5FQIA

W229d and f290w mutant of the last common ancestor of gram-negative bacteria (gnca4) beta-lactamase class a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
263
structure length
263
Chain Sequence
ALSEQLAELEKRSGGRLGVAVLDTATGRRFGYRGDERFPMCSTFKALLAAAVLARVDQGKENLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITYSDNTAANLLLEALGGPAALTAFLRSIGDNVTRLDRWEPELNTAAPGDPRDTTTPAAMAATLRTLLLGDVLSPASRQQLVDWLIANKTGDKRLRAGLPADDRVGDKTGTGEHGTTNDIAVIWPPNRAPILVAVYLTESQVDADARDAVIAEVARLVVAAWHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNCA4 LACTAMASE W229D AND F290W
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 100
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqiA00
4PPRA 3MKEA 1RCJA 3O88A 5TR7A 1K4EA 5FAPA 5M18A 4E3JA 3PBNA 4KQOA 1XGJA 1K55C 3IXHA 1I5QA 4OKPA 5E2FA 1Y54A 5TGFA 4OPYA 4YFMA 2PU2A 2OLVA 3PAGA 1FQGA 3IXBA 2HDSA 3P09A 5CECA 1TEMA 4KQQA 3UDFA 1ESIA 3A3IA 5FQQA 3Q7VA 4P85A 2QPNA 3WS0A 2ZM8A 5FI6A 1NYMA 1FSYA 3A3JA 3BRMA 5CGSA 4Q8IA 1FR1A 2J8YA 1ES2A 1ALQA 4S2IA 5CHUA 2JCHA 4OPZA 5A92A 3UO9A 3NCKA 4KZ6A 4WMCA 1LL5A 2P9VB 3P98A 2ZQ8A 1IYPA 4QB8A 5GL9A 3WS2A 4KZAA 5CTNA 3AGEA 4E3KA 3IF6A 4EV4A 3O3VA 3NIAA 1NXYA 3TOIA 3C4PA 2V2FF 3BFDA 2Y91A 1KGEA 4YINA 4X69A 5E2HA 3NDEA 4MBFA 4R3JA 3TG9A 4GD6A 4S2NA 3UY6A 1CEGA 3G30A 3VP0A 4E3OA 2EX9A 5D3OA 3TSGA 3D4FA 1IYSA 2XFSA 4DXCA 5CGWA 2RL3A 4GOGA 4JF6A 5GLAA 1VQQA 3BECA 3S4XA 5FASA 5F1FA 2DCFA 3BFEA 1JVJA 3HUNA 4EBLA 5A90A 2ZMAA 5CHMA 4BJPA 1YLTA 2ZQDA 1ES5A 2Y2PA 4JPMA 2XEPA 4RVAA 4JKTA 2XR0A 1G68A 2XQZA 3G32A 3Q7VB 1KE4A 2Y2LA 3OPLA 3DWZA 4KZ9A 4F94A 3N6IA 1K55A 1QMEA 4R4SA 1GHMA 1HTZA 1SHVA 2EX8A 2HP5A 3VFFA 2WZXA 4MBKA 1QMFA 3SOIA 4FD8A 4N1XA 1GHIA 4EUZA 2IWDA 5M19A 2BG1A 3VOZA 1K38A 3W4QA 3AGDA 3FZCA 1H8ZA 4HBTA 5JYOA 1NYYA 3WS4A 3BFFA 4JXVA 4BENA 1FCMA 3IHBA 2A49A 1LLBA 4QD4A 3A3FA 3MFDA 3IHAA 2WGIA 4MEZA 4OOMA 4JXGA 5GLCA 5FI7A 5CERA 1Z6FA 2WYXA 2WADA 2G2WA 2CC1A 1ZG4A 3C5AA 3G2YA 2IWCA 3ISGA 1YM1A 4IBRA 5E2EA 4WELA 4LV1A 1BLCA 4EQIA 1FCNA 3BFGA 4K0WA 2E8IA 2ZC3B 2Y2OA 4D2OA 1LL9A 1XA7A 4P0MA 2R9WA 1DJCA 1E4DA 1WYCA 3OC2A 1JWPA 1W7FA 5FA7A 1I2WA 1H5XA 5AQ7A 3S22A 3VP3A 4N9KA 1XPBA 3GSGA 4UA6A 1BZAA 4GDNA 4LV3A 3VP4A 1NJ4A 2HPBA 2XDMA 2VGJA 1XP4A 3OCNA 2WUQA 4LV0A 1W8QA 3N8LA 4N1HA 3JYIA 4ZAMA 4ID4A 1L0DA 2Y2MA 1NRFA 3CJMA 4JF5A 3A3EA 4JXWA 3OPHA 3SS5A 5M1AA 5IHVA 1RP5A 4GN2A 4IBXA 3IH8A 2J9PA 4E6XA 3A3DA 4BL2A 5I94A 4UHUA 4XUXA 1ZKJA 1OMEA 4UA7A 5HAIA 2X01A 1H8YA 1XA1A 1O7EA 4WZ5C 4OQ0A 4DXBA 2JBFA 4K0XA 2ZC5B 2DRWA 1S6RA 2WKHA 1IELA 3IWQA 5DTSA 1K54C 2UWXA 1E3UD 1MWTA 3UPNA 2P74A 3BFCA 5GHXA 1CI9A 2G2UA 3NY4A 5AQAA 1KVMA 1WYBA 2RCXA 5GHZA 2XK1A 3GR2A 3OZHA 2JE5A 1PZPA 1HVBA 3ITBA 4OLGA 2EFUA 1L0EA 5EVID 4DE1A 2WGVA 3NBLA 2QMIA 4BD1A 5E2GA 3IT9A 3ZGAB 1K57C 3IWOA 3Q7ZA 3LY3A 2Y2NA 1Q2PA 1AXBA 4UAAA 1J9MA 3MZEA 4XUZA 4E3IA 5FQ9A 1BULA 4DRTA 1C3BA 5CHJA 4QY5A 4UA9A 3SS3A 3QHYA 5EE8A 3UDIA 1FSWA 3PBQA 4GDBA 3V3RA 4PM5A 4OQIA 5FQIA 5CEDA 4BQMA 2ZM0A 3EQUA 3WS1A 4DE2A 2Y4AA 5GHYA 3E2LA 4OOLA 3UE3A 4DF6A 2WK0A 1YLYA 5AQBA 3RXXA 3MXRA 3IXDA 5EUAA 3OPPA 4NETA 1WE4A 3VP2A 1ESUA 4IVKA 3RJUA 3W8KA 4S2LA 1VM1A 3CG5A 2EX6A 1K56A 5HW3A 3QNBA 3CZDA 3ZG8B 3V3SA 1MWRA 4A5RA 4WM9A 3LY4A 1TDLA 1O07A 4P6BA 1L0FA 1BLPA 1JTDA 4WZ5A 3MXSA 3BEBA 1YMSA 3V50A 5DF8A 1TDGA 1YLZA 5G18A 1ZC2A 4S2OA 4B88A 4KZBA 1K54A 3N7WA 3FV7A 2HDQA 4B4XA 4PM8A 5CXWA 2EFXA 5FAQA 3PTEA 4EWFA 4FH4A 4E6WA 1RGYA 4KZ8A 4E3LA 3ZVTA 5JYPA 4GB7A 1N9BA 4OVDA 1BT5A 3VP1A 1PI5A 3HVFA 1BSGA 4S2MA 1HZOA 3G2ZA 3DWKA 3IWIA 4K91A 5A91A 3Q1FA 1I2SA 2QZ6A 4DDYA 1K57A 1M40A 1ONHA 2Y2IA 2ZC6B 3NI9A 4GNUA 1FCOA 1MY8A 1IKGA 4KG5A 4KZ5A 3IF5A 4WZ4A 1S0WA 3GRJA 3N8SA 3PBOA 4HBUA 3VFHA 3BYDA 4QJGA 1MXOA 2I72A 4MLLA 1KVLA 4FSFA 3NC8A 4WMCD 4FH2A 5HFOA 4Z9QA 2C5WB 2ZQAA 2ZQCA 1YLWA 4X68A 2PBYA 1PYYA 2BLSA 1MBLA 2FFFB 5U47A 1LHYA 3ZCZA 1NZOA 2ZLYA 4JF4A 5FI2A 3HREA 4LCLA 5F1GA 2XH9A 3VSKA 1JTGA 4BL3A 1SDEA 3I7JA 4WBGA 1PW8A 3O87A 5FDHA 3SH7A 3SH9A 3PBTA 4KZ4A 4MNRA 4RA7A 4R3BA 3ZNYA 4XXRA 3WRTA 1JWVA 4OLDA 3UNWA 4OOYA 3MKFA 4QU3A 1YLJA 3BLSA 4P87A 2XD5A 5FQMA 4C75A 1LI9A 3IQAA 3LCEA 4L0LA 5L2FA 4CJNA 1XX2A 2Z2LB 4RX3A 1SKFA 1PWGA 3IH9A 3WRZA 1BUEA 4EBNA 4HEFA 3UDXA 1EWZA 4OQGA 1DJAA 5EOOA 1XGIA 4E3NA 1YQSA 4DE0A 4R4RA 1L2SA 3AGFA 3IF6C 4LENA 4GKUA 1RGZA 4RYEA 1JWZA 4LCMA 5CGXA 4OP5A 4JLFA 3RXWA 2HDUA 3HUMA 2XGNA 3MZDA 1L0GA 1GA0A 4QY6A 3HLWA 3WS5A 1M6KA 3W4OA 5FSRA 3ZG9B 2Y2GA 1G6AA 3FWLA 3UE1A 4OPQA 2EX2A 5TFQA 4BLMA 2DNSA 4HESA 1IYQA 5AQ9A 2ZQ7A 1XXMA 4N92A 4Y0OA 4WEJA 3M2KA 1W8YA 3S1YA 4KG6A 3LO7A 3C4OA 3FKWA 2HP6A 5F83A 5DVAA 3LEZA 4C6YA 3ZVWA 2Y2HA 2ZC7A 3DTMA 2Z2MB 4U0TA 3MZFA 5FQJA 4PM6A 4LV2A 3M2JA 4ZJ1A 2EXAA 4KQRA 1W79A 1KE3A 1ONGA 1PWCA 1GA9A 4BD0A 4Y7PA 5KMWA 2R9XA 3SS4A 3BLMA 4C3QA 3M6HA 4OONA 4S2PA 4ZTKA 5F82A 5E43A 5KSHA 4X55A 2J7VA 2Y2JA 1PI4A 1PW1A 5BOHA 4N9LA 2H0TA 5J8XA 5GLBA 2ZM2A 1MWSA 2V1ZA 5EVIC 2XD1A 1YT4A 2OSUA 1BTLA 2H0YA 5DTTA 1GCEA 1HD8A 2Q9NA 4IEDA 3UN7A 1FR6A 4OQHA 1KE0A 1PIOA 2WAEA 4OPRA 5A93A 2WKIA 3GTCA 1K6RA 1LI0A 1W5DA 4U3TA 3FKVA 3PBRA 1ES4A 5EVLA 3HLGA 4S2JA 4E3MA 4ZJ2A 4OH0A 4ZJ3A 1K25A 3ZG7B 1KGGA 4B4ZA 4M3KA 5HX9A 3OCLA 2IWBA 1IKIA 1ZG6A 3N4IA 4MBHA 4IVIA 3FYZA 5HARA 1YLPA 4S2KA 1CEFA 3M6BA 2WGWA 4KG2A 4ZDXA 2Y2KA 3G31A 5FATA 5FQKA 4DE3A 1E25A 2V20A 3E2KA 4QHCA 4H8RA 3ZDJA 2Q9MA 3NDGA 2HP9A 4R23A 4PMAA 3UPOA 1KDSA 2XLNA 3Q82A 4KZ3A 4O7DA 5EOEA 1GHPA 1NZUA 4FCFA 4CPKA 3G4PA 1NY0A 3BM6A 1KDWA 2XF3A 5GLDA 1ERQA 2ZD8A 1BLSA 4GZBA 1MKIA 2ZJ9A 3G34A 1ES3A 2C6WB 2WKEA 3HLDA 3ZHHA 4Y0TA 1E3UA 3IF6B 3DW0A 4R0QA 1IYOA 3N8RA 3V39A 2EXBA 1SDNA 2Y55A 1K4FA 2WAFA 5HAQA 1EI5A 5HAPA 5EPHA 3GVBA 3HLBA 3ZG5A 5EVIA 4PM9A 3V5MA 4OP8A 1SCWA 2GDNA 4X56A 1K56D 3VSLA 4NK3A 1BLHA 2ZQ9A 4RX2A 1K6SA 5EECA 4EBPA 3O86A 5CEBA 3Q07A 5HL1A 3UE0A 2H5SA 2JC7A 5CRFA 1YMXA 4WYYA 1CK3A 2WGWB 4GD8A 5KSCA 1DJBA 3CMZA 1N4OA 1EROA 3HLCA 3EQVA 4Y0UA 5FAOA 1PWDA 4ZBEA 3ZFZA 1PZOA 2WZZA 3W4PA 5DF9A 4U0XA 4DKIA 3C7UA 2X02A 1U60A 2OLUA 3ITAA 2B5RA 1FOFA 2Y2QA 4KENB 4PM7A 3MBZA 3PBSA 5DF7A 2Y59A 2FFYA 4KZ7A 5KZHA 3GV9A 1ERMA 4WEKA 3VMAA 3HLEA 3OPRA 1TVFA 2J9OA 1MPLA 3HL9A 1IEMA 2VGKA 1MWUA 5CTMA 2HDRA 3WWXA 2P9VA 4X6TA 3SH8A 4S2NC 1CI8A 5DTKA 3C7VA 4JBFA 2XFTA 3HBRA 3PAEA 3ZNTA 2H10A 4R1GA 1XKZA 3GQZA 1DY6A 3Q81A 3VOYA 3ZG0A 3GMWA 4DDSA 2X71A 5EVIB 2PU4A 3G35A 3IXGA 3QNCA 1KGFA 1Q2QA 4JXSA 4X53A 3B3XA 2A3UA 3UPPA 2OV5A 3HLFA 2ZC4B 3HUOA
chains in the Genus database with same CATH superfamily
4YWZA 3OOVA 3UE6A 3DTIA 5E2FA 1I5QA 5TGFA 4YFMA 4Q0IA 2OLVA 3PAGA 1W63M 4PKYA 3FPWA 4KQQA 1GSXA 3A3IA 2OWJA 1H8MA 3Q7VA 3WS0A 5FI6A 5CGSA 4EXOA 2JCHA 5A92A 3NCKA 3WS2A 4EV4A 4E3KA 5FDSA 3ZQ5A 3NIAA 3C4PA 1H3QA 1YSPA 1KGEA 5E2HA 3TG9A 4S2NA 3UY6A 3VP0A 5CGWA 2RL3A 5GLAA 4UEYA 5F1FA 2HF6A 2ZMAA 2J80A 4Y17A 2QWSA 3LR4A 3Q7VB 1KE4A 1LL8A 5DFXA 4AFIA 1YKDA 3N6IA 1GHMA 5HPIA 5DKLA 3SOIA 1GHIA 2W3EA 3WS4A 3BFFA 4JXVA 2V0WA 4Y15A 3A3FA 5L07A 4JXGA 5FI7A 2E8JA 2WYXA 4MCWA 2CC1A 1ZG4A 3G2YA 3LIBA 5E2EA 1N9NA 4MDZA 1FCNA 3DTEA 2E8IA 2ZC3B 2Y2OA 4NEED 1DJCA 1E4DA 2Z6DA 3NECA 1H0MA 1CQAA 1JWPA 4L9FA 3IX4A 3S22A 1T1CA 2W0NA 2QKPA 4GDNA 4LV3A 1NJ4A 1XP4A 1D06A 2WUQA 2JN7A 4N1HA 3JYIA 2GJ3A 4HP9A 4JXWA 3SS5A 2QYBA 5IHVA 1RP5A 2ACGA 4IBXA 4Z1WA 3NHQA 4R6LA 2M1CA 1OMEA 5HAIA 4HJ3A 4K0XA 2ZC5B 2WKHA 3IWQA 4Q0JA 1K54C 1NLYA 1G6OA 2UWXA 3UPNA 1CI9A 3OLOA 5KIZA 3CPTA 2V8FA 2JE5A 1HVBA 4CLCC 2GZAA 3LI9A 4LRZE 4OLGA 5C5KA 5EVID 2WGVA 4BD1A 3LFVA 2D02A 3ZGAB 1YSQA 3LY3A 1Q2PA 1AXBA 4UAAA 4XUZA 3VE4A 1C3BA 2ZOHA 4QWOA 3EWKA 5EE8A 1FSWA 5FQIA 4NXEA 2ZM0A 3EQUA 3MSHA 4O01A 3SZTA 3WS1A 3E2LA 3RXXA 1NLZA 4NETA 3W8KA 2VV8A 3TJZC 3IS2A 2EX6A 3MS6A 1A0KA 1OT9A 4WM9A 3CPTB 4P6BA 1JTDA 3MXSA 5DF8A 2HDQA 1S4RA 3PTEA 4EWFA 4KZ8A 4E3LA 3KYQA 4GB7A 4OVDA 3VP1A 3TW8A 2W27A 3T4QA 2VGLS 3Q1FA 3DBAA 2QZ6A 3NI9A 2ZC6B 5CX7A 4G3VA 1FCOA 4KG5A 1EW0A 3PBOA 5EVEA 3VFHA 2I72A 3IS2B 4P6ZS 4FSFA 3NC8A 4WMCD 4Z9QA 2C5WB 2ZQCA 1HLUP 1PYYA 1MBLA 1D1JA 5U47A 5F1GA 2XH9A 1SDEA 1PW8A 5FDHA 2UV0E 3PBTA 4QPRA 5FQMA 5IT5A 3IQAA 4EW7A 3LEQA 4EBNA 4WL9A 2O9AA 1XGIA 5FEFA 1L2SA 4ARZA 3UMEA 3SW1A 4HI4A 3HUMA 2A24A 1S67L 1UGUA 1L0GA 1ZTUA 3T4LA 3L9KA 3HLWA 1M6KA 3UE1A 4OPQA 2EX2A 5TFQA 2J3WA 4HESA 5AQ9A 2KLIA 3EEAA 3QP4A 3E4PA 1OJ5A 5EM1A 3FKWA 5F83A 3RH8B 2P7JA 4C6YA 3DTMA 2Z2MB 4U0TA 5FQJA 4ZJ1A 3CHWP 4KQRA 1ACFA 1ONGA 1PWCA 4Y7PA 5KMWA 2R9XA 3SS4A 4C3QA 5HD5A 4ZTKA 5E43A 5KSHA 4ARZB 4X55A 1PI4A 4N9LA 2A24B 5J8XA 2OSUA 2XD1A 2XSSA 5HSQA 1GCEA 3H9WA 4IEDA 1KE0A 2WAEA 1LI0A 1W5DA 4U3TA 5G4YA 3PBRA 1ES4A 4LLOB 4NXFA 4OH0A 4B4ZA 2IWBA 1IKIA 1ZG6A 4MBHA 4IVIA 3T4KA 2WGWA 2EWWA 4Y5FA 2V20A 3E2KA 2HP9A 4PMAA 5L10A 2O9BA 2PYPA 5EOEA 5EV0A 1NZUA 4FCFA 1KDWA 2XF3A 5GLDA 1ERQA 2ZD8A 3ZHHA 1E3UA 4ME4A 3B47A 3V39A 1Y28A 5HAPA 3P01A 3ZG5A 3V5MA 1XFQA 4EERA 1BLHA 4RX2A 5HL1A 2PBDP 5CEBA 4ETZA 4YOFA 5CRFA 2WGWB 3JVUA 1EROA 5FAOA 3EQVA 3W4PA 1TD5A 3C7UA 1U60A 2B5RA 4L9GA 4JGQA 4CLCD 1ERMA 3HLEA 3OPRA 2J9OA 3UB7A 3LIDA 4ZRRA 2K31A 3SH8A 1CI8A 3C7VA 2V1BA 3HBRA 1XKZA 3ZG0A 4DDSA 5J4EA 3IXGA 4PPRA 3O88A 4UQIM 5TR7A 5FAPA 3PBNA 4KQOA 1XGJA 1K55C 1V9ZA 4R70A 1FQGA 2HDSA 3P09A 1TEMA 3BW6A 3EOIA 1T19A 3NJAA 1G5UA 4NXBA 3R7WA 1FSYA 3BRMA 2J8YA 4S2IA 5DFYA 4QB8A 5CTNA 3IF6A 3O3VA 2V2FF 3F1PA 4YINA 4X69A 3NDEA 4MBFA 4R3JA 4GD6A 3MQOA 3TSGA 3LIEA 3T1SA 4DXCA 4NXGA 4YNRA 2DCFA 1JVJA 3K3CA 2ZQDA 2Y2PA 3LR5A 4JPMA 4JKTA 2XQZA 3G32A 4F94A 3DWZA 3KSIA 4O0PA 3R7WB 3K2NA 4R4SA 1HTZA 4H6JA 2EX8A 1P9WA 1STZA 5IS1A 4FD8A 4N1XA 2EWVA 3MFXA 3P7NA 5HDDA 3KSGA 4JGRA 2Y79A 2A49A 1LLBA 2O0YA 3ICYA 3F1PB 1Z6FA 2G2WA 2BTFP 1YM1A 4FUWA 4WELA 3BFGA 4D2OA 1LL9A 1XA7A 1WYCA 1LSVA 3UB8A 1W7FA 1I2WA 1H5XA 4N9KA 3GSGA 4UA6A 1BZAA 2HPBA 3OCNA 4H6JB 4LV0A 1L0DA 1NRFA 2WKRA 5M1AA 4GN2A 3A3DA 5LBRA 5I94A 4UHUA 2HZ5A 1O7EA 4WZ5C 4OQ0A 4DXBA 2JBFA 5DJUA 1S6RA 3EGDC 4EESA 4KUKA 2P74A 3NY4A 2RCXA 5GHZA 2XK1A 1PZPA 2EFUA 3KX0X 3NBLA 5E2GA 1K57C 3MZEA 4MN5A 2B95A 4DRTA 3V3RA 3PBQA 5CEDA 4DN0A 4F3LA 5GHYA 2QJ5A 2WK0A 4I3JA 4EUVA 3MXRA 5EUAA 1WE4A 1ESUA 4EEPA 3CG5A 1K56A 5AVEA 4HOIA 1OTEA 3QP8A 1TDLA 4EU0A 1BLPA 2GX5A 1YMSA 4B88A 4KZBA 2NUTC 3FV7A 4II7A 5CXWA 3LIFA 2EFXA 2PHYA 4I5SA 5FAQA 4Y2FA 4E6WA 1RGYA 1ODVA 3ZVTA 5JYPA 1BT5A 2VA0A 5HZHA 2VV6A 4S2MA 5HWWA 1HZOA 3BWLA 3IWIA 4K91A 3UB5P 1CJFA 1M40A 1T18A 4GNUA 5L09A 2HV1A 1MY8A 4F3LB 3KSFA 5FEGA 4KZ5A 1S0WA 4HJ6A 4NKPA 1MXOA 4FH2A 4X68A 1OJGA 2PBYA 3VOLA 2FFFB 1LHYA 4MN6A 3UB9A 3HREA 4LCLA 4BL3A 1VHMA 4WBGA 3SH7A 1T1BA 3ZNYA 4RA7A 4R3BA 4XXRA 3LR0A 4PKYG 3UNWA 2XD5A 3FPVA 4L0LA 1XX2A 3H82A 2ZL1A 1BUEA 4OQGA 1DJAA 4E3NA 1OT6A 4DE0A 2Q0OA 3IF6C 3T4TA 5CGXA 4JLFA 2HDUA 3UMDA 1PRQA 4QY6A 3WS5A 5FSRA 2DNSA 5AJGA 2YKHA 4I3AA 3EEHA 1LSWA 3M2KA 1S1ZA 3E0YA 5TBMA 4KG6A 5DVAA 2O9CA 2ZMVA 2ZC7A 2OAP1 1VEUA 3H82B 2ZL1B 4BD0A 4WN5A 5F82A 2JKRM 3H7WA 2ZM2A 1MWSA 2V1ZA 1YT4A 2K7SA 2H0YA 3ZYTA 1HD8A 2Q9NA 2V8CA 4JGOA 2I9VA 5EVLA 3HLGA 4S2JA 5TBMB 4E3MA 3CWFA 3CI6A 4ZJ2A 3MMHA 4M3KA 3FYZA 3M6BA 1VEUB 2VGLM 3MF0A 3T1RA 1DP8A 5FQKA 2VEAA 3QP6A 3MQ0A 4H8RA 3NDGA 1KDSA 3H7WB 4P6ZM 3BM6A 2XROA 3G34A 3HLDA 3DW0A 4R0QA 4EETB 1SDNA 5EPHA 3HLBA 5EVIA 4OP8A 4NK3A 2ZQ9A 4EBPA 3Q07A 2HGVA 1GSWA 2FZ0A 3R4KA 2JC7A 1YMXA 4WYYA 2L0WA 3ZFZA 4U0XA 2HJEA 1BYWA 2Y2QA 1FOFA 4KENB 4PM7A 2Y59A 5KZHA 3CUEA 3GV9A 3HL9A 1MWUA 5CTMA 3BY8A 4X6TA 4S2NC 4JBFA 2XFTA 3C8CA 3GQZA 1DY6A 3VOYA 2X71A 5EVIB 2PU4A 3QNCA 1KGFA 4GLQA 2OAQ1 4GS9A 3B3XA 2B02A 5F6AA 3S7PA 3T4OA 4KZ6A 3PR6A 1K4EA 4E3JA 2AVXA 3IXHA 2PRFA 4OPYA 3LR3A 4CQHA 5CECA 3IBJA 3A0RA 3L7HA 3UDFA 5FQQA 1F5MA 1S1YA 3CAXA 1NYMA 3MJQA 3A3JA 3KSHA 2R78A 1GSVA 4JGPA 1FR1A 2L1MA 1ES2A 4BWIA 3UO9A 4WMCA 2VJWA 2ZQ8A 1IYPA 3VV4A 4KZAA 4DJ3A 1NXYA 3BFDA 4HQAA 1N9LA 4GS9B 2EX9A 5D3OA 1P0ZA 3D4FA 1IYSA 2XFSA 4LRXC 4JF6A 1VQQA 3BECA 3S4XA 3BFEA 3HUNA 4EBLA 4GCZA 1YLTA 4PAUA 1ES5A 4Q0HA 2XEPA 4IUKA 1G68A 2Y2LA 2DMWA 4KZ9A 1QMEA 4WUJA 1SHVA 2HP5A 2G7UA 5F68A 4EUZA 2BG1A 3VOZA 3W4QA 3AGDA 2W1RA 1NYYA 4PHTA 4BENA 1FCMA 3IHAA 4OOMA 5GLCA 3KYEA 2GNXA 3IX8A 3C5AA 2IWCA 3C2WA 3ISGA 4LV1A 1BLCA 4EQIA 4K0WA 4DJ2A 2R9WA 3OC2A 1L3LA 5MC7A 3U4LP 4IJGA 5AQ7A 4FTXA 3VP4A 2VGJA 1W8QA 2W3GA 1YPRA 2ZMFA 4ID4A 3LI8A 1VETA 2Y2MA 2JKFA 4HHDA 4JF5A 3A3EA 3OPHA 1PNEA 4XT2B 2J9PA 4BL2A 4XUXA 1D7EA 1IELA 1MWTA 3BFCA 5GHXA 2G2UA 3EGXC 1WYBA 3GR2A 2ZOIA 1L0EA 4DE1A 3IT9A 4HH2A 3Q7ZA 2Y2NA 3DAVA 1XJ2A 4GHIA 3IBRA 1VETB 4E3IA 5FQ9A 1BULA 5CHJA 4UA9A 3SS3A 1F2KA 3QHYA 3UDIA 4PM5A 4OQIA 4DE2A 4ESPA 2Y4AA 3UE3A 4OOLA 4DF6A 1YAXA 3IXDA 3OPPA 3VP2A 4S2LA 3LUQA 2PDRA 4IUHA 3CZDA 4A5RA 1MWRA 3LY4A 4HP4A 1L0FA 3BEBA 2VLGA 1TDGA 1YLZA 4S2OA 1K54A 3N7WA 4PM8A 4G3WA 4LGWA 1N9BA 4GHIB 2V9AA 4WLAA 4CLCA 5HDSA 3HVFA 3G2ZA 4DDYA 2Y2IA 2EA9A 3D3OA 1IKGA 3F1NA 4WZ4A 2KX6A 3N8SA 3UB6A 2XA7S 1WA9A 1P97A 4QJGA 4MLLA 1Y4OA 2W3DA 4KUOA 1UWNX 3A0VA 1IOUA 2BLSA 2ZLYA 4JF4A 5FI2A 1N9OA 1NRJA 5EM0A 3O87A 3SH9A 4KZ4A 4MNRA 4CLCB 1JWVA 2V0UA 4OLDA 4QU3A 4RQ9A 1YLJA 2JKTM 3BLSA 3LCEA 5L2FA 1XFNA 3PXPA 4CJNA 1SKFA 3IH9A 2JKRI 2MJ6A 4HEFA 3JPUA 3NOTC 3UDXA 1EWZA 3F1NB 4BMWA 2JKGA 3T50A 4R4RA 4GKUA 1RGZA 3FG8A 4RYEA 1MKMA 4LCMA 4OP5A 3RXWA 3BJNA 4X25A 2XGNA 3CITA 5A8BA 1G6AA 3FWLA 3IX3A 4BLMA 1IYQA 4HJ4A 3GDIA 5DKKA 2ZQ7A 1XXMA 4N92A 1OTIA 4WEJA 3S1YA 3C4OA 3ZVWA 1XJ6A 4PM6A 2EXAA 2PR6A 1W79A 1GA9A 3G6OA 5F5YA 2Y2JA 1PW1A 2H0TA 5GLBA 3GECA 2PAVP 4I3IA 3JVVA 1BTLA 4HY8A 1F9IA 5DTTA 4X1LA 1DP9A 3UN7A 1FR6A 4OQHA 4MMNA 3NOPC 4OPRA 3S7NA 3GTCA 2W1TA 5A93A 3FKVA 4X1MA 4ZJ3A 4ETXA 1K25A 5HX9A 3OCLA 2JHEA 3N4IA 4S2KA 1CEFA 4ZDXA 2Y2KA 5HDCA 4LRYC 4DE3A 3ZDJA 1T1AA 4HNBA 4R23A 5EFWA 2XLNA 4KZ3A 3C30A 2PD7A 1BLSA 1MKIA 2C6WB 2WKEA 3HJIA 3BY9A 3TRCA 2H28A 3N8RA 5IU1A 2KOIA 2W1TB 3QP5A 2WAFA 1EI5A 5F69A 2W3FA 3CLOA 4BBTA 2L4RA 4PM9A 1SCWA 2GDNA 3VSLA 5EECA 3O86A 1V9YA 3NULA 1CK3A 4GD8A 5KSCA 3CMZA 3HLCA 4Y0UA 4ZBEA 1PZOA 2J3TC 2WZZA 5DF9A 4DKIA 1XJ3A 1PFLA 3B42A 2OLUA 3PBSA 1OPXA 2INWA 1MPLA 2PYRA 1S4SA 1IEMA 2VGKA 2A2LA 2P9VA 2WKQA 3TE8A 3PAEA 3ZNTA 2H10A 2LB9A 3HJKA 4R1GA 3Q81A 4LPZA 3KO6A 2D01A 5HWTA 1UWPX 4JXSA 5J3WA 3T1XA 3UPOA 3HLFA 3MKEA 1RCJA 4B9OA 5M18A 4OKPA 1Y54A 5K5BA 2PU2A 3IXBA 1ESIA 4P85A 2QPNA 3DTKA 1J3WA 2ZM8A 3C38A 4FOFA 4Q8IA 3VE3A 1ALQA 5CHUA 4OPZA 1LL5A 2P9VB 3P98A 5GL9A 4D60A 3AGEA 3E4OA 3TOIA 2Y8HA 2Y91A 4HIAA 1OTDA 1CEGA 3G30A 4E3OA 2HJ9C 5L8MA 2VK3A 4GJ4A 4GOGA 5FASA 5A90A 5CHMA 4BJPA 4O8GA 4BBUA 4RVAA 2XR0A 3OPLA 5G4ZA 1K55A 2PD8A 3VFFA 2WZXA 4MBKA 1QMFA 1XJ4A 1OTBA 3OBFA 2YKFA 2IWDA 5M19A 1P9RA 1K38A 3FZCA 1H8ZA 4HBTA 5JYOA 5DJTA 1CF0A 5I5LA 3IHBA 3QP2A 4QD4A 4IHQA 3MFDA 2WGIA 4MEZA 5CERA 2WADA 1IFQA 4WF0A 4IBRA 1AWIA 2NUPC 4P0MA 2QHKA 3F1OA 5FA7A 3MQQA 3VP3A 1XPBA 3T4SA 4Y13A 2XDMA 2WKPA 3N8LA 4LFUA 4ZAMA 3S7QA 4DMZA 3CJMA 3IH8A 4E6XA 2V1AA 1ZKJA 4UA7A 2X01A 1H8YA 1XA1A 3T12B 2XRNA 2DRWA 5DTSA 3QP1A 2ZBBA 1E3UD 1KOUA 2PT7A 1DRMA 5AQAA 1KVMA 3OZHA 3F1OB 3ITBA 4M4XA 2QMIA 1TS7A 3IWOA 3B33A 1K0KA 1J9MA 2ZC4B 3T4JA 4QY5A 4GDBA 5HPFA 4BQMA 1FIKA 1JNUA 1G28A 1YLYA 5AQBA 1TS6A 4R3AA 4IVKA 3RJUA 1VM1A 5HW3A 2KDKA 3QNBA 3ZG8B 3V3SA 1O07A 3K3DA 4WZ5A 2CMNA 2W3HA 1TS8A 3V50A 5G18A 1ZC2A 3FC7A 4B4XA 3NOUC 1S66L 4R38A 4FH4A 2JKTI 3LIAA 1FILA 1PI5A 1MZUA 1BSGA 3DWKA 5A91A 3RFBA 4E04A 1I2SA 2O99A 1K57A 1ONHA 4XT2A 1MC0A 2BASA 1LSXA 3IF5A 3GRJA 2OWHA 4HBUA 3BYDA 2J3TD 1KVLA 3E4QA 5HFOA 2ZQAA 1YLWA 4HH3A 2P08A 4L9EA 3ZCZA 1NZOA 1DP6A 3LGOA 3HCYA 3VSKA 4Y3IA 1JTGA 2OOLA 1X0OA 3I7JA 1LT0A 3KYZA 3WRTA 4OOYA 3MKFA 4P87A 4C75A 5TJJA 1LI9A 3A0SA 4RX3A 2Z2LB 1PWGA 3WRZA 2K2NA 2FH5A 5EOOA 2VV7A 1YQSA 3AGFA 4LENA 1F98A 1JWZA 2Z6CA 1NWZA 1TF1A 3MZDA 1GA0A 4I39A 3W4OA 3ZG9B 2Y2GA 4CLCE 3ULFA 4Y0OA 1W8YA 3LO7A 4KQDA 2HP6A 3LEZA 4UQIS 2Y2HA 5HD3A 3D9YA 4BBVA 3MZFA 4LV2A 3M2JA 3S7OA 3BQAA 1KE3A 4K08A 5J7EA 1Z09A 3BLMA 3M6HA 4OONA 4S2PA 1TS0A 2LB5A 2J7VA 5BOHA 4EQ1A 3U2AA 2P04A 5EVIC 4NG2A 4B93A 1ZHHB 1PIOA 2WKIA 1K6RA 5HWVA 4I38A 1SZVA 4GW9A 3ZG7B 1KGGA 4G3KA 5HARA 1YLPA 4KG2A 3CUEC 3D72A 3G31A 3MXQA 3O5YA 5FATA 1E25A 1W63Q 4QHCA 1SKOA 5AVFA 2Q9MA 2XA7M 1OTAA 3W2ZA 3Q82A 4O7DA 1GHPA 4CPKA 3G4PA 1NY0A 5HL6A 4GZBA 2ZJ9A 4Y0TA 1ES3A 2B18A 2VKSA 3IF6B 3LICA 1IYOA 2EXBA 2Y55A 5HAQA 1K4FA 3BQ8A 3GVBA 2M7VA 3PHYA 3V67A 3MR0A 3LYXA 4X56A 1K56D 1K6SA 3UE0A 2H5SA 2PR5A 1DJBA 1N4OA 1PWDA 5FL3A 2X02A 3ITAA 1SKOB 3MBZA 5DF7A 3T1QB 2FFYA 1VB6A 3E98A 4KZ7A 3RTYA 4WEKA 3VMAA 1TVFA 4MN7A 4EEUA 3PYPA 2HDRA 3WWXA 2IA2A 2VZWA 5DTKA 2VX8A 3GMWA 3G35A 2QJ7A 1Q2QA 2M7UA 3UPPA 2A3UA 2OV5A 4X53A 3HUOA
chains in the Genus database with same CATH topology
4PPRA 3MKEA 1RCJA 3O88A 5TR7A 1K4EA 5FAPA 5M18A 4E3JA 3PBNA 4KQOA 1XGJA 1K55C 3IXHA 1I5QA 4OKPA 5E2FA 1Y54A 5TGFA 4OPYA 4YFMA 2PU2A 2OLVA 3PAGA 1FQGA 3IXBA 2HDSA 3P09A 5CECA 1TEMA 4KQQA 3UDFA 1ESIA 3A3IA 5FQQA 3Q7VA 4P85A 2QPNA 3WS0A 2ZM8A 5FI6A 1NYMA 1FSYA 3A3JA 3BRMA 5CGSA 4Q8IA 1FR1A 2J8YA 1ES2A 1ALQA 4S2IA 5CHUA 2JCHA 4OPZA 5A92A 3UO9A 3NCKA 4KZ6A 4WMCA 1LL5A 2P9VB 3P98A 2ZQ8A 1IYPA 4QB8A 5GL9A 3WS2A 4KZAA 5CTNA 3AGEA 4E3KA 3IF6A 4EV4A 3O3VA 3NIAA 1NXYA 3TOIA 3C4PA 2V2FF 3BFDA 2Y91A 1KGEA 4YINA 4X69A 5E2HA 3NDEA 4MBFA 4R3JA 3TG9A 4GD6A 4S2NA 3UY6A 1CEGA 3G30A 3VP0A 4E3OA 2EX9A 5D3OA 3TSGA 3D4FA 1IYSA 2XFSA 4DXCA 5CGWA 2RL3A 4GOGA 4JF6A 5GLAA 1VQQA 3BECA 3S4XA 5FASA 5F1FA 2DCFA 3BFEA 1JVJA 3HUNA 4EBLA 5A90A 2ZMAA 5CHMA 4BJPA 1YLTA 2ZQDA 1ES5A 2Y2PA 4JPMA 2XEPA 4RVAA 4JKTA 2XR0A 1G68A 2XQZA 3G32A 3Q7VB 1KE4A 2Y2LA 3OPLA 3DWZA 4KZ9A 4F94A 3N6IA 1K55A 1QMEA 4R4SA 1GHMA 1HTZA 1SHVA 2EX8A 2HP5A 3VFFA 2WZXA 4MBKA 1QMFA 3SOIA 4FD8A 4N1XA 1GHIA 4EUZA 2IWDA 5M19A 2BG1A 3VOZA 1K38A 3W4QA 3AGDA 3FZCA 1H8ZA 4HBTA 5JYOA 1NYYA 3WS4A 3BFFA 4JXVA 4BENA 1FCMA 3IHBA 2A49A 1LLBA 4QD4A 3A3FA 3MFDA 3IHAA 2WGIA 4MEZA 4OOMA 4JXGA 5GLCA 5FI7A 5CERA 1Z6FA 2WYXA 2WADA 2G2WA 2CC1A 1ZG4A 3C5AA 3G2YA 2IWCA 3ISGA 1YM1A 4IBRA 5E2EA 4WELA 4LV1A 1BLCA 4EQIA 1FCNA 3BFGA 4K0WA 2E8IA 2ZC3B 2Y2OA 4D2OA 1LL9A 1XA7A 4P0MA 2R9WA 1DJCA 1E4DA 1WYCA 3OC2A 1JWPA 1W7FA 5FA7A 1I2WA 1H5XA 5AQ7A 3S22A 3VP3A 4N9KA 1XPBA 3GSGA 4UA6A 1BZAA 4GDNA 4LV3A 3VP4A 1NJ4A 2HPBA 2XDMA 2VGJA 1XP4A 3OCNA 2WUQA 4LV0A 1W8QA 3N8LA 4N1HA 3JYIA 4ZAMA 4ID4A 1L0DA 2Y2MA 1NRFA 3CJMA 4JF5A 3A3EA 4JXWA 3OPHA 3SS5A 5M1AA 5IHVA 1RP5A 4GN2A 4IBXA 3IH8A 2J9PA 4E6XA 3A3DA 4BL2A 5I94A 4UHUA 4XUXA 1ZKJA 1OMEA 4UA7A 5HAIA 2X01A 1H8YA 1XA1A 1O7EA 4WZ5C 4OQ0A 4DXBA 2JBFA 4K0XA 2ZC5B 2DRWA 1S6RA 2WKHA 1IELA 3IWQA 5DTSA 1K54C 2UWXA 1E3UD 1MWTA 3UPNA 2P74A 3BFCA 5GHXA 1CI9A 2G2UA 3NY4A 5AQAA 1KVMA 1WYBA 2RCXA 5GHZA 2XK1A 3GR2A 3OZHA 2JE5A 1PZPA 1HVBA 3ITBA 4OLGA 2EFUA 1L0EA 5EVID 4DE1A 2WGVA 3NBLA 2QMIA 4BD1A 5E2GA 3IT9A 3ZGAB 1K57C 3IWOA 3Q7ZA 3LY3A 2Y2NA 1Q2PA 1AXBA 4UAAA 1J9MA 3MZEA 4XUZA 4E3IA 5FQ9A 1BULA 4DRTA 1C3BA 5CHJA 4QY5A 4UA9A 3SS3A 3QHYA 5EE8A 3UDIA 1FSWA 3PBQA 4GDBA 3V3RA 4PM5A 4OQIA 5FQIA 5CEDA 4BQMA 2ZM0A 3EQUA 3WS1A 4DE2A 2Y4AA 5GHYA 3E2LA 4OOLA 3UE3A 4DF6A 2WK0A 1YLYA 5AQBA 3RXXA 3MXRA 3IXDA 5EUAA 3OPPA 4NETA 1WE4A 3VP2A 1ESUA 4IVKA 3RJUA 3W8KA 4S2LA 1VM1A 3CG5A 2EX6A 1K56A 5HW3A 3QNBA 3CZDA 3ZG8B 3V3SA 1MWRA 4A5RA 4WM9A 3LY4A 1TDLA 1O07A 4P6BA 1L0FA 1BLPA 1JTDA 4WZ5A 3MXSA 3BEBA 1YMSA 3V50A 5DF8A 1TDGA 1YLZA 5G18A 1ZC2A 4S2OA 4B88A 4KZBA 1K54A 3N7WA 3FV7A 2HDQA 4B4XA 4PM8A 5CXWA 2EFXA 5FAQA 3PTEA 4EWFA 4FH4A 4E6WA 1RGYA 4KZ8A 4E3LA 3ZVTA 5JYPA 4GB7A 1N9BA 4OVDA 1BT5A 3VP1A 1PI5A 3HVFA 1BSGA 4S2MA 1HZOA 3G2ZA 3DWKA 3IWIA 4K91A 5A91A 3Q1FA 1I2SA 2QZ6A 4DDYA 1K57A 1M40A 1ONHA 2Y2IA 2ZC6B 3NI9A 4GNUA 1FCOA 1MY8A 1IKGA 4KG5A 4KZ5A 3IF5A 4WZ4A 1S0WA 3GRJA 3N8SA 3PBOA 4HBUA 3VFHA 3BYDA 4QJGA 1MXOA 2I72A 4MLLA 1KVLA 4FSFA 3NC8A 4WMCD 4FH2A 5HFOA 4Z9QA 2C5WB 2ZQAA 2ZQCA 1YLWA 4X68A 2PBYA 1PYYA 2BLSA 1MBLA 2FFFB 5U47A 1LHYA 3ZCZA 1NZOA 2ZLYA 4JF4A 5FI2A 3HREA 4LCLA 5F1GA 2XH9A 3VSKA 1JTGA 4BL3A 1SDEA 3I7JA 4WBGA 1PW8A 3O87A 5FDHA 3SH7A 3SH9A 3PBTA 4KZ4A 4MNRA 4RA7A 4R3BA 3ZNYA 4XXRA 3WRTA 1JWVA 4OLDA 3UNWA 4OOYA 3MKFA 4QU3A 1YLJA 3BLSA 4P87A 2XD5A 5FQMA 4C75A 1LI9A 3IQAA 3LCEA 4L0LA 5L2FA 4CJNA 1XX2A 2Z2LB 4RX3A 1SKFA 1PWGA 3IH9A 3WRZA 1BUEA 4EBNA 4HEFA 3UDXA 1EWZA 4OQGA 1DJAA 5EOOA 1XGIA 4E3NA 1YQSA 4DE0A 4R4RA 1L2SA 3AGFA 3IF6C 4LENA 4GKUA 1RGZA 4RYEA 1JWZA 4LCMA 5CGXA 4OP5A 4JLFA 3RXWA 2HDUA 3HUMA 2XGNA 3MZDA 1L0GA 1GA0A 4QY6A 3HLWA 3WS5A 1M6KA 3W4OA 5FSRA 3ZG9B 2Y2GA 1G6AA 3FWLA 3UE1A 4OPQA 2EX2A 5TFQA 4BLMA 2DNSA 4HESA 1IYQA 5AQ9A 2ZQ7A 1XXMA 4N92A 4Y0OA 4WEJA 3M2KA 1W8YA 3S1YA 4KG6A 3LO7A 3C4OA 3FKWA 2HP6A 5F83A 5DVAA 3LEZA 4C6YA 3ZVWA 2Y2HA 2ZC7A 3DTMA 2Z2MB 4U0TA 3MZFA 5FQJA 4PM6A 4LV2A 3M2JA 4ZJ1A 2EXAA 4KQRA 1W79A 1KE3A 1ONGA 1PWCA 1GA9A 4BD0A 4Y7PA 5KMWA 2R9XA 3SS4A 3BLMA 4C3QA 3M6HA 4OONA 4S2PA 4ZTKA 5F82A 5E43A 5KSHA 4X55A 2J7VA 2Y2JA 1PI4A 1PW1A 5BOHA 4N9LA 2H0TA 5J8XA 5GLBA 2ZM2A 1MWSA 2V1ZA 5EVIC 2XD1A 1YT4A 2OSUA 1BTLA 2H0YA 5DTTA 1GCEA 1HD8A 2Q9NA 4IEDA 3UN7A 1FR6A 4OQHA 1KE0A 1PIOA 2WAEA 4OPRA 5A93A 2WKIA 3GTCA 1K6RA 1LI0A 1W5DA 4U3TA 3FKVA 3PBRA 1ES4A 5EVLA 3HLGA 4S2JA 4E3MA 4ZJ2A 4OH0A 4ZJ3A 1K25A 3ZG7B 1KGGA 4B4ZA 4M3KA 5HX9A 3OCLA 2IWBA 1IKIA 1ZG6A 3N4IA 4MBHA 4IVIA 3FYZA 5HARA 1YLPA 4S2KA 1CEFA 3M6BA 2WGWA 4KG2A 4ZDXA 2Y2KA 3G31A 5FATA 5FQKA 4DE3A 1E25A 2V20A 3E2KA 4QHCA 4H8RA 3ZDJA 2Q9MA 3NDGA 2HP9A 4R23A 4PMAA 3UPOA 1KDSA 2XLNA 3Q82A 4KZ3A 4O7DA 5EOEA 1GHPA 1NZUA 4FCFA 4CPKA 3G4PA 1NY0A 3BM6A 1KDWA 2XF3A 5GLDA 1ERQA 2ZD8A 1BLSA 4GZBA 1MKIA 2ZJ9A 3G34A 1ES3A 2C6WB 2WKEA 3HLDA 3ZHHA 4Y0TA 1E3UA 3IF6B 3DW0A 4R0QA 1IYOA 3N8RA 3V39A 2EXBA 1SDNA 2Y55A 1K4FA 2WAFA 5HAQA 1EI5A 5HAPA 5EPHA 3GVBA 3HLBA 3ZG5A 5EVIA 4PM9A 3V5MA 4OP8A 1SCWA 2GDNA 4X56A 1K56D 3VSLA 4NK3A 1BLHA 2ZQ9A 4RX2A 1K6SA 5EECA 4EBPA 3O86A 5CEBA 3Q07A 5HL1A 3UE0A 2H5SA 2JC7A 5CRFA 1YMXA 4WYYA 1CK3A 2WGWB 4GD8A 5KSCA 1DJBA 3CMZA 1N4OA 1EROA 3HLCA 3EQVA 4Y0UA 5FAOA 1PWDA 4ZBEA 3ZFZA 1PZOA 2WZZA 3W4PA 5DF9A 4U0XA 4DKIA 3C7UA 2X02A 1U60A 2OLUA 3ITAA 2B5RA 1FOFA 2Y2QA 4KENB 4PM7A 3MBZA 3PBSA 5DF7A 2Y59A 2FFYA 4KZ7A 5KZHA 3GV9A 1ERMA 4WEKA 3VMAA 3HLEA 3OPRA 1TVFA 2J9OA 1MPLA 3HL9A 1IEMA 2VGKA 1MWUA 5CTMA 2HDRA 3WWXA 2P9VA 4X6TA 3SH8A 4S2NC 1CI8A 5DTKA 3C7VA 4JBFA 2XFTA 3HBRA 3PAEA 3ZNTA 2H10A 4R1GA 1XKZA 3GQZA 1DY6A 3Q81A 3VOYA 3ZG0A 3GMWA 4DDSA 2X71A 5EVIB 2PU4A 3G35A 3IXGA 3QNCA 1KGFA 1Q2QA 4JXSA 4X53A 3B3XA 2A3UA 3UPPA 2OV5A 3HLFA 2ZC4B 3HUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PPR A;  3MKE A;  1RCJ A;  3O88 A;  5TR7 A;  1K4E A;  5FAP A;  5M18 A;  4E3J A;  3PBN A;  4KQO A;  1XGJ A;  1K55 C;  3IXH A;  1I5Q A;  4OKP A;  5E2F A;  1Y54 A;  5TGF A;  4OPY A;  4YFM A;  2PU2 A;  2OLV A;  3PAG A;  1FQG A;  3IXB A;  2HDS A;  3P09 A;  5CEC A;  1TEM A;  4KQQ A;  3UDF A;  1ESI A;  3A3I A;  5FQQ A;  3Q7V A;  4P85 A;  2QPN A;  3WS0 A;  2ZM8 A;  5FI6 A;  1NYM A;  1FSY A;  3A3J A;  3BRM A;  5CGS A;  4Q8I A;  1FR1 A;  2J8Y A;  1ES2 A;  1ALQ A;  4S2I A;  5CHU A;  2JCH A;  4OPZ A;  5A92 A;  3UO9 A;  3NCK A;  4KZ6 A;  4WMC A;  1LL5 A;  2P9V B;  3P98 A;  2ZQ8 A;  1IYP A;  4QB8 A;  5GL9 A;  3WS2 A;  4KZA A;  5CTN A;  3AGE A;  4E3K A;  3IF6 A;  4EV4 A;  3O3V A;  3NIA A;  1NXY A;  3TOI A;  3C4P A;  2V2F F;  3BFD A;  2Y91 A;  1KGE A;  4YIN A;  4X69 A;  5E2H A;  3NDE A;  4MBF A;  4R3J A;  3TG9 A;  4GD6 A;  4S2N A;  3UY6 A;  1CEG A;  3G30 A;  3VP0 A;  4E3O A;  2EX9 A;  5D3O A;  3TSG A;  3D4F A;  1IYS A;  2XFS A;  4DXC A;  5CGW A;  2RL3 A;  4GOG A;  4JF6 A;  5GLA A;  1VQQ A;  3BEC A;  3S4X A;  5FAS A;  5F1F A;  2DCF A;  3BFE A;  1JVJ A;  3HUN A;  4EBL A;  5A90 A;  2ZMA A;  5CHM A;  4BJP A;  1YLT A;  2ZQD A;  1ES5 A;  2Y2P A;  4JPM A;  2XEP A;  4RVA A;  4JKT A;  2XR0 A;  1G68 A;  2XQZ A;  3G32 A;  3Q7V B;  1KE4 A;  2Y2L A;  3OPL A;  3DWZ A;  4KZ9 A;  4F94 A;  3N6I A;  1K55 A;  1QME A;  4R4S A;  1GHM A;  1HTZ A;  1SHV A;  2EX8 A;  2HP5 A;  3VFF A;  2WZX A;  4MBK A;  1QMF A;  3SOI A;  4FD8 A;  4N1X A;  1GHI A;  4EUZ A;  2IWD A;  5M19 A;  2BG1 A;  3VOZ A;  1K38 A;  3W4Q A;  3AGD A;  3FZC A;  1H8Z A;  4HBT A;  5JYO A;  1NYY A;  3WS4 A;  3BFF A;  4JXV A;  4BEN A;  1FCM A;  3IHB A;  2A49 A;  1LLB A;  4QD4 A;  3A3F A;  3MFD A;  3IHA A;  2WGI A;  4MEZ A;  4OOM A;  4JXG A;  5GLC A;  5FI7 A;  5CER A;  1Z6F A;  2WYX A;  2WAD A;  2G2W A;  2CC1 A;  1ZG4 A;  3C5A A;  3G2Y A;  2IWC A;  3ISG A;  1YM1 A;  4IBR A;  5E2E A;  4WEL A;  4LV1 A;  1BLC A;  4EQI A;  1FCN A;  3BFG A;  4K0W A;  2E8I A;  2ZC3 B;  2Y2O A;  4D2O A;  1LL9 A;  1XA7 A;  4P0M A;  2R9W A;  1DJC A;  1E4D A;  1WYC A;  3OC2 A;  1JWP A;  1W7F A;  5FA7 A;  1I2W A;  1H5X A;  5AQ7 A;  3S22 A;  3VP3 A;  4N9K A;  1XPB A;  3GSG A;  4UA6 A;  1BZA A;  4GDN A;  4LV3 A;  3VP4 A;  1NJ4 A;  2HPB A;  2XDM A;  2VGJ A;  1XP4 A;  3OCN A;  2WUQ A;  4LV0 A;  1W8Q A;  3N8L A;  4N1H A;  3JYI A;  4ZAM A;  4ID4 A;  1L0D A;  2Y2M A;  1NRF A;  3CJM A;  4JF5 A;  3A3E A;  4JXW A;  3OPH A;  3SS5 A;  5M1A A;  5IHV A;  1RP5 A;  4GN2 A;  4IBX A;  3IH8 A;  2J9P A;  4E6X A;  3A3D A;  4BL2 A;  5I94 A;  4UHU A;  4XUX A;  1ZKJ A;  1OME A;  4UA7 A;  5HAI A;  2X01 A;  1H8Y A;  1XA1 A;  1O7E A;  4WZ5 C;  4OQ0 A;  4DXB A;  2JBF A;  4K0X A;  2ZC5 B;  2DRW A;  1S6R A;  2WKH A;  1IEL A;  3IWQ A;  5DTS A;  1K54 C;  2UWX A;  1E3U D;  1MWT A;  3UPN A;  2P74 A;  3BFC A;  5GHX A;  1CI9 A;  2G2U A;  3NY4 A;  5AQA A;  1KVM A;  1WYB A;  2RCX A;  5GHZ A;  2XK1 A;  3GR2 A;  3OZH A;  2JE5 A;  1PZP A;  1HVB A;  3ITB A;  4OLG A;  2EFU A;  1L0E A;  5EVI D;  4DE1 A;  2WGV A;  3NBL A;  2QMI A;  4BD1 A;  5E2G A;  3IT9 A;  3ZGA B;  1K57 C;  3IWO A;  3Q7Z A;  3LY3 A;  2Y2N A;  1Q2P A;  1AXB A;  4UAA A;  1J9M A;  3MZE A;  4XUZ A;  4E3I A;  5FQ9 A;  1BUL A;  4DRT A;  1C3B A;  5CHJ A;  4QY5 A;  4UA9 A;  3SS3 A;  3QHY A;  5EE8 A;  3UDI A;  1FSW A;  3PBQ A;  4GDB A;  3V3R A;  4PM5 A;  4OQI A;  5FQI A;  5CED A;  4BQM A;  2ZM0 A;  3EQU A;  3WS1 A;  4DE2 A;  2Y4A A;  5GHY A;  3E2L A;  4OOL A;  3UE3 A;  4DF6 A;  2WK0 A;  1YLY A;  5AQB A;  3RXX A;  3MXR A;  3IXD A;  5EUA A;  3OPP A;  4NET A;  1WE4 A;  3VP2 A;  1ESU A;  4IVK A;  3RJU A;  3W8K A;  4S2L A;  1VM1 A;  3CG5 A;  2EX6 A;  1K56 A;  5HW3 A;  3QNB A;  3CZD A;  3ZG8 B;  3V3S A;  1MWR A;  4A5R A;  4WM9 A;  3LY4 A;  1TDL A;  1O07 A;  4P6B A;  1L0F A;  1BLP A;  1JTD A;  4WZ5 A;  3MXS A;  3BEB A;  1YMS A;  3V50 A;  5DF8 A;  1TDG A;  1YLZ A;  5G18 A;  1ZC2 A;  4S2O A;  4B88 A;  4KZB A;  1K54 A;  3N7W A;  3FV7 A;  2HDQ A;  4B4X A;  4PM8 A;  5CXW A;  2EFX A;  5FAQ A;  3PTE A;  4EWF A;  4FH4 A;  4E6W A;  1RGY A;  4KZ8 A;  4E3L A;  3ZVT A;  5JYP A;  4GB7 A;  1N9B A;  4OVD A;  1BT5 A;  3VP1 A;  1PI5 A;  3HVF A;  1BSG A;  4S2M A;  1HZO A;  3G2Z A;  3DWK A;  3IWI A;  4K91 A;  5A91 A;  3Q1F A;  1I2S A;  2QZ6 A;  4DDY A;  1K57 A;  1M40 A;  1ONH A;  2Y2I A;  2ZC6 B;  3NI9 A;  4GNU A;  1FCO A;  1MY8 A;  1IKG A;  4KG5 A;  4KZ5 A;  3IF5 A;  4WZ4 A;  1S0W A;  3GRJ A;  3N8S A;  3PBO A;  4HBU A;  3VFH A;  3BYD A;  4QJG A;  1MXO A;  2I72 A;  4MLL A;  1KVL A;  4FSF A;  3NC8 A;  4WMC D;  4FH2 A;  5HFO A;  4Z9Q A;  2C5W B;  2ZQA A;  2ZQC A;  1YLW A;  4X68 A;  2PBY A;  1PYY A;  2BLS A;  1MBL A;  2FFF B;  5U47 A;  1LHY A;  3ZCZ A;  1NZO A;  2ZLY A;  4JF4 A;  5FI2 A;  3HRE A;  4LCL A;  5F1G A;  2XH9 A;  3VSK A;  1JTG A;  4BL3 A;  1SDE A;  3I7J A;  4WBG A;  1PW8 A;  3O87 A;  5FDH A;  3SH7 A;  3SH9 A;  3PBT A;  4KZ4 A;  4MNR A;  4RA7 A;  4R3B A;  3ZNY A;  4XXR A;  3WRT A;  1JWV A;  4OLD A;  3UNW A;  4OOY A;  3MKF A;  4QU3 A;  1YLJ A;  3BLS A;  4P87 A;  2XD5 A;  5FQM A;  4C75 A;  1LI9 A;  3IQA A;  3LCE A;  4L0L A;  5L2F A;  4CJN A;  1XX2 A;  2Z2L B;  4RX3 A;  1SKF A;  1PWG A;  3IH9 A;  3WRZ A;  1BUE A;  4EBN A;  4HEF A;  3UDX A;  1EWZ A;  4OQG A;  1DJA A;  5EOO A;  1XGI A;  4E3N A;  1YQS A;  4DE0 A;  4R4R A;  1L2S A;  3AGF A;  3IF6 C;  4LEN A;  4GKU A;  1RGZ A;  4RYE A;  1JWZ A;  4LCM A;  5CGX A;  4OP5 A;  4JLF A;  3RXW A;  2HDU A;  3HUM A;  2XGN A;  3MZD A;  1L0G A;  1GA0 A;  4QY6 A;  3HLW A;  3WS5 A;  1M6K A;  3W4O A;  5FSR A;  3ZG9 B;  2Y2G A;  1G6A A;  3FWL A;  3UE1 A;  4OPQ A;  2EX2 A;  5TFQ A;  4BLM A;  2DNS A;  4HES A;  1IYQ A;  5AQ9 A;  2ZQ7 A;  1XXM A;  4N92 A;  4Y0O A;  4WEJ A;  3M2K A;  1W8Y A;  3S1Y A;  4KG6 A;  3LO7 A;  3C4O A;  3FKW A;  2HP6 A;  5F83 A;  5DVA A;  3LEZ A;  4C6Y A;  3ZVW A;  2Y2H A;  2ZC7 A;  3DTM A;  2Z2M B;  4U0T A;  3MZF A;  5FQJ A;  4PM6 A;  4LV2 A;  3M2J A;  4ZJ1 A;  2EXA A;  4KQR A;  1W79 A;  1KE3 A;  1ONG A;  1PWC A;  1GA9 A;  4BD0 A;  4Y7P A;  5KMW A;  2R9X A;  3SS4 A;  3BLM A;  4C3Q A;  3M6H A;  4OON A;  4S2P A;  4ZTK A;  5F82 A;  5E43 A;  5KSH A;  4X55 A;  2J7V A;  2Y2J A;  1PI4 A;  1PW1 A;  5BOH A;  4N9L A;  2H0T A;  5J8X A;  5GLB A;  2ZM2 A;  1MWS A;  2V1Z A;  5EVI C;  2XD1 A;  1YT4 A;  2OSU A;  1BTL A;  2H0Y A;  5DTT A;  1GCE A;  1HD8 A;  2Q9N A;  4IED A;  3UN7 A;  1FR6 A;  4OQH A;  1KE0 A;  1PIO A;  2WAE A;  4OPR A;  5A93 A;  2WKI A;  3GTC A;  1K6R A;  1LI0 A;  1W5D A;  4U3T A;  3FKV A;  3PBR A;  1ES4 A;  5EVL A;  3HLG A;  4S2J A;  4E3M A;  4ZJ2 A;  4OH0 A;  4ZJ3 A;  1K25 A;  3ZG7 B;  1KGG A;  4B4Z A;  4M3K A;  5HX9 A;  3OCL A;  2IWB A;  1IKI A;  1ZG6 A;  3N4I A;  4MBH A;  4IVI A;  3FYZ A;  5HAR A;  1YLP A;  4S2K A;  1CEF A;  3M6B A;  2WGW A;  4KG2 A;  4ZDX A;  2Y2K A;  3G31 A;  5FAT A;  5FQK A;  4DE3 A;  1E25 A;  2V20 A;  3E2K A;  4QHC A;  4H8R A;  3ZDJ A;  2Q9M A;  3NDG A;  2HP9 A;  4R23 A;  4PMA A;  3UPO A;  1KDS A;  2XLN A;  3Q82 A;  4KZ3 A;  4O7D A;  5EOE A;  1GHP A;  1NZU A;  4FCF A;  4CPK A;  3G4P A;  1NY0 A;  3BM6 A;  1KDW A;  2XF3 A;  5GLD A;  1ERQ A;  2ZD8 A;  1BLS A;  4GZB A;  1MKI A;  2ZJ9 A;  3G34 A;  1ES3 A;  2C6W B;  2WKE A;  3HLD A;  3ZHH A;  4Y0T A;  1E3U A;  3IF6 B;  3DW0 A;  4R0Q A;  1IYO A;  3N8R A;  3V39 A;  2EXB A;  1SDN A;  2Y55 A;  1K4F A;  2WAF A;  5HAQ A;  1EI5 A;  5HAP A;  5EPH A;  3GVB A;  3HLB A;  3ZG5 A;  5EVI A;  4PM9 A;  3V5M A;  4OP8 A;  1SCW A;  2GDN A;  4X56 A;  1K56 D;  3VSL A;  4NK3 A;  1BLH A;  2ZQ9 A;  4RX2 A;  1K6S A;  5EEC A;  4EBP A;  3O86 A;  5CEB A;  3Q07 A;  5HL1 A;  3UE0 A;  2H5S A;  2JC7 A;  5CRF A;  1YMX A;  4WYY A;  1CK3 A;  2WGW B;  4GD8 A;  5KSC A;  1DJB A;  3CMZ A;  1N4O A;  1ERO A;  3HLC A;  3EQV A;  4Y0U A;  5FAO A;  1PWD A;  4ZBE A;  3ZFZ A;  1PZO A;  2WZZ A;  3W4P A;  5DF9 A;  4U0X A;  4DKI A;  3C7U A;  2X02 A;  1U60 A;  2OLU A;  3ITA A;  2B5R A;  1FOF A;  2Y2Q A;  4KEN B;  4PM7 A;  3MBZ A;  3PBS A;  5DF7 A;  2Y59 A;  2FFY A;  4KZ7 A;  5KZH A;  3GV9 A;  1ERM A;  4WEK A;  3VMA A;  3HLE A;  3OPR A;  1TVF A;  2J9O A;  1MPL A;  3HL9 A;  1IEM A;  2VGK A;  1MWU A;  5CTM A;  2HDR A;  3WWX A;  2P9V A;  4X6T A;  3SH8 A;  4S2N C;  1CI8 A;  5DTK A;  3C7V A;  4JBF A;  2XFT A;  3HBR A;  3PAE A;  3ZNT A;  2H10 A;  4R1G A;  1XKZ A;  3GQZ A;  1DY6 A;  3Q81 A;  3VOY A;  3ZG0 A;  3GMW A;  4DDS A;  2X71 A;  5EVI B;  2PU4 A;  3G35 A;  3IXG A;  3QNC A;  1KGF A;  1Q2Q A;  4JXS A;  4X53 A;  3B3X A;  2A3U A;  3UPP A;  2OV5 A;  3HLF A;  2ZC4 B;  3HUO A; 
#chains in the Genus database with same CATH topology
 4YWZ A;  3OOV A;  3UE6 A;  3DTI A;  5E2F A;  1I5Q A;  5TGF A;  4YFM A;  4Q0I A;  2OLV A;  3PAG A;  1W63 M;  4PKY A;  3FPW A;  4KQQ A;  1GSX A;  3A3I A;  2OWJ A;  1H8M A;  3Q7V A;  3WS0 A;  5FI6 A;  5CGS A;  4EXO A;  2JCH A;  5A92 A;  3NCK A;  3WS2 A;  4EV4 A;  4E3K A;  5FDS A;  3ZQ5 A;  3NIA A;  3C4P A;  1H3Q A;  1YSP A;  1KGE A;  5E2H A;  3TG9 A;  4S2N A;  3UY6 A;  3VP0 A;  5CGW A;  2RL3 A;  5GLA A;  4UEY A;  5F1F A;  2HF6 A;  2ZMA A;  2J80 A;  4Y17 A;  2QWS A;  3LR4 A;  3Q7V B;  1KE4 A;  1LL8 A;  5DFX A;  4AFI A;  1YKD A;  3N6I A;  1GHM A;  5HPI A;  5DKL A;  3SOI A;  1GHI A;  2W3E A;  3WS4 A;  3BFF A;  4JXV A;  2V0W A;  4Y15 A;  3A3F A;  5L07 A;  4JXG A;  5FI7 A;  2E8J A;  2WYX A;  4MCW A;  2CC1 A;  1ZG4 A;  3G2Y A;  3LIB A;  5E2E A;  1N9N A;  4MDZ A;  1FCN A;  3DTE A;  2E8I A;  2ZC3 B;  2Y2O A;  4NEE D;  1DJC A;  1E4D A;  2Z6D A;  3NEC A;  1H0M A;  1CQA A;  1JWP A;  4L9F A;  3IX4 A;  3S22 A;  1T1C A;  2W0N A;  2QKP A;  4GDN A;  4LV3 A;  1NJ4 A;  1XP4 A;  1D06 A;  2WUQ A;  2JN7 A;  4N1H A;  3JYI A;  2GJ3 A;  4HP9 A;  4JXW A;  3SS5 A;  2QYB A;  5IHV A;  1RP5 A;  2ACG A;  4IBX A;  4Z1W A;  3NHQ A;  4R6L A;  2M1C A;  1OME A;  5HAI A;  4HJ3 A;  4K0X A;  2ZC5 B;  2WKH A;  3IWQ A;  4Q0J A;  1K54 C;  1NLY A;  1G6O A;  2UWX A;  3UPN A;  1CI9 A;  3OLO A;  5KIZ A;  3CPT A;  2V8F A;  2JE5 A;  1HVB A;  4CLC C;  2GZA A;  3LI9 A;  4LRZ E;  4OLG A;  5C5K A;  5EVI D;  2WGV A;  4BD1 A;  3LFV A;  2D02 A;  3ZGA B;  1YSQ A;  3LY3 A;  1Q2P A;  1AXB A;  4UAA A;  4XUZ A;  3VE4 A;  1C3B A;  2ZOH A;  4QWO A;  3EWK A;  5EE8 A;  1FSW A;  5FQI A;  4NXE A;  2ZM0 A;  3EQU A;  3MSH A;  4O01 A;  3SZT A;  3WS1 A;  3E2L A;  3RXX A;  1NLZ A;  4NET A;  3W8K A;  2VV8 A;  3TJZ C;  3IS2 A;  2EX6 A;  3MS6 A;  1A0K A;  1OT9 A;  4WM9 A;  3CPT B;  4P6B A;  1JTD A;  3MXS A;  5DF8 A;  2HDQ A;  1S4R A;  3PTE A;  4EWF A;  4KZ8 A;  4E3L A;  3KYQ A;  4GB7 A;  4OVD A;  3VP1 A;  3TW8 A;  2W27 A;  3T4Q A;  2VGL S;  3Q1F A;  3DBA A;  2QZ6 A;  3NI9 A;  2ZC6 B;  5CX7 A;  4G3V A;  1FCO A;  4KG5 A;  1EW0 A;  3PBO A;  5EVE A;  3VFH A;  2I72 A;  3IS2 B;  4P6Z S;  4FSF A;  3NC8 A;  4WMC D;  4Z9Q A;  2C5W B;  2ZQC A;  1HLU P;  1PYY A;  1MBL A;  1D1J A;  5U47 A;  5F1G A;  2XH9 A;  1SDE A;  1PW8 A;  5FDH A;  2UV0 E;  3PBT A;  4QPR A;  5FQM A;  5IT5 A;  3IQA A;  4EW7 A;  3LEQ A;  4EBN A;  4WL9 A;  2O9A A;  1XGI A;  5FEF A;  1L2S A;  4ARZ A;  3UME A;  3SW1 A;  4HI4 A;  3HUM A;  2A24 A;  1S67 L;  1UGU A;  1L0G A;  1ZTU A;  3T4L A;  3L9K A;  3HLW A;  1M6K A;  3UE1 A;  4OPQ A;  2EX2 A;  5TFQ A;  2J3W A;  4HES A;  5AQ9 A;  2KLI A;  3EEA A;  3QP4 A;  3E4P A;  1OJ5 A;  5EM1 A;  3FKW A;  5F83 A;  3RH8 B;  2P7J A;  4C6Y A;  3DTM A;  2Z2M B;  4U0T A;  5FQJ A;  4ZJ1 A;  3CHW P;  4KQR A;  1ACF A;  1ONG A;  1PWC A;  4Y7P A;  5KMW A;  2R9X A;  3SS4 A;  4C3Q A;  5HD5 A;  4ZTK A;  5E43 A;  5KSH A;  4ARZ B;  4X55 A;  1PI4 A;  4N9L A;  2A24 B;  5J8X A;  2OSU A;  2XD1 A;  2XSS A;  5HSQ A;  1GCE A;  3H9W A;  4IED A;  1KE0 A;  2WAE A;  1LI0 A;  1W5D A;  4U3T A;  5G4Y A;  3PBR A;  1ES4 A;  4LLO B;  4NXF A;  4OH0 A;  4B4Z A;  2IWB A;  1IKI A;  1ZG6 A;  4MBH A;  4IVI A;  3T4K A;  2WGW A;  2EWW A;  4Y5F A;  2V20 A;  3E2K A;  2HP9 A;  4PMA A;  5L10 A;  2O9B A;  2PYP A;  5EOE A;  5EV0 A;  1NZU A;  4FCF A;  1KDW A;  2XF3 A;  5GLD A;  1ERQ A;  2ZD8 A;  3ZHH A;  1E3U A;  4ME4 A;  3B47 A;  3V39 A;  1Y28 A;  5HAP A;  3P01 A;  3ZG5 A;  3V5M A;  1XFQ A;  4EER A;  1BLH A;  4RX2 A;  5HL1 A;  2PBD P;  5CEB A;  4ETZ A;  4YOF A;  5CRF A;  2WGW B;  3JVU A;  1ERO A;  5FAO A;  3EQV A;  3W4P A;  1TD5 A;  3C7U A;  1U60 A;  2B5R A;  4L9G A;  4JGQ A;  4CLC D;  1ERM A;  3HLE A;  3OPR A;  2J9O A;  3UB7 A;  3LID A;  4ZRR A;  2K31 A;  3SH8 A;  1CI8 A;  3C7V A;  2V1B A;  3HBR A;  1XKZ A;  3ZG0 A;  4DDS A;  5J4E A;  3IXG A;  4PPR A;  3O88 A;  4UQI M;  5TR7 A;  5FAP A;  3PBN A;  4KQO A;  1XGJ A;  1K55 C;  1V9Z A;  4R70 A;  1FQG A;  2HDS A;  3P09 A;  1TEM A;  3BW6 A;  3EOI A;  1T19 A;  3NJA A;  1G5U A;  4NXB A;  3R7W A;  1FSY A;  3BRM A;  2J8Y A;  4S2I A;  5DFY A;  4QB8 A;  5CTN A;  3IF6 A;  3O3V A;  2V2F F;  3F1P A;  4YIN A;  4X69 A;  3NDE A;  4MBF A;  4R3J A;  4GD6 A;  3MQO A;  3TSG A;  3LIE A;  3T1S A;  4DXC A;  4NXG A;  4YNR A;  2DCF A;  1JVJ A;  3K3C A;  2ZQD A;  2Y2P A;  3LR5 A;  4JPM A;  4JKT A;  2XQZ A;  3G32 A;  4F94 A;  3DWZ A;  3KSI A;  4O0P A;  3R7W B;  3K2N A;  4R4S A;  1HTZ A;  4H6J A;  2EX8 A;  1P9W A;  1STZ A;  5IS1 A;  4FD8 A;  4N1X A;  2EWV A;  3MFX A;  3P7N A;  5HDD A;  3KSG A;  4JGR A;  2Y79 A;  2A49 A;  1LLB A;  2O0Y A;  3ICY A;  3F1P B;  1Z6F A;  2G2W A;  2BTF P;  1YM1 A;  4FUW A;  4WEL A;  3BFG A;  4D2O A;  1LL9 A;  1XA7 A;  1WYC A;  1LSV A;  3UB8 A;  1W7F A;  1I2W A;  1H5X A;  4N9K A;  3GSG A;  4UA6 A;  1BZA A;  2HPB A;  3OCN A;  4H6J B;  4LV0 A;  1L0D A;  1NRF A;  2WKR A;  5M1A A;  4GN2 A;  3A3D A;  5LBR A;  5I94 A;  4UHU A;  2HZ5 A;  1O7E A;  4WZ5 C;  4OQ0 A;  4DXB A;  2JBF A;  5DJU A;  1S6R A;  3EGD C;  4EES A;  4KUK A;  2P74 A;  3NY4 A;  2RCX A;  5GHZ A;  2XK1 A;  1PZP A;  2EFU A;  3KX0 X;  3NBL A;  5E2G A;  1K57 C;  3MZE A;  4MN5 A;  2B95 A;  4DRT A;  3V3R A;  3PBQ A;  5CED A;  4DN0 A;  4F3L A;  5GHY A;  2QJ5 A;  2WK0 A;  4I3J A;  4EUV A;  3MXR A;  5EUA A;  1WE4 A;  1ESU A;  4EEP A;  3CG5 A;  1K56 A;  5AVE A;  4HOI A;  1OTE A;  3QP8 A;  1TDL A;  4EU0 A;  1BLP A;  2GX5 A;  1YMS A;  4B88 A;  4KZB A;  2NUT C;  3FV7 A;  4II7 A;  5CXW A;  3LIF A;  2EFX A;  2PHY A;  4I5S A;  5FAQ A;  4Y2F A;  4E6W A;  1RGY A;  1ODV A;  3ZVT A;  5JYP A;  1BT5 A;  2VA0 A;  5HZH A;  2VV6 A;  4S2M A;  5HWW A;  1HZO A;  3BWL A;  3IWI A;  4K91 A;  3UB5 P;  1CJF A;  1M40 A;  1T18 A;  4GNU A;  5L09 A;  2HV1 A;  1MY8 A;  4F3L B;  3KSF A;  5FEG A;  4KZ5 A;  1S0W A;  4HJ6 A;  4NKP A;  1MXO A;  4FH2 A;  4X68 A;  1OJG A;  2PBY A;  3VOL A;  2FFF B;  1LHY A;  4MN6 A;  3UB9 A;  3HRE A;  4LCL A;  4BL3 A;  1VHM A;  4WBG A;  3SH7 A;  1T1B A;  3ZNY A;  4RA7 A;  4R3B A;  4XXR A;  3LR0 A;  4PKY G;  3UNW A;  2XD5 A;  3FPV A;  4L0L A;  1XX2 A;  3H82 A;  2ZL1 A;  1BUE A;  4OQG A;  1DJA A;  4E3N A;  1OT6 A;  4DE0 A;  2Q0O A;  3IF6 C;  3T4T A;  5CGX A;  4JLF A;  2HDU A;  3UMD A;  1PRQ A;  4QY6 A;  3WS5 A;  5FSR A;  2DNS A;  5AJG A;  2YKH A;  4I3A A;  3EEH A;  1LSW A;  3M2K A;  1S1Z A;  3E0Y A;  5TBM A;  4KG6 A;  5DVA A;  2O9C A;  2ZMV A;  2ZC7 A;  2OAP 1;  1VEU A;  3H82 B;  2ZL1 B;  4BD0 A;  4WN5 A;  5F82 A;  2JKR M;  3H7W A;  2ZM2 A;  1MWS A;  2V1Z A;  1YT4 A;  2K7S A;  2H0Y A;  3ZYT A;  1HD8 A;  2Q9N A;  2V8C A;  4JGO A;  2I9V A;  5EVL A;  3HLG A;  4S2J A;  5TBM B;  4E3M A;  3CWF A;  3CI6 A;  4ZJ2 A;  3MMH A;  4M3K A;  3FYZ A;  3M6B A;  1VEU B;  2VGL M;  3MF0 A;  3T1R A;  1DP8 A;  5FQK A;  2VEA A;  3QP6 A;  3MQ0 A;  4H8R A;  3NDG A;  1KDS A;  3H7W B;  4P6Z M;  3BM6 A;  2XRO A;  3G34 A;  3HLD A;  3DW0 A;  4R0Q A;  4EET B;  1SDN A;  5EPH A;  3HLB A;  5EVI A;  4OP8 A;  4NK3 A;  2ZQ9 A;  4EBP A;  3Q07 A;  2HGV A;  1GSW A;  2FZ0 A;  3R4K A;  2JC7 A;  1YMX A;  4WYY A;  2L0W A;  3ZFZ A;  4U0X A;  2HJE A;  1BYW A;  2Y2Q A;  1FOF A;  4KEN B;  4PM7 A;  2Y59 A;  5KZH A;  3CUE A;  3GV9 A;  3HL9 A;  1MWU A;  5CTM A;  3BY8 A;  4X6T A;  4S2N C;  4JBF A;  2XFT A;  3C8C A;  3GQZ A;  1DY6 A;  3VOY A;  2X71 A;  5EVI B;  2PU4 A;  3QNC A;  1KGF A;  4GLQ A;  2OAQ 1;  4GS9 A;  3B3X A;  2B02 A;  5F6A A;  3S7P A;  3T4O A;  4KZ6 A;  3PR6 A;  1K4E A;  4E3J A;  2AVX A;  3IXH A;  2PRF A;  4OPY A;  3LR3 A;  4CQH A;  5CEC A;  3IBJ A;  3A0R A;  3L7H A;  3UDF A;  5FQQ A;  1F5M A;  1S1Y A;  3CAX A;  1NYM A;  3MJQ A;  3A3J A;  3KSH A;  2R78 A;  1GSV A;  4JGP A;  1FR1 A;  2L1M A;  1ES2 A;  4BWI A;  3UO9 A;  4WMC A;  2VJW A;  2ZQ8 A;  1IYP A;  3VV4 A;  4KZA A;  4DJ3 A;  1NXY A;  3BFD A;  4HQA A;  1N9L A;  4GS9 B;  2EX9 A;  5D3O A;  1P0Z A;  3D4F A;  1IYS A;  2XFS A;  4LRX C;  4JF6 A;  1VQQ A;  3BEC A;  3S4X A;  3BFE A;  3HUN A;  4EBL A;  4GCZ A;  1YLT A;  4PAU A;  1ES5 A;  4Q0H A;  2XEP A;  4IUK A;  1G68 A;  2Y2L A;  2DMW A;  4KZ9 A;  1QME A;  4WUJ A;  1SHV A;  2HP5 A;  2G7U A;  5F68 A;  4EUZ A;  2BG1 A;  3VOZ A;  3W4Q A;  3AGD A;  2W1R A;  1NYY A;  4PHT A;  4BEN A;  1FCM A;  3IHA A;  4OOM A;  5GLC A;  3KYE A;  2GNX A;  3IX8 A;  3C5A A;  2IWC A;  3C2W A;  3ISG A;  4LV1 A;  1BLC A;  4EQI A;  4K0W A;  4DJ2 A;  2R9W A;  3OC2 A;  1L3L A;  5MC7 A;  3U4L P;  4IJG A;  5AQ7 A;  4FTX A;  3VP4 A;  2VGJ A;  1W8Q A;  2W3G A;  1YPR A;  2ZMF A;  4ID4 A;  3LI8 A;  1VET A;  2Y2M A;  2JKF A;  4HHD A;  4JF5 A;  3A3E A;  3OPH A;  1PNE A;  4XT2 B;  2J9P A;  4BL2 A;  4XUX A;  1D7E A;  1IEL A;  1MWT A;  3BFC A;  5GHX A;  2G2U A;  3EGX C;  1WYB A;  3GR2 A;  2ZOI A;  1L0E A;  4DE1 A;  3IT9 A;  4HH2 A;  3Q7Z A;  2Y2N A;  3DAV A;  1XJ2 A;  4GHI A;  3IBR A;  1VET B;  4E3I A;  5FQ9 A;  1BUL A;  5CHJ A;  4UA9 A;  3SS3 A;  1F2K A;  3QHY A;  3UDI A;  4PM5 A;  4OQI A;  4DE2 A;  4ESP A;  2Y4A A;  3UE3 A;  4OOL A;  4DF6 A;  1YAX A;  3IXD A;  3OPP A;  3VP2 A;  4S2L A;  3LUQ A;  2PDR A;  4IUH A;  3CZD A;  4A5R A;  1MWR A;  3LY4 A;  4HP4 A;  1L0F A;  3BEB A;  2VLG A;  1TDG A;  1YLZ A;  4S2O A;  1K54 A;  3N7W A;  4PM8 A;  4G3W A;  4LGW A;  1N9B A;  4GHI B;  2V9A A;  4WLA A;  4CLC A;  5HDS A;  3HVF A;  3G2Z A;  4DDY A;  2Y2I A;  2EA9 A;  3D3O A;  1IKG A;  3F1N A;  4WZ4 A;  2KX6 A;  3N8S A;  3UB6 A;  2XA7 S;  1WA9 A;  1P97 A;  4QJG A;  4MLL A;  1Y4O A;  2W3D A;  4KUO A;  1UWN X;  3A0V A;  1IOU A;  2BLS A;  2ZLY A;  4JF4 A;  5FI2 A;  1N9O A;  1NRJ A;  5EM0 A;  3O87 A;  3SH9 A;  4KZ4 A;  4MNR A;  4CLC B;  1JWV A;  2V0U A;  4OLD A;  4QU3 A;  4RQ9 A;  1YLJ A;  2JKT M;  3BLS A;  3LCE A;  5L2F A;  1XFN A;  3PXP A;  4CJN A;  1SKF A;  3IH9 A;  2JKR I;  2MJ6 A;  4HEF A;  3JPU A;  3NOT C;  3UDX A;  1EWZ A;  3F1N B;  4BMW A;  2JKG A;  3T50 A;  4R4R A;  4GKU A;  1RGZ A;  3FG8 A;  4RYE A;  1MKM A;  4LCM A;  4OP5 A;  3RXW A;  3BJN A;  4X25 A;  2XGN A;  3CIT A;  5A8B A;  1G6A A;  3FWL A;  3IX3 A;  4BLM A;  1IYQ A;  4HJ4 A;  3GDI A;  5DKK A;  2ZQ7 A;  1XXM A;  4N92 A;  1OTI A;  4WEJ A;  3S1Y A;  3C4O A;  3ZVW A;  1XJ6 A;  4PM6 A;  2EXA A;  2PR6 A;  1W79 A;  1GA9 A;  3G6O A;  5F5Y A;  2Y2J A;  1PW1 A;  2H0T A;  5GLB A;  3GEC A;  2PAV P;  4I3I A;  3JVV A;  1BTL A;  4HY8 A;  1F9I A;  5DTT A;  4X1L A;  1DP9 A;  3UN7 A;  1FR6 A;  4OQH A;  4MMN A;  3NOP C;  4OPR A;  3S7N A;  3GTC A;  2W1T A;  5A93 A;  3FKV A;  4X1M A;  4ZJ3 A;  4ETX A;  1K25 A;  5HX9 A;  3OCL A;  2JHE A;  3N4I A;  4S2K A;  1CEF A;  4ZDX A;  2Y2K A;  5HDC A;  4LRY C;  4DE3 A;  3ZDJ A;  1T1A A;  4HNB A;  4R23 A;  5EFW A;  2XLN A;  4KZ3 A;  3C30 A;  2PD7 A;  1BLS A;  1MKI A;  2C6W B;  2WKE A;  3HJI A;  3BY9 A;  3TRC A;  2H28 A;  3N8R A;  5IU1 A;  2KOI A;  2W1T B;  3QP5 A;  2WAF A;  1EI5 A;  5F69 A;  2W3F A;  3CLO A;  4BBT A;  2L4R A;  4PM9 A;  1SCW A;  2GDN A;  3VSL A;  5EEC A;  3O86 A;  1V9Y A;  3NUL A;  1CK3 A;  4GD8 A;  5KSC A;  3CMZ A;  3HLC A;  4Y0U A;  4ZBE A;  1PZO A;  2J3T C;  2WZZ A;  5DF9 A;  4DKI A;  1XJ3 A;  1PFL A;  3B42 A;  2OLU A;  3PBS A;  1OPX A;  2INW A;  1MPL A;  2PYR A;  1S4S A;  1IEM A;  2VGK A;  2A2L A;  2P9V A;  2WKQ A;  3TE8 A;  3PAE A;  3ZNT A;  2H10 A;  2LB9 A;  3HJK A;  4R1G A;  3Q81 A;  4LPZ A;  3KO6 A;  2D01 A;  5HWT A;  1UWP X;  4JXS A;  5J3W A;  3T1X A;  3UPO A;  3HLF A;  3MKE A;  1RCJ A;  4B9O A;  5M18 A;  4OKP A;  1Y54 A;  5K5B A;  2PU2 A;  3IXB A;  1ESI A;  4P85 A;  2QPN A;  3DTK A;  1J3W A;  2ZM8 A;  3C38 A;  4FOF A;  4Q8I A;  3VE3 A;  1ALQ A;  5CHU A;  4OPZ A;  1LL5 A;  2P9V B;  3P98 A;  5GL9 A;  4D60 A;  3AGE A;  3E4O A;  3TOI A;  2Y8H A;  2Y91 A;  4HIA A;  1OTD A;  1CEG A;  3G30 A;  4E3O A;  2HJ9 C;  5L8M A;  2VK3 A;  4GJ4 A;  4GOG A;  5FAS A;  5A90 A;  5CHM A;  4BJP A;  4O8G A;  4BBU A;  4RVA A;  2XR0 A;  3OPL A;  5G4Z A;  1K55 A;  2PD8 A;  3VFF A;  2WZX A;  4MBK A;  1QMF A;  1XJ4 A;  1OTB A;  3OBF A;  2YKF A;  2IWD A;  5M19 A;  1P9R A;  1K38 A;  3FZC A;  1H8Z A;  4HBT A;  5JYO A;  5DJT A;  1CF0 A;  5I5L A;  3IHB A;  3QP2 A;  4QD4 A;  4IHQ A;  3MFD A;  2WGI A;  4MEZ A;  5CER A;  2WAD A;  1IFQ A;  4WF0 A;  4IBR A;  1AWI A;  2NUP C;  4P0M A;  2QHK A;  3F1O A;  5FA7 A;  3MQQ A;  3VP3 A;  1XPB A;  3T4S A;  4Y13 A;  2XDM A;  2WKP A;  3N8L A;  4LFU A;  4ZAM A;  3S7Q A;  4DMZ A;  3CJM A;  3IH8 A;  4E6X A;  2V1A A;  1ZKJ A;  4UA7 A;  2X01 A;  1H8Y A;  1XA1 A;  3T12 B;  2XRN A;  2DRW A;  5DTS A;  3QP1 A;  2ZBB A;  1E3U D;  1KOU A;  2PT7 A;  1DRM A;  5AQA A;  1KVM A;  3OZH A;  3F1O B;  3ITB A;  4M4X A;  2QMI A;  1TS7 A;  3IWO A;  3B33 A;  1K0K A;  1J9M A;  2ZC4 B;  3T4J A;  4QY5 A;  4GDB A;  5HPF A;  4BQM A;  1FIK A;  1JNU A;  1G28 A;  1YLY A;  5AQB A;  1TS6 A;  4R3A A;  4IVK A;  3RJU A;  1VM1 A;  5HW3 A;  2KDK A;  3QNB A;  3ZG8 B;  3V3S A;  1O07 A;  3K3D A;  4WZ5 A;  2CMN A;  2W3H A;  1TS8 A;  3V50 A;  5G18 A;  1ZC2 A;  3FC7 A;  4B4X A;  3NOU C;  1S66 L;  4R38 A;  4FH4 A;  2JKT I;  3LIA A;  1FIL A;  1PI5 A;  1MZU A;  1BSG A;  3DWK A;  5A91 A;  3RFB A;  4E04 A;  1I2S A;  2O99 A;  1K57 A;  1ONH A;  4XT2 A;  1MC0 A;  2BAS A;  1LSX A;  3IF5 A;  3GRJ A;  2OWH A;  4HBU A;  3BYD A;  2J3T D;  1KVL A;  3E4Q A;  5HFO A;  2ZQA A;  1YLW A;  4HH3 A;  2P08 A;  4L9E A;  3ZCZ A;  1NZO A;  1DP6 A;  3LGO A;  3HCY A;  3VSK A;  4Y3I A;  1JTG A;  2OOL A;  1X0O A;  3I7J A;  1LT0 A;  3KYZ A;  3WRT A;  4OOY A;  3MKF A;  4P87 A;  4C75 A;  5TJJ A;  1LI9 A;  3A0S A;  4RX3 A;  2Z2L B;  1PWG A;  3WRZ A;  2K2N A;  2FH5 A;  5EOO A;  2VV7 A;  1YQS A;  3AGF A;  4LEN A;  1F98 A;  1JWZ A;  2Z6C A;  1NWZ A;  1TF1 A;  3MZD A;  1GA0 A;  4I39 A;  3W4O A;  3ZG9 B;  2Y2G A;  4CLC E;  3ULF A;  4Y0O A;  1W8Y A;  3LO7 A;  4KQD A;  2HP6 A;  3LEZ A;  4UQI S;  2Y2H A;  5HD3 A;  3D9Y A;  4BBV A;  3MZF A;  4LV2 A;  3M2J A;  3S7O A;  3BQA A;  1KE3 A;  4K08 A;  5J7E A;  1Z09 A;  3BLM A;  3M6H A;  4OON A;  4S2P A;  1TS0 A;  2LB5 A;  2J7V A;  5BOH A;  4EQ1 A;  3U2A A;  2P04 A;  5EVI C;  4NG2 A;  4B93 A;  1ZHH B;  1PIO A;  2WKI A;  1K6R A;  5HWV A;  4I38 A;  1SZV A;  4GW9 A;  3ZG7 B;  1KGG A;  4G3K A;  5HAR A;  1YLP A;  4KG2 A;  3CUE C;  3D72 A;  3G31 A;  3MXQ A;  3O5Y A;  5FAT A;  1E25 A;  1W63 Q;  4QHC A;  1SKO A;  5AVF A;  2Q9M A;  2XA7 M;  1OTA A;  3W2Z A;  3Q82 A;  4O7D A;  1GHP A;  4CPK A;  3G4P A;  1NY0 A;  5HL6 A;  4GZB A;  2ZJ9 A;  4Y0T A;  1ES3 A;  2B18 A;  2VKS A;  3IF6 B;  3LIC A;  1IYO A;  2EXB A;  2Y55 A;  5HAQ A;  1K4F A;  3BQ8 A;  3GVB A;  2M7V A;  3PHY A;  3V67 A;  3MR0 A;  3LYX A;  4X56 A;  1K56 D;  1K6S A;  3UE0 A;  2H5S A;  2PR5 A;  1DJB A;  1N4O A;  1PWD A;  5FL3 A;  2X02 A;  3ITA A;  1SKO B;  3MBZ A;  5DF7 A;  3T1Q B;  2FFY A;  1VB6 A;  3E98 A;  4KZ7 A;  3RTY A;  4WEK A;  3VMA A;  1TVF A;  4MN7 A;  4EEU A;  3PYP A;  2HDR A;  3WWX A;  2IA2 A;  2VZW A;  5DTK A;  2VX8 A;  3GMW A;  3G35 A;  2QJ7 A;  1Q2Q A;  2M7U A;  3UPP A;  2A3U A;  2OV5 A;  4X53 A;  3HUO A; 
#chains in the Genus database with same CATH homology
 4PPR A;  3MKE A;  1RCJ A;  3O88 A;  5TR7 A;  1K4E A;  5FAP A;  5M18 A;  4E3J A;  3PBN A;  4KQO A;  1XGJ A;  1K55 C;  3IXH A;  1I5Q A;  4OKP A;  5E2F A;  1Y54 A;  5TGF A;  4OPY A;  4YFM A;  2PU2 A;  2OLV A;  3PAG A;  1FQG A;  3IXB A;  2HDS A;  3P09 A;  5CEC A;  1TEM A;  4KQQ A;  3UDF A;  1ESI A;  3A3I A;  5FQQ A;  3Q7V A;  4P85 A;  2QPN A;  3WS0 A;  2ZM8 A;  5FI6 A;  1NYM A;  1FSY A;  3A3J A;  3BRM A;  5CGS A;  4Q8I A;  1FR1 A;  2J8Y A;  1ES2 A;  1ALQ A;  4S2I A;  5CHU A;  2JCH A;  4OPZ A;  5A92 A;  3UO9 A;  3NCK A;  4KZ6 A;  4WMC A;  1LL5 A;  2P9V B;  3P98 A;  2ZQ8 A;  1IYP A;  4QB8 A;  5GL9 A;  3WS2 A;  4KZA A;  5CTN A;  3AGE A;  4E3K A;  3IF6 A;  4EV4 A;  3O3V A;  3NIA A;  1NXY A;  3TOI A;  3C4P A;  2V2F F;  3BFD A;  2Y91 A;  1KGE A;  4YIN A;  4X69 A;  5E2H A;  3NDE A;  4MBF A;  4R3J A;  3TG9 A;  4GD6 A;  4S2N A;  3UY6 A;  1CEG A;  3G30 A;  3VP0 A;  4E3O A;  2EX9 A;  5D3O A;  3TSG A;  3D4F A;  1IYS A;  2XFS A;  4DXC A;  5CGW A;  2RL3 A;  4GOG A;  4JF6 A;  5GLA A;  1VQQ A;  3BEC A;  3S4X A;  5FAS A;  5F1F A;  2DCF A;  3BFE A;  1JVJ A;  3HUN A;  4EBL A;  5A90 A;  2ZMA A;  5CHM A;  4BJP A;  1YLT A;  2ZQD A;  1ES5 A;  2Y2P A;  4JPM A;  2XEP A;  4RVA A;  4JKT A;  2XR0 A;  1G68 A;  2XQZ A;  3G32 A;  3Q7V B;  1KE4 A;  2Y2L A;  3OPL A;  3DWZ A;  4KZ9 A;  4F94 A;  3N6I A;  1K55 A;  1QME A;  4R4S A;  1GHM A;  1HTZ A;  1SHV A;  2EX8 A;  2HP5 A;  3VFF A;  2WZX A;  4MBK A;  1QMF A;  3SOI A;  4FD8 A;  4N1X A;  1GHI A;  4EUZ A;  2IWD A;  5M19 A;  2BG1 A;  3VOZ A;  1K38 A;  3W4Q A;  3AGD A;  3FZC A;  1H8Z A;  4HBT A;  5JYO A;  1NYY A;  3WS4 A;  3BFF A;  4JXV A;  4BEN A;  1FCM A;  3IHB A;  2A49 A;  1LLB A;  4QD4 A;  3A3F A;  3MFD A;  3IHA A;  2WGI A;  4MEZ A;  4OOM A;  4JXG A;  5GLC A;  5FI7 A;  5CER A;  1Z6F A;  2WYX A;  2WAD A;  2G2W A;  2CC1 A;  1ZG4 A;  3C5A A;  3G2Y A;  2IWC A;  3ISG A;  1YM1 A;  4IBR A;  5E2E A;  4WEL A;  4LV1 A;  1BLC A;  4EQI A;  1FCN A;  3BFG A;  4K0W A;  2E8I A;  2ZC3 B;  2Y2O A;  4D2O A;  1LL9 A;  1XA7 A;  4P0M A;  2R9W A;  1DJC A;  1E4D A;  1WYC A;  3OC2 A;  1JWP A;  1W7F A;  5FA7 A;  1I2W A;  1H5X A;  5AQ7 A;  3S22 A;  3VP3 A;  4N9K A;  1XPB A;  3GSG A;  4UA6 A;  1BZA A;  4GDN A;  4LV3 A;  3VP4 A;  1NJ4 A;  2HPB A;  2XDM A;  2VGJ A;  1XP4 A;  3OCN A;  2WUQ A;  4LV0 A;  1W8Q A;  3N8L A;  4N1H A;  3JYI A;  4ZAM A;  4ID4 A;  1L0D A;  2Y2M A;  1NRF A;  3CJM A;  4JF5 A;  3A3E A;  4JXW A;  3OPH A;  3SS5 A;  5M1A A;  5IHV A;  1RP5 A;  4GN2 A;  4IBX A;  3IH8 A;  2J9P A;  4E6X A;  3A3D A;  4BL2 A;  5I94 A;  4UHU A;  4XUX A;  1ZKJ A;  1OME A;  4UA7 A;  5HAI A;  2X01 A;  1H8Y A;  1XA1 A;  1O7E A;  4WZ5 C;  4OQ0 A;  4DXB A;  2JBF A;  4K0X A;  2ZC5 B;  2DRW A;  1S6R A;  2WKH A;  1IEL A;  3IWQ A;  5DTS A;  1K54 C;  2UWX A;  1E3U D;  1MWT A;  3UPN A;  2P74 A;  3BFC A;  5GHX A;  1CI9 A;  2G2U A;  3NY4 A;  5AQA A;  1KVM A;  1WYB A;  2RCX A;  5GHZ A;  2XK1 A;  3GR2 A;  3OZH A;  2JE5 A;  1PZP A;  1HVB A;  3ITB A;  4OLG A;  2EFU A;  1L0E A;  5EVI D;  4DE1 A;  2WGV A;  3NBL A;  2QMI A;  4BD1 A;  5E2G A;  3IT9 A;  3ZGA B;  1K57 C;  3IWO A;  3Q7Z A;  3LY3 A;  2Y2N A;  1Q2P A;  1AXB A;  4UAA A;  1J9M A;  3MZE A;  4XUZ A;  4E3I A;  5FQ9 A;  1BUL A;  4DRT A;  1C3B A;  5CHJ A;  4QY5 A;  4UA9 A;  3SS3 A;  3QHY A;  5EE8 A;  3UDI A;  1FSW A;  3PBQ A;  4GDB A;  3V3R A;  4PM5 A;  4OQI A;  5FQI A;  5CED A;  4BQM A;  2ZM0 A;  3EQU A;  3WS1 A;  4DE2 A;  2Y4A A;  5GHY A;  3E2L A;  4OOL A;  3UE3 A;  4DF6 A;  2WK0 A;  1YLY A;  5AQB A;  3RXX A;  3MXR A;  3IXD A;  5EUA A;  3OPP A;  4NET A;  1WE4 A;  3VP2 A;  1ESU A;  4IVK A;  3RJU A;  3W8K A;  4S2L A;  1VM1 A;  3CG5 A;  2EX6 A;  1K56 A;  5HW3 A;  3QNB A;  3CZD A;  3ZG8 B;  3V3S A;  1MWR A;  4A5R A;  4WM9 A;  3LY4 A;  1TDL A;  1O07 A;  4P6B A;  1L0F A;  1BLP A;  1JTD A;  4WZ5 A;  3MXS A;  3BEB A;  1YMS A;  3V50 A;  5DF8 A;  1TDG A;  1YLZ A;  5G18 A;  1ZC2 A;  4S2O A;  4B88 A;  4KZB A;  1K54 A;  3N7W A;  3FV7 A;  2HDQ A;  4B4X A;  4PM8 A;  5CXW A;  2EFX A;  5FAQ A;  3PTE A;  4EWF A;  4FH4 A;  4E6W A;  1RGY A;  4KZ8 A;  4E3L A;  3ZVT A;  5JYP A;  4GB7 A;  1N9B A;  4OVD A;  1BT5 A;  3VP1 A;  1PI5 A;  3HVF A;  1BSG A;  4S2M A;  1HZO A;  3G2Z A;  3DWK A;  3IWI A;  4K91 A;  5A91 A;  3Q1F A;  1I2S A;  2QZ6 A;  4DDY A;  1K57 A;  1M40 A;  1ONH A;  2Y2I A;  2ZC6 B;  3NI9 A;  4GNU A;  1FCO A;  1MY8 A;  1IKG A;  4KG5 A;  4KZ5 A;  3IF5 A;  4WZ4 A;  1S0W A;  3GRJ A;  3N8S A;  3PBO A;  4HBU A;  3VFH A;  3BYD A;  4QJG A;  1MXO A;  2I72 A;  4MLL A;  1KVL A;  4FSF A;  3NC8 A;  4WMC D;  4FH2 A;  5HFO A;  4Z9Q A;  2C5W B;  2ZQA A;  2ZQC A;  1YLW A;  4X68 A;  2PBY A;  1PYY A;  2BLS A;  1MBL A;  2FFF B;  5U47 A;  1LHY A;  3ZCZ A;  1NZO A;  2ZLY A;  4JF4 A;  5FI2 A;  3HRE A;  4LCL A;  5F1G A;  2XH9 A;  3VSK A;  1JTG A;  4BL3 A;  1SDE A;  3I7J A;  4WBG A;  1PW8 A;  3O87 A;  5FDH A;  3SH7 A;  3SH9 A;  3PBT A;  4KZ4 A;  4MNR A;  4RA7 A;  4R3B A;  3ZNY A;  4XXR A;  3WRT A;  1JWV A;  4OLD A;  3UNW A;  4OOY A;  3MKF A;  4QU3 A;  1YLJ A;  3BLS A;  4P87 A;  2XD5 A;  5FQM A;  4C75 A;  1LI9 A;  3IQA A;  3LCE A;  4L0L A;  5L2F A;  4CJN A;  1XX2 A;  2Z2L B;  4RX3 A;  1SKF A;  1PWG A;  3IH9 A;  3WRZ A;  1BUE A;  4EBN A;  4HEF A;  3UDX A;  1EWZ A;  4OQG A;  1DJA A;  5EOO A;  1XGI A;  4E3N A;  1YQS A;  4DE0 A;  4R4R A;  1L2S A;  3AGF A;  3IF6 C;  4LEN A;  4GKU A;  1RGZ A;  4RYE A;  1JWZ A;  4LCM A;  5CGX A;  4OP5 A;  4JLF A;  3RXW A;  2HDU A;  3HUM A;  2XGN A;  3MZD A;  1L0G A;  1GA0 A;  4QY6 A;  3HLW A;  3WS5 A;  1M6K A;  3W4O A;  5FSR A;  3ZG9 B;  2Y2G A;  1G6A A;  3FWL A;  3UE1 A;  4OPQ A;  2EX2 A;  5TFQ A;  4BLM A;  2DNS A;  4HES A;  1IYQ A;  5AQ9 A;  2ZQ7 A;  1XXM A;  4N92 A;  4Y0O A;  4WEJ A;  3M2K A;  1W8Y A;  3S1Y A;  4KG6 A;  3LO7 A;  3C4O A;  3FKW A;  2HP6 A;  5F83 A;  5DVA A;  3LEZ A;  4C6Y A;  3ZVW A;  2Y2H A;  2ZC7 A;  3DTM A;  2Z2M B;  4U0T A;  3MZF A;  5FQJ A;  4PM6 A;  4LV2 A;  3M2J A;  4ZJ1 A;  2EXA A;  4KQR A;  1W79 A;  1KE3 A;  1ONG A;  1PWC A;  1GA9 A;  4BD0 A;  4Y7P A;  5KMW A;  2R9X A;  3SS4 A;  3BLM A;  4C3Q A;  3M6H A;  4OON A;  4S2P A;  4ZTK A;  5F82 A;  5E43 A;  5KSH A;  4X55 A;  2J7V A;  2Y2J A;  1PI4 A;  1PW1 A;  5BOH A;  4N9L A;  2H0T A;  5J8X A;  5GLB A;  2ZM2 A;  1MWS A;  2V1Z A;  5EVI C;  2XD1 A;  1YT4 A;  2OSU A;  1BTL A;  2H0Y A;  5DTT A;  1GCE A;  1HD8 A;  2Q9N A;  4IED A;  3UN7 A;  1FR6 A;  4OQH A;  1KE0 A;  1PIO A;  2WAE A;  4OPR A;  5A93 A;  2WKI A;  3GTC A;  1K6R A;  1LI0 A;  1W5D A;  4U3T A;  3FKV A;  3PBR A;  1ES4 A;  5EVL A;  3HLG A;  4S2J A;  4E3M A;  4ZJ2 A;  4OH0 A;  4ZJ3 A;  1K25 A;  3ZG7 B;  1KGG A;  4B4Z A;  4M3K A;  5HX9 A;  3OCL A;  2IWB A;  1IKI A;  1ZG6 A;  3N4I A;  4MBH A;  4IVI A;  3FYZ A;  5HAR A;  1YLP A;  4S2K A;  1CEF A;  3M6B A;  2WGW A;  4KG2 A;  4ZDX A;  2Y2K A;  3G31 A;  5FAT A;  5FQK A;  4DE3 A;  1E25 A;  2V20 A;  3E2K A;  4QHC A;  4H8R A;  3ZDJ A;  2Q9M A;  3NDG A;  2HP9 A;  4R23 A;  4PMA A;  3UPO A;  1KDS A;  2XLN A;  3Q82 A;  4KZ3 A;  4O7D A;  5EOE A;  1GHP A;  1NZU A;  4FCF A;  4CPK A;  3G4P A;  1NY0 A;  3BM6 A;  1KDW A;  2XF3 A;  5GLD A;  1ERQ A;  2ZD8 A;  1BLS A;  4GZB A;  1MKI A;  2ZJ9 A;  3G34 A;  1ES3 A;  2C6W B;  2WKE A;  3HLD A;  3ZHH A;  4Y0T A;  1E3U A;  3IF6 B;  3DW0 A;  4R0Q A;  1IYO A;  3N8R A;  3V39 A;  2EXB A;  1SDN A;  2Y55 A;  1K4F A;  2WAF A;  5HAQ A;  1EI5 A;  5HAP A;  5EPH A;  3GVB A;  3HLB A;  3ZG5 A;  5EVI A;  4PM9 A;  3V5M A;  4OP8 A;  1SCW A;  2GDN A;  4X56 A;  1K56 D;  3VSL A;  4NK3 A;  1BLH A;  2ZQ9 A;  4RX2 A;  1K6S A;  5EEC A;  4EBP A;  3O86 A;  5CEB A;  3Q07 A;  5HL1 A;  3UE0 A;  2H5S A;  2JC7 A;  5CRF A;  1YMX A;  4WYY A;  1CK3 A;  2WGW B;  4GD8 A;  5KSC A;  1DJB A;  3CMZ A;  1N4O A;  1ERO A;  3HLC A;  3EQV A;  4Y0U A;  5FAO A;  1PWD A;  4ZBE A;  3ZFZ A;  1PZO A;  2WZZ A;  3W4P A;  5DF9 A;  4U0X A;  4DKI A;  3C7U A;  2X02 A;  1U60 A;  2OLU A;  3ITA A;  2B5R A;  1FOF A;  2Y2Q A;  4KEN B;  4PM7 A;  3MBZ A;  3PBS A;  5DF7 A;  2Y59 A;  2FFY A;  4KZ7 A;  5KZH A;  3GV9 A;  1ERM A;  4WEK A;  3VMA A;  3HLE A;  3OPR A;  1TVF A;  2J9O A;  1MPL A;  3HL9 A;  1IEM A;  2VGK A;  1MWU A;  5CTM A;  2HDR A;  3WWX A;  2P9V A;  4X6T A;  3SH8 A;  4S2N C;  1CI8 A;  5DTK A;  3C7V A;  4JBF A;  2XFT A;  3HBR A;  3PAE A;  3ZNT A;  2H10 A;  4R1G A;  1XKZ A;  3GQZ A;  1DY6 A;  3Q81 A;  3VOY A;  3ZG0 A;  3GMW A;  4DDS A;  2X71 A;  5EVI B;  2PU4 A;  3G35 A;  3IXG A;  3QNC A;  1KGF A;  1Q2Q A;  4JXS A;  4X53 A;  3B3X A;  2A3U A;  3UPP A;  2OV5 A;  3HLF A;  2ZC4 B;  3HUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...