5FQIA

W229d and f290w mutant of the last common ancestor of gram-negative bacteria (gnca4) beta-lactamase class a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
b'ALSEQLAELEKRSGGRLGVAVLDTATGRRFGYRGDERFPMCSTFKALLAAAVLARVDQGKENLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITYSDNTAANLLLEALGGPAALTAFLRSIGDNVTRLDRWEPELNTAAPGDPRDTTTPAAMAATLRTLLLGDVLSPASRQQLVDWLIANKTGDKRLRAGLPADDRVGDKTGTGEHGTTNDIAVIWPPNRAPILVAVYLTESQVDADARDAVIAEVARLVVAAWHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNCA4 LACTAMASE W229D AND F290W
molecule tags Hydrolase
source organism Synthetic construct
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
total genus 100
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqiA00
3N4IA 4X69A 1MPLA 5E2EA 3WRZA 4IVIA 3LY3A 4RYEA 2WGWA 1W7FA 1YQSA 3N8RA 3O88A 5CHMA 1XGIA 3BFDA 1GCEA 4RX3A 2C5WB 3VSKA 3G31A 3Q7VA 4N9KA 3Q81A 4PM8A 2V1ZA 3N8SA 3TG9A 3PBQA 4UHUA 1O07A 5D3OA 4Z9QA 3SS5A 2X71A 4GZBA 1SDEA 4BJPA 2WAEA 4S2IA 2ZQ8A 4C3QA 1HTZA 1L0FA 1N4OA 1YLYA 3MKFA 1CI9A 2ZM0A 1W8YA 2ZC4B 3Q7VB 2XDMA 1MXOA 4E6WA 2Q9MA 2X02A 3ZVTA 3BFGA 2EX2A 3SH9A 2G2WA 2JCHA 4ZBEA 4E3NA 5EVIC 4L0LA 2H0TA 4GB7A 1XXMA 3S22A 2ZC7A 2Y2NA 3IWOA 4CJNA 4R4SA 3V39A 4OOYA 1XA1A 4DF6A 1LL5A 2XR0A 1DY6A 2J8YA 1PYYA 2QMIA 3IH8A 1YLJA 5FI6A 3C7VA 1FR6A 4KZ7A 4BL3A 3ZG9B 3OPRA 1TDGA 1CI8A 3FWLA 3HBRA 4LCLA 5EVLA 1Y54A 5DTTA 2IWDA 1YMXA 1ES5A 1M6KA 2Y4AA 1E3UA 2DNSA 1EI5A 2HDRA 3FZCA 5FQQA 5M19A 3V3RA 2UWXA 2OSUA 3I7JA 2WZXA 3IXHA 1XA7A 1LHYA 3M2JA 2Z2LB 2WGVA 3UPNA 1K56A 1PI5A 3BLSA 4GN2A 3GMWA 3S1YA 3WWXA 3BECA 4IEDA 3IH9A 5HAPA 2PBYA 3M6BA 2RL3A 3UNWA 1NYMA 5EVID 3NDEA 3O87A 1NJ4A 1Q2PA 2Y2KA 3OPPA 1K38A 2XFSA 3HLBA 3OZHA 5CRFA 4DE0A 1L0EA 5DTKA 4C6YA 4S2NC 3WS0A 1BULA 1PWCA 5JYPA 4WMCD 3MZFA 4GOGA 3IF6C 1YT4A 2EX8A 4LV0A 1L0DA 1IKIA 5GHZA 3SS3A 5FATA 4LENA 2VGJA 3Q7ZA 1K54A 1HD8A 3W8KA 3UDXA 4WZ5A 4EUZA 3OPHA 4WZ5C 2ZD8A 1MWTA 3SH7A 1CEGA 2Y91A 5KMWA 2ZJ9A 2JBFA 1SKFA 4X68A 4GDNA 3TOIA 4QHCA 3HVFA 4WM9A 5FDHA 4X56A 3UE0A 5EVIA 4LCMA 3JYIA 4DE2A 3D4FA 5EECA 1SHVA 2Y2HA 2A3UA 3ZG5A 4ZAMA 3ZGAB 4JXSA 5M1AA 2WADA 4B88A 1RGYA 3ZG8B 1LL9A 3AGDA 1PWDA 2WZZA 3VSLA 3GSGA 2Y55A 4B4ZA 2G2UA 3G4PA 1KGGA 1NYYA 1BT5A 3FKVA 1GHIA 1NXYA 4OQIA 4JF6A 4RVAA 3HUMA 3A3EA 2XH9A 3IF5A 4NETA 5AQBA 3ZNYA 5AQAA 4FH4A 2IWBA 4FH2A 4JPMA 3EQUA 3MKEA 2H10A 3BFFA 2WUQA 1WYBA 3UDFA 3BFCA 2IWCA 5E43A 1KE3A 1FSWA 4JKTA 4PM5A 4LV3A 4WELA 1HZOA 1JWZA 3ITAA 2FFFB 3IWQA 3OC2A 4ZDXA 1K56D 3QNBA 2P74A 3UO9A 1K6RA 5GLDA 1I2WA 3SH8A 4IBRA 1NZUA 2R9XA 3RXXA 4BD1A 5CTMA 1FR1A 3MZDA 3S4XA 4BLMA 4DXCA 3C4OA 2J9PA 3G35A 5E2GA 4KQQA 5FAOA 1DJBA 3BRMA 4DXBA 3LY4A 3M2KA 4HEFA 1XP4A 1VM1A 1XGJA 5IHVA 1XPBA 4Y0TA 4PM6A 5KSCA 1BSGA 1H8YA 2Y2LA 3Q82A 4S2LA 1PZOA 1IYOA 4FCFA 2RCXA 4R1GA 3DW0A 1VQQA 1PW8A 5HFOA 4ZJ2A 3N7WA 1ZC2A 2ZC5B 1MWRA 3OCNA 2Y2IA 1ZKJA 2DRWA 4GDBA 4H8RA 5FAPA 1JWVA 3ZFZA 4RX2A 2XK1A 3E2LA 5FQ9A 5HW3A 1K57A 3ZNTA 1H8ZA 2EFXA 3GR2A 2HP5A 1KDSA 3PBNA 3CMZA 1PWGA 3HLEA 1KVMA 1W5DA 2PU4A 2ZQ9A 4KZ8A 4OQ0A 4QD4A 5CGXA 3PBTA 1CEFA 3N6IA 3ZCZA 3IWIA 1BUEA 2WAFA 3G30A 5DF8A 3IQAA 2E8IA 3ZVWA 5DVAA 4DE3A 4F94A 4YFMA 1FCNA 5CEBA 2Y2OA 4OOMA 5HL1A 1G68A 4MBFA 4BENA 2H0YA 2Z2MB 1OMEA 5FI2A 4X6TA 5FSRA 1FSYA 3PTEA 3NBLA 4OOLA 4QY5A 5GHXA 2EX9A 3NC8A 4GD8A 1O7EA 4WBGA 3W4PA 4RA7A 1JWPA 5FASA 1XX2A 1JTGA 3WS4A 3VP0A 1W79A 5I94A 4OP8A 2ZQAA 4BD0A 2EXBA 3VFHA 3VOYA 1BZAA 1BLHA 4EBPA 2ZM8A 3DWZA 4KG2A 1KE4A 3GQZA 4OLGA 4FSFA 4O7DA 3G34A 5FQMA 1G6AA 5F1FA 4OH0A 4Y7PA 5EUAA 2Y2GA 1TEMA 1NZOA 2HDUA 3HREA 5TFQA 3VP4A 1FQGA 4KZ4A 4PM7A 4MLLA 3G2ZA 2JC7A 4R3BA 4M3KA 4NK3A 2ZMAA 2VGKA 1E3UD 4OKPA 3HLDA 4P0MA 4UA7A 3BLMA 4JXWA 1RP5A 1MWSA 2BG1A 3CG5A 5EOEA 5TGFA 4QJGA 2I72A 3PBRA 3IXGA 4S2PA 2Y2MA 4KZ3A 1I2SA 3QNCA 1QMFA 4JXGA 1K55C 4PPRA 3ZDJA 1TDLA 1K4EA 1S0WA 3A3JA 4GKUA 3OCLA 3V5MA 1PW1A 1YLPA 4K91A 5A93A 2WKIA 5CECA 2XD1A 3W4QA 4FD8A 3UE3A 4OVDA 4E3MA 4EV4A 4DDSA 3C5AA 3UN7A 3BFEA 1KVLA 3ISGA 4EQIA 1XKZA 3E2KA 2FFYA 3VOZA 2HP6A 3HLCA 1M40A 3PBSA 5EPHA 4ZJ1A 3ZG0A 1LI0A 3B3XA 4GD6A 2WGWB 4JLFA 4UAAA 5GLCA 1YMSA 3VFFA 2QZ6A 1PI4A 4E3OA 4E3IA 3C7UA 3GTCA 3UDIA 3NIAA 1FCOA 3P09A 1J9MA 2BLSA 3NI9A 3IHAA 3QHYA 5A91A 3HLGA 1K57C 5JYOA 1ALQA 4C75A 2ZC6B 3FV7A 4JF4A 2XFTA 4GNUA 1YLWA 4MBKA 3IT9A 3IHBA 4QB8A 3V50A 4LV1A 1JTDA 3BYDA 4MEZA 3VP2A 1IKGA 1QMEA 1YM1A 3AGFA 4KQOA 1ERQA 1PZPA 2EXAA 2QPNA 5GLBA 2X01A 1GA9A 3HLWA 4Y0UA 1IYQA 4JXVA 5FQIA 4DDYA 3MXSA 1BLSA 1MY8A 4UA9A 3VMAA 4EWFA 2R9WA 3BEBA 5EOOA 1KDWA 4R3JA 2J7VA 1HVBA 2WYXA 1NRFA 1W8QA 4OQGA 3Q1FA 4HBUA 3O3VA 5AQ9A 2B5RA 3G2YA 4JF5A 2EX6A 2EFUA 2XQZA 1KGEA 1GHPA 5TR7A 3GRJA 3LCEA 1ES3A 3WRTA 4OQHA 1K55A 4E3KA 1U60A 3UPPA 4ID4A 5FAQA 1E4DA 2H5SA 4R4RA 4S2OA 1ES2A 1KE0A 4R23A 5A90A 5E2FA 4IBXA 4WEJA 4B4XA 3IXBA 4JBFA 4N92A 5F82A 2CC1A 1SDNA 3PAEA 1IEMA 3LO7A 4S2NA 4UA6A 2DCFA 3ZG7B 4A5RA 1H5XA 3IF6A 2P9VB 2V20A 2ZQ7A 3HUOA 1AXBA 4U0XA 1PIOA 3Q07A 5DTSA 4KZ9A 4K0XA 4OPRA 1FCMA 2Y2JA 2Y2PA 4PM9A 5CGWA 4ZTKA 5CERA 5J8XA 4HBTA 3BM6A 3V3SA 4MBHA 3UY6A 4BL2A 2PU2A 5BOHA 3C4PA 4U3TA 1LI9A 1ZG6A 4XUXA 5KSHA 3IF6B 5CEDA 1MBLA 1NY0A 1BLCA 4N1XA 4E3LA 2WKHA 4Q8IA 1FOFA 5L2FA 4OPZA 5FI7A 1Q2QA 4E3JA 1C3BA 3DWKA 2ZLYA 5CHUA 2Y59A 3N8LA 3A3DA 2Q9NA 4D2OA 4LV2A 4K0WA 3MXRA 3NY4A 4S2KA 2C6WB 4KZ6A 3UE1A 3VP1A 3IXDA 3LEZA 2XD5A 1JVJA 4KZAA 3CZDA 3TSGA 4X53A 1K25A 3W4OA 3NCKA 1LLBA 3MFDA 5FQKA 1K54C 2HDSA 3A3IA 4U0TA 3SS4A 1CK3A 1YLZA 4OONA 1S6RA 4DRTA 2XLNA 4P6BA 4KZ5A 5AQ7A 1Z6FA 5KZHA 2A49A 2JE5A 5CGSA 3M6HA 4PMAA 1BTLA 1MWUA 2HDQA 1E25A 1RGZA 4N1HA 5E2HA 1DJAA 1SCWA 3RJUA 5A92A 5CTNA 4BQMA 4EBNA 2GDNA 2V2FF 1IYSA 4S2JA 3WS1A 1K6SA 2ZQDA 3MZEA 4KENB 4WYYA 2XEPA 3EQVA 4X55A 1K4FA 1YLTA 4OPYA 5DF7A 5GL9A 3RXWA 1RCJA 1ONGA 4Y0OA 1ERMA 3O86A 1IELA 5U47A 4P87A 1ZG4A 3CJMA 1WE4A 5EE8A 5HAQA 2ZM2A 4WEKA 5F1GA 4QY6A 4DKIA 2WKEA 2HP9A 5HX9A 1BLPA 4DE1A 4KG5A 3FKWA 5CHJA 4CPKA 2OLUA 4KZBA 1ESUA 5F83A 4WMCA 4ZJ3A 4N9LA 1DJCA 1L2SA 2J9OA 5GHYA 1ES4A 4WZ4A 3PAGA 4P85A 1TVFA 4XXRA 1ONHA 4OPQA 2HPBA 1EWZA 4QU3A 1EROA 5DF9A 5G18A 4E6XA 1IYPA 3HL9A 3HLFA 4XUZA 1I5QA 1MKIA 4EBLA 3ZHHA 3UPOA 2WK0A 2ZQCA 1N9BA 4MNRA 4OLDA 4YINA 1L0GA 4KG6A 3P98A 4R0QA 5HAIA 3NDGA 2WGIA 2P9VA 4S2MA 5FA7A 5FQJA 3SOIA 3AGEA 1GA0A 4HESA 5CXWA 3FYZA 1GHMA 3A3FA 4IVKA 3GV9A 5GLAA 3G32A 3VP3A 5M18A 3WS2A 2OLVA 3DTMA 1ESIA 3HUNA 2XF3A 2ZC3B 1KGFA 3GVBA 3WS5A 4KQRA 5EVIB 3ITBA 3OPLA 3PBOA 1WYCA 2XGNA 2Y2QA 3MBZA 5HARA 2OV5A 4OP5A
chains in the Genus database with same CATH superfamily
3N4IA 4X69A 1MPLA 4EU0A 1YQSA 3T4LA 4N9KA 3F1OB 4YNRA 5D3OA 3SS5A 4BJPA 1CI9A 3L7HA 2ZM0A 3Q7VB 4Q0HA 4E6WA 2AVXA 3BFGA 3SH9A 2G2WA 2JCHA 4L0LA 4KUKA 4OOYA 4DF6A 4I39A 1YLJA 1NLZA 5J4EA 4E04A 4KZ7A 2HJ9C 3HBRA 3LFVA 2J3TD 4D60A 2O0YA 1DP9A 2Y4AA 3CITA 1XJ4A 3FZCA 3V3RA 3IXHA 4Q0JA 4I5SA 2L0WA 1YSPA 1TS6A 2HGVA 1V9YA 2G7UA 2PD7A 3S1YA 1J3WA 5HAPA 2PBYA 3M6BA 2VEAA 3NDEA 4XT2A 3OPPA 2HZ5A 2QKPA 2W3DA 2ZMFA 4C6YA 4WMCD 3PR6A 2EX8A 2FZ0A 4HJ6A 3SS3A 3TE8A 3KYQA 4WZ5C 2ZD8A 1MWTA 3TOIA 4QHCA 4WM9A 3IX8A 3H7WA 5MC7A 5EECA 2JKTM 1SHVA 3O5YA 4ZAMA 2HF6A 2WADA 4B88A 4O01A 1RGYA 1LL9A 3VSLA 3CPTA 2Y55A 3FKVA 1NYYA 4OQIA 2GZAA 4RQ9A 2VJWA 3MKEA 3T1RA 1WYBA 3UDFA 4K08A 5E43A 1KE3A 4WUJA 1OTIA 4PM5A 3ITAA 3BWLA 3IWQA 2ZMVA 4FOFA 3QNBA 2R9XA 4O8GA 3A0SA 5CTMA 1FR1A 3MZDA 2V0WA 3C4OA 5E2GA 2OOLA 4HEFA 1XGJA 3IS2B 5IHVA 5KSCA 1S1YA 4S2LA 3FPVA 1IYOA 3KO6A 2V1BA 3CAXA 3DW0A 2V8FA 1MWRA 2Y2IA 2DRWA 1JWVA 4GLQA 3EWKA 1S67L 3GR2A 1PRQA 4LLOB 1KDSA 2NUTC 3PBTA 2HJEA 3LIBA 1CEFA 5HL6A 4EESA 3ZVWA 1XJ2A 4F94A 4YFMA 4OOMA 2Z2MB 3QP6A 5FI2A 4X6TA 1KOUA 4QY5A 5GHXA 5HSQA 2ZL1A 4RA7A 3T4QA 5FASA 1XFNA 2Y8HA 4ARZA 4OP8A 2ZQAA 3UB7A 2EXBA 2VGLM 1NRJA 4OLGA 4I38A 4GW9A 5F1FA 4OH0A 3OOVA 3HREA 4PM7A 4NXGA 4NK3A 4JXWA 1RP5A 1MWSA 2BG1A 2I72A 1CF0A 4HNBA 4KZ3A 4JGOA 1MKMA 1QMFA 2VK3A 3GDIA 3HCYA 1TDLA 1S0WA 3K2NA 3S7PA 3W4QA 3FG8A 3UN7A 2V0UA 3BFEA 3F1NB 2Z6CA 3ZG0A 4GD6A 4UAAA 2WGWB 4E3IA 3U2AA 1FCOA 3IHAA 3QHYA 1K57C 1ALQA 2XFTA 4GHIB 1JTDA 2JKTI 3LIDA 4KQOA 2EXAA 5J3WA 4L9EA 3LR0A 4JXVA 5FQIA 4DDYA 3MXSA 1MY8A 2R9WA 5FDSA 1Y4OA 2JKFA 3O3VA 5AQ9A 2B5RA 2EX6A 2PRFA 3B33A 3E98A 1FILA 1TD5A 5L07A 1K55A 3UPPA 5FAQA 3IXBA 2O9CA 5F82A 2D01A 1SDNA 4MN5A 5FEFA 2ZQ7A 3LGOA 4U0XA 5DTSA 1PIOA 2XSSA 4OPRA 1T18A 3OLOA 4H6JB 4ZTKA 1SKOB 3BM6A 3UY6A 1DP8A 5BOHA 1LI9A 1OT6A 1NWZA 3MFXA 1MBLA 4AFIA 1NY0A 5CEDA 1Q2QA 2ZLYA 5CHUA 2Y59A 4BMWA 4D2OA 4K0WA 3MXRA 2W3EA 3LIEA 3LEZA 3CZDA 3TSGA 1K25A 3NCKA 3A3IA 1CK3A 1YLZA 2Q0OA 4DRTA 3FC7A 3DTEA 1EW0A 5E2HA 5A92A 2YKFA 2XROA 2GDNA 1OPXA 4R38A 2W3GA 3E4OA 5HDCA 4Y0OA 1ONGA 5EFWA 4PAUA 3CJMA 1W63M 2YKHA 5HAQA 3S7OA 2P08A 4DKIA 2WKQA 4GHIA 4KG5A 2OLUA 3P01A 4KZBA 1ESUA 1ODVA 1IOUA 3NOTC 4ZJ3A 4N9LA 1ES4A 3MF0A 1XJ6A 3PAGA 1ONHA 4OPQA 2HPBA 1EROA 3DBAA 5G18A 3B47A 3UPOA 2WK0A 1N9BA 2FH5A 3NDGA 4MDZA 4PKYG 5FA7A 3AGEA 3FYZA 4IVKA 1TF1A 3G32A 3P7NA 4LRZE 2XF3A 2ZC3B 3NHQA 2XRNA 1WYCA 1OTBA 2PBDP 3LYXA 2OAP1 2OAQ1 2WGWA 3N8RA 3O88A 2C5WB 4ETXA 3VSKA 3Q81A 2PYRA 2EWVA 3CI6A 1O07A 2X71A 4GZBA 1SDEA 3QP2A 2WAEA 1HTZA 1YLYA 2XDMA 2J3TC 2X02A 4MN6A 4R6LA 2EX2A 4GB7A 3PXPA 1XXMA 2ZC7A 2Y2NA 3UE6A 4CJNA 3V39A 5AVEA 1XA1A 3H9WA 1DY6A 4B9OA 1PYYA 3IH8A 2R78A 3H82B 1SKOA 4BL3A 3MQQA 3FWLA 3KX0X 1Y54A 1P9WA 3MJQA 3OBFA 4HP9A 1YMXA 1ES5A 1M6KA 2M7UA 1EI5A 3EOIA 5FQQA 3M2JA 2Z2LB 5F5YA 4KQDA 4G3VA 1WA9A 4ME4A 4CLCD 3C8CA 3GMWA 3WWXA 2JHEA 3IH9A 3UNWA 1NJ4A 1Q2PA 3OZHA 3T4TA 5CRFA 3UB5P 5G4YA 4HJ3A 4GOGA 1YT4A 5GHZA 1IKIA 5FATA 1K54A 1HD8A 2M7VA 3UDXA 4EUZA 3SH7A 1CEGA 2Y91A 3LR4A 2ZJ9A 2JBFA 1SKFA 4LGWA 3HVFA 5M1AA 2E8JA 1PWDA 3GSGA 1ACFA 2G2UA 1BT5A 3HUMA 3A3EA 4NETA 5AQBA 3ZNYA 4FH2A 4JPMA 2H10A 4NKPA 4PHTA 5F68A 3LI9A 2JKGA 1K56D 2P74A 3UO9A 1K6RA 1MC0A 5TBMB 4IBRA 3RXXA 4BD1A 3R4KA 3UB8A 3S4XA 4BLMA 3QP5A 3G35A 4KQQA 1DJBA 3M2KA 1VM1A 3T50A 1XPBA 3RTYA 1BSGA 1H8YA 2INWA 2QJ7A 4FCFA 2RCXA 1VQQA 3N7WA 2ZC5B 4H8RA 1IFQA 4RX2A 3E2LA 5FQ9A 5HW3A 3DAVA 2HP5A 3HLEA 2PU4A 4KZ8A 4HQAA 1F9IA 3MR0A 2WKPA 3N6IA 3G30A 3IQAA 3MQ0A 3IBJA 1VB6A 1FCNA 1G68A 3U4LP 2H0YA 5FSRA 2GJ3A 2IA2A 4G3WA 3NC8A 1O7EA 3W4PA 3V67A 1JTGA 2O9BA 4EBPA 5I5LA 1KE4A 2WKRA 4FSFA 4CLCA 3G34A 3KSHA 4Y7PA 2Y2GA 4LFUA 1TEMA 1NZOA 5TJJA 3VP4A 1FQGA 2W3HA 3H82A 4MLLA 3DTIA 4F3LA 3SZTA 2H28A 4UA7A 4P0MA 1DRMA 1FIKA 3D3OA 3EGDC 4L9FA 3PBRA 4S2PA 3DTKA 1I2SA 3QNCA 3CWFA 1K55C 1K4EA 3V5MA 2P04A 1PW1A 2Z6DA 4FD8A 4OVDA 4DDSA 3EEHA 1UWPX 3FPWA 2HP6A 3PBSA 3T4SA 5AVFA 1P0ZA 3P09A 5JYOA 3NI9A 4GJ4A 1S4SA 4JF4A 4GNUA 5K5BA 3IHBA 4MEZA 4DN0A 2KOIA 3JVUA 3QP8A 5GLBA 2X01A 1GA9A 3JVVA 3VE4A 1S1ZA 3VMAA 1TS8A 2L4RA 5HD5A 4P6ZS 4R3JA 2J7VA 4BBTA 1W8QA 4OQGA 4DMZA 4HBUA 3JPUA 4JF5A 2EFUA 2XQZA 2VZWA 3LCEA 1ES3A 1G5UA 4EQ1A 4OQHA 4E3KA 1U60A 1E4DA 4S2OA 3KYEA 5HDDA 4BBUA 1KE0A 4R23A 4B4XA 3PAEA 1S66L 2DCFA 3ZG7B 2W1TA 2P9VB 2V20A 1AXBA 4K0XA 2D02A 3LEQA 2Y2JA 2Y2PA 5CERA 4I3IA 4YWZA 2XA7M 2MJ6A 4X1LA 2VV6A 2W1TB 3IF6B 5DKLA 4Q8IA 2W27A 5L2FA 4OPZA 4DJ2A 3NY4A 3VP1A 4KZAA 5HZHA 2HV1A 1UGUA 1LLBA 5FQKA 2HDSA 1S6RA 2ZBBA 2W0NA 1TS7A 4P6BA 4KZ5A 4HOIA 2V1AA 5KZHA 3M6HA 3A0VA 3VOLA 1G6OA 4N1HA 1SCWA 4IUHA 4BQMA 1N9OA 2V2FF 4S2JA 1K6SA 2Y79A 3ZYTA 1X0OA 3T12B 4KENB 4Q0IA 4X55A 5L8MA 5DF7A 5GL9A 5U47A 5F1GA 4QY6A 2WKEA 2HP9A 4CPKA 4H6JA 1DJCA 1L2SA 2J9OA 3KSIA 3VV4A 1STZA 4P85A 3W2ZA 5F6AA 1D1JA 2BASA 1IYPA 4Y15A 3HL9A 1T1BA 1MKIA 2A24A 4R0QA 2O9AA 3MXQA 1GA0A 5CXWA 1GHMA 1G28A 1F98A 3GV9A 2A2LA 2VLGA 4Y13A 3OPLA 4OP5A 1VEUA 5E2EA 3BY8A 4IVIA 4RYEA 3BFDA 1GCEA 4RX3A 4CLCB 4PM8A 3N8SA 1OTDA 4UHUA 4Z9QA 4S2IA 2ZQ8A 1N4OA 4IHQA 3MKFA 4O0PA 1W8YA 4Y17A 1MXOA 3ZVTA 2H0TA 3S22A 4R4SA 3LR5A 1LL5A 2J8YA 3EEAA 2QMIA 1T1CA 5FI6A 3C7VA 1H8MA 2LB9A 1CI8A 3A0RA 5DTTA 5EV0A 2HDRA 4JGPA 5M19A 2UWXA 2OSUA 3I7JA 1GSWA 1XA7A 3UPNA 3HJIA 5FEGA 3BECA 4IEDA 2Y2KA 2XFSA 3HLBA 3ULFA 1L0EA 4S2NC 4GS9A 1BULA 1PWCA 3MZFA 3IF6C 4LV0A 3R7WA 4ESPA 2VGJA 3Q7ZA 3W8KA 3TRCA 1V9ZA 1ZTUA 4HH2A 5KMWA 4EW7A 2OWJA 5FDHA 1VETB 2K31A 4GCZA 3UE0A 5EVIA 3UMDA 3BJNA 4G3KA 2Y2HA 2A3UA 3ZG5A 2WZZA 5HDSA 1KGGA 1GHIA 1NXYA 4JF6A 4RVAA 3IF5A 2XH9A 5A8BA 5AQAA 4FH4A 4Y3IA 1VEUB 4HY8A 5DJTA 2IWCA 3RFBA 3UB9A 1JWZA 2FFFB 4ZDXA 3SH8A 4EEPA 3NJAA 2J9PA 4DJ3A 3BRMA 4DXBA 3LY4A 1S4RA 3T4OA 1YKDA 2J80A 1XFQA 3CHWP 4LRYC 4PM6A 3Q82A 1PZOA 2QYBA 1ZC2A 3OCNA 4E3JA 5FAPA 1ZKJA 4GDBA 3ZFZA 1K57A 3ZNTA 1H8ZA 4I3JA 4II7A 1W5DA 4OQ0A 4QD4A 1OTEA 1CQAA 3IWIA 1BUEA 4HIAA 5DF8A 1DP6A 2E8IA 5DVAA 4DE3A 2W1RA 3LI8A 3QP4A 5HL1A 2PT7A 4MBFA 1OMEA 2O99A 1FSYA 3HJKA 3NBLA 4UQIS 3E4PA 2EX9A 3E4QA 3IBRA 1YAXA 4WBGA 4UQIM 1N9LA 1JWPA 2EA9A 4X25A 3T4KA 1L3LA 4BWIA 3VFHA 4WLAA 2EWWA 1XJ3A 3DWZA 4KG2A 5FQMA 1G6AA 2HDUA 4IUKA 3D9YA 1NLYA 3G2ZA 2JC7A 3C38A 2VGKA 1E3UD 4OKPA 3HLDA 3BLMA 1LSWA 4QJGA 4GS9B 5F69A 3IXGA 2Y2MA 4PPRA 3A3JA 4GKUA 3OCLA 1BYWA 4K91A 1YLPA 4MN7A 5G4ZA 5A93A 1JNUA 2WKIA 4ZRRA 3UE3A 4E3MA 1KVLA 3ISGA 2FFYA 3VOZA 5DFYA 5EPHA 4ZJ1A 1LI0A 3B3XA 4JLFA 1Y28A 5GLCA 3VFFA 2QZ6A 1PI4A 4E3OA 3GTCA 3UDIA 3NIAA 1J9MA 2BLSA 1TS0A 3MQOA 2ZC6B 3FV7A 4JGRA 1YLWA 3IT9A 4QB8A 3BYDA 3VP2A 2LB5A 1IKGA 1QMEA 3AGFA 1T19A 3MMHA 2QPNA 1OJ5A 3NOUC 1OJGA 1IYQA 1BLSA 4ETZA 1P97A 3BEBA 5EOOA 5L09A 2WYXA 1NRFA 3LIAA 1KGEA 1GHPA 4HJ4A 2ZOIA 5EVEA 5HWTA 3WRTA 2JKRI 2H5SA 1ES2A 5A90A 1AWIA 5E2FA 4IBXA 1K0KA 4N92A 2CC1A 4UA6A 4S2NA 2J3WA 4KZ9A 3E0YA 4PM9A 1VHMA 5CGWA 3V3SA 1OT9A 1GSXA 1ZG6A 4XUXA 1BLCA 4E3LA 2QWSA 4WF0A 3A3DA 2Q9NA 3NULA 4LV2A 4S2KA 2C6WB 3IXDA 1Z09A 3UMEA 4X53A 5DKKA 3W4OA 3MFDA 3CPTB 1Z6FA 3NOPC 2A49A 5CGSA 4PMAA 1MWUA 5J7EA 1E25A 1RGZA 5CX7A 3F1PB 1DJAA 3RJUA 3LICA 4F3LB 2ZQDA 4WYYA 2V8CA 2XEPA 1K4FA 3G6OA 4OPYA 1ZG4A 1WE4A 5EE8A 2ZM2A 5HX9A 4XT2B 4DE1A 2PD8A 3MSHA 5HWVA 2BTFP 4Z1WA 5L10A 5F83A 5GHYA 1LT0A 4R3AA 4WZ4A 2CMNA 1TVFA 4XXRA 3R7WB 4B93A 1EWZA 3PHYA 4E6XA 4XUZA 1I5QA 3F1OA 3ZHHA 4CLCC 4YINA 1L0GA 4KG6A 3P98A 5HAIA 2P9VA 1F5MA 3SOIA 1F2KA 2VV8A 4IJGA 3A3FA 3T4JA 2M1CA 1HLUP 5GLAA 3VP3A 3WS2A 2OLVA 3DTMA 1ESIA 1KGFA 3GVBA 3WS5A 3BQ8A 3NECA 3ITBA 1N9NA 2OV5A 5HARA 2XGNA 2Y2QA 3WRZA 1D06A 3LY3A 4HI4A 1W7FA 5CHMA 1XGIA 3G31A 5C5KA 3Q7VA 2V1ZA 3TG9A 3IX3A 2KDKA 3PBQA 4NEED 5TBMA 3IX4A 4C3QA 1L0FA 1PFLA 2VKSA 2ZC4B 2Q9MA 5IT5A 4ZBEA 4E3NA 5EVIC 4LPZA 3S7NA 3IWOA 2XR0A 1D7EA 1FR6A 3ZG9B 3OPRA 1TDGA 4LCLA 5EVLA 4HHDA 2IWDA 1LL8A 1E3UA 3IS2A 2DNSA 3ICYA 4QPRA 2WZXA 2XA7S 1LHYA 2WGVA 5HPIA 1K56A 1PI5A 3BLSA 2K2NA 4GN2A 4WN5A 3F1NA 2RL3A 1NYMA 5EVID 1LSVA 2UV0E 3O87A 2B18A 2W3FA 1K38A 4DE0A 1A0KA 5DTKA 3WS0A 5JYPA 2PR6A 3KSGA 3TJZC 1L0DA 3VE3A 4LENA 4WZ5A 4MCWA 3OPHA 4X68A 4GDNA 3T1XA 4DE2A 4X56A 4LCMA 3JYIA 4P6ZM 3D4FA 3LUQA 2QHKA 4JXSA 5DFXA 3ZGAB 3ZG8B 3AGDA 4B4ZA 4FTXA 3G4PA 2B02A 2PAVP 2IWBA 3EQUA 3BFFA 2WUQA 3BFCA 2B95A 1FSWA 4JKTA 4X1MA 4LV3A 4WELA 1HZOA 3OC2A 4EETB 5GLDA 1I2WA 4FUWA 2NUPC 1NZUA 4DXCA 5FAOA 3RH8B 5HWWA 1XP4A 4Y0TA 3GECA 2Y2LA 4R1GA 5HFOA 1PW8A 4ZJ2A 2ZL1B 1OTAA 2XK1A 1VETA 4ARZB 2EFXA 4LRXC 2PYPA 3PBNA 3CMZA 1PWGA 1KVMA 2ZQ9A 5CGXA 4KUOA 4Y2FA 3ZCZA 2WAFA 4NXBA 2PDRA 3EGXC 4NXEA 5CEBA 2Y2OA 2PHYA 4BENA 3B42A 3T1SA 2KLIA 3PTEA 4OOLA 4GD8A 2VV7A 2K7SA 4EUVA 1XX2A 3WS4A 3VP0A 1CJFA 1W79A 5I94A 4BD0A 2I9VA 5HPFA 5EM1A 3VOYA 1BZAA 1BLHA 2ZM8A 3GQZA 4O7DA 3ZQ5A 3KYZA 5EUAA 3KSFA 4BBVA 5TFQA 1GSVA 4KZ4A 3MS6A 4R3BA 4M3KA 2ZMAA 1ZHHB 3S7QA 1PNEA 5TGFA 3CG5A 2L1MA 3BW6A 5EOEA 5IU1A 4JXGA 3ZDJA 2GNXA 5CECA 2XD1A 4EV4A 3BQAA 3C5AA 4EQIA 1XKZA 3E2KA 3HLCA 1M40A 3L9KA 1YMSA 5LBRA 3C7UA 5A91A 3HLGA 3H7WB 4C75A 1H0MA 3K3DA 4MBKA 3V50A 4LV1A 1YM1A 2DMWA 1ERQA 1PZPA 4L9GA 4R70A 3BY9A 3HLWA 4M4XA 4Y0UA 4UA9A 4EWFA 2GX5A 3T1QB 2ZOHA 1KDWA 1HVBA 3Q1FA 2ACGA 3G2YA 1YPRA 5TR7A 3GRJA 4ID4A 4R4RA 4WEJA 2JKRM 4JBFA 4JGQA 4YOFA 2KX6A 4Y5FA 1IEMA 3LO7A 4QWOA 4A5RA 1H5XA 3IF6A 3HUOA 3LIFA 2V9AA 2P7JA 3Q07A 3CUEA 1FCMA 3QP1A 5J8XA 4HBTA 4MBHA 4BL2A 2JN7A 2PU2A 3PYPA 1UWNX 2QJ5A 3C4PA 4U3TA 4EXOA 5KSHA 4N1XA 2WKHA 1T1AA 1FOFA 5FI7A 1C3BA 3DWKA 2OWHA 3N8LA 1SZVA 1W63Q 4HH3A 3K3CA 5DJUA 4KZ6A 3UE1A 5KIZA 3F1PA 2XD5A 1JVJA 4CLCE 4WL9A 2VA0A 3CLOA 1K54C 4UEYA 4U0TA 3SS4A 4OONA 5EM0A 2XLNA 3UB6A 3C30A 5AQ7A 4NXFA 2JE5A 1BTLA 2HDQA 5CTNA 4EBNA 1IYSA 3WS1A 5HD3A 2VX8A 3MZEA 3EQVA 2A24B 1YLTA 3SW1A 4HP4A 1RCJA 3RXWA 1ERMA 3O86A 4NG2A 1IELA 4P87A 5FL3A 5IS1A 4WEKA 3CUEC 1BLPA 3FKWA 5CHJA 4PKYA 1LSXA 3D72A 4WMCA 4EEUA 4QU3A 5DF9A 1H3QA 3HLFA 3TW8A 4EBLA 2PR5A 2ZQCA 4MNRA 1P9RA 4OLDA 2WGIA 4S2MA 3C2WA 1YSQA 5FQJA 5AJGA 4MMNA 4HESA 2VGLS 5M18A 1MZUA 3HUNA 4KQRA 4CQHA 5EVIB 3PBOA 4EERA 3MBZA 4I3AA 3LR3A
chains in the Genus database with same CATH topology
3N4IA 4X69A 1MPLA 5E2EA 3WRZA 4IVIA 3LY3A 4RYEA 2WGWA 1W7FA 1YQSA 3N8RA 3O88A 5CHMA 1XGIA 3BFDA 1GCEA 4RX3A 2C5WB 3VSKA 3G31A 3Q7VA 4N9KA 3Q81A 4PM8A 2V1ZA 3N8SA 3TG9A 3PBQA 4UHUA 1O07A 5D3OA 4Z9QA 3SS5A 2X71A 4GZBA 1SDEA 4BJPA 2WAEA 4S2IA 2ZQ8A 4C3QA 1HTZA 1L0FA 1N4OA 1YLYA 3MKFA 1CI9A 2ZM0A 1W8YA 2ZC4B 3Q7VB 2XDMA 1MXOA 4E6WA 2Q9MA 2X02A 3ZVTA 3BFGA 2EX2A 3SH9A 2G2WA 2JCHA 4ZBEA 4E3NA 5EVIC 4L0LA 2H0TA 4GB7A 1XXMA 3S22A 2ZC7A 2Y2NA 3IWOA 4CJNA 4R4SA 3V39A 4OOYA 1XA1A 4DF6A 1LL5A 2XR0A 1DY6A 2J8YA 1PYYA 2QMIA 3IH8A 1YLJA 5FI6A 3C7VA 1FR6A 4KZ7A 4BL3A 3ZG9B 3OPRA 1TDGA 1CI8A 3FWLA 3HBRA 4LCLA 5EVLA 1Y54A 5DTTA 2IWDA 1YMXA 1ES5A 1M6KA 2Y4AA 1E3UA 2DNSA 1EI5A 2HDRA 3FZCA 5FQQA 5M19A 3V3RA 2UWXA 2OSUA 3I7JA 2WZXA 3IXHA 1XA7A 1LHYA 3M2JA 2Z2LB 2WGVA 3UPNA 1K56A 1PI5A 3BLSA 4GN2A 3GMWA 3S1YA 3WWXA 3BECA 4IEDA 3IH9A 5HAPA 2PBYA 3M6BA 2RL3A 3UNWA 1NYMA 5EVID 3NDEA 3O87A 1NJ4A 1Q2PA 2Y2KA 3OPPA 1K38A 2XFSA 3HLBA 3OZHA 5CRFA 4DE0A 1L0EA 5DTKA 4C6YA 4S2NC 3WS0A 1BULA 1PWCA 5JYPA 4WMCD 3MZFA 4GOGA 3IF6C 1YT4A 2EX8A 4LV0A 1L0DA 1IKIA 5GHZA 3SS3A 5FATA 4LENA 2VGJA 3Q7ZA 1K54A 1HD8A 3W8KA 3UDXA 4WZ5A 4EUZA 3OPHA 4WZ5C 2ZD8A 1MWTA 3SH7A 1CEGA 2Y91A 5KMWA 2ZJ9A 2JBFA 1SKFA 4X68A 4GDNA 3TOIA 4QHCA 3HVFA 4WM9A 5FDHA 4X56A 3UE0A 5EVIA 4LCMA 3JYIA 4DE2A 3D4FA 5EECA 1SHVA 2Y2HA 2A3UA 3ZG5A 4ZAMA 3ZGAB 4JXSA 5M1AA 2WADA 4B88A 1RGYA 3ZG8B 1LL9A 3AGDA 1PWDA 2WZZA 3VSLA 3GSGA 2Y55A 4B4ZA 2G2UA 3G4PA 1KGGA 1NYYA 1BT5A 3FKVA 1GHIA 1NXYA 4OQIA 4JF6A 4RVAA 3HUMA 3A3EA 2XH9A 3IF5A 4NETA 5AQBA 3ZNYA 5AQAA 4FH4A 2IWBA 4FH2A 4JPMA 3EQUA 3MKEA 2H10A 3BFFA 2WUQA 1WYBA 3UDFA 3BFCA 2IWCA 5E43A 1KE3A 1FSWA 4JKTA 4PM5A 4LV3A 4WELA 1HZOA 1JWZA 3ITAA 2FFFB 3IWQA 3OC2A 4ZDXA 1K56D 3QNBA 2P74A 3UO9A 1K6RA 5GLDA 1I2WA 3SH8A 4IBRA 1NZUA 2R9XA 3RXXA 4BD1A 5CTMA 1FR1A 3MZDA 3S4XA 4BLMA 4DXCA 3C4OA 2J9PA 3G35A 5E2GA 4KQQA 5FAOA 1DJBA 3BRMA 4DXBA 3LY4A 3M2KA 4HEFA 1XP4A 1VM1A 1XGJA 5IHVA 1XPBA 4Y0TA 4PM6A 5KSCA 1BSGA 1H8YA 2Y2LA 3Q82A 4S2LA 1PZOA 1IYOA 4FCFA 2RCXA 4R1GA 3DW0A 1VQQA 1PW8A 5HFOA 4ZJ2A 3N7WA 1ZC2A 2ZC5B 1MWRA 3OCNA 2Y2IA 1ZKJA 2DRWA 4GDBA 4H8RA 5FAPA 1JWVA 3ZFZA 4RX2A 2XK1A 3E2LA 5FQ9A 5HW3A 1K57A 3ZNTA 1H8ZA 2EFXA 3GR2A 2HP5A 1KDSA 3PBNA 3CMZA 1PWGA 3HLEA 1KVMA 1W5DA 2PU4A 2ZQ9A 4KZ8A 4OQ0A 4QD4A 5CGXA 3PBTA 1CEFA 3N6IA 3ZCZA 3IWIA 1BUEA 2WAFA 3G30A 5DF8A 3IQAA 2E8IA 3ZVWA 5DVAA 4DE3A 4F94A 4YFMA 1FCNA 5CEBA 2Y2OA 4OOMA 5HL1A 1G68A 4MBFA 4BENA 2H0YA 2Z2MB 1OMEA 5FI2A 4X6TA 5FSRA 1FSYA 3PTEA 3NBLA 4OOLA 4QY5A 5GHXA 2EX9A 3NC8A 4GD8A 1O7EA 4WBGA 3W4PA 4RA7A 1JWPA 5FASA 1XX2A 1JTGA 3WS4A 3VP0A 1W79A 5I94A 4OP8A 2ZQAA 4BD0A 2EXBA 3VFHA 3VOYA 1BZAA 1BLHA 4EBPA 2ZM8A 3DWZA 4KG2A 1KE4A 3GQZA 4OLGA 4FSFA 4O7DA 3G34A 5FQMA 1G6AA 5F1FA 4OH0A 4Y7PA 5EUAA 2Y2GA 1TEMA 1NZOA 2HDUA 3HREA 5TFQA 3VP4A 1FQGA 4KZ4A 4PM7A 4MLLA 3G2ZA 2JC7A 4R3BA 4M3KA 4NK3A 2ZMAA 2VGKA 1E3UD 4OKPA 3HLDA 4P0MA 4UA7A 3BLMA 4JXWA 1RP5A 1MWSA 2BG1A 3CG5A 5EOEA 5TGFA 4QJGA 2I72A 3PBRA 3IXGA 4S2PA 2Y2MA 4KZ3A 1I2SA 3QNCA 1QMFA 4JXGA 1K55C 4PPRA 3ZDJA 1TDLA 1K4EA 1S0WA 3A3JA 4GKUA 3OCLA 3V5MA 1PW1A 1YLPA 4K91A 5A93A 2WKIA 5CECA 2XD1A 3W4QA 4FD8A 3UE3A 4OVDA 4E3MA 4EV4A 4DDSA 3C5AA 3UN7A 3BFEA 1KVLA 3ISGA 4EQIA 1XKZA 3E2KA 2FFYA 3VOZA 2HP6A 3HLCA 1M40A 3PBSA 5EPHA 4ZJ1A 3ZG0A 1LI0A 3B3XA 4GD6A 2WGWB 4JLFA 4UAAA 5GLCA 1YMSA 3VFFA 2QZ6A 1PI4A 4E3OA 4E3IA 3C7UA 3GTCA 3UDIA 3NIAA 1FCOA 3P09A 1J9MA 2BLSA 3NI9A 3IHAA 3QHYA 5A91A 3HLGA 1K57C 5JYOA 1ALQA 4C75A 2ZC6B 3FV7A 4JF4A 2XFTA 4GNUA 1YLWA 4MBKA 3IT9A 3IHBA 4QB8A 3V50A 4LV1A 1JTDA 3BYDA 4MEZA 3VP2A 1IKGA 1QMEA 1YM1A 3AGFA 4KQOA 1ERQA 1PZPA 2EXAA 2QPNA 5GLBA 2X01A 1GA9A 3HLWA 4Y0UA 1IYQA 4JXVA 5FQIA 4DDYA 3MXSA 1BLSA 1MY8A 4UA9A 3VMAA 4EWFA 2R9WA 3BEBA 5EOOA 1KDWA 4R3JA 2J7VA 1HVBA 2WYXA 1NRFA 1W8QA 4OQGA 3Q1FA 4HBUA 3O3VA 5AQ9A 2B5RA 3G2YA 4JF5A 2EX6A 2EFUA 2XQZA 1KGEA 1GHPA 5TR7A 3GRJA 3LCEA 1ES3A 3WRTA 4OQHA 1K55A 4E3KA 1U60A 3UPPA 4ID4A 5FAQA 1E4DA 2H5SA 4R4RA 4S2OA 1ES2A 1KE0A 4R23A 5A90A 5E2FA 4IBXA 4WEJA 4B4XA 3IXBA 4JBFA 4N92A 5F82A 2CC1A 1SDNA 3PAEA 1IEMA 3LO7A 4S2NA 4UA6A 2DCFA 3ZG7B 4A5RA 1H5XA 3IF6A 2P9VB 2V20A 2ZQ7A 3HUOA 1AXBA 4U0XA 1PIOA 3Q07A 5DTSA 4KZ9A 4K0XA 4OPRA 1FCMA 2Y2JA 2Y2PA 4PM9A 5CGWA 4ZTKA 5CERA 5J8XA 4HBTA 3BM6A 3V3SA 4MBHA 3UY6A 4BL2A 2PU2A 5BOHA 3C4PA 4U3TA 1LI9A 1ZG6A 4XUXA 5KSHA 3IF6B 5CEDA 1MBLA 1NY0A 1BLCA 4N1XA 4E3LA 2WKHA 4Q8IA 1FOFA 5L2FA 4OPZA 5FI7A 1Q2QA 4E3JA 1C3BA 3DWKA 2ZLYA 5CHUA 2Y59A 3N8LA 3A3DA 2Q9NA 4D2OA 4LV2A 4K0WA 3MXRA 3NY4A 4S2KA 2C6WB 4KZ6A 3UE1A 3VP1A 3IXDA 3LEZA 2XD5A 1JVJA 4KZAA 3CZDA 3TSGA 4X53A 1K25A 3W4OA 3NCKA 1LLBA 3MFDA 5FQKA 1K54C 2HDSA 3A3IA 4U0TA 3SS4A 1CK3A 1YLZA 4OONA 1S6RA 4DRTA 2XLNA 4P6BA 4KZ5A 5AQ7A 1Z6FA 5KZHA 2A49A 2JE5A 5CGSA 3M6HA 4PMAA 1BTLA 1MWUA 2HDQA 1E25A 1RGZA 4N1HA 5E2HA 1DJAA 1SCWA 3RJUA 5A92A 5CTNA 4BQMA 4EBNA 2GDNA 2V2FF 1IYSA 4S2JA 3WS1A 1K6SA 2ZQDA 3MZEA 4KENB 4WYYA 2XEPA 3EQVA 4X55A 1K4FA 1YLTA 4OPYA 5DF7A 5GL9A 3RXWA 1RCJA 1ONGA 4Y0OA 1ERMA 3O86A 1IELA 5U47A 4P87A 1ZG4A 3CJMA 1WE4A 5EE8A 5HAQA 2ZM2A 4WEKA 5F1GA 4QY6A 4DKIA 2WKEA 2HP9A 5HX9A 1BLPA 4DE1A 4KG5A 3FKWA 5CHJA 4CPKA 2OLUA 4KZBA 1ESUA 5F83A 4WMCA 4ZJ3A 4N9LA 1DJCA 1L2SA 2J9OA 5GHYA 1ES4A 4WZ4A 3PAGA 4P85A 1TVFA 4XXRA 1ONHA 4OPQA 2HPBA 1EWZA 4QU3A 1EROA 5DF9A 5G18A 4E6XA 1IYPA 3HL9A 3HLFA 4XUZA 1I5QA 1MKIA 4EBLA 3ZHHA 3UPOA 2WK0A 2ZQCA 1N9BA 4MNRA 4OLDA 4YINA 1L0GA 4KG6A 3P98A 4R0QA 5HAIA 3NDGA 2WGIA 2P9VA 4S2MA 5FA7A 5FQJA 3SOIA 3AGEA 1GA0A 4HESA 5CXWA 3FYZA 1GHMA 3A3FA 4IVKA 3GV9A 5GLAA 3G32A 3VP3A 5M18A 3WS2A 2OLVA 3DTMA 1ESIA 3HUNA 2XF3A 2ZC3B 1KGFA 3GVBA 3WS5A 4KQRA 5EVIB 3ITBA 3OPLA 3PBOA 1WYCA 2XGNA 2Y2QA 3MBZA 5HARA 2OV5A 4OP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4I A;  4X69 A;  1MPL A;  5E2E A;  3WRZ A;  4IVI A;  3LY3 A;  4RYE A;  2WGW A;  1W7F A;  1YQS A;  3N8R A;  3O88 A;  5CHM A;  1XGI A;  3BFD A;  1GCE A;  4RX3 A;  2C5W B;  3VSK A;  3G31 A;  3Q7V A;  4N9K A;  3Q81 A;  4PM8 A;  2V1Z A;  3N8S A;  3TG9 A;  3PBQ A;  4UHU A;  1O07 A;  5D3O A;  4Z9Q A;  3SS5 A;  2X71 A;  4GZB A;  1SDE A;  4BJP A;  2WAE A;  4S2I A;  2ZQ8 A;  4C3Q A;  1HTZ A;  1L0F A;  1N4O A;  1YLY A;  3MKF A;  1CI9 A;  2ZM0 A;  1W8Y A;  2ZC4 B;  3Q7V B;  2XDM A;  1MXO A;  4E6W A;  2Q9M A;  2X02 A;  3ZVT A;  3BFG A;  2EX2 A;  3SH9 A;  2G2W A;  2JCH A;  4ZBE A;  4E3N A;  5EVI C;  4L0L A;  2H0T A;  4GB7 A;  1XXM A;  3S22 A;  2ZC7 A;  2Y2N A;  3IWO A;  4CJN A;  4R4S A;  3V39 A;  4OOY A;  1XA1 A;  4DF6 A;  1LL5 A;  2XR0 A;  1DY6 A;  2J8Y A;  1PYY A;  2QMI A;  3IH8 A;  1YLJ A;  5FI6 A;  3C7V A;  1FR6 A;  4KZ7 A;  4BL3 A;  3ZG9 B;  3OPR A;  1TDG A;  1CI8 A;  3FWL A;  3HBR A;  4LCL A;  5EVL A;  1Y54 A;  5DTT A;  2IWD A;  1YMX A;  1ES5 A;  1M6K A;  2Y4A A;  1E3U A;  2DNS A;  1EI5 A;  2HDR A;  3FZC A;  5FQQ A;  5M19 A;  3V3R A;  2UWX A;  2OSU A;  3I7J A;  2WZX A;  3IXH A;  1XA7 A;  1LHY A;  3M2J A;  2Z2L B;  2WGV A;  3UPN A;  1K56 A;  1PI5 A;  3BLS A;  4GN2 A;  3GMW A;  3S1Y A;  3WWX A;  3BEC A;  4IED A;  3IH9 A;  5HAP A;  2PBY A;  3M6B A;  2RL3 A;  3UNW A;  1NYM A;  5EVI D;  3NDE A;  3O87 A;  1NJ4 A;  1Q2P A;  2Y2K A;  3OPP A;  1K38 A;  2XFS A;  3HLB A;  3OZH A;  5CRF A;  4DE0 A;  1L0E A;  5DTK A;  4C6Y A;  4S2N C;  3WS0 A;  1BUL A;  1PWC A;  5JYP A;  4WMC D;  3MZF A;  4GOG A;  3IF6 C;  1YT4 A;  2EX8 A;  4LV0 A;  1L0D A;  1IKI A;  5GHZ A;  3SS3 A;  5FAT A;  4LEN A;  2VGJ A;  3Q7Z A;  1K54 A;  1HD8 A;  3W8K A;  3UDX A;  4WZ5 A;  4EUZ A;  3OPH A;  4WZ5 C;  2ZD8 A;  1MWT A;  3SH7 A;  1CEG A;  2Y91 A;  5KMW A;  2ZJ9 A;  2JBF A;  1SKF A;  4X68 A;  4GDN A;  3TOI A;  4QHC A;  3HVF A;  4WM9 A;  5FDH A;  4X56 A;  3UE0 A;  5EVI A;  4LCM A;  3JYI A;  4DE2 A;  3D4F A;  5EEC A;  1SHV A;  2Y2H A;  2A3U A;  3ZG5 A;  4ZAM A;  3ZGA B;  4JXS A;  5M1A A;  2WAD A;  4B88 A;  1RGY A;  3ZG8 B;  1LL9 A;  3AGD A;  1PWD A;  2WZZ A;  3VSL A;  3GSG A;  2Y55 A;  4B4Z A;  2G2U A;  3G4P A;  1KGG A;  1NYY A;  1BT5 A;  3FKV A;  1GHI A;  1NXY A;  4OQI A;  4JF6 A;  4RVA A;  3HUM A;  3A3E A;  2XH9 A;  3IF5 A;  4NET A;  5AQB A;  3ZNY A;  5AQA A;  4FH4 A;  2IWB A;  4FH2 A;  4JPM A;  3EQU A;  3MKE A;  2H10 A;  3BFF A;  2WUQ A;  1WYB A;  3UDF A;  3BFC A;  2IWC A;  5E43 A;  1KE3 A;  1FSW A;  4JKT A;  4PM5 A;  4LV3 A;  4WEL A;  1HZO A;  1JWZ A;  3ITA A;  2FFF B;  3IWQ A;  3OC2 A;  4ZDX A;  1K56 D;  3QNB A;  2P74 A;  3UO9 A;  1K6R A;  5GLD A;  1I2W A;  3SH8 A;  4IBR A;  1NZU A;  2R9X A;  3RXX A;  4BD1 A;  5CTM A;  1FR1 A;  3MZD A;  3S4X A;  4BLM A;  4DXC A;  3C4O A;  2J9P A;  3G35 A;  5E2G A;  4KQQ A;  5FAO A;  1DJB A;  3BRM A;  4DXB A;  3LY4 A;  3M2K A;  4HEF A;  1XP4 A;  1VM1 A;  1XGJ A;  5IHV A;  1XPB A;  4Y0T A;  4PM6 A;  5KSC A;  1BSG A;  1H8Y A;  2Y2L A;  3Q82 A;  4S2L A;  1PZO A;  1IYO A;  4FCF A;  2RCX A;  4R1G A;  3DW0 A;  1VQQ A;  1PW8 A;  5HFO A;  4ZJ2 A;  3N7W A;  1ZC2 A;  2ZC5 B;  1MWR A;  3OCN A;  2Y2I A;  1ZKJ A;  2DRW A;  4GDB A;  4H8R A;  5FAP A;  1JWV A;  3ZFZ A;  4RX2 A;  2XK1 A;  3E2L A;  5FQ9 A;  5HW3 A;  1K57 A;  3ZNT A;  1H8Z A;  2EFX A;  3GR2 A;  2HP5 A;  1KDS A;  3PBN A;  3CMZ A;  1PWG A;  3HLE A;  1KVM A;  1W5D A;  2PU4 A;  2ZQ9 A;  4KZ8 A;  4OQ0 A;  4QD4 A;  5CGX A;  3PBT A;  1CEF A;  3N6I A;  3ZCZ A;  3IWI A;  1BUE A;  2WAF A;  3G30 A;  5DF8 A;  3IQA A;  2E8I A;  3ZVW A;  5DVA A;  4DE3 A;  4F94 A;  4YFM A;  1FCN A;  5CEB A;  2Y2O A;  4OOM A;  5HL1 A;  1G68 A;  4MBF A;  4BEN A;  2H0Y A;  2Z2M B;  1OME A;  5FI2 A;  4X6T A;  5FSR A;  1FSY A;  3PTE A;  3NBL A;  4OOL A;  4QY5 A;  5GHX A;  2EX9 A;  3NC8 A;  4GD8 A;  1O7E A;  4WBG A;  3W4P A;  4RA7 A;  1JWP A;  5FAS A;  1XX2 A;  1JTG A;  3WS4 A;  3VP0 A;  1W79 A;  5I94 A;  4OP8 A;  2ZQA A;  4BD0 A;  2EXB A;  3VFH A;  3VOY A;  1BZA A;  1BLH A;  4EBP A;  2ZM8 A;  3DWZ A;  4KG2 A;  1KE4 A;  3GQZ A;  4OLG A;  4FSF A;  4O7D A;  3G34 A;  5FQM A;  1G6A A;  5F1F A;  4OH0 A;  4Y7P A;  5EUA A;  2Y2G A;  1TEM A;  1NZO A;  2HDU A;  3HRE A;  5TFQ A;  3VP4 A;  1FQG A;  4KZ4 A;  4PM7 A;  4MLL A;  3G2Z A;  2JC7 A;  4R3B A;  4M3K A;  4NK3 A;  2ZMA A;  2VGK A;  1E3U D;  4OKP A;  3HLD A;  4P0M A;  4UA7 A;  3BLM A;  4JXW A;  1RP5 A;  1MWS A;  2BG1 A;  3CG5 A;  5EOE A;  5TGF A;  4QJG A;  2I72 A;  3PBR A;  3IXG A;  4S2P A;  2Y2M A;  4KZ3 A;  1I2S A;  3QNC A;  1QMF A;  4JXG A;  1K55 C;  4PPR A;  3ZDJ A;  1TDL A;  1K4E A;  1S0W A;  3A3J A;  4GKU A;  3OCL A;  3V5M A;  1PW1 A;  1YLP A;  4K91 A;  5A93 A;  2WKI A;  5CEC A;  2XD1 A;  3W4Q A;  4FD8 A;  3UE3 A;  4OVD A;  4E3M A;  4EV4 A;  4DDS A;  3C5A A;  3UN7 A;  3BFE A;  1KVL A;  3ISG A;  4EQI A;  1XKZ A;  3E2K A;  2FFY A;  3VOZ A;  2HP6 A;  3HLC A;  1M40 A;  3PBS A;  5EPH A;  4ZJ1 A;  3ZG0 A;  1LI0 A;  3B3X A;  4GD6 A;  2WGW B;  4JLF A;  4UAA A;  5GLC A;  1YMS A;  3VFF A;  2QZ6 A;  1PI4 A;  4E3O A;  4E3I A;  3C7U A;  3GTC A;  3UDI A;  3NIA A;  1FCO A;  3P09 A;  1J9M A;  2BLS A;  3NI9 A;  3IHA A;  3QHY A;  5A91 A;  3HLG A;  1K57 C;  5JYO A;  1ALQ A;  4C75 A;  2ZC6 B;  3FV7 A;  4JF4 A;  2XFT A;  4GNU A;  1YLW A;  4MBK A;  3IT9 A;  3IHB A;  4QB8 A;  3V50 A;  4LV1 A;  1JTD A;  3BYD A;  4MEZ A;  3VP2 A;  1IKG A;  1QME A;  1YM1 A;  3AGF A;  4KQO A;  1ERQ A;  1PZP A;  2EXA A;  2QPN A;  5GLB A;  2X01 A;  1GA9 A;  3HLW A;  4Y0U A;  1IYQ A;  4JXV A;  5FQI A;  4DDY A;  3MXS A;  1BLS A;  1MY8 A;  4UA9 A;  3VMA A;  4EWF A;  2R9W A;  3BEB A;  5EOO A;  1KDW A;  4R3J A;  2J7V A;  1HVB A;  2WYX A;  1NRF A;  1W8Q A;  4OQG A;  3Q1F A;  4HBU A;  3O3V A;  5AQ9 A;  2B5R A;  3G2Y A;  4JF5 A;  2EX6 A;  2EFU A;  2XQZ A;  1KGE A;  1GHP A;  5TR7 A;  3GRJ A;  3LCE A;  1ES3 A;  3WRT A;  4OQH A;  1K55 A;  4E3K A;  1U60 A;  3UPP A;  4ID4 A;  5FAQ A;  1E4D A;  2H5S A;  4R4R A;  4S2O A;  1ES2 A;  1KE0 A;  4R23 A;  5A90 A;  5E2F A;  4IBX A;  4WEJ A;  4B4X A;  3IXB A;  4JBF A;  4N92 A;  5F82 A;  2CC1 A;  1SDN A;  3PAE A;  1IEM A;  3LO7 A;  4S2N A;  4UA6 A;  2DCF A;  3ZG7 B;  4A5R A;  1H5X A;  3IF6 A;  2P9V B;  2V20 A;  2ZQ7 A;  3HUO A;  1AXB A;  4U0X A;  1PIO A;  3Q07 A;  5DTS A;  4KZ9 A;  4K0X A;  4OPR A;  1FCM A;  2Y2J A;  2Y2P A;  4PM9 A;  5CGW A;  4ZTK A;  5CER A;  5J8X A;  4HBT A;  3BM6 A;  3V3S A;  4MBH A;  3UY6 A;  4BL2 A;  2PU2 A;  5BOH A;  3C4P A;  4U3T A;  1LI9 A;  1ZG6 A;  4XUX A;  5KSH A;  3IF6 B;  5CED A;  1MBL A;  1NY0 A;  1BLC A;  4N1X A;  4E3L A;  2WKH A;  4Q8I A;  1FOF A;  5L2F A;  4OPZ A;  5FI7 A;  1Q2Q A;  4E3J A;  1C3B A;  3DWK A;  2ZLY A;  5CHU A;  2Y59 A;  3N8L A;  3A3D A;  2Q9N A;  4D2O A;  4LV2 A;  4K0W A;  3MXR A;  3NY4 A;  4S2K A;  2C6W B;  4KZ6 A;  3UE1 A;  3VP1 A;  3IXD A;  3LEZ A;  2XD5 A;  1JVJ A;  4KZA A;  3CZD A;  3TSG A;  4X53 A;  1K25 A;  3W4O A;  3NCK A;  1LLB A;  3MFD A;  5FQK A;  1K54 C;  2HDS A;  3A3I A;  4U0T A;  3SS4 A;  1CK3 A;  1YLZ A;  4OON A;  1S6R A;  4DRT A;  2XLN A;  4P6B A;  4KZ5 A;  5AQ7 A;  1Z6F A;  5KZH A;  2A49 A;  2JE5 A;  5CGS A;  3M6H A;  4PMA A;  1BTL A;  1MWU A;  2HDQ A;  1E25 A;  1RGZ A;  4N1H A;  5E2H A;  1DJA A;  1SCW A;  3RJU A;  5A92 A;  5CTN A;  4BQM A;  4EBN A;  2GDN A;  2V2F F;  1IYS A;  4S2J A;  3WS1 A;  1K6S A;  2ZQD A;  3MZE A;  4KEN B;  4WYY A;  2XEP A;  3EQV A;  4X55 A;  1K4F A;  1YLT A;  4OPY A;  5DF7 A;  5GL9 A;  3RXW A;  1RCJ A;  1ONG A;  4Y0O A;  1ERM A;  3O86 A;  1IEL A;  5U47 A;  4P87 A;  1ZG4 A;  3CJM A;  1WE4 A;  5EE8 A;  5HAQ A;  2ZM2 A;  4WEK A;  5F1G A;  4QY6 A;  4DKI A;  2WKE A;  2HP9 A;  5HX9 A;  1BLP A;  4DE1 A;  4KG5 A;  3FKW A;  5CHJ A;  4CPK A;  2OLU A;  4KZB A;  1ESU A;  5F83 A;  4WMC A;  4ZJ3 A;  4N9L A;  1DJC A;  1L2S A;  2J9O A;  5GHY A;  1ES4 A;  4WZ4 A;  3PAG A;  4P85 A;  1TVF A;  4XXR A;  1ONH A;  4OPQ A;  2HPB A;  1EWZ A;  4QU3 A;  1ERO A;  5DF9 A;  5G18 A;  4E6X A;  1IYP A;  3HL9 A;  3HLF A;  4XUZ A;  1I5Q A;  1MKI A;  4EBL A;  3ZHH A;  3UPO A;  2WK0 A;  2ZQC A;  1N9B A;  4MNR A;  4OLD A;  4YIN A;  1L0G A;  4KG6 A;  3P98 A;  4R0Q A;  5HAI A;  3NDG A;  2WGI A;  2P9V A;  4S2M A;  5FA7 A;  5FQJ A;  3SOI A;  3AGE A;  1GA0 A;  4HES A;  5CXW A;  3FYZ A;  1GHM A;  3A3F A;  4IVK A;  3GV9 A;  5GLA A;  3G32 A;  3VP3 A;  5M18 A;  3WS2 A;  2OLV A;  3DTM A;  1ESI A;  3HUN A;  2XF3 A;  2ZC3 B;  1KGF A;  3GVB A;  3WS5 A;  4KQR A;  5EVI B;  3ITB A;  3OPL A;  3PBO A;  1WYC A;  2XGN A;  2Y2Q A;  3MBZ A;  5HAR A;  2OV5 A;  4OP5 A; 
#chains in the Genus database with same CATH topology
 3N4I A;  4X69 A;  1MPL A;  4EU0 A;  1YQS A;  3T4L A;  4N9K A;  3F1O B;  4YNR A;  5D3O A;  3SS5 A;  4BJP A;  1CI9 A;  3L7H A;  2ZM0 A;  3Q7V B;  4Q0H A;  4E6W A;  2AVX A;  3BFG A;  3SH9 A;  2G2W A;  2JCH A;  4L0L A;  4KUK A;  4OOY A;  4DF6 A;  4I39 A;  1YLJ A;  1NLZ A;  5J4E A;  4E04 A;  4KZ7 A;  2HJ9 C;  3HBR A;  3LFV A;  2J3T D;  4D60 A;  2O0Y A;  1DP9 A;  2Y4A A;  3CIT A;  1XJ4 A;  3FZC A;  3V3R A;  3IXH A;  4Q0J A;  4I5S A;  2L0W A;  1YSP A;  1TS6 A;  2HGV A;  1V9Y A;  2G7U A;  2PD7 A;  3S1Y A;  1J3W A;  5HAP A;  2PBY A;  3M6B A;  2VEA A;  3NDE A;  4XT2 A;  3OPP A;  2HZ5 A;  2QKP A;  2W3D A;  2ZMF A;  4C6Y A;  4WMC D;  3PR6 A;  2EX8 A;  2FZ0 A;  4HJ6 A;  3SS3 A;  3TE8 A;  3KYQ A;  4WZ5 C;  2ZD8 A;  1MWT A;  3TOI A;  4QHC A;  4WM9 A;  3IX8 A;  3H7W A;  5MC7 A;  5EEC A;  2JKT M;  1SHV A;  3O5Y A;  4ZAM A;  2HF6 A;  2WAD A;  4B88 A;  4O01 A;  1RGY A;  1LL9 A;  3VSL A;  3CPT A;  2Y55 A;  3FKV A;  1NYY A;  4OQI A;  2GZA A;  4RQ9 A;  2VJW A;  3MKE A;  3T1R A;  1WYB A;  3UDF A;  4K08 A;  5E43 A;  1KE3 A;  4WUJ A;  1OTI A;  4PM5 A;  3ITA A;  3BWL A;  3IWQ A;  2ZMV A;  4FOF A;  3QNB A;  2R9X A;  4O8G A;  3A0S A;  5CTM A;  1FR1 A;  3MZD A;  2V0W A;  3C4O A;  5E2G A;  2OOL A;  4HEF A;  1XGJ A;  3IS2 B;  5IHV A;  5KSC A;  1S1Y A;  4S2L A;  3FPV A;  1IYO A;  3KO6 A;  2V1B A;  3CAX A;  3DW0 A;  2V8F A;  1MWR A;  2Y2I A;  2DRW A;  1JWV A;  4GLQ A;  3EWK A;  1S67 L;  3GR2 A;  1PRQ A;  4LLO B;  1KDS A;  2NUT C;  3PBT A;  2HJE A;  3LIB A;  1CEF A;  5HL6 A;  4EES A;  3ZVW A;  1XJ2 A;  4F94 A;  4YFM A;  4OOM A;  2Z2M B;  3QP6 A;  5FI2 A;  4X6T A;  1KOU A;  4QY5 A;  5GHX A;  5HSQ A;  2ZL1 A;  4RA7 A;  3T4Q A;  5FAS A;  1XFN A;  2Y8H A;  4ARZ A;  4OP8 A;  2ZQA A;  3UB7 A;  2EXB A;  2VGL M;  1NRJ A;  4OLG A;  4I38 A;  4GW9 A;  5F1F A;  4OH0 A;  3OOV A;  3HRE A;  4PM7 A;  4NXG A;  4NK3 A;  4JXW A;  1RP5 A;  1MWS A;  2BG1 A;  2I72 A;  1CF0 A;  4HNB A;  4KZ3 A;  4JGO A;  1MKM A;  1QMF A;  2VK3 A;  3GDI A;  3HCY A;  1TDL A;  1S0W A;  3K2N A;  3S7P A;  3W4Q A;  3FG8 A;  3UN7 A;  2V0U A;  3BFE A;  3F1N B;  2Z6C A;  3ZG0 A;  4GD6 A;  4UAA A;  2WGW B;  4E3I A;  3U2A A;  1FCO A;  3IHA A;  3QHY A;  1K57 C;  1ALQ A;  2XFT A;  4GHI B;  1JTD A;  2JKT I;  3LID A;  4KQO A;  2EXA A;  5J3W A;  4L9E A;  3LR0 A;  4JXV A;  5FQI A;  4DDY A;  3MXS A;  1MY8 A;  2R9W A;  5FDS A;  1Y4O A;  2JKF A;  3O3V A;  5AQ9 A;  2B5R A;  2EX6 A;  2PRF A;  3B33 A;  3E98 A;  1FIL A;  1TD5 A;  5L07 A;  1K55 A;  3UPP A;  5FAQ A;  3IXB A;  2O9C A;  5F82 A;  2D01 A;  1SDN A;  4MN5 A;  5FEF A;  2ZQ7 A;  3LGO A;  4U0X A;  5DTS A;  1PIO A;  2XSS A;  4OPR A;  1T18 A;  3OLO A;  4H6J B;  4ZTK A;  1SKO B;  3BM6 A;  3UY6 A;  1DP8 A;  5BOH A;  1LI9 A;  1OT6 A;  1NWZ A;  3MFX A;  1MBL A;  4AFI A;  1NY0 A;  5CED A;  1Q2Q A;  2ZLY A;  5CHU A;  2Y59 A;  4BMW A;  4D2O A;  4K0W A;  3MXR A;  2W3E A;  3LIE A;  3LEZ A;  3CZD A;  3TSG A;  1K25 A;  3NCK A;  3A3I A;  1CK3 A;  1YLZ A;  2Q0O A;  4DRT A;  3FC7 A;  3DTE A;  1EW0 A;  5E2H A;  5A92 A;  2YKF A;  2XRO A;  2GDN A;  1OPX A;  4R38 A;  2W3G A;  3E4O A;  5HDC A;  4Y0O A;  1ONG A;  5EFW A;  4PAU A;  3CJM A;  1W63 M;  2YKH A;  5HAQ A;  3S7O A;  2P08 A;  4DKI A;  2WKQ A;  4GHI A;  4KG5 A;  2OLU A;  3P01 A;  4KZB A;  1ESU A;  1ODV A;  1IOU A;  3NOT C;  4ZJ3 A;  4N9L A;  1ES4 A;  3MF0 A;  1XJ6 A;  3PAG A;  1ONH A;  4OPQ A;  2HPB A;  1ERO A;  3DBA A;  5G18 A;  3B47 A;  3UPO A;  2WK0 A;  1N9B A;  2FH5 A;  3NDG A;  4MDZ A;  4PKY G;  5FA7 A;  3AGE A;  3FYZ A;  4IVK A;  1TF1 A;  3G32 A;  3P7N A;  4LRZ E;  2XF3 A;  2ZC3 B;  3NHQ A;  2XRN A;  1WYC A;  1OTB A;  2PBD P;  3LYX A;  2OAP 1;  2OAQ 1;  2WGW A;  3N8R A;  3O88 A;  2C5W B;  4ETX A;  3VSK A;  3Q81 A;  2PYR A;  2EWV A;  3CI6 A;  1O07 A;  2X71 A;  4GZB A;  1SDE A;  3QP2 A;  2WAE A;  1HTZ A;  1YLY A;  2XDM A;  2J3T C;  2X02 A;  4MN6 A;  4R6L A;  2EX2 A;  4GB7 A;  3PXP A;  1XXM A;  2ZC7 A;  2Y2N A;  3UE6 A;  4CJN A;  3V39 A;  5AVE A;  1XA1 A;  3H9W A;  1DY6 A;  4B9O A;  1PYY A;  3IH8 A;  2R78 A;  3H82 B;  1SKO A;  4BL3 A;  3MQQ A;  3FWL A;  3KX0 X;  1Y54 A;  1P9W A;  3MJQ A;  3OBF A;  4HP9 A;  1YMX A;  1ES5 A;  1M6K A;  2M7U A;  1EI5 A;  3EOI A;  5FQQ A;  3M2J A;  2Z2L B;  5F5Y A;  4KQD A;  4G3V A;  1WA9 A;  4ME4 A;  4CLC D;  3C8C A;  3GMW A;  3WWX A;  2JHE A;  3IH9 A;  3UNW A;  1NJ4 A;  1Q2P A;  3OZH A;  3T4T A;  5CRF A;  3UB5 P;  5G4Y A;  4HJ3 A;  4GOG A;  1YT4 A;  5GHZ A;  1IKI A;  5FAT A;  1K54 A;  1HD8 A;  2M7V A;  3UDX A;  4EUZ A;  3SH7 A;  1CEG A;  2Y91 A;  3LR4 A;  2ZJ9 A;  2JBF A;  1SKF A;  4LGW A;  3HVF A;  5M1A A;  2E8J A;  1PWD A;  3GSG A;  1ACF A;  2G2U A;  1BT5 A;  3HUM A;  3A3E A;  4NET A;  5AQB A;  3ZNY A;  4FH2 A;  4JPM A;  2H10 A;  4NKP A;  4PHT A;  5F68 A;  3LI9 A;  2JKG A;  1K56 D;  2P74 A;  3UO9 A;  1K6R A;  1MC0 A;  5TBM B;  4IBR A;  3RXX A;  4BD1 A;  3R4K A;  3UB8 A;  3S4X A;  4BLM A;  3QP5 A;  3G35 A;  4KQQ A;  1DJB A;  3M2K A;  1VM1 A;  3T50 A;  1XPB A;  3RTY A;  1BSG A;  1H8Y A;  2INW A;  2QJ7 A;  4FCF A;  2RCX A;  1VQQ A;  3N7W A;  2ZC5 B;  4H8R A;  1IFQ A;  4RX2 A;  3E2L A;  5FQ9 A;  5HW3 A;  3DAV A;  2HP5 A;  3HLE A;  2PU4 A;  4KZ8 A;  4HQA A;  1F9I A;  3MR0 A;  2WKP A;  3N6I A;  3G30 A;  3IQA A;  3MQ0 A;  3IBJ A;  1VB6 A;  1FCN A;  1G68 A;  3U4L P;  2H0Y A;  5FSR A;  2GJ3 A;  2IA2 A;  4G3W A;  3NC8 A;  1O7E A;  3W4P A;  3V67 A;  1JTG A;  2O9B A;  4EBP A;  5I5L A;  1KE4 A;  2WKR A;  4FSF A;  4CLC A;  3G34 A;  3KSH A;  4Y7P A;  2Y2G A;  4LFU A;  1TEM A;  1NZO A;  5TJJ A;  3VP4 A;  1FQG A;  2W3H A;  3H82 A;  4MLL A;  3DTI A;  4F3L A;  3SZT A;  2H28 A;  4UA7 A;  4P0M A;  1DRM A;  1FIK A;  3D3O A;  3EGD C;  4L9F A;  3PBR A;  4S2P A;  3DTK A;  1I2S A;  3QNC A;  3CWF A;  1K55 C;  1K4E A;  3V5M A;  2P04 A;  1PW1 A;  2Z6D A;  4FD8 A;  4OVD A;  4DDS A;  3EEH A;  1UWP X;  3FPW A;  2HP6 A;  3PBS A;  3T4S A;  5AVF A;  1P0Z A;  3P09 A;  5JYO A;  3NI9 A;  4GJ4 A;  1S4S A;  4JF4 A;  4GNU A;  5K5B A;  3IHB A;  4MEZ A;  4DN0 A;  2KOI A;  3JVU A;  3QP8 A;  5GLB A;  2X01 A;  1GA9 A;  3JVV A;  3VE4 A;  1S1Z A;  3VMA A;  1TS8 A;  2L4R A;  5HD5 A;  4P6Z S;  4R3J A;  2J7V A;  4BBT A;  1W8Q A;  4OQG A;  4DMZ A;  4HBU A;  3JPU A;  4JF5 A;  2EFU A;  2XQZ A;  2VZW A;  3LCE A;  1ES3 A;  1G5U A;  4EQ1 A;  4OQH A;  4E3K A;  1U60 A;  1E4D A;  4S2O A;  3KYE A;  5HDD A;  4BBU A;  1KE0 A;  4R23 A;  4B4X A;  3PAE A;  1S66 L;  2DCF A;  3ZG7 B;  2W1T A;  2P9V B;  2V20 A;  1AXB A;  4K0X A;  2D02 A;  3LEQ A;  2Y2J A;  2Y2P A;  5CER A;  4I3I A;  4YWZ A;  2XA7 M;  2MJ6 A;  4X1L A;  2VV6 A;  2W1T B;  3IF6 B;  5DKL A;  4Q8I A;  2W27 A;  5L2F A;  4OPZ A;  4DJ2 A;  3NY4 A;  3VP1 A;  4KZA A;  5HZH A;  2HV1 A;  1UGU A;  1LLB A;  5FQK A;  2HDS A;  1S6R A;  2ZBB A;  2W0N A;  1TS7 A;  4P6B A;  4KZ5 A;  4HOI A;  2V1A A;  5KZH A;  3M6H A;  3A0V A;  3VOL A;  1G6O A;  4N1H A;  1SCW A;  4IUH A;  4BQM A;  1N9O A;  2V2F F;  4S2J A;  1K6S A;  2Y79 A;  3ZYT A;  1X0O A;  3T12 B;  4KEN B;  4Q0I A;  4X55 A;  5L8M A;  5DF7 A;  5GL9 A;  5U47 A;  5F1G A;  4QY6 A;  2WKE A;  2HP9 A;  4CPK A;  4H6J A;  1DJC A;  1L2S A;  2J9O A;  3KSI A;  3VV4 A;  1STZ A;  4P85 A;  3W2Z A;  5F6A A;  1D1J A;  2BAS A;  1IYP A;  4Y15 A;  3HL9 A;  1T1B A;  1MKI A;  2A24 A;  4R0Q A;  2O9A A;  3MXQ A;  1GA0 A;  5CXW A;  1GHM A;  1G28 A;  1F98 A;  3GV9 A;  2A2L A;  2VLG A;  4Y13 A;  3OPL A;  4OP5 A;  1VEU A;  5E2E A;  3BY8 A;  4IVI A;  4RYE A;  3BFD A;  1GCE A;  4RX3 A;  4CLC B;  4PM8 A;  3N8S A;  1OTD A;  4UHU A;  4Z9Q A;  4S2I A;  2ZQ8 A;  1N4O A;  4IHQ A;  3MKF A;  4O0P A;  1W8Y A;  4Y17 A;  1MXO A;  3ZVT A;  2H0T A;  3S22 A;  4R4S A;  3LR5 A;  1LL5 A;  2J8Y A;  3EEA A;  2QMI A;  1T1C A;  5FI6 A;  3C7V A;  1H8M A;  2LB9 A;  1CI8 A;  3A0R A;  5DTT A;  5EV0 A;  2HDR A;  4JGP A;  5M19 A;  2UWX A;  2OSU A;  3I7J A;  1GSW A;  1XA7 A;  3UPN A;  3HJI A;  5FEG A;  3BEC A;  4IED A;  2Y2K A;  2XFS A;  3HLB A;  3ULF A;  1L0E A;  4S2N C;  4GS9 A;  1BUL A;  1PWC A;  3MZF A;  3IF6 C;  4LV0 A;  3R7W A;  4ESP A;  2VGJ A;  3Q7Z A;  3W8K A;  3TRC A;  1V9Z A;  1ZTU A;  4HH2 A;  5KMW A;  4EW7 A;  2OWJ A;  5FDH A;  1VET B;  2K31 A;  4GCZ A;  3UE0 A;  5EVI A;  3UMD A;  3BJN A;  4G3K A;  2Y2H A;  2A3U A;  3ZG5 A;  2WZZ A;  5HDS A;  1KGG A;  1GHI A;  1NXY A;  4JF6 A;  4RVA A;  3IF5 A;  2XH9 A;  5A8B A;  5AQA A;  4FH4 A;  4Y3I A;  1VEU B;  4HY8 A;  5DJT A;  2IWC A;  3RFB A;  3UB9 A;  1JWZ A;  2FFF B;  4ZDX A;  3SH8 A;  4EEP A;  3NJA A;  2J9P A;  4DJ3 A;  3BRM A;  4DXB A;  3LY4 A;  1S4R A;  3T4O A;  1YKD A;  2J80 A;  1XFQ A;  3CHW P;  4LRY C;  4PM6 A;  3Q82 A;  1PZO A;  2QYB A;  1ZC2 A;  3OCN A;  4E3J A;  5FAP A;  1ZKJ A;  4GDB A;  3ZFZ A;  1K57 A;  3ZNT A;  1H8Z A;  4I3J A;  4II7 A;  1W5D A;  4OQ0 A;  4QD4 A;  1OTE A;  1CQA A;  3IWI A;  1BUE A;  4HIA A;  5DF8 A;  1DP6 A;  2E8I A;  5DVA A;  4DE3 A;  2W1R A;  3LI8 A;  3QP4 A;  5HL1 A;  2PT7 A;  4MBF A;  1OME A;  2O99 A;  1FSY A;  3HJK A;  3NBL A;  4UQI S;  3E4P A;  2EX9 A;  3E4Q A;  3IBR A;  1YAX A;  4WBG A;  4UQI M;  1N9L A;  1JWP A;  2EA9 A;  4X25 A;  3T4K A;  1L3L A;  4BWI A;  3VFH A;  4WLA A;  2EWW A;  1XJ3 A;  3DWZ A;  4KG2 A;  5FQM A;  1G6A A;  2HDU A;  4IUK A;  3D9Y A;  1NLY A;  3G2Z A;  2JC7 A;  3C38 A;  2VGK A;  1E3U D;  4OKP A;  3HLD A;  3BLM A;  1LSW A;  4QJG A;  4GS9 B;  5F69 A;  3IXG A;  2Y2M A;  4PPR A;  3A3J A;  4GKU A;  3OCL A;  1BYW A;  4K91 A;  1YLP A;  4MN7 A;  5G4Z A;  5A93 A;  1JNU A;  2WKI A;  4ZRR A;  3UE3 A;  4E3M A;  1KVL A;  3ISG A;  2FFY A;  3VOZ A;  5DFY A;  5EPH A;  4ZJ1 A;  1LI0 A;  3B3X A;  4JLF A;  1Y28 A;  5GLC A;  3VFF A;  2QZ6 A;  1PI4 A;  4E3O A;  3GTC A;  3UDI A;  3NIA A;  1J9M A;  2BLS A;  1TS0 A;  3MQO A;  2ZC6 B;  3FV7 A;  4JGR A;  1YLW A;  3IT9 A;  4QB8 A;  3BYD A;  3VP2 A;  2LB5 A;  1IKG A;  1QME A;  3AGF A;  1T19 A;  3MMH A;  2QPN A;  1OJ5 A;  3NOU C;  1OJG A;  1IYQ A;  1BLS A;  4ETZ A;  1P97 A;  3BEB A;  5EOO A;  5L09 A;  2WYX A;  1NRF A;  3LIA A;  1KGE A;  1GHP A;  4HJ4 A;  2ZOI A;  5EVE A;  5HWT A;  3WRT A;  2JKR I;  2H5S A;  1ES2 A;  5A90 A;  1AWI A;  5E2F A;  4IBX A;  1K0K A;  4N92 A;  2CC1 A;  4UA6 A;  4S2N A;  2J3W A;  4KZ9 A;  3E0Y A;  4PM9 A;  1VHM A;  5CGW A;  3V3S A;  1OT9 A;  1GSX A;  1ZG6 A;  4XUX A;  1BLC A;  4E3L A;  2QWS A;  4WF0 A;  3A3D A;  2Q9N A;  3NUL A;  4LV2 A;  4S2K A;  2C6W B;  3IXD A;  1Z09 A;  3UME A;  4X53 A;  5DKK A;  3W4O A;  3MFD A;  3CPT B;  1Z6F A;  3NOP C;  2A49 A;  5CGS A;  4PMA A;  1MWU A;  5J7E A;  1E25 A;  1RGZ A;  5CX7 A;  3F1P B;  1DJA A;  3RJU A;  3LIC A;  4F3L B;  2ZQD A;  4WYY A;  2V8C A;  2XEP A;  1K4F A;  3G6O A;  4OPY A;  1ZG4 A;  1WE4 A;  5EE8 A;  2ZM2 A;  5HX9 A;  4XT2 B;  4DE1 A;  2PD8 A;  3MSH A;  5HWV A;  2BTF P;  4Z1W A;  5L10 A;  5F83 A;  5GHY A;  1LT0 A;  4R3A A;  4WZ4 A;  2CMN A;  1TVF A;  4XXR A;  3R7W B;  4B93 A;  1EWZ A;  3PHY A;  4E6X A;  4XUZ A;  1I5Q A;  3F1O A;  3ZHH A;  4CLC C;  4YIN A;  1L0G A;  4KG6 A;  3P98 A;  5HAI A;  2P9V A;  1F5M A;  3SOI A;  1F2K A;  2VV8 A;  4IJG A;  3A3F A;  3T4J A;  2M1C A;  1HLU P;  5GLA A;  3VP3 A;  3WS2 A;  2OLV A;  3DTM A;  1ESI A;  1KGF A;  3GVB A;  3WS5 A;  3BQ8 A;  3NEC A;  3ITB A;  1N9N A;  2OV5 A;  5HAR A;  2XGN A;  2Y2Q A;  3WRZ A;  1D06 A;  3LY3 A;  4HI4 A;  1W7F A;  5CHM A;  1XGI A;  3G31 A;  5C5K A;  3Q7V A;  2V1Z A;  3TG9 A;  3IX3 A;  2KDK A;  3PBQ A;  4NEE D;  5TBM A;  3IX4 A;  4C3Q A;  1L0F A;  1PFL A;  2VKS A;  2ZC4 B;  2Q9M A;  5IT5 A;  4ZBE A;  4E3N A;  5EVI C;  4LPZ A;  3S7N A;  3IWO A;  2XR0 A;  1D7E A;  1FR6 A;  3ZG9 B;  3OPR A;  1TDG A;  4LCL A;  5EVL A;  4HHD A;  2IWD A;  1LL8 A;  1E3U A;  3IS2 A;  2DNS A;  3ICY A;  4QPR A;  2WZX A;  2XA7 S;  1LHY A;  2WGV A;  5HPI A;  1K56 A;  1PI5 A;  3BLS A;  2K2N A;  4GN2 A;  4WN5 A;  3F1N A;  2RL3 A;  1NYM A;  5EVI D;  1LSV A;  2UV0 E;  3O87 A;  2B18 A;  2W3F A;  1K38 A;  4DE0 A;  1A0K A;  5DTK A;  3WS0 A;  5JYP A;  2PR6 A;  3KSG A;  3TJZ C;  1L0D A;  3VE3 A;  4LEN A;  4WZ5 A;  4MCW A;  3OPH A;  4X68 A;  4GDN A;  3T1X A;  4DE2 A;  4X56 A;  4LCM A;  3JYI A;  4P6Z M;  3D4F A;  3LUQ A;  2QHK A;  4JXS A;  5DFX A;  3ZGA B;  3ZG8 B;  3AGD A;  4B4Z A;  4FTX A;  3G4P A;  2B02 A;  2PAV P;  2IWB A;  3EQU A;  3BFF A;  2WUQ A;  3BFC A;  2B95 A;  1FSW A;  4JKT A;  4X1M A;  4LV3 A;  4WEL A;  1HZO A;  3OC2 A;  4EET B;  5GLD A;  1I2W A;  4FUW A;  2NUP C;  1NZU A;  4DXC A;  5FAO A;  3RH8 B;  5HWW A;  1XP4 A;  4Y0T A;  3GEC A;  2Y2L A;  4R1G A;  5HFO A;  1PW8 A;  4ZJ2 A;  2ZL1 B;  1OTA A;  2XK1 A;  1VET A;  4ARZ B;  2EFX A;  4LRX C;  2PYP A;  3PBN A;  3CMZ A;  1PWG A;  1KVM A;  2ZQ9 A;  5CGX A;  4KUO A;  4Y2F A;  3ZCZ A;  2WAF A;  4NXB A;  2PDR A;  3EGX C;  4NXE A;  5CEB A;  2Y2O A;  2PHY A;  4BEN A;  3B42 A;  3T1S A;  2KLI A;  3PTE A;  4OOL A;  4GD8 A;  2VV7 A;  2K7S A;  4EUV A;  1XX2 A;  3WS4 A;  3VP0 A;  1CJF A;  1W79 A;  5I94 A;  4BD0 A;  2I9V A;  5HPF A;  5EM1 A;  3VOY A;  1BZA A;  1BLH A;  2ZM8 A;  3GQZ A;  4O7D A;  3ZQ5 A;  3KYZ A;  5EUA A;  3KSF A;  4BBV A;  5TFQ A;  1GSV A;  4KZ4 A;  3MS6 A;  4R3B A;  4M3K A;  2ZMA A;  1ZHH B;  3S7Q A;  1PNE A;  5TGF A;  3CG5 A;  2L1M A;  3BW6 A;  5EOE A;  5IU1 A;  4JXG A;  3ZDJ A;  2GNX A;  5CEC A;  2XD1 A;  4EV4 A;  3BQA A;  3C5A A;  4EQI A;  1XKZ A;  3E2K A;  3HLC A;  1M40 A;  3L9K A;  1YMS A;  5LBR A;  3C7U A;  5A91 A;  3HLG A;  3H7W B;  4C75 A;  1H0M A;  3K3D A;  4MBK A;  3V50 A;  4LV1 A;  1YM1 A;  2DMW A;  1ERQ A;  1PZP A;  4L9G A;  4R70 A;  3BY9 A;  3HLW A;  4M4X A;  4Y0U A;  4UA9 A;  4EWF A;  2GX5 A;  3T1Q B;  2ZOH A;  1KDW A;  1HVB A;  3Q1F A;  2ACG A;  3G2Y A;  1YPR A;  5TR7 A;  3GRJ A;  4ID4 A;  4R4R A;  4WEJ A;  2JKR M;  4JBF A;  4JGQ A;  4YOF A;  2KX6 A;  4Y5F A;  1IEM A;  3LO7 A;  4QWO A;  4A5R A;  1H5X A;  3IF6 A;  3HUO A;  3LIF A;  2V9A A;  2P7J A;  3Q07 A;  3CUE A;  1FCM A;  3QP1 A;  5J8X A;  4HBT A;  4MBH A;  4BL2 A;  2JN7 A;  2PU2 A;  3PYP A;  1UWN X;  2QJ5 A;  3C4P A;  4U3T A;  4EXO A;  5KSH A;  4N1X A;  2WKH A;  1T1A A;  1FOF A;  5FI7 A;  1C3B A;  3DWK A;  2OWH A;  3N8L A;  1SZV A;  1W63 Q;  4HH3 A;  3K3C A;  5DJU A;  4KZ6 A;  3UE1 A;  5KIZ A;  3F1P A;  2XD5 A;  1JVJ A;  4CLC E;  4WL9 A;  2VA0 A;  3CLO A;  1K54 C;  4UEY A;  4U0T A;  3SS4 A;  4OON A;  5EM0 A;  2XLN A;  3UB6 A;  3C30 A;  5AQ7 A;  4NXF A;  2JE5 A;  1BTL A;  2HDQ A;  5CTN A;  4EBN A;  1IYS A;  3WS1 A;  5HD3 A;  2VX8 A;  3MZE A;  3EQV A;  2A24 B;  1YLT A;  3SW1 A;  4HP4 A;  1RCJ A;  3RXW A;  1ERM A;  3O86 A;  4NG2 A;  1IEL A;  4P87 A;  5FL3 A;  5IS1 A;  4WEK A;  3CUE C;  1BLP A;  3FKW A;  5CHJ A;  4PKY A;  1LSX A;  3D72 A;  4WMC A;  4EEU A;  4QU3 A;  5DF9 A;  1H3Q A;  3HLF A;  3TW8 A;  4EBL A;  2PR5 A;  2ZQC A;  4MNR A;  1P9R A;  4OLD A;  2WGI A;  4S2M A;  3C2W A;  1YSQ A;  5FQJ A;  5AJG A;  4MMN A;  4HES A;  2VGL S;  5M18 A;  1MZU A;  3HUN A;  4KQR A;  4CQH A;  5EVI B;  3PBO A;  4EER A;  3MBZ A;  4I3A A;  3LR3 A; 
#chains in the Genus database with same CATH homology
 3N4I A;  4X69 A;  1MPL A;  5E2E A;  3WRZ A;  4IVI A;  3LY3 A;  4RYE A;  2WGW A;  1W7F A;  1YQS A;  3N8R A;  3O88 A;  5CHM A;  1XGI A;  3BFD A;  1GCE A;  4RX3 A;  2C5W B;  3VSK A;  3G31 A;  3Q7V A;  4N9K A;  3Q81 A;  4PM8 A;  2V1Z A;  3N8S A;  3TG9 A;  3PBQ A;  4UHU A;  1O07 A;  5D3O A;  4Z9Q A;  3SS5 A;  2X71 A;  4GZB A;  1SDE A;  4BJP A;  2WAE A;  4S2I A;  2ZQ8 A;  4C3Q A;  1HTZ A;  1L0F A;  1N4O A;  1YLY A;  3MKF A;  1CI9 A;  2ZM0 A;  1W8Y A;  2ZC4 B;  3Q7V B;  2XDM A;  1MXO A;  4E6W A;  2Q9M A;  2X02 A;  3ZVT A;  3BFG A;  2EX2 A;  3SH9 A;  2G2W A;  2JCH A;  4ZBE A;  4E3N A;  5EVI C;  4L0L A;  2H0T A;  4GB7 A;  1XXM A;  3S22 A;  2ZC7 A;  2Y2N A;  3IWO A;  4CJN A;  4R4S A;  3V39 A;  4OOY A;  1XA1 A;  4DF6 A;  1LL5 A;  2XR0 A;  1DY6 A;  2J8Y A;  1PYY A;  2QMI A;  3IH8 A;  1YLJ A;  5FI6 A;  3C7V A;  1FR6 A;  4KZ7 A;  4BL3 A;  3ZG9 B;  3OPR A;  1TDG A;  1CI8 A;  3FWL A;  3HBR A;  4LCL A;  5EVL A;  1Y54 A;  5DTT A;  2IWD A;  1YMX A;  1ES5 A;  1M6K A;  2Y4A A;  1E3U A;  2DNS A;  1EI5 A;  2HDR A;  3FZC A;  5FQQ A;  5M19 A;  3V3R A;  2UWX A;  2OSU A;  3I7J A;  2WZX A;  3IXH A;  1XA7 A;  1LHY A;  3M2J A;  2Z2L B;  2WGV A;  3UPN A;  1K56 A;  1PI5 A;  3BLS A;  4GN2 A;  3GMW A;  3S1Y A;  3WWX A;  3BEC A;  4IED A;  3IH9 A;  5HAP A;  2PBY A;  3M6B A;  2RL3 A;  3UNW A;  1NYM A;  5EVI D;  3NDE A;  3O87 A;  1NJ4 A;  1Q2P A;  2Y2K A;  3OPP A;  1K38 A;  2XFS A;  3HLB A;  3OZH A;  5CRF A;  4DE0 A;  1L0E A;  5DTK A;  4C6Y A;  4S2N C;  3WS0 A;  1BUL A;  1PWC A;  5JYP A;  4WMC D;  3MZF A;  4GOG A;  3IF6 C;  1YT4 A;  2EX8 A;  4LV0 A;  1L0D A;  1IKI A;  5GHZ A;  3SS3 A;  5FAT A;  4LEN A;  2VGJ A;  3Q7Z A;  1K54 A;  1HD8 A;  3W8K A;  3UDX A;  4WZ5 A;  4EUZ A;  3OPH A;  4WZ5 C;  2ZD8 A;  1MWT A;  3SH7 A;  1CEG A;  2Y91 A;  5KMW A;  2ZJ9 A;  2JBF A;  1SKF A;  4X68 A;  4GDN A;  3TOI A;  4QHC A;  3HVF A;  4WM9 A;  5FDH A;  4X56 A;  3UE0 A;  5EVI A;  4LCM A;  3JYI A;  4DE2 A;  3D4F A;  5EEC A;  1SHV A;  2Y2H A;  2A3U A;  3ZG5 A;  4ZAM A;  3ZGA B;  4JXS A;  5M1A A;  2WAD A;  4B88 A;  1RGY A;  3ZG8 B;  1LL9 A;  3AGD A;  1PWD A;  2WZZ A;  3VSL A;  3GSG A;  2Y55 A;  4B4Z A;  2G2U A;  3G4P A;  1KGG A;  1NYY A;  1BT5 A;  3FKV A;  1GHI A;  1NXY A;  4OQI A;  4JF6 A;  4RVA A;  3HUM A;  3A3E A;  2XH9 A;  3IF5 A;  4NET A;  5AQB A;  3ZNY A;  5AQA A;  4FH4 A;  2IWB A;  4FH2 A;  4JPM A;  3EQU A;  3MKE A;  2H10 A;  3BFF A;  2WUQ A;  1WYB A;  3UDF A;  3BFC A;  2IWC A;  5E43 A;  1KE3 A;  1FSW A;  4JKT A;  4PM5 A;  4LV3 A;  4WEL A;  1HZO A;  1JWZ A;  3ITA A;  2FFF B;  3IWQ A;  3OC2 A;  4ZDX A;  1K56 D;  3QNB A;  2P74 A;  3UO9 A;  1K6R A;  5GLD A;  1I2W A;  3SH8 A;  4IBR A;  1NZU A;  2R9X A;  3RXX A;  4BD1 A;  5CTM A;  1FR1 A;  3MZD A;  3S4X A;  4BLM A;  4DXC A;  3C4O A;  2J9P A;  3G35 A;  5E2G A;  4KQQ A;  5FAO A;  1DJB A;  3BRM A;  4DXB A;  3LY4 A;  3M2K A;  4HEF A;  1XP4 A;  1VM1 A;  1XGJ A;  5IHV A;  1XPB A;  4Y0T A;  4PM6 A;  5KSC A;  1BSG A;  1H8Y A;  2Y2L A;  3Q82 A;  4S2L A;  1PZO A;  1IYO A;  4FCF A;  2RCX A;  4R1G A;  3DW0 A;  1VQQ A;  1PW8 A;  5HFO A;  4ZJ2 A;  3N7W A;  1ZC2 A;  2ZC5 B;  1MWR A;  3OCN A;  2Y2I A;  1ZKJ A;  2DRW A;  4GDB A;  4H8R A;  5FAP A;  1JWV A;  3ZFZ A;  4RX2 A;  2XK1 A;  3E2L A;  5FQ9 A;  5HW3 A;  1K57 A;  3ZNT A;  1H8Z A;  2EFX A;  3GR2 A;  2HP5 A;  1KDS A;  3PBN A;  3CMZ A;  1PWG A;  3HLE A;  1KVM A;  1W5D A;  2PU4 A;  2ZQ9 A;  4KZ8 A;  4OQ0 A;  4QD4 A;  5CGX A;  3PBT A;  1CEF A;  3N6I A;  3ZCZ A;  3IWI A;  1BUE A;  2WAF A;  3G30 A;  5DF8 A;  3IQA A;  2E8I A;  3ZVW A;  5DVA A;  4DE3 A;  4F94 A;  4YFM A;  1FCN A;  5CEB A;  2Y2O A;  4OOM A;  5HL1 A;  1G68 A;  4MBF A;  4BEN A;  2H0Y A;  2Z2M B;  1OME A;  5FI2 A;  4X6T A;  5FSR A;  1FSY A;  3PTE A;  3NBL A;  4OOL A;  4QY5 A;  5GHX A;  2EX9 A;  3NC8 A;  4GD8 A;  1O7E A;  4WBG A;  3W4P A;  4RA7 A;  1JWP A;  5FAS A;  1XX2 A;  1JTG A;  3WS4 A;  3VP0 A;  1W79 A;  5I94 A;  4OP8 A;  2ZQA A;  4BD0 A;  2EXB A;  3VFH A;  3VOY A;  1BZA A;  1BLH A;  4EBP A;  2ZM8 A;  3DWZ A;  4KG2 A;  1KE4 A;  3GQZ A;  4OLG A;  4FSF A;  4O7D A;  3G34 A;  5FQM A;  1G6A A;  5F1F A;  4OH0 A;  4Y7P A;  5EUA A;  2Y2G A;  1TEM A;  1NZO A;  2HDU A;  3HRE A;  5TFQ A;  3VP4 A;  1FQG A;  4KZ4 A;  4PM7 A;  4MLL A;  3G2Z A;  2JC7 A;  4R3B A;  4M3K A;  4NK3 A;  2ZMA A;  2VGK A;  1E3U D;  4OKP A;  3HLD A;  4P0M A;  4UA7 A;  3BLM A;  4JXW A;  1RP5 A;  1MWS A;  2BG1 A;  3CG5 A;  5EOE A;  5TGF A;  4QJG A;  2I72 A;  3PBR A;  3IXG A;  4S2P A;  2Y2M A;  4KZ3 A;  1I2S A;  3QNC A;  1QMF A;  4JXG A;  1K55 C;  4PPR A;  3ZDJ A;  1TDL A;  1K4E A;  1S0W A;  3A3J A;  4GKU A;  3OCL A;  3V5M A;  1PW1 A;  1YLP A;  4K91 A;  5A93 A;  2WKI A;  5CEC A;  2XD1 A;  3W4Q A;  4FD8 A;  3UE3 A;  4OVD A;  4E3M A;  4EV4 A;  4DDS A;  3C5A A;  3UN7 A;  3BFE A;  1KVL A;  3ISG A;  4EQI A;  1XKZ A;  3E2K A;  2FFY A;  3VOZ A;  2HP6 A;  3HLC A;  1M40 A;  3PBS A;  5EPH A;  4ZJ1 A;  3ZG0 A;  1LI0 A;  3B3X A;  4GD6 A;  2WGW B;  4JLF A;  4UAA A;  5GLC A;  1YMS A;  3VFF A;  2QZ6 A;  1PI4 A;  4E3O A;  4E3I A;  3C7U A;  3GTC A;  3UDI A;  3NIA A;  1FCO A;  3P09 A;  1J9M A;  2BLS A;  3NI9 A;  3IHA A;  3QHY A;  5A91 A;  3HLG A;  1K57 C;  5JYO A;  1ALQ A;  4C75 A;  2ZC6 B;  3FV7 A;  4JF4 A;  2XFT A;  4GNU A;  1YLW A;  4MBK A;  3IT9 A;  3IHB A;  4QB8 A;  3V50 A;  4LV1 A;  1JTD A;  3BYD A;  4MEZ A;  3VP2 A;  1IKG A;  1QME A;  1YM1 A;  3AGF A;  4KQO A;  1ERQ A;  1PZP A;  2EXA A;  2QPN A;  5GLB A;  2X01 A;  1GA9 A;  3HLW A;  4Y0U A;  1IYQ A;  4JXV A;  5FQI A;  4DDY A;  3MXS A;  1BLS A;  1MY8 A;  4UA9 A;  3VMA A;  4EWF A;  2R9W A;  3BEB A;  5EOO A;  1KDW A;  4R3J A;  2J7V A;  1HVB A;  2WYX A;  1NRF A;  1W8Q A;  4OQG A;  3Q1F A;  4HBU A;  3O3V A;  5AQ9 A;  2B5R A;  3G2Y A;  4JF5 A;  2EX6 A;  2EFU A;  2XQZ A;  1KGE A;  1GHP A;  5TR7 A;  3GRJ A;  3LCE A;  1ES3 A;  3WRT A;  4OQH A;  1K55 A;  4E3K A;  1U60 A;  3UPP A;  4ID4 A;  5FAQ A;  1E4D A;  2H5S A;  4R4R A;  4S2O A;  1ES2 A;  1KE0 A;  4R23 A;  5A90 A;  5E2F A;  4IBX A;  4WEJ A;  4B4X A;  3IXB A;  4JBF A;  4N92 A;  5F82 A;  2CC1 A;  1SDN A;  3PAE A;  1IEM A;  3LO7 A;  4S2N A;  4UA6 A;  2DCF A;  3ZG7 B;  4A5R A;  1H5X A;  3IF6 A;  2P9V B;  2V20 A;  2ZQ7 A;  3HUO A;  1AXB A;  4U0X A;  1PIO A;  3Q07 A;  5DTS A;  4KZ9 A;  4K0X A;  4OPR A;  1FCM A;  2Y2J A;  2Y2P A;  4PM9 A;  5CGW A;  4ZTK A;  5CER A;  5J8X A;  4HBT A;  3BM6 A;  3V3S A;  4MBH A;  3UY6 A;  4BL2 A;  2PU2 A;  5BOH A;  3C4P A;  4U3T A;  1LI9 A;  1ZG6 A;  4XUX A;  5KSH A;  3IF6 B;  5CED A;  1MBL A;  1NY0 A;  1BLC A;  4N1X A;  4E3L A;  2WKH A;  4Q8I A;  1FOF A;  5L2F A;  4OPZ A;  5FI7 A;  1Q2Q A;  4E3J A;  1C3B A;  3DWK A;  2ZLY A;  5CHU A;  2Y59 A;  3N8L A;  3A3D A;  2Q9N A;  4D2O A;  4LV2 A;  4K0W A;  3MXR A;  3NY4 A;  4S2K A;  2C6W B;  4KZ6 A;  3UE1 A;  3VP1 A;  3IXD A;  3LEZ A;  2XD5 A;  1JVJ A;  4KZA A;  3CZD A;  3TSG A;  4X53 A;  1K25 A;  3W4O A;  3NCK A;  1LLB A;  3MFD A;  5FQK A;  1K54 C;  2HDS A;  3A3I A;  4U0T A;  3SS4 A;  1CK3 A;  1YLZ A;  4OON A;  1S6R A;  4DRT A;  2XLN A;  4P6B A;  4KZ5 A;  5AQ7 A;  1Z6F A;  5KZH A;  2A49 A;  2JE5 A;  5CGS A;  3M6H A;  4PMA A;  1BTL A;  1MWU A;  2HDQ A;  1E25 A;  1RGZ A;  4N1H A;  5E2H A;  1DJA A;  1SCW A;  3RJU A;  5A92 A;  5CTN A;  4BQM A;  4EBN A;  2GDN A;  2V2F F;  1IYS A;  4S2J A;  3WS1 A;  1K6S A;  2ZQD A;  3MZE A;  4KEN B;  4WYY A;  2XEP A;  3EQV A;  4X55 A;  1K4F A;  1YLT A;  4OPY A;  5DF7 A;  5GL9 A;  3RXW A;  1RCJ A;  1ONG A;  4Y0O A;  1ERM A;  3O86 A;  1IEL A;  5U47 A;  4P87 A;  1ZG4 A;  3CJM A;  1WE4 A;  5EE8 A;  5HAQ A;  2ZM2 A;  4WEK A;  5F1G A;  4QY6 A;  4DKI A;  2WKE A;  2HP9 A;  5HX9 A;  1BLP A;  4DE1 A;  4KG5 A;  3FKW A;  5CHJ A;  4CPK A;  2OLU A;  4KZB A;  1ESU A;  5F83 A;  4WMC A;  4ZJ3 A;  4N9L A;  1DJC A;  1L2S A;  2J9O A;  5GHY A;  1ES4 A;  4WZ4 A;  3PAG A;  4P85 A;  1TVF A;  4XXR A;  1ONH A;  4OPQ A;  2HPB A;  1EWZ A;  4QU3 A;  1ERO A;  5DF9 A;  5G18 A;  4E6X A;  1IYP A;  3HL9 A;  3HLF A;  4XUZ A;  1I5Q A;  1MKI A;  4EBL A;  3ZHH A;  3UPO A;  2WK0 A;  2ZQC A;  1N9B A;  4MNR A;  4OLD A;  4YIN A;  1L0G A;  4KG6 A;  3P98 A;  4R0Q A;  5HAI A;  3NDG A;  2WGI A;  2P9V A;  4S2M A;  5FA7 A;  5FQJ A;  3SOI A;  3AGE A;  1GA0 A;  4HES A;  5CXW A;  3FYZ A;  1GHM A;  3A3F A;  4IVK A;  3GV9 A;  5GLA A;  3G32 A;  3VP3 A;  5M18 A;  3WS2 A;  2OLV A;  3DTM A;  1ESI A;  3HUN A;  2XF3 A;  2ZC3 B;  1KGF A;  3GVB A;  3WS5 A;  4KQR A;  5EVI B;  3ITB A;  3OPL A;  3PBO A;  1WYC A;  2XGN A;  2Y2Q A;  3MBZ A;  5HAR A;  2OV5 A;  4OP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...