 B;  4RX3 A;  3MXS A;  2I72 A;  3Q7V A;  2WGI A;  4KG5 A;  3ZDJ A;  3DTM A;  4EBN A;  4DXB A;  5A93 A;  2QMI A;  2XDM A;  1K56 A;  2ZMA A;  1K38 A;  3MKF A;  3BRM A;  2IWB A;  3QNB A;  3W4O A;  2X02 A;  1NZO A;  1BSG A;  3ZNT A;  1DY6 A;  1W79 A;  2WGW A;  2Z2L B;  3A3F A;  3C7U A;  3BM6 A;  3IWI A;  4Y0U A;  3CMZ A;  3Q7Z A;  1IYP A;  3NCK A;  4OPR A;  4OP5 A;  3SH8 A;  5FSR A;  1L0F A;  1ERO A;  3IWO A;  5G18 A;  3G2Y A;  3BFC A;  3PBR A;  4UA9 A;  5HAR A;  3ZVW A;  3FKW A;  4MBK A;  4OPY A;  5A90 A;  3LEZ A;  3VSK A;  4N9K A;  4P0M A;  5GHX A;  2Q9N A;  1CI9 A;  1NRF A;  3HUM A;  1NJ4 A;  3UPP A;  3HUO A;  3MZE A;  4HEF A;  4X6T A;  5EVI C;  1BT5 A;  4LCL A;  1G6A A;  4F94 A;  3IH8 A;  2UWX A;  3RJU A;  4E3I A;  5E2H A;  1TVF A;  1Y54 A;  3IH9 A;  2Z2M B;  2VGK A;  3M2K A;  1E3U D;  3ZG9 B;  3S1Y A;  4QHC A;  4UA7 A;  3CZD A;  1GHM A;  3LCE A;  5F1G A;  4DF6 A;  5JYP A;  1ZG4 A;  1Q2Q A;  1TEM A;  4KZ4 A;  3HLC A;  5IHV A;  4CPK A;  4X55 A;  1K6R A;  2BLS A;  3RXW A;  5CXW A;  4WYY A;  1PW8 A;  4PMA A;  3UNW A;  1PZO A;  4WM9 A;  5DF8 A;  5CGX A;  3S22 A;  2Y2J A;  5E2G A;  4PM5 A;  3MFD A;  4IBR A;  1BUL A;  5GHY A;  4LEN A;  1YLW A;  3TG9 A;  4KG2 A;  2J7V A;  1BZA A;  5AQA A;  5TGF A;  2XEP A;  4K0W A;  1L0G A;  4OVD A;  3NY4 A;  5CGW A;  5EVL A;  3ZHH A;  3SS3 A;  5FQJ A;  4B4Z A;  2G2U A;  4GD6 A;  4E3K A;  1Z6F A;  3A3J A;  3MZD A;  4R4S A;  1K54 A;  3IQA A;  4OQG A;  2XR0 A;  2ZM8 A;  4S2K A;  1NY0 A;  5AQB A;  1YQS A;  5A91 A;  2ZC3 B;  3A3E A;  3PBO A;  4KQO A;  1XA7 A;  2Y2K A;  4BJP A;  5FAQ A;  5KMW A;  3IWQ A;  5A92 A; 
#chains in the Genus database with same CATH topology
 4NET A;  3VE4 A;  2DNS A;  3C2W A;  4F3L B;  5FQK A;  1DP9 A;  2Y2Q A;  2O99 A;  3VOY A;  3NBL A;  2EFX A;  1GA0 A;  2JN7 A;  1UGU A;  4BL2 A;  1RGZ A;  1TS0 A;  3MMH A;  4Q8I A;  3HVF A;  3KO6 A;  1VM1 A;  5EV0 A;  2ZQ8 A;  5FQ9 A;  1TS6 A;  4LRY C;  1SDN A;  5HW3 A;  4GKU A;  4NKP A;  1MKI A;  1M40 A;  4XUZ A;  3Q7V B;  2VK3 A;  2WYX A;  3LR5 A;  1D1J A;  4BWI A;  4PPR A;  1CEG A;  1K57 A;  4B93 A;  4GB7 A;  5GLC A;  5HZH A;  1MC0 A;  3G31 A;  2G7U A;  3VP2 A;  1O7E A;  3OPP A;  3CG5 A;  3E4Q A;  1Q2P A;  3G32 A;  2ZC4 B;  3D9Y A;  3FV7 A;  2J8Y A;  3FC7 A;  3R4K A;  4G3V A;  4O7D A;  1FCN A;  2W1T A;  5M1A A;  4N1X A;  3IX8 A;  4E3O A;  5F5Y A;  5J4E A;  3A3I A;  2KDK A;  5CED A;  1EW0 A;  1YLT A;  5I5L A;  2X01 A;  4WL9 A;  1P9W A;  1TDG A;  4NK3 A;  3EQU A;  3G35 A;  2A49 A;  4WZ5 C;  2W3E A;  3R7W B;  3P09 A;  4R4R A;  2OLU A;  2PU4 A;  3IXD A;  3UME A;  2INW A;  3TJZ C;  1H0M A;  3T4L A;  3UE0 A;  4MLL A;  2J9P A;  3E2L A;  2DMW A;  2WKI A;  4LGW A;  4A5R A;  3Q82 A;  1ZC2 A;  4IUK A;  5HL1 A;  1K57 C;  4WEJ A;  2Y2N A;  3A0S A;  4IVK A;  4BQM A;  5BOH A;  2OLV A;  5AVF A;  1M6K A;  4LCM A;  1NXY A;  5CHM A;  4HH2 A;  2ZM2 A;  3C8C A;  1SKO A;  4GCZ A;  1FQG A;  4I3I A;  4M3K A;  2VGL M;  4R38 A;  3LIB A;  4OPQ A;  4OLD A;  1LL5 A;  4N9L A;  4NXG A;  4X68 A;  3DWZ A;  1P97 A;  3QP8 A;  2P74 A;  3NIA A;  3MQO A;  1DJA A;  4HQA A;  4KZ5 A;  2XGN A;  4BBV A;  2ZJ9 A;  3Q1F A;  1S6R A;  4ME4 A;  3IHB A;  2VGL S;  3T1S A;  2WKP A;  3UB9 A;  2XD5 A;  3UB5 P;  1FOF A;  2PBY A;  1CI8 A;  1OTD A;  3VP0 A;  3ZCZ A;  3MQQ A;  1YMS A;  3V50 A;  3V3S A;  3BY9 A;  3U2A A;  1LI9 A;  2JKR M;  5DF7 A;  3VP1 A;  1N9B A;  1S1Y A;  1SCW A;  3A0V A;  1K4E A;  4FH4 A;  2VLG A;  1Y4O A;  2W1T B;  3VOZ A;  3C4O A;  3JVU A;  5HD5 A;  4IBX A;  3EGX C;  4UEY A;  1TDL A;  2Q9M A;  1LHY A;  4HBU A;  5TJJ A;  2XFT A;  4LLO B;  1OPX A;  4FH2 A;  2PD7 A;  4K91 A;  5M18 A;  4ZDX A;  2OV5 A;  3RXX A;  4U3T A;  1PI4 A;  1PYY A;  2A3U A;  3PHY A;  2ZD8 A;  3MQ0 A;  5HWV A;  2O9A A;  4LRX C;  1FR1 A;  3OPH A;  2V0U A;  2R78 A;  3PAG A;  5DTT A;  1W8Q A;  3WS4 A;  1YMX A;  5CEC A;  2WUQ A;  1KGE A;  1DP8 A;  2V8C A;  2W3H A;  4JPM A;  3MS6 A;  3VFF A;  4BL3 A;  4EW7 A;  3UN7 A;  2VKS A;  3OBF A;  4N1H A;  3D3O A;  2B5R A;  1JWV A;  4E3M A;  2XD1 A;  4B88 A;  2KX6 A;  3WS2 A;  1L0E A;  4HI4 A;  3UY6 A;  4LV0 A;  2FFF B;  1ES4 A;  1IKG A;  3UDF A;  1VQQ A;  1HTZ A;  4I3A A;  3K3D A;  5TR7 A;  2QWS A;  1N9N A;  5AJG A;  2WK0 A;  3HLB A;  5DF9 A;  5EVI A;  1IKI A;  3W4P A;  3F1N A;  3BFE A;  5DJU A;  4FSF A;  2L0W A;  4NXB A;  4UAA A;  3V3R A;  4CJN A;  3ITB A;  1LL9 A;  1YLJ A;  3OPL A;  3IX3 A;  4S2L A;  5EM0 A;  4DE2 A;  5GL9 A;  2H5S A;  2J3W A;  3AGE A;  1SDE A;  2K31 A;  4RQ9 A;  4BD1 A;  1YM1 A;  3N8R A;  2P08 A;  4GDB A;  4MN6 A;  2GZA A;  4S2P A;  3O88 A;  2ZC5 B;  4KG6 A;  3RH8 B;  2ZC6 B;  3KSF A;  5DKL A;  3ZDJ A;  4EBN A;  3MKF A;  3BRM A;  3W4O A;  3E4P A;  1DY6 A;  2Z2L B;  2WGW A;  3IWI A;  3FPW A;  3EOI A;  3SH8 A;  4I38 A;  5G18 A;  2H28 A;  4KQD A;  4UA9 A;  4GLQ A;  5A90 A;  1IOU A;  5GHX A;  4NXF A;  1XJ2 A;  1NRF A;  5EVI C;  3DTI A;  2E8J A;  3HCY A;  1Y54 A;  1E3U D;  2UV0 E;  1G6O A;  3E98 A;  3LCE A;  5F1G A;  1ZG4 A;  1TEM A;  5IHV A;  3NEC A;  1K6R A;  2BLS A;  2VX8 A;  4WYY A;  5DF8 A;  5CGX A;  2Y2J A;  2VA0 A;  5E2G A;  4EUV A;  2HZ5 A;  5GHY A;  3UE6 A;  1YLW A;  4KG2 A;  2J7V A;  3OLO A;  5CGW A;  3SS3 A;  4E3K A;  3A3J A;  1G28 A;  4EU0 A;  2O9C A;  4OQG A;  1T1A A;  4EQ1 A;  5AQB A;  1YQS A;  1NLZ A;  2ZMV A;  4PKY G;  4DE0 A;  4QJG A;  1V9Y A;  1W63 Q;  5EVI B;  2DCF A;  4PAU A;  3CIT A;  3F1N B;  2O0Y A;  4EBL A;  3TOI A;  2KOI A;  1LSV A;  4HP9 A;  1BYW A;  4IVI A;  2VJW A;  1K6S A;  4KQQ A;  4P6B A;  2XFS A;  2H10 A;  3JPU A;  1E25 A;  4P87 A;  1GA9 A;  2GJ3 A;  3MZF A;  2WAD A;  3IXB A;  3ZG7 B;  2XF3 A;  3OOV A;  5GLB A;  3V5M A;  4RYE A;  3LYX A;  3BLM A;  1WYB A;  4OOM A;  2VV6 A;  3GQZ A;  1LI0 A;  5EM1 A;  3T4O A;  1MWT A;  3DTE A;  2PHY A;  3IT9 A;  3ULF A;  1XGJ A;  1L2S A;  1HLU P;  3N6I A;  3KSH A;  2WGW B;  2P9V A;  4CLC D;  3FZC A;  3LUQ A;  2ZQC A;  1KGG A;  3ITA A;  4QB8 A;  2HDQ A;  4II7 A;  3UDI A;  1RCJ A;  2OOL A;  2PYR A;  3CJM A;  2Y8H A;  3O87 A;  5EEC A;  4Y0T A;  1K56 D;  4AFI A;  3JVV A;  4PM8 A;  4WN5 A;  5U47 A;  5HX9 A;  4EUZ A;  1OTB A;  5AVE A;  3NOU C;  5CEB A;  3AGF A;  1MWU A;  2Y59 A;  3W8K A;  4R0Q A;  3MFX A;  2ZOH A;  1XX2 A;  1Y28 A;  4R23 A;  1KOU A;  4JGQ A;  4JF6 A;  5HAP A;  4PM7 A;  1GCE A;  3ZQ5 A;  3OPR A;  3P7N A;  4E3L A;  1ONH A;  3UMD A;  1PNE A;  4E3N A;  1H3Q A;  5J8X A;  4KUO A;  4JXG A;  1ALQ A;  5J7E A;  2FFY A;  1OJG A;  4R70 A;  2CMN A;  4Z9Q A;  2WKQ A;  2R9X A;  3WS1 A;  4GJ4 A;  3PBS A;  5J3W A;  4KZ8 A;  3HRE A;  1PWG A;  1PWD A;  2JKT M;  3G2Z A;  1PW1 A;  2XK1 A;  3I7J A;  3SOI A;  5FAS A;  5EUA A;  2HJE A;  5FDS A;  3UPN A;  3ZG0 A;  1GSV A;  4Y3I A;  3VP4 A;  4LV2 A;  4HNB A;  3B42 A;  4KZ6 A;  4KZA A;  1PFL A;  1PI5 A;  3LIF A;  4PM9 A;  2X71 A;  4GD8 A;  4ZAM A;  1STZ A;  4WZ5 A;  2HP5 A;  3LY4 A;  1JTG A;  3G34 A;  4FOF A;  3LR3 A;  3DTK A;  3OC2 A;  1T18 A;  1WA9 A;  4FTX A;  1K0K A;  2IWD A;  1YLZ A;  2Z6D A;  2WZX A;  4C3Q A;  4DXC A;  2P9V B;  5IT5 A;  3HLD A;  1VEU A;  1W63 M;  3IXG A;  4WF0 A;  3K3C A;  1T19 A;  2JE5 A;  3LO7 A;  2V1Z A;  3AGD A;  4GOG A;  3C5A A;  3CAX A;  1UWP X;  1W8Y A;  1I2W A;  4I39 A;  5CER A;  1WE4 A;  2WZZ A;  2LB5 A;  5F69 A;  1K55 A;  3EWK A;  3H7W A;  5F68 A;  3GTC A;  2OWH A;  5G4Y A;  2LB9 A;  5MC7 A;  4GS9 A;  3FG8 A;  3QNC A;  2QZ6 A;  1TF1 A;  5HL6 A;  3L9K A;  5HPF A;  1ZG6 A;  3CWF A;  5EOO A;  3LY3 A;  2B18 A;  3UO9 A;  4OOY A;  1DJC A;  4DE3 A;  4WZ4 A;  3PYP A;  1TD5 A;  1J3W A;  3SZT A;  4KZ7 A;  2H0T A;  3SW1 A;  1MBL A;  3BJN A;  3E4O A;  3OCL A;  2B95 A;  5DTK A;  4CLC C;  3SH9 A;  2D02 A;  1FR6 A;  3CPT B;  5FEF A;  4K0X A;  4R3J A;  2GNX A;  5KIZ A;  4G3K A;  1L3L A;  2WKE A;  2Y2G A;  1K55 C;  2V20 A;  3BYD A;  3IBJ A;  3WWX A;  4L9G A;  4ZBE A;  1XP4 A;  4OP8 A;  2J3T D;  3G6O A;  4D60 A;  4DE1 A;  1OT9 A;  1NYY A;  4LRZ E;  1HZO A;  3IF5 A;  4MNR A;  3NI9 A;  4EV4 A;  2IWC A;  4E6X A;  1GHI A;  4OLG A;  2XA7 M;  1VEU B;  3Q07 A;  3WRT A;  5M19 A;  5E2F A;  4GNU A;  1DJB A;  4E3J A;  4UA6 A;  5F83 A;  5FI6 A;  2RCX A;  1S0W A;  4CLC B;  2EX9 A;  4ESP A;  2HF6 A;  1H5X A;  2J80 A;  4XUX A;  1FSY A;  3QP1 A;  1CF0 A;  4R6L A;  4JKT A;  1H8M A;  1JWP A;  2Y2H A;  3NDE A;  2M1C A;  3W2Z A;  4ID4 A;  2V8F A;  4N92 A;  4HJ3 A;  1I5Q A;  2XA7 S;  1C3B A;  4KEN B;  2PR6 A;  2VEA A;  3H7W B;  4DN0 A;  3F1O A;  4KG5 A;  4ARZ A;  3DTM A;  3LIC A;  4XT2 B;  2QMI A;  4FUW A;  2PBD P;  2PD8 A;  4Q0J A;  1NZO A;  2Q0O A;  4GS9 B;  4Y0U A;  4H6J A;  3CMZ A;  3Q7Z A;  4OPR A;  1ERO A;  2OAQ 1;  3VE3 A;  3ZVW A;  4MBK A;  2HGV A;  1OJ5 A;  2I9V A;  3LEZ A;  4N9K A;  4P0M A;  4Y2F A;  2Q9N A;  3HUM A;  1NJ4 A;  3UPP A;  5DFY A;  3MZE A;  4X6T A;  4HEF A;  4LCL A;  3RJU A;  4E3I A;  1TVF A;  4MN7 A;  1D7E A;  3BY8 A;  3S1Y A;  3CZD A;  4DF6 A;  5JYP A;  3T4T A;  3HLC A;  3RXW A;  2PR5 A;  1OTA A;  4PMA A;  3UNW A;  1PZO A;  1LL8 A;  4B9O A;  1MZU A;  4WM9 A;  5IS1 A;  1XJ4 A;  1BUL A;  1BZA A;  4K0W A;  4OVD A;  5EVL A;  5FQJ A;  4B4Z A;  2G2U A;  3MZD A;  1K54 A;  2Z6C A;  2ZM8 A;  4S2K A;  2W3D A;  2ZC3 B;  3A3E A;  4BJP A;  4NG2 A;  2Y2K A;  5KMW A;  1OTE A;  3IWQ A;  4G3W A;  4BD0 A;  3PBN A;  4KQR A;  3G30 A;  3PR6 A;  4FD8 A;  3T12 B;  3S4X A;  3SH7 A;  2JC7 A;  1ES5 A;  1K25 A;  4R3A A;  2YKF A;  1AXB A;  3MBZ A;  4GDN A;  5FEG A;  3WS0 A;  3S7O A;  3OCN A;  2QHK A;  5CTN A;  5EVE A;  1LSW A;  1L0D A;  1CEF A;  1XXM A;  2V2F F;  2VGJ A;  4WEK A;  3TSG A;  5FAP A;  4DJ3 A;  2G2W A;  4R3B A;  1MXO A;  2NUP C;  5GLA A;  3LID A;  4YNR A;  5JYO A;  3F1O B;  2HDU A;  4YIN A;  3ZFZ A;  2DRW A;  1MY8 A;  4WMC D;  4ARZ B;  5DKK A;  5KSC A;  4E6W A;  3T4K A;  2B02 A;  4LFU A;  3TRC A;  4H6J B;  4RVA A;  1K54 C;  1GHP A;  1BLP A;  3FPV A;  4LV1 A;  1I2S A;  1YLY A;  4P6Z M;  4OKP A;  2ZMF A;  4JXS A;  1D06 A;  1KVM A;  4I3J A;  2J3T C;  2EXA A;  2Y2P A;  3H9W A;  3BEC A;  4HY8 A;  4E04 A;  1RP5 A;  1TS7 A;  3BWL A;  3V39 A;  3MJQ A;  2K2N A;  5FA7 A;  2W0N A;  4Y15 A;  3SS5 A;  3IX4 A;  4P6Z S;  4S2N A;  1ZKJ A;  1XJ6 A;  5HWW A;  4FCF A;  4EET B;  3UE3 A;  3DW0 A;  3L7H A;  4U0T A;  1BUE A;  2ZC7 A;  3O3V A;  4RA7 A;  3BW6 A;  1S67 L;  3EGD C;  1NRJ A;  2WAE A;  4MDZ A;  1AWI A;  3TW8 A;  1W7F A;  5FI2 A;  4X56 A;  1XA1 A;  2XSS A;  3S7P A;  4QD4 A;  3OZH A;  1DRM A;  2FH5 A;  4KZB A;  4PHT A;  4RX2 A;  3CHW P;  1SZV A;  5F6A A;  3DWK A;  4C6Y A;  5HDD A;  4MCW A;  1ERQ A;  4EWF A;  1KE0 A;  5L8M A;  3QP4 A;  3N4I A;  2ZLY A;  4QWO A;  2ZQA A;  2HV1 A;  1YT4 A;  1FCO A;  3HUN A;  3KSI A;  4KZ9 A;  4OPZ A;  4EBP A;  3NUL A;  1QMF A;  4GN2 A;  4BBU A;  5CRF A;  4BEN A;  4OQI A;  5EE8 A;  4ETZ A;  1CJF A;  4S2J A;  5FAO A;  4S2N C;  2HPB A;  5F1F A;  3VSL A;  5L2F A;  4H8R A;  2W27 A;  1FIK A;  1F9I A;  1XKZ A;  2Y2M A;  5AQ7 A;  1BLS A;  5CGS A;  5E2E A;  1N4O A;  2VV7 A;  3Q81 A;  4QPR A;  2GDN A;  3FYZ A;  1EI5 A;  2A24 A;  3PBQ A;  4GHI A;  3KYQ A;  4HP4 A;  3LIE A;  5DTS A;  4JLF A;  5E43 A;  4ZJ3 A;  3C4P A;  4MN5 A;  3HLE A;  4ETX A;  2AVX A;  4S2O A;  5FQQ A;  2XRN A;  3HLG A;  2ZOI A;  3GMW A;  3WRZ A;  3ZGA B;  1H8Y A;  2HDS A;  4XXR A;  2PT7 A;  3GVB A;  4PM6 A;  3UDX A;  1V9Z A;  2ZL1 A;  3C7V A;  1E3U A;  3CUE A;  3PAE A;  3T4J A;  5FQI A;  5DFX A;  1G68 A;  1Z09 A;  1QME A;  4DJ2 A;  1LLB A;  1NLY A;  2OSU A;  1YAX A;  1ACF A;  4JF5 A;  2L4R A;  4UQI M;  3WS5 A;  1S4R A;  4DDS A;  4KZ3 A;  5HFO A;  4OQ0 A;  4I5S A;  1J9M A;  3HLW A;  1T1B A;  2JCH A;  4EEP A;  2E8I A;  3A0R A;  2JKR I;  4EEU A;  1BLC A;  3ZG5 A;  2IA2 A;  2Y79 A;  2BAS A;  1YKD A;  2JHE A;  1KDS A;  3T1X A;  4IED A;  4WUJ A;  3KSG A;  4GZB A;  5HDC A;  3KX0 X;  4MMN A;  4UQI S;  3JYI A;  4YFM A;  1T1C A;  1S1Z A;  3CPT A;  1JVJ A;  3CLO A;  3EEA A;  5IU1 A;  4EQI A;  2XH9 A;  2Y4A A;  1XGI A;  3DBA A;  2D01 A;  4GW9 A;  4HJ4 A;  4Y7P A;  5KSH A;  3CUE C;  1ERM A;  1X0O A;  3LI8 A;  1SKF A;  3QHY A;  4EES A;  3M6B A;  3PBT A;  4QY6 A;  3ZVT A;  5D3O A;  1PWC A;  3RTY A;  5L07 A;  4HHD A;  2BG1 A;  3T4Q A;  2A24 B;  4X53 A;  3FWL A;  5TBM A;  1PIO A;  4GHI B;  3QP6 A;  1FSW A;  4X25 A;  2Y91 A;  3GR2 A;  4CLC A;  3UE1 A;  3HL9 A;  3PTE A;  3UPO A;  1FCM A;  2ACG A;  4HOI A;  3MXS A;  2I72 A;  2WGI A;  2ZBB A;  4CQH A;  5A93 A;  4DXB A;  2XDM A;  1K56 A;  1XFN A;  2ZL1 B;  2X02 A;  3LGO A;  3ZNT A;  4XT2 A;  4DMZ A;  5HWT A;  1IYP A;  4OP5 A;  5FSR A;  3G2Y A;  3BFC A;  5HAR A;  3E0Y A;  4OPY A;  3VSK A;  4HH3 A;  1CI9 A;  1DP6 A;  2O9B A;  1F2K A;  3KYE A;  1G6A A;  4WLA A;  3IH8 A;  2MJ6 A;  2UWX A;  5E2H A;  2VGK A;  3ZG9 B;  4QHC A;  2OWJ A;  1GHM A;  4CPK A;  3QP5 A;  4X55 A;  5FL3 A;  5CXW A;  3B47 A;  4X1L A;  3S22 A;  4IBR A;  3HJK A;  4LEN A;  2XEP A;  4KUK A;  1ZTU A;  4GD6 A;  4R4S A;  3IQA A;  1NY0 A;  4Y17 A;  1G5U A;  1GSX A;  1XJ3 A;  3C38 A;  3PBO A;  4OOL A;  2EWW A;  3NOT C;  3VV4 A;  3VFH A;  1GSW A;  3HBR A;  4EXO A;  3GV9 A;  3MF0 A;  5A8B A;  4Q0H A;  2YKH A;  3GSG A;  1HVB A;  4ZTK A;  5HAI A;  4U0X A;  4OON A;  4CLC E;  3F1P A;  3ZNY A;  3FKV A;  3EEH A;  3IXH A;  2JKG A;  1IEM A;  4WBG A;  1VHM A;  5TBM B;  2C6W B;  5FQM A;  4ZJ1 A;  4P85 A;  4HES A;  1YSP A;  3KYZ A;  1P0Z A;  2HJ9 C;  2ZQD A;  5FAT A;  2W3F A;  5EVI D;  1YSQ A;  3LI9 A;  5FI7 A;  3P98 A;  1KDW A;  2QPN A;  4Y0O A;  1A0K A;  5TFQ A;  3SS4 A;  5GHZ A;  2GX5 A;  1H8Z A;  2FZ0 A;  2WKR A;  3W4Q A;  5AQ9 A;  1IYS A;  3MSH A;  3HJI A;  4JF4 A;  3HLF A;  1RGY A;  1E4D A;  2EX8 A;  2EXB A;  3LIA A;  1VET A;  1LT0 A;  4PKY A;  2V9A A;  3BQA A;  1ONG A;  3VP3 A;  1MKM A;  3S7Q A;  2ZM0 A;  1IFQ A;  4K08 A;  3M6H A;  1K4F A;  4IJG A;  2Y2O A;  4YWZ A;  3V67 A;  3N8L A;  2HP6 A;  3BLS A;  4MEZ A;  5F82 A;  2OAP 1;  3PXP A;  4JGR A;  4JGO A;  3UB8 A;  1JTD A;  4JXW A;  4BLM A;  1NWZ A;  3O5Y A;  4O8G A;  3IF6 A;  4X69 A;  2PRF A;  3NDG A;  1TS8 A;  2QJ5 A;  3CI6 A;  3ISG A;  5CX7 A;  1OME A;  5DVA A;  5K5B A;  3GEC A;  5HD3 A;  1SKO B;  2RL3 A;  4YOF A;  4O0P A;  4R1G A;  1IEL A;  3IS2 A;  4Y5F A;  1KGF A;  3F1P B;  1YPR A;  5FDH A;  1MWS A;  3ZYT A;  3B3X A;  1IYQ A;  2PDR A;  3BQ8 A;  1OTI A;  4EER A;  3N8S A;  1MPL A;  4OH0 A;  3VOL A;  1PZP A;  1IYO A;  2M7U A;  3DAV A;  3IF6 C;  5HDS A;  3BFG A;  1KVL A;  3M2J A;  3N7W A;  5L10 A;  5LBR A;  1VET B;  1ES2 A;  4B4X A;  4LV3 A;  3LEQ A;  1BTL A;  1KE3 A;  2R9W A;  4O01 A;  3O86 A;  5GLD A;  4ZJ2 A;  5L09 A;  4X1M A;  3UB7 A;  2EFU A;  1SHV A;  1S4S A;  1ES3 A;  1YLP A;  3BFF A;  2Y55 A;  2JKT I;  2L1M A;  5G4Z A;  4MBH A;  2Y2L A;  4L0L A;  5CTM A;  1LSX A;  2HDR A;  4IUH A;  4Z1W A;  2V1A A;  2EA9 A;  3T1R A;  4WEL A;  1WYC A;  3UB6 A;  5KZH A;  3C30 A;  5HPI A;  2QJ7 A;  3IHA A;  2EX6 A;  2W1R A;  1KE4 A;  3D4F A;  3IF6 B;  2M7V A;  2XLN A;  1N9L A;  1VB6 A;  4QU3 A;  3A3D A;  4QY5 A;  2PU2 A;  1HD8 A;  3VMA A;  1NYM A;  1PRQ A;  5CHU A;  2WKH A;  3U4L P;  3MXR A;  1FIL A;  1OT6 A;  2ZQ7 A;  2H0Y A;  4BMW A;  2ZQ9 A;  1XFQ A;  2C5W B;  3H82 A;  4DKI A;  3BEB A;  5CHJ A;  4NXE A;  3LR4 A;  5EOE A;  5I94 A;  1F5M A;  3GRJ A;  5EFW A;  2KLI A;  3BFD A;  2PYP A;  4D2O A;  1JWZ A;  2JBF A;  1XPB A;  2P7J A;  3G4P A;  4L9E A;  3IS2 B;  3D72 A;  3NC8 A;  4OQH A;  4HBT A;  1P9R A;  4JXV A;  3E2K A;  1O07 A;  3EQV A;  2V0W A;  4JBF A;  2CC1 A;  1BLH A;  4L9F A;  1ESI A;  3MXQ A;  3NOP C;  2HP9 A;  3T4S A;  4S2I A;  2J9O A;  1S66 L;  5EPH A;  2WGV A;  3NJA A;  1ESU A;  5HAQ A;  5DJT A;  1ODV A;  1MWR A;  4S2M A;  2Y2I A;  4HJ6 A;  5HSQ A;  1CK3 A;  3MKE A;  4C75 A;  3RFB A;  2JKF A;  4F3L A;  1JNU A;  2K7S A;  1EWZ A;  2XQZ A;  4UHU A;  4DRT A;  2QYB A;  3NHQ A;  4M4X A;  4MBF A;  4WMC A;  3TE8 A;  3ZG8 B;  3P01 A;  1NZU A;  3S7N A;  1F98 A;  2A2L A;  2EX2 A;  3LFV A;  2WAF A;  4ZRR A;  2P04 A;  3IBR A;  4DDY A;  1W5D A;  3T50 A;  1CQA A;  1U60 A;  3ICY A;  4RX3 A;  3QP2 A;  3Q7V A;  1N9O A;  2ZMA A;  1K38 A;  2W3G A;  4IHQ A;  2IWB A;  3QNB A;  4NEE D;  1BSG A;  1W79 A;  3A3F A;  3C7U A;  3BM6 A;  3NCK A;  1L0F A;  3IWO A;  2V1B A;  2VZW A;  3PBR A;  3FKW A;  3H82 B;  4Q0I A;  2PAV P;  4Y13 A;  3HUO A;  1BT5 A;  4F94 A;  5C5K A;  2NUT C;  3IH9 A;  2EWV A;  2Z2M B;  3M2K A;  4UA7 A;  3LR0 A;  3B33 A;  1Q2Q A;  4KZ4 A;  3T1Q B;  2VV8 A;  2QKP A;  2XRO A;  1PW8 A;  2BTF P;  4PM5 A;  3MFD A;  3MR0 A;  1UWN X;  3TG9 A;  5AQA A;  5TGF A;  4JGP A;  1L0G A;  3R7W A;  3GDI A;  3NY4 A;  3ZHH A;  1Z6F A;  2XR0 A;  3K2N A;  4HIA A;  4BBT A;  5A91 A;  4KQO A;  1XA7 A;  5FAQ A;  4LPZ A;  5A92 A;  1ZHH B; 
#chains in the Genus database with same CATH homology
 4DE0 A;  4BD0 A;  4NET A;  4QJG A;  4OOL A;  2DNS A;  3PBN A;  4KQR A;  5FQK A;  2Y2Q A;  3G30 A;  5EVI B;  2DCF A;  4FD8 A;  3VOY A;  3NBL A;  3VFH A;  3HBR A;  2EFX A;  1GA0 A;  3GV9 A;  3S4X A;  3SH7 A;  2JC7 A;  4EBL A;  3TOI A;  1ES5 A;  4BL2 A;  1K25 A;  1RGZ A;  3GSG A;  1HVB A;  1AXB A;  3MBZ A;  4GDN A;  4ZTK A;  5HAI A;  4U0X A;  4IVI A;  3WS0 A;  1K6S A;  4OON A;  4Q8I A;  4KQQ A;  3ZNY A;  3FKV A;  3HVF A;  4P6B A;  1VM1 A;  2XFS A;  2H10 A;  3OCN A;  3IXH A;  1IEM A;  2ZQ8 A;  4WBG A;  5CTN A;  5FQ9 A;  1E25 A;  4P87 A;  1GA9 A;  3MZF A;  2C6W B;  1L0D A;  1CEF A;  1XXM A;  2V2F F;  2WAD A;  4P85 A;  5FQM A;  4ZJ1 A;  4HES A;  2VGJ A;  4WEK A;  3IXB A;  2ZQD A;  3ZG7 B;  2XF3 A;  5FAT A;  1SDN A;  5FAP A;  3TSG A;  2G2W A;  5EVI D;  5GLB A;  3V5M A;  5HW3 A;  4GKU A;  4RYE A;  5FI7 A;  3P98 A;  4R3B A;  1MXO A;  1WYB A;  3BLM A;  1KDW A;  2QPN A;  1MKI A;  5GLA A;  4OOM A;  4Y0O A;  1M40 A;  3GQZ A;  5TFQ A;  1LI0 A;  4XUZ A;  3SS4 A;  5JYO A;  4YIN A;  2HDU A;  3Q7V B;  3ZFZ A;  2DRW A;  1MY8 A;  4WMC D;  5GHZ A;  1MWT A;  3IT9 A;  1H8Z A;  2WYX A;  3W4Q A;  4PPR A;  5AQ9 A;  5KSC A;  1XGJ A;  1L2S A;  1IYS A;  4E6W A;  1CEG A;  3N6I A;  1K57 A;  4JF4 A;  3HLF A;  2WGW B;  4RVA A;  1RGY A;  1E4D A;  2EX8 A;  2EXB A;  2P9V A;  1K54 C;  4GB7 A;  5GLC A;  1GHP A;  1BLP A;  3FZC A;  2ZQC A;  1KGG A;  3G31 A;  4LV1 A;  1I2S A;  1ONG A;  3ITA A;  4QB8 A;  2HDQ A;  3UDI A;  1RCJ A;  3VP3 A;  1YLY A;  3CJM A;  3VP2 A;  2ZM0 A;  3O87 A;  1O7E A;  4OKP A;  5EEC A;  3OPP A;  3CG5 A;  4JXS A;  4Y0T A;  1Q2P A;  1K56 D;  3G32 A;  2ZC4 B;  1KVM A;  3M6H A;  1K4F A;  2Y2O A;  2EXA A;  2Y2P A;  3FV7 A;  2J8Y A;  3BEC A;  4O7D A;  4PM8 A;  1FCN A;  3N8L A;  2HP6 A;  5M1A A;  5U47 A;  5HX9 A;  4EUZ A;  3BLS A;  4N1X A;  4E3O A;  4MEZ A;  3A3I A;  1RP5 A;  3V39 A;  3AGF A;  5CEB A;  1MWU A;  1YLT A;  5F82 A;  2X01 A;  2Y59 A;  3W8K A;  4R0Q A;  1TDG A;  4NK3 A;  3EQU A;  3G35 A;  1XX2 A;  5FA7 A;  3SS5 A;  2A49 A;  1JTD A;  4JXW A;  4S2N A;  1ZKJ A;  4BLM A;  4WZ5 C;  4FCF A;  4R23 A;  4JF6 A;  3UE3 A;  3DW0 A;  3P09 A;  4PM7 A;  4R4R A;  1GCE A;  5HAP A;  2OLU A;  2PU4 A;  3IF6 A;  3IXD A;  4U0T A;  1BUE A;  2ZC7 A;  4X69 A;  3OPR A;  3NDG A;  3O3V A;  4RA7 A;  2WAE A;  4E3L A;  1ONH A;  3UE0 A;  4E3N A;  4MLL A;  3ISG A;  5J8X A;  1W7F A;  1OME A;  4JXG A;  2J9P A;  3E2L A;  1ALQ A;  5DVA A;  2WKI A;  5FI2 A;  2FFY A;  4X56 A;  3Q82 A;  1XA1 A;  4A5R A;  1ZC2 A;  5HL1 A;  1K57 C;  4WEJ A;  2Y2N A;  2RL3 A;  4IVK A;  4Z9Q A;  4QD4 A;  2R9X A;  3OZH A;  2OLV A;  3WS1 A;  4BQM A;  5BOH A;  3PBS A;  1M6K A;  4LCM A;  1NXY A;  4R1G A;  4KZB A;  4KZ8 A;  1IEL A;  3HRE A;  4RX2 A;  5CHM A;  1PWG A;  1PWD A;  2ZM2 A;  1FQG A;  3G2Z A;  4M3K A;  1PW1 A;  2XK1 A;  3DWK A;  1KGF A;  3I7J A;  4C6Y A;  5FDH A;  3SOI A;  1ERQ A;  5FAS A;  1MWS A;  5EUA A;  4EWF A;  1KE0 A;  3UPN A;  3ZG0 A;  3N4I A;  3VP4 A;  4LV2 A;  2ZLY A;  3B3X A;  2ZQA A;  1YT4 A;  1FCO A;  3HUN A;  4KZ6 A;  1IYQ A;  4OPQ A;  4OLD A;  4KZ9 A;  1LL5 A;  4KZA A;  4N9L A;  4OPZ A;  4EBP A;  1PI5 A;  4PM9 A;  4X68 A;  3DWZ A;  2X71 A;  4GD8 A;  4ZAM A;  2P74 A;  1QMF A;  4WZ5 A;  2HP5 A;  4GN2 A;  3LY4 A;  3NIA A;  1DJA A;  5CRF A;  3N8S A;  2XGN A;  4KZ5 A;  1JTG A;  4BEN A;  1MPL A;  2ZJ9 A;  3G34 A;  4OQI A;  3Q1F A;  1S6R A;  5EE8 A;  4OH0 A;  3OC2 A;  3IHB A;  4S2J A;  5FAO A;  4S2N C;  1PZP A;  2HPB A;  1IYO A;  5F1F A;  2XD5 A;  1FOF A;  2IWD A;  3VSL A;  1YLZ A;  3IF6 C;  2PBY A;  1CI8 A;  5L2F A;  3BFG A;  4H8R A;  2WZX A;  4C3Q A;  4DXC A;  1KVL A;  3M2J A;  3N7W A;  3VP0 A;  2P9V B;  3ZCZ A;  1ES2 A;  1XKZ A;  1YMS A;  2Y2M A;  5AQ7 A;  3V50 A;  4B4X A;  3V3S A;  3HLD A;  4LV3 A;  1BLS A;  5CGS A;  1LI9 A;  5DF7 A;  1BTL A;  5E2E A;  1KE3 A;  2R9W A;  3IXG A;  3O86 A;  1N4O A;  1N9B A;  5GLD A;  3Q81 A;  4ZJ2 A;  3VP1 A;  2GDN A;  3FYZ A;  1SCW A;  2EFU A;  2JE5 A;  1K4E A;  1SHV A;  1ES3 A;  1EI5 A;  3LO7 A;  2V1Z A;  3AGD A;  4GOG A;  4FH4 A;  3C5A A;  1YLP A;  3BFF A;  3PBQ A;  5DTS A;  1W8Y A;  1I2W A;  2Y55 A;  4JLF A;  5E43 A;  3VOZ A;  4ZJ3 A;  5CER A;  3C4O A;  4MBH A;  3C4P A;  1WE4 A;  2WZZ A;  3HLE A;  2Y2L A;  4L0L A;  4S2O A;  1K55 A;  5CTM A;  5FQQ A;  4IBX A;  3HLG A;  3GMW A;  1TDL A;  3WRZ A;  2HDR A;  2Q9M A;  1H8Y A;  1LHY A;  4HBU A;  3ZGA B;  2HDS A;  4WEL A;  1WYC A;  2XFT A;  4XXR A;  5KZH A;  3GTC A;  3GVB A;  4PM6 A;  4FH2 A;  3IHA A;  3UDX A;  2EX6 A;  3D4F A;  1KE4 A;  3IF6 B;  3C7V A;  2XLN A;  1E3U A;  3PAE A;  4QU3 A;  3A3D A;  5FQI A;  4QY5 A;  2PU2 A;  4K91 A;  5M18 A;  1HD8 A;  3VMA A;  1NYM A;  1G68 A;  5CHU A;  4ZDX A;  3QNC A;  5CED A;  2QZ6 A;  2WKH A;  3MXR A;  1QME A;  2ZQ7 A;  2OV5 A;  2H0Y A;  1ZG6 A;  1LLB A;  2OSU A;  5EOO A;  4JF5 A;  2ZQ9 A;  3LY3 A;  2C5W B;  3RXX A;  4U3T A;  1PI4 A;  3WS5 A;  4DKI A;  1PYY A;  3BEB A;  2A3U A;  5CHJ A;  2ZD8 A;  4DDS A;  4KZ3 A;  5HFO A;  4OQ0 A;  3UO9 A;  4OOY A;  1DJC A;  5I94 A;  1J9M A;  3HLW A;  3GRJ A;  5EOE A;  4DE3 A;  2JCH A;  4WZ4 A;  3BFD A;  1FR1 A;  2E8I A;  3OPH A;  4D2O A;  1BLC A;  3ZG5 A;  1JWZ A;  3PAG A;  2JBF A;  5DTT A;  1XPB A;  1W8Q A;  4KZ7 A;  3G4P A;  2H0T A;  3WS4 A;  1YMX A;  1MBL A;  1KDS A;  3NC8 A;  2WUQ A;  3OCL A;  4HBT A;  4OQH A;  5CEC A;  4JXV A;  1KGE A;  4IED A;  5DTK A;  4JPM A;  3E2K A;  1O07 A;  3SH9 A;  3EQV A;  3VFF A;  1FR6 A;  4BL3 A;  4JBF A;  4K0X A;  3UN7 A;  4GZB A;  4R3J A;  2CC1 A;  1BLH A;  1ESI A;  2HP9 A;  4S2I A;  2J9O A;  4N1H A;  3JYI A;  4YFM A;  2B5R A;  5EPH A;  2WGV A;  1ESU A;  1JVJ A;  5HAQ A;  1JWV A;  4E3M A;  2WKE A;  2XD1 A;  2Y2G A;  4B88 A;  1K55 C;  2V20 A;  3WS2 A;  3BYD A;  4EQI A;  3WWX A;  1L0E A;  2XH9 A;  2Y4A A;  4ZBE A;  1XGI A;  1XP4 A;  3UY6 A;  4OP8 A;  4LV0 A;  1MWR A;  2FFF B;  4S2M A;  1ES4 A;  4DE1 A;  2Y2I A;  1IKG A;  1CK3 A;  1NYY A;  3UDF A;  1HZO A;  1VQQ A;  1HTZ A;  3IF5 A;  3MKE A;  4C75 A;  5TR7 A;  4Y7P A;  4MNR A;  3NI9 A;  2WK0 A;  3HLB A;  5KSH A;  1ERM A;  5DF9 A;  4EV4 A;  2IWC A;  5EVI A;  4E6X A;  1GHI A;  4OLG A;  1SKF A;  1IKI A;  3QHY A;  3W4P A;  3M6B A;  3PBT A;  4QY6 A;  3BFE A;  1EWZ A;  2XQZ A;  4UHU A;  4DRT A;  3Q07 A;  3WRT A;  5M19 A;  3ZVT A;  4FSF A;  5E2F A;  5D3O A;  4GNU A;  1PWC A;  1DJB A;  4MBF A;  4UAA A;  4UA6 A;  4E3J A;  4WMC A;  5F83 A;  3V3R A;  3ZG8 B;  5FI6 A;  4CJN A;  2BG1 A;  2RCX A;  1S0W A;  1NZU A;  3ITB A;  1LL9 A;  2EX9 A;  1YLJ A;  1H5X A;  3OPL A;  4S2L A;  3FWL A;  4X53 A;  4XUX A;  5GL9 A;  4DE2 A;  1FSY A;  1PIO A;  2H5S A;  2EX2 A;  3AGE A;  1FSW A;  2WAF A;  2Y91 A;  3GR2 A;  4JKT A;  1SDE A;  3UE1 A;  2Y2H A;  1JWP A;  3HL9 A;  4BD1 A;  3PTE A;  1YM1 A;  3N8R A;  3NDE A;  4GDB A;  4ID4 A;  4DDY A;  3UPO A;  4S2P A;  1FCM A;  3O88 A;  4N92 A;  1W5D A;  1I5Q A;  2ZC5 B;  1C3B A;  4KEN B;  4KG6 A;  1U60 A;  2ZC6 B;  4RX3 A;  3MXS A;  2I72 A;  3Q7V A;  2WGI A;  4KG5 A;  3ZDJ A;  3DTM A;  4EBN A;  4DXB A;  5A93 A;  2QMI A;  2XDM A;  1K56 A;  2ZMA A;  1K38 A;  3MKF A;  3BRM A;  2IWB A;  3QNB A;  3W4O A;  2X02 A;  1NZO A;  1BSG A;  3ZNT A;  1DY6 A;  1W79 A;  2WGW A;  2Z2L B;  3A3F A;  3C7U A;  3BM6 A;  3IWI A;  4Y0U A;  3CMZ A;  3Q7Z A;  1IYP A;  3NCK A;  4OPR A;  4OP5 A;  3SH8 A;  5FSR A;  1L0F A;  1ERO A;  3IWO A;  5G18 A;  3G2Y A;  3BFC A;  3PBR A;  4UA9 A;  5HAR A;  3ZVW A;  3FKW A;  4MBK A;  4OPY A;  5A90 A;  3LEZ A;  3VSK A;  4N9K A;  4P0M A;  5GHX A;  2Q9N A;  1CI9 A;  1NRF A;  3HUM A;  1NJ4 A;  3UPP A;  3HUO A;  3MZE A;  4HEF A;  4X6T A;  5EVI C;  1BT5 A;  4LCL A;  1G6A A;  4F94 A;  3IH8 A;  2UWX A;  3RJU A;  4E3I A;  5E2H A;  1TVF A;  1Y54 A;  3IH9 A;  2Z2M B;  2VGK A;  3M2K A;  1E3U D;  3ZG9 B;  3S1Y A;  4QHC A;  4UA7 A;  3CZD A;  1GHM A;  3LCE A;  5F1G A;  4DF6 A;  5JYP A;  1ZG4 A;  1Q2Q A;  1TEM A;  4KZ4 A;  3HLC A;  5IHV A;  4CPK A;  4X55 A;  1K6R A;  2BLS A;  3RXW A;  5CXW A;  4WYY A;  1PW8 A;  4PMA A;  3UNW A;  1PZO A;  4WM9 A;  5DF8 A;  5CGX A;  3S22 A;  2Y2J A;  5E2G A;  4PM5 A;  3MFD A;  4IBR A;  1BUL A;  5GHY A;  4LEN A;  1YLW A;  3TG9 A;  4KG2 A;  2J7V A;  1BZA A;  5AQA A;  5TGF A;  2XEP A;  4K0W A;  1L0G A;  4OVD A;  3NY4 A;  5CGW A;  5EVL A;  3ZHH A;  3SS3 A;  5FQJ A;  4B4Z A;  2G2U A;  4GD6 A;  4E3K A;  1Z6F A;  3A3J A;  3MZD A;  4R4S A;  1K54 A;  3IQA A;  4OQG A;  2XR0 A;  2ZM8 A;  4S2K A;  1NY0 A;  5AQB A;  1YQS A;  5A91 A;  2ZC3 B;  3A3E A;  3PBO A;  4KQO A;  1XA7 A;  2Y2K A;  4BJP A;  5FAQ A;  5KMW A;  3IWQ A;  5A92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...