4HJ4A

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
177
structure length
177
Chain Sequence
AMDQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
molecule keywords LOV protein
total genus 56
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hj4A00
4LRYC 5HD5A 2V0UA 2VV7A 1VB6A 4BBTA 4F3LA 1S1ZA 1WA9A 4HP4A 1JNUA 3VOLA 5HWVA 3ZQ5A 3KX0X 3LUQA 1DP9A 4PKYG 3UB7A 4WF0A 2P7JA 1MZUA 4R38A 2W0NA 4WL9A 2J80A 3P7NA 3H7WA 4JGOA 5AVFA 1GSXA 4MN5A 4PKYA 4LRXC 4RQ9A 5AVEA 3BY8A 5HDCA 4LLOB 4LPZA 4JGRA 4BBVA 3E4QA 1S66L 1OTEA 4GS9B 3LIEA 3UB6A 5J4EA 3MFXA 4HIAA 5IS1A 3F1PA 4LRZE 4NXBA 1T1CA 1XJ6A 2OWHA 3LYXA 4XT2A 3LIBA 2BASA 2YKHA 1GSVA 1OTIA 3C2WA 5HSQA 3F1NA 3LIAA 4K08A 1T1BA 2L0WA 5HDDA 1N9LA 3BY9A 3CWFA 1LSWA 4HJ6A 2Z6DA 3NOUC 3H82B 2H28A 1KOUA 1XFQA 3D72A 3MQOA 1UWNX 3A0RA 3F1NB 3K3DA 4WUJA 2OWJA 4KQDA 4YWZA 3RTYA 1V9ZA 2WKRA 3IS2B 1F9IA 3PHYA 3FG8A 3EWKA 2R78A 4GHIB 4EW7A 3UB9A 1N9NA 3UB8A 1OT9A 4EERA 4HHDA 1V9YA 4GS9A 5HD3A 5HZHA 3MXQA 2WKQA 1F98A 1OJ5A 1D06A 1XFNA 2QKPA 4DJ3A 2QHKA 2V1BA 3B33A 3FC7A 4H6JB 5DKKA 4HJ3A 4WN5A 2A24B 2KX6A 4HNBA 3CLOA 3ULFA 2PD8A 4HY8A 1P97A 1S1YA 2GJ3A 2VV6A 2CMNA 2PR5A 2W27A 4H6JA 3UMEA 5TBMB 1LSXA 4HH3A 3CAXA 3UE6A 5A8BA 2V9AA 2PDRA 1OTBA 4I38A 1S67L 4R6LA 5F5YA 5HDSA 1XJ2A 4GHIA 3F1PB 3E4OA 4I3JA 4EETB 1GSWA 3T50A 3HJIA 1TS6A 2V0WA 2B02A 2V1AA 3HJKA 4GW9A 3LICA 1S4SA 3MJQA 3NOTC 2M1CA 2ZBBA 2L1MA 3NJAA 5KIZA 2KDKA 2ZOHA 3GDIA 3SW1A 1D7EA 2JN7A 2PD7A 3A0VA 3RH8B 1DRMA 1T19A 1LL8A 2PHYA 3LI8A 1TS0A 4EEUA 2INWA 4R70A 4EEPA 3IBRA 1ODVA 3OLOA 2WKPA 4M4XA 1G28A 4B9OA 1UWPX 2EA9A 1T1AA 2K7SA 1BYWA 4GCZA 1EW0A 3K3CA 4I5SA 3MR0A 3PYPA 5DJTA 5G4YA 4BBUA 1DP8A 1DP6A 4NXEA 3VE3A 1LSVA 4DJ2A 1LT0A 5F68A 3UMDA 1Y28A 2QJ5A 4KUKA 2Z6CA 1UGUA 5DKLA 4HJ4A 5F6AA 4HI4A 3F1OA 1XJ3A 2PYPA 2L4RA 2VLGA 4EQ1A 1N9OA 2D01A 2YKFA 3H7WB 5I5LA 3VE4A 3GECA 3C8CA 1T18A 2PR6A 3A0SA 4NXFA 3H9WA 3BWLA 5J7EA 3E4PA 2VV8A 5EFWA 4L9GA 4EXOA 2A24A 1X0OA 3ICYA 5IU1A 5HWWA 4HOIA 4I3IA 4F3LB 4L9EA 1XJ4A 4JGPA 4WLAA 2PYRA 4JGQA 3LIDA 1P0ZA 5DJUA 2JHEA 1OTAA 3NHQA 5F69A 4E04A 1NWZA 3G6OA 4HP9A 4HQAA 1TS7A 2D02A 4NXGA 4I3AA 4R3AA 3H82A 4XT2B 2ZOIA 1S4RA 3EEHA 1OJGA 3F1OB 2QWSA 4L9FA 4MN6A 3IS2A 1TS8A 4KUOA 2OOLA 1OTDA 3LIFA 1OT6A 3MQQA 3NOPC 2VEAA 5HWTA 5TBMA 4HH2A 5J3WA 2HV1A 5G4ZA 4EESA 2I9VA 4I39A 3LI9A 2QJ7A
chains in the Genus database with same CATH superfamily
3IX8A 4N1HA 4ZAMA 1DP9A 4ZDXA 3E98A 1ZC2A 3BLSA 4LLOB 1VEUA 2Y2HA 1YLTA 4P6ZS 5KMWA 4LRZE 1H8MA 4E6WA 3UDIA 1PW8A 3NDEA 1FCNA 3NOUC 3OOVA 2G7UA 3FZCA 3ZG7B 3ZG0A 5JYOA 1F9IA 2X02A 2Z2LB 3MKEA 1NYYA 4O0PA 3UE0A 3T4SA 2VV6A 3CAXA 2XRNA 4IBXA 3SS5A 2V1AA 1YLWA 1PZOA 3KYEA 5L2FA 5KIZA 4IHQA 3RH8B 1TS0A 3TSGA 4OQHA 4X56A 3N7WA 2ZL1B 2J3TD 4KZ9A 4DJ2A 1Q2PA 1KVMA 4DF6A 3IT9A 2XA7S 3I7JA 3PBSA 3F1OA 1GA9A 3A0SA 4X1MA 5D3OA 3E4PA 4L9GA 2ZL1A 4NEED 4I3IA 5DTTA 4CQHA 3PAEA 3CZDA 4E3IA 1FCMA 3KYZA 1TDGA 4OOMA 1F2KA 2PBDP 4UHUA 4S2KA 2EFXA 4ID4A 5CTNA 4C3QA 3HREA 1ONHA 2V0UA 2VV7A 4NK3A 4F3LA 4IUKA 2ZQ9A 1SKOA 2ZMAA 3JVUA 3KX0X 4GOGA 4QHCA 1PFLA 2O9AA 4JGRA 4DXCA 1GA0A 1OTEA 4ZJ2A 3TE8A 3Q81A 2VK3A 1VHMA 1T1CA 1XJ6A 2X71A 3ZCZA 3BFCA 1VEUB 1GSVA 1N9LA 2XFSA 3BM6A 3WS4A 4XT2A 3FWLA 3KSHA 2WKRA 3PHYA 3BLMA 1F5MA 1K6SA 1ZG6A 4EERA 4EW7A 4IVIA 3LEZA 3SH8A 4FTXA 3IWIA 5GL9A 2A24B 2KX6A 3BJNA 2PD8A 3UMEA 1NY0A 4E3LA 5HPIA 1S67L 4R6LA 1EWZA 4G3WA 4GHIA 1DJAA 2EX9A 1CQAA 3DBAA 1BLCA 2M1CA 1MKMA 5FI6A 1PIOA 4E3KA 3GVBA 2JKTI 1A0KA 1XP4A 2INWA 5A93A 1HLUP 4R23A 2ZQ7A 3IX3A 1BLSA 3HVFA 3FKWA 1LT0A 2IWCA 1Y28A 2ZMFA 2HDQA 4KUKA 3MXSA 2BLSA 1MWRA 2ZM8A 5M1AA 1TDLA 2WZXA 2ZD8A 4CLCA 1FR6A 3ZDJA 4B88A 3AGFA 1FSWA 1OTAA 2Y2PA 3VFFA 2JKRI 1EI5A 3IF5A 4UA6A 1ES2A 3L9KA 1H8ZA 1YSPA 5L10A 5CEDA 1OTDA 4HBTA 1E25A 3IXGA 3C4PA 4Z1WA 3IHBA 1E4DA 5HD5A 1S1ZA 3TW8A 1U60A 1LL9A 2J80A 5EM0A 3KYQA 1BTLA 5EV0A 4EUVA 5IS1A 3F1PA 5CX7A 2HDUA 5E2HA 2Y2QA 3LGOA 3OC2A 2GZAA 3V3SA 3A0RA 4EQIA 3FG8A 3EWKA 1OT9A 4GB7A 1H3QA 3MF0A 4WN5A 4BJPA 1C3BA 3PBNA 2W1TB 2ZC7A 2V9AA 1CF0A 4KZ8A 2VGLS 5F1GA 3IWOA 1K38A 1BLHA 2B02A 1GHIA 2ZM2A 3S1YA 4D60A 3GDIA 4XUZA 3MBZA 5FAOA 2VKSA 4HESA 4IEDA 1O07A 1DP6A 2JKGA 3NY4A 4EUZA 1XJ3A 1SKFA 2D01A 2YKFA 2ZC5B 2PR6A 3QHYA 4CPKA 1P9RA 2PYRA 5GLBA 1P0ZA 4S2NC 4IUHA 4Q0JA 1YMXA 3V3RA 4LCLA 4BWIA 1LLBA 1G6OA 3G4PA 4QWOA 3M2KA 2PBYA 3CITA 3NULA 2Y2GA 2GX5A 4R38A 5CGXA 1DY6A 3T1RA 3LR0A 4CLCC 1KE0A 4R4SA 2OWHA 3P01A 2HP5A 1YKDA 2EX8A 2PU2A 5HDDA 2IWBA 2Y2JA 3MQOA 5EUAA 5HAQA 4LENA 1YT4A 3T4TA 4Y17A 4YNRA 1RP5A 2RL3A 4S2LA 4DJ3A 4BD1A 2W3EA 3CMZA 4HJ3A 5KZHA 3QP8A 5A92A 1CJFA 2VX8A 4L0LA 2EXBA 1XJ2A 1GHMA 5EVIC 3G32A 3NJAA 4WZ5A 1E3UD 1N9BA 1DJCA 4PPRA 3LR4A 2VJWA 1ERQA 4GDBA 2VGKA 2O9BA 1I2SA 1H5XA 2E8IA 4DE2A 4Y0OA 3BQAA 1M40A 4NG2A 1BSGA 3VP1A 2WKHA 4HI4A 2VLGA 3E2KA 4DE1A 2Z2MB 3KO6A 3VP2A 4OQ0A 5EVIB 4UQIM 3CJMA 1D1JA 4S2MA 2BTFP 1ES3A 2EX6A 4MDZA 2K31A 4NXGA 4KZ7A 3EEHA 3B3XA 2V8FA 4MN6A 2OOLA 1FIKA 3DW0A 2I9VA 2R9WA 1YLYA 2JC7A 5FSRA 5FEGA 5HWVA 4Y2FA 2V20A 1MZUA 3H7WA 3W4PA 4BBVA 3T4JA 1K56A 1S66L 2HF6A 4X6TA 5E2EA 3T4OA 2QPNA 4NXBA 5EVLA 3LIBA 3C2WA 4C75A 3QP6A 3ZYTA 4MBKA 4YOFA 3T4KA 3K3DA 3Q82A 1V9ZA 1L0DA 3UB9A 4Q0HA 2QKPA 4P87A 2HDRA 4KG2A 2EX2A 2DCFA 3G34A 4HY8A 2GJ3A 2CMNA 4FH4A 5AJGA 3O87A 5I94A 4FD8A 2HJEA 2ZQAA 4JXGA 4AFIA 1KVLA 2ZOHA 2PD7A 1JTGA 3A0VA 3OCNA 3HLBA 2PHYA 3IHAA 1MWSA 1IYOA 2WAEA 1WYCA 3DWKA 2EA9A 1EW0A 3G30A 3Q7ZA 1OMEA 4K0XA 3JPUA 4E3OA 5AQ9A 3UE3A 2HZ5A 4ZTKA 1XXMA 3T4LA 4DRTA 4X68A 2Y8HA 3IXHA 4FUWA 2A24A 3EEAA 3V5MA 1PWGA 3NBLA 3LIDA 2Y59A 5F69A 2PAVP 3CUEC 4S2NA 5DTSA 2QWSA 3IS2A 3MS6A 2DRWA 4IBRA 4II7A 3NOPC 2EFUA 1JTDA 2GNXA 2Y91A 1VB6A 3ZQ5A 2J3TC 3S22A 4S2JA 4OLGA 3D3OA 4R4RA 4OOLA 1LHYA 5J4EA 3G31A 1YAXA 2XA7M 3CWFA 2Z6DA 3QNBA 2WK0A 1XFQA 5FAQA 3ZVWA 4KQDA 4ME4A 4DDYA 1ONGA 3VP3A 4HHDA 4GS9A 5HZHA 2A3UA 4GD8A 3PBOA 5TJJA 2H0YA 4H6JB 3ULFA 1NJ4A 2XFTA 2W27A 3PAGA 3F1PB 1K56D 5FDSA 1ERMA 1PZPA 5L8MA 1J3WA 1H0MA 1YPRA 3BRMA 3UDXA 2G2UA 1NLYA 1T1AA 4GCZA 3K3CA 3MR0A 4PM8A 3WS0A 3VSLA 4HJ4A 4Y5FA 3A3JA 1SZVA 2G2WA 2HPBA 3OZHA 3UNWA 2CC1A 1K4FA 1TVFA 4L9EA 4JGPA 4F94A 1WE4A 4HQAA 2WGVA 1PNEA 4LV0A 1CEFA 1TS8A 4DN0A 4GD6A 1FR1A 4HH2A 1NZOA 4P6BA 3SZTA 2QJ7A 3UPOA 2GDNA 5BOHA 4HP4A 4MEZA 3VOLA 4JKTA 4KZ5A 3HLEA 3B42A 4RQ9A 3BY8A 3LYXA 1KDWA 5GHYA 3BY9A 4HJ6A 2XROA 4OQGA 1L0GA 3PBQA 2ZC3B 3IF6B 4DMZA 1ES4A 5HD3A 2WAFA 4X69A 3MXQA 2XD1A 2ZLYA 3LCEA 1S1YA 4HEFA 4RVAA 1HVBA 1YQSA 1FCOA 4I3JA 3DTEA 4XUXA 4GW9A 3LICA 4OPRA 3IBJA 5EE8A 3IBRA 4CLCB 1G6AA 3EQUA 3GSGA 1BYWA 1KGFA 2O99A 4EBPA 3PYPA 3N4IA 3SH9A 3IXDA 1MWUA 1W8QA 2WUQA 1JWZA 2BG1A 5F6AA 5F1FA 3ZNTA 5I5LA 4O01A 1BT5A 5HL6A 5EFWA 3HLGA 3UN7A 3C4OA 4GZBA 1IYSA 4I3AA 4QB8A 3QNCA 4X1LA 3MMHA 2C6WB 4MMNA 5CGWA 3U4LP 1ACFA 4S2OA 3UPNA 2HP6A 5IHVA 4OPQA 3S4XA 3HCYA 2WZZA 1PYYA 4S2PA 2J8YA 3MFXA 4E3NA 1FILA 5AQ7A 4OVDA 2ZQDA 2OLVA 3A3EA 3D72A 4WUJA 4D2OA 3S7QA 2R78A 1YLPA 1K57A 3UB8A 2PRFA 2OLUA 5EOEA 1WYBA 5EM1A 4H8RA 4BL2A 3GMWA 3EOIA 1IOUA 4ZRRA 1PI5A 2PR5A 3JYIA 1PRQA 2PDRA 2UWXA 2K2NA 5F5YA 4PM7A 5FATA 2H5SA 4MLLA 2QMIA 3O88A 1TD5A 3VFHA 4KZAA 3DAVA 1K0KA 5FQMA 4B4XA 4JXWA 4I5SA 4WEKA 3V39A 5L07A 3VE3A 2HP9A 2W3DA 2JCHA 5F68A 3UE1A 3LFVA 4ETZA 3GECA 1LI9A 5IT5A 3OCLA 1W5DA 4OONA 4CLCD 2OV5A 1X0OA 2NUPC 3OPPA 3NECA 3AGEA 3VP0A 4JLFA 2VGLM 2Y79A 3EQVA 5AQBA 4ARZA 4O7DA 1FSYA 5E43A 5HWTA 3BFGA 3W8KA 3WWXA 2WGWB 3LI9A 3UPPA 4LRYC 4BMWA 2KLIA 5AQAA 4P6ZM 3N6IA 1K54A 4PKYG 2V2FF 2Y2OA 4A5RA 4WL9A 1GSXA 1GCEA 1S6RA 4O8GA 4HIAA 3JVVA 1MPLA 2Y55A 2XDMA 1KE3A 3RTYA 4OP8A 4C6YA 3D9YA 3W4QA 3HLCA 4UA7A 2WKQA 1F98A 2ZC4B 5G18A 2ZQCA 3E2LA 2V1BA 2XF3A 3B33A 1K6RA 1W7FA 3WS2A 3HUMA 1XPBA 4X55A 4MCWA 5J8XA 1VM1A 4EWFA 4BLMA 2P08A 3PBTA 2WKEA 3G2ZA 3K2NA 2XEPA 4MNRA 1RGZA 4EEUA 4LV2A 3OLOA 3Q1FA 2OAP1 2QZ6A 3QP4A 5KSCA 2LB5A 2IWDA 1L2SA 2W1RA 2QJ5A 1IKIA 1G68A 4LV1A 1N9OA 3VE4A 3H7WB 1K55A 2LB9A 4M3KA 2WYXA 1SDEA 4PMAA 5DJUA 4X53A 3KSGA 4E6XA 3A3FA 3VOZA 4KZBA 2ZOIA 4BENA 1W8YA 4JF6A 5TR7A 3SW1A 1VETA 1CK3A 3OPHA 4GLQA 3UB7A 3R7WB 3P09A 4LFUA 3Q7VB 1SDNA 3P7NA 1MY8A 4MN5A 3UDFA 2A2LA 1NYMA 3LIEA 4KG5A 5CGSA 2P9VB 1ESIA 2YKHA 5HSQA 3LIAA 4K08A 4GNUA 4LV3A 3PBRA 3BEBA 3WRTA 3M6HA 5DFXA 1P9WA 3MKFA 4DXBA 4KZ3A 1IEMA 1LSXA 3BFEA 2FFFB 3HJIA 2Q9NA 2L1MA 3LY3A 5HW3A 3CG5A 2JN7A 4RYEA 2B95A 4OKPA 3OPLA 1ODVA 2Y2NA 1UWPX 5EVID 2Y2IA 1DP8A 4NXEA 2OAQ1 4WMCD 2EWWA 1VQQA 1T18A 2P74A 3R4KA 5J7EA 1CEGA 3ZG9B 3BW6A 3ICYA 3S7PA 4WBGA 3GR2A 1DJBA 1M6KA 3ITBA 4HP9A 4Y13A 4FH2A 5GLDA 2KOIA 1OJGA 3RXXA 1MKIA 1Y54A 2ACGA 3MQQA 5HL1A 2A49A 2V8CA 2VEAA 2W1TA 1K25A 5MC7A 3A3IA 1O7EA 4WEJA 4ZJ3A 5M19A 4JGOA 5HAPA 1K4EA 3E4QA 2ZJ9A 4GS9B 4U0TA 1MC0A 1BZAA 2XH9A 1OTIA 3TRCA 4KZ6A 4B93A 2H28A 1Y4OA 4PM6A 3ZG5A 1PWDA 1N9NA 4KZ4A 4PHTA 4Y0UA 1V9YA 4R1GA 4JXVA 2QHKA 3FC7A 4E3MA 3FYZA 1Z6FA 3OPRA 3KSIA 2WKIA 2ZC6B 3T1SA 1HTZA 5C5KA 1IYQA 5DF9A 3FPWA 4I38A 4OP5A 4QD4A 3MSHA 2KDKA 2JBFA 2Y4AA 5HX9A 3FKVA 1DRMA 3IQAA 4KENB 5A91A 1G28A 4FSFA 3MZDA 4PAUA 1GHPA 5DFYA 3GV9A 2Z6CA 1UGUA 5CTMA 5DKLA 4OH0A 2PT7A 3N8SA 4JXSA 5FEFA 4KQRA 4CLCE 4KQOA 5E2GA 1NXYA 4UAAA 5DF8A 1BUEA 3NHQA 3SH7A 1NWZA 4MBFA 2D02A 3H82A 3NDGA 4RA7A 1QMFA 4KUOA 3L7HA 5CHUA 2HV1A 4Y15A 1FQGA 4UA9A 4BBTA 2ZQ8A 2OSUA 3IH8A 3LUQA 4N9KA 5HDCA 4LRXC 3W2ZA 3IF6A 3LR3A 4QJGA 2XGNA 1LL5A 5CECA 1T1BA 4PM5A 1Z09A 4LGWA 2XR0A 3IS2B 5DTKA 4GJ4A 2XLNA 4R3BA 4WMCA 4WELA 1ZHHB 1IKGA 1OJ5A 1D06A 2WADA 4JPMA 1EROA 5EVIA 1S0WA 3LR5A 1PI4A 5DKKA 3HBRA 4HNBA 3HL9A 1W63Q 2X01A 3E4OA 4EETB 4K0WA 3HJKA 3M6BA 2B18A 3VV4A 4Q8IA 3MJQA 3U2AA 1CI8A 3BYDA 3FV7A 4Y7PA 2K7SA 3BECA 4BBUA 3G35A 1LSVA 5GHZA 2NUTC 3DTKA 3QP5A 1XKZA 4WYYA 4EQ1A 1FOFA 4NXFA 3C8CA 3BWLA 1L0EA 4DE0A 4QY6A 4IVKA 3UY6A 5HWWA 4MN7A 3LY4A 1XX2A 1XGJA 2JHEA 2Y2LA 4E04A 3HUOA 1TS7A 2EWVA 4LCMA 1S4RA 3MXRA 3W4OA 3F1OB 4OOYA 4UEYA 5FA7A 5TBMA 3NCKA 2JKFA 5FDHA 2DNSA 5CEBA 4I39A 4XXRA 3N8LA 5E2FA 4WM9A 3KSFA 5L09A 1AXBA 2P7JA 4CJNA 5GLAA 3ZNYA 1TF1A 4MBHA 2UV0E 3P98A 3IH9A 3IXBA 2IA2A 5TFQA 4DDSA 4K91A 1KOUA 1SKOB 3R7WA 5FQQA 2W3GA 3VMAA 5CHMA 5HARA 2I72A 1PWCA 1L3LA 2HGVA 2WGIA 3PR6A 2ZM0A 2Y2MA 4N1XA 2MJ6A 3DTMA 1P97A 5TBMB 3UE6A 1HD8A 4FOFA 5HDSA 1J9MA 4ZBEA 2P9VA 1KGGA 1ESUA 1K54C 1W63M 3LO7A 3LI8A 1KDSA 2M7UA 1MWTA 3DWZA 4PM9A 1RCJA 5CERA 4RX3A 3T1QB 4FCFA 2H10A 1YMSA 4N9LA 5FI7A 3MFDA 2W3FA 1JVJA 2E8JA 2VV8A 2HJ9C 1YSQA 1E3UA 3GTCA 4Z9QA 4WLAA 3S7NA 3ZG8B 4WZ4A 4B4ZA 3TG9A 1RGYA 3ZFZA 4L9FA 3MZEA 3G2YA 4QPRA 1H8YA 1YM1A 1Q2QA 4GN2A 4S2IA 3V50A 4X25A 5IU1A 3A3DA 2V1ZA 2ZMVA 3ISGA 1I5QA 3NI9A 1OPXA 1ZG4A 3T4QA 1HZOA 4KG6A 3CI6A 2B5RA 2PU4A 3F1NA 2L0WA 1I2WA 4NKPA 4JF5A 2OWJA 3CPTB 3ZVTA 3QP1A 4ETXA 5CHJA 4JF4A 2P04A 5DF7A 3HLFA 5FAPA 4HH3A 1IFQA 1OTBA 4Q0IA 4U0XA 1GSWA 4EBLA 2O9CA 1S4SA 3SOIA 3BQ8A 1D7EA 2VZWA 3SS4A 1BLPA 4P0MA 3BFFA 1JWPA 3UO9A 2WKPA 3C5AA 5JYPA 2JKTM 1ES5A 3PXPA 5DJTA 5K5BA 4JBFA 3TJZC 3CPTA 1PW1A 2W3HA 4P85A 3O3VA 3EGDC 2RCXA 5A90A 3IF6C 3H9WA 3IX4A 5M18A 4EXOA 1YLJA 4F3LB 2M7VA 1XA7A 1NLZA 4YFMA 4XT2B 5EOOA 1IELA 3LIFA 1SHVA 1OT6A 1TEMA 1QMEA 1L0FA 2J9OA 1WA9A 3PTEA 4EV4A 4EBNA 5FQKA 2JKRM 1G5UA 1XGIA 5DVAA 3T12B 2HDSA 4PKYA 5AVEA 3ITAA 4HBUA 4Y3IA 3VSKA 2Q0OA 3TOIA 3O86A 1NRJA 2FZ0A 3C7VA 2C5WB 4N92A 5FQ9A 4IJGA 5F83A 1LSWA 3RFBA 2J7VA 3H82B 4G3VA 3ZGAB 4KQQA 3F1NB 3CUEA 3M2JA 4ARZB 1XA1A 5HFOA 2VGJA 4GHIB 3NC8A 5GLCA 4Y0TA 2FH5A 4NETA 3WS1A 4UQIS 4GDNA 3E0YA 2J9PA 4H6JA 2VA0A 3S7OA 2Q9MA 3MQ0A 3ZHHA 2FFYA 3T50A 2V0WA 2EXAA 5U47A 3HLWA 2ZBBA 1T19A 1LL8A 3Q07A 4EEPA 4R70A 1ALQA 4B9OA 1YLZA 2JE5A 3WS5A 3UMDA 3SS3A 3RXWA 1AWIA 2L4RA 4BL3A 1ZTUA 1K55C 2QYBA 5FQJA 3WRZA 4HOIA 1XJ4A 2Y2KA 3HUNA 3EGXC 5FI2A 5TGFA 3G6OA 3BFDA 1N4OA 3MZFA 5J3WA 5CRFA 5EECA 1JNUA 1W79A 4OPYA 1VETB 2XQZA 4WF0A 3GRJA 2W0NA 4EU0A 5AVFA 4DKIA 4EESA 4QY5A 4LPZA 3OBFA 3UB5P 3UB6A 1CI9A 4OQIA 1SCWA 5FQIA 2BASA 1BULA 3N8RA 4GKUA 4YWZA 1UWNX 4ESPA 4E3JA 4YINA 2DMWA 3AGDA 1NRFA 1STZA 3NIAA 3T1XA 1XFNA 3LEQA 2XK1A 1JWVA 1KE4A 3CLOA 3Q7VA 4DE3A 5A8BA 5FASA 3B47A 1MBLA 4G3KA 1LI0A 2XSSA 1TS6A 5FL3A 5EVEA 3NOTC 2H0TA 3GQZA 3RJUA 1IYPA 3DTIA 4BQMA 4M4XA 3C30A 4U3TA 5GHXA 1ZKJA 3QP2A 4OPZA 5G4YA 4RX2A 4OLDA 4WZ5C 5LBRA 4BD0A 2R9XA 3VOYA 1MXOA 3HLDA 3IWQA 1K57C 2PYPA 3C7UA 1NZUA 2J3WA 1KGEA 3FPVA 2WGWA 3CHWP 2O0YA 4ZJ1A 4QU3A 3C38A 5KSHA 5EPHA 4JGQA 3O5YA 5HAIA 5HPFA 2XD5A 3D4FA 5CXWA 4R3AA 4R0QA 4R3JA 5F82A 2AVXA 5G4ZA 3V67A 3VP4A
chains in the Genus database with same CATH topology
4BMWA 4LRYC 2KLIA 4P6ZM 3KSFA 5HWVA 1DP9A 4PKYG 4Y2FA 2P7JA 1MZUA 3E98A 4WL9A 3H7WA 1GSXA 1TF1A 4LLOB 4BBVA 4O8GA 3T4JA 1S66L 2HF6A 3T4OA 4P6ZS 4HIAA 3JVVA 4LRZE 4NXBA 1H8MA 3LIBA 3C2WA 2IA2A 3ZYTA 3NOUC 3OOVA 1KOUA 2G7UA 4YOFA 3K3DA 3T4KA 3R7WA 3RTYA 2W3GA 1V9ZA 1F9IA 3UB9A 2HGVA 3PR6A 2WKQA 1F98A 4Q0HA 2QKPA 2V1BA 3B33A 4HY8A 4O0PA 2MJ6A 3T4SA 1P97A 2GJ3A 2VV6A 2CMNA 5AJGA 5TBMB 3CAXA 3UE6A 4MCWA 4FOFA 5HDSA 2XRNA 2P08A 3PBTA 2V1AA 2HJEA 3K2NA 4AFIA 5KIZA 2ZOHA 4IHQA 2PD7A 3A0VA 3RH8B 1W63M 3OCNA 2PHYA 3LI8A 1TS0A 4EEUA 3OLOA 2OAP1 2EA9A 2M7UA 1EW0A 2J3TD 2LB5A 4DJ2A 2W1RA 2QJ5A 2XA7S 3PBSA 3UE3A 3F1OA 3T4LA 1N9OA 3VE4A 3H7WB 2LB9A 3A0SA 2W3FA 2Y8HA 3E4PA 2VV8A 4L9GA 2A24A 2HJ9C 1YSQA 3EEAA 4NEED 4I3IA 4CQHA 5DJUA 4WLAA 3S7NA 3LIDA 3KYZA 5F69A 3KSGA 3CUEC 4OOMA 2ZOIA 2QWSA 4L9FA 3IS2A 4II7A 3NOPC 4QPRA 3SW1A 2GNXA 2V0UA 2VV7A 1VB6A 4F3LA 4IUKA 3ZQ5A 2J3TC 3JVUA 3KX0X 4GLQA 3UB7A 3R7WB 5IU1A 3P7NA 4MN5A 3D3OA 2O9AA 4JGRA 2A2LA 4OOLA 1OTEA 2ZMVA 3LIEA 3TE8A 5J4EA 1VHMA 1OPXA 1T1CA 1XJ6A 3T4QA 1YAXA 2YKHA 1GSVA 5HSQA 3CI6A 3F1NA 3LIAA 2XA7M 4K08A 2L0WA 1N9LA 3CWFA 4NKPA 2Z6DA 4XT2A 1XFQA 3PBRA 2OWJA 4KQDA 3KSHA 2WKRA 4ME4A 3PHYA 1F5MA 4EW7A 4EERA 4HHDA 4GS9A 5DFXA 5HZHA 4ETXA 1P9WA 3PBOA 5TJJA 4H6JB 2A24B 2KX6A 2P04A 3ULFA 3BJNA 2PD8A 3UMEA 2W27A 5HPIA 1LSXA 1IFQA 4HH3A 1OTBA 1S67L 4R6LA 4G3WA 4GHIA 4Q0IA 3F1PB 1GSWA 3HJIA 3DBAA 2O9CA 1S4SA 2M1CA 2L1MA 1MKMA 3BQ8A 5L8MA 1D7EA 2JN7A 2VZWA 2JKTI 2INWA 1ODVA 2WKPA 1NLYA 1UWPX 1T1AA 4GCZA 3K3CA 3MR0A 2JKTM 5K5BA 3PXPA 5DJTA 1DP8A 4NXEA 2OAQ1 1LT0A 3TJZC 2EWWA 1Y28A 2ZMFA 4KUKA 2W3HA 4HJ4A 4Y5FA 3EGDC 4CLCA 1T18A 3H9WA 3R4KA 5J7EA 4EXOA 3BW6A 3ICYA 3S7PA 4F3LB 4L9EA 4JGPA 1OTAA 2M7VA 2JKRI 1NLZA 4HP9A 4HQAA 4XT2B 2KOIA 1OJGA 1YSPA 1TS8A 3LIFA 1OTDA 3MQQA 1OT6A 4DN0A 2VEAA 2W1TA 4HH2A 4Z1WA 5MC7A 2QJ7A 5HD5A 1S1ZA 1WA9A 4HP4A 3TW8A 3VOLA 2JKRM 4WEJA 2J80A 4JGOA 3B42A 4PKYA 4RQ9A 5AVEA 3KYQA 3BY8A 3E4QA 4GS9B 4Y3IA 4EUVA 1MC0A 5IS1A 3F1PA 5CX7A 3LYXA 1NRJA 2FZ0A 1OTIA 4IJGA 3BY9A 1LSWA 3OC2A 4HJ6A 2GZAA 3RFBA 3TRCA 4B93A 3H82B 2H28A 4G3VA 2XROA 3A0RA 3F1NB 3PBQA 3CUEA 4ARZB 3FG8A 3EWKA 4GHIB 1N9NA 4PHTA 1OT9A 1V9YA 4DMZA 5HD3A 1H3QA 3MF0A 3MXQA 2FH5A 2QHKA 4UQIS 3FC7A 4WN5A 4BJPA 3KSIA 3E0YA 1S1YA 4H6JA 3PBNA 2W1TB 2VA0A 2V9AA 3S7OA 5C5KA 3FPWA 2VGLS 4I38A 5DF9A 3MQ0A 4I3JA 3T50A 2V0WA 2B02A 4GW9A 3LICA 2ZBBA 2KDKA 3GDIA 1DRMA 1T19A 1LL8A 3IBJA 4EEPA 4R70A 3IBRA 4CLCB 3EQUA 1G28A 4B9OA 2VKSA 1BYWA 2O99A 4FSFA 3PYPA 4PAUA 1DP6A 5DFYA 3UMDA 2Z6CA 1UGUA 5DKLA 5F6AA 2PT7A 1XJ3A 2L4RA 4CLCE 2D01A 2YKFA 4KQOA 5I5LA 4O01A 1ZTUA 2PR6A 5HL6A 2QYBA 5EFWA 1P9RA 4HOIA 1XJ4A 2PYRA 1P0ZA 3EGXC 3NHQA 1NWZA 3G6OA 4IUHA 2D02A 4I3AA 3H82A 4Q0JA 3MMHA 4KUOA 4MMNA 5J3WA 4BWIA 2HV1A 1G6OA 4BBTA 3HCYA 3CITA 1JNUA 2GX5A 3LUQA 4WF0A 4R38A 2W0NA 4EU0A 5AVFA 5HDCA 4EESA 4LRXC 4LPZA 3LR0A 3W2ZA 3OBFA 4CLCC 3UB6A 3MFXA 2OWHA 3LR3A 3P01A 2BASA 1YKDA 1T1BA 5HDDA 3D72A 3MQOA 4YWZA 1UWNX 4WUJA 3S7QA 3IS2B 3T4TA 2R78A 2DMWA 3UB8A 4GJ4A 4WELA 1STZA 1ZHHB 4YNRA 1OJ5A 1D06A 1XFNA 4DJ3A 3LR5A 2W3EA 5DKKA 4HJ3A 3EOIA 1IOUA 4HNBA 3CLOA 4ZRRA 2VX8A 2PR5A 5A8BA 2PDRA 3B47A 4L0LA 1W63Q 2K2NA 4G3KA 5F5YA 1XJ2A 3E4OA 4EETB 2XSSA 1TS6A 3HJKA 3VV4A 2B18A 5FL3A 3MJQA 3NOTC 1TD5A 3NJAA 3U2AA 3LR4A 2VJWA 4M4XA 2O9BA 2K7SA 3C30A 4I5SA 3BQAA 4WEKA 5G4YA 4BBUA 3VE3A 2W3DA 1LSVA 5F68A 5LBRA 2NUTC 3LFVA 4ETZA 4HI4A 2PYPA 2VLGA 4EQ1A 3KO6A 3GECA 3C8CA 2J3WA 4NXFA 3FPVA 3BWLA 5IT5A 3OCLA 2O0YA 4UQIM 4CLCD 1X0OA 3C38A 5HWWA 2NUPC 5KSHA 4MN7A 4JGQA 3O5YA 2JHEA 5HPFA 2K31A 4MDZA 4E04A 1TS7A 2EWVA 4NXGA 4R3AA 2VGLM 1S4RA 3EEHA 2Y79A 3EQVA 3F1OB 4MN6A 4ARZA 2OOLA 4UEYA 5HWTA 5TBMA 5G4ZA 2I9VA 3V67A 4I39A 3LI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRY C;  5HD5 A;  2V0U A;  2VV7 A;  1VB6 A;  4BBT A;  4F3L A;  1S1Z A;  1WA9 A;  4HP4 A;  1JNU A;  3VOL A;  5HWV A;  3ZQ5 A;  3KX0 X;  3LUQ A;  1DP9 A;  4PKY G;  3UB7 A;  4WF0 A;  2P7J A;  1MZU A;  4R38 A;  2W0N A;  4WL9 A;  2J80 A;  3P7N A;  3H7W A;  4JGO A;  5AVF A;  1GSX A;  4MN5 A;  4PKY A;  4LRX C;  4RQ9 A;  5AVE A;  3BY8 A;  5HDC A;  4LLO B;  4LPZ A;  4JGR A;  4BBV A;  3E4Q A;  1S66 L;  1OTE A;  4GS9 B;  3LIE A;  3UB6 A;  5J4E A;  3MFX A;  4HIA A;  5IS1 A;  3F1P A;  4LRZ E;  4NXB A;  1T1C A;  1XJ6 A;  2OWH A;  3LYX A;  4XT2 A;  3LIB A;  2BAS A;  2YKH A;  1GSV A;  1OTI A;  3C2W A;  5HSQ A;  3F1N A;  3LIA A;  4K08 A;  1T1B A;  2L0W A;  5HDD A;  1N9L A;  3BY9 A;  3CWF A;  1LSW A;  4HJ6 A;  2Z6D A;  3NOU C;  3H82 B;  2H28 A;  1KOU A;  1XFQ A;  3D72 A;  3MQO A;  1UWN X;  3A0R A;  3F1N B;  3K3D A;  4WUJ A;  2OWJ A;  4KQD A;  4YWZ A;  3RTY A;  1V9Z A;  2WKR A;  3IS2 B;  1F9I A;  3PHY A;  3FG8 A;  3EWK A;  2R78 A;  4GHI B;  4EW7 A;  3UB9 A;  1N9N A;  3UB8 A;  1OT9 A;  4EER A;  4HHD A;  1V9Y A;  4GS9 A;  5HD3 A;  5HZH A;  3MXQ A;  2WKQ A;  1F98 A;  1OJ5 A;  1D06 A;  1XFN A;  2QKP A;  4DJ3 A;  2QHK A;  2V1B A;  3B33 A;  3FC7 A;  4H6J B;  5DKK A;  4HJ3 A;  4WN5 A;  2A24 B;  2KX6 A;  4HNB A;  3CLO A;  3ULF A;  2PD8 A;  4HY8 A;  1P97 A;  1S1Y A;  2GJ3 A;  2VV6 A;  2CMN A;  2PR5 A;  2W27 A;  4H6J A;  3UME A;  5TBM B;  1LSX A;  4HH3 A;  3CAX A;  3UE6 A;  5A8B A;  2V9A A;  2PDR A;  1OTB A;  4I38 A;  1S67 L;  4R6L A;  5F5Y A;  5HDS A;  1XJ2 A;  4GHI A;  3F1P B;  3E4O A;  4I3J A;  4EET B;  1GSW A;  3T50 A;  3HJI A;  1TS6 A;  2V0W A;  2B02 A;  2V1A A;  3HJK A;  4GW9 A;  3LIC A;  1S4S A;  3MJQ A;  3NOT C;  2M1C A;  2ZBB A;  2L1M A;  3NJA A;  5KIZ A;  2KDK A;  2ZOH A;  3GDI A;  3SW1 A;  1D7E A;  2JN7 A;  2PD7 A;  3A0V A;  3RH8 B;  1DRM A;  1T19 A;  1LL8 A;  2PHY A;  3LI8 A;  1TS0 A;  4EEU A;  2INW A;  4R70 A;  4EEP A;  3IBR A;  1ODV A;  3OLO A;  2WKP A;  4M4X A;  1G28 A;  4B9O A;  1UWP X;  2EA9 A;  1T1A A;  2K7S A;  1BYW A;  4GCZ A;  1EW0 A;  3K3C A;  4I5S A;  3MR0 A;  3PYP A;  5DJT A;  5G4Y A;  4BBU A;  1DP8 A;  1DP6 A;  4NXE A;  3VE3 A;  1LSV A;  4DJ2 A;  1LT0 A;  5F68 A;  3UMD A;  1Y28 A;  2QJ5 A;  4KUK A;  2Z6C A;  1UGU A;  5DKL A;  4HJ4 A;  5F6A A;  4HI4 A;  3F1O A;  1XJ3 A;  2PYP A;  2L4R A;  2VLG A;  4EQ1 A;  1N9O A;  2D01 A;  2YKF A;  3H7W B;  5I5L A;  3VE4 A;  3GEC A;  3C8C A;  1T18 A;  2PR6 A;  3A0S A;  4NXF A;  3H9W A;  3BWL A;  5J7E A;  3E4P A;  2VV8 A;  5EFW A;  4L9G A;  4EXO A;  2A24 A;  1X0O A;  3ICY A;  5IU1 A;  5HWW A;  4HOI A;  4I3I A;  4F3L B;  4L9E A;  1XJ4 A;  4JGP A;  4WLA A;  2PYR A;  4JGQ A;  3LID A;  1P0Z A;  5DJU A;  2JHE A;  1OTA A;  3NHQ A;  5F69 A;  4E04 A;  1NWZ A;  3G6O A;  4HP9 A;  4HQA A;  1TS7 A;  2D02 A;  4NXG A;  4I3A A;  4R3A A;  3H82 A;  4XT2 B;  2ZOI A;  1S4R A;  3EEH A;  1OJG A;  3F1O B;  2QWS A;  4L9F A;  4MN6 A;  3IS2 A;  1TS8 A;  4KUO A;  2OOL A;  1OTD A;  3LIF A;  1OT6 A;  3MQQ A;  3NOP C;  2VEA A;  5HWT A;  5TBM A;  4HH2 A;  5J3W A;  2HV1 A;  5G4Z A;  4EES A;  2I9V A;  4I39 A;  3LI9 A;  2QJ7 A; 
#chains in the Genus database with same CATH topology
 3IX8 A;  4N1H A;  4ZAM A;  1DP9 A;  4ZDX A;  3E98 A;  1ZC2 A;  3BLS A;  4LLO B;  1VEU A;  2Y2H A;  1YLT A;  4P6Z S;  5KMW A;  4LRZ E;  1H8M A;  4E6W A;  3UDI A;  1PW8 A;  3NDE A;  1FCN A;  3NOU C;  3OOV A;  2G7U A;  3FZC A;  3ZG7 B;  3ZG0 A;  5JYO A;  1F9I A;  2X02 A;  2Z2L B;  3MKE A;  1NYY A;  4O0P A;  3UE0 A;  3T4S A;  2VV6 A;  3CAX A;  2XRN A;  4IBX A;  3SS5 A;  2V1A A;  1YLW A;  1PZO A;  3KYE A;  5L2F A;  5KIZ A;  4IHQ A;  3RH8 B;  1TS0 A;  3TSG A;  4OQH A;  4X56 A;  3N7W A;  2ZL1 B;  2J3T D;  4KZ9 A;  4DJ2 A;  1Q2P A;  1KVM A;  4DF6 A;  3IT9 A;  2XA7 S;  3I7J A;  3PBS A;  3F1O A;  1GA9 A;  3A0S A;  4X1M A;  5D3O A;  3E4P A;  4L9G A;  2ZL1 A;  4NEE D;  4I3I A;  5DTT A;  4CQH A;  3PAE A;  3CZD A;  4E3I A;  1FCM A;  3KYZ A;  1TDG A;  4OOM A;  1F2K A;  2PBD P;  4UHU A;  4S2K A;  2EFX A;  4ID4 A;  5CTN A;  4C3Q A;  3HRE A;  1ONH A;  2V0U A;  2VV7 A;  4NK3 A;  4F3L A;  4IUK A;  2ZQ9 A;  1SKO A;  2ZMA A;  3JVU A;  3KX0 X;  4GOG A;  4QHC A;  1PFL A;  2O9A A;  4JGR A;  4DXC A;  1GA0 A;  1OTE A;  4ZJ2 A;  3TE8 A;  3Q81 A;  2VK3 A;  1VHM A;  1T1C A;  1XJ6 A;  2X71 A;  3ZCZ A;  3BFC A;  1VEU B;  1GSV A;  1N9L A;  2XFS A;  3BM6 A;  3WS4 A;  4XT2 A;  3FWL A;  3KSH A;  2WKR A;  3PHY A;  3BLM A;  1F5M A;  1K6S A;  1ZG6 A;  4EER A;  4EW7 A;  4IVI A;  3LEZ A;  3SH8 A;  4FTX A;  3IWI A;  5GL9 A;  2A24 B;  2KX6 A;  3BJN A;  2PD8 A;  3UME A;  1NY0 A;  4E3L A;  5HPI A;  1S67 L;  4R6L A;  1EWZ A;  4G3W A;  4GHI A;  1DJA A;  2EX9 A;  1CQA A;  3DBA A;  1BLC A;  2M1C A;  1MKM A;  5FI6 A;  1PIO A;  4E3K A;  3GVB A;  2JKT I;  1A0K A;  1XP4 A;  2INW A;  5A93 A;  1HLU P;  4R23 A;  2ZQ7 A;  3IX3 A;  1BLS A;  3HVF A;  3FKW A;  1LT0 A;  2IWC A;  1Y28 A;  2ZMF A;  2HDQ A;  4KUK A;  3MXS A;  2BLS A;  1MWR A;  2ZM8 A;  5M1A A;  1TDL A;  2WZX A;  2ZD8 A;  4CLC A;  1FR6 A;  3ZDJ A;  4B88 A;  3AGF A;  1FSW A;  1OTA A;  2Y2P A;  3VFF A;  2JKR I;  1EI5 A;  3IF5 A;  4UA6 A;  1ES2 A;  3L9K A;  1H8Z A;  1YSP A;  5L10 A;  5CED A;  1OTD A;  4HBT A;  1E25 A;  3IXG A;  3C4P A;  4Z1W A;  3IHB A;  1E4D A;  5HD5 A;  1S1Z A;  3TW8 A;  1U60 A;  1LL9 A;  2J80 A;  5EM0 A;  3KYQ A;  1BTL A;  5EV0 A;  4EUV A;  5IS1 A;  3F1P A;  5CX7 A;  2HDU A;  5E2H A;  2Y2Q A;  3LGO A;  3OC2 A;  2GZA A;  3V3S A;  3A0R A;  4EQI A;  3FG8 A;  3EWK A;  1OT9 A;  4GB7 A;  1H3Q A;  3MF0 A;  4WN5 A;  4BJP A;  1C3B A;  3PBN A;  2W1T B;  2ZC7 A;  2V9A A;  1CF0 A;  4KZ8 A;  2VGL S;  5F1G A;  3IWO A;  1K38 A;  1BLH A;  2B02 A;  1GHI A;  2ZM2 A;  3S1Y A;  4D60 A;  3GDI A;  4XUZ A;  3MBZ A;  5FAO A;  2VKS A;  4HES A;  4IED A;  1O07 A;  1DP6 A;  2JKG A;  3NY4 A;  4EUZ A;  1XJ3 A;  1SKF A;  2D01 A;  2YKF A;  2ZC5 B;  2PR6 A;  3QHY A;  4CPK A;  1P9R A;  2PYR A;  5GLB A;  1P0Z A;  4S2N C;  4IUH A;  4Q0J A;  1YMX A;  3V3R A;  4LCL A;  4BWI A;  1LLB A;  1G6O A;  3G4P A;  4QWO A;  3M2K A;  2PBY A;  3CIT A;  3NUL A;  2Y2G A;  2GX5 A;  4R38 A;  5CGX A;  1DY6 A;  3T1R A;  3LR0 A;  4CLC C;  1KE0 A;  4R4S A;  2OWH A;  3P01 A;  2HP5 A;  1YKD A;  2EX8 A;  2PU2 A;  5HDD A;  2IWB A;  2Y2J A;  3MQO A;  5EUA A;  5HAQ A;  4LEN A;  1YT4 A;  3T4T A;  4Y17 A;  4YNR A;  1RP5 A;  2RL3 A;  4S2L A;  4DJ3 A;  4BD1 A;  2W3E A;  3CMZ A;  4HJ3 A;  5KZH A;  3QP8 A;  5A92 A;  1CJF A;  2VX8 A;  4L0L A;  2EXB A;  1XJ2 A;  1GHM A;  5EVI C;  3G32 A;  3NJA A;  4WZ5 A;  1E3U D;  1N9B A;  1DJC A;  4PPR A;  3LR4 A;  2VJW A;  1ERQ A;  4GDB A;  2VGK A;  2O9B A;  1I2S A;  1H5X A;  2E8I A;  4DE2 A;  4Y0O A;  3BQA A;  1M40 A;  4NG2 A;  1BSG A;  3VP1 A;  2WKH A;  4HI4 A;  2VLG A;  3E2K A;  4DE1 A;  2Z2M B;  3KO6 A;  3VP2 A;  4OQ0 A;  5EVI B;  4UQI M;  3CJM A;  1D1J A;  4S2M A;  2BTF P;  1ES3 A;  2EX6 A;  4MDZ A;  2K31 A;  4NXG A;  4KZ7 A;  3EEH A;  3B3X A;  2V8F A;  4MN6 A;  2OOL A;  1FIK A;  3DW0 A;  2I9V A;  2R9W A;  1YLY A;  2JC7 A;  5FSR A;  5FEG A;  5HWV A;  4Y2F A;  2V20 A;  1MZU A;  3H7W A;  3W4P A;  4BBV A;  3T4J A;  1K56 A;  1S66 L;  2HF6 A;  4X6T A;  5E2E A;  3T4O A;  2QPN A;  4NXB A;  5EVL A;  3LIB A;  3C2W A;  4C75 A;  3QP6 A;  3ZYT A;  4MBK A;  4YOF A;  3T4K A;  3K3D A;  3Q82 A;  1V9Z A;  1L0D A;  3UB9 A;  4Q0H A;  2QKP A;  4P87 A;  2HDR A;  4KG2 A;  2EX2 A;  2DCF A;  3G34 A;  4HY8 A;  2GJ3 A;  2CMN A;  4FH4 A;  5AJG A;  3O87 A;  5I94 A;  4FD8 A;  2HJE A;  2ZQA A;  4JXG A;  4AFI A;  1KVL A;  2ZOH A;  2PD7 A;  1JTG A;  3A0V A;  3OCN A;  3HLB A;  2PHY A;  3IHA A;  1MWS A;  1IYO A;  2WAE A;  1WYC A;  3DWK A;  2EA9 A;  1EW0 A;  3G30 A;  3Q7Z A;  1OME A;  4K0X A;  3JPU A;  4E3O A;  5AQ9 A;  3UE3 A;  2HZ5 A;  4ZTK A;  1XXM A;  3T4L A;  4DRT A;  4X68 A;  2Y8H A;  3IXH A;  4FUW A;  2A24 A;  3EEA A;  3V5M A;  1PWG A;  3NBL A;  3LID A;  2Y59 A;  5F69 A;  2PAV P;  3CUE C;  4S2N A;  5DTS A;  2QWS A;  3IS2 A;  3MS6 A;  2DRW A;  4IBR A;  4II7 A;  3NOP C;  2EFU A;  1JTD A;  2GNX A;  2Y91 A;  1VB6 A;  3ZQ5 A;  2J3T C;  3S22 A;  4S2J A;  4OLG A;  3D3O A;  4R4R A;  4OOL A;  1LHY A;  5J4E A;  3G31 A;  1YAX A;  2XA7 M;  3CWF A;  2Z6D A;  3QNB A;  2WK0 A;  1XFQ A;  5FAQ A;  3ZVW A;  4KQD A;  4ME4 A;  4DDY A;  1ONG A;  3VP3 A;  4HHD A;  4GS9 A;  5HZH A;  2A3U A;  4GD8 A;  3PBO A;  5TJJ A;  2H0Y A;  4H6J B;  3ULF A;  1NJ4 A;  2XFT A;  2W27 A;  3PAG A;  3F1P B;  1K56 D;  5FDS A;  1ERM A;  1PZP A;  5L8M A;  1J3W A;  1H0M A;  1YPR A;  3BRM A;  3UDX A;  2G2U A;  1NLY A;  1T1A A;  4GCZ A;  3K3C A;  3MR0 A;  4PM8 A;  3WS0 A;  3VSL A;  4HJ4 A;  4Y5F A;  3A3J A;  1SZV A;  2G2W A;  2HPB A;  3OZH A;  3UNW A;  2CC1 A;  1K4F A;  1TVF A;  4L9E A;  4JGP A;  4F94 A;  1WE4 A;  4HQA A;  2WGV A;  1PNE A;  4LV0 A;  1CEF A;  1TS8 A;  4DN0 A;  4GD6 A;  1FR1 A;  4HH2 A;  1NZO A;  4P6B A;  3SZT A;  2QJ7 A;  3UPO A;  2GDN A;  5BOH A;  4HP4 A;  4MEZ A;  3VOL A;  4JKT A;  4KZ5 A;  3HLE A;  3B42 A;  4RQ9 A;  3BY8 A;  3LYX A;  1KDW A;  5GHY A;  3BY9 A;  4HJ6 A;  2XRO A;  4OQG A;  1L0G A;  3PBQ A;  2ZC3 B;  3IF6 B;  4DMZ A;  1ES4 A;  5HD3 A;  2WAF A;  4X69 A;  3MXQ A;  2XD1 A;  2ZLY A;  3LCE A;  1S1Y A;  4HEF A;  4RVA A;  1HVB A;  1YQS A;  1FCO A;  4I3J A;  3DTE A;  4XUX A;  4GW9 A;  3LIC A;  4OPR A;  3IBJ A;  5EE8 A;  3IBR A;  4CLC B;  1G6A A;  3EQU A;  3GSG A;  1BYW A;  1KGF A;  2O99 A;  4EBP A;  3PYP A;  3N4I A;  3SH9 A;  3IXD A;  1MWU A;  1W8Q A;  2WUQ A;  1JWZ A;  2BG1 A;  5F6A A;  5F1F A;  3ZNT A;  5I5L A;  4O01 A;  1BT5 A;  5HL6 A;  5EFW A;  3HLG A;  3UN7 A;  3C4O A;  4GZB A;  1IYS A;  4I3A A;  4QB8 A;  3QNC A;  4X1L A;  3MMH A;  2C6W B;  4MMN A;  5CGW A;  3U4L P;  1ACF A;  4S2O A;  3UPN A;  2HP6 A;  5IHV A;  4OPQ A;  3S4X A;  3HCY A;  2WZZ A;  1PYY A;  4S2P A;  2J8Y A;  3MFX A;  4E3N A;  1FIL A;  5AQ7 A;  4OVD A;  2ZQD A;  2OLV A;  3A3E A;  3D72 A;  4WUJ A;  4D2O A;  3S7Q A;  2R78 A;  1YLP A;  1K57 A;  3UB8 A;  2PRF A;  2OLU A;  5EOE A;  1WYB A;  5EM1 A;  4H8R A;  4BL2 A;  3GMW A;  3EOI A;  1IOU A;  4ZRR A;  1PI5 A;  2PR5 A;  3JYI A;  1PRQ A;  2PDR A;  2UWX A;  2K2N A;  5F5Y A;  4PM7 A;  5FAT A;  2H5S A;  4MLL A;  2QMI A;  3O88 A;  1TD5 A;  3VFH A;  4KZA A;  3DAV A;  1K0K A;  5FQM A;  4B4X A;  4JXW A;  4I5S A;  4WEK A;  3V39 A;  5L07 A;  3VE3 A;  2HP9 A;  2W3D A;  2JCH A;  5F68 A;  3UE1 A;  3LFV A;  4ETZ A;  3GEC A;  1LI9 A;  5IT5 A;  3OCL A;  1W5D A;  4OON A;  4CLC D;  2OV5 A;  1X0O A;  2NUP C;  3OPP A;  3NEC A;  3AGE A;  3VP0 A;  4JLF A;  2VGL M;  2Y79 A;  3EQV A;  5AQB A;  4ARZ A;  4O7D A;  1FSY A;  5E43 A;  5HWT A;  3BFG A;  3W8K A;  3WWX A;  2WGW B;  3LI9 A;  3UPP A;  4LRY C;  4BMW A;  2KLI A;  5AQA A;  4P6Z M;  3N6I A;  1K54 A;  4PKY G;  2V2F F;  2Y2O A;  4A5R A;  4WL9 A;  1GSX A;  1GCE A;  1S6R A;  4O8G A;  4HIA A;  3JVV A;  1MPL A;  2Y55 A;  2XDM A;  1KE3 A;  3RTY A;  4OP8 A;  4C6Y A;  3D9Y A;  3W4Q A;  3HLC A;  4UA7 A;  2WKQ A;  1F98 A;  2ZC4 B;  5G18 A;  2ZQC A;  3E2L A;  2V1B A;  2XF3 A;  3B33 A;  1K6R A;  1W7F A;  3WS2 A;  3HUM A;  1XPB A;  4X55 A;  4MCW A;  5J8X A;  1VM1 A;  4EWF A;  4BLM A;  2P08 A;  3PBT A;  2WKE A;  3G2Z A;  3K2N A;  2XEP A;  4MNR A;  1RGZ A;  4EEU A;  4LV2 A;  3OLO A;  3Q1F A;  2OAP 1;  2QZ6 A;  3QP4 A;  5KSC A;  2LB5 A;  2IWD A;  1L2S A;  2W1R A;  2QJ5 A;  1IKI A;  1G68 A;  4LV1 A;  1N9O A;  3VE4 A;  3H7W B;  1K55 A;  2LB9 A;  4M3K A;  2WYX A;  1SDE A;  4PMA A;  5DJU A;  4X53 A;  3KSG A;  4E6X A;  3A3F A;  3VOZ A;  4KZB A;  2ZOI A;  4BEN A;  1W8Y A;  4JF6 A;  5TR7 A;  3SW1 A;  1VET A;  1CK3 A;  3OPH A;  4GLQ A;  3UB7 A;  3R7W B;  3P09 A;  4LFU A;  3Q7V B;  1SDN A;  3P7N A;  1MY8 A;  4MN5 A;  3UDF A;  2A2L A;  1NYM A;  3LIE A;  4KG5 A;  5CGS A;  2P9V B;  1ESI A;  2YKH A;  5HSQ A;  3LIA A;  4K08 A;  4GNU A;  4LV3 A;  3PBR A;  3BEB A;  3WRT A;  3M6H A;  5DFX A;  1P9W A;  3MKF A;  4DXB A;  4KZ3 A;  1IEM A;  1LSX A;  3BFE A;  2FFF B;  3HJI A;  2Q9N A;  2L1M A;  3LY3 A;  5HW3 A;  3CG5 A;  2JN7 A;  4RYE A;  2B95 A;  4OKP A;  3OPL A;  1ODV A;  2Y2N A;  1UWP X;  5EVI D;  2Y2I A;  1DP8 A;  4NXE A;  2OAQ 1;  4WMC D;  2EWW A;  1VQQ A;  1T18 A;  2P74 A;  3R4K A;  5J7E A;  1CEG A;  3ZG9 B;  3BW6 A;  3ICY A;  3S7P A;  4WBG A;  3GR2 A;  1DJB A;  1M6K A;  3ITB A;  4HP9 A;  4Y13 A;  4FH2 A;  5GLD A;  2KOI A;  1OJG A;  3RXX A;  1MKI A;  1Y54 A;  2ACG A;  3MQQ A;  5HL1 A;  2A49 A;  2V8C A;  2VEA A;  2W1T A;  1K25 A;  5MC7 A;  3A3I A;  1O7E A;  4WEJ A;  4ZJ3 A;  5M19 A;  4JGO A;  5HAP A;  1K4E A;  3E4Q A;  2ZJ9 A;  4GS9 B;  4U0T A;  1MC0 A;  1BZA A;  2XH9 A;  1OTI A;  3TRC A;  4KZ6 A;  4B93 A;  2H28 A;  1Y4O A;  4PM6 A;  3ZG5 A;  1PWD A;  1N9N A;  4KZ4 A;  4PHT A;  4Y0U A;  1V9Y A;  4R1G A;  4JXV A;  2QHK A;  3FC7 A;  4E3M A;  3FYZ A;  1Z6F A;  3OPR A;  3KSI A;  2WKI A;  2ZC6 B;  3T1S A;  1HTZ A;  5C5K A;  1IYQ A;  5DF9 A;  3FPW A;  4I38 A;  4OP5 A;  4QD4 A;  3MSH A;  2KDK A;  2JBF A;  2Y4A A;  5HX9 A;  3FKV A;  1DRM A;  3IQA A;  4KEN B;  5A91 A;  1G28 A;  4FSF A;  3MZD A;  4PAU A;  1GHP A;  5DFY A;  3GV9 A;  2Z6C A;  1UGU A;  5CTM A;  5DKL A;  4OH0 A;  2PT7 A;  3N8S A;  4JXS A;  5FEF A;  4KQR A;  4CLC E;  4KQO A;  5E2G A;  1NXY A;  4UAA A;  5DF8 A;  1BUE A;  3NHQ A;  3SH7 A;  1NWZ A;  4MBF A;  2D02 A;  3H82 A;  3NDG A;  4RA7 A;  1QMF A;  4KUO A;  3L7H A;  5CHU A;  2HV1 A;  4Y15 A;  1FQG A;  4UA9 A;  4BBT A;  2ZQ8 A;  2OSU A;  3IH8 A;  3LUQ A;  4N9K A;  5HDC A;  4LRX C;  3W2Z A;  3IF6 A;  3LR3 A;  4QJG A;  2XGN A;  1LL5 A;  5CEC A;  1T1B A;  4PM5 A;  1Z09 A;  4LGW A;  2XR0 A;  3IS2 B;  5DTK A;  4GJ4 A;  2XLN A;  4R3B A;  4WMC A;  4WEL A;  1ZHH B;  1IKG A;  1OJ5 A;  1D06 A;  2WAD A;  4JPM A;  1ERO A;  5EVI A;  1S0W A;  3LR5 A;  1PI4 A;  5DKK A;  3HBR A;  4HNB A;  3HL9 A;  1W63 Q;  2X01 A;  3E4O A;  4EET B;  4K0W A;  3HJK A;  3M6B A;  2B18 A;  3VV4 A;  4Q8I A;  3MJQ A;  3U2A A;  1CI8 A;  3BYD A;  3FV7 A;  4Y7P A;  2K7S A;  3BEC A;  4BBU A;  3G35 A;  1LSV A;  5GHZ A;  2NUT C;  3DTK A;  3QP5 A;  1XKZ A;  4WYY A;  4EQ1 A;  1FOF A;  4NXF A;  3C8C A;  3BWL A;  1L0E A;  4DE0 A;  4QY6 A;  4IVK A;  3UY6 A;  5HWW A;  4MN7 A;  3LY4 A;  1XX2 A;  1XGJ A;  2JHE A;  2Y2L A;  4E04 A;  3HUO A;  1TS7 A;  2EWV A;  4LCM A;  1S4R A;  3MXR A;  3W4O A;  3F1O B;  4OOY A;  4UEY A;  5FA7 A;  5TBM A;  3NCK A;  2JKF A;  5FDH A;  2DNS A;  5CEB A;  4I39 A;  4XXR A;  3N8L A;  5E2F A;  4WM9 A;  3KSF A;  5L09 A;  1AXB A;  2P7J A;  4CJN A;  5GLA A;  3ZNY A;  1TF1 A;  4MBH A;  2UV0 E;  3P98 A;  3IH9 A;  3IXB A;  2IA2 A;  5TFQ A;  4DDS A;  4K91 A;  1KOU A;  1SKO B;  3R7W A;  5FQQ A;  2W3G A;  3VMA A;  5CHM A;  5HAR A;  2I72 A;  1PWC A;  1L3L A;  2HGV A;  2WGI A;  3PR6 A;  2ZM0 A;  2Y2M A;  4N1X A;  2MJ6 A;  3DTM A;  1P97 A;  5TBM B;  3UE6 A;  1HD8 A;  4FOF A;  5HDS A;  1J9M A;  4ZBE A;  2P9V A;  1KGG A;  1ESU A;  1K54 C;  1W63 M;  3LO7 A;  3LI8 A;  1KDS A;  2M7U A;  1MWT A;  3DWZ A;  4PM9 A;  1RCJ A;  5CER A;  4RX3 A;  3T1Q B;  4FCF A;  2H10 A;  1YMS A;  4N9L A;  5FI7 A;  3MFD A;  2W3F A;  1JVJ A;  2E8J A;  2VV8 A;  2HJ9 C;  1YSQ A;  1E3U A;  3GTC A;  4Z9Q A;  4WLA A;  3S7N A;  3ZG8 B;  4WZ4 A;  4B4Z A;  3TG9 A;  1RGY A;  3ZFZ A;  4L9F A;  3MZE A;  3G2Y A;  4QPR A;  1H8Y A;  1YM1 A;  1Q2Q A;  4GN2 A;  4S2I A;  3V50 A;  4X25 A;  5IU1 A;  3A3D A;  2V1Z A;  2ZMV A;  3ISG A;  1I5Q A;  3NI9 A;  1OPX A;  1ZG4 A;  3T4Q A;  1HZO A;  4KG6 A;  3CI6 A;  2B5R A;  2PU4 A;  3F1N A;  2L0W A;  1I2W A;  4NKP A;  4JF5 A;  2OWJ A;  3CPT B;  3ZVT A;  3QP1 A;  4ETX A;  5CHJ A;  4JF4 A;  2P04 A;  5DF7 A;  3HLF A;  5FAP A;  4HH3 A;  1IFQ A;  1OTB A;  4Q0I A;  4U0X A;  1GSW A;  4EBL A;  2O9C A;  1S4S A;  3SOI A;  3BQ8 A;  1D7E A;  2VZW A;  3SS4 A;  1BLP A;  4P0M A;  3BFF A;  1JWP A;  3UO9 A;  2WKP A;  3C5A A;  5JYP A;  2JKT M;  1ES5 A;  3PXP A;  5DJT A;  5K5B A;  4JBF A;  3TJZ C;  3CPT A;  1PW1 A;  2W3H A;  4P85 A;  3O3V A;  3EGD C;  2RCX A;  5A90 A;  3IF6 C;  3H9W A;  3IX4 A;  5M18 A;  4EXO A;  1YLJ A;  4F3L B;  2M7V A;  1XA7 A;  1NLZ A;  4YFM A;  4XT2 B;  5EOO A;  1IEL A;  3LIF A;  1SHV A;  1OT6 A;  1TEM A;  1QME A;  1L0F A;  2J9O A;  1WA9 A;  3PTE A;  4EV4 A;  4EBN A;  5FQK A;  2JKR M;  1G5U A;  1XGI A;  5DVA A;  3T12 B;  2HDS A;  4PKY A;  5AVE A;  3ITA A;  4HBU A;  4Y3I A;  3VSK A;  2Q0O A;  3TOI A;  3O86 A;  1NRJ A;  2FZ0 A;  3C7V A;  2C5W B;  4N92 A;  5FQ9 A;  4IJG A;  5F83 A;  1LSW A;  3RFB A;  2J7V A;  3H82 B;  4G3V A;  3ZGA B;  4KQQ A;  3F1N B;  3CUE A;  3M2J A;  4ARZ B;  1XA1 A;  5HFO A;  2VGJ A;  4GHI B;  3NC8 A;  5GLC A;  4Y0T A;  2FH5 A;  4NET A;  3WS1 A;  4UQI S;  4GDN A;  3E0Y A;  2J9P A;  4H6J A;  2VA0 A;  3S7O A;  2Q9M A;  3MQ0 A;  3ZHH A;  2FFY A;  3T50 A;  2V0W A;  2EXA A;  5U47 A;  3HLW A;  2ZBB A;  1T19 A;  1LL8 A;  3Q07 A;  4EEP A;  4R70 A;  1ALQ A;  4B9O A;  1YLZ A;  2JE5 A;  3WS5 A;  3UMD A;  3SS3 A;  3RXW A;  1AWI A;  2L4R A;  4BL3 A;  1ZTU A;  1K55 C;  2QYB A;  5FQJ A;  3WRZ A;  4HOI A;  1XJ4 A;  2Y2K A;  3HUN A;  3EGX C;  5FI2 A;  5TGF A;  3G6O A;  3BFD A;  1N4O A;  3MZF A;  5J3W A;  5CRF A;  5EEC A;  1JNU A;  1W79 A;  4OPY A;  1VET B;  2XQZ A;  4WF0 A;  3GRJ A;  2W0N A;  4EU0 A;  5AVF A;  4DKI A;  4EES A;  4QY5 A;  4LPZ A;  3OBF A;  3UB5 P;  3UB6 A;  1CI9 A;  4OQI A;  1SCW A;  5FQI A;  2BAS A;  1BUL A;  3N8R A;  4GKU A;  4YWZ A;  1UWN X;  4ESP A;  4E3J A;  4YIN A;  2DMW A;  3AGD A;  1NRF A;  1STZ A;  3NIA A;  3T1X A;  1XFN A;  3LEQ A;  2XK1 A;  1JWV A;  1KE4 A;  3CLO A;  3Q7V A;  4DE3 A;  5A8B A;  5FAS A;  3B47 A;  1MBL A;  4G3K A;  1LI0 A;  2XSS A;  1TS6 A;  5FL3 A;  5EVE A;  3NOT C;  2H0T A;  3GQZ A;  3RJU A;  1IYP A;  3DTI A;  4BQM A;  4M4X A;  3C30 A;  4U3T A;  5GHX A;  1ZKJ A;  3QP2 A;  4OPZ A;  5G4Y A;  4RX2 A;  4OLD A;  4WZ5 C;  5LBR A;  4BD0 A;  2R9X A;  3VOY A;  1MXO A;  3HLD A;  3IWQ A;  1K57 C;  2PYP A;  3C7U A;  1NZU A;  2J3W A;  1KGE A;  3FPV A;  2WGW A;  3CHW P;  2O0Y A;  4ZJ1 A;  4QU3 A;  3C38 A;  5KSH A;  5EPH A;  4JGQ A;  3O5Y A;  5HAI A;  5HPF A;  2XD5 A;  3D4F A;  5CXW A;  4R3A A;  4R0Q A;  4R3J A;  5F82 A;  2AVX A;  5G4Z A;  3V67 A;  3VP4 A; 
#chains in the Genus database with same CATH homology
 4BMW A;  4LRY C;  2KLI A;  4P6Z M;  3KSF A;  5HWV A;  1DP9 A;  4PKY G;  4Y2F A;  2P7J A;  1MZU A;  3E98 A;  4WL9 A;  3H7W A;  1GSX A;  1TF1 A;  4LLO B;  4BBV A;  4O8G A;  3T4J A;  1S66 L;  2HF6 A;  3T4O A;  4P6Z S;  4HIA A;  3JVV A;  4LRZ E;  4NXB A;  1H8M A;  3LIB A;  3C2W A;  2IA2 A;  3ZYT A;  3NOU C;  3OOV A;  1KOU A;  2G7U A;  4YOF A;  3K3D A;  3T4K A;  3R7W A;  3RTY A;  2W3G A;  1V9Z A;  1F9I A;  3UB9 A;  2HGV A;  3PR6 A;  2WKQ A;  1F98 A;  4Q0H A;  2QKP A;  2V1B A;  3B33 A;  4HY8 A;  4O0P A;  2MJ6 A;  3T4S A;  1P97 A;  2GJ3 A;  2VV6 A;  2CMN A;  5AJG A;  5TBM B;  3CAX A;  3UE6 A;  4MCW A;  4FOF A;  5HDS A;  2XRN A;  2P08 A;  3PBT A;  2V1A A;  2HJE A;  3K2N A;  4AFI A;  5KIZ A;  2ZOH A;  4IHQ A;  2PD7 A;  3A0V A;  3RH8 B;  1W63 M;  3OCN A;  2PHY A;  3LI8 A;  1TS0 A;  4EEU A;  3OLO A;  2OAP 1;  2EA9 A;  2M7U A;  1EW0 A;  2J3T D;  2LB5 A;  4DJ2 A;  2W1R A;  2QJ5 A;  2XA7 S;  3PBS A;  3UE3 A;  3F1O A;  3T4L A;  1N9O A;  3VE4 A;  3H7W B;  2LB9 A;  3A0S A;  2W3F A;  2Y8H A;  3E4P A;  2VV8 A;  4L9G A;  2A24 A;  2HJ9 C;  1YSQ A;  3EEA A;  4NEE D;  4I3I A;  4CQH A;  5DJU A;  4WLA A;  3S7N A;  3LID A;  3KYZ A;  5F69 A;  3KSG A;  3CUE C;  4OOM A;  2ZOI A;  2QWS A;  4L9F A;  3IS2 A;  4II7 A;  3NOP C;  4QPR A;  3SW1 A;  2GNX A;  2V0U A;  2VV7 A;  1VB6 A;  4F3L A;  4IUK A;  3ZQ5 A;  2J3T C;  3JVU A;  3KX0 X;  4GLQ A;  3UB7 A;  3R7W B;  5IU1 A;  3P7N A;  4MN5 A;  3D3O A;  2O9A A;  4JGR A;  2A2L A;  4OOL A;  1OTE A;  2ZMV A;  3LIE A;  3TE8 A;  5J4E A;  1VHM A;  1OPX A;  1T1C A;  1XJ6 A;  3T4Q A;  1YAX A;  2YKH A;  1GSV A;  5HSQ A;  3CI6 A;  3F1N A;  3LIA A;  2XA7 M;  4K08 A;  2L0W A;  1N9L A;  3CWF A;  4NKP A;  2Z6D A;  4XT2 A;  1XFQ A;  3PBR A;  2OWJ A;  4KQD A;  3KSH A;  2WKR A;  4ME4 A;  3PHY A;  1F5M A;  4EW7 A;  4EER A;  4HHD A;  4GS9 A;  5DFX A;  5HZH A;  4ETX A;  1P9W A;  3PBO A;  5TJJ A;  4H6J B;  2A24 B;  2KX6 A;  2P04 A;  3ULF A;  3BJN A;  2PD8 A;  3UME A;  2W27 A;  5HPI A;  1LSX A;  1IFQ A;  4HH3 A;  1OTB A;  1S67 L;  4R6L A;  4G3W A;  4GHI A;  4Q0I A;  3F1P B;  1GSW A;  3HJI A;  3DBA A;  2O9C A;  1S4S A;  2M1C A;  2L1M A;  1MKM A;  3BQ8 A;  5L8M A;  1D7E A;  2JN7 A;  2VZW A;  2JKT I;  2INW A;  1ODV A;  2WKP A;  1NLY A;  1UWP X;  1T1A A;  4GCZ A;  3K3C A;  3MR0 A;  2JKT M;  5K5B A;  3PXP A;  5DJT A;  1DP8 A;  4NXE A;  2OAQ 1;  1LT0 A;  3TJZ C;  2EWW A;  1Y28 A;  2ZMF A;  4KUK A;  2W3H A;  4HJ4 A;  4Y5F A;  3EGD C;  4CLC A;  1T18 A;  3H9W A;  3R4K A;  5J7E A;  4EXO A;  3BW6 A;  3ICY A;  3S7P A;  4F3L B;  4L9E A;  4JGP A;  1OTA A;  2M7V A;  2JKR I;  1NLZ A;  4HP9 A;  4HQA A;  4XT2 B;  2KOI A;  1OJG A;  1YSP A;  1TS8 A;  3LIF A;  1OTD A;  3MQQ A;  1OT6 A;  4DN0 A;  2VEA A;  2W1T A;  4HH2 A;  4Z1W A;  5MC7 A;  2QJ7 A;  5HD5 A;  1S1Z A;  1WA9 A;  4HP4 A;  3TW8 A;  3VOL A;  2JKR M;  4WEJ A;  2J80 A;  4JGO A;  3B42 A;  4PKY A;  4RQ9 A;  5AVE A;  3KYQ A;  3BY8 A;  3E4Q A;  4GS9 B;  4Y3I A;  4EUV A;  1MC0 A;  5IS1 A;  3F1P A;  5CX7 A;  3LYX A;  1NRJ A;  2FZ0 A;  1OTI A;  4IJG A;  3BY9 A;  1LSW A;  3OC2 A;  4HJ6 A;  2GZA A;  3RFB A;  3TRC A;  4B93 A;  3H82 B;  2H28 A;  4G3V A;  2XRO A;  3A0R A;  3F1N B;  3PBQ A;  3CUE A;  4ARZ B;  3FG8 A;  3EWK A;  4GHI B;  1N9N A;  4PHT A;  1OT9 A;  1V9Y A;  4DMZ A;  5HD3 A;  1H3Q A;  3MF0 A;  3MXQ A;  2FH5 A;  2QHK A;  4UQI S;  3FC7 A;  4WN5 A;  4BJP A;  3KSI A;  3E0Y A;  1S1Y A;  4H6J A;  3PBN A;  2W1T B;  2VA0 A;  2V9A A;  3S7O A;  5C5K A;  3FPW A;  2VGL S;  4I38 A;  5DF9 A;  3MQ0 A;  4I3J A;  3T50 A;  2V0W A;  2B02 A;  4GW9 A;  3LIC A;  2ZBB A;  2KDK A;  3GDI A;  1DRM A;  1T19 A;  1LL8 A;  3IBJ A;  4EEP A;  4R70 A;  3IBR A;  4CLC B;  3EQU A;  1G28 A;  4B9O A;  2VKS A;  1BYW A;  2O99 A;  4FSF A;  3PYP A;  4PAU A;  1DP6 A;  5DFY A;  3UMD A;  2Z6C A;  1UGU A;  5DKL A;  5F6A A;  2PT7 A;  1XJ3 A;  2L4R A;  4CLC E;  2D01 A;  2YKF A;  4KQO A;  5I5L A;  4O01 A;  1ZTU A;  2PR6 A;  5HL6 A;  2QYB A;  5EFW A;  1P9R A;  4HOI A;  1XJ4 A;  2PYR A;  1P0Z A;  3EGX C;  3NHQ A;  1NWZ A;  3G6O A;  4IUH A;  2D02 A;  4I3A A;  3H82 A;  4Q0J A;  3MMH A;  4KUO A;  4MMN A;  5J3W A;  4BWI A;  2HV1 A;  1G6O A;  4BBT A;  3HCY A;  3CIT A;  1JNU A;  2GX5 A;  3LUQ A;  4WF0 A;  4R38 A;  2W0N A;  4EU0 A;  5AVF A;  5HDC A;  4EES A;  4LRX C;  4LPZ A;  3LR0 A;  3W2Z A;  3OBF A;  4CLC C;  3UB6 A;  3MFX A;  2OWH A;  3LR3 A;  3P01 A;  2BAS A;  1YKD A;  1T1B A;  5HDD A;  3D72 A;  3MQO A;  4YWZ A;  1UWN X;  4WUJ A;  3S7Q A;  3IS2 B;  3T4T A;  2R78 A;  2DMW A;  3UB8 A;  4GJ4 A;  4WEL A;  1STZ A;  1ZHH B;  4YNR A;  1OJ5 A;  1D06 A;  1XFN A;  4DJ3 A;  3LR5 A;  2W3E A;  5DKK A;  4HJ3 A;  3EOI A;  1IOU A;  4HNB A;  3CLO A;  4ZRR A;  2VX8 A;  2PR5 A;  5A8B A;  2PDR A;  3B47 A;  4L0L A;  1W63 Q;  2K2N A;  4G3K A;  5F5Y A;  1XJ2 A;  3E4O A;  4EET B;  2XSS A;  1TS6 A;  3HJK A;  3VV4 A;  2B18 A;  5FL3 A;  3MJQ A;  3NOT C;  1TD5 A;  3NJA A;  3U2A A;  3LR4 A;  2VJW A;  4M4X A;  2O9B A;  2K7S A;  3C30 A;  4I5S A;  3BQA A;  4WEK A;  5G4Y A;  4BBU A;  3VE3 A;  2W3D A;  1LSV A;  5F68 A;  5LBR A;  2NUT C;  3LFV A;  4ETZ A;  4HI4 A;  2PYP A;  2VLG A;  4EQ1 A;  3KO6 A;  3GEC A;  3C8C A;  2J3W A;  4NXF A;  3FPV A;  3BWL A;  5IT5 A;  3OCL A;  2O0Y A;  4UQI M;  4CLC D;  1X0O A;  3C38 A;  5HWW A;  2NUP C;  5KSH A;  4MN7 A;  4JGQ A;  3O5Y A;  2JHE A;  5HPF A;  2K31 A;  4MDZ A;  4E04 A;  1TS7 A;  2EWV A;  4NXG A;  4R3A A;  2VGL M;  1S4R A;  3EEH A;  2Y79 A;  3EQV A;  3F1O B;  4MN6 A;  4ARZ A;  2OOL A;  4UEY A;  5HWT A;  5TBM A;  5G4Z A;  2I9V A;  3V67 A;  4I39 A;  3LI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...