4HJ4A

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
177
structure length
177
Chain Sequence
AMDQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
molecule keywords LOV protein
total genus 56
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hj4A00
4B9OA 3LICA 5HZHA 4HHDA 2GJ3A 3F1NA 4HJ4A 1OTDA 2ZBBA 3HJKA 4LLOB 1NWZA 1P0ZA 1T1AA 4JGQA 3ZQ5A 5HWWA 3BY9A 5DKLA 3OLOA 5F69A 4EEUA 5A8BA 1N9OA 4KUKA 2Z6CA 1XJ3A 1G28A 4I5SA 1WA9A 5IU1A 3PHYA 4GW9A 1S1YA 3MQQA 3F1NB 3T50A 4F3LA 3GDIA 4NXGA 2PDRA 2PHYA 4HQAA 4PKYG 5F5YA 1DRMA 2I9VA 1LT0A 1D06A 2PYRA 4HJ3A 1UWNX 4K08A 1JNUA 5F6AA 1XJ6A 3NHQA 4KUOA 1GSVA 4GHIB 1S1ZA 4GS9A 5TBMA 2VV7A 1UGUA 3ICYA 5F68A 2B02A 2V9AA 1ODVA 4HH3A 3A0RA 1LL8A 4BBTA 5HD5A 2EA9A 2VLGA 4KQDA 2BASA 3KX0X 2KX6A 4LRXC 4NXFA 2WKQA 3F1PB 3VOLA 1KOUA 3VE3A 1N9NA 3A0VA 4EXOA 3K3CA 3LI9A 4L9GA 4LPZA 4M4XA 4L9FA 4GHIA 3D72A 4I38A 3RH8B 4E04A 3NOUC 1F9IA 1MZUA 1GSWA 3LUQA 4WN5A 3MFXA 4HY8A 5EFWA 5HDSA 2A24B 3PYPA 2H28A 4EETB 5HDCA 1T1BA 2V0UA 4HIAA 3UMEA 5IS1A 1D7EA 5J3WA 4XT2B 1S66L 2PD7A 4HP4A 4EQ1A 2D02A 4I39A 4DJ2A 4YWZA 3H82A 3NJAA 3RTYA 2V1AA 2W0NA 4H6JA 1TS6A 1V9ZA 2YKHA 3MJQA 2ZOHA 3E4OA 3UB8A 4BBUA 1OJ5A 1EW0A 2PR5A 3GECA 1OT6A 4NXEA 1XJ4A 4L9EA 3UMDA 4EEPA 1OTAA 3BY8A 3F1OB 3E4PA 2Z6DA 5KIZA 4RQ9A 2JHEA 2ZOIA 4LRZE 1UWPX 3CLOA 3E4QA 4HI4A 1LSWA 1S67L 3B33A 3C8CA 5G4YA 3MXQA 1OTEA 3ULFA 2P7JA 1OT9A 2OWJA 2OWHA 3CWFA 2L1MA 3H7WA 4R3AA 5HDDA 4WUJA 3LIDA 5AVEA 4R6LA 5HD3A 3UB9A 4HH2A 4HNBA 1VB6A 1X0OA 2W27A 3G6OA 1Y28A 4I3JA 2J80A 4MN5A 5I5LA 2VEAA 5DKKA 1GSXA 1S4SA 1T1CA 3A0SA 4NXBA 1N9LA 1T19A 3K3DA 2VV8A 4PKYA 3MR0A 2QWSA 1DP9A 4MN6A 4EESA 5DJTA 4F3LB 1TS0A 2A24A 1XJ2A 4JGRA 2V0WA 3C2WA 2QHKA 2KDKA 3MQOA 2CMNA 3LIEA 4EW7A 3LI8A 2V1BA 4JGPA 4DJ3A 3SW1A 1XFQA 4GS9B 5TBMB 2L0WA 1T18A 3FG8A 2WKPA 2HV1A 2VV6A 3EWKA 3P7NA 4HOIA 4GCZA 4XT2A 3IBRA 2QJ7A 4R70A 3FC7A 1LSXA 4HP9A 4BBVA 4R38A 1OTBA 1DP8A 2JN7A 1TS7A 3H9WA 3LYXA 3IS2B 4EERA 1V9YA 1LSVA 4I3IA 3NOTC 1BYWA 1F98A 4WLAA 2QKPA 3LIAA 4WL9A 5HWTA 1DP6A 4JGOA 2PR6A 4I3AA 2D01A 5G4ZA 5J4EA 5AVFA 2QJ5A 1OTIA 3H7WB 5J7EA 3IS2A 3LIBA 2YKFA 3H82B 2K7SA 3UE6A 3VE4A 5HSQA 1TS8A 2PYPA 4H6JB 3BWLA 1OJGA 1XFNA 4LRYC 3CAXA 2WKRA 3UB6A 2PD8A 2R78A 3EEHA 5HWVA 4WF0A 3F1OA 4HJ6A 3HJIA 2L4RA 1P97A 1S4RA 5DJUA 3UB7A 3NOPC 3F1PA 2INWA 3LIFA 2M1CA 2OOLA
chains in the Genus database with same CATH superfamily
3N8SA 3A3IA 5HX9A 1P0ZA 2WZXA 3IF6A 2ZMFA 4C3QA 1GA0A 2LB5A 4G3WA 1LI9A 1YLWA 4KZBA 3VP3A 1K54C 3Q7VA 3RXXA 4MN7A 3RXWA 2HDUA 5GLDA 3A0RA 4EV4A 3HUMA 2BASA 3VMAA 4ETZA 1HLUP 1PIOA 2DMWA 1Q2PA 3TW8A 5LBRA 3HUOA 3EOIA 5IS1A 3ZDJA 4F3LB 1YLPA 4FTXA 2PR5A 4X53A 4XUZA 2M7VA 3T4QA 2OV5A 4Q8IA 5BOHA 1I5QA 2P9VA 2Z6DA 3UB5P 4LRZE 1AXBA 3QP5A 3BFEA 1FSYA 5E2GA 4P87A 4Y5FA 3EGDC 3NY4A 1PI5A 2G2UA 3KSGA 3S22A 1NZUA 1STZA 3O3VA 4G3KA 2Y2LA 3EEAA 1DJCA 2VGLM 3LIEA 3BYDA 2ZMAA 2VV6A 3EWKA 4QY5A 3IF6C 3S4XA 3LEQA 2JN7A 4X69A 4EERA 2QYBA 1OPXA 1KVLA 3P98A 1NY0A 1K54A 3DTMA 4X1MA 2YKFA 5I94A 2DRWA 3SS5A 2FH5A 2Y2JA 2P08A 5FDSA 5DTSA 1J3WA 4QU3A 4LLOB 1CF0A 3BY9A 5DKLA 5F69A 2EWWA 5HPIA 2JC7A 3CITA 1WA9A 4N1HA 3PHYA 5FQKA 3V5MA 3T1QB 4UQIS 4GJ4A 1TDGA 5EV0A 5FDHA 5A90A 4GHIB 1S1ZA 4HESA 3OCNA 2VV7A 4UA7A 2HDQA 2KX6A 3UE3A 3KO6A 2X02A 4OLDA 3HLFA 2ZC4B 4RX3A 4OPZA 4M4XA 1YAXA 5A91A 1MZUA 1GHMA 3CI6A 1K4FA 5HDCA 1BULA 2PD7A 3PTEA 4YWZA 3H82A 1G5UA 3TE8A 4NXEA 1M40A 4DKIA 4M3KA 4BL2A 4CQHA 2A3UA 3KYQA 1J9MA 3H7WA 2OWJA 4Y15A 4E6WA 1FR1A 4CLCC 4MN6A 2Y4AA 3Q07A 4EW7A 1W5DA 2PBDP 1DJBA 2E8IA 3AGDA 1SZVA 4P6ZM 3T1RA 3V67A 5HAIA 1G6AA 4XUXA 3PBNA 4E3KA 4OPQA 1TS8A 3ISGA 2OAQ1 4P6BA 4WF0A 1ERMA 1YSPA 5EVIB 1S4RA 1CK3A 3LIFA 4ETXA 4Y13A 3OPRA 4HJ4A 3HJKA 2Y2HA 1IYSA 4KQOA 2VJWA 5EVID 3EGXC 4DE2A 1S1YA 1YSQA 1ZTUA 2XGNA 4RX2A 4GB7A 5CGSA 4RVAA 5F68A 1BT5A 2XSSA 3LR4A 1HD8A 5HD5A 3VE3A 3N6IA 3RH8B 5HDSA 4NETA 3GSGA 4IBXA 3S1YA 3UMEA 4EQ1A 3PBQA 3TG9A 3CZDA 1OJ5A 1VQQA 2Q0OA 3E2LA 1OT6A 3GECA 2ZQCA 4EEPA 3SS4A 4S2KA 3C4PA 3PAEA 4BD0A 3E4QA 5EOOA 1S67L 5G4YA 4E6XA 3T4SA 2W3GA 2HDSA 1GSXA 5DKKA 4JLFA 3UDXA 3N7WA 3IT9A 1TS0A 1I2WA 3C2WA 2QHKA 1XFQA 1PWCA 3P09A 4ZDXA 2QJ7A 4HP9A 1LSXA 3DW0A 4JF5A 2XD1A 1Y54A 4WL9A 5GHXA 4GNUA 5CHUA 2XEPA 4E3NA 3H82B 5DVAA 2QPNA 3VSLA 3DWZA 4Q0HA 3CPTA 4HJ6A 3HJIA 4C6YA 5GLCA 1TDLA 3UE0A 2JKGA 3AGEA 3IHAA 3T12B 3UB7A 4DF6A 4EQIA 3VSKA 3F1NA 4EBLA 5FI2A 3UE1A 2HGVA 2I72A 2W3DA 5E2EA 2HDRA 2Y2OA 3O88A 1EI5A 5U47A 2KLIA 2ZM0A 2PDRA 4HQAA 4EUVA 3ITBA 1K25A 2I9VA 1DJAA 2Z2LB 3DBAA 4DDYA 3A3FA 4KZ9A 3QNCA 5FL3A 2WAFA 3G30A 2EA9A 1MWRA 3IHBA 3ZG9B 1KOUA 1E3UD 3A0VA 1K56D 5TFQA 3FKWA 2VKSA 3SOIA 4D2OA 1PW8A 3HLEA 3NDGA 3ZHHA 1BTLA 4WEJA 4BL3A 3MFDA 1V9ZA 3WRTA 4Y0TA 3BY8A 3E4PA 1Q2QA 5MC7A 2ZOIA 5M18A 3B33A 3U2AA 1PRQA 1CQAA 3ULFA 1SKFA 4R6LA 4Y7PA 1KGEA 1S4SA 3KSHA 2Y55A 1F2KA 4JXVA 4ZJ1A 1BLCA 4UHUA 3T4LA 3RJUA 5TBMB 1K56A 2OLVA 3FG8A 5L10A 5J8XA 4KZAA 1FOFA 3A3DA 1TS7A 1Z6FA 4Y2FA 3LY3A 1XP4A 4FH4A 5HWTA 3ITAA 3T1XA 5J7EA 3KSIA 2K7SA 5TGFA 4X55A 3O86A 4IUKA 3LCEA 3WWXA 1FCNA 2OOLA 2W3FA 2WYXA 1T1AA 2ZD8A 3VOZA 1N9OA 2J7VA 2VA0A 4B88A 3HLBA 2HP6A 4NXGA 3C38A 4H8RA 3W2ZA 2XQZA 3VP1A 5M1AA 2PYRA 3BFGA 1MPLA 1CJFA 3QP2A 3LR5A 1GSVA 3WS2A 1XX2A 1JTGA 1ERQA 3F1PB 3T1SA 5EVIC 4B4ZA 4I38A 4HY8A 5EFWA 1FIKA 3M6BA 4HIAA 4PHTA 2J9PA 1CEGA 2D02A 3T4TA 2W0NA 3PBRA 4H6JA 4E3MA 2A2LA 2C5WB 4KZ6A 5A93A 3HVFA 5KIZA 1YLYA 3IF5A 4U0XA 1UWPX 4U3TA 3W4OA 3ZG7B 3IXBA 3UB9A 4MN5A 1JWZA 4DXCA 2J80A 2JCHA 1T1CA 1SKOB 4G3VA 4JGRA 3HLWA 4P85A 4DJ3A 4IHQA 4Q0JA 2B95A 5EVEA 1BLPA 5FAPA 2EX8A 4OPRA 4FD8A 2UWXA 1CI8A 2JE5A 1GHPA 4I3IA 4OPYA 3OPHA 4ZTKA 5F82A 4BLMA 1MWTA 1P9RA 4MEZA 1K0KA 3NULA 5A92A 1BLHA 2R78A 4LGWA 3OPPA 5CEBA 3M2KA 1PZPA 2IA2A 2M7UA 2FFYA 1NWZA 1JTDA 4HEFA 4L0LA 3G4PA 4ME4A 1FILA 5CECA 2EXAA 2B02A 3BFFA 2ZL1A 2WKIA 1N9NA 4OLGA 5HAQA 4EXOA 3LI9A 4DXBA 1ZHHB 3IH9A 4P6ZS 1TD5A 3MFXA 1T1BA 1EROA 3VP4A 2QMIA 2EFXA 2V1AA 2YKHA 2G2WA 1YM1A 2W3HA 1EW0A 4PMAA 3C4OA 1OTAA 3BM6A 4DE3A 4Y0OA 2OAP1 4R3BA 3MXQA 3CJMA 2P7JA 3Q1FA 3CWFA 4R3AA 3MF0A 3UB6A 4DN0A 1Y28A 5AQBA 5FI7A 3PR6A 4EESA 4EU0A 3Q7VB 1XJ2A 2WGVA 4BJPA 1WYCA 3HUNA 4OOYA 5AJGA 4X68A 1L0GA 4WYYA 4IJGA 1BUEA 4O0PA 3UN7A 1ES3A 3D3OA 5FASA 1GA9A 2D01A 2Y2MA 5FATA 4UA9A 1NYMA 3H7WB 5EE8A 1ZG4A 4JKTA 2PRFA 4GOGA 2A49A 1YMXA 2K2NA 2PU4A 3BECA 1IOUA 2ZBBA 3L9KA 4R1GA 5HWWA 2ZQDA 1E25A 1YLJA 1ZC2A 2HJ9C 2Z6CA 5DTKA 3MZEA 1SKOA 5CEDA 3GQZA 3IXGA 1H0MA 4QHCA 1LT0A 4Q0IA 2ZC5B 3RFBA 5HAPA 2W1TB 4QWOA 3ICYA 3DAVA 1W79A 2O9CA 4LCMA 4KQDA 5HZHA 3KX0X 3IBJA 2WKQA 2H0YA 4GHIA 3FKVA 1F9IA 4WZ4A 2H10A 5CHJA 1WYBA 3TRCA 1VEUA 2HP5A 1KGGA 2ZM8A 1JVJA 5CTNA 2XLNA 3ZVTA 3T4JA 4L9EA 1HVBA 4ZJ2A 5EVIA 3IX8A 5FAOA 4JPMA 1NLZA 1VETB 4JBFA 4HH2A 4D60A 2ZQ9A 5I5LA 4CPKA 2VEAA 1T19A 4PKYA 1Z09A 4U0TA 3HBRA 2Y8HA 3G2ZA 5HW3A 3GR2A 4ARZA 3Q81A 4RA7A 2EFUA 4IVIA 4OQIA 5HPFA 5JYOA 5CGWA 4QD4A 4X25A 5HFOA 2J3TC 1E4DA 5GHZA 1XA7A 1KE4A 1W7FA 4OQHA 2QKPA 3LIAA 3PBSA 3DWKA 1FQGA 2VX8A 3HLCA 2QJ5A 1P9WA 2PYPA 1K57A 3CMZA 4DRTA 3EEHA 3F1OA 1LL9A 3LGOA 3TOIA 1O07A 3LICA 4WZ5A 1NRJA 1KE0A 4GN2A 4EEUA 1GCEA 4MBHA 1XJ3A 2FFFB 2EX9A 3MQQA 1QMEA 2J9OA 3GDIA 4ZJ3A 1DRMA 3EQUA 2H0TA 4CJNA 2V8FA 1XA1A 3HLGA 4LRXC 4R4SA 4PPRA 3QP8A 3ZNTA 1LHYA 1GSWA 3HL9A 5CTMA 3SH7A 2ZQ7A 1PNEA 4ARZB 1D7EA 5J3WA 5GHYA 3BLMA 1ACFA 3VP2A 2ZOHA 4JF6A 5L8MA 3ZG5A 3CPTB 4S2IA 2XFSA 2JKRI 4HI4A 5GLBA 1D1JA 3HREA 2EX6A 4C75A 4X6TA 3NDEA 5FI6A 3DTEA 3LR3A 2VV8A 2QWSA 5DJTA 2Y2IA 4JGPA 3BQAA 2QZ6A 3A3EA 5FAQA 2O99A 4E3OA 3G35A 3Q7ZA 4WM9A 1H8YA 1G68A 1Y4OA 2UV0E 3L7HA 1KDSA 5J4EA 1OTIA 2VK3A 2Y2QA 1XKZA 1K6SA 4BWIA 2P74A 4N9LA 1OJGA 3ZNYA 1N9BA 2PD8A 2E8JA 4CLCB 4KG2A 4O8GA 2JKTI 1ONGA 4HHDA 1H5XA 3LY4A 4PM5A 1NJ4A 4BMWA 4WMCD 3T50A 4JXWA 2PU2A 3MKEA 1H3QA 4KZ5A 5TR7A 4NG2A 5KSCA 4CLCE 5AQ7A 1ESIA 4MBFA 3N8RA 4ESPA 5TBMA 3PBTA 2HJEA 4Y17A 5EM0A 5GL9A 3MMHA 4HH3A 4PM8A 2Y2GA 4LPZA 1YLZA 3C7UA 3UPOA 1NZOA 1ES5A 4OP5A 1YLTA 3V3SA 4YFMA 3PAGA 4HP4A 4I39A 2HF6A 3ZYTA 2V8CA 1YMSA 4JXSA 2XRNA 4WUJA 3LIDA 4EUZA 1VB6A 3K3DA 2XROA 5CRFA 4QJGA 4OH0A 3LI8A 1O7EA 2LB9A 4GCZA 4R70A 2ZM2A 3JVVA 1XXMA 3CHWP 4OONA 3MKFA 1S0WA 1VETA 4FCFA 1LI0A 1K38A 2EWVA 2NUPC 4PM7A 5HWVA 3F1PA 2M1CA 2J3TD 4GKUA 1K6RA 3UDFA 2W1RA 3MSHA 5A8BA 4GW9A 3OPLA 4YINA 4R4RA 1H8MA 1IKGA 4GD6A 2WADA 1HZOA 3IF6B 1UWNX 4LV3A 3BFCA 4B93A 3NHQA 3UDIA 4ZRRA 2EXBA 4BBTA 3LFVA 2G7UA 1CI9A 2V2FF 4LENA 4MBKA 4LCLA 1LLBA 2BTFP 1JWPA 2HP9A 4BBUA 3T4OA 1OMEA 4ZBEA 1ESUA 2XF3A 1YQSA 4UQIM 3BQ8A 2VGKA 4LV1A 1PWDA 4LFUA 3CUEA 3IXDA 3SW1A 2L0WA 3P7NA 4S2JA 3E0YA 3ZCZA 4OQGA 4BD1A 1YKDA 4QB8A 5FSRA 2Y59A 3C30A 3UE6A 3Q82A 4Z1WA 3SH9A 1XFNA 5CERA 4ZAMA 5EOEA 4WZ5C 3BRMA 3IH8A 3ZGAB 5FQIA 1P97A 3N8LA 5DF7A 1L3LA 2J3WA 1TF1A 4MDZA 2Z2MB 2AVXA 2WGIA 1W63M 1GHIA 3CG5A 4OP8A 2RL3A 3W4PA 3S7QA 1H8ZA 4K91A 2VLGA 3IWOA 4AFIA 3GRJA 4CLCD 4HBTA 3NOUC 1KGFA 3O87A 3P01A 2H28A 4KZ7A 5FQQA 4LV0A 1S66L 5HL1A 4DJ2A 2ACGA 4UEYA 3UB8A 3R4KA 3JPUA 5FEGA 4DMZA 3OC2A 2BG1A 5FQJA 4S2LA 5HD3A 2W3EA 5HARA 5E2HA 2A24A 3R7WA 3K2NA 2CMNA 1MXOA 1HTZA 1WE4A 3B42A 2O0YA 4EWFA 4QPRA 2Y79A 1SHVA 3IX4A 4OOLA 2Y2NA 4KQRA 3V50A 4ID4A 2GDNA 4IUHA 1ES2A 2ZMVA 3IWQA 2W1TA 4A5RA 1YPRA 2ZC6B 4S2OA 2L4RA 3SH8A 1KVMA 1NXYA 4KZ4A 4GZBA 2H5SA 3C5AA 3OLOA 3V3RA 4XXRA 1DY6A 1G28A 5IU1A 1S6RA 3FPWA 2WKHA 4F3LA 5F5YA 1IKIA 1PZOA 3OOVA 2WAEA 1D06A 4DDSA 1SCWA 5JYPA 1MKMA 3WRZA 2V9AA 2XA7M 5CXWA 1LL8A 5FQMA 4S2MA 1G6OA 4S2PA 4OVDA 3S7OA 3K3CA 4E04A 4K0XA 1ZKJA 2KOIA 3LUQA 2A24B 3PYPA 3R7WB 3DTIA 3A3JA 5TJJA 3D9YA 5G18A 4P0MA 1IYQA 5IHVA 4OOMA 3F1OB 3NI9A 4RQ9A 1FR6A 3C8CA 2ZC3B 5HDDA 4I3JA 1X0OA 3UPNA 3UNWA 2V20A 3G31A 1DP9A 3G2YA 1PI4A 1VEUB 3NC8A 2V1ZA 4GD8A 2NUTC 2HV1A 2WKPA 4IBRA 4XT2A 4JF4A 4N92A 1CEFA 1F98A 2PBYA 4DE1A 3QP1A 4OQ0A 4NKPA 2JBFA 3BW6A 4B9OA 4JGQA 3ZQ5A 4N1XA 3UO9A 4NK3A 3E2KA 4I5SA 5EM1A 5AQAA 4KZ8A 4K08A 1JNUA 5F6AA 1XJ6A 3S7PA 4MCWA 2GNXA 1KE3A 1ZG6A 2ZC7A 3T4KA 5KSHA 4NXFA 2DCFA 5AQ9A 3FPVA 3O5YA 3OZHA 4L9GA 4B4XA 3IXHA 3M2JA 1PFLA 4WN5A 3MZDA 3MXSA 4EETB 5E43A 2V0UA 2XD5A 4KQQA 3B47A 1K4EA 3W4QA 3GTCA 3PXPA 4YNRA 1AWIA 5DF9A 3C7VA 4WEKA 3HLDA 1OT9A 3NCKA 3W8KA 3V39A 3LO7A 4MLLA 2X01A 4N9KA 3A0SA 2Q9MA 1N9LA 5EVLA 4YOFA 4KENB 1LL5A 5KZHA 3BFDA 5FEFA 1IYPA 1QMFA 4PM6A 4E3JA 3N4IA 1W8QA 2K31A 4HOIA 1OTBA 5F1GA 1V9YA 3FYZA 1LSVA 4R23A 3NOTC 3GVBA 4JGOA 1C3BA 1TEMA 1ES4A 1MBLA 2ZL1B 1BSGA 3E98A 3IQAA 2XFTA 2GJ3A 3MQ0A 5EECA 1RP5A 4PAUA 4WELA 4BQMA 4RYEA 1L0EA 4PKYG 2RCXA 2VGLS 2ZJ9A 2Y91A 4HJ3A 5EUAA 3SZTA 4MMNA 3IWIA 2WUQA 1ODVA 1KDWA 4OKPA 2HZ5A 3FWLA 4LV2A 4O01A 3D72A 4JXGA 3VOYA 4DE0A 1IELA 4X1LA 2OLUA 3MS6A 4XT2B 3UY6A 4FOFA 4FSFA 4S2NC 3UMDA 1PWGA 1IYOA 5DFXA 1K55A 4IVKA 2JHEA 1FCOA 2MJ6A 4GDNA 3CLOA 3GV9A 4Y0UA 3BJNA 4HBUA 2L1MA 1NYYA 1RGYA 3G6OA 2DNSA 2R9WA 2ZQAA 3VFHA 3WS4A 3DTKA 1L0DA 2EX2A 3QP4A 1T18A 1VM1A 4BBVA 5EPHA 2PAVP 3HCYA 3FV7A 1M6KA 5F1FA 3EQVA 4FUWA 3U4LP 5AVFA 1NLYA 3VE4A 5HSQA 2XK1A 2XDMA 2BLSA 3QP6A 2GX5A 2HPBA 5L09A 2WKRA 2IWDA 2PT7A 3TSGA 4E3IA 3VFFA 3NOPC 2GZAA 3KSFA 3NJAA 3BLSA 3I7JA 3ZFZA 2ZLYA 5L2FA 5M19A 5FA7A 3OBFA 5L07A 4EBPA 3F1NB 1MWSA 1E3UA 2X71A 1YT4A 1A0KA 2WGWA 2XH9A 2CC1A 2R9XA 4O7DA 4GS9A 1FSWA 1UGUA 1PYYA 1K57C 5E2FA 1IEMA 1MY8A 3BEBA 3IX3A 5F83A 3QNBA 3GMWA 2XR0A 1NRFA 2VGJA 3WS1A 4NEED 4BENA 3FZCA 3D4FA 3MJQA 3VP0A 4KZ3A 4Z9QA 2WKEA 4PM9A 5K5BA 1VHMA 2OWHA 1SDEA 4UA6A 2W27A 1XGIA 2FZ0A 2WZZA 1XPBA 3AGFA 4NXBA 1N4OA 3G32A 3OCLA 3MR0A 3ZG0A 2O9BA 3MQOA 1PW1A 2VZWA 2V1BA 2IWCA 3CUEC 3IBRA 3FC7A 2J8YA 1RCJA 3WS0A 5KMWA 2XA7S 2PR6A 3LR0A 4X56A 5CX7A 2B18A 3NIAA 3IS2A 2WGWB 1SDNA 3BWLA 1K55C 1MC0A 3CAXA 3JYIA 4WMCA 4EBNA 2O9AA 2INWA 4KG6A 5IT5A 4Y3IA 4WBGA 1OTDA 3NBLA 1ONHA 2OSUA 1ALQA 1EWZA 1L0FA 3KYZA 4FH2A 4KUKA 2JKRM 1XGJA 1L2SA 1BLSA 2P04A 3TJZC 5D3OA 1FCMA 2PHYA 1JWVA 4MNRA 3WS5A 4KUOA 5FQ9A 3QHYA 1I2SA 5DFYA 3VOLA 2C6WB 2ZQ8A 4L9FA 5CHMA 3B3XA 1RGZA 2JKTM 2Y2PA 1W63Q 3G34A 5CGXA 4F94A 4GDBA 4R3JA 3MXRA 3SS3A 4GLQA 2Y2KA 3RTYA 1TS6A 4CLCA 1XJ4A 5DF8A 1LSWA 1OTEA 2JKFA 4IEDA 5AVEA 4HNBA 2WK0A 5GLAA 4S2NA 2IWBA 3VV4A 1MWUA 3MBZA 3MZFA 2V0WA 2KDKA 2Q9NA 3NECA 4GS9B 4K0WA 4UAAA 5DTTA 4E3LA 4R0QA 4R38A 1IFQA 1DP8A 3KYEA 3UPPA 3LYXA 3H9WA 3JVUA 2P9VB 2B5RA 1W8YA 3IS2B 1BZAA 1BYWA 4WLAA 3M6HA 3PBOA 1DP6A 4I3AA 5C5KA 3LEZA 1F5MA 5G4ZA 3LIBA 4QY6A 4KG5A 4H6JB 5HL6A 3S7NA 3ZG8B 3ZVWA 1TVFA 4II7A 1U60A 5DJUA 1MKIA 4LRYC 3E4OA
chains in the Genus database with same CATH topology
4B9OA 2W3FA 2JKTI 4HHDA 1P0ZA 1T1AA 4JGQA 3ZQ5A 2ZMFA 1N9OA 4I5SA 2VA0A 4BMWA 2LB5A 3T50A 4G3WA 4NXGA 3C38A 3W2ZA 1H3QA 2PYRA 4CLCE 4K08A 1JNUA 5F6AA 1XJ6A 4MN7A 3S7PA 3LR5A 1GSVA 2GNXA 4MCWA 5TBMA 3PBTA 2HJEA 3MMHA 4HH3A 3A0RA 2BASA 3T4KA 5KSHA 4NXFA 3F1PB 4ETZA 3FPVA 3O5YA 4L9GA 4LPZA 4I38A 2DMWA 3TW8A 4WN5A 4HY8A 5EFWA 5LBRA 4EETB 3EOIA 2V0UA 4HIAA 4PHTA 5IS1A 4HP4A 2D02A 4I39A 3T4TA 3B47A 2W0NA 3PBRA 4H6JA 4F3LB 2A2LA 2PR5A 3PXPA 4YNRA 2HF6A 2M7VA 3T4QA 3ZYTA 2Z6DA 5KIZA 5DF9A 4LRZE 1UWPX 4WEKA 2XRNA 1OT9A 4WUJA 3LIDA 3UB9A 4MN5A 4Y5FA 1VB6A 3EGDC 2J80A 3A0SA 1T1CA 3KSGA 1N9LA 3K3DA 2XROA 1STZA 4YOFA 4G3VA 4G3KA 4JGRA 3EEAA 2VGLM 3LIEA 3LI8A 4DJ3A 4IHQA 4Q0JA 2VV6A 3EWKA 2LB9A 2K31A 4HOIA 4GCZA 4R70A 1OTBA 3JVVA 2JN7A 4EERA 2QYBA 1V9YA 1OPXA 1LSVA 4I3IA 3NOTC 4JGOA 2YKFA 1P9RA 2FH5A 2EWVA 2R78A 2NUPC 5HWVA 2IA2A 3E98A 2P08A 3F1PA 2M7UA 2M1CA 2J3TD 2GJ3A 4LLOB 1NWZA 3MQ0A 3BY9A 5DKLA 5F69A 2W1RA 5A8BA 2EWWA 5HPIA 3CITA 4PAUA 1WA9A 4WELA 3PHYA 4GW9A 1H8MA 4L0LA 4UQIS 4GJ4A 4PKYG 2VGLS 4HJ3A 1UWNX 4B93A 4ME4A 3NHQA 4MMNA 4GHIB 1S1ZA 4ZRRA 3OCNA 2VV7A 2B02A 1ODVA 4BBTA 3LFVA 2KX6A 3UE3A 2G7UA 1N9NA 3KO6A 4EXOA 3LI9A 4M4XA 1YAXA 4O01A 3D72A 1ZHHB 4P6ZS 1MZUA 3CI6A 1TD5A 3MFXA 5HDCA 1T1BA 4XT2B 2PD7A 4YWZA 3H82A 2V1AA 2YKHA 4FOFA 4FSFA 4BBUA 2W3HA 1EW0A 3T4OA 3TE8A 4NXEA 3UMDA 1OTAA 5DFXA 2JHEA 4CQHA 2MJ6A 3CLOA 2OAP1 3KYQA 3MXQA 2P7JA 3BJNA 2OWJA 3CWFA 3H7WA 2L1MA 4R3AA 4UQIM 3BQ8A 3MF0A 3UB6A 3G6OA 4DN0A 1Y28A 3PR6A 4MN6A 4CLCC 4EESA 4EU0A 1XJ2A 4BJPA 3CUEA 5AJGA 4EW7A 3SW1A 2L0WA 1T18A 4IJGA 3P7NA 3E0YA 4P6ZM 4BBVA 4O0PA 3V67A 3D3OA 3HCYA 3EQVA 1YKDA 3PBNA 2D01A 5AVFA 3C30A 3H7WB 1NLYA 3VE4A 5HSQA 3UE6A 1TS8A 4Z1WA 2GX5A 1XFNA 2WKRA 2OAQ1 4WF0A 2PT7A 1YSPA 1P97A 1S4RA 2K2NA 3NOPC 2GZAA 3LIFA 3KSFA 4ETXA 3NJAA 2J3WA 4HJ4A 1IOUA 2ZBBA 3HJKA 5HWWA 1TF1A 4KQOA 4MDZA 2VJWA 2HJ9C 2Z6CA 3OBFA 1W63M 3EGXC 1S1YA 3F1NB 1YSQA 1ZTUA 1LT0A 4Q0IA 3RFBA 2W1TB 4GS9A 3ICYA 1UGUA 5F68A 2XSSA 3S7QA 2O9CA 3LR4A 5HD5A 4KQDA 2VLGA 5HZHA 3KX0X 3IBJA 2WKQA 3VE3A 4AFIA 4CLCD 4GHIA 3RH8B 3NOUC 1F9IA 3P01A 5HDSA 3TRCA 2H28A 3UMEA 4NEED 1S66L 4EQ1A 4DJ2A 3PBQA 4UEYA 3MJQA 3UB8A 1OJ5A 3T4JA 3GECA 1OT6A 3R4KA 4L9EA 4EEPA 4DMZA 5K5BA 3E4QA 1S67L 1VHMA 5G4YA 1NLZA 3OC2A 2OWHA 3T4SA 5HD3A 2W3EA 4HH2A 2W27A 2FZ0A 5I5LA 2VEAA 2W3GA 1GSXA 5DKKA 4NXBA 1T19A 3OCLA 4PKYA 3MR0A 2Y8HA 1TS0A 2A24A 2O9BA 3R7WA 3MQOA 3C2WA 2QHKA 4ARZA 3K2NA 2CMNA 2VZWA 2V1BA 1XFQA 3B42A 5HPFA 2O0YA 3CUEC 3IBRA 2QJ7A 4QPRA 2Y79A 1LSXA 3FC7A 4HP9A 2J3TC 4OOLA 2QKPA 3LIAA 4WL9A 2XA7S 2PR6A 3LR0A 3PBSA 2VX8A 4IUHA 2QJ5A 5CX7A 2B18A 2ZMVA 3IS2A 3H82B 1P9WA 2PYPA 2W1TA 3BWLA 1MC0A 3CAXA 3EEHA 4Q0HA 3F1OA 4HJ6A 3HJIA 2L4RA 2O9AA 3UB7A 2INWA 5IT5A 4Y3IA 3LICA 3F1NA 1NRJA 1OTDA 2HGVA 3OLOA 4EEUA 3KYZA 4KUKA 2W3DA 1XJ3A 1G28A 2JKRM 5IU1A 3MQQA 2P04A 3TJZC 3FPWA 4F3LA 3GDIA 2KLIA 2PDRA 2PHYA 4HQAA 5F5YA 4EUVA 3OOVA 1DRMA 2I9VA 3EQUA 1D06A 3DBAA 4KUOA 1MKMA 2V9AA 2XA7M 5FL3A 1LL8A 2EA9A 4LRXC 5DFYA 1G6OA 3VOLA 1KOUA 3A0VA 3S7OA 3K3CA 4L9FA 4E04A 2VKSA 2KOIA 3LUQA 1GSWA 2JKTM 1W63Q 2A24B 3PYPA 3R7WB 4ARZB 5TJJA 1D7EA 5J3WA 4GLQA 3RTYA 4WEJA 1TS6A 1V9ZA 2ZOHA 4CLCA 5L8MA 4OOMA 1XJ4A 3BY8A 3F1OB 3E4PA 4RQ9A 5MC7A 2ZOIA 2JKRI 4HI4A 1LSWA 3B33A 3C8CA 3U2AA 1OTEA 3ULFA 5HDDA 5AVEA 4R6LA 4I3JA 4HNBA 1X0OA 1S4SA 3KSHA 3LR3A 2VV8A 2QWSA 1DP9A 5DJTA 3VV4A 2V0WA 2KDKA 4JGPA 3BQAA 3T4LA 4GS9B 5TBMB 3FG8A 2NUTC 2HV1A 2WKPA 4XT2A 4R38A 1IFQA 1DP8A 2O99A 1TS7A 3H9WA 3JVUA 3LYXA 4Y2FA 3IS2B 1BYWA 1F98A 4WLAA 3PBOA 5HWTA 1DP6A 4I3AA 5C5KA 1F5MA 5G4ZA 5J4EA 1OTIA 5J7EA 3LIBA 3KSIA 2K7SA 4H6JB 4BWIA 5HL6A 3S7NA 1OJGA 2PD8A 4II7A 4NKPA 4IUKA 4CLCB 5DJUA 3BW6A 4LRYC 3E4OA 4O8GA 2OOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9O A;  3LIC A;  5HZH A;  4HHD A;  2GJ3 A;  3F1N A;  4HJ4 A;  1OTD A;  2ZBB A;  3HJK A;  4LLO B;  1NWZ A;  1P0Z A;  1T1A A;  4JGQ A;  3ZQ5 A;  5HWW A;  3BY9 A;  5DKL A;  3OLO A;  5F69 A;  4EEU A;  5A8B A;  1N9O A;  4KUK A;  2Z6C A;  1XJ3 A;  1G28 A;  4I5S A;  1WA9 A;  5IU1 A;  3PHY A;  4GW9 A;  1S1Y A;  3MQQ A;  3F1N B;  3T50 A;  4F3L A;  3GDI A;  4NXG A;  2PDR A;  2PHY A;  4HQA A;  4PKY G;  5F5Y A;  1DRM A;  2I9V A;  1LT0 A;  1D06 A;  2PYR A;  4HJ3 A;  1UWN X;  4K08 A;  1JNU A;  5F6A A;  1XJ6 A;  3NHQ A;  4KUO A;  1GSV A;  4GHI B;  1S1Z A;  4GS9 A;  5TBM A;  2VV7 A;  1UGU A;  3ICY A;  5F68 A;  2B02 A;  2V9A A;  1ODV A;  4HH3 A;  3A0R A;  1LL8 A;  4BBT A;  5HD5 A;  2EA9 A;  2VLG A;  4KQD A;  2BAS A;  3KX0 X;  2KX6 A;  4LRX C;  4NXF A;  2WKQ A;  3F1P B;  3VOL A;  1KOU A;  3VE3 A;  1N9N A;  3A0V A;  4EXO A;  3K3C A;  3LI9 A;  4L9G A;  4LPZ A;  4M4X A;  4L9F A;  4GHI A;  3D72 A;  4I38 A;  3RH8 B;  4E04 A;  3NOU C;  1F9I A;  1MZU A;  1GSW A;  3LUQ A;  4WN5 A;  3MFX A;  4HY8 A;  5EFW A;  5HDS A;  2A24 B;  3PYP A;  2H28 A;  4EET B;  5HDC A;  1T1B A;  2V0U A;  4HIA A;  3UME A;  5IS1 A;  1D7E A;  5J3W A;  4XT2 B;  1S66 L;  2PD7 A;  4HP4 A;  4EQ1 A;  2D02 A;  4I39 A;  4DJ2 A;  4YWZ A;  3H82 A;  3NJA A;  3RTY A;  2V1A A;  2W0N A;  4H6J A;  1TS6 A;  1V9Z A;  2YKH A;  3MJQ A;  2ZOH A;  3E4O A;  3UB8 A;  4BBU A;  1OJ5 A;  1EW0 A;  2PR5 A;  3GEC A;  1OT6 A;  4NXE A;  1XJ4 A;  4L9E A;  3UMD A;  4EEP A;  1OTA A;  3BY8 A;  3F1O B;  3E4P A;  2Z6D A;  5KIZ A;  4RQ9 A;  2JHE A;  2ZOI A;  4LRZ E;  1UWP X;  3CLO A;  3E4Q A;  4HI4 A;  1LSW A;  1S67 L;  3B33 A;  3C8C A;  5G4Y A;  3MXQ A;  1OTE A;  3ULF A;  2P7J A;  1OT9 A;  2OWJ A;  2OWH A;  3CWF A;  2L1M A;  3H7W A;  4R3A A;  5HDD A;  4WUJ A;  3LID A;  5AVE A;  4R6L A;  5HD3 A;  3UB9 A;  4HH2 A;  4HNB A;  1VB6 A;  1X0O A;  2W27 A;  3G6O A;  1Y28 A;  4I3J A;  2J80 A;  4MN5 A;  5I5L A;  2VEA A;  5DKK A;  1GSX A;  1S4S A;  1T1C A;  3A0S A;  4NXB A;  1N9L A;  1T19 A;  3K3D A;  2VV8 A;  4PKY A;  3MR0 A;  2QWS A;  1DP9 A;  4MN6 A;  4EES A;  5DJT A;  4F3L B;  1TS0 A;  2A24 A;  1XJ2 A;  4JGR A;  2V0W A;  3C2W A;  2QHK A;  2KDK A;  3MQO A;  2CMN A;  3LIE A;  4EW7 A;  3LI8 A;  2V1B A;  4JGP A;  4DJ3 A;  3SW1 A;  1XFQ A;  4GS9 B;  5TBM B;  2L0W A;  1T18 A;  3FG8 A;  2WKP A;  2HV1 A;  2VV6 A;  3EWK A;  3P7N A;  4HOI A;  4GCZ A;  4XT2 A;  3IBR A;  2QJ7 A;  4R70 A;  3FC7 A;  1LSX A;  4HP9 A;  4BBV A;  4R38 A;  1OTB A;  1DP8 A;  2JN7 A;  1TS7 A;  3H9W A;  3LYX A;  3IS2 B;  4EER A;  1V9Y A;  1LSV A;  4I3I A;  3NOT C;  1BYW A;  1F98 A;  4WLA A;  2QKP A;  3LIA A;  4WL9 A;  5HWT A;  1DP6 A;  4JGO A;  2PR6 A;  4I3A A;  2D01 A;  5G4Z A;  5J4E A;  5AVF A;  2QJ5 A;  1OTI A;  3H7W B;  5J7E A;  3IS2 A;  3LIB A;  2YKF A;  3H82 B;  2K7S A;  3UE6 A;  3VE4 A;  5HSQ A;  1TS8 A;  2PYP A;  4H6J B;  3BWL A;  1OJG A;  1XFN A;  4LRY C;  3CAX A;  2WKR A;  3UB6 A;  2PD8 A;  2R78 A;  3EEH A;  5HWV A;  4WF0 A;  3F1O A;  4HJ6 A;  3HJI A;  2L4R A;  1P97 A;  1S4R A;  5DJU A;  3UB7 A;  3NOP C;  3F1P A;  2INW A;  3LIF A;  2M1C A;  2OOL A; 
#chains in the Genus database with same CATH topology
 3N8S A;  3A3I A;  5HX9 A;  1P0Z A;  2WZX A;  3IF6 A;  2ZMF A;  4C3Q A;  1GA0 A;  2LB5 A;  4G3W A;  1LI9 A;  1YLW A;  4KZB A;  3VP3 A;  1K54 C;  3Q7V A;  3RXX A;  4MN7 A;  3RXW A;  2HDU A;  5GLD A;  3A0R A;  4EV4 A;  3HUM A;  2BAS A;  3VMA A;  4ETZ A;  1HLU P;  1PIO A;  2DMW A;  1Q2P A;  3TW8 A;  5LBR A;  3HUO A;  3EOI A;  5IS1 A;  3ZDJ A;  4F3L B;  1YLP A;  4FTX A;  2PR5 A;  4X53 A;  4XUZ A;  2M7V A;  3T4Q A;  2OV5 A;  4Q8I A;  5BOH A;  1I5Q A;  2P9V A;  2Z6D A;  3UB5 P;  4LRZ E;  1AXB A;  3QP5 A;  3BFE A;  1FSY A;  5E2G A;  4P87 A;  4Y5F A;  3EGD C;  3NY4 A;  1PI5 A;  2G2U A;  3KSG A;  3S22 A;  1NZU A;  1STZ A;  3O3V A;  4G3K A;  2Y2L A;  3EEA A;  1DJC A;  2VGL M;  3LIE A;  3BYD A;  2ZMA A;  2VV6 A;  3EWK A;  4QY5 A;  3IF6 C;  3S4X A;  3LEQ A;  2JN7 A;  4X69 A;  4EER A;  2QYB A;  1OPX A;  1KVL A;  3P98 A;  1NY0 A;  1K54 A;  3DTM A;  4X1M A;  2YKF A;  5I94 A;  2DRW A;  3SS5 A;  2FH5 A;  2Y2J A;  2P08 A;  5FDS A;  5DTS A;  1J3W A;  4QU3 A;  4LLO B;  1CF0 A;  3BY9 A;  5DKL A;  5F69 A;  2EWW A;  5HPI A;  2JC7 A;  3CIT A;  1WA9 A;  4N1H A;  3PHY A;  5FQK A;  3V5M A;  3T1Q B;  4UQI S;  4GJ4 A;  1TDG A;  5EV0 A;  5FDH A;  5A90 A;  4GHI B;  1S1Z A;  4HES A;  3OCN A;  2VV7 A;  4UA7 A;  2HDQ A;  2KX6 A;  3UE3 A;  3KO6 A;  2X02 A;  4OLD A;  3HLF A;  2ZC4 B;  4RX3 A;  4OPZ A;  4M4X A;  1YAX A;  5A91 A;  1MZU A;  1GHM A;  3CI6 A;  1K4F A;  5HDC A;  1BUL A;  2PD7 A;  3PTE A;  4YWZ A;  3H82 A;  1G5U A;  3TE8 A;  4NXE A;  1M40 A;  4DKI A;  4M3K A;  4BL2 A;  4CQH A;  2A3U A;  3KYQ A;  1J9M A;  3H7W A;  2OWJ A;  4Y15 A;  4E6W A;  1FR1 A;  4CLC C;  4MN6 A;  2Y4A A;  3Q07 A;  4EW7 A;  1W5D A;  2PBD P;  1DJB A;  2E8I A;  3AGD A;  1SZV A;  4P6Z M;  3T1R A;  3V67 A;  5HAI A;  1G6A A;  4XUX A;  3PBN A;  4E3K A;  4OPQ A;  1TS8 A;  3ISG A;  2OAQ 1;  4P6B A;  4WF0 A;  1ERM A;  1YSP A;  5EVI B;  1S4R A;  1CK3 A;  3LIF A;  4ETX A;  4Y13 A;  3OPR A;  4HJ4 A;  3HJK A;  2Y2H A;  1IYS A;  4KQO A;  2VJW A;  5EVI D;  3EGX C;  4DE2 A;  1S1Y A;  1YSQ A;  1ZTU A;  2XGN A;  4RX2 A;  4GB7 A;  5CGS A;  4RVA A;  5F68 A;  1BT5 A;  2XSS A;  3LR4 A;  1HD8 A;  5HD5 A;  3VE3 A;  3N6I A;  3RH8 B;  5HDS A;  4NET A;  3GSG A;  4IBX A;  3S1Y A;  3UME A;  4EQ1 A;  3PBQ A;  3TG9 A;  3CZD A;  1OJ5 A;  1VQQ A;  2Q0O A;  3E2L A;  1OT6 A;  3GEC A;  2ZQC A;  4EEP A;  3SS4 A;  4S2K A;  3C4P A;  3PAE A;  4BD0 A;  3E4Q A;  5EOO A;  1S67 L;  5G4Y A;  4E6X A;  3T4S A;  2W3G A;  2HDS A;  1GSX A;  5DKK A;  4JLF A;  3UDX A;  3N7W A;  3IT9 A;  1TS0 A;  1I2W A;  3C2W A;  2QHK A;  1XFQ A;  1PWC A;  3P09 A;  4ZDX A;  2QJ7 A;  4HP9 A;  1LSX A;  3DW0 A;  4JF5 A;  2XD1 A;  1Y54 A;  4WL9 A;  5GHX A;  4GNU A;  5CHU A;  2XEP A;  4E3N A;  3H82 B;  5DVA A;  2QPN A;  3VSL A;  3DWZ A;  4Q0H A;  3CPT A;  4HJ6 A;  3HJI A;  4C6Y A;  5GLC A;  1TDL A;  3UE0 A;  2JKG A;  3AGE A;  3IHA A;  3T12 B;  3UB7 A;  4DF6 A;  4EQI A;  3VSK A;  3F1N A;  4EBL A;  5FI2 A;  3UE1 A;  2HGV A;  2I72 A;  2W3D A;  5E2E A;  2HDR A;  2Y2O A;  3O88 A;  1EI5 A;  5U47 A;  2KLI A;  2ZM0 A;  2PDR A;  4HQA A;  4EUV A;  3ITB A;  1K25 A;  2I9V A;  1DJA A;  2Z2L B;  3DBA A;  4DDY A;  3A3F A;  4KZ9 A;  3QNC A;  5FL3 A;  2WAF A;  3G30 A;  2EA9 A;  1MWR A;  3IHB A;  3ZG9 B;  1KOU A;  1E3U D;  3A0V A;  1K56 D;  5TFQ A;  3FKW A;  2VKS A;  3SOI A;  4D2O A;  1PW8 A;  3HLE A;  3NDG A;  3ZHH A;  1BTL A;  4WEJ A;  4BL3 A;  3MFD A;  1V9Z A;  3WRT A;  4Y0T A;  3BY8 A;  3E4P A;  1Q2Q A;  5MC7 A;  2ZOI A;  5M18 A;  3B33 A;  3U2A A;  1PRQ A;  1CQA A;  3ULF A;  1SKF A;  4R6L A;  4Y7P A;  1KGE A;  1S4S A;  3KSH A;  2Y55 A;  1F2K A;  4JXV A;  4ZJ1 A;  1BLC A;  4UHU A;  3T4L A;  3RJU A;  5TBM B;  1K56 A;  2OLV A;  3FG8 A;  5L10 A;  5J8X A;  4KZA A;  1FOF A;  3A3D A;  1TS7 A;  1Z6F A;  4Y2F A;  3LY3 A;  1XP4 A;  4FH4 A;  5HWT A;  3ITA A;  3T1X A;  5J7E A;  3KSI A;  2K7S A;  5TGF A;  4X55 A;  3O86 A;  4IUK A;  3LCE A;  3WWX A;  1FCN A;  2OOL A;  2W3F A;  2WYX A;  1T1A A;  2ZD8 A;  3VOZ A;  1N9O A;  2J7V A;  2VA0 A;  4B88 A;  3HLB A;  2HP6 A;  4NXG A;  3C38 A;  4H8R A;  3W2Z A;  2XQZ A;  3VP1 A;  5M1A A;  2PYR A;  3BFG A;  1MPL A;  1CJF A;  3QP2 A;  3LR5 A;  1GSV A;  3WS2 A;  1XX2 A;  1JTG A;  1ERQ A;  3F1P B;  3T1S A;  5EVI C;  4B4Z A;  4I38 A;  4HY8 A;  5EFW A;  1FIK A;  3M6B A;  4HIA A;  4PHT A;  2J9P A;  1CEG A;  2D02 A;  3T4T A;  2W0N A;  3PBR A;  4H6J A;  4E3M A;  2A2L A;  2C5W B;  4KZ6 A;  5A93 A;  3HVF A;  5KIZ A;  1YLY A;  3IF5 A;  4U0X A;  1UWP X;  4U3T A;  3W4O A;  3ZG7 B;  3IXB A;  3UB9 A;  4MN5 A;  1JWZ A;  4DXC A;  2J80 A;  2JCH A;  1T1C A;  1SKO B;  4G3V A;  4JGR A;  3HLW A;  4P85 A;  4DJ3 A;  4IHQ A;  4Q0J A;  2B95 A;  5EVE A;  1BLP A;  5FAP A;  2EX8 A;  4OPR A;  4FD8 A;  2UWX A;  1CI8 A;  2JE5 A;  1GHP A;  4I3I A;  4OPY A;  3OPH A;  4ZTK A;  5F82 A;  4BLM A;  1MWT A;  1P9R A;  4MEZ A;  1K0K A;  3NUL A;  5A92 A;  1BLH A;  2R78 A;  4LGW A;  3OPP A;  5CEB A;  3M2K A;  1PZP A;  2IA2 A;  2M7U A;  2FFY A;  1NWZ A;  1JTD A;  4HEF A;  4L0L A;  3G4P A;  4ME4 A;  1FIL A;  5CEC A;  2EXA A;  2B02 A;  3BFF A;  2ZL1 A;  2WKI A;  1N9N A;  4OLG A;  5HAQ A;  4EXO A;  3LI9 A;  4DXB A;  1ZHH B;  3IH9 A;  4P6Z S;  1TD5 A;  3MFX A;  1T1B A;  1ERO A;  3VP4 A;  2QMI A;  2EFX A;  2V1A A;  2YKH A;  2G2W A;  1YM1 A;  2W3H A;  1EW0 A;  4PMA A;  3C4O A;  1OTA A;  3BM6 A;  4DE3 A;  4Y0O A;  2OAP 1;  4R3B A;  3MXQ A;  3CJM A;  2P7J A;  3Q1F A;  3CWF A;  4R3A A;  3MF0 A;  3UB6 A;  4DN0 A;  1Y28 A;  5AQB A;  5FI7 A;  3PR6 A;  4EES A;  4EU0 A;  3Q7V B;  1XJ2 A;  2WGV A;  4BJP A;  1WYC A;  3HUN A;  4OOY A;  5AJG A;  4X68 A;  1L0G A;  4WYY A;  4IJG A;  1BUE A;  4O0P A;  3UN7 A;  1ES3 A;  3D3O A;  5FAS A;  1GA9 A;  2D01 A;  2Y2M A;  5FAT A;  4UA9 A;  1NYM A;  3H7W B;  5EE8 A;  1ZG4 A;  4JKT A;  2PRF A;  4GOG A;  2A49 A;  1YMX A;  2K2N A;  2PU4 A;  3BEC A;  1IOU A;  2ZBB A;  3L9K A;  4R1G A;  5HWW A;  2ZQD A;  1E25 A;  1YLJ A;  1ZC2 A;  2HJ9 C;  2Z6C A;  5DTK A;  3MZE A;  1SKO A;  5CED A;  3GQZ A;  3IXG A;  1H0M A;  4QHC A;  1LT0 A;  4Q0I A;  2ZC5 B;  3RFB A;  5HAP A;  2W1T B;  4QWO A;  3ICY A;  3DAV A;  1W79 A;  2O9C A;  4LCM A;  4KQD A;  5HZH A;  3KX0 X;  3IBJ A;  2WKQ A;  2H0Y A;  4GHI A;  3FKV A;  1F9I A;  4WZ4 A;  2H10 A;  5CHJ A;  1WYB A;  3TRC A;  1VEU A;  2HP5 A;  1KGG A;  2ZM8 A;  1JVJ A;  5CTN A;  2XLN A;  3ZVT A;  3T4J A;  4L9E A;  1HVB A;  4ZJ2 A;  5EVI A;  3IX8 A;  5FAO A;  4JPM A;  1NLZ A;  1VET B;  4JBF A;  4HH2 A;  4D60 A;  2ZQ9 A;  5I5L A;  4CPK A;  2VEA A;  1T19 A;  4PKY A;  1Z09 A;  4U0T A;  3HBR A;  2Y8H A;  3G2Z A;  5HW3 A;  3GR2 A;  4ARZ A;  3Q81 A;  4RA7 A;  2EFU A;  4IVI A;  4OQI A;  5HPF A;  5JYO A;  5CGW A;  4QD4 A;  4X25 A;  5HFO A;  2J3T C;  1E4D A;  5GHZ A;  1XA7 A;  1KE4 A;  1W7F A;  4OQH A;  2QKP A;  3LIA A;  3PBS A;  3DWK A;  1FQG A;  2VX8 A;  3HLC A;  2QJ5 A;  1P9W A;  2PYP A;  1K57 A;  3CMZ A;  4DRT A;  3EEH A;  3F1O A;  1LL9 A;  3LGO A;  3TOI A;  1O07 A;  3LIC A;  4WZ5 A;  1NRJ A;  1KE0 A;  4GN2 A;  4EEU A;  1GCE A;  4MBH A;  1XJ3 A;  2FFF B;  2EX9 A;  3MQQ A;  1QME A;  2J9O A;  3GDI A;  4ZJ3 A;  1DRM A;  3EQU A;  2H0T A;  4CJN A;  2V8F A;  1XA1 A;  3HLG A;  4LRX C;  4R4S A;  4PPR A;  3QP8 A;  3ZNT A;  1LHY A;  1GSW A;  3HL9 A;  5CTM A;  3SH7 A;  2ZQ7 A;  1PNE A;  4ARZ B;  1D7E A;  5J3W A;  5GHY A;  3BLM A;  1ACF A;  3VP2 A;  2ZOH A;  4JF6 A;  5L8M A;  3ZG5 A;  3CPT B;  4S2I A;  2XFS A;  2JKR I;  4HI4 A;  5GLB A;  1D1J A;  3HRE A;  2EX6 A;  4C75 A;  4X6T A;  3NDE A;  5FI6 A;  3DTE A;  3LR3 A;  2VV8 A;  2QWS A;  5DJT A;  2Y2I A;  4JGP A;  3BQA A;  2QZ6 A;  3A3E A;  5FAQ A;  2O99 A;  4E3O A;  3G35 A;  3Q7Z A;  4WM9 A;  1H8Y A;  1G68 A;  1Y4O A;  2UV0 E;  3L7H A;  1KDS A;  5J4E A;  1OTI A;  2VK3 A;  2Y2Q A;  1XKZ A;  1K6S A;  4BWI A;  2P74 A;  4N9L A;  1OJG A;  3ZNY A;  1N9B A;  2PD8 A;  2E8J A;  4CLC B;  4KG2 A;  4O8G A;  2JKT I;  1ONG A;  4HHD A;  1H5X A;  3LY4 A;  4PM5 A;  1NJ4 A;  4BMW A;  4WMC D;  3T50 A;  4JXW A;  2PU2 A;  3MKE A;  1H3Q A;  4KZ5 A;  5TR7 A;  4NG2 A;  5KSC A;  4CLC E;  5AQ7 A;  1ESI A;  4MBF A;  3N8R A;  4ESP A;  5TBM A;  3PBT A;  2HJE A;  4Y17 A;  5EM0 A;  5GL9 A;  3MMH A;  4HH3 A;  4PM8 A;  2Y2G A;  4LPZ A;  1YLZ A;  3C7U A;  3UPO A;  1NZO A;  1ES5 A;  4OP5 A;  1YLT A;  3V3S A;  4YFM A;  3PAG A;  4HP4 A;  4I39 A;  2HF6 A;  3ZYT A;  2V8C A;  1YMS A;  4JXS A;  2XRN A;  4WUJ A;  3LID A;  4EUZ A;  1VB6 A;  3K3D A;  2XRO A;  5CRF A;  4QJG A;  4OH0 A;  3LI8 A;  1O7E A;  2LB9 A;  4GCZ A;  4R70 A;  2ZM2 A;  3JVV A;  1XXM A;  3CHW P;  4OON A;  3MKF A;  1S0W A;  1VET A;  4FCF A;  1LI0 A;  1K38 A;  2EWV A;  2NUP C;  4PM7 A;  5HWV A;  3F1P A;  2M1C A;  2J3T D;  4GKU A;  1K6R A;  3UDF A;  2W1R A;  3MSH A;  5A8B A;  4GW9 A;  3OPL A;  4YIN A;  4R4R A;  1H8M A;  1IKG A;  4GD6 A;  2WAD A;  1HZO A;  3IF6 B;  1UWN X;  4LV3 A;  3BFC A;  4B93 A;  3NHQ A;  3UDI A;  4ZRR A;  2EXB A;  4BBT A;  3LFV A;  2G7U A;  1CI9 A;  2V2F F;  4LEN A;  4MBK A;  4LCL A;  1LLB A;  2BTF P;  1JWP A;  2HP9 A;  4BBU A;  3T4O A;  1OME A;  4ZBE A;  1ESU A;  2XF3 A;  1YQS A;  4UQI M;  3BQ8 A;  2VGK A;  4LV1 A;  1PWD A;  4LFU A;  3CUE A;  3IXD A;  3SW1 A;  2L0W A;  3P7N A;  4S2J A;  3E0Y A;  3ZCZ A;  4OQG A;  4BD1 A;  1YKD A;  4QB8 A;  5FSR A;  2Y59 A;  3C30 A;  3UE6 A;  3Q82 A;  4Z1W A;  3SH9 A;  1XFN A;  5CER A;  4ZAM A;  5EOE A;  4WZ5 C;  3BRM A;  3IH8 A;  3ZGA B;  5FQI A;  1P97 A;  3N8L A;  5DF7 A;  1L3L A;  2J3W A;  1TF1 A;  4MDZ A;  2Z2M B;  2AVX A;  2WGI A;  1W63 M;  1GHI A;  3CG5 A;  4OP8 A;  2RL3 A;  3W4P A;  3S7Q A;  1H8Z A;  4K91 A;  2VLG A;  3IWO A;  4AFI A;  3GRJ A;  4CLC D;  4HBT A;  3NOU C;  1KGF A;  3O87 A;  3P01 A;  2H28 A;  4KZ7 A;  5FQQ A;  4LV0 A;  1S66 L;  5HL1 A;  4DJ2 A;  2ACG A;  4UEY A;  3UB8 A;  3R4K A;  3JPU A;  5FEG A;  4DMZ A;  3OC2 A;  2BG1 A;  5FQJ A;  4S2L A;  5HD3 A;  2W3E A;  5HAR A;  5E2H A;  2A24 A;  3R7W A;  3K2N A;  2CMN A;  1MXO A;  1HTZ A;  1WE4 A;  3B42 A;  2O0Y A;  4EWF A;  4QPR A;  2Y79 A;  1SHV A;  3IX4 A;  4OOL A;  2Y2N A;  4KQR A;  3V50 A;  4ID4 A;  2GDN A;  4IUH A;  1ES2 A;  2ZMV A;  3IWQ A;  2W1T A;  4A5R A;  1YPR A;  2ZC6 B;  4S2O A;  2L4R A;  3SH8 A;  1KVM A;  1NXY A;  4KZ4 A;  4GZB A;  2H5S A;  3C5A A;  3OLO A;  3V3R A;  4XXR A;  1DY6 A;  1G28 A;  5IU1 A;  1S6R A;  3FPW A;  2WKH A;  4F3L A;  5F5Y A;  1IKI A;  1PZO A;  3OOV A;  2WAE A;  1D06 A;  4DDS A;  1SCW A;  5JYP A;  1MKM A;  3WRZ A;  2V9A A;  2XA7 M;  5CXW A;  1LL8 A;  5FQM A;  4S2M A;  1G6O A;  4S2P A;  4OVD A;  3S7O A;  3K3C A;  4E04 A;  4K0X A;  1ZKJ A;  2KOI A;  3LUQ A;  2A24 B;  3PYP A;  3R7W B;  3DTI A;  3A3J A;  5TJJ A;  3D9Y A;  5G18 A;  4P0M A;  1IYQ A;  5IHV A;  4OOM A;  3F1O B;  3NI9 A;  4RQ9 A;  1FR6 A;  3C8C A;  2ZC3 B;  5HDD A;  4I3J A;  1X0O A;  3UPN A;  3UNW A;  2V20 A;  3G31 A;  1DP9 A;  3G2Y A;  1PI4 A;  1VEU B;  3NC8 A;  2V1Z A;  4GD8 A;  2NUT C;  2HV1 A;  2WKP A;  4IBR A;  4XT2 A;  4JF4 A;  4N92 A;  1CEF A;  1F98 A;  2PBY A;  4DE1 A;  3QP1 A;  4OQ0 A;  4NKP A;  2JBF A;  3BW6 A;  4B9O A;  4JGQ A;  3ZQ5 A;  4N1X A;  3UO9 A;  4NK3 A;  3E2K A;  4I5S A;  5EM1 A;  5AQA A;  4KZ8 A;  4K08 A;  1JNU A;  5F6A A;  1XJ6 A;  3S7P A;  4MCW A;  2GNX A;  1KE3 A;  1ZG6 A;  2ZC7 A;  3T4K A;  5KSH A;  4NXF A;  2DCF A;  5AQ9 A;  3FPV A;  3O5Y A;  3OZH A;  4L9G A;  4B4X A;  3IXH A;  3M2J A;  1PFL A;  4WN5 A;  3MZD A;  3MXS A;  4EET B;  5E43 A;  2V0U A;  2XD5 A;  4KQQ A;  3B47 A;  1K4E A;  3W4Q A;  3GTC A;  3PXP A;  4YNR A;  1AWI A;  5DF9 A;  3C7V A;  4WEK A;  3HLD A;  1OT9 A;  3NCK A;  3W8K A;  3V39 A;  3LO7 A;  4MLL A;  2X01 A;  4N9K A;  3A0S A;  2Q9M A;  1N9L A;  5EVL A;  4YOF A;  4KEN B;  1LL5 A;  5KZH A;  3BFD A;  5FEF A;  1IYP A;  1QMF A;  4PM6 A;  4E3J A;  3N4I A;  1W8Q A;  2K31 A;  4HOI A;  1OTB A;  5F1G A;  1V9Y A;  3FYZ A;  1LSV A;  4R23 A;  3NOT C;  3GVB A;  4JGO A;  1C3B A;  1TEM A;  1ES4 A;  1MBL A;  2ZL1 B;  1BSG A;  3E98 A;  3IQA A;  2XFT A;  2GJ3 A;  3MQ0 A;  5EEC A;  1RP5 A;  4PAU A;  4WEL A;  4BQM A;  4RYE A;  1L0E A;  4PKY G;  2RCX A;  2VGL S;  2ZJ9 A;  2Y91 A;  4HJ3 A;  5EUA A;  3SZT A;  4MMN A;  3IWI A;  2WUQ A;  1ODV A;  1KDW A;  4OKP A;  2HZ5 A;  3FWL A;  4LV2 A;  4O01 A;  3D72 A;  4JXG A;  3VOY A;  4DE0 A;  1IEL A;  4X1L A;  2OLU A;  3MS6 A;  4XT2 B;  3UY6 A;  4FOF A;  4FSF A;  4S2N C;  3UMD A;  1PWG A;  1IYO A;  5DFX A;  1K55 A;  4IVK A;  2JHE A;  1FCO A;  2MJ6 A;  4GDN A;  3CLO A;  3GV9 A;  4Y0U A;  3BJN A;  4HBU A;  2L1M A;  1NYY A;  1RGY A;  3G6O A;  2DNS A;  2R9W A;  2ZQA A;  3VFH A;  3WS4 A;  3DTK A;  1L0D A;  2EX2 A;  3QP4 A;  1T18 A;  1VM1 A;  4BBV A;  5EPH A;  2PAV P;  3HCY A;  3FV7 A;  1M6K A;  5F1F A;  3EQV A;  4FUW A;  3U4L P;  5AVF A;  1NLY A;  3VE4 A;  5HSQ A;  2XK1 A;  2XDM A;  2BLS A;  3QP6 A;  2GX5 A;  2HPB A;  5L09 A;  2WKR A;  2IWD A;  2PT7 A;  3TSG A;  4E3I A;  3VFF A;  3NOP C;  2GZA A;  3KSF A;  3NJA A;  3BLS A;  3I7J A;  3ZFZ A;  2ZLY A;  5L2F A;  5M19 A;  5FA7 A;  3OBF A;  5L07 A;  4EBP A;  3F1N B;  1MWS A;  1E3U A;  2X71 A;  1YT4 A;  1A0K A;  2WGW A;  2XH9 A;  2CC1 A;  2R9X A;  4O7D A;  4GS9 A;  1FSW A;  1UGU A;  1PYY A;  1K57 C;  5E2F A;  1IEM A;  1MY8 A;  3BEB A;  3IX3 A;  5F83 A;  3QNB A;  3GMW A;  2XR0 A;  1NRF A;  2VGJ A;  3WS1 A;  4NEE D;  4BEN A;  3FZC A;  3D4F A;  3MJQ A;  3VP0 A;  4KZ3 A;  4Z9Q A;  2WKE A;  4PM9 A;  5K5B A;  1VHM A;  2OWH A;  1SDE A;  4UA6 A;  2W27 A;  1XGI A;  2FZ0 A;  2WZZ A;  1XPB A;  3AGF A;  4NXB A;  1N4O A;  3G32 A;  3OCL A;  3MR0 A;  3ZG0 A;  2O9B A;  3MQO A;  1PW1 A;  2VZW A;  2V1B A;  2IWC A;  3CUE C;  3IBR A;  3FC7 A;  2J8Y A;  1RCJ A;  3WS0 A;  5KMW A;  2XA7 S;  2PR6 A;  3LR0 A;  4X56 A;  5CX7 A;  2B18 A;  3NIA A;  3IS2 A;  2WGW B;  1SDN A;  3BWL A;  1K55 C;  1MC0 A;  3CAX A;  3JYI A;  4WMC A;  4EBN A;  2O9A A;  2INW A;  4KG6 A;  5IT5 A;  4Y3I A;  4WBG A;  1OTD A;  3NBL A;  1ONH A;  2OSU A;  1ALQ A;  1EWZ A;  1L0F A;  3KYZ A;  4FH2 A;  4KUK A;  2JKR M;  1XGJ A;  1L2S A;  1BLS A;  2P04 A;  3TJZ C;  5D3O A;  1FCM A;  2PHY A;  1JWV A;  4MNR A;  3WS5 A;  4KUO A;  5FQ9 A;  3QHY A;  1I2S A;  5DFY A;  3VOL A;  2C6W B;  2ZQ8 A;  4L9F A;  5CHM A;  3B3X A;  1RGZ A;  2JKT M;  2Y2P A;  1W63 Q;  3G34 A;  5CGX A;  4F94 A;  4GDB A;  4R3J A;  3MXR A;  3SS3 A;  4GLQ A;  2Y2K A;  3RTY A;  1TS6 A;  4CLC A;  1XJ4 A;  5DF8 A;  1LSW A;  1OTE A;  2JKF A;  4IED A;  5AVE A;  4HNB A;  2WK0 A;  5GLA A;  4S2N A;  2IWB A;  3VV4 A;  1MWU A;  3MBZ A;  3MZF A;  2V0W A;  2KDK A;  2Q9N A;  3NEC A;  4GS9 B;  4K0W A;  4UAA A;  5DTT A;  4E3L A;  4R0Q A;  4R38 A;  1IFQ A;  1DP8 A;  3KYE A;  3UPP A;  3LYX A;  3H9W A;  3JVU A;  2P9V B;  2B5R A;  1W8Y A;  3IS2 B;  1BZA A;  1BYW A;  4WLA A;  3M6H A;  3PBO A;  1DP6 A;  4I3A A;  5C5K A;  3LEZ A;  1F5M A;  5G4Z A;  3LIB A;  4QY6 A;  4KG5 A;  4H6J B;  5HL6 A;  3S7N A;  3ZG8 B;  3ZVW A;  1TVF A;  4II7 A;  1U60 A;  5DJU A;  1MKI A;  4LRY C;  3E4O A; 
#chains in the Genus database with same CATH homology
 4B9O A;  2W3F A;  2JKT I;  4HHD A;  1P0Z A;  1T1A A;  4JGQ A;  3ZQ5 A;  2ZMF A;  1N9O A;  4I5S A;  2VA0 A;  4BMW A;  2LB5 A;  3T50 A;  4G3W A;  4NXG A;  3C38 A;  3W2Z A;  1H3Q A;  2PYR A;  4CLC E;  4K08 A;  1JNU A;  5F6A A;  1XJ6 A;  4MN7 A;  3S7P A;  3LR5 A;  1GSV A;  2GNX A;  4MCW A;  5TBM A;  3PBT A;  2HJE A;  3MMH A;  4HH3 A;  3A0R A;  2BAS A;  3T4K A;  5KSH A;  4NXF A;  3F1P B;  4ETZ A;  3FPV A;  3O5Y A;  4L9G A;  4LPZ A;  4I38 A;  2DMW A;  3TW8 A;  4WN5 A;  4HY8 A;  5EFW A;  5LBR A;  4EET B;  3EOI A;  2V0U A;  4HIA A;  4PHT A;  5IS1 A;  4HP4 A;  2D02 A;  4I39 A;  3T4T A;  3B47 A;  2W0N A;  3PBR A;  4H6J A;  4F3L B;  2A2L A;  2PR5 A;  3PXP A;  4YNR A;  2HF6 A;  2M7V A;  3T4Q A;  3ZYT A;  2Z6D A;  5KIZ A;  5DF9 A;  4LRZ E;  1UWP X;  4WEK A;  2XRN A;  1OT9 A;  4WUJ A;  3LID A;  3UB9 A;  4MN5 A;  4Y5F A;  1VB6 A;  3EGD C;  2J80 A;  3A0S A;  1T1C A;  3KSG A;  1N9L A;  3K3D A;  2XRO A;  1STZ A;  4YOF A;  4G3V A;  4G3K A;  4JGR A;  3EEA A;  2VGL M;  3LIE A;  3LI8 A;  4DJ3 A;  4IHQ A;  4Q0J A;  2VV6 A;  3EWK A;  2LB9 A;  2K31 A;  4HOI A;  4GCZ A;  4R70 A;  1OTB A;  3JVV A;  2JN7 A;  4EER A;  2QYB A;  1V9Y A;  1OPX A;  1LSV A;  4I3I A;  3NOT C;  4JGO A;  2YKF A;  1P9R A;  2FH5 A;  2EWV A;  2R78 A;  2NUP C;  5HWV A;  2IA2 A;  3E98 A;  2P08 A;  3F1P A;  2M7U A;  2M1C A;  2J3T D;  2GJ3 A;  4LLO B;  1NWZ A;  3MQ0 A;  3BY9 A;  5DKL A;  5F69 A;  2W1R A;  5A8B A;  2EWW A;  5HPI A;  3CIT A;  4PAU A;  1WA9 A;  4WEL A;  3PHY A;  4GW9 A;  1H8M A;  4L0L A;  4UQI S;  4GJ4 A;  4PKY G;  2VGL S;  4HJ3 A;  1UWN X;  4B93 A;  4ME4 A;  3NHQ A;  4MMN A;  4GHI B;  1S1Z A;  4ZRR A;  3OCN A;  2VV7 A;  2B02 A;  1ODV A;  4BBT A;  3LFV A;  2KX6 A;  3UE3 A;  2G7U A;  1N9N A;  3KO6 A;  4EXO A;  3LI9 A;  4M4X A;  1YAX A;  4O01 A;  3D72 A;  1ZHH B;  4P6Z S;  1MZU A;  3CI6 A;  1TD5 A;  3MFX A;  5HDC A;  1T1B A;  4XT2 B;  2PD7 A;  4YWZ A;  3H82 A;  2V1A A;  2YKH A;  4FOF A;  4FSF A;  4BBU A;  2W3H A;  1EW0 A;  3T4O A;  3TE8 A;  4NXE A;  3UMD A;  1OTA A;  5DFX A;  2JHE A;  4CQH A;  2MJ6 A;  3CLO A;  2OAP 1;  3KYQ A;  3MXQ A;  2P7J A;  3BJN A;  2OWJ A;  3CWF A;  3H7W A;  2L1M A;  4R3A A;  4UQI M;  3BQ8 A;  3MF0 A;  3UB6 A;  3G6O A;  4DN0 A;  1Y28 A;  3PR6 A;  4MN6 A;  4CLC C;  4EES A;  4EU0 A;  1XJ2 A;  4BJP A;  3CUE A;  5AJG A;  4EW7 A;  3SW1 A;  2L0W A;  1T18 A;  4IJG A;  3P7N A;  3E0Y A;  4P6Z M;  4BBV A;  4O0P A;  3V67 A;  3D3O A;  3HCY A;  3EQV A;  1YKD A;  3PBN A;  2D01 A;  5AVF A;  3C30 A;  3H7W B;  1NLY A;  3VE4 A;  5HSQ A;  3UE6 A;  1TS8 A;  4Z1W A;  2GX5 A;  1XFN A;  2WKR A;  2OAQ 1;  4WF0 A;  2PT7 A;  1YSP A;  1P97 A;  1S4R A;  2K2N A;  3NOP C;  2GZA A;  3LIF A;  3KSF A;  4ETX A;  3NJA A;  2J3W A;  4HJ4 A;  1IOU A;  2ZBB A;  3HJK A;  5HWW A;  1TF1 A;  4KQO A;  4MDZ A;  2VJW A;  2HJ9 C;  2Z6C A;  3OBF A;  1W63 M;  3EGX C;  1S1Y A;  3F1N B;  1YSQ A;  1ZTU A;  1LT0 A;  4Q0I A;  3RFB A;  2W1T B;  4GS9 A;  3ICY A;  1UGU A;  5F68 A;  2XSS A;  3S7Q A;  2O9C A;  3LR4 A;  5HD5 A;  4KQD A;  2VLG A;  5HZH A;  3KX0 X;  3IBJ A;  2WKQ A;  3VE3 A;  4AFI A;  4CLC D;  4GHI A;  3RH8 B;  3NOU C;  1F9I A;  3P01 A;  5HDS A;  3TRC A;  2H28 A;  3UME A;  4NEE D;  1S66 L;  4EQ1 A;  4DJ2 A;  3PBQ A;  4UEY A;  3MJQ A;  3UB8 A;  1OJ5 A;  3T4J A;  3GEC A;  1OT6 A;  3R4K A;  4L9E A;  4EEP A;  4DMZ A;  5K5B A;  3E4Q A;  1S67 L;  1VHM A;  5G4Y A;  1NLZ A;  3OC2 A;  2OWH A;  3T4S A;  5HD3 A;  2W3E A;  4HH2 A;  2W27 A;  2FZ0 A;  5I5L A;  2VEA A;  2W3G A;  1GSX A;  5DKK A;  4NXB A;  1T19 A;  3OCL A;  4PKY A;  3MR0 A;  2Y8H A;  1TS0 A;  2A24 A;  2O9B A;  3R7W A;  3MQO A;  3C2W A;  2QHK A;  4ARZ A;  3K2N A;  2CMN A;  2VZW A;  2V1B A;  1XFQ A;  3B42 A;  5HPF A;  2O0Y A;  3CUE C;  3IBR A;  2QJ7 A;  4QPR A;  2Y79 A;  1LSX A;  3FC7 A;  4HP9 A;  2J3T C;  4OOL A;  2QKP A;  3LIA A;  4WL9 A;  2XA7 S;  2PR6 A;  3LR0 A;  3PBS A;  2VX8 A;  4IUH A;  2QJ5 A;  5CX7 A;  2B18 A;  2ZMV A;  3IS2 A;  3H82 B;  1P9W A;  2PYP A;  2W1T A;  3BWL A;  1MC0 A;  3CAX A;  3EEH A;  4Q0H A;  3F1O A;  4HJ6 A;  3HJI A;  2L4R A;  2O9A A;  3UB7 A;  2INW A;  5IT5 A;  4Y3I A;  3LIC A;  3F1N A;  1NRJ A;  1OTD A;  2HGV A;  3OLO A;  4EEU A;  3KYZ A;  4KUK A;  2W3D A;  1XJ3 A;  1G28 A;  2JKR M;  5IU1 A;  3MQQ A;  2P04 A;  3TJZ C;  3FPW A;  4F3L A;  3GDI A;  2KLI A;  2PDR A;  2PHY A;  4HQA A;  5F5Y A;  4EUV A;  3OOV A;  1DRM A;  2I9V A;  3EQU A;  1D06 A;  3DBA A;  4KUO A;  1MKM A;  2V9A A;  2XA7 M;  5FL3 A;  1LL8 A;  2EA9 A;  4LRX C;  5DFY A;  1G6O A;  3VOL A;  1KOU A;  3A0V A;  3S7O A;  3K3C A;  4L9F A;  4E04 A;  2VKS A;  2KOI A;  3LUQ A;  1GSW A;  2JKT M;  1W63 Q;  2A24 B;  3PYP A;  3R7W B;  4ARZ B;  5TJJ A;  1D7E A;  5J3W A;  4GLQ A;  3RTY A;  4WEJ A;  1TS6 A;  1V9Z A;  2ZOH A;  4CLC A;  5L8M A;  4OOM A;  1XJ4 A;  3BY8 A;  3F1O B;  3E4P A;  4RQ9 A;  5MC7 A;  2ZOI A;  2JKR I;  4HI4 A;  1LSW A;  3B33 A;  3C8C A;  3U2A A;  1OTE A;  3ULF A;  5HDD A;  5AVE A;  4R6L A;  4I3J A;  4HNB A;  1X0O A;  1S4S A;  3KSH A;  3LR3 A;  2VV8 A;  2QWS A;  1DP9 A;  5DJT A;  3VV4 A;  2V0W A;  2KDK A;  4JGP A;  3BQA A;  3T4L A;  4GS9 B;  5TBM B;  3FG8 A;  2NUT C;  2HV1 A;  2WKP A;  4XT2 A;  4R38 A;  1IFQ A;  1DP8 A;  2O99 A;  1TS7 A;  3H9W A;  3JVU A;  3LYX A;  4Y2F A;  3IS2 B;  1BYW A;  1F98 A;  4WLA A;  3PBO A;  5HWT A;  1DP6 A;  4I3A A;  5C5K A;  1F5M A;  5G4Z A;  5J4E A;  1OTI A;  5J7E A;  3LIB A;  3KSI A;  2K7S A;  4H6J B;  4BWI A;  5HL6 A;  3S7N A;  1OJG A;  2PD8 A;  4II7 A;  4NKP A;  4IUK A;  4CLC B;  5DJU A;  3BW6 A;  4LRY C;  3E4O A;  4O8G A;  2OOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...