5FQIA

W229d and f290w mutant of the last common ancestor of gram-negative bacteria (gnca4) beta-lactamase class a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
ALSEQLAELEKRSGGRLGVAVLDTATGRRFGYRGDERFPMCSTFKALLAAAVLARVDQGKENLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITYSDNTAANLLLEALGGPAALTAFLRSIGDNVTRLDRWEPELNTAAPGDPRDTTTPAAMAATLRTLLLGDVLSPASRQQLVDWLIANKTGDKRLRAGLPADDRVGDKTGTGEHGTTNDIAVIWPPNRAPILVAVYLTESQVDADARDAVIAEVARLVVAAWHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNCA4 LACTAMASE W229D AND F290W
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 100
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqiA00
1K38A 5F1FA 3ZG7B 4C75A 4KZBA 2X71A 1WYCA 1XP4A 4OH0A 1GHPA 4RYEA 1WE4A 3VSLA 3SH7A 5FAPA 3UO9A 5E43A 4R3BA 5J8XA 3W8KA 1LLBA 1KGGA 1XPBA 2QPNA 3IF6A 2HPBA 4P87A 1NY0A 3GMWA 1H5XA 4PM7A 1XXMA 4OLGA 4MLLA 1MWSA 3D4FA 1IELA 1FCMA 1JVJA 2H5SA 2J7VA 4WYYA 3W4PA 3WS2A 4E3MA 1ZG4A 1MXOA 2Y55A 2WAFA 2Y2QA 3Q81A 3ZNTA 4KZ9A 1CI9A 3VMAA 3BFCA 3HUNA 3A3JA 4S2OA 3RXWA 4KZ6A 4UA7A 3ZFZA 4R0QA 3NCKA 2EX8A 2IWBA 3VOYA 1SHVA 4R1GA 4XUXA 4D2OA 3DW0A 4ZJ2A 2ZQ7A 4HEFA 4WMCA 4B4ZA 1YMSA 2XLNA 5GLDA 5FA7A 1DJBA 4R23A 4M3KA 3TOIA 2XF3A 2WAEA 5DF9A 1SCWA 2P74A 5CGWA 5F1GA 3WRZA 1L0FA 5KMWA 4KG2A 1KVMA 3HVFA 4BL3A 2EX6A 1MKIA 1LI0A 1YMXA 4KZ7A 5EVIB 1QMEA 2Y91A 3PAGA 3VP4A 1ES4A 1BUEA 4JXSA 2WGVA 4Z9QA 4KQRA 1K56D 3G35A 3IXGA 5EUAA 3BFFA 3MXSA 4GB7A 1PW1A 2EFUA 2G2WA 3A3FA 3RJUA 1LI9A 1Y54A 5FQIA 3OPRA 5FQMA 1FSYA 5E2FA 1GA0A 3BLMA 1I2WA 5GL9A 2X01A 4U0TA 4KZ4A 3VP2A 4Y0UA 4DE3A 3BYDA 5A92A 1AXBA 2XFSA 1ZKJA 3AGDA 3Q7ZA 4QD4A 1XX2A 4OP8A 5A93A 1NYMA 2WKEA 1BLCA 3HL9A 5FATA 4A5RA 5EVIA 2B5RA 4IVIA 3Q7VA 3G34A 3NI9A 5L2FA 1K57A 2A49A 1M40A 1HVBA 5CGSA 1BZAA 3ZG0A 2R9XA 4EWFA 5TFQA 2FFYA 1ES5A 2PBYA 2ZM8A 2Y2HA 1TEMA 3WRTA 3IXDA 2G2UA 1Z6FA 1K54A 1KDSA 1IYSA 2WADA 4P6BA 5EVIC 4E3IA 4PM5A 3W4QA 3ZG8B 3C7VA 1K57C 4OQIA 4R4RA 2WKHA 5HW3A 1K25A 4BD1A 5GLBA 4GKUA 4OONA 1KE0A 2GDNA 1XGIA 3FV7A 3N8LA 4MEZA 4WELA 3ZDJA 1BULA 4R3JA 1K54C 4X55A 1PZPA 1ZC2A 3O3VA 3HUMA 4KENB 3VFHA 1S0WA 3HLBA 2RCXA 1XKZA 1W5DA 4WZ4A 3P98A 2XQZA 2QMIA 1JWPA 4LCLA 3HLWA 1FQGA 1VM1A 2DNSA 3IF5A 2XR0A 5GHXA 4FCFA 4R4SA 3GR2A 4JF6A 1MBLA 4XUZA 2EFXA 3HLEA 4BQMA 3NBLA 3OZHA 2H0TA 3UDFA 1ESUA 3JYIA 2P9VA 3V3SA 1E3UA 4HESA 1IYOA 3GTCA 3MKEA 4U3TA 3GSGA 5CEDA 3VFFA 3LY4A 3LY3A 3B3XA 2ZLYA 2JBFA 4ZJ1A 1JWZA 1FR6A 3HLFA 4KG6A 1IKIA 1GA9A 1WYBA 1MY8A 3N6IA 3RXXA 2Z2LB 5D3OA 2OLUA 5EVLA 5DTKA 1NRFA 5EOEA 3ZG9B 5CEBA 4LENA 4O7DA 2RL3A 4YINA 5GHYA 1ES2A 4PM6A 4GD8A 4CPKA 3QHYA 4GDBA 3VP0A 1GHIA 3G2ZA 3WS0A 2I72A 2WGIA 1RCJA 3EQVA 3V5MA 2VGJA 4ID4A 3DTMA 3OPPA 1MWTA 3V39A 1MPLA 4EBLA 2HP5A 3IXBA 3A3EA 2BG1A 4FSFA 4S2JA 1JTGA 4RVAA 4UAAA 1KE4A 4BLMA 2H10A 2ZC6B 4ZBEA 3I7JA 1Q2PA 3QNCA 3UE3A 4FH2A 4KZ3A 3PBSA 3HLDA 1RGYA 2XEPA 3GVBA 2QZ6A 3FYZA 5AQ9A 3WWXA 1ALQA 4KG5A 4ZDXA 2IWCA 2Y2OA 1IYPA 5DVAA 2V20A 1CEGA 3MKFA 4EBPA 4DE0A 5M1AA 3MBZA 2ZQCA 3A3IA 1SDEA 3ZVTA 3QNBA 1RP5A 1L2SA 3LCEA 3SS3A 1CI8A 3BEBA 4Y0TA 5KSCA 1PI4A 5CXWA 1MWUA 4GOGA 1IEMA 1KGEA 2ZMAA 3AGEA 4ZAMA 5F82A 3ZCZA 2EX2A 1NZOA 1GHMA 4JXGA 5G18A 3SOIA 3IH9A 5TGFA 1BLSA 2ZM0A 1ERQA 1QMFA 3UY6A 2EX9A 1XGJA 2JCHA 5FQ9A 3PBRA 2Y2KA 5CERA 1GCEA 3ZNYA 3ZG5A 1EROA 4LV0A 4H8RA 4DRTA 5GLAA 5EPHA 3BM6A 1ZG6A 2ZC3B 3P09A 3Q82A 5CHJA 4RX2A 2HP6A 5U47A 1TDLA 4KZ8A 4OOYA 2XFTA 3N4IA 2WZXA 3IQAA 4JF4A 1NXYA 3OCNA 1PWDA 4OP5A 5FQQA 4K91A 4BENA 3C7UA 2HDSA 4WEKA 1BSGA 1W79A 2WGWB 4RA7A 5JYPA 3OPHA 3V50A 5CHUA 3UE0A 3WS5A 4KZ5A 4OKPA 5AQ7A 1BT5A 2XD5A 4OPQA 3S22A 1EWZA 1ONGA 5CGXA 4DF6A 3A3DA 5GHZA 3PAEA 4KZAA 1YLPA 3TG9A 4OOLA 4HBTA 1H8ZA 1O7EA 4NK3A 3NY4A 3G2YA 3UDIA 5HFOA 1BTLA 2JC7A 3IWIA 4E6XA 5HAQA 3PTEA 4P0MA 1HZOA 3HUOA 5M18A 1EI5A 4U0XA 4S2LA 4S2NA 1TVFA 5M19A 3GQZA 5F83A 1YQSA 3M2JA 4BD0A 1DY6A 3CJMA 2WZZA 3O86A 1IKGA 5DF7A 3HLGA 2CC1A 4N1XA 1XA7A 1E4DA 1PYYA 2ZC7A 5DTSA 1JTDA 1FR1A 1YLTA 3G31A 2PU2A 2ZQ9A 3NDEA 4S2NC 4EV4A 5HAPA 2ZQ8A 3BLSA 2V2FF 1DJAA 1YLJA 3ZVWA 1G68A 2WYXA 3NC8A 4B88A 1K56A 4WMCD 5FASA 3UPNA 4E3KA 3SS5A 3PBTA 3UDXA 5A91A 1NYYA 3FKWA 1E25A 2C5WB 1IYQA 3BFDA 4N1HA 1KE3A 2C6WB 5HL1A 2HP9A 3CMZA 2J9PA 2Y2LA 2ZC4B 4MBKA 3E2LA 2UWXA 2PU4A 1L0GA 2Y2PA 1HTZA 4EUZA 2H0YA 5CRFA 1FOFA 4N9KA 3PBOA 2XD1A 3ZHHA 4OPZA 1KVLA 4MBFA 4X69A 3S1YA 4WBGA 1YM1A 4KQQA 4PPRA 5CTNA 3FZCA 4IEDA 4KQOA 3IF6B 3GRJA 3SS4A 3MZEA 3UPPA 2ZQAA 3PBQA 3UPOA 5EOOA 5CHMA 2FFFB 5KZHA 1S6RA 2IWDA 2ZM2A 3MZDA 4UA6A 4OPRA 3HLCA 4OVDA 4BJPA 2Y59A 1ES3A 2Y2JA 1ONHA 4BL2A 1KDWA 1J9MA 1JWVA 1HD8A 3OC2A 3OPLA 5EVID 3NDGA 1SDNA 4WZ5A 4F94A 4OQ0A 3E2KA 4S2KA 3S4XA 5IHVA 3ZGAB 3IWOA 1NJ4A 4X56A 1LL9A 3O87A 2Q9NA 4DKIA 1O07A 3BFEA 3O88A 2EXAA 3N8RA 3NIAA 4UHUA 4GZBA 3VP1A 4WZ5C 3MFDA 1FSWA 2DRWA 3N7WA 1SKFA 1K4EA 5DF8A 3VOZA 3M2KA 5AQBA 4UA9A 4LV2A 3UN7A 3IF6C 4QY5A 3WS4A 5FQKA 5FSRA 1PZOA 2J8YA 1LHYA 5FAQA 3HBRA 4QJGA 3BRMA 3CG5A 4JXWA 4C3QA 3SH9A 3FKVA 2OLVA 1I2SA 4EQIA 3IHBA 2OSUA 2R9WA 2X02A 3AGFA 4GD6A 3VSKA 4QU3A 5E2EA 3G32A 5A90A 2WK0A 4S2PA 3IT9A 4PM8A 4HBUA 1N4OA 2HDUA 2Y2IA 3G30A 3HREA 5FI7A 5CECA 1FCOA 2ZC5B 5FDHA 5EE8A 4X53A 3Q1FA 1W8YA 4IBXA 1M6KA 1PWGA 4RX3A 4JXVA 4EBNA 2Q9MA 1L0EA 2Y2GA 3Q7VB 4Q8IA 2J9OA 2XH9A 4GN2A 3C4PA 4E3JA 1YLWA 1PI5A 3M6BA 4C6YA 1E3UD 1YLYA 4OQGA 4LV3A 4IBRA 3FWLA 3SH8A 1BLHA 5BOHA 4N92A 4GDNA 2Y2NA 4E3NA 1ESIA 1XA1A 4S2MA 2JE5A 3UNWA 4FD8A 4ZTKA 3ITAA 4LV1A 1PIOA 4XXRA 3MZFA 4QB8A 3MXRA 1OMEA 3ITBA 4WEJA 1N9BA 2V1ZA 1TDGA 3IH8A 4PMAA 5E2GA 1KGFA 1U60A 4DDYA 3WS1A 3ISGA 1VQQA 1MWRA 3Q07A 1YT4A 1PW8A 4N9LA 4YFMA 4QHCA 4DXCA 1I5QA 5FI6A 4Y7PA 3IWQA 2XDMA 4GNUA 5DTTA 4Y0OA 1YLZA 2A3UA 4LCMA 2E8IA 5JYOA 3IHAA 1C3BA 4S2IA 5HARA 1Q2QA 1G6AA 4NETA 4L0LA 1K4FA 4JKTA 4B4XA 2WGWA 4QY6A 3V3RA 1ERMA 4WM9A 1BLPA 1RGZA 5EECA 2DCFA 1K6RA 3LEZA 2Y2MA 3DWKA 3BECA 5AQAA 4CJNA 3W4OA 4DE2A 4JF5A 2WKIA 3UE1A 4MBHA 5TR7A 1K55A 2P9VB 5CTMA 5E2HA 2HDQA 3VP3A 1DJCA 3IXHA 3M6HA 4X6TA 4ZJ3A 3G4PA 1LL5A 5I94A 4DE1A 4OPYA 1K6SA 3C4OA 2EXBA 4E6WA 2ZD8A 4FH4A 2HDRA 1K55C 4K0WA 2Z2MB 3CZDA 5KSHA 4E3OA 1H8YA 4IVKA 3GV9A 5FI2A 4DXBA 2VGKA 2ZQDA 2XGNA 4JLFA 2Y4AA 3LO7A 2BLSA 3OCLA 4K0XA 4PM9A 4P85A 2OV5A 4DDSA 1NZUA 1W8QA 2XK1A 1CEFA 4OLDA 1FCNA 4E3LA 1W7FA 3BFGA 5HAIA 3PBNA 3N8SA 4MNRA 1PWCA 5FQJA 2ZJ9A 2WUQA 5HX9A 4JPMA 5GLCA 1L0DA 3DWZA 4OOMA 4JBFA 1CK3A 4X68A 5FAOA 3C5AA 3TSGA 4OQHA 3EQUA
chains in the Genus database with same CATH superfamily
5F1FA 2WKPA 4C75A 2X71A 1XP4A 4OH0A 1GHPA 3VSLA 2O9CA 3UO9A 5E43A 1CQAA 1KGGA 3IF6A 1XXMA 3VV4A 2UV0E 4R38A 2HGVA 4WYYA 3KYZA 4HI4A 2Y2QA 4KZ9A 3BFCA 3A3JA 5L10A 2IWBA 4ARZB 2ZL1B 3T4SA 4XUXA 4D2OA 3DW0A 4HEFA 4KUOA 4GLQA 4Y5FA 5HPIA 3F1PA 4M3KA 1LSXA 5DF9A 4BL3A 1YMXA 4KZ7A 2O9BA 3S7OA 1XJ4A 4KQRA 1P97A 3BFFA 3MXSA 1X0OA 1PW1A 4D60A 5IT5A 1T1AA 1FSYA 4GHIB 5C5KA 3FPVA 5A92A 1AXBA 2XFSA 1ZKJA 2W1RA 4OP8A 2KDKA 2WKEA 1BLCA 5FATA 4H6JB 2B5RA 4IVIA 1PFLA 1K57A 2LB9A 4Q0JA 5TFQA 2FFYA 3IXDA 3W4QA 3C7VA 3TJZC 4OQIA 1K25A 2E8JA 1KE0A 4UQIM 1BULA 1K54C 1ZC2A 3HUMA 2RCXA 4WZ4A 3W2ZA 2XQZA 2LB5A 1JWPA 4LCLA 4ESPA 3KYQA 1TS0A 4JF6A 1WA9A 4Q0IA 1G6OA 3GECA 4I3AA 3S7QA 1XJ3A 1E3UA 2J80A 3MKEA 2INWA 3B3XA 2JBFA 4ZJ1A 2K2NA 2H28A 2QYBA 5HDDA 1NRFA 4HJ4A 4O7DA 4HP9A 5GHYA 3CLOA 3G6OA 1SKOA 2JKTM 3QHYA 1GHIA 3G2ZA 3WS0A 4ID4A 3DTMA 3LR4A 4WL9A 2HP5A 5FL3A 3A3EA 2BG1A 2H10A 3I7JA 3U2AA 3CI6A 3HLDA 3EGXC 2XEPA 3GVBA 2QZ6A 3WWXA 4KG5A 5DVAA 3C30A 2ZQCA 3A3IA 4I5SA 3EOIA 3QNBA 3IBRA 3LCEA 1CI8A 3SS3A 5KSCA 2M7VA 3DBAA 4GOGA 5F82A 4ZAMA 3ZCZA 1F2KA 1OTEA 1T19A 2EX2A 4UEYA 1NZOA 4LFUA 1GHMA 5G18A 3SOIA 2D01A 1ERQA 1QMFA 2ZL1A 2JCHA 3DTEA 2XRNA 3OBFA 4H8RA 4FTXA 5GLAA 3VE4A 2ZC3B 5CHJA 5U47A 2HP6A 4KZ8A 2WZXA 1NXYA 4OP5A 4K91A 1JNUA 3C7UA 5AVFA 4WEKA 1BSGA 2W1TB 4WF0A 3IS2B 3V50A 5CHUA 3UE0A 4KZ5A 1GSWA 2JKRM 3LUQA 2ZOIA 4GHIA 4HJ3A 3C38A 4H6JA 1XJ6A 4EU0A 5HFOA 4E6XA 2JC7A 5HAQA 1EI5A 4S2LA 4S2NA 1OJGA 4BD0A 3LR0A 1ACFA 2WZZA 5IU1A 1Y28A 5DF7A 2L0WA 2Z6CA 4HQAA 3LIBA 4M4XA 5HAPA 1FR1A 2ZQ9A 4EV4A 2GX5A 1K56A 4CLCB 3UDXA 1NYYA 3MXQA 4N1HA 2C5WB 1IYQA 3BFDA 3IX4A 2J9PA 2Y2LA 1OTAA 3H7WB 4R6LA 1L0GA 3E4PA 1IFQA 4OPZA 4X69A 4KQQA 5CTNA 2PYPA 5FEGA 2ZQAA 3E0YA 2FFFB 5HD3A 1AWIA 4BJPA 4HH3A 3OPLA 3OC2A 5EVID 4F94A 3ZGAB 3R7WB 1LL9A 2QHKA 2Q9NA 3BFEA 2EXAA 1Z09A 4UHUA 3E98A 2GJ3A 3VP1A 1FSWA 3NECA 1K4EA 5AQBA 1CF0A 3IX3A 3UN7A 4Y13A 3HBRA 2W3DA 3BQ8A 4JXWA 3FKVA 4GD6A 3K2NA 1MZUA 3G32A 4S2PA 3KSIA 2XA7S 3G30A 4XT2A 4LLOB 1FCOA 1M6KA 4JXVA 2Q9MA 3MR0A 3Q7VB 2XH9A 4I38A 4EETB 1UWPX 3FWLA 3SH8A 4N92A 4GS9A 4E3NA 1ESIA 3ZYTA 4ZTKA 4LV1A 4GJ4A 3MXRA 1OMEA 2V1ZA 3D72A 4QHCA 1I5QA 4Y7PA 2CMNA 3QP4A 4PHTA 1IOUA 1HLUP 1PNEA 4S2IA 4L0LA 2W1TA 3JPUA 4IJGA 3IS2A 3KSGA 2K31A 1ERMA 1BLPA 2O9AA 3LEZA 4HOIA 2Y2MA 4CJNA 4DE2A 2V0WA 1VEUB 3QP8A 3T4JA 4MCWA 3G4PA 4LPZA 4OPYA 4BBUA 1K6SA 3C4OA 3JVVA 2O0YA 5KSHA 3MQOA 3GV9A 5FI2A 2VGKA 2XGNA 2BLSA 2B95A 2V1AA 2Y8HA 4P85A 1W8QA 3BFGA 5AJGA 2PD7A 4P6ZM 1A0KA 1PWCA 2WUQA 3RFBA 3EQUA 2JKFA 2PR6A 3ZG7B 2P08A 1WE4A 5FAPA 4R3BA 2PYRA 5J8XA 3W8KA 2QPNA 3BY8A 1NY0A 4OLGA 1MWSA 3D4FA 1IELA 1JVJA 1S67L 3W4PA 3WS2A 1ZG4A 5DJUA 2WAFA 3RXWA 4S2OA 1TS8A 4KZ6A 3NCKA 5J4EA 4EERA 3R7WA 4WMCA 4B4ZA 2XLNA 1P9WA 2L1MA 1UWNX 3MMHA 2P74A 5F1GA 3WRZA 5KMWA 1KVMA 3HVFA 2ZOHA 1MKIA 2Y91A 2AVXA 2WKQA 2WGVA 3BJNA 4HNBA 2P7JA 2L4RA 1LI9A 3UB7A 3KSHA 5E2FA 3BLMA 2ACGA 4KZ4A 3VP2A 3MSHA 3Q7ZA 1XX2A 4LGWA 3Q7VA 4PKYG 3R4KA 2XROA 2VA0A 3NOTC 1ES5A 2WADA 1K54A 4P6BA 5EVIC 4PM5A 2BTFP 2JKTI 1XGIA 1ZTUA 1PZPA 3CAXA 4KENB 1S0WA 2VV8A 3HLBA 1LSWA 1XKZA 1W5DA 2QMIA 3HLWA 2YKFA 3IF5A 5GHXA 4FCFA 4R4SA 3FC7A 3HLEA 2ZMVA 3OZHA 2H0TA 3UDFA 1ESUA 3JYIA 1VEUA 3V3SA 4HESA 4U3TA 3B33A 5DKKA 5DKLA 1IKIA 2NUTC 2Z2LB 3RXXA 3DTIA 3T1XA 5DTKA 3ZG9B 5EOEA 5CEBA 4YINA 2RL3A 3T4QA 4CPKA 2B18A 2I72A 3UE6A 3V5MA 1LT0A 1MPLA 3UMDA 3T4LA 1S1ZA 1XFQA 4BLMA 1GSVA 4G3VA 4FH2A 4HHDA 4MN5A 3PBSA 3FYZA 1TS6A 1ALQA 4ZDXA 2IWCA 2Y2OA 1IYPA 2PR5A 3MBZA 1L2SA 5EM0A 4MMNA 1D1JA 3IH9A 1YPRA 3PXPA 1XGJA 4WN5A 3LR3A 3ZG5A 5CERA 1GCEA 3ZNYA 4LV0A 3SZTA 4K08A 2R78A 4JGOA 1Y4OA 4RX2A 5DJTA 4RQ9A 1P9RA 4PAUA 1PWDA 5FQQA 3BQAA 2XA7M 2WGWB 4RA7A 3OPHA 4OKPA 4EEUA 4DJ3A 3S22A 5CGXA 4DF6A 5GHZA 1YLPA 1H8ZA 4NK3A 3UDIA 2HF6A 5G4ZA 5M18A 4U0XA 1TVFA 5M19A 5F83A 2V8CA 3LGOA 3TRCA 3CJMA 4N1XA 4EUVA 1XA7A 3NOUC 1F98A 1ODVA 3BLSA 3LEQA 4I3JA 1NLZA 4E3KA 3SS5A 3PBTA 5A91A 4NKPA 3UB6A 2PAVP 2QKPA 3QP6A 3E2LA 2UWXA 3RTYA 2XD1A 4MBFA 3S1YA 4WBGA 4L9EA 2FH5A 1TS7A 2V9AA 5EOOA 5KZHA 2IWDA 2ZM2A 4OPRA 4OVDA 4BL2A 1OTBA 1HD8A 3HJIA 3NDGA 3PYPA 4Q0HA 5IHVA 3S4XA 3IWOA 1ZHHB 2A24A 3LYXA 1O07A 3O88A 5HDCA 4WLAA 2EWWA 3MQQA 4GZBA 4WZ5C 3MFDA 4XT2B 2GNXA 3UB8A 1SKFA 1DP9A 4GW9A 3VOZA 2VLGA 5F68A 4LV2A 3IF6C 5FQKA 5FSRA 1PZOA 4QJGA 3F1OB 3BWLA 4EQIA 4GS9B 2R9WA 3VSKA 5A90A 5J7EA 2JKGA 2WK0A 3O5YA 2HDUA 2Y2IA 5FI7A 3HREA 5EE8A 4X53A 1KOUA 1PWGA 4EBNA 2J9OA 4E3JA 3C4PA 1TF1A 3MS6A 3M6BA 4C6YA 2B02A 4OQGA 2I9VA 4EEPA 2W3FA 4GDNA 3T4TA 2Y2NA 4I39A 2JE5A 4FD8A 5FDSA 4LRXC 1D7EA 1PIOA 4XXRA 2JN7A 3S7PA 4QB8A 3ITBA 1N9BA 1TDGA 5E2GA 4DDYA 1U60A 1PW8A 4N9LA 4YFMA 2XDMA 4HY8A 3BW6A 1C3BA 3T1SA 1G5UA 2WGWA 2VGLM 4O8GA 3DWKA 2KLIA 3W4OA 2O99A 3UE1A 4MBHA 5CTMA 2HDQA 4ZJ3A 4KQDA 2EXBA 4FH4A 1D06A 1H8MA 1K55C 4K0WA 3KO6A 1H8YA 1VHMA 4DN0A 3OCLA 5EFWA 1LSVA 1W63Q 4CLCE 4OLDA 1CEFA 1W7FA 3PBNA 1VETA 2QJ5A 1OTIA 1L0DA 5FAOA 2P04A 4OQHA 1NRJA 3L7HA 3BY9A 4KZBA 4RYEA 1VB6A 4B9OA 3SW1A 3GDIA 4DMZA 1XPBA 4P87A 4PM7A 3DTKA 1FCMA 4E3MA 3P01A 2IA2A 2Y55A 3QP5A 2JHEA 3ZNTA 3HUNA 3CWFA 3ZFZA 3VOYA 4R1GA 3QP2A 4G3WA 2ZQ7A 2MJ6A 1YMSA 5GLDA 5FA7A 4IUKA 1P0ZA 2XF3A 1SCWA 4MDZA 1L0FA 5F5YA 2EX6A 1LI0A 3D3OA 3VP4A 1QMEA 1ES4A 5TBMA 5HWTA 4Z9QA 5EUAA 3OLOA 3F1OA 2G2WA 4MN6A 2J3TD 3UB5P 4LRYC 1Y54A 5FQMA 4BBVA 2X01A 4U0TA 3B47A 3BYDA 4QD4A 5A93A 2A2LA 1NYMA 3HL9A 5EVIA 3NI9A 1M40A 4CLCD 1HVBA 1DP8A 1BZAA 4UQIS 4EWFA 2PBYA 2YKHA 2Z6DA 1TEMA 3WRTA 2G2UA 1KDSA 4E3IA 1W63M 4O0PA 3IX8A 2FZ0A 5HW3A 4BD1A 5GLBA 3N8LA 4WELA 3ZDJA 4X55A 5EVEA 3K3CA 3O3VA 3A0SA 2QJ7A 1V9YA 5HWWA 1FQGA 2XR0A 1DP6A 1MBLA 3MF0A 2EFXA 4O01A 1STZA 3NBLA 2W0NA 3P7NA 1IYOA 3GTCA 3GSGA 3VFFA 3EEAA 3T50A 2W3GA 2ZLYA 1JWZA 1FR6A 4KG6A 1MY8A 2EWVA 2W3EA 5EVLA 4LENA 1ES2A 4PM6A 1TD5A 1OTDA 2V8FA 3VP0A 2WGIA 2VGJA 2XSSA 3LFVA 4ME4A 3V39A 4EBLA 4BWIA 4FUWA 3MFXA 4R3AA 4FSFA 3NOPC 4RVAA 3EEHA 1KE4A 5EM1A 4ETZA 5HSQA 2ZC6B 5L09A 1Q2PA 1RGYA 5AQ9A 1UGUA 5F69A 1CEGA 1YKDA 5M1AA 1GSXA 4NXEA 1RP5A 3BEBA 4JGQA 1PI4A 1MWUA 5HDSA 4R70A 1IEMA 2ZMAA 3AGEA 4KUKA 4HJ6A 4ETXA 1BLSA 2ZM0A 2G7UA 3UY6A 3PBRA 2Y2KA 1S4SA 5DFYA 1H3QA 3L9KA 4DRTA 5EPHA 3BM6A 1ZG6A 4BBTA 5KIZA 1TDLA 2XFTA 3N4IA 1N9OA 3IQAA 4JF4A 4X25A 4BENA 2HDSA 1W79A 5JYPA 2V1BA 4I3IA 4HH2A 5AQ7A 1T1CA 2XD5A 4OPQA 2HJEA 1EWZA 1PRQA 1O7EA 3UB9A 1F9IA 3NY4A 5FEFA 1BTLA 3D9YA 3PTEA 3TW8A 4P0MA 3HUOA 5A8BA 1DRMA 3HJKA 3GQZA 1DY6A 3O86A 5IS1A 3HLGA 2CC1A 1E4DA 1PYYA 5AVEA 5DTSA 1H0MA 1JTDA 3G31A 2PU2A 3VOLA 2PRFA 1DJAA 1YLJA 3ZVWA 2WYXA 1S4RA 3F1NA 3UPNA 1L3LA 3FKWA 1E25A 1OJ5A 1KE3A 3CMZA 4MBKA 2ZC4B 5TJJA 4B93A 2PU4A 2Y2PA 2PT7A 1HTZA 4EUZA 2H0YA 5CRFA 3NJAA 1FOFA 4N9KA 3PBOA 3ZHHA 2J3TC 2A24B 1YM1A 3FZCA 4IEDA 4KQOA 4X1MA 5CHMA 1S6RA 4BMWA 1ES3A 1KDWA 2OAP1 1FIKA 1J9MA 2HZ5A 3CUEC 1SDNA 4WZ5A 4CLCC 3E2KA 4X56A 3O87A 4QWOA 2W3HA 3N8RA 2JKRI 3NIAA 3S7NA 1F5MA 3H82B 4UA9A 5F6AA 3WS4A 3MJQA 3LR5A 1LHYA 4HP4A 3LIEA 3SH9A 1I2SA 3IHBA 1CJFA 2OSUA 5E2EA 4E04A 3IT9A 4PM8A 4HBUA 1N4OA 2HV1A 5CECA 5FDHA 3Q1FA 5HPFA 4IBXA 4Q8IA 4RX3A 3JVUA 3ULFA 2Y2GA 5L07A 4GN2A 1YLWA 1PI5A 1E3UD 1YLYA 4IBRA 1BLHA 1XA1A 5HZHA 2VV7A 3ITAA 4DJ2A 1YSPA 4WEJA 1KGFA 3WS1A 3ISGA 1MWRA 1YT4A 5FI6A 4GNUA 2D02A 3IHAA 5HARA 1Q2QA 1G6AA 3LI8A 4NETA 2Q0OA 4JKTA 2PHYA 4QY6A 3T4OA 3V3RA 2HJ9C 2DCFA 2QWSA 5AQAA 3E4OA 5TR7A 1K55A 2P9VB 1S66L 5E2HA 1VETB 4X6TA 5HD5A 1LL5A 4E6WA 4P6ZS 2HDRA 3LI9A 2Z2MB 2ZBBA 4E3OA 4IVKA 4DXBA 2ZQDA 4JLFA 4AFIA 4EXOA 5LBRA 4DDSA 3DAVA 4E3LA 5HAIA 3K3DA 5FQJA 2OOLA 4JPMA 5DFXA 1CK3A 2GZAA 5I5LA 4NXFA 1K38A 1WYCA 2VV6A 3SH7A 1LLBA 2HPBA 3GMWA 1T1BA 1H5XA 5J3WA 3IBJA 4MLLA 2H5SA 2J7VA 4EESA 5MC7A 1MXOA 3Q81A 5TBMB 1S1YA 1CI9A 3VMAA 4UA7A 4R0QA 3NHQA 4FOFA 2EX8A 1BYWA 1SHVA 4ZJ2A 1DJBA 3C2WA 4R23A 3T12B 3TOIA 2WAEA 4Z1WA 5CGWA 3MQ0A 4KG2A 3KSFA 4EW7A 5EVIB 3PAGA 3H82A 1OT9A 1BUEA 4JXSA 1G28A 1FILA 1K56D 3G35A 3IXGA 4GB7A 4ARZA 2EFUA 3RJUA 3A3FA 3FG8A 5FQIA 3OPRA 3LIDA 1GA0A 1I2WA 5GL9A 3PR6A 4Y17A 4Y0UA 4DE3A 3AGDA 4A5RA 4X1LA 3G34A 5L2FA 2A49A 5CGSA 2M7UA 3ZG0A 4IHQA 2R9XA 2VZWA 2ZM8A 2Y2HA 1Z6FA 1NWZA 1IYSA 3ZG8B 2Y79A 1K57C 4R4RA 2WKHA 4GKUA 4OONA 2GDNA 3FV7A 4NEED 2K7SA 4MEZA 4R3JA 2VKSA 3VFHA 4Y2FA 3LICA 1MC0A 3P98A 4JGPA 4L9GA 1VM1A 2DNSA 4YWZA 3GR2A 4XUZA 4L9FA 4BQMA 1YAXA 3T4KA 4ZRRA 2NUPC 2P9VA 3PHYA 4EQ1A 4NXBA 5CEDA 3LY4A 3LY3A 2V0UA 3HLFA 1GA9A 1WYBA 3N6IA 1N9LA 3EWKA 5D3OA 2OLUA 4IUHA 4JGRA 4GD8A 1OPXA 4GDBA 3HCYA 1RCJA 3EQVA 3OPPA 1MWTA 3CPTB 3IXBA 3T1RA 4LRZE 4S2JA 4UAAA 1JTGA 4ZBEA 5L8MA 3QNCA 3UE3A 1OT6A 4KZ3A 2V20A 4CQHA 3MKFA 4EBPA 4DE0A 3ZVTA 1SDEA 2PD8A 4Y0TA 5CXWA 1KGEA 3CITA 3RH8B 3T1QB 4JXGA 3B42A 5TGFA 2EX9A 5FQ9A 2KOIA 1EROA 3UMEA 4G3KA 2PDRA 3P09A 3Q82A 3VE3A 4OOYA 4GCZA 3OCNA 1NLYA 4Y15A 5EV0A 1K0KA 2J3WA 2OAQ1 3WS5A 1BT5A 1ONGA 3A0RA 3A3DA 3PAEA 4KZAA 3TG9A 4OOLA 4HBTA 3F1NB 3G2YA 4QPRA 3IWIA 1HZOA 1YQSA 3M2JA 3U4LP 1V9ZA 4NG2A 1IKGA 4F3LB 3CHWP 2VEAA 3KYEA 2ZC7A 1YLTA 3NDEA 4S2NC 2ZQ8A 2V2FF 1G68A 3NC8A 1J3WA 4B88A 4WMCD 5FASA 2C6WB 5HL1A 2HP9A 5CX7A 2OWJA 3FPWA 4PKYA 1KVLA 4PPRA 3LIAA 3IF6B 3GRJA 3SS4A 3MZEA 3UPPA 3H9WA 3PBQA 3CUEA 3UPOA 4CLCA 1MKMA 3A0VA 3MZDA 4UA6A 3HLCA 2Y59A 2Y2JA 1ONHA 3H7WA 4WUJA 1JWVA 5K5BA 3ZQ5A 4OQ0A 4S2KA 2ZMFA 1NJ4A 4DKIA 3F1PB 3ICYA 2WKRA 2DRWA 3N7WA 5DF8A 3M2KA 3CPTA 4QY5A 5HL6A 2J8YA 3TE8A 5FAQA 3BRMA 3CG5A 4C3QA 2OLVA 3AGFA 2X02A 3QP1A 4QU3A 5G4YA 3V67A 1XFNA 2ZC5B 1W8YA 3KX0X 1L0EA 3NULA 4HIAA 3LIFA 4NXGA 4LV3A 5BOHA 1T18A 4MN7A 4S2MA 3UNWA 1SZVA 3MZFA 4YOFA 3IH8A 4PMAA 1YSQA 1VQQA 2VGLS 1N9NA 3Q07A 3C8CA 4DXCA 5DTTA 3IWQA 4Y0OA 1YLZA 2A3UA 5HWVA 4LCMA 2E8IA 2VK3A 5JYOA 1XJ2A 2OWHA 1K4FA 4B4XA 3OOVA 4WM9A 1RGZA 5EECA 1K6RA 3EGDC 3BECA 4Y3IA 4JF5A 2WKIA 2VJWA 3VP3A 1DJCA 3IXHA 3M6HA 5I94A 4DE1A 1EW0A 3E4QA 4II7A 2ZD8A 3CZDA 2EA9A 1LL8A 4F3LA 2Y4AA 3LO7A 2PBDP 4K0XA 4PM9A 1SKOB 2OV5A 1NZUA 2XK1A 1FCNA 2VX8A 2KX6A 3N8SA 4YNRA 4MNRA 2ZJ9A 2W27A 5HX9A 5GLCA 2DMWA 3DWZA 4OOMA 4JBFA 4X68A 3C5AA 3TSGA 2M1CA 2BASA
chains in the Genus database with same CATH topology
1K38A 5F1FA 3ZG7B 4C75A 4KZBA 2X71A 1WYCA 1XP4A 4OH0A 1GHPA 4RYEA 1WE4A 3VSLA 3SH7A 5FAPA 3UO9A 5E43A 4R3BA 5J8XA 3W8KA 1LLBA 1KGGA 1XPBA 2QPNA 3IF6A 2HPBA 4P87A 1NY0A 3GMWA 1H5XA 4PM7A 1XXMA 4OLGA 4MLLA 1MWSA 3D4FA 1IELA 1FCMA 1JVJA 2H5SA 2J7VA 4WYYA 3W4PA 3WS2A 4E3MA 1ZG4A 1MXOA 2Y55A 2WAFA 2Y2QA 3Q81A 3ZNTA 4KZ9A 1CI9A 3VMAA 3BFCA 3HUNA 3A3JA 4S2OA 3RXWA 4KZ6A 4UA7A 3ZFZA 4R0QA 3NCKA 2EX8A 2IWBA 3VOYA 1SHVA 4R1GA 4XUXA 4D2OA 3DW0A 4ZJ2A 2ZQ7A 4HEFA 4WMCA 4B4ZA 1YMSA 2XLNA 5GLDA 5FA7A 1DJBA 4R23A 4M3KA 3TOIA 2XF3A 2WAEA 5DF9A 1SCWA 2P74A 5CGWA 5F1GA 3WRZA 1L0FA 5KMWA 4KG2A 1KVMA 3HVFA 4BL3A 2EX6A 1MKIA 1LI0A 1YMXA 4KZ7A 5EVIB 1QMEA 2Y91A 3PAGA 3VP4A 1ES4A 1BUEA 4JXSA 2WGVA 4Z9QA 4KQRA 1K56D 3G35A 3IXGA 5EUAA 3BFFA 3MXSA 4GB7A 1PW1A 2EFUA 2G2WA 3A3FA 3RJUA 1LI9A 1Y54A 5FQIA 3OPRA 5FQMA 1FSYA 5E2FA 1GA0A 3BLMA 1I2WA 5GL9A 2X01A 4U0TA 4KZ4A 3VP2A 4Y0UA 4DE3A 3BYDA 5A92A 1AXBA 2XFSA 1ZKJA 3AGDA 3Q7ZA 4QD4A 1XX2A 4OP8A 5A93A 1NYMA 2WKEA 1BLCA 3HL9A 5FATA 4A5RA 5EVIA 2B5RA 4IVIA 3Q7VA 3G34A 3NI9A 5L2FA 1K57A 2A49A 1M40A 1HVBA 5CGSA 1BZAA 3ZG0A 2R9XA 4EWFA 5TFQA 2FFYA 1ES5A 2PBYA 2ZM8A 2Y2HA 1TEMA 3WRTA 3IXDA 2G2UA 1Z6FA 1K54A 1KDSA 1IYSA 2WADA 4P6BA 5EVIC 4E3IA 4PM5A 3W4QA 3ZG8B 3C7VA 1K57C 4OQIA 4R4RA 2WKHA 5HW3A 1K25A 4BD1A 5GLBA 4GKUA 4OONA 1KE0A 2GDNA 1XGIA 3FV7A 3N8LA 4MEZA 4WELA 3ZDJA 1BULA 4R3JA 1K54C 4X55A 1PZPA 1ZC2A 3O3VA 3HUMA 4KENB 3VFHA 1S0WA 3HLBA 2RCXA 1XKZA 1W5DA 4WZ4A 3P98A 2XQZA 2QMIA 1JWPA 4LCLA 3HLWA 1FQGA 1VM1A 2DNSA 3IF5A 2XR0A 5GHXA 4FCFA 4R4SA 3GR2A 4JF6A 1MBLA 4XUZA 2EFXA 3HLEA 4BQMA 3NBLA 3OZHA 2H0TA 3UDFA 1ESUA 3JYIA 2P9VA 3V3SA 1E3UA 4HESA 1IYOA 3GTCA 3MKEA 4U3TA 3GSGA 5CEDA 3VFFA 3LY4A 3LY3A 3B3XA 2ZLYA 2JBFA 4ZJ1A 1JWZA 1FR6A 3HLFA 4KG6A 1IKIA 1GA9A 1WYBA 1MY8A 3N6IA 3RXXA 2Z2LB 5D3OA 2OLUA 5EVLA 5DTKA 1NRFA 5EOEA 3ZG9B 5CEBA 4LENA 4O7DA 2RL3A 4YINA 5GHYA 1ES2A 4PM6A 4GD8A 4CPKA 3QHYA 4GDBA 3VP0A 1GHIA 3G2ZA 3WS0A 2I72A 2WGIA 1RCJA 3EQVA 3V5MA 2VGJA 4ID4A 3DTMA 3OPPA 1MWTA 3V39A 1MPLA 4EBLA 2HP5A 3IXBA 3A3EA 2BG1A 4FSFA 4S2JA 1JTGA 4RVAA 4UAAA 1KE4A 4BLMA 2H10A 2ZC6B 4ZBEA 3I7JA 1Q2PA 3QNCA 3UE3A 4FH2A 4KZ3A 3PBSA 3HLDA 1RGYA 2XEPA 3GVBA 2QZ6A 3FYZA 5AQ9A 3WWXA 1ALQA 4KG5A 4ZDXA 2IWCA 2Y2OA 1IYPA 5DVAA 2V20A 1CEGA 3MKFA 4EBPA 4DE0A 5M1AA 3MBZA 2ZQCA 3A3IA 1SDEA 3ZVTA 3QNBA 1RP5A 1L2SA 3LCEA 3SS3A 1CI8A 3BEBA 4Y0TA 5KSCA 1PI4A 5CXWA 1MWUA 4GOGA 1IEMA 1KGEA 2ZMAA 3AGEA 4ZAMA 5F82A 3ZCZA 2EX2A 1NZOA 1GHMA 4JXGA 5G18A 3SOIA 3IH9A 5TGFA 1BLSA 2ZM0A 1ERQA 1QMFA 3UY6A 2EX9A 1XGJA 2JCHA 5FQ9A 3PBRA 2Y2KA 5CERA 1GCEA 3ZNYA 3ZG5A 1EROA 4LV0A 4H8RA 4DRTA 5GLAA 5EPHA 3BM6A 1ZG6A 2ZC3B 3P09A 3Q82A 5CHJA 4RX2A 2HP6A 5U47A 1TDLA 4KZ8A 4OOYA 2XFTA 3N4IA 2WZXA 3IQAA 4JF4A 1NXYA 3OCNA 1PWDA 4OP5A 5FQQA 4K91A 4BENA 3C7UA 2HDSA 4WEKA 1BSGA 1W79A 2WGWB 4RA7A 5JYPA 3OPHA 3V50A 5CHUA 3UE0A 3WS5A 4KZ5A 4OKPA 5AQ7A 1BT5A 2XD5A 4OPQA 3S22A 1EWZA 1ONGA 5CGXA 4DF6A 3A3DA 5GHZA 3PAEA 4KZAA 1YLPA 3TG9A 4OOLA 4HBTA 1H8ZA 1O7EA 4NK3A 3NY4A 3G2YA 3UDIA 5HFOA 1BTLA 2JC7A 3IWIA 4E6XA 5HAQA 3PTEA 4P0MA 1HZOA 3HUOA 5M18A 1EI5A 4U0XA 4S2LA 4S2NA 1TVFA 5M19A 3GQZA 5F83A 1YQSA 3M2JA 4BD0A 1DY6A 3CJMA 2WZZA 3O86A 1IKGA 5DF7A 3HLGA 2CC1A 4N1XA 1XA7A 1E4DA 1PYYA 2ZC7A 5DTSA 1JTDA 1FR1A 1YLTA 3G31A 2PU2A 2ZQ9A 3NDEA 4S2NC 4EV4A 5HAPA 2ZQ8A 3BLSA 2V2FF 1DJAA 1YLJA 3ZVWA 1G68A 2WYXA 3NC8A 4B88A 1K56A 4WMCD 5FASA 3UPNA 4E3KA 3SS5A 3PBTA 3UDXA 5A91A 1NYYA 3FKWA 1E25A 2C5WB 1IYQA 3BFDA 4N1HA 1KE3A 2C6WB 5HL1A 2HP9A 3CMZA 2J9PA 2Y2LA 2ZC4B 4MBKA 3E2LA 2UWXA 2PU4A 1L0GA 2Y2PA 1HTZA 4EUZA 2H0YA 5CRFA 1FOFA 4N9KA 3PBOA 2XD1A 3ZHHA 4OPZA 1KVLA 4MBFA 4X69A 3S1YA 4WBGA 1YM1A 4KQQA 4PPRA 5CTNA 3FZCA 4IEDA 4KQOA 3IF6B 3GRJA 3SS4A 3MZEA 3UPPA 2ZQAA 3PBQA 3UPOA 5EOOA 5CHMA 2FFFB 5KZHA 1S6RA 2IWDA 2ZM2A 3MZDA 4UA6A 4OPRA 3HLCA 4OVDA 4BJPA 2Y59A 1ES3A 2Y2JA 1ONHA 4BL2A 1KDWA 1J9MA 1JWVA 1HD8A 3OC2A 3OPLA 5EVID 3NDGA 1SDNA 4WZ5A 4F94A 4OQ0A 3E2KA 4S2KA 3S4XA 5IHVA 3ZGAB 3IWOA 1NJ4A 4X56A 1LL9A 3O87A 2Q9NA 4DKIA 1O07A 3BFEA 3O88A 2EXAA 3N8RA 3NIAA 4UHUA 4GZBA 3VP1A 4WZ5C 3MFDA 1FSWA 2DRWA 3N7WA 1SKFA 1K4EA 5DF8A 3VOZA 3M2KA 5AQBA 4UA9A 4LV2A 3UN7A 3IF6C 4QY5A 3WS4A 5FQKA 5FSRA 1PZOA 2J8YA 1LHYA 5FAQA 3HBRA 4QJGA 3BRMA 3CG5A 4JXWA 4C3QA 3SH9A 3FKVA 2OLVA 1I2SA 4EQIA 3IHBA 2OSUA 2R9WA 2X02A 3AGFA 4GD6A 3VSKA 4QU3A 5E2EA 3G32A 5A90A 2WK0A 4S2PA 3IT9A 4PM8A 4HBUA 1N4OA 2HDUA 2Y2IA 3G30A 3HREA 5FI7A 5CECA 1FCOA 2ZC5B 5FDHA 5EE8A 4X53A 3Q1FA 1W8YA 4IBXA 1M6KA 1PWGA 4RX3A 4JXVA 4EBNA 2Q9MA 1L0EA 2Y2GA 3Q7VB 4Q8IA 2J9OA 2XH9A 4GN2A 3C4PA 4E3JA 1YLWA 1PI5A 3M6BA 4C6YA 1E3UD 1YLYA 4OQGA 4LV3A 4IBRA 3FWLA 3SH8A 1BLHA 5BOHA 4N92A 4GDNA 2Y2NA 4E3NA 1ESIA 1XA1A 4S2MA 2JE5A 3UNWA 4FD8A 4ZTKA 3ITAA 4LV1A 1PIOA 4XXRA 3MZFA 4QB8A 3MXRA 1OMEA 3ITBA 4WEJA 1N9BA 2V1ZA 1TDGA 3IH8A 4PMAA 5E2GA 1KGFA 1U60A 4DDYA 3WS1A 3ISGA 1VQQA 1MWRA 3Q07A 1YT4A 1PW8A 4N9LA 4YFMA 4QHCA 4DXCA 1I5QA 5FI6A 4Y7PA 3IWQA 2XDMA 4GNUA 5DTTA 4Y0OA 1YLZA 2A3UA 4LCMA 2E8IA 5JYOA 3IHAA 1C3BA 4S2IA 5HARA 1Q2QA 1G6AA 4NETA 4L0LA 1K4FA 4JKTA 4B4XA 2WGWA 4QY6A 3V3RA 1ERMA 4WM9A 1BLPA 1RGZA 5EECA 2DCFA 1K6RA 3LEZA 2Y2MA 3DWKA 3BECA 5AQAA 4CJNA 3W4OA 4DE2A 4JF5A 2WKIA 3UE1A 4MBHA 5TR7A 1K55A 2P9VB 5CTMA 5E2HA 2HDQA 3VP3A 1DJCA 3IXHA 3M6HA 4X6TA 4ZJ3A 3G4PA 1LL5A 5I94A 4DE1A 4OPYA 1K6SA 3C4OA 2EXBA 4E6WA 2ZD8A 4FH4A 2HDRA 1K55C 4K0WA 2Z2MB 3CZDA 5KSHA 4E3OA 1H8YA 4IVKA 3GV9A 5FI2A 4DXBA 2VGKA 2ZQDA 2XGNA 4JLFA 2Y4AA 3LO7A 2BLSA 3OCLA 4K0XA 4PM9A 4P85A 2OV5A 4DDSA 1NZUA 1W8QA 2XK1A 1CEFA 4OLDA 1FCNA 4E3LA 1W7FA 3BFGA 5HAIA 3PBNA 3N8SA 4MNRA 1PWCA 5FQJA 2ZJ9A 2WUQA 5HX9A 4JPMA 5GLCA 1L0DA 3DWZA 4OOMA 4JBFA 1CK3A 4X68A 5FAOA 3C5AA 3TSGA 4OQHA 3EQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K38 A;  5F1F A;  3ZG7 B;  4C75 A;  4KZB A;  2X71 A;  1WYC A;  1XP4 A;  4OH0 A;  1GHP A;  4RYE A;  1WE4 A;  3VSL A;  3SH7 A;  5FAP A;  3UO9 A;  5E43 A;  4R3B A;  5J8X A;  3W8K A;  1LLB A;  1KGG A;  1XPB A;  2QPN A;  3IF6 A;  2HPB A;  4P87 A;  1NY0 A;  3GMW A;  1H5X A;  4PM7 A;  1XXM A;  4OLG A;  4MLL A;  1MWS A;  3D4F A;  1IEL A;  1FCM A;  1JVJ A;  2H5S A;  2J7V A;  4WYY A;  3W4P A;  3WS2 A;  4E3M A;  1ZG4 A;  1MXO A;  2Y55 A;  2WAF A;  2Y2Q A;  3Q81 A;  3ZNT A;  4KZ9 A;  1CI9 A;  3VMA A;  3BFC A;  3HUN A;  3A3J A;  4S2O A;  3RXW A;  4KZ6 A;  4UA7 A;  3ZFZ A;  4R0Q A;  3NCK A;  2EX8 A;  2IWB A;  3VOY A;  1SHV A;  4R1G A;  4XUX A;  4D2O A;  3DW0 A;  4ZJ2 A;  2ZQ7 A;  4HEF A;  4WMC A;  4B4Z A;  1YMS A;  2XLN A;  5GLD A;  5FA7 A;  1DJB A;  4R23 A;  4M3K A;  3TOI A;  2XF3 A;  2WAE A;  5DF9 A;  1SCW A;  2P74 A;  5CGW A;  5F1G A;  3WRZ A;  1L0F A;  5KMW A;  4KG2 A;  1KVM A;  3HVF A;  4BL3 A;  2EX6 A;  1MKI A;  1LI0 A;  1YMX A;  4KZ7 A;  5EVI B;  1QME A;  2Y91 A;  3PAG A;  3VP4 A;  1ES4 A;  1BUE A;  4JXS A;  2WGV A;  4Z9Q A;  4KQR A;  1K56 D;  3G35 A;  3IXG A;  5EUA A;  3BFF A;  3MXS A;  4GB7 A;  1PW1 A;  2EFU A;  2G2W A;  3A3F A;  3RJU A;  1LI9 A;  1Y54 A;  5FQI A;  3OPR A;  5FQM A;  1FSY A;  5E2F A;  1GA0 A;  3BLM A;  1I2W A;  5GL9 A;  2X01 A;  4U0T A;  4KZ4 A;  3VP2 A;  4Y0U A;  4DE3 A;  3BYD A;  5A92 A;  1AXB A;  2XFS A;  1ZKJ A;  3AGD A;  3Q7Z A;  4QD4 A;  1XX2 A;  4OP8 A;  5A93 A;  1NYM A;  2WKE A;  1BLC A;  3HL9 A;  5FAT A;  4A5R A;  5EVI A;  2B5R A;  4IVI A;  3Q7V A;  3G34 A;  3NI9 A;  5L2F A;  1K57 A;  2A49 A;  1M40 A;  1HVB A;  5CGS A;  1BZA A;  3ZG0 A;  2R9X A;  4EWF A;  5TFQ A;  2FFY A;  1ES5 A;  2PBY A;  2ZM8 A;  2Y2H A;  1TEM A;  3WRT A;  3IXD A;  2G2U A;  1Z6F A;  1K54 A;  1KDS A;  1IYS A;  2WAD A;  4P6B A;  5EVI C;  4E3I A;  4PM5 A;  3W4Q A;  3ZG8 B;  3C7V A;  1K57 C;  4OQI A;  4R4R A;  2WKH A;  5HW3 A;  1K25 A;  4BD1 A;  5GLB A;  4GKU A;  4OON A;  1KE0 A;  2GDN A;  1XGI A;  3FV7 A;  3N8L A;  4MEZ A;  4WEL A;  3ZDJ A;  1BUL A;  4R3J A;  1K54 C;  4X55 A;  1PZP A;  1ZC2 A;  3O3V A;  3HUM A;  4KEN B;  3VFH A;  1S0W A;  3HLB A;  2RCX A;  1XKZ A;  1W5D A;  4WZ4 A;  3P98 A;  2XQZ A;  2QMI A;  1JWP A;  4LCL A;  3HLW A;  1FQG A;  1VM1 A;  2DNS A;  3IF5 A;  2XR0 A;  5GHX A;  4FCF A;  4R4S A;  3GR2 A;  4JF6 A;  1MBL A;  4XUZ A;  2EFX A;  3HLE A;  4BQM A;  3NBL A;  3OZH A;  2H0T A;  3UDF A;  1ESU A;  3JYI A;  2P9V A;  3V3S A;  1E3U A;  4HES A;  1IYO A;  3GTC A;  3MKE A;  4U3T A;  3GSG A;  5CED A;  3VFF A;  3LY4 A;  3LY3 A;  3B3X A;  2ZLY A;  2JBF A;  4ZJ1 A;  1JWZ A;  1FR6 A;  3HLF A;  4KG6 A;  1IKI A;  1GA9 A;  1WYB A;  1MY8 A;  3N6I A;  3RXX A;  2Z2L B;  5D3O A;  2OLU A;  5EVL A;  5DTK A;  1NRF A;  5EOE A;  3ZG9 B;  5CEB A;  4LEN A;  4O7D A;  2RL3 A;  4YIN A;  5GHY A;  1ES2 A;  4PM6 A;  4GD8 A;  4CPK A;  3QHY A;  4GDB A;  3VP0 A;  1GHI A;  3G2Z A;  3WS0 A;  2I72 A;  2WGI A;  1RCJ A;  3EQV A;  3V5M A;  2VGJ A;  4ID4 A;  3DTM A;  3OPP A;  1MWT A;  3V39 A;  1MPL A;  4EBL A;  2HP5 A;  3IXB A;  3A3E A;  2BG1 A;  4FSF A;  4S2J A;  1JTG A;  4RVA A;  4UAA A;  1KE4 A;  4BLM A;  2H10 A;  2ZC6 B;  4ZBE A;  3I7J A;  1Q2P A;  3QNC A;  3UE3 A;  4FH2 A;  4KZ3 A;  3PBS A;  3HLD A;  1RGY A;  2XEP A;  3GVB A;  2QZ6 A;  3FYZ A;  5AQ9 A;  3WWX A;  1ALQ A;  4KG5 A;  4ZDX A;  2IWC A;  2Y2O A;  1IYP A;  5DVA A;  2V20 A;  1CEG A;  3MKF A;  4EBP A;  4DE0 A;  5M1A A;  3MBZ A;  2ZQC A;  3A3I A;  1SDE A;  3ZVT A;  3QNB A;  1RP5 A;  1L2S A;  3LCE A;  3SS3 A;  1CI8 A;  3BEB A;  4Y0T A;  5KSC A;  1PI4 A;  5CXW A;  1MWU A;  4GOG A;  1IEM A;  1KGE A;  2ZMA A;  3AGE A;  4ZAM A;  5F82 A;  3ZCZ A;  2EX2 A;  1NZO A;  1GHM A;  4JXG A;  5G18 A;  3SOI A;  3IH9 A;  5TGF A;  1BLS A;  2ZM0 A;  1ERQ A;  1QMF A;  3UY6 A;  2EX9 A;  1XGJ A;  2JCH A;  5FQ9 A;  3PBR A;  2Y2K A;  5CER A;  1GCE A;  3ZNY A;  3ZG5 A;  1ERO A;  4LV0 A;  4H8R A;  4DRT A;  5GLA A;  5EPH A;  3BM6 A;  1ZG6 A;  2ZC3 B;  3P09 A;  3Q82 A;  5CHJ A;  4RX2 A;  2HP6 A;  5U47 A;  1TDL A;  4KZ8 A;  4OOY A;  2XFT A;  3N4I A;  2WZX A;  3IQA A;  4JF4 A;  1NXY A;  3OCN A;  1PWD A;  4OP5 A;  5FQQ A;  4K91 A;  4BEN A;  3C7U A;  2HDS A;  4WEK A;  1BSG A;  1W79 A;  2WGW B;  4RA7 A;  5JYP A;  3OPH A;  3V50 A;  5CHU A;  3UE0 A;  3WS5 A;  4KZ5 A;  4OKP A;  5AQ7 A;  1BT5 A;  2XD5 A;  4OPQ A;  3S22 A;  1EWZ A;  1ONG A;  5CGX A;  4DF6 A;  3A3D A;  5GHZ A;  3PAE A;  4KZA A;  1YLP A;  3TG9 A;  4OOL A;  4HBT A;  1H8Z A;  1O7E A;  4NK3 A;  3NY4 A;  3G2Y A;  3UDI A;  5HFO A;  1BTL A;  2JC7 A;  3IWI A;  4E6X A;  5HAQ A;  3PTE A;  4P0M A;  1HZO A;  3HUO A;  5M18 A;  1EI5 A;  4U0X A;  4S2L A;  4S2N A;  1TVF A;  5M19 A;  3GQZ A;  5F83 A;  1YQS A;  3M2J A;  4BD0 A;  1DY6 A;  3CJM A;  2WZZ A;  3O86 A;  1IKG A;  5DF7 A;  3HLG A;  2CC1 A;  4N1X A;  1XA7 A;  1E4D A;  1PYY A;  2ZC7 A;  5DTS A;  1JTD A;  1FR1 A;  1YLT A;  3G31 A;  2PU2 A;  2ZQ9 A;  3NDE A;  4S2N C;  4EV4 A;  5HAP A;  2ZQ8 A;  3BLS A;  2V2F F;  1DJA A;  1YLJ A;  3ZVW A;  1G68 A;  2WYX A;  3NC8 A;  4B88 A;  1K56 A;  4WMC D;  5FAS A;  3UPN A;  4E3K A;  3SS5 A;  3PBT A;  3UDX A;  5A91 A;  1NYY A;  3FKW A;  1E25 A;  2C5W B;  1IYQ A;  3BFD A;  4N1H A;  1KE3 A;  2C6W B;  5HL1 A;  2HP9 A;  3CMZ A;  2J9P A;  2Y2L A;  2ZC4 B;  4MBK A;  3E2L A;  2UWX A;  2PU4 A;  1L0G A;  2Y2P A;  1HTZ A;  4EUZ A;  2H0Y A;  5CRF A;  1FOF A;  4N9K A;  3PBO A;  2XD1 A;  3ZHH A;  4OPZ A;  1KVL A;  4MBF A;  4X69 A;  3S1Y A;  4WBG A;  1YM1 A;  4KQQ A;  4PPR A;  5CTN A;  3FZC A;  4IED A;  4KQO A;  3IF6 B;  3GRJ A;  3SS4 A;  3MZE A;  3UPP A;  2ZQA A;  3PBQ A;  3UPO A;  5EOO A;  5CHM A;  2FFF B;  5KZH A;  1S6R A;  2IWD A;  2ZM2 A;  3MZD A;  4UA6 A;  4OPR A;  3HLC A;  4OVD A;  4BJP A;  2Y59 A;  1ES3 A;  2Y2J A;  1ONH A;  4BL2 A;  1KDW A;  1J9M A;  1JWV A;  1HD8 A;  3OC2 A;  3OPL A;  5EVI D;  3NDG A;  1SDN A;  4WZ5 A;  4F94 A;  4OQ0 A;  3E2K A;  4S2K A;  3S4X A;  5IHV A;  3ZGA B;  3IWO A;  1NJ4 A;  4X56 A;  1LL9 A;  3O87 A;  2Q9N A;  4DKI A;  1O07 A;  3BFE A;  3O88 A;  2EXA A;  3N8R A;  3NIA A;  4UHU A;  4GZB A;  3VP1 A;  4WZ5 C;  3MFD A;  1FSW A;  2DRW A;  3N7W A;  1SKF A;  1K4E A;  5DF8 A;  3VOZ A;  3M2K A;  5AQB A;  4UA9 A;  4LV2 A;  3UN7 A;  3IF6 C;  4QY5 A;  3WS4 A;  5FQK A;  5FSR A;  1PZO A;  2J8Y A;  1LHY A;  5FAQ A;  3HBR A;  4QJG A;  3BRM A;  3CG5 A;  4JXW A;  4C3Q A;  3SH9 A;  3FKV A;  2OLV A;  1I2S A;  4EQI A;  3IHB A;  2OSU A;  2R9W A;  2X02 A;  3AGF A;  4GD6 A;  3VSK A;  4QU3 A;  5E2E A;  3G32 A;  5A90 A;  2WK0 A;  4S2P A;  3IT9 A;  4PM8 A;  4HBU A;  1N4O A;  2HDU A;  2Y2I A;  3G30 A;  3HRE A;  5FI7 A;  5CEC A;  1FCO A;  2ZC5 B;  5FDH A;  5EE8 A;  4X53 A;  3Q1F A;  1W8Y A;  4IBX A;  1M6K A;  1PWG A;  4RX3 A;  4JXV A;  4EBN A;  2Q9M A;  1L0E A;  2Y2G A;  3Q7V B;  4Q8I A;  2J9O A;  2XH9 A;  4GN2 A;  3C4P A;  4E3J A;  1YLW A;  1PI5 A;  3M6B A;  4C6Y A;  1E3U D;  1YLY A;  4OQG A;  4LV3 A;  4IBR A;  3FWL A;  3SH8 A;  1BLH A;  5BOH A;  4N92 A;  4GDN A;  2Y2N A;  4E3N A;  1ESI A;  1XA1 A;  4S2M A;  2JE5 A;  3UNW A;  4FD8 A;  4ZTK A;  3ITA A;  4LV1 A;  1PIO A;  4XXR A;  3MZF A;  4QB8 A;  3MXR A;  1OME A;  3ITB A;  4WEJ A;  1N9B A;  2V1Z A;  1TDG A;  3IH8 A;  4PMA A;  5E2G A;  1KGF A;  1U60 A;  4DDY A;  3WS1 A;  3ISG A;  1VQQ A;  1MWR A;  3Q07 A;  1YT4 A;  1PW8 A;  4N9L A;  4YFM A;  4QHC A;  4DXC A;  1I5Q A;  5FI6 A;  4Y7P A;  3IWQ A;  2XDM A;  4GNU A;  5DTT A;  4Y0O A;  1YLZ A;  2A3U A;  4LCM A;  2E8I A;  5JYO A;  3IHA A;  1C3B A;  4S2I A;  5HAR A;  1Q2Q A;  1G6A A;  4NET A;  4L0L A;  1K4F A;  4JKT A;  4B4X A;  2WGW A;  4QY6 A;  3V3R A;  1ERM A;  4WM9 A;  1BLP A;  1RGZ A;  5EEC A;  2DCF A;  1K6R A;  3LEZ A;  2Y2M A;  3DWK A;  3BEC A;  5AQA A;  4CJN A;  3W4O A;  4DE2 A;  4JF5 A;  2WKI A;  3UE1 A;  4MBH A;  5TR7 A;  1K55 A;  2P9V B;  5CTM A;  5E2H A;  2HDQ A;  3VP3 A;  1DJC A;  3IXH A;  3M6H A;  4X6T A;  4ZJ3 A;  3G4P A;  1LL5 A;  5I94 A;  4DE1 A;  4OPY A;  1K6S A;  3C4O A;  2EXB A;  4E6W A;  2ZD8 A;  4FH4 A;  2HDR A;  1K55 C;  4K0W A;  2Z2M B;  3CZD A;  5KSH A;  4E3O A;  1H8Y A;  4IVK A;  3GV9 A;  5FI2 A;  4DXB A;  2VGK A;  2ZQD A;  2XGN A;  4JLF A;  2Y4A A;  3LO7 A;  2BLS A;  3OCL A;  4K0X A;  4PM9 A;  4P85 A;  2OV5 A;  4DDS A;  1NZU A;  1W8Q A;  2XK1 A;  1CEF A;  4OLD A;  1FCN A;  4E3L A;  1W7F A;  3BFG A;  5HAI A;  3PBN A;  3N8S A;  4MNR A;  1PWC A;  5FQJ A;  2ZJ9 A;  2WUQ A;  5HX9 A;  4JPM A;  5GLC A;  1L0D A;  3DWZ A;  4OOM A;  4JBF A;  1CK3 A;  4X68 A;  5FAO A;  3C5A A;  3TSG A;  4OQH A;  3EQU A; 
#chains in the Genus database with same CATH topology
 5F1F A;  2WKP A;  4C75 A;  2X71 A;  1XP4 A;  4OH0 A;  1GHP A;  3VSL A;  2O9C A;  3UO9 A;  5E43 A;  1CQA A;  1KGG A;  3IF6 A;  1XXM A;  3VV4 A;  2UV0 E;  4R38 A;  2HGV A;  4WYY A;  3KYZ A;  4HI4 A;  2Y2Q A;  4KZ9 A;  3BFC A;  3A3J A;  5L10 A;  2IWB A;  4ARZ B;  2ZL1 B;  3T4S A;  4XUX A;  4D2O A;  3DW0 A;  4HEF A;  4KUO A;  4GLQ A;  4Y5F A;  5HPI A;  3F1P A;  4M3K A;  1LSX A;  5DF9 A;  4BL3 A;  1YMX A;  4KZ7 A;  2O9B A;  3S7O A;  1XJ4 A;  4KQR A;  1P97 A;  3BFF A;  3MXS A;  1X0O A;  1PW1 A;  4D60 A;  5IT5 A;  1T1A A;  1FSY A;  4GHI B;  5C5K A;  3FPV A;  5A92 A;  1AXB A;  2XFS A;  1ZKJ A;  2W1R A;  4OP8 A;  2KDK A;  2WKE A;  1BLC A;  5FAT A;  4H6J B;  2B5R A;  4IVI A;  1PFL A;  1K57 A;  2LB9 A;  4Q0J A;  5TFQ A;  2FFY A;  3IXD A;  3W4Q A;  3C7V A;  3TJZ C;  4OQI A;  1K25 A;  2E8J A;  1KE0 A;  4UQI M;  1BUL A;  1K54 C;  1ZC2 A;  3HUM A;  2RCX A;  4WZ4 A;  3W2Z A;  2XQZ A;  2LB5 A;  1JWP A;  4LCL A;  4ESP A;  3KYQ A;  1TS0 A;  4JF6 A;  1WA9 A;  4Q0I A;  1G6O A;  3GEC A;  4I3A A;  3S7Q A;  1XJ3 A;  1E3U A;  2J80 A;  3MKE A;  2INW A;  3B3X A;  2JBF A;  4ZJ1 A;  2K2N A;  2H28 A;  2QYB A;  5HDD A;  1NRF A;  4HJ4 A;  4O7D A;  4HP9 A;  5GHY A;  3CLO A;  3G6O A;  1SKO A;  2JKT M;  3QHY A;  1GHI A;  3G2Z A;  3WS0 A;  4ID4 A;  3DTM A;  3LR4 A;  4WL9 A;  2HP5 A;  5FL3 A;  3A3E A;  2BG1 A;  2H10 A;  3I7J A;  3U2A A;  3CI6 A;  3HLD A;  3EGX C;  2XEP A;  3GVB A;  2QZ6 A;  3WWX A;  4KG5 A;  5DVA A;  3C30 A;  2ZQC A;  3A3I A;  4I5S A;  3EOI A;  3QNB A;  3IBR A;  3LCE A;  1CI8 A;  3SS3 A;  5KSC A;  2M7V A;  3DBA A;  4GOG A;  5F82 A;  4ZAM A;  3ZCZ A;  1F2K A;  1OTE A;  1T19 A;  2EX2 A;  4UEY A;  1NZO A;  4LFU A;  1GHM A;  5G18 A;  3SOI A;  2D01 A;  1ERQ A;  1QMF A;  2ZL1 A;  2JCH A;  3DTE A;  2XRN A;  3OBF A;  4H8R A;  4FTX A;  5GLA A;  3VE4 A;  2ZC3 B;  5CHJ A;  5U47 A;  2HP6 A;  4KZ8 A;  2WZX A;  1NXY A;  4OP5 A;  4K91 A;  1JNU A;  3C7U A;  5AVF A;  4WEK A;  1BSG A;  2W1T B;  4WF0 A;  3IS2 B;  3V50 A;  5CHU A;  3UE0 A;  4KZ5 A;  1GSW A;  2JKR M;  3LUQ A;  2ZOI A;  4GHI A;  4HJ3 A;  3C38 A;  4H6J A;  1XJ6 A;  4EU0 A;  5HFO A;  4E6X A;  2JC7 A;  5HAQ A;  1EI5 A;  4S2L A;  4S2N A;  1OJG A;  4BD0 A;  3LR0 A;  1ACF A;  2WZZ A;  5IU1 A;  1Y28 A;  5DF7 A;  2L0W A;  2Z6C A;  4HQA A;  3LIB A;  4M4X A;  5HAP A;  1FR1 A;  2ZQ9 A;  4EV4 A;  2GX5 A;  1K56 A;  4CLC B;  3UDX A;  1NYY A;  3MXQ A;  4N1H A;  2C5W B;  1IYQ A;  3BFD A;  3IX4 A;  2J9P A;  2Y2L A;  1OTA A;  3H7W B;  4R6L A;  1L0G A;  3E4P A;  1IFQ A;  4OPZ A;  4X69 A;  4KQQ A;  5CTN A;  2PYP A;  5FEG A;  2ZQA A;  3E0Y A;  2FFF B;  5HD3 A;  1AWI A;  4BJP A;  4HH3 A;  3OPL A;  3OC2 A;  5EVI D;  4F94 A;  3ZGA B;  3R7W B;  1LL9 A;  2QHK A;  2Q9N A;  3BFE A;  2EXA A;  1Z09 A;  4UHU A;  3E98 A;  2GJ3 A;  3VP1 A;  1FSW A;  3NEC A;  1K4E A;  5AQB A;  1CF0 A;  3IX3 A;  3UN7 A;  4Y13 A;  3HBR A;  2W3D A;  3BQ8 A;  4JXW A;  3FKV A;  4GD6 A;  3K2N A;  1MZU A;  3G32 A;  4S2P A;  3KSI A;  2XA7 S;  3G30 A;  4XT2 A;  4LLO B;  1FCO A;  1M6K A;  4JXV A;  2Q9M A;  3MR0 A;  3Q7V B;  2XH9 A;  4I38 A;  4EET B;  1UWP X;  3FWL A;  3SH8 A;  4N92 A;  4GS9 A;  4E3N A;  1ESI A;  3ZYT A;  4ZTK A;  4LV1 A;  4GJ4 A;  3MXR A;  1OME A;  2V1Z A;  3D72 A;  4QHC A;  1I5Q A;  4Y7P A;  2CMN A;  3QP4 A;  4PHT A;  1IOU A;  1HLU P;  1PNE A;  4S2I A;  4L0L A;  2W1T A;  3JPU A;  4IJG A;  3IS2 A;  3KSG A;  2K31 A;  1ERM A;  1BLP A;  2O9A A;  3LEZ A;  4HOI A;  2Y2M A;  4CJN A;  4DE2 A;  2V0W A;  1VEU B;  3QP8 A;  3T4J A;  4MCW A;  3G4P A;  4LPZ A;  4OPY A;  4BBU A;  1K6S A;  3C4O A;  3JVV A;  2O0Y A;  5KSH A;  3MQO A;  3GV9 A;  5FI2 A;  2VGK A;  2XGN A;  2BLS A;  2B95 A;  2V1A A;  2Y8H A;  4P85 A;  1W8Q A;  3BFG A;  5AJG A;  2PD7 A;  4P6Z M;  1A0K A;  1PWC A;  2WUQ A;  3RFB A;  3EQU A;  2JKF A;  2PR6 A;  3ZG7 B;  2P08 A;  1WE4 A;  5FAP A;  4R3B A;  2PYR A;  5J8X A;  3W8K A;  2QPN A;  3BY8 A;  1NY0 A;  4OLG A;  1MWS A;  3D4F A;  1IEL A;  1JVJ A;  1S67 L;  3W4P A;  3WS2 A;  1ZG4 A;  5DJU A;  2WAF A;  3RXW A;  4S2O A;  1TS8 A;  4KZ6 A;  3NCK A;  5J4E A;  4EER A;  3R7W A;  4WMC A;  4B4Z A;  2XLN A;  1P9W A;  2L1M A;  1UWN X;  3MMH A;  2P74 A;  5F1G A;  3WRZ A;  5KMW A;  1KVM A;  3HVF A;  2ZOH A;  1MKI A;  2Y91 A;  2AVX A;  2WKQ A;  2WGV A;  3BJN A;  4HNB A;  2P7J A;  2L4R A;  1LI9 A;  3UB7 A;  3KSH A;  5E2F A;  3BLM A;  2ACG A;  4KZ4 A;  3VP2 A;  3MSH A;  3Q7Z A;  1XX2 A;  4LGW A;  3Q7V A;  4PKY G;  3R4K A;  2XRO A;  2VA0 A;  3NOT C;  1ES5 A;  2WAD A;  1K54 A;  4P6B A;  5EVI C;  4PM5 A;  2BTF P;  2JKT I;  1XGI A;  1ZTU A;  1PZP A;  3CAX A;  4KEN B;  1S0W A;  2VV8 A;  3HLB A;  1LSW A;  1XKZ A;  1W5D A;  2QMI A;  3HLW A;  2YKF A;  3IF5 A;  5GHX A;  4FCF A;  4R4S A;  3FC7 A;  3HLE A;  2ZMV A;  3OZH A;  2H0T A;  3UDF A;  1ESU A;  3JYI A;  1VEU A;  3V3S A;  4HES A;  4U3T A;  3B33 A;  5DKK A;  5DKL A;  1IKI A;  2NUT C;  2Z2L B;  3RXX A;  3DTI A;  3T1X A;  5DTK A;  3ZG9 B;  5EOE A;  5CEB A;  4YIN A;  2RL3 A;  3T4Q A;  4CPK A;  2B18 A;  2I72 A;  3UE6 A;  3V5M A;  1LT0 A;  1MPL A;  3UMD A;  3T4L A;  1S1Z A;  1XFQ A;  4BLM A;  1GSV A;  4G3V A;  4FH2 A;  4HHD A;  4MN5 A;  3PBS A;  3FYZ A;  1TS6 A;  1ALQ A;  4ZDX A;  2IWC A;  2Y2O A;  1IYP A;  2PR5 A;  3MBZ A;  1L2S A;  5EM0 A;  4MMN A;  1D1J A;  3IH9 A;  1YPR A;  3PXP A;  1XGJ A;  4WN5 A;  3LR3 A;  3ZG5 A;  5CER A;  1GCE A;  3ZNY A;  4LV0 A;  3SZT A;  4K08 A;  2R78 A;  4JGO A;  1Y4O A;  4RX2 A;  5DJT A;  4RQ9 A;  1P9R A;  4PAU A;  1PWD A;  5FQQ A;  3BQA A;  2XA7 M;  2WGW B;  4RA7 A;  3OPH A;  4OKP A;  4EEU A;  4DJ3 A;  3S22 A;  5CGX A;  4DF6 A;  5GHZ A;  1YLP A;  1H8Z A;  4NK3 A;  3UDI A;  2HF6 A;  5G4Z A;  5M18 A;  4U0X A;  1TVF A;  5M19 A;  5F83 A;  2V8C A;  3LGO A;  3TRC A;  3CJM A;  4N1X A;  4EUV A;  1XA7 A;  3NOU C;  1F98 A;  1ODV A;  3BLS A;  3LEQ A;  4I3J A;  1NLZ A;  4E3K A;  3SS5 A;  3PBT A;  5A91 A;  4NKP A;  3UB6 A;  2PAV P;  2QKP A;  3QP6 A;  3E2L A;  2UWX A;  3RTY A;  2XD1 A;  4MBF A;  3S1Y A;  4WBG A;  4L9E A;  2FH5 A;  1TS7 A;  2V9A A;  5EOO A;  5KZH A;  2IWD A;  2ZM2 A;  4OPR A;  4OVD A;  4BL2 A;  1OTB A;  1HD8 A;  3HJI A;  3NDG A;  3PYP A;  4Q0H A;  5IHV A;  3S4X A;  3IWO A;  1ZHH B;  2A24 A;  3LYX A;  1O07 A;  3O88 A;  5HDC A;  4WLA A;  2EWW A;  3MQQ A;  4GZB A;  4WZ5 C;  3MFD A;  4XT2 B;  2GNX A;  3UB8 A;  1SKF A;  1DP9 A;  4GW9 A;  3VOZ A;  2VLG A;  5F68 A;  4LV2 A;  3IF6 C;  5FQK A;  5FSR A;  1PZO A;  4QJG A;  3F1O B;  3BWL A;  4EQI A;  4GS9 B;  2R9W A;  3VSK A;  5A90 A;  5J7E A;  2JKG A;  2WK0 A;  3O5Y A;  2HDU A;  2Y2I A;  5FI7 A;  3HRE A;  5EE8 A;  4X53 A;  1KOU A;  1PWG A;  4EBN A;  2J9O A;  4E3J A;  3C4P A;  1TF1 A;  3MS6 A;  3M6B A;  4C6Y A;  2B02 A;  4OQG A;  2I9V A;  4EEP A;  2W3F A;  4GDN A;  3T4T A;  2Y2N A;  4I39 A;  2JE5 A;  4FD8 A;  5FDS A;  4LRX C;  1D7E A;  1PIO A;  4XXR A;  2JN7 A;  3S7P A;  4QB8 A;  3ITB A;  1N9B A;  1TDG A;  5E2G A;  4DDY A;  1U60 A;  1PW8 A;  4N9L A;  4YFM A;  2XDM A;  4HY8 A;  3BW6 A;  1C3B A;  3T1S A;  1G5U A;  2WGW A;  2VGL M;  4O8G A;  3DWK A;  2KLI A;  3W4O A;  2O99 A;  3UE1 A;  4MBH A;  5CTM A;  2HDQ A;  4ZJ3 A;  4KQD A;  2EXB A;  4FH4 A;  1D06 A;  1H8M A;  1K55 C;  4K0W A;  3KO6 A;  1H8Y A;  1VHM A;  4DN0 A;  3OCL A;  5EFW A;  1LSV A;  1W63 Q;  4CLC E;  4OLD A;  1CEF A;  1W7F A;  3PBN A;  1VET A;  2QJ5 A;  1OTI A;  1L0D A;  5FAO A;  2P04 A;  4OQH A;  1NRJ A;  3L7H A;  3BY9 A;  4KZB A;  4RYE A;  1VB6 A;  4B9O A;  3SW1 A;  3GDI A;  4DMZ A;  1XPB A;  4P87 A;  4PM7 A;  3DTK A;  1FCM A;  4E3M A;  3P01 A;  2IA2 A;  2Y55 A;  3QP5 A;  2JHE A;  3ZNT A;  3HUN A;  3CWF A;  3ZFZ A;  3VOY A;  4R1G A;  3QP2 A;  4G3W A;  2ZQ7 A;  2MJ6 A;  1YMS A;  5GLD A;  5FA7 A;  4IUK A;  1P0Z A;  2XF3 A;  1SCW A;  4MDZ A;  1L0F A;  5F5Y A;  2EX6 A;  1LI0 A;  3D3O A;  3VP4 A;  1QME A;  1ES4 A;  5TBM A;  5HWT A;  4Z9Q A;  5EUA A;  3OLO A;  3F1O A;  2G2W A;  4MN6 A;  2J3T D;  3UB5 P;  4LRY C;  1Y54 A;  5FQM A;  4BBV A;  2X01 A;  4U0T A;  3B47 A;  3BYD A;  4QD4 A;  5A93 A;  2A2L A;  1NYM A;  3HL9 A;  5EVI A;  3NI9 A;  1M40 A;  4CLC D;  1HVB A;  1DP8 A;  1BZA A;  4UQI S;  4EWF A;  2PBY A;  2YKH A;  2Z6D A;  1TEM A;  3WRT A;  2G2U A;  1KDS A;  4E3I A;  1W63 M;  4O0P A;  3IX8 A;  2FZ0 A;  5HW3 A;  4BD1 A;  5GLB A;  3N8L A;  4WEL A;  3ZDJ A;  4X55 A;  5EVE A;  3K3C A;  3O3V A;  3A0S A;  2QJ7 A;  1V9Y A;  5HWW A;  1FQG A;  2XR0 A;  1DP6 A;  1MBL A;  3MF0 A;  2EFX A;  4O01 A;  1STZ A;  3NBL A;  2W0N A;  3P7N A;  1IYO A;  3GTC A;  3GSG A;  3VFF A;  3EEA A;  3T50 A;  2W3G A;  2ZLY A;  1JWZ A;  1FR6 A;  4KG6 A;  1MY8 A;  2EWV A;  2W3E A;  5EVL A;  4LEN A;  1ES2 A;  4PM6 A;  1TD5 A;  1OTD A;  2V8F A;  3VP0 A;  2WGI A;  2VGJ A;  2XSS A;  3LFV A;  4ME4 A;  3V39 A;  4EBL A;  4BWI A;  4FUW A;  3MFX A;  4R3A A;  4FSF A;  3NOP C;  4RVA A;  3EEH A;  1KE4 A;  5EM1 A;  4ETZ A;  5HSQ A;  2ZC6 B;  5L09 A;  1Q2P A;  1RGY A;  5AQ9 A;  1UGU A;  5F69 A;  1CEG A;  1YKD A;  5M1A A;  1GSX A;  4NXE A;  1RP5 A;  3BEB A;  4JGQ A;  1PI4 A;  1MWU A;  5HDS A;  4R70 A;  1IEM A;  2ZMA A;  3AGE A;  4KUK A;  4HJ6 A;  4ETX A;  1BLS A;  2ZM0 A;  2G7U A;  3UY6 A;  3PBR A;  2Y2K A;  1S4S A;  5DFY A;  1H3Q A;  3L9K A;  4DRT A;  5EPH A;  3BM6 A;  1ZG6 A;  4BBT A;  5KIZ A;  1TDL A;  2XFT A;  3N4I A;  1N9O A;  3IQA A;  4JF4 A;  4X25 A;  4BEN A;  2HDS A;  1W79 A;  5JYP A;  2V1B A;  4I3I A;  4HH2 A;  5AQ7 A;  1T1C A;  2XD5 A;  4OPQ A;  2HJE A;  1EWZ A;  1PRQ A;  1O7E A;  3UB9 A;  1F9I A;  3NY4 A;  5FEF A;  1BTL A;  3D9Y A;  3PTE A;  3TW8 A;  4P0M A;  3HUO A;  5A8B A;  1DRM A;  3HJK A;  3GQZ A;  1DY6 A;  3O86 A;  5IS1 A;  3HLG A;  2CC1 A;  1E4D A;  1PYY A;  5AVE A;  5DTS A;  1H0M A;  1JTD A;  3G31 A;  2PU2 A;  3VOL A;  2PRF A;  1DJA A;  1YLJ A;  3ZVW A;  2WYX A;  1S4R A;  3F1N A;  3UPN A;  1L3L A;  3FKW A;  1E25 A;  1OJ5 A;  1KE3 A;  3CMZ A;  4MBK A;  2ZC4 B;  5TJJ A;  4B93 A;  2PU4 A;  2Y2P A;  2PT7 A;  1HTZ A;  4EUZ A;  2H0Y A;  5CRF A;  3NJA A;  1FOF A;  4N9K A;  3PBO A;  3ZHH A;  2J3T C;  2A24 B;  1YM1 A;  3FZC A;  4IED A;  4KQO A;  4X1M A;  5CHM A;  1S6R A;  4BMW A;  1ES3 A;  1KDW A;  2OAP 1;  1FIK A;  1J9M A;  2HZ5 A;  3CUE C;  1SDN A;  4WZ5 A;  4CLC C;  3E2K A;  4X56 A;  3O87 A;  4QWO A;  2W3H A;  3N8R A;  2JKR I;  3NIA A;  3S7N A;  1F5M A;  3H82 B;  4UA9 A;  5F6A A;  3WS4 A;  3MJQ A;  3LR5 A;  1LHY A;  4HP4 A;  3LIE A;  3SH9 A;  1I2S A;  3IHB A;  1CJF A;  2OSU A;  5E2E A;  4E04 A;  3IT9 A;  4PM8 A;  4HBU A;  1N4O A;  2HV1 A;  5CEC A;  5FDH A;  3Q1F A;  5HPF A;  4IBX A;  4Q8I A;  4RX3 A;  3JVU A;  3ULF A;  2Y2G A;  5L07 A;  4GN2 A;  1YLW A;  1PI5 A;  1E3U D;  1YLY A;  4IBR A;  1BLH A;  1XA1 A;  5HZH A;  2VV7 A;  3ITA A;  4DJ2 A;  1YSP A;  4WEJ A;  1KGF A;  3WS1 A;  3ISG A;  1MWR A;  1YT4 A;  5FI6 A;  4GNU A;  2D02 A;  3IHA A;  5HAR A;  1Q2Q A;  1G6A A;  3LI8 A;  4NET A;  2Q0O A;  4JKT A;  2PHY A;  4QY6 A;  3T4O A;  3V3R A;  2HJ9 C;  2DCF A;  2QWS A;  5AQA A;  3E4O A;  5TR7 A;  1K55 A;  2P9V B;  1S66 L;  5E2H A;  1VET B;  4X6T A;  5HD5 A;  1LL5 A;  4E6W A;  4P6Z S;  2HDR A;  3LI9 A;  2Z2M B;  2ZBB A;  4E3O A;  4IVK A;  4DXB A;  2ZQD A;  4JLF A;  4AFI A;  4EXO A;  5LBR A;  4DDS A;  3DAV A;  4E3L A;  5HAI A;  3K3D A;  5FQJ A;  2OOL A;  4JPM A;  5DFX A;  1CK3 A;  2GZA A;  5I5L A;  4NXF A;  1K38 A;  1WYC A;  2VV6 A;  3SH7 A;  1LLB A;  2HPB A;  3GMW A;  1T1B A;  1H5X A;  5J3W A;  3IBJ A;  4MLL A;  2H5S A;  2J7V A;  4EES A;  5MC7 A;  1MXO A;  3Q81 A;  5TBM B;  1S1Y A;  1CI9 A;  3VMA A;  4UA7 A;  4R0Q A;  3NHQ A;  4FOF A;  2EX8 A;  1BYW A;  1SHV A;  4ZJ2 A;  1DJB A;  3C2W A;  4R23 A;  3T12 B;  3TOI A;  2WAE A;  4Z1W A;  5CGW A;  3MQ0 A;  4KG2 A;  3KSF A;  4EW7 A;  5EVI B;  3PAG A;  3H82 A;  1OT9 A;  1BUE A;  4JXS A;  1G28 A;  1FIL A;  1K56 D;  3G35 A;  3IXG A;  4GB7 A;  4ARZ A;  2EFU A;  3RJU A;  3A3F A;  3FG8 A;  5FQI A;  3OPR A;  3LID A;  1GA0 A;  1I2W A;  5GL9 A;  3PR6 A;  4Y17 A;  4Y0U A;  4DE3 A;  3AGD A;  4A5R A;  4X1L A;  3G34 A;  5L2F A;  2A49 A;  5CGS A;  2M7U A;  3ZG0 A;  4IHQ A;  2R9X A;  2VZW A;  2ZM8 A;  2Y2H A;  1Z6F A;  1NWZ A;  1IYS A;  3ZG8 B;  2Y79 A;  1K57 C;  4R4R A;  2WKH A;  4GKU A;  4OON A;  2GDN A;  3FV7 A;  4NEE D;  2K7S A;  4MEZ A;  4R3J A;  2VKS A;  3VFH A;  4Y2F A;  3LIC A;  1MC0 A;  3P98 A;  4JGP A;  4L9G A;  1VM1 A;  2DNS A;  4YWZ A;  3GR2 A;  4XUZ A;  4L9F A;  4BQM A;  1YAX A;  3T4K A;  4ZRR A;  2NUP C;  2P9V A;  3PHY A;  4EQ1 A;  4NXB A;  5CED A;  3LY4 A;  3LY3 A;  2V0U A;  3HLF A;  1GA9 A;  1WYB A;  3N6I A;  1N9L A;  3EWK A;  5D3O A;  2OLU A;  4IUH A;  4JGR A;  4GD8 A;  1OPX A;  4GDB A;  3HCY A;  1RCJ A;  3EQV A;  3OPP A;  1MWT A;  3CPT B;  3IXB A;  3T1R A;  4LRZ E;  4S2J A;  4UAA A;  1JTG A;  4ZBE A;  5L8M A;  3QNC A;  3UE3 A;  1OT6 A;  4KZ3 A;  2V20 A;  4CQH A;  3MKF A;  4EBP A;  4DE0 A;  3ZVT A;  1SDE A;  2PD8 A;  4Y0T A;  5CXW A;  1KGE A;  3CIT A;  3RH8 B;  3T1Q B;  4JXG A;  3B42 A;  5TGF A;  2EX9 A;  5FQ9 A;  2KOI A;  1ERO A;  3UME A;  4G3K A;  2PDR A;  3P09 A;  3Q82 A;  3VE3 A;  4OOY A;  4GCZ A;  3OCN A;  1NLY A;  4Y15 A;  5EV0 A;  1K0K A;  2J3W A;  2OAQ 1;  3WS5 A;  1BT5 A;  1ONG A;  3A0R A;  3A3D A;  3PAE A;  4KZA A;  3TG9 A;  4OOL A;  4HBT A;  3F1N B;  3G2Y A;  4QPR A;  3IWI A;  1HZO A;  1YQS A;  3M2J A;  3U4L P;  1V9Z A;  4NG2 A;  1IKG A;  4F3L B;  3CHW P;  2VEA A;  3KYE A;  2ZC7 A;  1YLT A;  3NDE A;  4S2N C;  2ZQ8 A;  2V2F F;  1G68 A;  3NC8 A;  1J3W A;  4B88 A;  4WMC D;  5FAS A;  2C6W B;  5HL1 A;  2HP9 A;  5CX7 A;  2OWJ A;  3FPW A;  4PKY A;  1KVL A;  4PPR A;  3LIA A;  3IF6 B;  3GRJ A;  3SS4 A;  3MZE A;  3UPP A;  3H9W A;  3PBQ A;  3CUE A;  3UPO A;  4CLC A;  1MKM A;  3A0V A;  3MZD A;  4UA6 A;  3HLC A;  2Y59 A;  2Y2J A;  1ONH A;  3H7W A;  4WUJ A;  1JWV A;  5K5B A;  3ZQ5 A;  4OQ0 A;  4S2K A;  2ZMF A;  1NJ4 A;  4DKI A;  3F1P B;  3ICY A;  2WKR A;  2DRW A;  3N7W A;  5DF8 A;  3M2K A;  3CPT A;  4QY5 A;  5HL6 A;  2J8Y A;  3TE8 A;  5FAQ A;  3BRM A;  3CG5 A;  4C3Q A;  2OLV A;  3AGF A;  2X02 A;  3QP1 A;  4QU3 A;  5G4Y A;  3V67 A;  1XFN A;  2ZC5 B;  1W8Y A;  3KX0 X;  1L0E A;  3NUL A;  4HIA A;  3LIF A;  4NXG A;  4LV3 A;  5BOH A;  1T18 A;  4MN7 A;  4S2M A;  3UNW A;  1SZV A;  3MZF A;  4YOF A;  3IH8 A;  4PMA A;  1YSQ A;  1VQQ A;  2VGL S;  1N9N A;  3Q07 A;  3C8C A;  4DXC A;  5DTT A;  3IWQ A;  4Y0O A;  1YLZ A;  2A3U A;  5HWV A;  4LCM A;  2E8I A;  2VK3 A;  5JYO A;  1XJ2 A;  2OWH A;  1K4F A;  4B4X A;  3OOV A;  4WM9 A;  1RGZ A;  5EEC A;  1K6R A;  3EGD C;  3BEC A;  4Y3I A;  4JF5 A;  2WKI A;  2VJW A;  3VP3 A;  1DJC A;  3IXH A;  3M6H A;  5I94 A;  4DE1 A;  1EW0 A;  3E4Q A;  4II7 A;  2ZD8 A;  3CZD A;  2EA9 A;  1LL8 A;  4F3L A;  2Y4A A;  3LO7 A;  2PBD P;  4K0X A;  4PM9 A;  1SKO B;  2OV5 A;  1NZU A;  2XK1 A;  1FCN A;  2VX8 A;  2KX6 A;  3N8S A;  4YNR A;  4MNR A;  2ZJ9 A;  2W27 A;  5HX9 A;  5GLC A;  2DMW A;  3DWZ A;  4OOM A;  4JBF A;  4X68 A;  3C5A A;  3TSG A;  2M1C A;  2BAS A; 
#chains in the Genus database with same CATH homology
 1K38 A;  5F1F A;  3ZG7 B;  4C75 A;  4KZB A;  2X71 A;  1WYC A;  1XP4 A;  4OH0 A;  1GHP A;  4RYE A;  1WE4 A;  3VSL A;  3SH7 A;  5FAP A;  3UO9 A;  5E43 A;  4R3B A;  5J8X A;  3W8K A;  1LLB A;  1KGG A;  1XPB A;  2QPN A;  3IF6 A;  2HPB A;  4P87 A;  1NY0 A;  3GMW A;  1H5X A;  4PM7 A;  1XXM A;  4OLG A;  4MLL A;  1MWS A;  3D4F A;  1IEL A;  1FCM A;  1JVJ A;  2H5S A;  2J7V A;  4WYY A;  3W4P A;  3WS2 A;  4E3M A;  1ZG4 A;  1MXO A;  2Y55 A;  2WAF A;  2Y2Q A;  3Q81 A;  3ZNT A;  4KZ9 A;  1CI9 A;  3VMA A;  3BFC A;  3HUN A;  3A3J A;  4S2O A;  3RXW A;  4KZ6 A;  4UA7 A;  3ZFZ A;  4R0Q A;  3NCK A;  2EX8 A;  2IWB A;  3VOY A;  1SHV A;  4R1G A;  4XUX A;  4D2O A;  3DW0 A;  4ZJ2 A;  2ZQ7 A;  4HEF A;  4WMC A;  4B4Z A;  1YMS A;  2XLN A;  5GLD A;  5FA7 A;  1DJB A;  4R23 A;  4M3K A;  3TOI A;  2XF3 A;  2WAE A;  5DF9 A;  1SCW A;  2P74 A;  5CGW A;  5F1G A;  3WRZ A;  1L0F A;  5KMW A;  4KG2 A;  1KVM A;  3HVF A;  4BL3 A;  2EX6 A;  1MKI A;  1LI0 A;  1YMX A;  4KZ7 A;  5EVI B;  1QME A;  2Y91 A;  3PAG A;  3VP4 A;  1ES4 A;  1BUE A;  4JXS A;  2WGV A;  4Z9Q A;  4KQR A;  1K56 D;  3G35 A;  3IXG A;  5EUA A;  3BFF A;  3MXS A;  4GB7 A;  1PW1 A;  2EFU A;  2G2W A;  3A3F A;  3RJU A;  1LI9 A;  1Y54 A;  5FQI A;  3OPR A;  5FQM A;  1FSY A;  5E2F A;  1GA0 A;  3BLM A;  1I2W A;  5GL9 A;  2X01 A;  4U0T A;  4KZ4 A;  3VP2 A;  4Y0U A;  4DE3 A;  3BYD A;  5A92 A;  1AXB A;  2XFS A;  1ZKJ A;  3AGD A;  3Q7Z A;  4QD4 A;  1XX2 A;  4OP8 A;  5A93 A;  1NYM A;  2WKE A;  1BLC A;  3HL9 A;  5FAT A;  4A5R A;  5EVI A;  2B5R A;  4IVI A;  3Q7V A;  3G34 A;  3NI9 A;  5L2F A;  1K57 A;  2A49 A;  1M40 A;  1HVB A;  5CGS A;  1BZA A;  3ZG0 A;  2R9X A;  4EWF A;  5TFQ A;  2FFY A;  1ES5 A;  2PBY A;  2ZM8 A;  2Y2H A;  1TEM A;  3WRT A;  3IXD A;  2G2U A;  1Z6F A;  1K54 A;  1KDS A;  1IYS A;  2WAD A;  4P6B A;  5EVI C;  4E3I A;  4PM5 A;  3W4Q A;  3ZG8 B;  3C7V A;  1K57 C;  4OQI A;  4R4R A;  2WKH A;  5HW3 A;  1K25 A;  4BD1 A;  5GLB A;  4GKU A;  4OON A;  1KE0 A;  2GDN A;  1XGI A;  3FV7 A;  3N8L A;  4MEZ A;  4WEL A;  3ZDJ A;  1BUL A;  4R3J A;  1K54 C;  4X55 A;  1PZP A;  1ZC2 A;  3O3V A;  3HUM A;  4KEN B;  3VFH A;  1S0W A;  3HLB A;  2RCX A;  1XKZ A;  1W5D A;  4WZ4 A;  3P98 A;  2XQZ A;  2QMI A;  1JWP A;  4LCL A;  3HLW A;  1FQG A;  1VM1 A;  2DNS A;  3IF5 A;  2XR0 A;  5GHX A;  4FCF A;  4R4S A;  3GR2 A;  4JF6 A;  1MBL A;  4XUZ A;  2EFX A;  3HLE A;  4BQM A;  3NBL A;  3OZH A;  2H0T A;  3UDF A;  1ESU A;  3JYI A;  2P9V A;  3V3S A;  1E3U A;  4HES A;  1IYO A;  3GTC A;  3MKE A;  4U3T A;  3GSG A;  5CED A;  3VFF A;  3LY4 A;  3LY3 A;  3B3X A;  2ZLY A;  2JBF A;  4ZJ1 A;  1JWZ A;  1FR6 A;  3HLF A;  4KG6 A;  1IKI A;  1GA9 A;  1WYB A;  1MY8 A;  3N6I A;  3RXX A;  2Z2L B;  5D3O A;  2OLU A;  5EVL A;  5DTK A;  1NRF A;  5EOE A;  3ZG9 B;  5CEB A;  4LEN A;  4O7D A;  2RL3 A;  4YIN A;  5GHY A;  1ES2 A;  4PM6 A;  4GD8 A;  4CPK A;  3QHY A;  4GDB A;  3VP0 A;  1GHI A;  3G2Z A;  3WS0 A;  2I72 A;  2WGI A;  1RCJ A;  3EQV A;  3V5M A;  2VGJ A;  4ID4 A;  3DTM A;  3OPP A;  1MWT A;  3V39 A;  1MPL A;  4EBL A;  2HP5 A;  3IXB A;  3A3E A;  2BG1 A;  4FSF A;  4S2J A;  1JTG A;  4RVA A;  4UAA A;  1KE4 A;  4BLM A;  2H10 A;  2ZC6 B;  4ZBE A;  3I7J A;  1Q2P A;  3QNC A;  3UE3 A;  4FH2 A;  4KZ3 A;  3PBS A;  3HLD A;  1RGY A;  2XEP A;  3GVB A;  2QZ6 A;  3FYZ A;  5AQ9 A;  3WWX A;  1ALQ A;  4KG5 A;  4ZDX A;  2IWC A;  2Y2O A;  1IYP A;  5DVA A;  2V20 A;  1CEG A;  3MKF A;  4EBP A;  4DE0 A;  5M1A A;  3MBZ A;  2ZQC A;  3A3I A;  1SDE A;  3ZVT A;  3QNB A;  1RP5 A;  1L2S A;  3LCE A;  3SS3 A;  1CI8 A;  3BEB A;  4Y0T A;  5KSC A;  1PI4 A;  5CXW A;  1MWU A;  4GOG A;  1IEM A;  1KGE A;  2ZMA A;  3AGE A;  4ZAM A;  5F82 A;  3ZCZ A;  2EX2 A;  1NZO A;  1GHM A;  4JXG A;  5G18 A;  3SOI A;  3IH9 A;  5TGF A;  1BLS A;  2ZM0 A;  1ERQ A;  1QMF A;  3UY6 A;  2EX9 A;  1XGJ A;  2JCH A;  5FQ9 A;  3PBR A;  2Y2K A;  5CER A;  1GCE A;  3ZNY A;  3ZG5 A;  1ERO A;  4LV0 A;  4H8R A;  4DRT A;  5GLA A;  5EPH A;  3BM6 A;  1ZG6 A;  2ZC3 B;  3P09 A;  3Q82 A;  5CHJ A;  4RX2 A;  2HP6 A;  5U47 A;  1TDL A;  4KZ8 A;  4OOY A;  2XFT A;  3N4I A;  2WZX A;  3IQA A;  4JF4 A;  1NXY A;  3OCN A;  1PWD A;  4OP5 A;  5FQQ A;  4K91 A;  4BEN A;  3C7U A;  2HDS A;  4WEK A;  1BSG A;  1W79 A;  2WGW B;  4RA7 A;  5JYP A;  3OPH A;  3V50 A;  5CHU A;  3UE0 A;  3WS5 A;  4KZ5 A;  4OKP A;  5AQ7 A;  1BT5 A;  2XD5 A;  4OPQ A;  3S22 A;  1EWZ A;  1ONG A;  5CGX A;  4DF6 A;  3A3D A;  5GHZ A;  3PAE A;  4KZA A;  1YLP A;  3TG9 A;  4OOL A;  4HBT A;  1H8Z A;  1O7E A;  4NK3 A;  3NY4 A;  3G2Y A;  3UDI A;  5HFO A;  1BTL A;  2JC7 A;  3IWI A;  4E6X A;  5HAQ A;  3PTE A;  4P0M A;  1HZO A;  3HUO A;  5M18 A;  1EI5 A;  4U0X A;  4S2L A;  4S2N A;  1TVF A;  5M19 A;  3GQZ A;  5F83 A;  1YQS A;  3M2J A;  4BD0 A;  1DY6 A;  3CJM A;  2WZZ A;  3O86 A;  1IKG A;  5DF7 A;  3HLG A;  2CC1 A;  4N1X A;  1XA7 A;  1E4D A;  1PYY A;  2ZC7 A;  5DTS A;  1JTD A;  1FR1 A;  1YLT A;  3G31 A;  2PU2 A;  2ZQ9 A;  3NDE A;  4S2N C;  4EV4 A;  5HAP A;  2ZQ8 A;  3BLS A;  2V2F F;  1DJA A;  1YLJ A;  3ZVW A;  1G68 A;  2WYX A;  3NC8 A;  4B88 A;  1K56 A;  4WMC D;  5FAS A;  3UPN A;  4E3K A;  3SS5 A;  3PBT A;  3UDX A;  5A91 A;  1NYY A;  3FKW A;  1E25 A;  2C5W B;  1IYQ A;  3BFD A;  4N1H A;  1KE3 A;  2C6W B;  5HL1 A;  2HP9 A;  3CMZ A;  2J9P A;  2Y2L A;  2ZC4 B;  4MBK A;  3E2L A;  2UWX A;  2PU4 A;  1L0G A;  2Y2P A;  1HTZ A;  4EUZ A;  2H0Y A;  5CRF A;  1FOF A;  4N9K A;  3PBO A;  2XD1 A;  3ZHH A;  4OPZ A;  1KVL A;  4MBF A;  4X69 A;  3S1Y A;  4WBG A;  1YM1 A;  4KQQ A;  4PPR A;  5CTN A;  3FZC A;  4IED A;  4KQO A;  3IF6 B;  3GRJ A;  3SS4 A;  3MZE A;  3UPP A;  2ZQA A;  3PBQ A;  3UPO A;  5EOO A;  5CHM A;  2FFF B;  5KZH A;  1S6R A;  2IWD A;  2ZM2 A;  3MZD A;  4UA6 A;  4OPR A;  3HLC A;  4OVD A;  4BJP A;  2Y59 A;  1ES3 A;  2Y2J A;  1ONH A;  4BL2 A;  1KDW A;  1J9M A;  1JWV A;  1HD8 A;  3OC2 A;  3OPL A;  5EVI D;  3NDG A;  1SDN A;  4WZ5 A;  4F94 A;  4OQ0 A;  3E2K A;  4S2K A;  3S4X A;  5IHV A;  3ZGA B;  3IWO A;  1NJ4 A;  4X56 A;  1LL9 A;  3O87 A;  2Q9N A;  4DKI A;  1O07 A;  3BFE A;  3O88 A;  2EXA A;  3N8R A;  3NIA A;  4UHU A;  4GZB A;  3VP1 A;  4WZ5 C;  3MFD A;  1FSW A;  2DRW A;  3N7W A;  1SKF A;  1K4E A;  5DF8 A;  3VOZ A;  3M2K A;  5AQB A;  4UA9 A;  4LV2 A;  3UN7 A;  3IF6 C;  4QY5 A;  3WS4 A;  5FQK A;  5FSR A;  1PZO A;  2J8Y A;  1LHY A;  5FAQ A;  3HBR A;  4QJG A;  3BRM A;  3CG5 A;  4JXW A;  4C3Q A;  3SH9 A;  3FKV A;  2OLV A;  1I2S A;  4EQI A;  3IHB A;  2OSU A;  2R9W A;  2X02 A;  3AGF A;  4GD6 A;  3VSK A;  4QU3 A;  5E2E A;  3G32 A;  5A90 A;  2WK0 A;  4S2P A;  3IT9 A;  4PM8 A;  4HBU A;  1N4O A;  2HDU A;  2Y2I A;  3G30 A;  3HRE A;  5FI7 A;  5CEC A;  1FCO A;  2ZC5 B;  5FDH A;  5EE8 A;  4X53 A;  3Q1F A;  1W8Y A;  4IBX A;  1M6K A;  1PWG A;  4RX3 A;  4JXV A;  4EBN A;  2Q9M A;  1L0E A;  2Y2G A;  3Q7V B;  4Q8I A;  2J9O A;  2XH9 A;  4GN2 A;  3C4P A;  4E3J A;  1YLW A;  1PI5 A;  3M6B A;  4C6Y A;  1E3U D;  1YLY A;  4OQG A;  4LV3 A;  4IBR A;  3FWL A;  3SH8 A;  1BLH A;  5BOH A;  4N92 A;  4GDN A;  2Y2N A;  4E3N A;  1ESI A;  1XA1 A;  4S2M A;  2JE5 A;  3UNW A;  4FD8 A;  4ZTK A;  3ITA A;  4LV1 A;  1PIO A;  4XXR A;  3MZF A;  4QB8 A;  3MXR A;  1OME A;  3ITB A;  4WEJ A;  1N9B A;  2V1Z A;  1TDG A;  3IH8 A;  4PMA A;  5E2G A;  1KGF A;  1U60 A;  4DDY A;  3WS1 A;  3ISG A;  1VQQ A;  1MWR A;  3Q07 A;  1YT4 A;  1PW8 A;  4N9L A;  4YFM A;  4QHC A;  4DXC A;  1I5Q A;  5FI6 A;  4Y7P A;  3IWQ A;  2XDM A;  4GNU A;  5DTT A;  4Y0O A;  1YLZ A;  2A3U A;  4LCM A;  2E8I A;  5JYO A;  3IHA A;  1C3B A;  4S2I A;  5HAR A;  1Q2Q A;  1G6A A;  4NET A;  4L0L A;  1K4F A;  4JKT A;  4B4X A;  2WGW A;  4QY6 A;  3V3R A;  1ERM A;  4WM9 A;  1BLP A;  1RGZ A;  5EEC A;  2DCF A;  1K6R A;  3LEZ A;  2Y2M A;  3DWK A;  3BEC A;  5AQA A;  4CJN A;  3W4O A;  4DE2 A;  4JF5 A;  2WKI A;  3UE1 A;  4MBH A;  5TR7 A;  1K55 A;  2P9V B;  5CTM A;  5E2H A;  2HDQ A;  3VP3 A;  1DJC A;  3IXH A;  3M6H A;  4X6T A;  4ZJ3 A;  3G4P A;  1LL5 A;  5I94 A;  4DE1 A;  4OPY A;  1K6S A;  3C4O A;  2EXB A;  4E6W A;  2ZD8 A;  4FH4 A;  2HDR A;  1K55 C;  4K0W A;  2Z2M B;  3CZD A;  5KSH A;  4E3O A;  1H8Y A;  4IVK A;  3GV9 A;  5FI2 A;  4DXB A;  2VGK A;  2ZQD A;  2XGN A;  4JLF A;  2Y4A A;  3LO7 A;  2BLS A;  3OCL A;  4K0X A;  4PM9 A;  4P85 A;  2OV5 A;  4DDS A;  1NZU A;  1W8Q A;  2XK1 A;  1CEF A;  4OLD A;  1FCN A;  4E3L A;  1W7F A;  3BFG A;  5HAI A;  3PBN A;  3N8S A;  4MNR A;  1PWC A;  5FQJ A;  2ZJ9 A;  2WUQ A;  5HX9 A;  4JPM A;  5GLC A;  1L0D A;  3DWZ A;  4OOM A;  4JBF A;  1CK3 A;  4X68 A;  5FAO A;  3C5A A;  3TSG A;  4OQH A;  3EQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...