4HJ4A

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
177
structure length
177
Chain Sequence
AMDQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords LOV protein
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 56
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hj4A00
1GSVA 2VEAA 3MJQA 5HZHA 4XT2B 3UMDA 1DRMA 3PHYA 1N9LA 2PD8A 4JGQA 2OOLA 1DP9A 3LIFA 3UB6A 3E4QA 5IS1A 1GSXA 1OT6A 4EEPA 4I3JA 2YKFA 2H28A 2HV1A 4RQ9A 4F3LA 4HI4A 2VV8A 5J7EA 3A0SA 4LLOB 4GS9B 1X0OA 1LL8A 4WN5A 1LT0A 4NXBA 4I38A 4GS9A 4HY8A 3K3DA 4HH2A 1OTAA 4I3IA 1S1YA 5KIZA 1T1AA 4YWZA 4DJ3A 4HQAA 1OTIA 4MN5A 3E4OA 4BBVA 2QHKA 5IU1A 3H7WB 2OWJA 3BY9A 2Z6DA 2KDKA 3HJIA 4LRZE 2VV6A 3K3CA 3F1NB 1OT9A 2J80A 3H7WA 4WF0A 5F69A 3IS2B 4I5SA 1S67L 4EQ1A 2WKRA 4R70A 3H82B 5HDSA 5F5YA 4R38A 2KX6A 3CLOA 3C8CA 4NXGA 3IS2A 5F6AA 4HIAA 3ULFA 3H82A 4I3AA 1TS7A 2D02A 4EESA 4HHDA 2V1BA 3GECA 3RTYA 4GCZA 1T1BA 4LPZA 3T50A 1OJGA 4EW7A 2JN7A 4L9FA 5J3WA 4WL9A 5HWVA 1TS8A 4LRYC 2K7SA 5DKKA 2Z6CA 4JGPA 4HH3A 4HJ4A 4EEUA 3KX0X 1T1CA 2QKPA 3LYXA 1NWZA 4F3LB 2P7JA 2I9VA 2V0UA 4L9EA 5HWTA 3UB9A 3FG8A 3MR0A 4PKYA 1TS6A 5DJUA 2PYRA 3BY8A 3LIEA 2PR5A 2PR6A 3D72A 3B33A 3MQQA 2BASA 4PKYG 1XJ6A 1S66L 3UE6A 5F68A 4MN6A 4K08A 3MFXA 3UB7A 3EWKA 4HNBA 2PD7A 2QJ5A 4DJ2A 1VB6A 2EA9A 4GW9A 1JNUA 1F98A 3MQOA 2ZOHA 1V9ZA 3HJKA 5DKLA 1Y28A 2D01A 3SW1A 3UMEA 1N9NA 3CWFA 2YKHA 2W27A 1EW0A 5HWWA 1ODVA 2QWSA 3G6OA 5G4ZA 1DP8A 1XJ2A 4M4XA 1T18A 1XJ3A 1D7EA 1UWPX 5TBMB 3NOTC 3E4PA 3LICA 2PDRA 1GSWA 1S1ZA 2OWHA 2VLGA 5HDDA 4GHIA 3A0VA 3MXQA 5TBMA 1LSWA 2PHYA 1T19A 3LI9A 3UB8A 1XFNA 3F1OB 3CAXA 1LSVA 1G28A 3PYPA 5HD3A 5J4EA 2L4RA 1OTBA 4EXOA 4JGRA 3F1OA 3VE4A 4B9OA 3BWLA 5HSQA 1WA9A 4HJ6A 4BBUA 5G4YA 5HD5A 3ZQ5A 3P7NA 4XT2A 4JGOA 1S4SA 4KQDA 4KUOA 1MZUA 4HOIA 5AVEA 2L1MA 1TS0A 4EETB 2ZBBA 1S4RA 2ZOIA 1DP6A 2L0WA 4EERA 1F9IA 3VE3A 3NOPC 4KUKA 3GDIA 1D06A 2B02A 3H9WA 1V9YA 4L9GA 4NXEA 1LSXA 2CMNA 1KOUA 1N9OA 3NOUC 3LIBA 4HP9A 2JHEA 1P0ZA 1UGUA 3OLOA 3NJAA 3EEHA 2W0NA 2VV7A 3VOLA 2V1AA 4WUJA 2R78A 2V9AA 1P97A 3LIDA 4R6LA 1XFQA 1XJ4A 1OTEA 4E04A 5I5LA 4BBTA 4HJ3A 5EFWA 3RH8B 2PYPA 2M1CA 2WKQA 2A24B 3LI8A 4WLAA 4H6JB 3IBRA 5HDCA 3ICYA 3LIAA 3FC7A 4HP4A 4GHIB 4LRXC 2QJ7A 3A0RA 3F1PB 1OTDA 5DJTA 4I39A 2A24A 4H6JA 3F1NA 3NHQA 5A8BA 2INWA 3LUQA 1BYWA 1OJ5A 4NXFA 3F1PA 4R3AA 2V0WA 3C2WA 2GJ3A 5AVFA 1UWNX 2WKPA
chains in the Genus database with same CATH superfamily
3TE8A 5E2FA 4OP5A 5TR7A 3C38A 4KZ9A 3EEAA 3GRJA 4Y17A 1PIOA 4PMAA 5HPIA 5K5BA 2ZQAA 4FH2A 1FIKA 1PZOA 3PHYA 3EQVA 4PAUA 2GNXA 4KG2A 1EROA 1DP9A 3LIFA 4JLFA 2GZAA 5IS1A 5KSCA 5HX9A 1ZG4A 4EEPA 3GV9A 1HLUP 4S2PA 2VV8A 2Y2OA 3IH9A 2Y8HA 4LLOB 4GS9B 1PNEA 1FSYA 4L0LA 1LT0A 5FQQA 4IBRA 2VGLS 4F94A 1NY0A 1IKIA 4ZTKA 4GS9A 4HY8A 5FI6A 3DBAA 1OMEA 4O7DA 5FAOA 5HL1A 5KSHA 2CC1A 2FZ0A 5KIZA 5IT5A 2V20A 4X68A 3OPPA 3DTEA 4DF6A 4FUWA 4MN5A 3FPVA 4OONA 3CUEC 4GDBA 5G18A 1S6RA 3GR2A 4B4XA 4EQIA 2GX5A 4D2OA 2ZMVA 3IWOA 3BYDA 4IUKA 4UAAA 2EFXA 3V5MA 4MMNA 1CK3A 1OPXA 3MKEA 3JPUA 2J80A 3IXBA 1LL9A 3ITAA 4R70A 2Y2JA 5HDSA 1YSQA 3A3DA 3ZVWA 3CLOA 2G7UA 3C8CA 3MKFA 4HIAA 1KGGA 3ULFA 1DJBA 3M6HA 2XA7M 5FDSA 4HHDA 1TVFA 2V1BA 3GECA 1RCJA 4X1MA 2Q9NA 1IYQA 3CMZA 4LPZA 1WYBA 3T50A 2JN7A 4II7A 4WL9A 5HWVA 4LRYC 2K7SA 4IJGA 2Z6CA 3T1QB 3CI6A 1MWRA 3CITA 4HJ4A 4EEUA 3RXWA 4LV2A 1LL5A 3UDFA 1NWZA 1WYCA 3DTIA 3UE3A 1BSGA 3N8SA 2XK1A 1A0KA 3TJZC 1KE3A 4ME4A 4GLQA 3OPLA 3A3JA 2H0TA 1CI9A 3HUMA 3C4OA 4DXBA 2G2WA 3IBJA 3IF6C 1AXBA 3G2YA 1Q2PA 3B33A 3MQQA 4PKYG 3V50A 3ZVTA 3LO7A 1S66L 3GQZA 4UHUA 4OOMA 4X56A 5F68A 4MN6A 1BLHA 5JYOA 3IF5A 3BQ8A 4HNBA 4EBPA 4DJ2A 2RCXA 2P74A 5TJJA 1D1JA 2WUQA 2EA9A 3PR6A 4G3WA 4HBUA 1SZVA 4X1LA 4MDZA 1SCWA 3MBZA 4JXGA 3T4SA 2Y2PA 4LENA 2ZOHA 2ZM2A 1CEGA 1RP5A 1Y28A 2Z2MB 3SW1A 3NIAA 1K38A 4IEDA 3S4XA 2GDNA 3QP1A 1EW0A 5F1FA 5HWWA 1ALQA 1ODVA 3ZNTA 3KSIA 3T4JA 4S2NC 2ZC4B 4NKPA 1FCMA 2OSUA 2PRFA 3VSKA 3BFFA 1XJ2A 4M4XA 5TGFA 1XJ3A 1UWPX 4HBTA 1XP4A 1ERQA 4GNUA 2JCHA 2ZC3B 4K0WA 5FQ9A 4G3KA 4GHIA 3A0VA 3BFCA 1I5QA 3MXQA 3BM6A 2PHYA 1SDEA 3BLMA 1QMEA 3IWQA 2C6WB 2PU2A 3MZDA 1I2SA 1XFNA 4E3NA 1LI0A 1G28A 1H8ZA 1RGYA 1OTBA 2A3UA 1ZKJA 2WYXA 2VKSA 4Z9QA 1MWSA 1YLZA 4IVIA 3C4PA 1E25A 5G4YA 3FV7A 1Q2QA 2H5SA 3GVBA 5FDHA 4XT2A 3Q1FA 4KG5A 3IX4A 3WWXA 3VFHA 3P98A 4N9LA 3L7HA 1BTLA 4KUOA 4GJ4A 1F2KA 5GHYA 1NRJA 2O9BA 1ESUA 3FKWA 2UV0E 1Z09A 4EETB 2ZBBA 5KZHA 2J8YA 4JXVA 1DP6A 1W7FA 2L0WA 2RL3A 2X01A 4OQIA 2XGNA 4CLCE 4JF5A 3IX8A 1SKOB 2ZMFA 3HVFA 2B18A 3VP3A 2PAVP 4R4SA 1N9BA 2HZ5A 3CHWP 4MBHA 5FEGA 2IWBA 1MPLA 2W0NA 2QYBA 2V9AA 2P08A 4MLLA 3N6IA 5GL9A 1XFQA 2VK3A 5CHJA 4N92A 2W1TB 5EFWA 4EUVA 2PYPA 2WKQA 5LBRA 2P9VA 3LI8A 2R9WA 4R3BA 3T1RA 2W1TA 2I72A 4HP4A 2XEPA 2Y2NA 2QJ7A 3T4LA 3F1PB 4Y15A 3HCYA 5DJTA 1NYYA 1H8MA 3RXXA 3F1NA 5A8BA 2INWA 3NDGA 5CTMA 4N1XA 3LUQA 1OJ5A 4NXFA 3F1PA 1UWNX 2WKPA 3MXRA 5EPHA 4GZBA 4CLCB 1H3QA 1VHMA 3FYZA 5GHXA 1NLZA 3DW0A 5HZHA 4E6XA 4AFIA 1G68A 2JKGA 5A91A 3MS6A 3CG5A 2OAP1 4Y0UA 5FEFA 1N9LA 3A3FA 1JWZA 4JGQA 4LV3A 4DKIA 2OOLA 4UA9A 4Y2FA 3E4QA 4OOLA 1GSXA 5HPFA 1GCEA 1MKMA 4I3JA 2P04A 2ZC7A 1K57C 4XUZA 2HV1A 4RQ9A 5EM0A 1EI5A 4DDYA 3WS5A 2J3TD 4HI4A 2WGVA 5F1GA 2VGLM 3A0SA 4O01A 1IYSA 5DF8A 2O0YA 3G30A 3SZTA 1K54C 4WN5A 2WADA 4N9KA 5DFXA 4NXBA 1XKZA 1ES4A 1ZHHB 3HUOA 3K3DA 4HH2A 4BD0A 3V3SA 3A3IA 5EVIB 4S2KA 3G2ZA 1KGEA 3FZCA 1PYYA 4OPQA 3T4OA 1YLTA 3HLDA 3TRCA 5CEDA 1CF0A 4P87A 5HFOA 5EVLA 2QZ6A 1E3UA 4UA6A 4DXCA 3HJIA 3UO9A 2VV6A 1ACFA 3V39A 1O7EA 5KMWA 3E2KA 1OT9A 4KENB 3VP0A 5EOOA 4EQ1A 3H82B 2ZLYA 2J3TC 3QP8A 4C75A 5FASA 5F5YA 3NBLA 4Q0JA 3G35A 3QNCA 2ZM0A 4NXGA 4BJPA 4UQIM 3H82A 2Y2QA 4OOYA 1TD5A 3IQAA 4EESA 5CTNA 1K56A 4GD8A 2V1ZA 2Z2LB 1P9WA 5DTSA 1T1BA 1OJGA 4GKUA 4A5RA 3OCNA 4S2LA 5DKKA 3N7WA 4JGPA 4HH3A 3KX0X 1AWIA 3E98A 1T1CA 2QKPA 4EV4A 2ZC5B 3Q81A 1TEMA 4MBKA 2P7JA 2I9VA 2V0UA 2HJ9C 2WZXA 2ZQ7A 5AQBA 5HAIA 4KZ3A 3UB9A 3DWKA 3HUNA 4HEFA 1KVLA 5FQKA 4MBFA 4X53A 5FSRA 4OLGA 1TS6A 1IELA 2PR5A 4ZDXA 2A2LA 3UDIA 4S2JA 3D72A 1NXYA 1YSPA 3LY3A 4IUHA 4XUXA 2K31A 2V2FF 3BQAA 4P6ZM 4NK3A 4WMCD 1STZA 3CUEA 1VB6A 3EQUA 2HGVA 2EX8A 3LR4A 2AVXA 2Y2HA 4DE1A 5JYPA 5EVEA 3T12B 1F98A 3C30A 4QY6A 1GHPA 3JVUA 4X55A 3T4QA 2XQZA 5DKLA 4E3MA 4QJGA 2D01A 1XA7A 5M18A 4BL3A 3DTKA 2JKTI 3MSHA 3G6OA 3WS1A 3IT9A 4JF4A 1F5MA 2XD1A 2UWXA 4M3KA 5MC7A 1GA0A 3LFVA 2HPBA 2Y55A 2VGKA 1BLPA 3M2JA 1K6RA 1YLYA 2HDSA 1YLWA 5E2GA 2PDRA 1GSWA 2OWHA 3DWZA 3AGDA 3FPWA 4PM6A 2Y2LA 1T19A 1KE0A 1L2SA 3ZCZA 1PW1A 3LI9A 3BECA 3CAXA 1CEFA 3IF6B 2KOIA 3KYZA 3BFDA 5J8XA 4X6TA 4ID4A 2L4RA 4EXOA 5A92A 4B9OA 3BWLA 5HSQA 1S0WA 4HJ6A 1KDSA 3IF6A 3TG9A 4R23A 4BD1A 3ZQ5A 3P7NA 4WEKA 4LV1A 5TFQA 3QHYA 3MXSA 3OBFA 2DNSA 4HOIA 3SOIA 4PM5A 3HREA 5CHUA 1ES2A 4RVAA 5FAPA 5DF7A 5L8MA 5CEBA 3GDIA 3ISGA 3SS3A 1LHYA 3DAVA 3W4QA 2H0YA 3G31A 4KZAA 2V8FA 3EGXC 1LSXA 2VZWA 1N9OA 3NOUC 3LIBA 4LCMA 5FQMA 3E0YA 3NDEA 1GHIA 2XFTA 2JHEA 3OLOA 2A49A 1VM1A 4O8GA 1P97A 2WKEA 4S2NA 1G5UA 4Y13A 1PRQA 1L0FA 3G4PA 5CECA 4DE2A 4YNRA 3RH8B 1RGZA 5AJGA 3W4OA 3PAEA 4BL2A 4GHIB 1PI4A 3A0RA 1BT5A 4ZJ1A 4I39A 3OC2A 4XXRA 1DY6A 1ES3A 5C5KA 4FD8A 4FTXA 2WGIA 2HF6A 2Y2MA 2QPNA 1BZAA 4OPRA 1SHVA 1H8YA 2XA7S 1XGJA 4XT2B 3UB5P 3PBRA 4Y3IA 3UMDA 1DRMA 2HP6A 1PFLA 1TDLA 2EX2A 2PT7A 1K4FA 2XFSA 4OQGA 5BOHA 2W1RA 3BW6A 4Y0OA 3LCEA 3S7QA 4WZ5C 1Y4OA 4IVKA 1OT6A 1IOUA 1NRFA 3IHBA 2ZJ9A 3BJNA 3ZYTA 2H28A 2X02A 4F3LA 3DTMA 3R4KA 1W8YA 2WAEA 2ZQ9A 1K55C 5J7EA 2ZQCA 1L0GA 1QMFA 3QP5A 1YMXA 3VV4A 4IBXA 1X0OA 4YFMA 4LFUA 3W4PA 1VQQA 5CX7A 4I38A 5GLAA 3KSFA 2DMWA 1L0DA 5FI7A 1S1YA 4KZ7A 2P9VB 4HQAA 1OTIA 2W3FA 1O07A 4BQMA 1HVBA 3PBTA 3QP4A 4BBVA 1ERMA 1HTZA 5GLBA 2QHKA 2K2NA 3H7WB 4D60A 3JYIA 3VP1A 2OWJA 4PHTA 4ZAMA 2KDKA 4LRZE 2FFYA 4WM9A 2WGWB 3K3CA 1BLSA 3SH9A 3F1NB 2HDUA 4Z1WA 3H7WA 2B5RA 4WF0A 3IS2B 2HDRA 1JWVA 1KDWA 5DF9A 3UNWA 2JKFA 2WGWA 3B42A 2WKIA 4U0TA 2WZZA 2VX8A 3O88A 4CLCD 1KGFA 4X69A 2LB9A 3IS2A 4R1GA 4Y7PA 3ZG5A 1G6OA 4GB7A 2ZQDA 1YPRA 5IHVA 4P0MA 2KLIA 1FCOA 3ZNYA 5J3WA 1SKFA 4KZ4A 4WELA 2VJWA 1IYPA 4UEYA 4NG2A 1H0MA 2OV5A 2QMIA 1XA1A 1YLJA 2IWCA 2ZMAA 3R7WB 3LYXA 1YAXA 4ETZA 1K57A 5FATA 4GDNA 2ZD8A 4OPYA 3C7UA 4L9EA 3R7WA 1K4EA 4JBFA 4OH0A 4Q8IA 4WBGA 3T1XA 3PBOA 3HLFA 1VETB 4PKYA 4IHQA 2MJ6A 4CLCC 5DJUA 2PYRA 4YOFA 1E3UD 2PR6A 5EVID 1NZUA 1VETA 2BASA 3BLSA 3ZHHA 2ZL1A 5EM1A 1K25A 3LR3A 3OOVA 3WS2A 1G6AA 3LGOA 5L2FA 4GW9A 4MEZA 5A93A 1CI8A 2Y2IA 4OLDA 3BEBA 2M7UA 2XRNA 3S22A 2M7VA 4QPRA 1NJ4A 1JNUA 2Q0OA 1J9MA 4JKTA 4EWFA 3O86A 2W3GA 3LR0A 3C5AA 5L07A 1CQAA 3CWFA 2YKHA 2W27A 2XF3A 4E3KA 3IWIA 4HESA 3G34A 3GMWA 4ARZB 2X71A 4WYYA 2V8CA 2XH9A 1DP8A 5EVIC 3BRMA 3ZG0A 3VOYA 5TBMB 4ARZA 3PTEA 3E4PA 2HP9A 3VMAA 5HAPA 1S1ZA 2VLGA 3UE1A 4ZBEA 5TBMA 1YQSA 1LSWA 4K91A 4DE3A 1JVJA 3MQ0A 5FAQA 3UB8A 3N8LA 4GOGA 3WRTA 3HL9A 3CJMA 3WS4A 4OP8A 4N1HA 1EWZA 2WKHA 5HD3A 4PM8A 5J4EA 3VSLA 3ZFZA 4QD4A 2NUPC 1PZPA 4JGRA 3B3XA 1WA9A 4BBUA 5DTKA 2JC7A 5D3OA 4JGOA 4K0XA 3HLCA 1S4SA 4DDSA 2EXBA 3IXDA 4KQDA 2EX9A 3T4KA 2OLVA 2J9PA 3Q82A 5GHZA 5AQAA 1MZUA 5AVEA 3VFFA 2L1MA 1PW8A 2Y91A 1TS0A 5AQ9A 1S4RA 5CRFA 4DMZA 3S1YA 4EERA 3PBNA 2XLNA 4G3VA 5L09A 4EBLA 4KUKA 2HDQA 3HLWA 3ZDJA 1D06A 1Z6FA 2B02A 1NYMA 4U3TA 3H9WA 4EU0A 3BFGA 4NXEA 1IKGA 3W8KA 3CZDA 1KOUA 3CPTB 1K0KA 4HP9A 3I7JA 3HLEA 1Y54A 4JPMA 4R4RA 1UGUA 3EEHA 4KQQA 2VV7A 3VOLA 4WUJA 3B47A 5CGWA 1M40A 3CPTA 5HARA 4R6LA 1P9RA 3QNBA 1HD8A 4QB8A 4E04A 3SS5A 1BULA 3OZHA 4BBTA 3ZG7B 2M1CA 2A24B 2XD5A 1TDGA 3LIAA 2JKTM 4OKPA 4X25A 4C6YA 3FC7A 4FSFA 4WEJA 4RX2A 5EOEA 4LRXC 4WMCA 1PWGA 1FOFA 4QWOA 3T1SA 4KQOA 4MNRA 2A24A 3M6BA 4RX3A 2PBDP 3LEQA 5EV0A 3N8RA 2XSSA 1FILA 4C3QA 1MKIA 2OAQ1 2IWDA 4DN0A 3W2ZA 1BYWA 3QP6A 3BFEA 4KZBA 3EGDC 3U2AA 2V0WA 1GHMA 2G2UA 3C2WA 2GJ3A 1JWPA 3V3RA 4QU3A 4ZRRA 4UQIS 2B95A 5M1AA 4UA7A 1W79A 5FQJA 3NECA 1GSVA 2JBFA 2VEAA 3GTCA 3MJQA 3AGFA 3Q7ZA 2NUTC 5CGXA 2LB5A 4MN7A 1J3WA 3HLBA 2PD8A 3IH8A 1IYOA 3UB6A 3OCLA 4R3JA 2W3HA 3OPRA 1L0EA 4DRTA 1YT4A 4P85A 5EUAA 4JXSA 2YKFA 5U47A 3WS0A 1IFQA 2WK0A 3EOIA 4LV0A 1FR6A 4DE0A 1ZG6A 3KSGA 1JTDA 2R9XA 1NZOA 3K2NA 1LL8A 3RJUA 4BWIA 5CHMA 3FKVA 4EUZA 3NI9A 2XROA 3NCKA 1OTAA 4I3IA 5E2EA 4QHCA 4NETA 1T1AA 4YWZA 4DJ3A 4P6ZS 3IXHA 4E3JA 2OLUA 3E4OA 3NULA 1BUEA 2ACGA 5HW3A 4KZ8A 3UN7A 5IU1A 3TSGA 4O0PA 1PWCA 3KO6A 2BTFP 5I94A 3NC8A 3BY9A 2Z6DA 1YMSA 3G32A 4FOFA 4PM7A 1FR1A 1ZTUA 3IXGA 5F83A 4QY5A 5F69A 4I5SA 1S67L 2WKRA 1MWUA 1JTGA 3E2LA 3U4LP 4OVDA 5FI2A 3S7PA 4R38A 3MZEA 2KX6A 5F6AA 4E3OA 1HZOA 1XX2A 4I3AA 1TS7A 2D02A 4OQHA 4Y5FA 1I2WA 1DJCA 3MZFA 1H5XA 4B88A 3D4FA 2JE5A 3RTYA 4GCZA 1FQGA 1XPBA 1FSWA 2C5WB 4EW7A 3SH8A 2HP5A 1PWDA 4L9FA 3O5YA 1W8QA 1TS8A 4S2OA 5E2HA 3UDXA 1KVMA 2PU4A 3PBSA 3HBRA 5DFYA 3Q07A 3MMHA 4CPKA 4WZ5A 3NY4A 2VGJA 5M19A 3S7NA 1GA9A 5FA7A 4F3LB 1FCNA 2EX6A 3MF0A 1K55A 2IA2A 3D3OA 5DVAA 5HWTA 1SDNA 3KYEA 1XGIA 5CXWA 4Y0TA 3SH7A 3FG8A 1YM1A 3MR0A 3UY6A 2W3DA 1NLYA 3BY8A 3LIEA 3LY4A 4E3LA 4Q0IA 3KSHA 1XJ6A 5GLDA 3UE6A 4KG6A 1W63M 4P6BA 4B93A 4K08A 3VP2A 3MFXA 3UB7A 3EWKA 2PD7A 3WRZA 2QJ5A 1MC0A 1MBLA 2JKRI 5GLCA 2EFUA 1ESIA 3PBQA 1KE4A 4JF6A 4OQ0A 1W63Q 5DTTA 2JKRM 4GN2A 2ZC6B 3MQOA 3TOIA 1V9ZA 3HJKA 1SKOA 4RYEA 4KZ5A 3UPOA 4LGWA 4B4ZA 3ZG8B 3RFBA 2J7VA 3UMEA 2WAFA 1N9NA 5HL6A 3C7VA 2QWSA 2HJEA 3T4TA 5CGSA 3HLGA 4CQHA 5G4ZA 3P01A 4ZJ2A 2EXAA 4JXWA 1T18A 1YLPA 1D7EA 5FL3A 1XXMA 3NOTC 5EECA 3LICA 4E3IA 2E8IA 2Y2GA 3O87A 5HDDA 3N4IA 1L3LA 4KQRA 2PBYA 2XDMA 4BLMA 1W5DA 3TW8A 3Q7VB 1ZC2A 1E4DA 3F1OB 4OPZA 4H8RA 1LSVA 1CJFA 4ETXA 2BG1A 1C3BA 3D9YA 3PYPA 4S2IA 4BENA 5CERA 1WE4A 2EWWA 3Q7VA 5AQ7A 3L9KA 4EBNA 1K6SA 3VP4A 3F1OA 3VE4A 4LCLA 1VEUB 2O9AA 5A90A 4CLCA 3ZG9B 1MY8A 4ZJ3A 2BLSA 5HD5A 1N4OA 4RA7A 1DJAA 2Y2KA 1K54A 3LEZA 1MXOA 5L10A 2O9CA 1ONGA 2ZL1B 5HAQA 2Q9MA 1VEUA 2DRWA 2Y79A 1BLCA 4WZ4A 3UPNA 3O3VA 1YKDA 3PAGA 1M6KA 3KYQA 3MFDA 4YINA 4FCFA 3AGEA 1ES5A 3P09A 1TF1A 2ZOIA 3V67A 4GD6A 4NEED 1ONHA 1F9IA 3FWLA 3VE3A 3NOPC 4E6WA 3PXPA 4PPRA 4CJNA 5F82A 3A3EA 1V9YA 4L9GA 3S7OA 3ITBA 2CMNA 2ZM8A 2FH5A 3UE0A 3JVVA 1P0ZA 3NJAA 3ZGAB 3GSGA 1PI5A 1K56D 3OPHA 2V1AA 2R78A 3LIDA 4ESPA 2VA0A 2H10A 2Y4AA 1XJ4A 2FFFB 1OTEA 1LLBA 3IX3A 5I5LA 2W3EA 3QP2A 2J3WA 5EVIA 5EE8A 2ZQ8A 4HJ3A 3LR5A 4U0XA 3IHAA 4WLAA 3SS4A 4H6JB 3IBRA 5HDCA 3ICYA 4MCWA 5FQIA 4R0QA 1OTDA 4KZ6A 3UPPA 1MWTA 4H6JA 1U60A 3NHQA 3M2KA 2EWVA 4FH4A 3VOZA 1IEMA 2J9OA 4R3AA 2Y59A 4Q0HA 2O99A 4BMWA 5AVFA 2DCFA 2XR0A 4S2MA 5E43A 2E8JA 1LI9A 4PM9A
chains in the Genus database with same CATH topology
1GSVA 1VHMA 3TE8A 2VEAA 3MJQA 1NLZA 5HZHA 4XT2B 3C38A 3PBRA 4AFIA 3EEAA 4Y3IA 2NUTC 3UMDA 2LB5A 4MN7A 1DRMA 5HPIA 5K5BA 2OAP1 3PHYA 2PT7A 3EQVA 4PAUA 1N9LA 2GNXA 2PD8A 4JGQA 2OOLA 1DP9A 3LIFA 4Y2FA 3UB6A 2GZAA 3E4QA 2W1RA 3OCLA 3BW6A 3S7QA 5IS1A 4OOLA 1GSXA 5HPFA 2W3HA 1OT6A 1IOUA 4EEPA 1MKMA 4I3JA 2P04A 2YKFA 3BJNA 3ZYTA 2H28A 2HV1A 4RQ9A 4F3LA 1IFQA 3R4KA 2J3TD 4HI4A 2VV8A 3EOIA 5J7EA 2Y8HA 3KSGA 2VGLM 3VV4A 3A0SA 4O01A 4LLOB 4GS9B 3K2NA 1X0OA 2O0YA 1LL8A 4BWIA 4WN5A 4L0LA 1LT0A 2VGLS 5DFXA 4NXBA 5CX7A 4I38A 1ZHHB 4GS9A 3KSFA 4HY8A 2XROA 3DBAA 3K3DA 4HH2A 1OTAA 2DMWA 4I3IA 5KSHA 1S1YA 2FZ0A 5KIZA 5IT5A 1T1AA 4YWZA 4DJ3A 4P6ZS 4HQAA 1OTIA 2W3FA 4MN5A 3FPVA 3T4OA 3E4OA 3CUEC 3PBTA 4BBVA 3TRCA 2QHKA 2K2NA 5IU1A 3H7WB 4O0PA 3KO6A 2OWJA 2GX5A 4PHTA 3BY9A 2Z6DA 2KDKA 3HJIA 2ZMVA 4LRZE 2VV6A 3K3CA 4FOFA 4IUKA 3F1NB 4MMNA 1OPXA 4Z1WA 1OT9A 3H7WA 1ZTUA 2J80A 4WF0A 5F69A 3IS2B 4I5SA 1S67L 4EQ1A 2WKRA 4R70A 3H82B 5DF9A 2J3TC 5HDSA 5F5YA 3B42A 4Q0JA 2VX8A 3S7PA 4R38A 1YSQA 2KX6A 3CLOA 4CLCD 2G7UA 2LB9A 3C8CA 4NXGA 3IS2A 5F6AA 4BJPA 4HIAA 4UQIM 3ULFA 3H82A 4I3AA 1TS7A 2D02A 4Y5FA 1TD5A 2XA7M 4EESA 1G6OA 4HHDA 2V1BA 3GECA 1P9WA 2KLIA 3RTYA 4GCZA 1T1BA 4LPZA 3T50A 1OJGA 4EW7A 2JN7A 4II7A 4L9FA 3O5YA 5J3WA 4WL9A 5HWVA 1TS8A 4LRYC 4WELA 2VJWA 3OCNA 2K7SA 4IJGA 4UEYA 3PBSA 5DKKA 2Z6CA 3CI6A 5DFYA 4JGPA 3MMHA 3CITA 4HH3A 4HJ4A 4EEUA 3KX0X 3E98A 3R7WB 1T1CA 2QKPA 3LYXA 3S7NA 1YAXA 1NWZA 4ETZA 3UE3A 4F3LB 2P7JA 3TJZC 2I9VA 3MF0A 2V0UA 2IA2A 4L9EA 4ME4A 3D3OA 4GLQA 5HWTA 3R7WA 2HJ9C 3PBOA 3UB9A 3FG8A 3MR0A 4PKYA 2W3DA 4IHQA 1NLYA 3IBJA 2MJ6A 1TS6A 4CLCC 5DJUA 2PYRA 4YOFA 3BY8A 3LIEA 2PR5A 2A2LA 4Q0IA 2PR6A 3D72A 3KSHA 3B33A 3MQQA 2BASA 4PKYG 1XJ6A 1S66L 3UE6A 1W63M 1YSPA 4OOMA 4B93A 5F68A 4MN6A 4K08A 3LR3A 4IUHA 3MFXA 3UB7A 3EWKA 2K31A 3BQAA 4P6ZM 3BQ8A 4HNBA 3OOVA 2PD7A 1STZA 3CUEA 2QJ5A 1MC0A 4DJ2A 5TJJA 1VB6A 3EQUA 2EA9A 2HGVA 2JKRI 3LR4A 4GW9A 3PR6A 4G3WA 4MDZA 2M7UA 3PBQA 2XRNA 2M7VA 4QPRA 1W63Q 1JNUA 1F98A 3C30A 2JKRM 3T4SA 3JVUA 3MQOA 2ZOHA 1V9ZA 3T4QA 3HJKA 5DKLA 2W3GA 3LR0A 1Y28A 3RFBA 2D01A 3SW1A 3UMEA 5HL6A 1N9NA 3CWFA 2YKHA 2W27A 1EW0A 2JKTI 1ODVA 2QWSA 5HWWA 3KSIA 3G6OA 2HJEA 3T4TA 3T4JA 4ARZB 1F5MA 4NKPA 5MC7A 4CQHA 5G4ZA 3LFVA 3P01A 1DP8A 1XJ2A 4M4XA 1T18A 1XJ3A 1D7EA 1UWPX 5FL3A 5TBMB 3NOTC 4ARZA 3E4PA 3LICA 2PDRA 1GSWA 1S1ZA 2OWHA 2VLGA 5HDDA 4G3KA 4GHIA 3A0VA 3MXQA 3FPWA 5TBMA 1LSWA 2PHYA 1T19A 3TW8A 3MQ0A 3LI9A 3UB8A 1XFNA 3F1OB 3CAXA 1LSVA 4ETXA 1G28A 2KOIA 3KYZA 3PYPA 5HD3A 5J4EA 2EWWA 2L4RA 1OTBA 4EXOA 2NUPC 4JGRA 3F1OA 3VE4A 4B9OA 3BWLA 5HSQA 1WA9A 2VKSA 4HJ6A 2O9AA 4BBUA 4CLCA 5G4YA 5HD5A 3ZQ5A 3P7NA 4XT2A 4WEKA 4JGOA 2O9CA 1S4SA 4KQDA 2Y79A 3T4KA 3OBFA 4KUOA 4GJ4A 1YKDA 1MZUA 4HOIA 3KYQA 1NRJA 2O9BA 5AVEA 2L1MA 1TS0A 4EETB 2ZBBA 1S4RA 1TF1A 2ZOIA 1DP6A 3V67A 4DMZA 4NEED 2L0WA 4EERA 3PBNA 4G3VA 5L8MA 1F9IA 3VE3A 3NOPC 4KUKA 3GDIA 3PXPA 1D06A 2B02A 4CLCE 3H9WA 1V9YA 4EU0A 4L9GA 2ZMFA 3S7OA 4NXEA 2B18A 3EGXC 1LSXA 2VZWA 2CMNA 1KOUA 1N9OA 3NOUC 2FH5A 3LIBA 4HP9A 3E0YA 3JVVA 2JHEA 1P0ZA 1UGUA 3OLOA 3NJAA 3EEHA 2W0NA 2VV7A 3VOLA 4O8GA 2V1AA 4WUJA 2R78A 3B47A 2QYBA 2V9AA 1P97A 3LIDA 2P08A 2VA0A 4R6LA 1XFQA 1XJ4A 1OTEA 1P9RA 4E04A 2W1TB 5I5LA 2W3EA 2J3WA 4BBTA 4HJ3A 3LR5A 4YNRA 5EFWA 3RH8B 4EUVA 2PYPA 2M1CA 2WKQA 5LBRA 2A24B 3LI8A 4WLAA 5AJGA 4H6JB 3IBRA 5HDCA 3ICYA 4MCWA 3LIAA 2JKTM 3FC7A 4FSFA 2W1TA 4GHIB 4HP4A 4WEJA 4LRXC 2QJ7A 3T4LA 3A0RA 4KQOA 3F1PB 3HCYA 1OTDA 5DJTA 4I39A 2A24A 3OC2A 2XSSA 4H6JA 2OAQ1 1H8MA 3F1NA 3NHQA 5A8BA 2EWVA 2INWA 4DN0A 3LUQA 3W2ZA 1BYWA 1OJ5A 4NXFA 5C5KA 3F1PA 4R3AA 3U2AA 3EGDC 2V0WA 4Q0HA 2HF6A 3C2WA 2GJ3A 2O99A 4BMWA 5AVFA 4ZRRA 4UQIS 1UWNX 2WKPA 4CLCB 1H3QA 2XA7S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSV A;  2VEA A;  3MJQ A;  5HZH A;  4XT2 B;  3UMD A;  1DRM A;  3PHY A;  1N9L A;  2PD8 A;  4JGQ A;  2OOL A;  1DP9 A;  3LIF A;  3UB6 A;  3E4Q A;  5IS1 A;  1GSX A;  1OT6 A;  4EEP A;  4I3J A;  2YKF A;  2H28 A;  2HV1 A;  4RQ9 A;  4F3L A;  4HI4 A;  2VV8 A;  5J7E A;  3A0S A;  4LLO B;  4GS9 B;  1X0O A;  1LL8 A;  4WN5 A;  1LT0 A;  4NXB A;  4I38 A;  4GS9 A;  4HY8 A;  3K3D A;  4HH2 A;  1OTA A;  4I3I A;  1S1Y A;  5KIZ A;  1T1A A;  4YWZ A;  4DJ3 A;  4HQA A;  1OTI A;  4MN5 A;  3E4O A;  4BBV A;  2QHK A;  5IU1 A;  3H7W B;  2OWJ A;  3BY9 A;  2Z6D A;  2KDK A;  3HJI A;  4LRZ E;  2VV6 A;  3K3C A;  3F1N B;  1OT9 A;  2J80 A;  3H7W A;  4WF0 A;  5F69 A;  3IS2 B;  4I5S A;  1S67 L;  4EQ1 A;  2WKR A;  4R70 A;  3H82 B;  5HDS A;  5F5Y A;  4R38 A;  2KX6 A;  3CLO A;  3C8C A;  4NXG A;  3IS2 A;  5F6A A;  4HIA A;  3ULF A;  3H82 A;  4I3A A;  1TS7 A;  2D02 A;  4EES A;  4HHD A;  2V1B A;  3GEC A;  3RTY A;  4GCZ A;  1T1B A;  4LPZ A;  3T50 A;  1OJG A;  4EW7 A;  2JN7 A;  4L9F A;  5J3W A;  4WL9 A;  5HWV A;  1TS8 A;  4LRY C;  2K7S A;  5DKK A;  2Z6C A;  4JGP A;  4HH3 A;  4HJ4 A;  4EEU A;  3KX0 X;  1T1C A;  2QKP A;  3LYX A;  1NWZ A;  4F3L B;  2P7J A;  2I9V A;  2V0U A;  4L9E A;  5HWT A;  3UB9 A;  3FG8 A;  3MR0 A;  4PKY A;  1TS6 A;  5DJU A;  2PYR A;  3BY8 A;  3LIE A;  2PR5 A;  2PR6 A;  3D72 A;  3B33 A;  3MQQ A;  2BAS A;  4PKY G;  1XJ6 A;  1S66 L;  3UE6 A;  5F68 A;  4MN6 A;  4K08 A;  3MFX A;  3UB7 A;  3EWK A;  4HNB A;  2PD7 A;  2QJ5 A;  4DJ2 A;  1VB6 A;  2EA9 A;  4GW9 A;  1JNU A;  1F98 A;  3MQO A;  2ZOH A;  1V9Z A;  3HJK A;  5DKL A;  1Y28 A;  2D01 A;  3SW1 A;  3UME A;  1N9N A;  3CWF A;  2YKH A;  2W27 A;  1EW0 A;  5HWW A;  1ODV A;  2QWS A;  3G6O A;  5G4Z A;  1DP8 A;  1XJ2 A;  4M4X A;  1T18 A;  1XJ3 A;  1D7E A;  1UWP X;  5TBM B;  3NOT C;  3E4P A;  3LIC A;  2PDR A;  1GSW A;  1S1Z A;  2OWH A;  2VLG A;  5HDD A;  4GHI A;  3A0V A;  3MXQ A;  5TBM A;  1LSW A;  2PHY A;  1T19 A;  3LI9 A;  3UB8 A;  1XFN A;  3F1O B;  3CAX A;  1LSV A;  1G28 A;  3PYP A;  5HD3 A;  5J4E A;  2L4R A;  1OTB A;  4EXO A;  4JGR A;  3F1O A;  3VE4 A;  4B9O A;  3BWL A;  5HSQ A;  1WA9 A;  4HJ6 A;  4BBU A;  5G4Y A;  5HD5 A;  3ZQ5 A;  3P7N A;  4XT2 A;  4JGO A;  1S4S A;  4KQD A;  4KUO A;  1MZU A;  4HOI A;  5AVE A;  2L1M A;  1TS0 A;  4EET B;  2ZBB A;  1S4R A;  2ZOI A;  1DP6 A;  2L0W A;  4EER A;  1F9I A;  3VE3 A;  3NOP C;  4KUK A;  3GDI A;  1D06 A;  2B02 A;  3H9W A;  1V9Y A;  4L9G A;  4NXE A;  1LSX A;  2CMN A;  1KOU A;  1N9O A;  3NOU C;  3LIB A;  4HP9 A;  2JHE A;  1P0Z A;  1UGU A;  3OLO A;  3NJA A;  3EEH A;  2W0N A;  2VV7 A;  3VOL A;  2V1A A;  4WUJ A;  2R78 A;  2V9A A;  1P97 A;  3LID A;  4R6L A;  1XFQ A;  1XJ4 A;  1OTE A;  4E04 A;  5I5L A;  4BBT A;  4HJ3 A;  5EFW A;  3RH8 B;  2PYP A;  2M1C A;  2WKQ A;  2A24 B;  3LI8 A;  4WLA A;  4H6J B;  3IBR A;  5HDC A;  3ICY A;  3LIA A;  3FC7 A;  4HP4 A;  4GHI B;  4LRX C;  2QJ7 A;  3A0R A;  3F1P B;  1OTD A;  5DJT A;  4I39 A;  2A24 A;  4H6J A;  3F1N A;  3NHQ A;  5A8B A;  2INW A;  3LUQ A;  1BYW A;  1OJ5 A;  4NXF A;  3F1P A;  4R3A A;  2V0W A;  3C2W A;  2GJ3 A;  5AVF A;  1UWN X;  2WKP A; 
#chains in the Genus database with same CATH topology
 3TE8 A;  5E2F A;  4OP5 A;  5TR7 A;  3C38 A;  4KZ9 A;  3EEA A;  3GRJ A;  4Y17 A;  1PIO A;  4PMA A;  5HPI A;  5K5B A;  2ZQA A;  4FH2 A;  1FIK A;  1PZO A;  3PHY A;  3EQV A;  4PAU A;  2GNX A;  4KG2 A;  1ERO A;  1DP9 A;  3LIF A;  4JLF A;  2GZA A;  5IS1 A;  5KSC A;  5HX9 A;  1ZG4 A;  4EEP A;  3GV9 A;  1HLU P;  4S2P A;  2VV8 A;  2Y2O A;  3IH9 A;  2Y8H A;  4LLO B;  4GS9 B;  1PNE A;  1FSY A;  4L0L A;  1LT0 A;  5FQQ A;  4IBR A;  2VGL S;  4F94 A;  1NY0 A;  1IKI A;  4ZTK A;  4GS9 A;  4HY8 A;  5FI6 A;  3DBA A;  1OME A;  4O7D A;  5FAO A;  5HL1 A;  5KSH A;  2CC1 A;  2FZ0 A;  5KIZ A;  5IT5 A;  2V20 A;  4X68 A;  3OPP A;  3DTE A;  4DF6 A;  4FUW A;  4MN5 A;  3FPV A;  4OON A;  3CUE C;  4GDB A;  5G18 A;  1S6R A;  3GR2 A;  4B4X A;  4EQI A;  2GX5 A;  4D2O A;  2ZMV A;  3IWO A;  3BYD A;  4IUK A;  4UAA A;  2EFX A;  3V5M A;  4MMN A;  1CK3 A;  1OPX A;  3MKE A;  3JPU A;  2J80 A;  3IXB A;  1LL9 A;  3ITA A;  4R70 A;  2Y2J A;  5HDS A;  1YSQ A;  3A3D A;  3ZVW A;  3CLO A;  2G7U A;  3C8C A;  3MKF A;  4HIA A;  1KGG A;  3ULF A;  1DJB A;  3M6H A;  2XA7 M;  5FDS A;  4HHD A;  1TVF A;  2V1B A;  3GEC A;  1RCJ A;  4X1M A;  2Q9N A;  1IYQ A;  3CMZ A;  4LPZ A;  1WYB A;  3T50 A;  2JN7 A;  4II7 A;  4WL9 A;  5HWV A;  4LRY C;  2K7S A;  4IJG A;  2Z6C A;  3T1Q B;  3CI6 A;  1MWR A;  3CIT A;  4HJ4 A;  4EEU A;  3RXW A;  4LV2 A;  1LL5 A;  3UDF A;  1NWZ A;  1WYC A;  3DTI A;  3UE3 A;  1BSG A;  3N8S A;  2XK1 A;  1A0K A;  3TJZ C;  1KE3 A;  4ME4 A;  4GLQ A;  3OPL A;  3A3J A;  2H0T A;  1CI9 A;  3HUM A;  3C4O A;  4DXB A;  2G2W A;  3IBJ A;  3IF6 C;  1AXB A;  3G2Y A;  1Q2P A;  3B33 A;  3MQQ A;  4PKY G;  3V50 A;  3ZVT A;  3LO7 A;  1S66 L;  3GQZ A;  4UHU A;  4OOM A;  4X56 A;  5F68 A;  4MN6 A;  1BLH A;  5JYO A;  3IF5 A;  3BQ8 A;  4HNB A;  4EBP A;  4DJ2 A;  2RCX A;  2P74 A;  5TJJ A;  1D1J A;  2WUQ A;  2EA9 A;  3PR6 A;  4G3W A;  4HBU A;  1SZV A;  4X1L A;  4MDZ A;  1SCW A;  3MBZ A;  4JXG A;  3T4S A;  2Y2P A;  4LEN A;  2ZOH A;  2ZM2 A;  1CEG A;  1RP5 A;  1Y28 A;  2Z2M B;  3SW1 A;  3NIA A;  1K38 A;  4IED A;  3S4X A;  2GDN A;  3QP1 A;  1EW0 A;  5F1F A;  5HWW A;  1ALQ A;  1ODV A;  3ZNT A;  3KSI A;  3T4J A;  4S2N C;  2ZC4 B;  4NKP A;  1FCM A;  2OSU A;  2PRF A;  3VSK A;  3BFF A;  1XJ2 A;  4M4X A;  5TGF A;  1XJ3 A;  1UWP X;  4HBT A;  1XP4 A;  1ERQ A;  4GNU A;  2JCH A;  2ZC3 B;  4K0W A;  5FQ9 A;  4G3K A;  4GHI A;  3A0V A;  3BFC A;  1I5Q A;  3MXQ A;  3BM6 A;  2PHY A;  1SDE A;  3BLM A;  1QME A;  3IWQ A;  2C6W B;  2PU2 A;  3MZD A;  1I2S A;  1XFN A;  4E3N A;  1LI0 A;  1G28 A;  1H8Z A;  1RGY A;  1OTB A;  2A3U A;  1ZKJ A;  2WYX A;  2VKS A;  4Z9Q A;  1MWS A;  1YLZ A;  4IVI A;  3C4P A;  1E25 A;  5G4Y A;  3FV7 A;  1Q2Q A;  2H5S A;  3GVB A;  5FDH A;  4XT2 A;  3Q1F A;  4KG5 A;  3IX4 A;  3WWX A;  3VFH A;  3P98 A;  4N9L A;  3L7H A;  1BTL A;  4KUO A;  4GJ4 A;  1F2K A;  5GHY A;  1NRJ A;  2O9B A;  1ESU A;  3FKW A;  2UV0 E;  1Z09 A;  4EET B;  2ZBB A;  5KZH A;  2J8Y A;  4JXV A;  1DP6 A;  1W7F A;  2L0W A;  2RL3 A;  2X01 A;  4OQI A;  2XGN A;  4CLC E;  4JF5 A;  3IX8 A;  1SKO B;  2ZMF A;  3HVF A;  2B18 A;  3VP3 A;  2PAV P;  4R4S A;  1N9B A;  2HZ5 A;  3CHW P;  4MBH A;  5FEG A;  2IWB A;  1MPL A;  2W0N A;  2QYB A;  2V9A A;  2P08 A;  4MLL A;  3N6I A;  5GL9 A;  1XFQ A;  2VK3 A;  5CHJ A;  4N92 A;  2W1T B;  5EFW A;  4EUV A;  2PYP A;  2WKQ A;  5LBR A;  2P9V A;  3LI8 A;  2R9W A;  4R3B A;  3T1R A;  2W1T A;  2I72 A;  4HP4 A;  2XEP A;  2Y2N A;  2QJ7 A;  3T4L A;  3F1P B;  4Y15 A;  3HCY A;  5DJT A;  1NYY A;  1H8M A;  3RXX A;  3F1N A;  5A8B A;  2INW A;  3NDG A;  5CTM A;  4N1X A;  3LUQ A;  1OJ5 A;  4NXF A;  3F1P A;  1UWN X;  2WKP A;  3MXR A;  5EPH A;  4GZB A;  4CLC B;  1H3Q A;  1VHM A;  3FYZ A;  5GHX A;  1NLZ A;  3DW0 A;  5HZH A;  4E6X A;  4AFI A;  1G68 A;  2JKG A;  5A91 A;  3MS6 A;  3CG5 A;  2OAP 1;  4Y0U A;  5FEF A;  1N9L A;  3A3F A;  1JWZ A;  4JGQ A;  4LV3 A;  4DKI A;  2OOL A;  4UA9 A;  4Y2F A;  3E4Q A;  4OOL A;  1GSX A;  5HPF A;  1GCE A;  1MKM A;  4I3J A;  2P04 A;  2ZC7 A;  1K57 C;  4XUZ A;  2HV1 A;  4RQ9 A;  5EM0 A;  1EI5 A;  4DDY A;  3WS5 A;  2J3T D;  4HI4 A;  2WGV A;  5F1G A;  2VGL M;  3A0S A;  4O01 A;  1IYS A;  5DF8 A;  2O0Y A;  3G30 A;  3SZT A;  1K54 C;  4WN5 A;  2WAD A;  4N9K A;  5DFX A;  4NXB A;  1XKZ A;  1ES4 A;  1ZHH B;  3HUO A;  3K3D A;  4HH2 A;  4BD0 A;  3V3S A;  3A3I A;  5EVI B;  4S2K A;  3G2Z A;  1KGE A;  3FZC A;  1PYY A;  4OPQ A;  3T4O A;  1YLT A;  3HLD A;  3TRC A;  5CED A;  1CF0 A;  4P87 A;  5HFO A;  5EVL A;  2QZ6 A;  1E3U A;  4UA6 A;  4DXC A;  3HJI A;  3UO9 A;  2VV6 A;  1ACF A;  3V39 A;  1O7E A;  5KMW A;  3E2K A;  1OT9 A;  4KEN B;  3VP0 A;  5EOO A;  4EQ1 A;  3H82 B;  2ZLY A;  2J3T C;  3QP8 A;  4C75 A;  5FAS A;  5F5Y A;  3NBL A;  4Q0J A;  3G35 A;  3QNC A;  2ZM0 A;  4NXG A;  4BJP A;  4UQI M;  3H82 A;  2Y2Q A;  4OOY A;  1TD5 A;  3IQA A;  4EES A;  5CTN A;  1K56 A;  4GD8 A;  2V1Z A;  2Z2L B;  1P9W A;  5DTS A;  1T1B A;  1OJG A;  4GKU A;  4A5R A;  3OCN A;  4S2L A;  5DKK A;  3N7W A;  4JGP A;  4HH3 A;  3KX0 X;  1AWI A;  3E98 A;  1T1C A;  2QKP A;  4EV4 A;  2ZC5 B;  3Q81 A;  1TEM A;  4MBK A;  2P7J A;  2I9V A;  2V0U A;  2HJ9 C;  2WZX A;  2ZQ7 A;  5AQB A;  5HAI A;  4KZ3 A;  3UB9 A;  3DWK A;  3HUN A;  4HEF A;  1KVL A;  5FQK A;  4MBF A;  4X53 A;  5FSR A;  4OLG A;  1TS6 A;  1IEL A;  2PR5 A;  4ZDX A;  2A2L A;  3UDI A;  4S2J A;  3D72 A;  1NXY A;  1YSP A;  3LY3 A;  4IUH A;  4XUX A;  2K31 A;  2V2F F;  3BQA A;  4P6Z M;  4NK3 A;  4WMC D;  1STZ A;  3CUE A;  1VB6 A;  3EQU A;  2HGV A;  2EX8 A;  3LR4 A;  2AVX A;  2Y2H A;  4DE1 A;  5JYP A;  5EVE A;  3T12 B;  1F98 A;  3C30 A;  4QY6 A;  1GHP A;  3JVU A;  4X55 A;  3T4Q A;  2XQZ A;  5DKL A;  4E3M A;  4QJG A;  2D01 A;  1XA7 A;  5M18 A;  4BL3 A;  3DTK A;  2JKT I;  3MSH A;  3G6O A;  3WS1 A;  3IT9 A;  4JF4 A;  1F5M A;  2XD1 A;  2UWX A;  4M3K A;  5MC7 A;  1GA0 A;  3LFV A;  2HPB A;  2Y55 A;  2VGK A;  1BLP A;  3M2J A;  1K6R A;  1YLY A;  2HDS A;  1YLW A;  5E2G A;  2PDR A;  1GSW A;  2OWH A;  3DWZ A;  3AGD A;  3FPW A;  4PM6 A;  2Y2L A;  1T19 A;  1KE0 A;  1L2S A;  3ZCZ A;  1PW1 A;  3LI9 A;  3BEC A;  3CAX A;  1CEF A;  3IF6 B;  2KOI A;  3KYZ A;  3BFD A;  5J8X A;  4X6T A;  4ID4 A;  2L4R A;  4EXO A;  5A92 A;  4B9O A;  3BWL A;  5HSQ A;  1S0W A;  4HJ6 A;  1KDS A;  3IF6 A;  3TG9 A;  4R23 A;  4BD1 A;  3ZQ5 A;  3P7N A;  4WEK A;  4LV1 A;  5TFQ A;  3QHY A;  3MXS A;  3OBF A;  2DNS A;  4HOI A;  3SOI A;  4PM5 A;  3HRE A;  5CHU A;  1ES2 A;  4RVA A;  5FAP A;  5DF7 A;  5L8M A;  5CEB A;  3GDI A;  3ISG A;  3SS3 A;  1LHY A;  3DAV A;  3W4Q A;  2H0Y A;  3G31 A;  4KZA A;  2V8F A;  3EGX C;  1LSX A;  2VZW A;  1N9O A;  3NOU C;  3LIB A;  4LCM A;  5FQM A;  3E0Y A;  3NDE A;  1GHI A;  2XFT A;  2JHE A;  3OLO A;  2A49 A;  1VM1 A;  4O8G A;  1P97 A;  2WKE A;  4S2N A;  1G5U A;  4Y13 A;  1PRQ A;  1L0F A;  3G4P A;  5CEC A;  4DE2 A;  4YNR A;  3RH8 B;  1RGZ A;  5AJG A;  3W4O A;  3PAE A;  4BL2 A;  4GHI B;  1PI4 A;  3A0R A;  1BT5 A;  4ZJ1 A;  4I39 A;  3OC2 A;  4XXR A;  1DY6 A;  1ES3 A;  5C5K A;  4FD8 A;  4FTX A;  2WGI A;  2HF6 A;  2Y2M A;  2QPN A;  1BZA A;  4OPR A;  1SHV A;  1H8Y A;  2XA7 S;  1XGJ A;  4XT2 B;  3UB5 P;  3PBR A;  4Y3I A;  3UMD A;  1DRM A;  2HP6 A;  1PFL A;  1TDL A;  2EX2 A;  2PT7 A;  1K4F A;  2XFS A;  4OQG A;  5BOH A;  2W1R A;  3BW6 A;  4Y0O A;  3LCE A;  3S7Q A;  4WZ5 C;  1Y4O A;  4IVK A;  1OT6 A;  1IOU A;  1NRF A;  3IHB A;  2ZJ9 A;  3BJN A;  3ZYT A;  2H28 A;  2X02 A;  4F3L A;  3DTM A;  3R4K A;  1W8Y A;  2WAE A;  2ZQ9 A;  1K55 C;  5J7E A;  2ZQC A;  1L0G A;  1QMF A;  3QP5 A;  1YMX A;  3VV4 A;  4IBX A;  1X0O A;  4YFM A;  4LFU A;  3W4P A;  1VQQ A;  5CX7 A;  4I38 A;  5GLA A;  3KSF A;  2DMW A;  1L0D A;  5FI7 A;  1S1Y A;  4KZ7 A;  2P9V B;  4HQA A;  1OTI A;  2W3F A;  1O07 A;  4BQM A;  1HVB A;  3PBT A;  3QP4 A;  4BBV A;  1ERM A;  1HTZ A;  5GLB A;  2QHK A;  2K2N A;  3H7W B;  4D60 A;  3JYI A;  3VP1 A;  2OWJ A;  4PHT A;  4ZAM A;  2KDK A;  4LRZ E;  2FFY A;  4WM9 A;  2WGW B;  3K3C A;  1BLS A;  3SH9 A;  3F1N B;  2HDU A;  4Z1W A;  3H7W A;  2B5R A;  4WF0 A;  3IS2 B;  2HDR A;  1JWV A;  1KDW A;  5DF9 A;  3UNW A;  2JKF A;  2WGW A;  3B42 A;  2WKI A;  4U0T A;  2WZZ A;  2VX8 A;  3O88 A;  4CLC D;  1KGF A;  4X69 A;  2LB9 A;  3IS2 A;  4R1G A;  4Y7P A;  3ZG5 A;  1G6O A;  4GB7 A;  2ZQD A;  1YPR A;  5IHV A;  4P0M A;  2KLI A;  1FCO A;  3ZNY A;  5J3W A;  1SKF A;  4KZ4 A;  4WEL A;  2VJW A;  1IYP A;  4UEY A;  4NG2 A;  1H0M A;  2OV5 A;  2QMI A;  1XA1 A;  1YLJ A;  2IWC A;  2ZMA A;  3R7W B;  3LYX A;  1YAX A;  4ETZ A;  1K57 A;  5FAT A;  4GDN A;  2ZD8 A;  4OPY A;  3C7U A;  4L9E A;  3R7W A;  1K4E A;  4JBF A;  4OH0 A;  4Q8I A;  4WBG A;  3T1X A;  3PBO A;  3HLF A;  1VET B;  4PKY A;  4IHQ A;  2MJ6 A;  4CLC C;  5DJU A;  2PYR A;  4YOF A;  1E3U D;  2PR6 A;  5EVI D;  1NZU A;  1VET A;  2BAS A;  3BLS A;  3ZHH A;  2ZL1 A;  5EM1 A;  1K25 A;  3LR3 A;  3OOV A;  3WS2 A;  1G6A A;  3LGO A;  5L2F A;  4GW9 A;  4MEZ A;  5A93 A;  1CI8 A;  2Y2I A;  4OLD A;  3BEB A;  2M7U A;  2XRN A;  3S22 A;  2M7V A;  4QPR A;  1NJ4 A;  1JNU A;  2Q0O A;  1J9M A;  4JKT A;  4EWF A;  3O86 A;  2W3G A;  3LR0 A;  3C5A A;  5L07 A;  1CQA A;  3CWF A;  2YKH A;  2W27 A;  2XF3 A;  4E3K A;  3IWI A;  4HES A;  3G34 A;  3GMW A;  4ARZ B;  2X71 A;  4WYY A;  2V8C A;  2XH9 A;  1DP8 A;  5EVI C;  3BRM A;  3ZG0 A;  3VOY A;  5TBM B;  4ARZ A;  3PTE A;  3E4P A;  2HP9 A;  3VMA A;  5HAP A;  1S1Z A;  2VLG A;  3UE1 A;  4ZBE A;  5TBM A;  1YQS A;  1LSW A;  4K91 A;  4DE3 A;  1JVJ A;  3MQ0 A;  5FAQ A;  3UB8 A;  3N8L A;  4GOG A;  3WRT A;  3HL9 A;  3CJM A;  3WS4 A;  4OP8 A;  4N1H A;  1EWZ A;  2WKH A;  5HD3 A;  4PM8 A;  5J4E A;  3VSL A;  3ZFZ A;  4QD4 A;  2NUP C;  1PZP A;  4JGR A;  3B3X A;  1WA9 A;  4BBU A;  5DTK A;  2JC7 A;  5D3O A;  4JGO A;  4K0X A;  3HLC A;  1S4S A;  4DDS A;  2EXB A;  3IXD A;  4KQD A;  2EX9 A;  3T4K A;  2OLV A;  2J9P A;  3Q82 A;  5GHZ A;  5AQA A;  1MZU A;  5AVE A;  3VFF A;  2L1M A;  1PW8 A;  2Y91 A;  1TS0 A;  5AQ9 A;  1S4R A;  5CRF A;  4DMZ A;  3S1Y A;  4EER A;  3PBN A;  2XLN A;  4G3V A;  5L09 A;  4EBL A;  4KUK A;  2HDQ A;  3HLW A;  3ZDJ A;  1D06 A;  1Z6F A;  2B02 A;  1NYM A;  4U3T A;  3H9W A;  4EU0 A;  3BFG A;  4NXE A;  1IKG A;  3W8K A;  3CZD A;  1KOU A;  3CPT B;  1K0K A;  4HP9 A;  3I7J A;  3HLE A;  1Y54 A;  4JPM A;  4R4R A;  1UGU A;  3EEH A;  4KQQ A;  2VV7 A;  3VOL A;  4WUJ A;  3B47 A;  5CGW A;  1M40 A;  3CPT A;  5HAR A;  4R6L A;  1P9R A;  3QNB A;  1HD8 A;  4QB8 A;  4E04 A;  3SS5 A;  1BUL A;  3OZH A;  4BBT A;  3ZG7 B;  2M1C A;  2A24 B;  2XD5 A;  1TDG A;  3LIA A;  2JKT M;  4OKP A;  4X25 A;  4C6Y A;  3FC7 A;  4FSF A;  4WEJ A;  4RX2 A;  5EOE A;  4LRX C;  4WMC A;  1PWG A;  1FOF A;  4QWO A;  3T1S A;  4KQO A;  4MNR A;  2A24 A;  3M6B A;  4RX3 A;  2PBD P;  3LEQ A;  5EV0 A;  3N8R A;  2XSS A;  1FIL A;  4C3Q A;  1MKI A;  2OAQ 1;  2IWD A;  4DN0 A;  3W2Z A;  1BYW A;  3QP6 A;  3BFE A;  4KZB A;  3EGD C;  3U2A A;  2V0W A;  1GHM A;  2G2U A;  3C2W A;  2GJ3 A;  1JWP A;  3V3R A;  4QU3 A;  4ZRR A;  4UQI S;  2B95 A;  5M1A A;  4UA7 A;  1W79 A;  5FQJ A;  3NEC A;  1GSV A;  2JBF A;  2VEA A;  3GTC A;  3MJQ A;  3AGF A;  3Q7Z A;  2NUT C;  5CGX A;  2LB5 A;  4MN7 A;  1J3W A;  3HLB A;  2PD8 A;  3IH8 A;  1IYO A;  3UB6 A;  3OCL A;  4R3J A;  2W3H A;  3OPR A;  1L0E A;  4DRT A;  1YT4 A;  4P85 A;  5EUA A;  4JXS A;  2YKF A;  5U47 A;  3WS0 A;  1IFQ A;  2WK0 A;  3EOI A;  4LV0 A;  1FR6 A;  4DE0 A;  1ZG6 A;  3KSG A;  1JTD A;  2R9X A;  1NZO A;  3K2N A;  1LL8 A;  3RJU A;  4BWI A;  5CHM A;  3FKV A;  4EUZ A;  3NI9 A;  2XRO A;  3NCK A;  1OTA A;  4I3I A;  5E2E A;  4QHC A;  4NET A;  1T1A A;  4YWZ A;  4DJ3 A;  4P6Z S;  3IXH A;  4E3J A;  2OLU A;  3E4O A;  3NUL A;  1BUE A;  2ACG A;  5HW3 A;  4KZ8 A;  3UN7 A;  5IU1 A;  3TSG A;  4O0P A;  1PWC A;  3KO6 A;  2BTF P;  5I94 A;  3NC8 A;  3BY9 A;  2Z6D A;  1YMS A;  3G32 A;  4FOF A;  4PM7 A;  1FR1 A;  1ZTU A;  3IXG A;  5F83 A;  4QY5 A;  5F69 A;  4I5S A;  1S67 L;  2WKR A;  1MWU A;  1JTG A;  3E2L A;  3U4L P;  4OVD A;  5FI2 A;  3S7P A;  4R38 A;  3MZE A;  2KX6 A;  5F6A A;  4E3O A;  1HZO A;  1XX2 A;  4I3A A;  1TS7 A;  2D02 A;  4OQH A;  4Y5F A;  1I2W A;  1DJC A;  3MZF A;  1H5X A;  4B88 A;  3D4F A;  2JE5 A;  3RTY A;  4GCZ A;  1FQG A;  1XPB A;  1FSW A;  2C5W B;  4EW7 A;  3SH8 A;  2HP5 A;  1PWD A;  4L9F A;  3O5Y A;  1W8Q A;  1TS8 A;  4S2O A;  5E2H A;  3UDX A;  1KVM A;  2PU4 A;  3PBS A;  3HBR A;  5DFY A;  3Q07 A;  3MMH A;  4CPK A;  4WZ5 A;  3NY4 A;  2VGJ A;  5M19 A;  3S7N A;  1GA9 A;  5FA7 A;  4F3L B;  1FCN A;  2EX6 A;  3MF0 A;  1K55 A;  2IA2 A;  3D3O A;  5DVA A;  5HWT A;  1SDN A;  3KYE A;  1XGI A;  5CXW A;  4Y0T A;  3SH7 A;  3FG8 A;  1YM1 A;  3MR0 A;  3UY6 A;  2W3D A;  1NLY A;  3BY8 A;  3LIE A;  3LY4 A;  4E3L A;  4Q0I A;  3KSH A;  1XJ6 A;  5GLD A;  3UE6 A;  4KG6 A;  1W63 M;  4P6B A;  4B93 A;  4K08 A;  3VP2 A;  3MFX A;  3UB7 A;  3EWK A;  2PD7 A;  3WRZ A;  2QJ5 A;  1MC0 A;  1MBL A;  2JKR I;  5GLC A;  2EFU A;  1ESI A;  3PBQ A;  1KE4 A;  4JF6 A;  4OQ0 A;  1W63 Q;  5DTT A;  2JKR M;  4GN2 A;  2ZC6 B;  3MQO A;  3TOI A;  1V9Z A;  3HJK A;  1SKO A;  4RYE A;  4KZ5 A;  3UPO A;  4LGW A;  4B4Z A;  3ZG8 B;  3RFB A;  2J7V A;  3UME A;  2WAF A;  1N9N A;  5HL6 A;  3C7V A;  2QWS A;  2HJE A;  3T4T A;  5CGS A;  3HLG A;  4CQH A;  5G4Z A;  3P01 A;  4ZJ2 A;  2EXA A;  4JXW A;  1T18 A;  1YLP A;  1D7E A;  5FL3 A;  1XXM A;  3NOT C;  5EEC A;  3LIC A;  4E3I A;  2E8I A;  2Y2G A;  3O87 A;  5HDD A;  3N4I A;  1L3L A;  4KQR A;  2PBY A;  2XDM A;  4BLM A;  1W5D A;  3TW8 A;  3Q7V B;  1ZC2 A;  1E4D A;  3F1O B;  4OPZ A;  4H8R A;  1LSV A;  1CJF A;  4ETX A;  2BG1 A;  1C3B A;  3D9Y A;  3PYP A;  4S2I A;  4BEN A;  5CER A;  1WE4 A;  2EWW A;  3Q7V A;  5AQ7 A;  3L9K A;  4EBN A;  1K6S A;  3VP4 A;  3F1O A;  3VE4 A;  4LCL A;  1VEU B;  2O9A A;  5A90 A;  4CLC A;  3ZG9 B;  1MY8 A;  4ZJ3 A;  2BLS A;  5HD5 A;  1N4O A;  4RA7 A;  1DJA A;  2Y2K A;  1K54 A;  3LEZ A;  1MXO A;  5L10 A;  2O9C A;  1ONG A;  2ZL1 B;  5HAQ A;  2Q9M A;  1VEU A;  2DRW A;  2Y79 A;  1BLC A;  4WZ4 A;  3UPN A;  3O3V A;  1YKD A;  3PAG A;  1M6K A;  3KYQ A;  3MFD A;  4YIN A;  4FCF A;  3AGE A;  1ES5 A;  3P09 A;  1TF1 A;  2ZOI A;  3V67 A;  4GD6 A;  4NEE D;  1ONH A;  1F9I A;  3FWL A;  3VE3 A;  3NOP C;  4E6W A;  3PXP A;  4PPR A;  4CJN A;  5F82 A;  3A3E A;  1V9Y A;  4L9G A;  3S7O A;  3ITB A;  2CMN A;  2ZM8 A;  2FH5 A;  3UE0 A;  3JVV A;  1P0Z A;  3NJA A;  3ZGA B;  3GSG A;  1PI5 A;  1K56 D;  3OPH A;  2V1A A;  2R78 A;  3LID A;  4ESP A;  2VA0 A;  2H10 A;  2Y4A A;  1XJ4 A;  2FFF B;  1OTE A;  1LLB A;  3IX3 A;  5I5L A;  2W3E A;  3QP2 A;  2J3W A;  5EVI A;  5EE8 A;  2ZQ8 A;  4HJ3 A;  3LR5 A;  4U0X A;  3IHA A;  4WLA A;  3SS4 A;  4H6J B;  3IBR A;  5HDC A;  3ICY A;  4MCW A;  5FQI A;  4R0Q A;  1OTD A;  4KZ6 A;  3UPP A;  1MWT A;  4H6J A;  1U60 A;  3NHQ A;  3M2K A;  2EWV A;  4FH4 A;  3VOZ A;  1IEM A;  2J9O A;  4R3A A;  2Y59 A;  4Q0H A;  2O99 A;  4BMW A;  5AVF A;  2DCF A;  2XR0 A;  4S2M A;  5E43 A;  2E8J A;  1LI9 A;  4PM9 A; 
#chains in the Genus database with same CATH homology
 1GSV A;  1VHM A;  3TE8 A;  2VEA A;  3MJQ A;  1NLZ A;  5HZH A;  4XT2 B;  3C38 A;  3PBR A;  4AFI A;  3EEA A;  4Y3I A;  2NUT C;  3UMD A;  2LB5 A;  4MN7 A;  1DRM A;  5HPI A;  5K5B A;  2OAP 1;  3PHY A;  2PT7 A;  3EQV A;  4PAU A;  1N9L A;  2GNX A;  2PD8 A;  4JGQ A;  2OOL A;  1DP9 A;  3LIF A;  4Y2F A;  3UB6 A;  2GZA A;  3E4Q A;  2W1R A;  3OCL A;  3BW6 A;  3S7Q A;  5IS1 A;  4OOL A;  1GSX A;  5HPF A;  2W3H A;  1OT6 A;  1IOU A;  4EEP A;  1MKM A;  4I3J A;  2P04 A;  2YKF A;  3BJN A;  3ZYT A;  2H28 A;  2HV1 A;  4RQ9 A;  4F3L A;  1IFQ A;  3R4K A;  2J3T D;  4HI4 A;  2VV8 A;  3EOI A;  5J7E A;  2Y8H A;  3KSG A;  2VGL M;  3VV4 A;  3A0S A;  4O01 A;  4LLO B;  4GS9 B;  3K2N A;  1X0O A;  2O0Y A;  1LL8 A;  4BWI A;  4WN5 A;  4L0L A;  1LT0 A;  2VGL S;  5DFX A;  4NXB A;  5CX7 A;  4I38 A;  1ZHH B;  4GS9 A;  3KSF A;  4HY8 A;  2XRO A;  3DBA A;  3K3D A;  4HH2 A;  1OTA A;  2DMW A;  4I3I A;  5KSH A;  1S1Y A;  2FZ0 A;  5KIZ A;  5IT5 A;  1T1A A;  4YWZ A;  4DJ3 A;  4P6Z S;  4HQA A;  1OTI A;  2W3F A;  4MN5 A;  3FPV A;  3T4O A;  3E4O A;  3CUE C;  3PBT A;  4BBV A;  3TRC A;  2QHK A;  2K2N A;  5IU1 A;  3H7W B;  4O0P A;  3KO6 A;  2OWJ A;  2GX5 A;  4PHT A;  3BY9 A;  2Z6D A;  2KDK A;  3HJI A;  2ZMV A;  4LRZ E;  2VV6 A;  3K3C A;  4FOF A;  4IUK A;  3F1N B;  4MMN A;  1OPX A;  4Z1W A;  1OT9 A;  3H7W A;  1ZTU A;  2J80 A;  4WF0 A;  5F69 A;  3IS2 B;  4I5S A;  1S67 L;  4EQ1 A;  2WKR A;  4R70 A;  3H82 B;  5DF9 A;  2J3T C;  5HDS A;  5F5Y A;  3B42 A;  4Q0J A;  2VX8 A;  3S7P A;  4R38 A;  1YSQ A;  2KX6 A;  3CLO A;  4CLC D;  2G7U A;  2LB9 A;  3C8C A;  4NXG A;  3IS2 A;  5F6A A;  4BJP A;  4HIA A;  4UQI M;  3ULF A;  3H82 A;  4I3A A;  1TS7 A;  2D02 A;  4Y5F A;  1TD5 A;  2XA7 M;  4EES A;  1G6O A;  4HHD A;  2V1B A;  3GEC A;  1P9W A;  2KLI A;  3RTY A;  4GCZ A;  1T1B A;  4LPZ A;  3T50 A;  1OJG A;  4EW7 A;  2JN7 A;  4II7 A;  4L9F A;  3O5Y A;  5J3W A;  4WL9 A;  5HWV A;  1TS8 A;  4LRY C;  4WEL A;  2VJW A;  3OCN A;  2K7S A;  4IJG A;  4UEY A;  3PBS A;  5DKK A;  2Z6C A;  3CI6 A;  5DFY A;  4JGP A;  3MMH A;  3CIT A;  4HH3 A;  4HJ4 A;  4EEU A;  3KX0 X;  3E98 A;  3R7W B;  1T1C A;  2QKP A;  3LYX A;  3S7N A;  1YAX A;  1NWZ A;  4ETZ A;  3UE3 A;  4F3L B;  2P7J A;  3TJZ C;  2I9V A;  3MF0 A;  2V0U A;  2IA2 A;  4L9E A;  4ME4 A;  3D3O A;  4GLQ A;  5HWT A;  3R7W A;  2HJ9 C;  3PBO A;  3UB9 A;  3FG8 A;  3MR0 A;  4PKY A;  2W3D A;  4IHQ A;  1NLY A;  3IBJ A;  2MJ6 A;  1TS6 A;  4CLC C;  5DJU A;  2PYR A;  4YOF A;  3BY8 A;  3LIE A;  2PR5 A;  2A2L A;  4Q0I A;  2PR6 A;  3D72 A;  3KSH A;  3B33 A;  3MQQ A;  2BAS A;  4PKY G;  1XJ6 A;  1S66 L;  3UE6 A;  1W63 M;  1YSP A;  4OOM A;  4B93 A;  5F68 A;  4MN6 A;  4K08 A;  3LR3 A;  4IUH A;  3MFX A;  3UB7 A;  3EWK A;  2K31 A;  3BQA A;  4P6Z M;  3BQ8 A;  4HNB A;  3OOV A;  2PD7 A;  1STZ A;  3CUE A;  2QJ5 A;  1MC0 A;  4DJ2 A;  5TJJ A;  1VB6 A;  3EQU A;  2EA9 A;  2HGV A;  2JKR I;  3LR4 A;  4GW9 A;  3PR6 A;  4G3W A;  4MDZ A;  2M7U A;  3PBQ A;  2XRN A;  2M7V A;  4QPR A;  1W63 Q;  1JNU A;  1F98 A;  3C30 A;  2JKR M;  3T4S A;  3JVU A;  3MQO A;  2ZOH A;  1V9Z A;  3T4Q A;  3HJK A;  5DKL A;  2W3G A;  3LR0 A;  1Y28 A;  3RFB A;  2D01 A;  3SW1 A;  3UME A;  5HL6 A;  1N9N A;  3CWF A;  2YKH A;  2W27 A;  1EW0 A;  2JKT I;  1ODV A;  2QWS A;  5HWW A;  3KSI A;  3G6O A;  2HJE A;  3T4T A;  3T4J A;  4ARZ B;  1F5M A;  4NKP A;  5MC7 A;  4CQH A;  5G4Z A;  3LFV A;  3P01 A;  1DP8 A;  1XJ2 A;  4M4X A;  1T18 A;  1XJ3 A;  1D7E A;  1UWP X;  5FL3 A;  5TBM B;  3NOT C;  4ARZ A;  3E4P A;  3LIC A;  2PDR A;  1GSW A;  1S1Z A;  2OWH A;  2VLG A;  5HDD A;  4G3K A;  4GHI A;  3A0V A;  3MXQ A;  3FPW A;  5TBM A;  1LSW A;  2PHY A;  1T19 A;  3TW8 A;  3MQ0 A;  3LI9 A;  3UB8 A;  1XFN A;  3F1O B;  3CAX A;  1LSV A;  4ETX A;  1G28 A;  2KOI A;  3KYZ A;  3PYP A;  5HD3 A;  5J4E A;  2EWW A;  2L4R A;  1OTB A;  4EXO A;  2NUP C;  4JGR A;  3F1O A;  3VE4 A;  4B9O A;  3BWL A;  5HSQ A;  1WA9 A;  2VKS A;  4HJ6 A;  2O9A A;  4BBU A;  4CLC A;  5G4Y A;  5HD5 A;  3ZQ5 A;  3P7N A;  4XT2 A;  4WEK A;  4JGO A;  2O9C A;  1S4S A;  4KQD A;  2Y79 A;  3T4K A;  3OBF A;  4KUO A;  4GJ4 A;  1YKD A;  1MZU A;  4HOI A;  3KYQ A;  1NRJ A;  2O9B A;  5AVE A;  2L1M A;  1TS0 A;  4EET B;  2ZBB A;  1S4R A;  1TF1 A;  2ZOI A;  1DP6 A;  3V67 A;  4DMZ A;  4NEE D;  2L0W A;  4EER A;  3PBN A;  4G3V A;  5L8M A;  1F9I A;  3VE3 A;  3NOP C;  4KUK A;  3GDI A;  3PXP A;  1D06 A;  2B02 A;  4CLC E;  3H9W A;  1V9Y A;  4EU0 A;  4L9G A;  2ZMF A;  3S7O A;  4NXE A;  2B18 A;  3EGX C;  1LSX A;  2VZW A;  2CMN A;  1KOU A;  1N9O A;  3NOU C;  2FH5 A;  3LIB A;  4HP9 A;  3E0Y A;  3JVV A;  2JHE A;  1P0Z A;  1UGU A;  3OLO A;  3NJA A;  3EEH A;  2W0N A;  2VV7 A;  3VOL A;  4O8G A;  2V1A A;  4WUJ A;  2R78 A;  3B47 A;  2QYB A;  2V9A A;  1P97 A;  3LID A;  2P08 A;  2VA0 A;  4R6L A;  1XFQ A;  1XJ4 A;  1OTE A;  1P9R A;  4E04 A;  2W1T B;  5I5L A;  2W3E A;  2J3W A;  4BBT A;  4HJ3 A;  3LR5 A;  4YNR A;  5EFW A;  3RH8 B;  4EUV A;  2PYP A;  2M1C A;  2WKQ A;  5LBR A;  2A24 B;  3LI8 A;  4WLA A;  5AJG A;  4H6J B;  3IBR A;  5HDC A;  3ICY A;  4MCW A;  3LIA A;  2JKT M;  3FC7 A;  4FSF A;  2W1T A;  4GHI B;  4HP4 A;  4WEJ A;  4LRX C;  2QJ7 A;  3T4L A;  3A0R A;  4KQO A;  3F1P B;  3HCY A;  1OTD A;  5DJT A;  4I39 A;  2A24 A;  3OC2 A;  2XSS A;  4H6J A;  2OAQ 1;  1H8M A;  3F1N A;  3NHQ A;  5A8B A;  2EWV A;  2INW A;  4DN0 A;  3LUQ A;  3W2Z A;  1BYW A;  1OJ5 A;  4NXF A;  5C5K A;  3F1P A;  4R3A A;  3U2A A;  3EGD C;  2V0W A;  4Q0H A;  2HF6 A;  3C2W A;  2GJ3 A;  2O99 A;  4BMW A;  5AVF A;  4ZRR A;  4UQI S;  1UWN X;  2WKP A;  4CLC B;  1H3Q A;  2XA7 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...