4HJ4A

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
177
structure length
177
Chain Sequence
AMDQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOV protein
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
total genus 56
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hj4A00
2Z6DA 3T50A 1LT0A 5F68A 2P7JA 4H6JA 3LIEA 3CLOA 1X0OA 4KUOA 4HH3A 4NXGA 3E4OA 4L9FA 2D02A 5DKKA 2VV7A 2QJ7A 3GDIA 1OTBA 4XT2A 1VB6A 1S67L 1XJ4A 4KQDA 1XFQA 3UB6A 4GW9A 1V9ZA 4HQAA 2PDRA 4EXOA 4NXFA 1OJ5A 1S1YA 4GCZA 3B33A 5I5LA 2V1BA 3H7WA 5G4YA 3IS2B 1D7EA 4B9OA 2PD8A 5AVEA 5DJUA 2PYRA 2OOLA 1P0ZA 5J7EA 3PHYA 3E4PA 3C8CA 3CAXA 5EFWA 1MZUA 2V0WA 3H82B 1KOUA 4HI4A 4EESA 3SW1A 1OT6A 5HDCA 1S4RA 2KX6A 3ULFA 4LPZA 2W0NA 4R70A 3UMEA 3P7NA 2INWA 4JGRA 2JN7A 3LYXA 3RTYA 3UE6A 3K3CA 4EQ1A 3C2WA 5G4ZA 2W27A 3FG8A 1ODVA 5AVFA 1Y28A 1GSVA 4LLOB 4JGPA 1UGUA 5HDDA 3NJAA 2CMNA 4KUKA 4BBUA 4R3AA 4EW7A 4HH2A 2A24A 4HNBA 1S1ZA 5TBMB 3F1NA 4EEUA 2GJ3A 2QKPA 2HV1A 1OTDA 1T1CA 1GSXA 2ZBBA 3KX0X 2J80A 4I39A 1F9IA 5HSQA 1UWPX 4HOIA 4HHDA 2WKPA 4EEPA 1TS7A 3VOLA 2PHYA 4F3LB 4GHIB 3LIDA 5F6AA 1TS6A 1S4SA 4MN5A 1UWNX 3F1PB 3IBRA 2YKFA 3H9WA 5J3WA 4NXEA 2I9VA 3BY8A 4BBTA 1T1BA 3LI8A 5HDSA 1NWZA 2R78A 2VLGA 3A0RA 3A0VA 1JNUA 4WUJA 3D72A 4HJ3A 1N9OA 3MQOA 2QWSA 5KIZA 4LRXC 4R6LA 1DP8A 2OWHA 4R38A 3VE4A 4NXBA 2WKQA 1OT9A 4LRYC 2VV8A 4I3AA 2Z6CA 3NOUC 5HWVA 3IS2A 3CWFA 3LIBA 1TS0A 3LIAA 1XJ3A 1OTEA 2L1MA 2VV6A 3E4QA 3ICYA 4L9GA 5IU1A 1P97A 1T1AA 4YWZA 2PD7A 1XJ2A 3H82A 3F1OB 2PR6A 3LI9A 4GS9B 1DRMA 3UB8A 1LL8A 3A0SA 5F5YA 1EW0A 4HP9A 4BBVA 1XFNA 3K3DA 3PYPA 1G28A 1XJ6A 3OLOA 3EWKA 4EERA 4H6JB 3NOPC 4RQ9A 1LSWA 4LRZE 4I5SA 4DJ2A 3MJQA 1N9LA 1OTIA 2VEAA 3BY9A 5DJTA 1LSVA 1OJGA 4XT2B 2OWJA 2B02A 2JHEA 2L0WA 5TBMA 4L9EA 5A8BA 5HD5A 3HJIA 4EETB 3H7WB 2M1CA 2K7SA 3GECA 4PKYG 3MFXA 1WA9A 3G6OA 5J4EA 2QJ5A 4PKYA 2V1AA 2PYPA 4DJ3A 2V0UA 5F69A 4WLAA 1F98A 3MQQA 4MN6A 4F3LA 1S66L 2PR5A 1V9YA 3RH8B 4GHIA 5HD3A 3F1PA 2BASA 4HJ6A 3LUQA 2EA9A 1DP6A 3MXQA 3FC7A 1D06A 4HJ4A 4HY8A 3ZQ5A 4HP4A 3EEHA 4K08A 1OTAA 5HWTA 3UMDA 2D01A 4WF0A 2ZOIA 4HIAA 3UB9A 1GSWA 1DP9A 3NOTC 4WN5A 1TS8A 4M4XA 3LICA 4JGQA 3NHQA 2KDKA 3HJKA 2A24B 4JGOA 5IS1A 3F1NB 5DKLA 2H28A 1N9NA 1T18A 4WL9A 3MR0A 3BWLA 4E04A 2WKRA 1T19A 2ZOHA 5HZHA 2YKHA 3F1OA 3LIFA 4I38A 3UB7A 5HWWA 4GS9A 1BYWA 4I3JA 2V9AA 1LSXA 4I3IA 2L4RA 2QHKA 3VE3A
chains in the Genus database with same CATH superfamily
1HZOA 1IYPA 2EX8A 2W3DA 3G35A 3T50A 1LT0A 2ACGA 2FH5A 3M2JA 4FD8A 2O9CA 1K54C 4H6JA 2QMIA 1PNEA 5A92A 3TRCA 2PU4A 4L9FA 3IH8A 4PM6A 2IWDA 3UN7A 1HD8A 1BLPA 3GDIA 3SS4A 2Y2IA 1VB6A 5EVIA 3SZTA 4MCWA 1XJ4A 4P6BA 4P85A 3UB6A 1L3LA 4OKPA 1MXOA 5GHZA 1ONGA 3CG5A 2PDRA 3BJNA 4MBHA 4EXOA 4NXFA 1S1YA 3CUEA 1YT4A 3D3OA 1HLUP 3T4TA 3UDIA 3N4IA 2JC7A 2PD8A 1IEMA 5HAQA 2PYRA 2OOLA 3ITBA 5CTNA 5J7EA 3JVUA 3NIAA 3HUOA 4KZ9A 2ZC7A 1NLYA 3BRMA 2A3UA 3ZNTA 2XRNA 4ID4A 5HDCA 3IQAA 4KZ7A 4U0TA 3UMEA 3P7NA 4JGRA 4LV3A 4Z1WA 5HFOA 1K55C 3RTYA 3W4PA 1RGZA 1KVLA 1JWZA 3O5YA 3GMWA 1J3WA 3HLBA 4OPZA 4EQ1A 2EWWA 2HP6A 5G4ZA 3V3SA 4JF5A 2W27A 3FG8A 1ODVA 1I2SA 3W8KA 4LLOB 4JGPA 1SHVA 5HDDA 4Y0UA 3CJMA 4GD6A 3IHAA 3NJAA 2I72A 4BBUA 4HH2A 4GOGA 3WS1A 4FSFA 1PIOA 3O3VA 2GJ3A 3BFDA 1KGEA 4WMCD 4S2NA 3E2LA 3T4SA 4E6XA 2K2NA 3PR6A 3UO9A 1PWGA 4H8RA 1YLWA 4QY5A 3V3RA 1YQSA 2A49A 1UWPX 4YINA 2M7VA 3DAVA 1PZPA 1VM1A 1GA0A 3ITAA 3V5MA 4GDBA 2O99A 3EQVA 4E3JA 1JTDA 5CEBA 3QP8A 4HESA 3WWXA 4GB7A 4WM9A 3IBRA 3T1QB 2JKTI 3H9WA 1KGGA 4FCFA 5J3WA 3PBTA 2I9VA 1I5QA 2XF3A 1Q2PA 2Q9NA 3BY8A 3V39A 4BBTA 5HDSA 2VA0A 3BYDA 1FSWA 1BTLA 3MSHA 1C3BA 4WUJA 1PYYA 4KG6A 4HJ3A 2V1ZA 2QWSA 4R23A 4E3MA 2JCHA 1ES5A 3R4KA 2JKRI 3LR5A 2P9VB 4LGWA 5CHJA 4PPRA 4R6LA 4Y7PA 2W3EA 5EV0A 3G4PA 4EV4A 4ZTKA 5EVLA 4UA6A 3IX8A 5EVIC 3QP2A 4S2JA 3CWFA 2ZQ8A 4R4RA 4GDNA 2XR0A 5GLBA 1XJ3A 4CQHA 2OLUA 2VV6A 4QHCA 3T1XA 2ZL1A 5MC7A 2A2LA 1T1AA 3CUEC 3H82A 4QJGA 3MQ0A 1FIKA 3VFHA 3F1OB 3T4LA 3HLDA 3UB8A 4RX3A 3IX3A 3OPPA 3A0SA 1EW0A 1FOFA 1EWZA 2ZMFA 4RYEA 2UV0E 5E2EA 5EM1A 4G3WA 4JF6A 3NOPC 1K6RA 3P98A 3UB5P 3ZNYA 2VZWA 1Z6FA 1HTZA 3WRZA 1KE4A 1OTIA 4O0PA 2PRFA 2Y4AA 4S2PA 3MXSA 5DJTA 4OP5A 1SKOB 3M6BA 1OJGA 1AXBA 3BECA 5CERA 4OQHA 3VOYA 2XD5A 2OWJA 1TD5A 3IBJA 4B4XA 4QD4A 2L0WA 5TBMA 4L9EA 1KGFA 5HD5A 3ZCZA 3MZEA 3HJIA 3MFXA 1NYMA 1ERMA 5IHVA 3UPNA 3G6OA 2RL3A 5EE8A 1AWIA 2V1AA 2EXAA 4F3LA 4S2NC 3EOIA 4UA7A 2ZD8A 1V9YA 4C6YA 4EBPA 4GHIA 1Y54A 4QB8A 5DF8A 4KZAA 3NCKA 2BASA 1BZAA 4NEED 1XA7A 4K0XA 3ZYTA 1MWUA 5DFYA 3CPTA 4IVKA 2M7UA 5HWTA 1W63Q 2FFFB 5AQBA 2H10A 5AQ7A 5HPIA 3BW6A 4EUZA 4R3BA 3NULA 2J9OA 3QP5A 1DP9A 2G7UA 3IHBA 2WGWB 4WN5A 3GSGA 1TS8A 2B95A 1ES2A 4M4XA 3LICA 3NHQA 2W3GA 3HJKA 1K54A 4JGOA 3UE1A 4B93A 2H28A 4OPQA 2Y2PA 3LR3A 1PI5A 2DRWA 1FCOA 3Q1FA 5CHMA 5E2HA 2IA2A 3HVFA 4PMAA 4BENA 4X1MA 3PBQA 4GS9A 1BYWA 4Q0IA 1STZA 3DWZA 2ZJ9A 1L0FA 4I3IA 2L4RA 4NK3A 2VKSA 5L07A 3VSLA 2J9PA 2GX5A 3CLOA 1K56A 3Q7VB 4JF4A 3HL9A 4S2IA 4NXGA 1H5XA 3G32A 3MZDA 2WKHA 3GTCA 5EVEA 2D02A 4O7DA 2VV7A 3W4OA 1OTBA 2GZAA 1IYSA 1S67L 2HDUA 3C7VA 1FR6A 3LY4A 1XFQA 1V9ZA 4HQAA 2Y91A 1BULA 1OJ5A 4GCZA 5L09A 4P6ZM 2V1BA 4LENA 4DF6A 1IELA 3Q07A 5FDHA 2Q9MA 1G6AA 3IS2B 2JKGA 4B9OA 4RX2A 1PWCA 4ZJ3A 1P9RA 3DTKA 3OPHA 2ZC3B 2VGKA 3ZVTA 4YOFA 5F1GA 3T4KA 4ZBEA 5I94A 1NZOA 3HLCA 3PHYA 5EFWA 1MZUA 1KOUA 4EESA 5EECA 5FQKA 1W79A 4DE0A 2OSUA 3EEAA 5GLCA 4S2OA 4N92A 1KDWA 2JN7A 5E2GA 3CI6A 1NRJA 3GV9A 3UE6A 4CPKA 3C2WA 2Z2LB 2EXBA 4EBLA 5AVFA 1Y28A 5GHYA 4CLCD 1FR1A 4OH0A 3T1RA 2EX6A 2WZXA 1WYBA 1PWDA 1YMSA 3ZFZA 3IWIA 2VGLS 2ZMAA 3LR4A 2VX8A 4HNBA 1S1ZA 3FWLA 3F1NA 3IT9A 2AVXA 1OTDA 1T1CA 4YFMA 5F1FA 4MBFA 2ZBBA 3KX0X 4I39A 4QU3A 2V8FA 5M19A 3R7WB 4OOLA 4ESPA 5FEFA 3QNCA 4HHDA 2WKPA 1XKZA 1FSYA 3PBRA 1TS7A 3VOLA 2WKIA 3EGXC 4Y0TA 3MMHA 3DTEA 4ARZB 5F6AA 1TS6A 5FQMA 3MFDA 1YSPA 2Y2NA 5EPHA 2V2FF 3S7NA 3FYZA 1IKGA 5DFXA 4X68A 3TSGA 2J8YA 4WZ4A 3U2AA 3A0RA 4B88A 4LFUA 2ZM8A 3UPOA 4DXCA 1JNUA 5CGWA 3D72A 2GNXA 5CHUA 2G2UA 3NBLA 2PBDP 2Y2KA 3S4XA 4LRXC 3ZDJA 3VMAA 3UDXA 2ZC6B 4Y3IA 1DP8A 2HF6A 2ZQDA 2QPNA 2XQZA 2QZ6A 4NXBA 4LRYC 1BUEA 1L0DA 4WEKA 4OLGA 3BEBA 3NOUC 1NJ4A 4U0XA 1TEMA 2HGVA 5FQJA 2W1RA 4UAAA 4X69A 2PD7A 4KZ4A 4OP8A 3QP4A 4HBUA 2PR6A 3KSGA 3LI9A 2ZC4B 2OAQ1 3QNBA 5HW3A 4BJPA 1K25A 3UDFA 2HDRA 3V50A 3M6HA 5F5YA 4R0QA 1YLYA 1LI9A 1EROA 4LV1A 3LEQA 3K3DA 3VP4A 1G28A 3O86A 3S1YA 2P74A 1F5MA 5CTMA 2WAEA 4LRZE 1MWSA 3QP1A 2LB9A 3MJQA 4DJ2A 3IF6B 1BSGA 2VEAA 1LSVA 4WZ5A 2XGNA 4X6TA 2NUPC 4XT2B 4LCMA 2BTFP 2B02A 5EOEA 4K91A 5J8XA 3OZHA 4N1XA 2J3TD 4CJNA 1RGYA 1W8QA 5GL9A 4EETB 1NRFA 3FPWA 3H7WB 2M1CA 2K7SA 2Y2MA 1ZKJA 4IBRA 4JXVA 1ERQA 4BD0A 4OONA 2QJ5A 2P08A 1H0MA 4PKYA 1LHYA 2C5WB 2V0UA 5M18A 4WLAA 4Q8IA 2BG1A 3FV7A 3ZG0A 4MN6A 3NDEA 3BFGA 2PR5A 4BMWA 2E8IA 1VQQA 3OCNA 4NETA 2X02A 1VHMA 4IUKA 1MC0A 4PM8A 3HLGA 1E3UD 1IKIA 1OMEA 4ZJ2A 1KVMA 1K4FA 4DXBA 4HP4A 4OLDA 4CLCB 4K08A 2XA7M 1DJAA 3IWQA 5HL1A 3E98A 1XGIA 2ZOIA 2OLVA 4FH4A 2J7VA 1F2KA 4KZBA 4OPYA 1ESIA 5FI6A 2OAP1 1E25A 4PM9A 3TJZC 2P9VA 4JGQA 2KDKA 4OOMA 2O0YA 1XA1A 2Q0OA 3GVBA 2A24B 1JVJA 2RCXA 5FASA 5IS1A 1ACFA 3B42A 4GZBA 4K0WA 1E4DA 1T18A 4NKPA 3C4OA 4RA7A 3AGEA 1PZOA 2WKRA 1VETB 5HZHA 2YKHA 1ALQA 2B18A 3F1OA 3LIFA 4I38A 3HLFA 3S7OA 2PBYA 5U47A 1CI8A 3S22A 5KSHA 5FA7A 4XUZA 3DTIA 5K5BA 4WEJA 4JXWA 2Y55A 5F68A 1YLTA 2P7JA 1TF1A 4BD1A 3LIEA 3FZCA 3DWKA 3IWOA 4KUOA 3TE8A 1SDEA 3CZDA 3E4OA 4X1LA 5E43A 3RXWA 4QY6A 3QHYA 1SKOA 2NUTC 5L10A 3W4QA 3C5AA 4GKUA 3GRJA 4IEDA 4L0LA 3A3DA 2HPBA 4GW9A 5FQIA 3G2YA 3CMZA 3VP2A 4KZ8A 3AGFA 4JPMA 1BLHA 3B33A 2V20A 2H0TA 4WZ5C 4YNRA 3MXRA 4DDSA 4XXRA 3P09A 5HL6A 3ZG7B 1D7EA 4MBKA 2HP5A 2PT7A 3V67A 3A3EA 3NECA 5A90A 1N4OA 4E3KA 3T4JA 1EI5A 3EQUA 3CAXA 1S6RA 2V0WA 1IOUA 3SW1A 1OT6A 2CC1A 1S4RA 1K38A 3ULFA 4LPZA 3CHWP 4DMZA 3FKVA 2IWCA 3KYQA 2E8JA 4R70A 3KSIA 1G68A 2O9AA 4QWOA 3LYXA 3RFBA 3MZFA 3K3CA 4IBXA 2EFXA 1H3QA 2VGJA 4Y2FA 5FSRA 5HAPA 2XROA 1FCMA 1UGUA 2WGWA 4X25A 4DN0A 4WMCA 2CMNA 4KUKA 4R3AA 4EW7A 1BLCA 4KZ3A 2ZQCA 2Y2JA 3NC8A 1HVBA 4EEUA 5FL3A 1YLPA 1MPLA 4OOYA 3BFEA 1H8YA 4PHTA 1F9IA 3K2NA 1FQGA 1DJCA 5KMWA 4R3JA 2W1TB 3G31A 3E0YA 4EEPA 3VP0A 5TR7A 4B4ZA 3PTEA 5L2FA 4QPRA 2EX2A 3S7QA 2J3WA 1VEUB 5JYPA 2Y8HA 1CQAA 5FAPA 1ZTUA 4S2MA 4MN5A 4X55A 4U3TA 3F1PB 4N9KA 2XFSA 4HEFA 2XDMA 4FTXA 4HBTA 5F82A 4NXEA 2WKEA 4E3NA 3HBRA 3PBSA 4ETXA 1S0WA 1T1BA 3Q7VA 1NWZA 1E3UA 1CEGA 1KE0A 2R78A 2VLGA 3G34A 4ZJ1A 2B5RA 3A0VA 1M40A 3MQOA 2Y2LA 5KIZA 3WS4A 5G18A 5FATA 5L8MA 3C38A 3LGOA 5BOHA 4FUWA 3SH8A 1P9WA 3LEZA 4ME4A 1MKIA 1DJBA 4DE3A 5HWVA 2HJ9C 3IS2A 3QP6A 1CEFA 3FKWA 3LIBA 1YAXA 1TS0A 3IF5A 1OTEA 1YKDA 1H8ZA 4Q0JA 3A3JA 2HJEA 3ICYA 3IXHA 3N8SA 4L9GA 4GD8A 3G2ZA 3D4FA 1KE3A 5FQ9A 1GHIA 4EWFA 3KSHA 3TW8A 4E6WA 5CECA 1ES3A 1IFQA 3LFVA 4JXSA 1XXMA 4BBVA 2P04A 4KENB 3PYPA 1XJ6A 3EWKA 1JTGA 4H6JB 5CRFA 1SDNA 3KSFA 1OPXA 1SKFA 3BLMA 1LSWA 4OQGA 4KZ6A 2KOIA 1N9LA 5TGFA 3VP3A 3BY9A 1GA9A 3PAEA 1L2SA 1CK3A 5EVIB 4E3OA 1YPRA 3UNWA 4E3LA 1IYOA 1GCEA 1XGJA 3Q82A 5A93A 5KSCA 3MKFA 4BWIA 5M1AA 3PXPA 3E2KA 3IXGA 4UQIS 5A8BA 3RJUA 1IYQA 5FI7A 1Q2QA 1JWVA 4JLFA 3R7WA 4PKYG 4GNUA 4WELA 1LL5A 2XLNA 5LBRA 5J4EA 5A91A 1D1JA 2JKTM 1BLSA 3IH9A 2JBFA 3VV4A 5F69A 1O7EA 1S66L 2XH9A 2J3TC 4ARZA 3OPRA 1LLBA 3IXBA 3UE0A 3TG9A 3NY4A 4JKTA 5HD3A 4S2LA 4HJ6A 2KLIA 3LUQA 3OOVA 1DP6A 4BL2A 3ZQ5A 4HY8A 4HJ4A 5KZHA 3EEHA 1ONHA 4ETZA 2JKRM 3L9KA 1XX2A 3HLWA 5DVAA 3ZHHA 1ESUA 3EGDC 4N1HA 4BL3A 4DKIA 1TVFA 2ZQ9A 2FZ0A 4G3VA 4OPRA 3SH7A 2VK3A 4RVAA 3NOTC 4FH2A 4ZDXA 3T12B 2W3FA 1PW8A 2DCFA 3TOIA 2UWXA 3FPVA 5HAIA 2VJWA 3MBZA 3IX4A 4R1GA 2Y2GA 3N6IA 4II7A 3SOIA 1PI4A 2WZZA 1NLZA 4PM7A 1XP4A 2ZQAA 5FQQA 4BLMA 1FCNA 4GLQA 4LCLA 5FAQA 4O8GA 2JE5A 3SS3A 3ZGAB 1N9NA 4WL9A 1W8YA 5HARA 3SH9A 4E04A 1Y4OA 1T19A 4MN7A 2Y59A 1K4EA 1DY6A 2Y2HA 3WS5A 1WE4A 4LV2A 4A5RA 1MBLA 5HWWA 1H8MA 3S7PA 4I3JA 4DDYA 1K57A 4C75A 2Z6DA 3O87A 5GLAA 2Z2MB 4P0MA 4P6ZS 4FOFA 2WUQA 3SS5A 4N9LA 2K31A 4O01A 1X0OA 4R4SA 4HH3A 1LL9A 3IF6A 1RCJA 4Z9QA 2WADA 4UEYA 4EQIA 3BQ8A 3DBAA 3MS6A 3Q81A 5DKKA 2QJ7A 3HCYA 4XT2A 3W2ZA 1K56D 2XSSA 4KQOA 1PW1A 3T4QA 4KQDA 5HX9A 1N9BA 5D3OA 4PAUA 1J9MA 2MJ6A 2R9XA 5I5LA 3ZVWA 3JYIA 3H7WA 3C4PA 5G4YA 4Y13A 1I2WA 5DTTA 1O07A 5IT5A 2IWBA 1G5UA 4MLLA 5E2FA 4UHUA 1L0GA 2HZ5A 5AVEA 2ZL1B 5DJUA 2EFUA 3N8LA 1U60A 2Y2QA 2R9WA 1P0ZA 3E4PA 3C8CA 3GR2A 3H82B 4DE1A 4HI4A 1Z09A 5AJGA 2KX6A 2GDNA 3DW0A 3LCEA 4E3IA 3LR0A 2W0NA 2ZMVA 2INWA 4BQMA 2PAVP 3C30A 4CLCA 2DNSA 1LI0A 4DE2A 1YLZA 3AGDA 1G6OA 2JKFA 5TFQA 4NG2A 4KG2A 1PFLA 3P01A 3Q7ZA 3UY6A 1NXYA 4Q0HA 3BQAA 1GSVA 3ISGA 4MNRA 1ZG4A 4D2OA 3B3XA 4OQ0A 3KO6A 4MEZA 4UA9A 5DF7A 4IJGA 4KQQA 3VOZA 4MDZA 2OV5A 2A24A 1YMXA 5TBMB 1SCWA 1ES4A 2QKPA 2HV1A 4G3KA 4WYYA 4IVIA 1ZHHB 3OBFA 4Y15A 3UPPA 1GSXA 4D60A 3BFFA 2J80A 5F83A 4OQIA 2Y79A 3WRTA 1VETA 5HSQA 3WS2A 4HOIA 1MWTA 5GHXA 3NDGA 1GHPA 1XPBA 2ZLYA 3RXXA 2QYBA 1NZUA 3O88A 3PBNA 2PHYA 1ZC2A 5CGXA 4F3LB 1NY0A 2VGLM 4GHIB 3LIDA 2WGIA 1GHMA 1S4SA 2LB5A 3M2KA 1UWNX 2FFYA 2YKFA 1PRQA 5CEDA 3CPTB 3LI8A 3JPUA 4KG5A 5FDSA 1ZG6A 3WS0A 5EVID 1K57C 1NYYA 1MKMA 5JYOA 1BT5A 2WK0A 2V8CA 5C5KA 1YLJA 4GJ4A 1YM1A 3NI9A 1N9OA 2H0YA 2ZQ7A 4IUHA 4UQIM 4CLCE 2WAFA 3IF6C 2OWHA 2XFTA 4R38A 2HP9A 3JVVA 3VE4A 1W63M 2WKQA 1OT9A 2VV8A 4I3AA 1SZVA 2Z6CA 3BLSA 3VP1A 4IHQA 5FEGA 3LIAA 2L1MA 5DTSA 5FI2A 2BLSA 3ZG8B 3E4QA 5IU1A 3MKEA 1K0KA 1P97A 4YWZA 1XJ2A 3I7JA 1QMEA 2O9BA 4GS9B 3U4LP 1W5DA 1W7FA 1DRMA 1LL8A 3GQZA 3HUNA 4Y17A 2HDSA 4HP9A 1YSQA 1XFNA 2EX9A 3PAGA 3OLOA 4EERA 3PBOA 4P87A 2XK1A 4RQ9A 1A0KA 3OPLA 3T4OA 4I5SA 4CLCC 3HLEA 2EWVA 4AFIA 5CGSA 2X01A 5TJJA 4S2KA 3A3FA 4ZRRA 3G30A 2JHEA 5EUAA 5AQ9A 5AQAA 3N7WA 4EUVA 3LY3A 1JWPA 4EBNA 2C6WB 4X56A 4DRTA 3ZG5A 3GECA 5HPFA 3IXDA 1WA9A 2XA7S 3N8RA 4OVDA 4X53A 3DTMA 3CITA 2W1TA 4LV0A 1TDLA 2PYPA 3L7HA 4DJ3A 1F98A 3MQQA 1VEUA 5GLDA 4Y5FA 3VSKA 3OC2A 3RH8B 1K55A 2ZM2A 4MMNA 3OCLA 4PM5A 1KDSA 1MY8A 2WGVA 4EU0A 4F94A 2WYXA 3F1PA 4Y0OA 2DMWA 3LO7A 2EA9A 4JXGA 3MXQA 3FC7A 1D06A 5DF9A 3KYEA 2X71A 1OTAA 3ZG9B 3UMDA 2XEPA 1RP5A 2D01A 1CI9A 4WF0A 2G2WA 3BFCA 3VFFA 4HIAA 3MF0A 1M6KA 1FILA 3UB9A 1GSWA 3UE3A 1TDGA 1L0EA 4WBGA 4GN2A 1MWRA 1K6SA 5EM0A 2ZC5B 4C3QA 2W3HA 3KYZA 5FAOA 2HDQA 3F1NB 5DKLA 5CX7A 1CJFA 3T1SA 4XUXA 5EOOA 3B47A 3MR0A 3BWLA 2PU2A 1QMFA 3HUMA 4KQRA 4KZ5A 2ZOHA 3BM6A 2ZM0A 4JBFA 2XD1A 1CF0A 1WYCA 3A3IA 3C7UA 4M3KA 4ZAMA 5CXWA 5DTKA 3UB7A 2Y2OA 2V9AA 1LSXA 3HREA 3D9YA 2QHKA 3VE3A 2H5SA
chains in the Genus database with same CATH topology
2Z6DA 5K5BA 4WEJA 2W3DA 3T50A 1LT0A 2FH5A 4P6ZS 5F68A 2P7JA 2O9CA 1TF1A 4FOFA 2GX5A 4H6JA 3LIEA 3CLOA 2K31A 4O01A 1X0OA 4KUOA 3TRCA 4HH3A 4NXGA 3TE8A 3E4OA 4L9FA 4UEYA 3BQ8A 3DBAA 2NUTC 2D02A 5DKKA 2VV7A 2QJ7A 3GDIA 3HCYA 1OTBA 4XT2A 3W2ZA 2GZAA 1VB6A 2XSSA 1S67L 4MCWA 4KQOA 4L0LA 1XJ4A 3T4QA 4KQDA 1XFQA 3UB6A 4GW9A 1V9ZA 4HQAA 4PAUA 2PDRA 3BJNA 4EXOA 4NXFA 2MJ6A 1OJ5A 1S1YA 4GCZA 3B33A 4P6ZM 5I5LA 2V1BA 3CUEA 4YNRA 3H7WA 5G4YA 3IS2B 5HL6A 1D7EA 3D3OA 5IT5A 2PT7A 4B9OA 3T4TA 3V67A 1P9RA 2PD8A 3T4JA 5AVEA 4YOFA 5DJUA 2PYRA 3T4KA 2OOLA 1P0ZA 3EQUA 5J7EA 3PHYA 3E4PA 3C8CA 3JVUA 3CAXA 5EFWA 1MZUA 2V0WA 3H82B 1KOUA 4HI4A 1NLYA 4EESA 1IOUA 3SW1A 1OT6A 2XRNA 5HDCA 1S4RA 5AJGA 2KX6A 3ULFA 4LPZA 4DMZA 3LR0A 2W0NA 3KYQA 2ZMVA 3EEAA 4R70A 3KSIA 3UMEA 3P7NA 2INWA 3C30A 4JGRA 2JN7A 2O9AA 4CLCA 3LYXA 4Z1WA 1G6OA 3RFBA 3RTYA 3CI6A 1NRJA 3UE6A 3K3CA 3O5YA 3P01A 4EQ1A 3C2WA 2EWWA 1H3QA 5G4ZA 2W27A 3FG8A 1ODVA 4Q0HA 4Y2FA 3BQAA 1Y28A 5AVFA 1GSVA 4CLCD 4LLOB 2XROA 4JGPA 1UGUA 5HDDA 3KO6A 4DN0A 3NJAA 2CMNA 2VGLS 4IJGA 4KUKA 4BBUA 4R3AA 4MDZA 4HH2A 3LR4A 4EW7A 2A24A 2VX8A 4FSFA 1S1ZA 4HNBA 5TBMB 3F1NA 4EEUA 5FL3A 2GJ3A 2QKPA 2HV1A 4G3KA 1OTDA 1T1CA 1ZHHB 3OBFA 4PHTA 1GSXA 2ZBBA 3KX0X 3T4SA 2J80A 4I39A 2K2NA 3R7WB 1F9IA 3PR6A 4OOLA 2Y79A 3K2NA 5HSQA 1UWPX 2M7VA 4HOIA 2W1TB 4HHDA 2WKPA 3E0YA 4EEPA 2QYBA 3PBRA 1TS7A 3VOLA 4QPRA 3PBNA 2PHYA 3EGXC 3S7QA 2J3WA 4F3LB 2VGLM 3MMHA 4GHIB 3LIDA 4ARZB 2O99A 5F6AA 1TS6A 2Y8HA 3EQVA 1ZTUA 1S4SA 2LB5A 4MN5A 1UWNX 3F1PB 3IBRA 1YSPA 2JKTI 2YKFA 3H9WA 5J3WA 3S7NA 4NXEA 3PBTA 2I9VA 3PBSA 4ETXA 3BY8A 4BBTA 1T1BA 3LI8A 5HDSA 5DFXA 1NWZA 2VA0A 2R78A 2VLGA 3U2AA 3A0RA 1MKMA 3A0VA 1JNUA 5C5KA 4WUJA 4GJ4A 3D72A 2GNXA 4HJ3A 1N9OA 3MQOA 2QWSA 5KIZA 4IUHA 4LRXC 3R4KA 4UQIM 4CLCE 2JKRI 3LR5A 5L8MA 3C38A 4R6LA 1DP8A 4Y3IA 2OWHA 4R38A 2HF6A 2W3EA 3JVVA 3VE4A 4NXBA 1P9WA 1W63M 2WKQA 1OT9A 4LRYC 4ME4A 2VV8A 4I3AA 4WEKA 2Z6CA 3NOUC 5HWVA 2HJ9C 3IS2A 3CWFA 3LIBA 1YAXA 4IHQA 1TS0A 3LIAA 1XJ3A 1OTEA 1YKDA 2L1MA 2HGVA 4CQHA 4Q0JA 2VV6A 3E4QA 2HJEA 3ICYA 2W1RA 4L9GA 5IU1A 5MC7A 2A2LA 1P97A 1T1AA 3CUEC 4YWZA 2PD7A 1XJ2A 3H82A 2O9BA 3MQ0A 3F1OB 2PR6A 3KSGA 3LI9A 3T4LA 4GS9B 2OAQ1 1DRMA 3KSHA 3UB8A 1LL8A 4BJPA 3TW8A 3A0SA 1IFQA 3LFVA 5F5YA 1EW0A 4HP9A 1YSQA 4BBVA 1XFNA 2ZMFA 2P04A 3K3DA 3PYPA 1G28A 1XJ6A 3OLOA 3EWKA 4EERA 4H6JB 3KSFA 4G3WA 3NOPC 1F5MA 3PBOA 1OPXA 4RQ9A 2VZWA 1LSWA 4LRZE 3T4OA 4I5SA 2LB9A 3MJQA 2KOIA 4DJ2A 4CLCC 1N9LA 1OTIA 4O0PA 2VEAA 2EWVA 3BY9A 5DJTA 1LSVA 1OJGA 4AFIA 5TJJA 2NUPC 4XT2B 4ZRRA 2OWJA 2B02A 1TD5A 3IBJA 2JHEA 2J3TD 2L0WA 5TBMA 4L9EA 4BWIA 4EUVA 3PXPA 4UQIS 5A8BA 5HD5A 3HJIA 4EETB 3FPWA 3H7WB 2M1CA 2K7SA 3R7WA 3GECA 4PKYG 3MFXA 4WELA 5HPFA 1WA9A 2XA7S 5LBRA 3G6OA 5J4EA 2QJ5A 2P08A 2JKTM 3CITA 2W1TA 4PKYA 2V1AA 2PYPA 4DJ3A 2V0UA 3VV4A 5F69A 4WLAA 1F98A 3MQQA 4MN6A 4F3LA 1S66L 2PR5A 3EOIA 4Y5FA 3OC2A 1V9YA 3RH8B 4BMWA 4GHIA 2J3TC 4ARZA 4MMNA 3OCNA 3OCLA 1VHMA 4IUKA 4EU0A 1MC0A 5HD3A 3F1PA 2BASA 4HJ6A 2DMWA 2KLIA 3LUQA 2EA9A 3OOVA 1DP6A 4NEED 3ZYTA 3MXQA 5DFYA 3FC7A 1D06A 4HJ4A 4HY8A 3ZQ5A 4HP4A 3EEHA 5DF9A 4CLCB 4K08A 4ETZA 2JKRM 2XA7M 1OTAA 2M7UA 5HWTA 3UMDA 1W63Q 2D01A 3E98A 4WF0A 3EGDC 5HPIA 2ZOIA 4HIAA 3MF0A 2FZ0A 3BW6A 4G3VA 3UB9A 1GSWA 3UE3A 1DP9A 3NOTC 2G7UA 4WN5A 1TS8A 2OAP1 2W3FA 4M4XA 3TJZC 3FPVA 3LICA 3NHQA 4JGQA 2KDKA 4OOMA 2O0YA 2VJWA 2W3GA 3HJKA 2A24B 2W3HA 3KYZA 4II7A 4JGOA 5IS1A 3F1NB 4B93A 1NLZA 5DKLA 5CX7A 3B42A 2H28A 4GLQA 3LR3A 4O8GA 3B47A 1N9NA 1T18A 4NKPA 4WL9A 3MR0A 3BWLA 4E04A 2WKRA 2IA2A 1T19A 4MN7A 2ZOHA 5HZHA 2YKHA 2B18A 3PBQA 3F1OA 3LIFA 4I38A 3UB7A 3S7OA 5HWWA 1H8MA 4GS9A 1BYWA 4Q0IA 3S7PA 4I3JA 1STZA 5KSHA 2V9AA 1LSXA 4I3IA 2L4RA 2VKSA 2QHKA 3VE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z6D A;  3T50 A;  1LT0 A;  5F68 A;  2P7J A;  4H6J A;  3LIE A;  3CLO A;  1X0O A;  4KUO A;  4HH3 A;  4NXG A;  3E4O A;  4L9F A;  2D02 A;  5DKK A;  2VV7 A;  2QJ7 A;  3GDI A;  1OTB A;  4XT2 A;  1VB6 A;  1S67 L;  1XJ4 A;  4KQD A;  1XFQ A;  3UB6 A;  4GW9 A;  1V9Z A;  4HQA A;  2PDR A;  4EXO A;  4NXF A;  1OJ5 A;  1S1Y A;  4GCZ A;  3B33 A;  5I5L A;  2V1B A;  3H7W A;  5G4Y A;  3IS2 B;  1D7E A;  4B9O A;  2PD8 A;  5AVE A;  5DJU A;  2PYR A;  2OOL A;  1P0Z A;  5J7E A;  3PHY A;  3E4P A;  3C8C A;  3CAX A;  5EFW A;  1MZU A;  2V0W A;  3H82 B;  1KOU A;  4HI4 A;  4EES A;  3SW1 A;  1OT6 A;  5HDC A;  1S4R A;  2KX6 A;  3ULF A;  4LPZ A;  2W0N A;  4R70 A;  3UME A;  3P7N A;  2INW A;  4JGR A;  2JN7 A;  3LYX A;  3RTY A;  3UE6 A;  3K3C A;  4EQ1 A;  3C2W A;  5G4Z A;  2W27 A;  3FG8 A;  1ODV A;  5AVF A;  1Y28 A;  1GSV A;  4LLO B;  4JGP A;  1UGU A;  5HDD A;  3NJA A;  2CMN A;  4KUK A;  4BBU A;  4R3A A;  4EW7 A;  4HH2 A;  2A24 A;  4HNB A;  1S1Z A;  5TBM B;  3F1N A;  4EEU A;  2GJ3 A;  2QKP A;  2HV1 A;  1OTD A;  1T1C A;  1GSX A;  2ZBB A;  3KX0 X;  2J80 A;  4I39 A;  1F9I A;  5HSQ A;  1UWP X;  4HOI A;  4HHD A;  2WKP A;  4EEP A;  1TS7 A;  3VOL A;  2PHY A;  4F3L B;  4GHI B;  3LID A;  5F6A A;  1TS6 A;  1S4S A;  4MN5 A;  1UWN X;  3F1P B;  3IBR A;  2YKF A;  3H9W A;  5J3W A;  4NXE A;  2I9V A;  3BY8 A;  4BBT A;  1T1B A;  3LI8 A;  5HDS A;  1NWZ A;  2R78 A;  2VLG A;  3A0R A;  3A0V A;  1JNU A;  4WUJ A;  3D72 A;  4HJ3 A;  1N9O A;  3MQO A;  2QWS A;  5KIZ A;  4LRX C;  4R6L A;  1DP8 A;  2OWH A;  4R38 A;  3VE4 A;  4NXB A;  2WKQ A;  1OT9 A;  4LRY C;  2VV8 A;  4I3A A;  2Z6C A;  3NOU C;  5HWV A;  3IS2 A;  3CWF A;  3LIB A;  1TS0 A;  3LIA A;  1XJ3 A;  1OTE A;  2L1M A;  2VV6 A;  3E4Q A;  3ICY A;  4L9G A;  5IU1 A;  1P97 A;  1T1A A;  4YWZ A;  2PD7 A;  1XJ2 A;  3H82 A;  3F1O B;  2PR6 A;  3LI9 A;  4GS9 B;  1DRM A;  3UB8 A;  1LL8 A;  3A0S A;  5F5Y A;  1EW0 A;  4HP9 A;  4BBV A;  1XFN A;  3K3D A;  3PYP A;  1G28 A;  1XJ6 A;  3OLO A;  3EWK A;  4EER A;  4H6J B;  3NOP C;  4RQ9 A;  1LSW A;  4LRZ E;  4I5S A;  4DJ2 A;  3MJQ A;  1N9L A;  1OTI A;  2VEA A;  3BY9 A;  5DJT A;  1LSV A;  1OJG A;  4XT2 B;  2OWJ A;  2B02 A;  2JHE A;  2L0W A;  5TBM A;  4L9E A;  5A8B A;  5HD5 A;  3HJI A;  4EET B;  3H7W B;  2M1C A;  2K7S A;  3GEC A;  4PKY G;  3MFX A;  1WA9 A;  3G6O A;  5J4E A;  2QJ5 A;  4PKY A;  2V1A A;  2PYP A;  4DJ3 A;  2V0U A;  5F69 A;  4WLA A;  1F98 A;  3MQQ A;  4MN6 A;  4F3L A;  1S66 L;  2PR5 A;  1V9Y A;  3RH8 B;  4GHI A;  5HD3 A;  3F1P A;  2BAS A;  4HJ6 A;  3LUQ A;  2EA9 A;  1DP6 A;  3MXQ A;  3FC7 A;  1D06 A;  4HJ4 A;  4HY8 A;  3ZQ5 A;  4HP4 A;  3EEH A;  4K08 A;  1OTA A;  5HWT A;  3UMD A;  2D01 A;  4WF0 A;  2ZOI A;  4HIA A;  3UB9 A;  1GSW A;  1DP9 A;  3NOT C;  4WN5 A;  1TS8 A;  4M4X A;  3LIC A;  4JGQ A;  3NHQ A;  2KDK A;  3HJK A;  2A24 B;  4JGO A;  5IS1 A;  3F1N B;  5DKL A;  2H28 A;  1N9N A;  1T18 A;  4WL9 A;  3MR0 A;  3BWL A;  4E04 A;  2WKR A;  1T19 A;  2ZOH A;  5HZH A;  2YKH A;  3F1O A;  3LIF A;  4I38 A;  3UB7 A;  5HWW A;  4GS9 A;  1BYW A;  4I3J A;  2V9A A;  1LSX A;  4I3I A;  2L4R A;  2QHK A;  3VE3 A; 
#chains in the Genus database with same CATH topology
 1HZO A;  1IYP A;  2EX8 A;  2W3D A;  3G35 A;  3T50 A;  1LT0 A;  2ACG A;  2FH5 A;  3M2J A;  4FD8 A;  2O9C A;  1K54 C;  4H6J A;  2QMI A;  1PNE A;  5A92 A;  3TRC A;  2PU4 A;  4L9F A;  3IH8 A;  4PM6 A;  2IWD A;  3UN7 A;  1HD8 A;  1BLP A;  3GDI A;  3SS4 A;  2Y2I A;  1VB6 A;  5EVI A;  3SZT A;  4MCW A;  1XJ4 A;  4P6B A;  4P85 A;  3UB6 A;  1L3L A;  4OKP A;  1MXO A;  5GHZ A;  1ONG A;  3CG5 A;  2PDR A;  3BJN A;  4MBH A;  4EXO A;  4NXF A;  1S1Y A;  3CUE A;  1YT4 A;  3D3O A;  1HLU P;  3T4T A;  3UDI A;  3N4I A;  2JC7 A;  2PD8 A;  1IEM A;  5HAQ A;  2PYR A;  2OOL A;  3ITB A;  5CTN A;  5J7E A;  3JVU A;  3NIA A;  3HUO A;  4KZ9 A;  2ZC7 A;  1NLY A;  3BRM A;  2A3U A;  3ZNT A;  2XRN A;  4ID4 A;  5HDC A;  3IQA A;  4KZ7 A;  4U0T A;  3UME A;  3P7N A;  4JGR A;  4LV3 A;  4Z1W A;  5HFO A;  1K55 C;  3RTY A;  3W4P A;  1RGZ A;  1KVL A;  1JWZ A;  3O5Y A;  3GMW A;  1J3W A;  3HLB A;  4OPZ A;  4EQ1 A;  2EWW A;  2HP6 A;  5G4Z A;  3V3S A;  4JF5 A;  2W27 A;  3FG8 A;  1ODV A;  1I2S A;  3W8K A;  4LLO B;  4JGP A;  1SHV A;  5HDD A;  4Y0U A;  3CJM A;  4GD6 A;  3IHA A;  3NJA A;  2I72 A;  4BBU A;  4HH2 A;  4GOG A;  3WS1 A;  4FSF A;  1PIO A;  3O3V A;  2GJ3 A;  3BFD A;  1KGE A;  4WMC D;  4S2N A;  3E2L A;  3T4S A;  4E6X A;  2K2N A;  3PR6 A;  3UO9 A;  1PWG A;  4H8R A;  1YLW A;  4QY5 A;  3V3R A;  1YQS A;  2A49 A;  1UWP X;  4YIN A;  2M7V A;  3DAV A;  1PZP A;  1VM1 A;  1GA0 A;  3ITA A;  3V5M A;  4GDB A;  2O99 A;  3EQV A;  4E3J A;  1JTD A;  5CEB A;  3QP8 A;  4HES A;  3WWX A;  4GB7 A;  4WM9 A;  3IBR A;  3T1Q B;  2JKT I;  3H9W A;  1KGG A;  4FCF A;  5J3W A;  3PBT A;  2I9V A;  1I5Q A;  2XF3 A;  1Q2P A;  2Q9N A;  3BY8 A;  3V39 A;  4BBT A;  5HDS A;  2VA0 A;  3BYD A;  1FSW A;  1BTL A;  3MSH A;  1C3B A;  4WUJ A;  1PYY A;  4KG6 A;  4HJ3 A;  2V1Z A;  2QWS A;  4R23 A;  4E3M A;  2JCH A;  1ES5 A;  3R4K A;  2JKR I;  3LR5 A;  2P9V B;  4LGW A;  5CHJ A;  4PPR A;  4R6L A;  4Y7P A;  2W3E A;  5EV0 A;  3G4P A;  4EV4 A;  4ZTK A;  5EVL A;  4UA6 A;  3IX8 A;  5EVI C;  3QP2 A;  4S2J A;  3CWF A;  2ZQ8 A;  4R4R A;  4GDN A;  2XR0 A;  5GLB A;  1XJ3 A;  4CQH A;  2OLU A;  2VV6 A;  4QHC A;  3T1X A;  2ZL1 A;  5MC7 A;  2A2L A;  1T1A A;  3CUE C;  3H82 A;  4QJG A;  3MQ0 A;  1FIK A;  3VFH A;  3F1O B;  3T4L A;  3HLD A;  3UB8 A;  4RX3 A;  3IX3 A;  3OPP A;  3A0S A;  1EW0 A;  1FOF A;  1EWZ A;  2ZMF A;  4RYE A;  2UV0 E;  5E2E A;  5EM1 A;  4G3W A;  4JF6 A;  3NOP C;  1K6R A;  3P98 A;  3UB5 P;  3ZNY A;  2VZW A;  1Z6F A;  1HTZ A;  3WRZ A;  1KE4 A;  1OTI A;  4O0P A;  2PRF A;  2Y4A A;  4S2P A;  3MXS A;  5DJT A;  4OP5 A;  1SKO B;  3M6B A;  1OJG A;  1AXB A;  3BEC A;  5CER A;  4OQH A;  3VOY A;  2XD5 A;  2OWJ A;  1TD5 A;  3IBJ A;  4B4X A;  4QD4 A;  2L0W A;  5TBM A;  4L9E A;  1KGF A;  5HD5 A;  3ZCZ A;  3MZE A;  3HJI A;  3MFX A;  1NYM A;  1ERM A;  5IHV A;  3UPN A;  3G6O A;  2RL3 A;  5EE8 A;  1AWI A;  2V1A A;  2EXA A;  4F3L A;  4S2N C;  3EOI A;  4UA7 A;  2ZD8 A;  1V9Y A;  4C6Y A;  4EBP A;  4GHI A;  1Y54 A;  4QB8 A;  5DF8 A;  4KZA A;  3NCK A;  2BAS A;  1BZA A;  4NEE D;  1XA7 A;  4K0X A;  3ZYT A;  1MWU A;  5DFY A;  3CPT A;  4IVK A;  2M7U A;  5HWT A;  1W63 Q;  2FFF B;  5AQB A;  2H10 A;  5AQ7 A;  5HPI A;  3BW6 A;  4EUZ A;  4R3B A;  3NUL A;  2J9O A;  3QP5 A;  1DP9 A;  2G7U A;  3IHB A;  2WGW B;  4WN5 A;  3GSG A;  1TS8 A;  2B95 A;  1ES2 A;  4M4X A;  3LIC A;  3NHQ A;  2W3G A;  3HJK A;  1K54 A;  4JGO A;  3UE1 A;  4B93 A;  2H28 A;  4OPQ A;  2Y2P A;  3LR3 A;  1PI5 A;  2DRW A;  1FCO A;  3Q1F A;  5CHM A;  5E2H A;  2IA2 A;  3HVF A;  4PMA A;  4BEN A;  4X1M A;  3PBQ A;  4GS9 A;  1BYW A;  4Q0I A;  1STZ A;  3DWZ A;  2ZJ9 A;  1L0F A;  4I3I A;  2L4R A;  4NK3 A;  2VKS A;  5L07 A;  3VSL A;  2J9P A;  2GX5 A;  3CLO A;  1K56 A;  3Q7V B;  4JF4 A;  3HL9 A;  4S2I A;  4NXG A;  1H5X A;  3G32 A;  3MZD A;  2WKH A;  3GTC A;  5EVE A;  2D02 A;  4O7D A;  2VV7 A;  3W4O A;  1OTB A;  2GZA A;  1IYS A;  1S67 L;  2HDU A;  3C7V A;  1FR6 A;  3LY4 A;  1XFQ A;  1V9Z A;  4HQA A;  2Y91 A;  1BUL A;  1OJ5 A;  4GCZ A;  5L09 A;  4P6Z M;  2V1B A;  4LEN A;  4DF6 A;  1IEL A;  3Q07 A;  5FDH A;  2Q9M A;  1G6A A;  3IS2 B;  2JKG A;  4B9O A;  4RX2 A;  1PWC A;  4ZJ3 A;  1P9R A;  3DTK A;  3OPH A;  2ZC3 B;  2VGK A;  3ZVT A;  4YOF A;  5F1G A;  3T4K A;  4ZBE A;  5I94 A;  1NZO A;  3HLC A;  3PHY A;  5EFW A;  1MZU A;  1KOU A;  4EES A;  5EEC A;  5FQK A;  1W79 A;  4DE0 A;  2OSU A;  3EEA A;  5GLC A;  4S2O A;  4N92 A;  1KDW A;  2JN7 A;  5E2G A;  3CI6 A;  1NRJ A;  3GV9 A;  3UE6 A;  4CPK A;  3C2W A;  2Z2L B;  2EXB A;  4EBL A;  5AVF A;  1Y28 A;  5GHY A;  4CLC D;  1FR1 A;  4OH0 A;  3T1R A;  2EX6 A;  2WZX A;  1WYB A;  1PWD A;  1YMS A;  3ZFZ A;  3IWI A;  2VGL S;  2ZMA A;  3LR4 A;  2VX8 A;  4HNB A;  1S1Z A;  3FWL A;  3F1N A;  3IT9 A;  2AVX A;  1OTD A;  1T1C A;  4YFM A;  5F1F A;  4MBF A;  2ZBB A;  3KX0 X;  4I39 A;  4QU3 A;  2V8F A;  5M19 A;  3R7W B;  4OOL A;  4ESP A;  5FEF A;  3QNC A;  4HHD A;  2WKP A;  1XKZ A;  1FSY A;  3PBR A;  1TS7 A;  3VOL A;  2WKI A;  3EGX C;  4Y0T A;  3MMH A;  3DTE A;  4ARZ B;  5F6A A;  1TS6 A;  5FQM A;  3MFD A;  1YSP A;  2Y2N A;  5EPH A;  2V2F F;  3S7N A;  3FYZ A;  1IKG A;  5DFX A;  4X68 A;  3TSG A;  2J8Y A;  4WZ4 A;  3U2A A;  3A0R A;  4B88 A;  4LFU A;  2ZM8 A;  3UPO A;  4DXC A;  1JNU A;  5CGW A;  3D72 A;  2GNX A;  5CHU A;  2G2U A;  3NBL A;  2PBD P;  2Y2K A;  3S4X A;  4LRX C;  3ZDJ A;  3VMA A;  3UDX A;  2ZC6 B;  4Y3I A;  1DP8 A;  2HF6 A;  2ZQD A;  2QPN A;  2XQZ A;  2QZ6 A;  4NXB A;  4LRY C;  1BUE A;  1L0D A;  4WEK A;  4OLG A;  3BEB A;  3NOU C;  1NJ4 A;  4U0X A;  1TEM A;  2HGV A;  5FQJ A;  2W1R A;  4UAA A;  4X69 A;  2PD7 A;  4KZ4 A;  4OP8 A;  3QP4 A;  4HBU A;  2PR6 A;  3KSG A;  3LI9 A;  2ZC4 B;  2OAQ 1;  3QNB A;  5HW3 A;  4BJP A;  1K25 A;  3UDF A;  2HDR A;  3V50 A;  3M6H A;  5F5Y A;  4R0Q A;  1YLY A;  1LI9 A;  1ERO A;  4LV1 A;  3LEQ A;  3K3D A;  3VP4 A;  1G28 A;  3O86 A;  3S1Y A;  2P74 A;  1F5M A;  5CTM A;  2WAE A;  4LRZ E;  1MWS A;  3QP1 A;  2LB9 A;  3MJQ A;  4DJ2 A;  3IF6 B;  1BSG A;  2VEA A;  1LSV A;  4WZ5 A;  2XGN A;  4X6T A;  2NUP C;  4XT2 B;  4LCM A;  2BTF P;  2B02 A;  5EOE A;  4K91 A;  5J8X A;  3OZH A;  4N1X A;  2J3T D;  4CJN A;  1RGY A;  1W8Q A;  5GL9 A;  4EET B;  1NRF A;  3FPW A;  3H7W B;  2M1C A;  2K7S A;  2Y2M A;  1ZKJ A;  4IBR A;  4JXV A;  1ERQ A;  4BD0 A;  4OON A;  2QJ5 A;  2P08 A;  1H0M A;  4PKY A;  1LHY A;  2C5W B;  2V0U A;  5M18 A;  4WLA A;  4Q8I A;  2BG1 A;  3FV7 A;  3ZG0 A;  4MN6 A;  3NDE A;  3BFG A;  2PR5 A;  4BMW A;  2E8I A;  1VQQ A;  3OCN A;  4NET A;  2X02 A;  1VHM A;  4IUK A;  1MC0 A;  4PM8 A;  3HLG A;  1E3U D;  1IKI A;  1OME A;  4ZJ2 A;  1KVM A;  1K4F A;  4DXB A;  4HP4 A;  4OLD A;  4CLC B;  4K08 A;  2XA7 M;  1DJA A;  3IWQ A;  5HL1 A;  3E98 A;  1XGI A;  2ZOI A;  2OLV A;  4FH4 A;  2J7V A;  1F2K A;  4KZB A;  4OPY A;  1ESI A;  5FI6 A;  2OAP 1;  1E25 A;  4PM9 A;  3TJZ C;  2P9V A;  4JGQ A;  2KDK A;  4OOM A;  2O0Y A;  1XA1 A;  2Q0O A;  3GVB A;  2A24 B;  1JVJ A;  2RCX A;  5FAS A;  5IS1 A;  1ACF A;  3B42 A;  4GZB A;  4K0W A;  1E4D A;  1T18 A;  4NKP A;  3C4O A;  4RA7 A;  3AGE A;  1PZO A;  2WKR A;  1VET B;  5HZH A;  2YKH A;  1ALQ A;  2B18 A;  3F1O A;  3LIF A;  4I38 A;  3HLF A;  3S7O A;  2PBY A;  5U47 A;  1CI8 A;  3S22 A;  5KSH A;  5FA7 A;  4XUZ A;  3DTI A;  5K5B A;  4WEJ A;  4JXW A;  2Y55 A;  5F68 A;  1YLT A;  2P7J A;  1TF1 A;  4BD1 A;  3LIE A;  3FZC A;  3DWK A;  3IWO A;  4KUO A;  3TE8 A;  1SDE A;  3CZD A;  3E4O A;  4X1L A;  5E43 A;  3RXW A;  4QY6 A;  3QHY A;  1SKO A;  2NUT C;  5L10 A;  3W4Q A;  3C5A A;  4GKU A;  3GRJ A;  4IED A;  4L0L A;  3A3D A;  2HPB A;  4GW9 A;  5FQI A;  3G2Y A;  3CMZ A;  3VP2 A;  4KZ8 A;  3AGF A;  4JPM A;  1BLH A;  3B33 A;  2V20 A;  2H0T A;  4WZ5 C;  4YNR A;  3MXR A;  4DDS A;  4XXR A;  3P09 A;  5HL6 A;  3ZG7 B;  1D7E A;  4MBK A;  2HP5 A;  2PT7 A;  3V67 A;  3A3E A;  3NEC A;  5A90 A;  1N4O A;  4E3K A;  3T4J A;  1EI5 A;  3EQU A;  3CAX A;  1S6R A;  2V0W A;  1IOU A;  3SW1 A;  1OT6 A;  2CC1 A;  1S4R A;  1K38 A;  3ULF A;  4LPZ A;  3CHW P;  4DMZ A;  3FKV A;  2IWC A;  3KYQ A;  2E8J A;  4R70 A;  3KSI A;  1G68 A;  2O9A A;  4QWO A;  3LYX A;  3RFB A;  3MZF A;  3K3C A;  4IBX A;  2EFX A;  1H3Q A;  2VGJ A;  4Y2F A;  5FSR A;  5HAP A;  2XRO A;  1FCM A;  1UGU A;  2WGW A;  4X25 A;  4DN0 A;  4WMC A;  2CMN A;  4KUK A;  4R3A A;  4EW7 A;  1BLC A;  4KZ3 A;  2ZQC A;  2Y2J A;  3NC8 A;  1HVB A;  4EEU A;  5FL3 A;  1YLP A;  1MPL A;  4OOY A;  3BFE A;  1H8Y A;  4PHT A;  1F9I A;  3K2N A;  1FQG A;  1DJC A;  5KMW A;  4R3J A;  2W1T B;  3G31 A;  3E0Y A;  4EEP A;  3VP0 A;  5TR7 A;  4B4Z A;  3PTE A;  5L2F A;  4QPR A;  2EX2 A;  3S7Q A;  2J3W A;  1VEU B;  5JYP A;  2Y8H A;  1CQA A;  5FAP A;  1ZTU A;  4S2M A;  4MN5 A;  4X55 A;  4U3T A;  3F1P B;  4N9K A;  2XFS A;  4HEF A;  2XDM A;  4FTX A;  4HBT A;  5F82 A;  4NXE A;  2WKE A;  4E3N A;  3HBR A;  3PBS A;  4ETX A;  1S0W A;  1T1B A;  3Q7V A;  1NWZ A;  1E3U A;  1CEG A;  1KE0 A;  2R78 A;  2VLG A;  3G34 A;  4ZJ1 A;  2B5R A;  3A0V A;  1M40 A;  3MQO A;  2Y2L A;  5KIZ A;  3WS4 A;  5G18 A;  5FAT A;  5L8M A;  3C38 A;  3LGO A;  5BOH A;  4FUW A;  3SH8 A;  1P9W A;  3LEZ A;  4ME4 A;  1MKI A;  1DJB A;  4DE3 A;  5HWV A;  2HJ9 C;  3IS2 A;  3QP6 A;  1CEF A;  3FKW A;  3LIB A;  1YAX A;  1TS0 A;  3IF5 A;  1OTE A;  1YKD A;  1H8Z A;  4Q0J A;  3A3J A;  2HJE A;  3ICY A;  3IXH A;  3N8S A;  4L9G A;  4GD8 A;  3G2Z A;  3D4F A;  1KE3 A;  5FQ9 A;  1GHI A;  4EWF A;  3KSH A;  3TW8 A;  4E6W A;  5CEC A;  1ES3 A;  1IFQ A;  3LFV A;  4JXS A;  1XXM A;  4BBV A;  2P04 A;  4KEN B;  3PYP A;  1XJ6 A;  3EWK A;  1JTG A;  4H6J B;  5CRF A;  1SDN A;  3KSF A;  1OPX A;  1SKF A;  3BLM A;  1LSW A;  4OQG A;  4KZ6 A;  2KOI A;  1N9L A;  5TGF A;  3VP3 A;  3BY9 A;  1GA9 A;  3PAE A;  1L2S A;  1CK3 A;  5EVI B;  4E3O A;  1YPR A;  3UNW A;  4E3L A;  1IYO A;  1GCE A;  1XGJ A;  3Q82 A;  5A93 A;  5KSC A;  3MKF A;  4BWI A;  5M1A A;  3PXP A;  3E2K A;  3IXG A;  4UQI S;  5A8B A;  3RJU A;  1IYQ A;  5FI7 A;  1Q2Q A;  1JWV A;  4JLF A;  3R7W A;  4PKY G;  4GNU A;  4WEL A;  1LL5 A;  2XLN A;  5LBR A;  5J4E A;  5A91 A;  1D1J A;  2JKT M;  1BLS A;  3IH9 A;  2JBF A;  3VV4 A;  5F69 A;  1O7E A;  1S66 L;  2XH9 A;  2J3T C;  4ARZ A;  3OPR A;  1LLB A;  3IXB A;  3UE0 A;  3TG9 A;  3NY4 A;  4JKT A;  5HD3 A;  4S2L A;  4HJ6 A;  2KLI A;  3LUQ A;  3OOV A;  1DP6 A;  4BL2 A;  3ZQ5 A;  4HY8 A;  4HJ4 A;  5KZH A;  3EEH A;  1ONH A;  4ETZ A;  2JKR M;  3L9K A;  1XX2 A;  3HLW A;  5DVA A;  3ZHH A;  1ESU A;  3EGD C;  4N1H A;  4BL3 A;  4DKI A;  1TVF A;  2ZQ9 A;  2FZ0 A;  4G3V A;  4OPR A;  3SH7 A;  2VK3 A;  4RVA A;  3NOT C;  4FH2 A;  4ZDX A;  3T12 B;  2W3F A;  1PW8 A;  2DCF A;  3TOI A;  2UWX A;  3FPV A;  5HAI A;  2VJW A;  3MBZ A;  3IX4 A;  4R1G A;  2Y2G A;  3N6I A;  4II7 A;  3SOI A;  1PI4 A;  2WZZ A;  1NLZ A;  4PM7 A;  1XP4 A;  2ZQA A;  5FQQ A;  4BLM A;  1FCN A;  4GLQ A;  4LCL A;  5FAQ A;  4O8G A;  2JE5 A;  3SS3 A;  3ZGA B;  1N9N A;  4WL9 A;  1W8Y A;  5HAR A;  3SH9 A;  4E04 A;  1Y4O A;  1T19 A;  4MN7 A;  2Y59 A;  1K4E A;  1DY6 A;  2Y2H A;  3WS5 A;  1WE4 A;  4LV2 A;  4A5R A;  1MBL A;  5HWW A;  1H8M A;  3S7P A;  4I3J A;  4DDY A;  1K57 A;  4C75 A;  2Z6D A;  3O87 A;  5GLA A;  2Z2M B;  4P0M A;  4P6Z S;  4FOF A;  2WUQ A;  3SS5 A;  4N9L A;  2K31 A;  4O01 A;  1X0O A;  4R4S A;  4HH3 A;  1LL9 A;  3IF6 A;  1RCJ A;  4Z9Q A;  2WAD A;  4UEY A;  4EQI A;  3BQ8 A;  3DBA A;  3MS6 A;  3Q81 A;  5DKK A;  2QJ7 A;  3HCY A;  4XT2 A;  3W2Z A;  1K56 D;  2XSS A;  4KQO A;  1PW1 A;  3T4Q A;  4KQD A;  5HX9 A;  1N9B A;  5D3O A;  4PAU A;  1J9M A;  2MJ6 A;  2R9X A;  5I5L A;  3ZVW A;  3JYI A;  3H7W A;  3C4P A;  5G4Y A;  4Y13 A;  1I2W A;  5DTT A;  1O07 A;  5IT5 A;  2IWB A;  1G5U A;  4MLL A;  5E2F A;  4UHU A;  1L0G A;  2HZ5 A;  5AVE A;  2ZL1 B;  5DJU A;  2EFU A;  3N8L A;  1U60 A;  2Y2Q A;  2R9W A;  1P0Z A;  3E4P A;  3C8C A;  3GR2 A;  3H82 B;  4DE1 A;  4HI4 A;  1Z09 A;  5AJG A;  2KX6 A;  2GDN A;  3DW0 A;  3LCE A;  4E3I A;  3LR0 A;  2W0N A;  2ZMV A;  2INW A;  4BQM A;  2PAV P;  3C30 A;  4CLC A;  2DNS A;  1LI0 A;  4DE2 A;  1YLZ A;  3AGD A;  1G6O A;  2JKF A;  5TFQ A;  4NG2 A;  4KG2 A;  1PFL A;  3P01 A;  3Q7Z A;  3UY6 A;  1NXY A;  4Q0H A;  3BQA A;  1GSV A;  3ISG A;  4MNR A;  1ZG4 A;  4D2O A;  3B3X A;  4OQ0 A;  3KO6 A;  4MEZ A;  4UA9 A;  5DF7 A;  4IJG A;  4KQQ A;  3VOZ A;  4MDZ A;  2OV5 A;  2A24 A;  1YMX A;  5TBM B;  1SCW A;  1ES4 A;  2QKP A;  2HV1 A;  4G3K A;  4WYY A;  4IVI A;  1ZHH B;  3OBF A;  4Y15 A;  3UPP A;  1GSX A;  4D60 A;  3BFF A;  2J80 A;  5F83 A;  4OQI A;  2Y79 A;  3WRT A;  1VET A;  5HSQ A;  3WS2 A;  4HOI A;  1MWT A;  5GHX A;  3NDG A;  1GHP A;  1XPB A;  2ZLY A;  3RXX A;  2QYB A;  1NZU A;  3O88 A;  3PBN A;  2PHY A;  1ZC2 A;  5CGX A;  4F3L B;  1NY0 A;  2VGL M;  4GHI B;  3LID A;  2WGI A;  1GHM A;  1S4S A;  2LB5 A;  3M2K A;  1UWN X;  2FFY A;  2YKF A;  1PRQ A;  5CED A;  3CPT B;  3LI8 A;  3JPU A;  4KG5 A;  5FDS A;  1ZG6 A;  3WS0 A;  5EVI D;  1K57 C;  1NYY A;  1MKM A;  5JYO A;  1BT5 A;  2WK0 A;  2V8C A;  5C5K A;  1YLJ A;  4GJ4 A;  1YM1 A;  3NI9 A;  1N9O A;  2H0Y A;  2ZQ7 A;  4IUH A;  4UQI M;  4CLC E;  2WAF A;  3IF6 C;  2OWH A;  2XFT A;  4R38 A;  2HP9 A;  3JVV A;  3VE4 A;  1W63 M;  2WKQ A;  1OT9 A;  2VV8 A;  4I3A A;  1SZV A;  2Z6C A;  3BLS A;  3VP1 A;  4IHQ A;  5FEG A;  3LIA A;  2L1M A;  5DTS A;  5FI2 A;  2BLS A;  3ZG8 B;  3E4Q A;  5IU1 A;  3MKE A;  1K0K A;  1P97 A;  4YWZ A;  1XJ2 A;  3I7J A;  1QME A;  2O9B A;  4GS9 B;  3U4L P;  1W5D A;  1W7F A;  1DRM A;  1LL8 A;  3GQZ A;  3HUN A;  4Y17 A;  2HDS A;  4HP9 A;  1YSQ A;  1XFN A;  2EX9 A;  3PAG A;  3OLO A;  4EER A;  3PBO A;  4P87 A;  2XK1 A;  4RQ9 A;  1A0K A;  3OPL A;  3T4O A;  4I5S A;  4CLC C;  3HLE A;  2EWV A;  4AFI A;  5CGS A;  2X01 A;  5TJJ A;  4S2K A;  3A3F A;  4ZRR A;  3G30 A;  2JHE A;  5EUA A;  5AQ9 A;  5AQA A;  3N7W A;  4EUV A;  3LY3 A;  1JWP A;  4EBN A;  2C6W B;  4X56 A;  4DRT A;  3ZG5 A;  3GEC A;  5HPF A;  3IXD A;  1WA9 A;  2XA7 S;  3N8R A;  4OVD A;  4X53 A;  3DTM A;  3CIT A;  2W1T A;  4LV0 A;  1TDL A;  2PYP A;  3L7H A;  4DJ3 A;  1F98 A;  3MQQ A;  1VEU A;  5GLD A;  4Y5F A;  3VSK A;  3OC2 A;  3RH8 B;  1K55 A;  2ZM2 A;  4MMN A;  3OCL A;  4PM5 A;  1KDS A;  1MY8 A;  2WGV A;  4EU0 A;  4F94 A;  2WYX A;  3F1P A;  4Y0O A;  2DMW A;  3LO7 A;  2EA9 A;  4JXG A;  3MXQ A;  3FC7 A;  1D06 A;  5DF9 A;  3KYE A;  2X71 A;  1OTA A;  3ZG9 B;  3UMD A;  2XEP A;  1RP5 A;  2D01 A;  1CI9 A;  4WF0 A;  2G2W A;  3BFC A;  3VFF A;  4HIA A;  3MF0 A;  1M6K A;  1FIL A;  3UB9 A;  1GSW A;  3UE3 A;  1TDG A;  1L0E A;  4WBG A;  4GN2 A;  1MWR A;  1K6S A;  5EM0 A;  2ZC5 B;  4C3Q A;  2W3H A;  3KYZ A;  5FAO A;  2HDQ A;  3F1N B;  5DKL A;  5CX7 A;  1CJF A;  3T1S A;  4XUX A;  5EOO A;  3B47 A;  3MR0 A;  3BWL A;  2PU2 A;  1QMF A;  3HUM A;  4KQR A;  4KZ5 A;  2ZOH A;  3BM6 A;  2ZM0 A;  4JBF A;  2XD1 A;  1CF0 A;  1WYC A;  3A3I A;  3C7U A;  4M3K A;  4ZAM A;  5CXW A;  5DTK A;  3UB7 A;  2Y2O A;  2V9A A;  1LSX A;  3HRE A;  3D9Y A;  2QHK A;  3VE3 A;  2H5S A; 
#chains in the Genus database with same CATH homology
 2Z6D A;  5K5B A;  4WEJ A;  2W3D A;  3T50 A;  1LT0 A;  2FH5 A;  4P6Z S;  5F68 A;  2P7J A;  2O9C A;  1TF1 A;  4FOF A;  2GX5 A;  4H6J A;  3LIE A;  3CLO A;  2K31 A;  4O01 A;  1X0O A;  4KUO A;  3TRC A;  4HH3 A;  4NXG A;  3TE8 A;  3E4O A;  4L9F A;  4UEY A;  3BQ8 A;  3DBA A;  2NUT C;  2D02 A;  5DKK A;  2VV7 A;  2QJ7 A;  3GDI A;  3HCY A;  1OTB A;  4XT2 A;  3W2Z A;  2GZA A;  1VB6 A;  2XSS A;  1S67 L;  4MCW A;  4KQO A;  4L0L A;  1XJ4 A;  3T4Q A;  4KQD A;  1XFQ A;  3UB6 A;  4GW9 A;  1V9Z A;  4HQA A;  4PAU A;  2PDR A;  3BJN A;  4EXO A;  4NXF A;  2MJ6 A;  1OJ5 A;  1S1Y A;  4GCZ A;  3B33 A;  4P6Z M;  5I5L A;  2V1B A;  3CUE A;  4YNR A;  3H7W A;  5G4Y A;  3IS2 B;  5HL6 A;  1D7E A;  3D3O A;  5IT5 A;  2PT7 A;  4B9O A;  3T4T A;  3V67 A;  1P9R A;  2PD8 A;  3T4J A;  5AVE A;  4YOF A;  5DJU A;  2PYR A;  3T4K A;  2OOL A;  1P0Z A;  3EQU A;  5J7E A;  3PHY A;  3E4P A;  3C8C A;  3JVU A;  3CAX A;  5EFW A;  1MZU A;  2V0W A;  3H82 B;  1KOU A;  4HI4 A;  1NLY A;  4EES A;  1IOU A;  3SW1 A;  1OT6 A;  2XRN A;  5HDC A;  1S4R A;  5AJG A;  2KX6 A;  3ULF A;  4LPZ A;  4DMZ A;  3LR0 A;  2W0N A;  3KYQ A;  2ZMV A;  3EEA A;  4R70 A;  3KSI A;  3UME A;  3P7N A;  2INW A;  3C30 A;  4JGR A;  2JN7 A;  2O9A A;  4CLC A;  3LYX A;  4Z1W A;  1G6O A;  3RFB A;  3RTY A;  3CI6 A;  1NRJ A;  3UE6 A;  3K3C A;  3O5Y A;  3P01 A;  4EQ1 A;  3C2W A;  2EWW A;  1H3Q A;  5G4Z A;  2W27 A;  3FG8 A;  1ODV A;  4Q0H A;  4Y2F A;  3BQA A;  1Y28 A;  5AVF A;  1GSV A;  4CLC D;  4LLO B;  2XRO A;  4JGP A;  1UGU A;  5HDD A;  3KO6 A;  4DN0 A;  3NJA A;  2CMN A;  2VGL S;  4IJG A;  4KUK A;  4BBU A;  4R3A A;  4MDZ A;  4HH2 A;  3LR4 A;  4EW7 A;  2A24 A;  2VX8 A;  4FSF A;  1S1Z A;  4HNB A;  5TBM B;  3F1N A;  4EEU A;  5FL3 A;  2GJ3 A;  2QKP A;  2HV1 A;  4G3K A;  1OTD A;  1T1C A;  1ZHH B;  3OBF A;  4PHT A;  1GSX A;  2ZBB A;  3KX0 X;  3T4S A;  2J80 A;  4I39 A;  2K2N A;  3R7W B;  1F9I A;  3PR6 A;  4OOL A;  2Y79 A;  3K2N A;  5HSQ A;  1UWP X;  2M7V A;  4HOI A;  2W1T B;  4HHD A;  2WKP A;  3E0Y A;  4EEP A;  2QYB A;  3PBR A;  1TS7 A;  3VOL A;  4QPR A;  3PBN A;  2PHY A;  3EGX C;  3S7Q A;  2J3W A;  4F3L B;  2VGL M;  3MMH A;  4GHI B;  3LID A;  4ARZ B;  2O99 A;  5F6A A;  1TS6 A;  2Y8H A;  3EQV A;  1ZTU A;  1S4S A;  2LB5 A;  4MN5 A;  1UWN X;  3F1P B;  3IBR A;  1YSP A;  2JKT I;  2YKF A;  3H9W A;  5J3W A;  3S7N A;  4NXE A;  3PBT A;  2I9V A;  3PBS A;  4ETX A;  3BY8 A;  4BBT A;  1T1B A;  3LI8 A;  5HDS A;  5DFX A;  1NWZ A;  2VA0 A;  2R78 A;  2VLG A;  3U2A A;  3A0R A;  1MKM A;  3A0V A;  1JNU A;  5C5K A;  4WUJ A;  4GJ4 A;  3D72 A;  2GNX A;  4HJ3 A;  1N9O A;  3MQO A;  2QWS A;  5KIZ A;  4IUH A;  4LRX C;  3R4K A;  4UQI M;  4CLC E;  2JKR I;  3LR5 A;  5L8M A;  3C38 A;  4R6L A;  1DP8 A;  4Y3I A;  2OWH A;  4R38 A;  2HF6 A;  2W3E A;  3JVV A;  3VE4 A;  4NXB A;  1P9W A;  1W63 M;  2WKQ A;  1OT9 A;  4LRY C;  4ME4 A;  2VV8 A;  4I3A A;  4WEK A;  2Z6C A;  3NOU C;  5HWV A;  2HJ9 C;  3IS2 A;  3CWF A;  3LIB A;  1YAX A;  4IHQ A;  1TS0 A;  3LIA A;  1XJ3 A;  1OTE A;  1YKD A;  2L1M A;  2HGV A;  4CQH A;  4Q0J A;  2VV6 A;  3E4Q A;  2HJE A;  3ICY A;  2W1R A;  4L9G A;  5IU1 A;  5MC7 A;  2A2L A;  1P97 A;  1T1A A;  3CUE C;  4YWZ A;  2PD7 A;  1XJ2 A;  3H82 A;  2O9B A;  3MQ0 A;  3F1O B;  2PR6 A;  3KSG A;  3LI9 A;  3T4L A;  4GS9 B;  2OAQ 1;  1DRM A;  3KSH A;  3UB8 A;  1LL8 A;  4BJP A;  3TW8 A;  3A0S A;  1IFQ A;  3LFV A;  5F5Y A;  1EW0 A;  4HP9 A;  1YSQ A;  4BBV A;  1XFN A;  2ZMF A;  2P04 A;  3K3D A;  3PYP A;  1G28 A;  1XJ6 A;  3OLO A;  3EWK A;  4EER A;  4H6J B;  3KSF A;  4G3W A;  3NOP C;  1F5M A;  3PBO A;  1OPX A;  4RQ9 A;  2VZW A;  1LSW A;  4LRZ E;  3T4O A;  4I5S A;  2LB9 A;  3MJQ A;  2KOI A;  4DJ2 A;  4CLC C;  1N9L A;  1OTI A;  4O0P A;  2VEA A;  2EWV A;  3BY9 A;  5DJT A;  1LSV A;  1OJG A;  4AFI A;  5TJJ A;  2NUP C;  4XT2 B;  4ZRR A;  2OWJ A;  2B02 A;  1TD5 A;  3IBJ A;  2JHE A;  2J3T D;  2L0W A;  5TBM A;  4L9E A;  4BWI A;  4EUV A;  3PXP A;  4UQI S;  5A8B A;  5HD5 A;  3HJI A;  4EET B;  3FPW A;  3H7W B;  2M1C A;  2K7S A;  3R7W A;  3GEC A;  4PKY G;  3MFX A;  4WEL A;  5HPF A;  1WA9 A;  2XA7 S;  5LBR A;  3G6O A;  5J4E A;  2QJ5 A;  2P08 A;  2JKT M;  3CIT A;  2W1T A;  4PKY A;  2V1A A;  2PYP A;  4DJ3 A;  2V0U A;  3VV4 A;  5F69 A;  4WLA A;  1F98 A;  3MQQ A;  4MN6 A;  4F3L A;  1S66 L;  2PR5 A;  3EOI A;  4Y5F A;  3OC2 A;  1V9Y A;  3RH8 B;  4BMW A;  4GHI A;  2J3T C;  4ARZ A;  4MMN A;  3OCN A;  3OCL A;  1VHM A;  4IUK A;  4EU0 A;  1MC0 A;  5HD3 A;  3F1P A;  2BAS A;  4HJ6 A;  2DMW A;  2KLI A;  3LUQ A;  2EA9 A;  3OOV A;  1DP6 A;  4NEE D;  3ZYT A;  3MXQ A;  5DFY A;  3FC7 A;  1D06 A;  4HJ4 A;  4HY8 A;  3ZQ5 A;  4HP4 A;  3EEH A;  5DF9 A;  4CLC B;  4K08 A;  4ETZ A;  2JKR M;  2XA7 M;  1OTA A;  2M7U A;  5HWT A;  3UMD A;  1W63 Q;  2D01 A;  3E98 A;  4WF0 A;  3EGD C;  5HPI A;  2ZOI A;  4HIA A;  3MF0 A;  2FZ0 A;  3BW6 A;  4G3V A;  3UB9 A;  1GSW A;  3UE3 A;  1DP9 A;  3NOT C;  2G7U A;  4WN5 A;  1TS8 A;  2OAP 1;  2W3F A;  4M4X A;  3TJZ C;  3FPV A;  3LIC A;  3NHQ A;  4JGQ A;  2KDK A;  4OOM A;  2O0Y A;  2VJW A;  2W3G A;  3HJK A;  2A24 B;  2W3H A;  3KYZ A;  4II7 A;  4JGO A;  5IS1 A;  3F1N B;  4B93 A;  1NLZ A;  5DKL A;  5CX7 A;  3B42 A;  2H28 A;  4GLQ A;  3LR3 A;  4O8G A;  3B47 A;  1N9N A;  1T18 A;  4NKP A;  4WL9 A;  3MR0 A;  3BWL A;  4E04 A;  2WKR A;  2IA2 A;  1T19 A;  4MN7 A;  2ZOH A;  5HZH A;  2YKH A;  2B18 A;  3PBQ A;  3F1O A;  3LIF A;  4I38 A;  3UB7 A;  3S7O A;  5HWW A;  1H8M A;  4GS9 A;  1BYW A;  4Q0I A;  3S7P A;  4I3J A;  1STZ A;  5KSH A;  2V9A A;  1LSX A;  4I3I A;  2L4R A;  2VKS A;  2QHK A;  3VE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...