4HJ4A

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
177
structure length
177
Chain Sequence
AMDQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
molecule keywords LOV protein
total genus 56
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hj4A00
1GSWA 1V9YA 4NXGA 1OJGA 1LSWA 2WKRA 2WKQA 3FC7A 3PHYA 4L9FA 3UB7A 3C8CA 4EERA 5HD5A 5HWTA 1T18A 4DJ2A 5J4EA 4WLAA 1GSXA 1N9OA 4HP9A 5DJUA 4H6JB 5G4ZA 1T19A 5G4YA 1OTDA 1OTEA 1XFNA 2WKPA 5AVFA 4HJ6A 1LT0A 3E4QA 1DP6A 3BWLA 4H6JA 3F1NA 2QJ5A 4WF0A 3LUQA 1OT6A 3F1OB 3NJAA 1S4SA 2BASA 2D02A 2V0WA 5F6AA 3GECA 2ZOIA 3F1OA 4B9OA 1DRMA 4EETB 3B33A 1NWZA 3P7NA 3H7WB 4R70A 3F1NB 3H82B 1MZUA 2L4RA 3UB6A 4E04A 4PKYG 5F68A 4NXFA 3LI9A 1OT9A 1XFQA 3UB8A 3VE4A 1DP9A 1N9NA 3NHQA 3A0SA 2YKHA 1T1BA 3CLOA 5HSQA 3LICA 4LLOB 3H82A 3CAXA 3HJIA 1F98A 3ICYA 4BBVA 3FG8A 5J3WA 1D7EA 5F5YA 4YWZA 2V0UA 1T1CA 2EA9A 3MJQA 3MXQA 3NOUC 4KQDA 1S1YA 2VV8A 1TS8A 3BY8A 4WUJA 1LL8A 3IBRA 4I38A 4KUKA 3G6OA 1S67L 5DJTA 3T50A 3K3CA 4NXEA 4XT2A 3PYPA 5HWWA 2OWHA 4I39A 2V1AA 2PYRA 3IS2A 4WN5A 5TBMB 2V9AA 5HZHA 2PYPA 1OJ5A 4GS9B 4LPZA 1TS7A 4HH2A 2PR6A 4HI4A 2ZOHA 1OTBA 4JGQA 4K08A 4F3LB 2W0NA 2I9VA 4HJ3A 5F69A 5J7EA 5EFWA 1Y28A 1UGUA 2JHEA 3LIAA 2QJ7A 1DP8A 1N9LA 3KX0X 5TBMA 2Z6DA 3UE6A 4EESA 2PD7A 3F1PA 3MQOA 4MN6A 2K7SA 4BBUA 2PR5A 4KUOA 3NOTC 2QWSA 4EXOA 1LSVA 2HV1A 2W27A 3C2WA 3MR0A 3RH8B 1G28A 2YKFA 1LSXA 1VB6A 1S66L 2KDKA 2ZBBA 2L1MA 4LRZE 5HWVA 4I5SA 2INWA 1UWPX 4I3AA 1TS6A 4EQ1A 1TS0A 3EWKA 5DKLA 5IU1A 3ZQ5A 4HHDA 3UMEA 4DJ3A 2QHKA 1WA9A 2VV6A 3LYXA 1XJ3A 2L0WA 1GSVA 2OOLA 4HQAA 4R3AA 3UMDA 3LIFA 1S1ZA 3SW1A 4HOIA 5KIZA 1OTIA 5HDCA 2Z6CA 3HJKA 1XJ4A 2H28A 2D01A 4L9GA 3A0RA 1D06A 3H9WA 2JN7A 3OLOA 1V9ZA 2V1BA 1UWNX 4M4XA 4PKYA 4R38A 3H7WA 3VOLA 5A8BA 4GS9A 3GDIA 2M1CA 1T1AA 2PDRA 4GCZA 2VEAA 3D72A 3CWFA 4XT2B 2P7JA 1EW0A 3K3DA 2PD8A 4L9EA 2PHYA 1BYWA 3VE3A 3LIEA 4LRYC 1ODVA 3A0VA 1X0OA 2J80A 4EEPA 1P97A 4EW7A 2CMNA 3E4PA 4NXBA 3MQQA 1JNUA 2QKPA 4JGOA 4HH3A 1XJ6A 5HDDA 5I5LA 4I3JA 4JGPA 4EEUA 4HIAA 3F1PB 2VLGA 2A24A 4HY8A 1S4RA 3E4OA 2R78A 3ULFA 1OTAA 4HP4A 2VV7A 1P0ZA 2KX6A 3LI8A 2A24B 3EEHA 3BY9A 3NOPC 4HNBA 4LRXC 4RQ9A 1F9IA 2B02A 2OWJA 5DKKA 5HD3A 3RTYA 4F3LA 5HDSA 4GW9A 3UB9A 4WL9A 4GHIA 4MN5A 3LIDA 4JGRA 4R6LA 4HJ4A 4I3IA 3IS2B 3MFXA 5AVEA 4BBTA 2GJ3A 3LIBA 5IS1A 1KOUA 4GHIB 1XJ2A
chains in the Genus database with same CATH superfamily
1CQAA 3LR0A 4DJ2A 3G30A 5G4YA 4N9KA 3FWLA 2WZZA 3BWLA 1LI9A 3NC8A 4S2NA 3FZCA 3QNBA 1L3LA 4OPYA 2ZOIA 5FI7A 1O07A 3M6BA 3ZHHA 4DN0A 3NBLA 1FSWA 1N9NA 5CTNA 5EE8A 3V50A 4MLLA 1W63M 2XFTA 3Q82A 4UAAA 4JBFA 4OPZA 3HCYA 3QP4A 5MC7A 2XA7M 4B4ZA 4ZBEA 1MBLA 4OQ0A 3MR0A 3RH8B 4C3QA 1XX2A 4GJ4A 4BD0A 4LRZE 2ZQ9A 4KENB 3D9YA 5F1GA 4KG6A 3A0RA 3UN7A 1F2KA 1ONGA 4PKYA 4OKPA 2ZC7A 3O88A 3FPVA 4OVDA 4MN7A 5L07A 3JVVA 1W5DA 3G32A 4G3KA 5FASA 4QY6A 3ZVWA 3UDXA 5CHMA 5CXWA 3QP6A 3ZCZA 3SOIA 3WS0A 1P9WA 1K6RA 3IWIA 1JTGA 3SH9A 5HX9A 4HP9A 1LT0A 1VETB 4H6JA 4QHCA 4DE2A 3HUOA 4XXRA 2XFSA 2EX6A 2OV5A 5E2EA 4GNUA 4HBTA 1AXBA 5CGXA 1YM1A 4E04A 4CPKA 4BENA 2X02A 3T1SA 2YKHA 5HSQA 2DRWA 5CEDA 1NJ4A 2A2LA 2HJEA 3CPTA 3MXQA 2W1RA 4GKUA 4KG2A 4I38A 1YLWA 3K3CA 4I39A 2G2WA 1GA9A 3IS2A 3T4OA 2A3UA 1OJ5A 2EX8A 4P85A 4XUZA 2JC7A 4X6TA 1ZC2A 1K25A 4ME4A 4P87A 3L7HA 3P01A 4AFIA 3BQ8A 2WADA 2INWA 2ZL1A 2VX8A 1KE4A 3ZQ5A 1PWCA 2FFYA 5KIZA 5DF9A 2H28A 3ZDJA 1W8YA 2Y2MA 3EEAA 1RCJA 3NIAA 5HAQA 4WM9A 3O86A 2PHYA 4EWFA 5DF7A 5EOEA 2XEPA 2DNSA 3F1PB 2A49A 3MZDA 3LI8A 1PI4A 4GHIA 4HJ4A 1Z6FA 3GV9A 4G3WA 1GSWA 3FC7A 3T4KA 3E4QA 4LGWA 2RCXA 3NJAA 5I94A 4NG2A 3QNCA 1Y4OA 2ZM8A 3H82B 2EFXA 2W1TB 3KSGA 5F68A 3FPWA 1OT9A 3VE4A 4RA7A 1T1BA 2NUTC 4WBGA 5GLAA 3ICYA 5EPHA 1E3UA 4JXSA 2VV8A 1IKGA 3PAEA 4DKIA 2XDMA 1S67L 1K38A 2V2FF 3RXWA 1PFLA 2WGWA 4KZ9A 3QP8A 3IXGA 5EFWA 2HP9A 2QJ7A 4RX3A 4MBHA 3UDIA 3JYIA 4C6YA 3PAGA 4FOFA 4KZ5A 2LB5A 5DFXA 4I3AA 5L10A 1GHPA 4HQAA 4BMWA 3OPRA 2D01A 1BLSA 4FUWA 2PBYA 3UPNA 4OQIA 2GNXA 4EBNA 2HDQA 3A0VA 5FL3A 4B93A 4FH4A 4GLQA 3RFBA 2XGNA 2VLGA 4YFMA 3KYQA 4R3JA 4HP4A 2ZMFA 5HD3A 1H8ZA 1HVBA 1YSPA 4F3LA 5HPIA 4Y17A 2HP6A 4MCWA 4Z1WA 3IX3A 4PM9A 1E4DA 4E6WA 4LFUA 1SZVA 3KO6A 5HWTA 3OBFA 1GSXA 3LR5A 3DAVA 3M6HA 2J7VA 1K55C 4YNRA 1S4SA 2VGJA 4BQMA 3LI9A 3UB8A 3DWKA 3ZVTA 1K54A 2UWXA 2EX9A 2Y91A 3H82A 1VEUA 1M6KA 5FI6A 3NOUC 3OC2A 4S2MA 2QPNA 1LL8A 3ITAA 4GOGA 3W4QA 3NY4A 4GS9B 4HH2A 1MKMA 4HI4A 1PWDA 3D4FA 3KX0X 1L0GA 2OSUA 3UPOA 3T4SA 4ESPA 1EWZA 2WGWB 4LV3A 4B4XA 1G28A 1JTDA 2YKFA 4K0XA 2WUQA 3HLFA 4DRTA 5HWVA 3EOIA 4KQQA 2JCHA 2C6WB 1XJ3A 2W3EA 1PI5A 3BW6A 1FCOA 5L09A 3PBQA 4XT2B 2H0YA 3KYEA 2PDRA 1NZUA 3CHWP 3T4LA 4E3NA 4Y13A 4Q0IA 4KZAA 3CITA 1BT5A 3CUEC 3EEHA 2VGKA 3BY9A 2Z2LB 3Q7ZA 4R6LA 1K56A 5HAIA 2NUPC 3C4OA 4X25A 5TGFA 4H6JB 5FQIA 3DTMA 1H0MA 4DF6A 1BTLA 1K6SA 2W3HA 2OAP1 1VHMA 1K4EA 3GECA 4OONA 4QPRA 4KZ8A 1ES4A 5DFYA 2XQZA 5EVIB 4IUHA 3MBZA 5EOOA 1I2WA 3IHAA 3WRTA 4YINA 1F98A 3LO7A 1BZAA 2BLSA 3MXSA 3V67A 5FDHA 1KVMA 3O3VA 3IHBA 4GDNA 2J9OA 1ZG6A 4PM6A 2OLUA 3KSIA 5TJJA 2PBDP 1AWIA 5DTKA 3NI9A 4DJ3A 2OOLA 1I2SA 1CF0A 3LIFA 3IQAA 5FI2A 3AGFA 4KZ7A 4MMNA 1HLUP 1SKOA 4FTXA 3G31A 3PBSA 1Y54A 1BYWA 3IH8A 3HLDA 5FATA 3C7VA 3E4PA 3C4PA 4HIAA 4WYYA 4HY8A 3EQUA 3A3DA 3ZG7B 5L2FA 3HREA 4X69A 2HJ9C 2Q9NA 4LV2A 2B02A 2XRNA 1SDEA 3LCEA 3D3OA 5KZHA 4RYEA 4A5RA 3LIBA 1G5UA 4PMAA 4EERA 1RGYA 3OPLA 5G4ZA 3ZG8B 1K56D 3CUEA 3VP2A 3BLSA 3IBJA 2K31A 3S1YA 2Y2KA 4ZRRA 3F1OB 4LCLA 1WYBA 1NWZA 1SCWA 2L4RA 3NCKA 4PKYG 2VJWA 1PW1A 4LLOB 2HZ5A 1H5XA 3N7WA 3TG9A 2V0UA 1NRJA 4E3IA 5CHJA 4R0QA 3G6OA 4NXEA 3PYPA 1STZA 3BRMA 3MF0A 1SKFA 3G2YA 4QWOA 5FQJA 1XJ2A 4EV4A 4F94A 4FCFA 2G7UA 4S2OA 3MQOA 3BECA 3MXRA 4DMZA 3RJUA 2KLIA 2HV1A 1VB6A 2BTFP 3LGOA 1L0EA 1WA9A 1NYMA 1IFQA 1PZOA 1FCMA 2W3GA 2Y4AA 4L9GA 1ZKJA 3BM6A 1ACFA 1V9ZA 2FFFB 1FOFA 4GS9A 2Y2GA 1EW0A 2JKFA 1K55A 2Y59A 5EVLA 3BFDA 1OTAA 5D3OA 5DKKA 3UE0A 4KZ3A 4MN5A 3LIDA 4JGRA 3HLCA 5E2HA 4LENA 1S6RA 2WKQA 1W7FA 4G3VA 5AVFA 5G18A 1TEMA 1FILA 2QJ5A 1OT6A 1WYCA 3N8RA 3ZG0A 4MEZA 3B33A 3P7NA 2IA2A 1PYYA 2O9BA 4N1HA 5KMWA 4CLCE 3A0SA 2O9CA 2JE5A 3PBNA 4WUJA 5GHZA 4KQDA 5BOHA 1YKDA 1Q2PA 3Q7VA 3RXXA 5A92A 3IX8A 1BLHA 2V1ZA 3W4PA 5HWWA 5TBMB 1TS7A 3VP1A 5F69A 5J7EA 4EUZA 2EFUA 3TRCA 4C75A 2VGLM 3UE6A 4WMCA 4MN6A 4BBUA 1LSVA 3BFGA 5FQQA 4OOMA 5A91A 1L2SA 3HUNA 3HVFA 3UE1A 4D60A 5HDCA 1XJ4A 2PAVP 4KQRA 2PU4A 4M4XA 1XP4A 3C7UA 3ZFZA 1UWNX 3A3IA 3GDIA 3L9KA 3LIEA 5CECA 4IHQA 4JGPA 5FQ9A 3IXBA 1DJCA 4R4SA 2FH5A 3RTYA 4N1XA 3ZNTA 2P74A 4WL9A 3V3RA 1NY0A 4Q0JA 2Q0OA 4WEKA 1GHIA 2P9VB 2ZQCA 3WS5A 3IH9A 4Y5FA 1OTDA 2ZQDA 3W4OA 2WZXA 5E2GA 5TFQA 4FD8A 2ZC4B 4K91A 4NKPA 3CG5A 3HLGA 4EETB 4U3TA 5E2FA 4OQHA 5FAPA 5CGWA 2ZJ9A 4L0LA 3B3XA 4X56A 1FR1A 1D7EA 1NLYA 5HW3A 4CLCC 3T50A 3MKEA 2PRFA 2Y2OA 3IX4A 2PR6A 1GHMA 2DCFA 3SS5A 5TR7A 3MKFA 3UB5P 2JHEA 3SS3A 5A93A 1XKZA 2WAFA 2VV6A 1BSGA 1YSQA 1M40A 1PWGA 4UA7A 3HLWA 4Q8IA 3S7OA 1D06A 1H8YA 3OLOA 1DY6A 3Q7VB 2VZWA 5F1FA 4R23A 4IVIA 3T1RA 3K3DA 2ZC3B 5HARA 4NXBA 3TSGA 5HDDA 4II7A 1KVLA 2ZC6B 2Y55A 4GN2A 2KX6A 1W63Q 4HNBA 2W1TA 4Y7PA 1RP5A 4OQGA 1ESIA 5GLBA 2HGVA 4P6ZM 1V9YA 2WKRA 1VETA 3C8CA 3VP3A 3N8LA 4WLAA 3EGDC 4E3OA 4HJ6A 4ARZB 2OLVA 1DP6A 3G35A 2J3TC 2XR0A 4ETZA 4S2IA 2XROA 3G2ZA 4IJGA 5EM0A 5AJGA 3UE3A 4RX2A 4HEFA 3R7WB 5F83A 3CPTB 4X55A 4U0TA 1XA7A 5EUAA 5FDSA 1BLPA 4Q0HA 4ID4A 4MBFA 2B95A 1ALQA 3FKWA 3R7WA 1IYSA 1JWPA 3U2AA 4GB7A 2G2UA 3CI6A 1JVJA 3K2NA 1ZHHB 5EVIC 4GD8A 4HJ3A 1CI8A 5FEFA 2GX5A 4BWIA 1N9LA 4IEDA 2AVXA 5KSHA 2JKRI 2M7VA 2L1MA 4IVKA 4PM5A 4P6BA 1TS6A 4OP8A 3GQZA 5DKLA 1JWVA 1H3QA 2L0WA 3TE8A 1LHYA 3BLMA 1H8MA 5DVAA 1KGFA 5FAOA 3VFHA 2UV0E 1XXMA 2GZAA 4L9EA 1EI5A 2EXBA 3LEQA 2XLNA 4HBUA 4S2NC 3E98A 4HH3A 1ESUA 3E4OA 5FSRA 4E6XA 1IOUA 1RGZA 1CK3A 4X53A 5EVEA 1CJFA 3UB9A 2PU2A 1MPLA 3GR2A 4WEJA 5IS1A 1KOUA 3KSFA 1OJGA 3DTIA 3BFEA 3NDEA 1Z09A 1OMEA 2QYBA 5HD5A 3V3SA 3VOYA 5J4EA 3KSHA 1PW8A 2WKPA 4BL3A 5EV0A 2GDNA 4ZDXA 3LUQA 4KZ4A 3O5YA 3BFFA 3T4TA 3H7WB 3TJZC 1TDGA 5E43A 1IELA 1N9BA 3JPUA 3S7QA 1BUEA 3GRJA 5AQAA 3UDFA 1MWTA 3BFCA 3CAXA 3NDGA 3UB7A 2EA9A 5CRFA 1S1YA 4DDSA 1MY8A 1XGIA 4S2PA 4DE3A 4XT2A 2Z2MB 4PHTA 4WN5A 1ES2A 2V9AA 2PYPA 4BLMA 2K2NA 3DW0A 1SHVA 5KSCA 2Z6DA 4EESA 2PD7A 3MZFA 4EXOA 2XD1A 3I7JA 5J8XA 1TS0A 3HLBA 2QMIA 1YPRA 1KE3A 1ONHA 3H9WA 5DTTA 3E2KA 4WMCD 4DE0A 4JLFA 1ES5A 3VE3A 3B42A 1X0OA 2J80A 3HL9A 4P6ZS 1LL5A 4Y0UA 1TDLA 2C5WB 2M7UA 3FV7A 2X71A 4EEUA 3S7NA 4JXVA 4YOFA 1PIOA 2X01A 1OPXA 4RVAA 3LY4A 2A24B 2VKSA 4RQ9A 1TF1A 4PPRA 2LB9A 2HF6A 1E25A 5AVEA 3QHYA 1K0KA 3PHYA 1FSYA 3N6IA 1XFNA 4ZJ2A 3T12B 1ES3A 3WWXA 5K5BA 3OZHA 4Y15A 1MC0A 1YLZA 3F1OA 4Y3IA 1XPBA 2ZMVA 3UPPA 4R1GA 3WS4A 3IT9A 2ZM2A 4UQIS 3V5MA 3DTEA 2EWVA 3IXDA 1U60A 3MJQA 1KDSA 3IWQA 1F5MA 3BY8A 4OPQA 1CI9A 2EWWA 3DTKA 3SS4A 3WS2A 2OWHA 2PYRA 5HZHA 4E3KA 4S2JA 4MNRA 3PXPA 4B88A 1L0DA 2Y2HA 2ZOHA 2JBFA 4S2LA 4XUXA 4NETA 1BLCA 3LIAA 4EUVA 4M3KA 2HP5A 1K57C 5CX7A 3C30A 3E0YA 2O9AA 4R4RA 5CTMA 1MWSA 3Q07A 1YMXA 4I5SA 5CERA 5IU1A 1C3BA 1D1JA 2ZC5B 4Y0OA 5CEBA 3SW1A 4KZBA 1OTIA 1ERQA 2ACGA 2ZL1B 1YQSA 4D2OA 1FIKA 4IBRA 2V1BA 2JKTI 2M1CA 2P7JA 3OPHA 2W3FA 1NYYA 5HAPA 1W8QA 2QKPA 4E3JA 5I5LA 2HDRA 3HBRA 3ULFA 2VV7A 1P0ZA 4ZJ1A 1N4OA 3SZTA 3PR6A 1PNEA 3PBTA 2VA0A 4DXBA 4ZJ3A 1NZOA 1G6AA 2J3TD 4DDYA 1ZG4A 1G68A 1T18A 2WK0A 2B5RA 4DE1A 2WAEA 5JYOA 2IWBA 3CZDA 4WF0A 4ZAMA 3LY3A 2Y2NA 3Q81A 3TW8A 5DF8A 3FYZA 3TOIA 5GL9A 4E3MA 3PTEA 1KGEA 1MZUA 4NXFA 1DP9A 3HUMA 2P08A 2Y2PA 3HJIA 3ZG5A 3HLEA 3C38A 4O01A 4UA9A 5DJTA 1NLZA 2XK1A 3M2JA 2QZ6A 3CJMA 1VEUB 1KGGA 4OH0A 4BJPA 2R9WA 1UGUA 4QJGA 3LR4A 5IHVA 1FR6A 5F82A 3T1XA 5L8MA 1YAXA 4OP5A 2ZBBA 1GA0A 1XA1A 3Q1FA 4CLCB 1O7EA 3JVUA 3UMEA 2QHKA 5U47A 1SDNA 3MQ0A 3HJKA 1J9MA 3NULA 5A8BA 1T1AA 4LCMA 4P0MA 5A90A 4JF5A 2WGIA 1G6OA 3OCLA 2XSSA 4JGOA 5GLDA 2Q9MA 5EECA 1JWZA 3NOPC 4IBXA 5M1AA 1F9IA 3T4QA 2WKEA 5FEGA 3IF6B 3U4LP 1LSWA 4BL2A 2JKTM 5IT5A 4EBLA 4OOYA 4NK3A 4NEED 5JYPA 1K54C 1FQGA 5DTSA 5EM1A 1QMEA 3F1NA 3VV4A 3G34A 2D02A 4B9OA 2RL3A 1DRMA 2ZQ7A 2P04A 3BYDA 4ARZA 4LV0A 1MWRA 3T4JA 1YLYA 3FG8A 5J3WA 3R4KA 4EQIA 4O0PA 3NECA 3SH7A 5EVIA 1IEMA 1YLJA 4X1LA 1W79A 1PRQA 3VSLA 1K57A 1OTBA 3ISGA 2I9VA 1Y28A 3DWZA 4WZ5C 2WGVA 2K7SA 4WZ4A 1TD5A 3A3EA 2WYXA 5AQBA 1YLPA 4EQ1A 3M2KA 3LFVA 2HPBA 1SKOB 5GHYA 5HL1A 2ZM0A 4R3AA 3UMDA 3O87A 2Z6CA 3P98A 4R38A 3H7WA 4GZBA 4GCZA 4R3BA 1LLBA 3A3JA 1P97A 4QU3A 2Y8HA 1JNUA 5FQMA 1CEGA 2A24A 4ETXA 4WZ5A 2OWJA 1KDWA 5HDSA 4GW9A 2V8FA 3IS2B 3MFXA 5FQKA 4NXGA 5HL6A 4Z9QA 3ZG9B 1T19A 1OTEA 4IUKA 3CMZA 2V0WA 2V8CA 2Y2QA 2HDUA 4Y2FA 4PAUA 4R70A 1GCEA 2IWDA 3F1NB 3UB6A 3VMAA 1DJAA 2R9XA 3BQAA 1HZOA 3LICA 2XA7S 5GHXA 4BBVA 3BEBA 4N92A 3IF6A 3MZEA 3UY6A 1A0KA 3IBRA 4S2KA 2DMWA 5GLCA 2ZQAA 4U0XA 2HDSA 1QMFA 2XD5A 5AQ7A 4JGQA 4K08A 5FAQA 2W0NA 3IF5A 1DP8A 1PZPA 3NOTC 3C2WA 2W27A 4E3LA 1LSXA 2KDKA 4WELA 3OOVA 1YMSA 1S0WA 2W3DA 3W2ZA 3WS1A 4JXGA 3GTCA 1XGJA 4UHUA 4JKTA 2P9VA 4CLCD 1L0FA 3VOLA 2XH9A 5FA7A 3P09A 3IF6C 1ERMA 4EW7A 4OOLA 2I72A 4I3JA 4FH2A 2V20A 1S4RA 1VM1A 1VQQA 3GSGA 2E8IA 3VFFA 2CC1A 4OLDA 1LI0A 4EBPA 3MSHA 1E3UD 1WE4A 2H0TA 4HESA 4JF4A 3VSKA 1NXYA 2JKGA 3AGEA 4L9FA 1TVFA 2VK3A 5DJUA 3VOZA 4KG5A 3S7PA 1I5QA 1ZTUA 1DJBA 2BASA 2JKRM 2J9PA 4QD4A 4X1MA 3N8SA 5LBRA 3V39A 3WRZA 1XFQA 4UQIM 3NHQA 1NRFA 3UNWA 2ZLYA 3BJNA 2BG1A 1EROA 1T1CA 1TS8A 3OCNA 1MKIA 3MMHA 3A3FA 3QP2A 2PT7A 3IXHA 2Y79A 4F3LB 1K4FA 4UEYA 1HTZA 4KUOA 5CHUA 1Q2QA 2B18A 2KOIA 3VP4A 4CLCA 4KZ6A 2EX2A 3ZNYA 3QP5A 3EWKA 1IYPA 2OAQ1 1P9RA 2Y2JA 1S1ZA 3GMWA 3W8KA 4BD1A 1MWUA 4O7DA 3C5AA 2E8JA 2WKIA 2JN7A 2FZ0A 3T1QB 2J8YA 2VEAA 4OPRA 5HFOA 3CWFA 2PD8A 2ZD8A 4LRYC 1IYQA 3MQQA 1HD8A 3AGDA 4EU0A 1MXOA 3PBOA 4CJNA 3ZYTA 4LRXC 5M18A 5AQ9A 4H8RA 4I3IA 3FKVA 2GJ3A 1YLTA 2O99A 4GHIB 2H5SA 1N9OA 4N9LA 1J3WA 3N4IA 1IKIA 3ITBA 3LEZA 2ZMAA 2ZQ8A 5F6AA 4FSFA 4GD6A 4PM7A 3G4PA 4KQOA 4ZTKA 3EGXC 5CGSA 3IWOA 3CLOA 3S4XA 4DXCA 3B47A 5F5YA 4YWZA 4JXWA 3EQVA 3DBAA 3VP0A 4KUKA 2XF3A 4K0WA 4MBKA 2V1AA 4CQHA 3OPPA 4LPZA 4Y0TA 3QP1A 4O8GA 4PM8A 2Y2LA 2VGLS 5TBMA 3F1PA 2PR5A 2H10A 2QWSA 1FCNA 1S66L 5HPFA 4JPMA 1YT4A 1BULA 1UWPX 4QY5A 3MS6A 2WKHA 4HHDA 3LYXA 1GSVA 4UA6A 3PBRA 4HOIA 3UO9A 5M19A 4MDZA 3KYZA 4QB8A 3D72A 2Y2IA 5C5KA 3S22A 2J3WA 1ODVA 1CEFA 4EEPA 2CMNA 4OLGA 3ZGAB 3LR3A 4JF6A 1XJ6A 2R78A 2MJ6A 3GVBA 1IYOA 3SH8A 1KE0A 2O0YA 5EVID 2IWCA 1LL9A 2EXAA 4X68A 3E2LA 4BBTA 3MFDA 4LV1A 4GDBA
chains in the Genus database with same CATH topology
1V9YA 1LSWA 2WKRA 2JKTM 3C8CA 3LR0A 5IT5A 4DJ2A 4NEED 4WLAA 3EGDC 4H6JB 5G4YA 4HJ6A 4ARZB 1DP6A 3BWLA 2J3TC 3F1NA 3VV4A 4ETZA 2W3HA 2OAP1 1VHMA 2D02A 3GECA 2XROA 4QPRA 2ZOIA 4B9OA 4IJGA 1DRMA 5AJGA 2P04A 5DFYA 3UE3A 3R7WB 4IUHA 4DN0A 1N9NA 4ARZA 4Q0HA 1F98A 3T4JA 3FG8A 5J3WA 3R4KA 4O0PA 3V67A 3R7WA 3U2AA 1W63M 3CI6A 3K2NA 1ZHHB 3HCYA 1OTBA 4HJ3A 2I9VA 3KSIA 2GX5A 5MC7A 1Y28A 4BWIA 2XA7M 1N9LA 5TJJA 2K7SA 5KSHA 3MR0A 3RH8B 1TD5A 2JKRI 2M7VA 4GJ4A 2L1MA 4LRZE 1TS6A 4EQ1A 3LFVA 5DKLA 1H3QA 4DJ3A 4R3AA 2L0WA 2OOLA 3TE8A 3UMDA 3LIFA 2Z6CA 1H8MA 3A0RA 4MMNA 4PKYA 4R38A 2GZAA 3H7WA 4GCZA 4L9EA 3PBSA 3FPVA 1BYWA 1P97A 3E4PA 4MN7A 2Y8HA 1JNUA 3E98A 4HH3A 4HIAA 2A24A 4HY8A 3E4OA 3JVVA 3EQUA 4G3KA 1IOUA 4ETXA 2HJ9C 2B02A 2XRNA 2OWJA 5HDSA 4GW9A 3UB9A 3D3OA 3IS2B 3MFXA 4WEJA 3LIBA 5IS1A 1KOUA 1P9WA 3KSFA 4NXGA 5HL6A 1OJGA 2QYBA 4EERA 5HD5A 5J4EA 3KSHA 4HP9A 5G4ZA 1T19A 3CUEA 1OTEA 2WKPA 4IUKA 1LT0A 4H6JA 3IBJA 2K31A 3LUQA 4ZRRA 3O5YA 3F1OB 2V0WA 4Y2FA 3T4TA 4PAUA 1NWZA 4R70A 3H7WB 3F1NB 2L4RA 3TJZC 3UB6A 4E04A 4PKYG 2VJWA 2YKHA 3BQAA 3S7QA 5HSQA 3LICA 4LLOB 2XA7S 3CAXA 4BBVA 2A2LA 2HJEA 2V0UA 3UB7A 2EA9A 3MXQA 1NRJA 2W1RA 1S1YA 3IBRA 4I38A 3G6OA 3K3CA 4NXEA 4XT2A 3PYPA 2DMWA 4I39A 3T4OA 3IS2A 4PHTA 1STZA 4WN5A 2V9AA 2PYPA 1OJ5A 3MF0A 2K2NA 4JGQA 4K08A 2W0NA 4ME4A 3P01A 1DP8A 4AFIA 2Z6DA 2G7UA 4EESA 2PD7A 3MQOA 3BQ8A 4DMZA 3NOTC 4EXOA 2KLIA 3C2WA 2HV1A 2W27A 1LSXA 1VB6A 2KDKA 4WELA 3OOVA 2INWA 1TS0A 2VX8A 3ZQ5A 2W3DA 1WA9A 3W2ZA 1IFQA 5KIZA 2W3GA 5DF9A 2H28A 4CLCD 4L9GA 3EEAA 3H9WA 3VOLA 1V9ZA 4P6ZM 4GS9A 1EW0A 2PHYA 3VE3A 3B42A 1X0OA 2J80A 4P6ZS 4EW7A 4OOLA 2M7UA 4I3JA 4EEUA 3F1PB 3S7NA 1S4RA 1OTAA 4YOFA 1OPXA 3LI8A 2A24B 2VKSA 5DKKA 4RQ9A 1TF1A 2LB9A 2HF6A 4GHIA 4MN5A 3LIDA 4JGRA 4HJ4A 5AVEA 4G3WA 1GSWA 2WKQA 3FC7A 3PHYA 4L9FA 3T4KA 5DJUA 1XFNA 4G3VA 3S7PA 5AVFA 1ZTUA 3E4QA 2QJ5A 1OT6A 3NJAA 2BASA 5K5BA 1MC0A 2JKRM 3F1OA 4Y3IA 3B33A 3P7NA 2IA2A 3H82B 5LBRA 2W1TB 3KSGA 2ZMVA 5F68A 2O9BA 1OT9A 1XFQA 3FPWA 3VE4A 4UQIM 3NHQA 4CLCE 3A0SA 1T1BA 2NUTC 4UQIS 3BJNA 3ICYA 2EWVA 2O9CA 1T1CA 3PBNA 3MJQA 1F5MA 4WUJA 4KQDA 2VV8A 3BY8A 1TS8A 1YKDA 3OCNA 3MMHA 1S67L 2EWWA 5HWWA 2OWHA 2PYRA 2PT7A 5HZHA 5TBMB 1TS7A 3PXPA 2Y79A 2ZOHA 4F3LB 5F69A 5J7EA 3TRCA 5EFWA 3LIAA 4EUVA 2QJ7A 2VGLM 3UE6A 5CX7A 4UEYA 3C30A 4MN6A 4BBUA 3E0YA 4KUOA 2B18A 1LSVA 2KOIA 2O9AA 4FOFA 4CLCA 2LB5A 4I5SA 5DFXA 4I3AA 4OOMA 3EWKA 5IU1A 2OAQ1 4HQAA 1P9RA 1S1ZA 3SW1A 1OTIA 5HDCA 4BMWA 1XJ4A 2D01A 4M4XA 2JN7A 2FZ0A 2JKTI 1UWNX 2V1BA 3GDIA 2M1CA 2VEAA 3CWFA 2P7JA 2PD8A 2GNXA 3LIEA 3A0VA 2W3FA 4LRYC 5FL3A 3MQQA 2QKPA 4IHQA 4B93A 4EU0A 4GLQA 5I5LA 4JGPA 3RFBA 3PBOA 2VLGA 3ULFA 3KYQA 4HP4A 2VV7A 1P0ZA 3ZYTA 4LRXC 2ZMFA 2FH5A 3PR6A 1YSPA 3PBTA 5HD3A 3RTYA 4F3LA 5HPIA 2VA0A 4WL9A 4MCWA 4Z1WA 4I3IA 2GJ3A 2O99A 2J3TD 4GHIB 4Q0JA 4WEKA 3KO6A 1T18A 5HWTA 3OBFA 1GSXA 1N9OA 4Y5FA 1OTDA 3LR5A 4WF0A 4YNRA 1S4SA 5F6AA 3TW8A 4FSFA 4NKPA 4EETB 1MZUA 4KQOA 4NXFA 3LI9A 3UB8A 1DP9A 4L0LA 3EGXC 3CLOA 2P08A 3H82A 3HJIA 1D7EA 3B47A 5F5YA 4YWZA 3C38A 3NOUC 3OC2A 3EQVA 3DBAA 4O01A 1LL8A 1NLYA 4KUKA 5DJTA 3T50A 4CLCC 1NLZA 2V1AA 4CQHA 4GS9B 4LPZA 4HH2A 2PR6A 1MKMA 4HI4A 4O8GA 4BJPA 1UGUA 2JHEA 3KX0X 2VGLS 3LR4A 3T4SA 5TBMA 3F1PA 2PR5A 2QWSA 1G28A 2YKFA 5L8MA 1S66L 1YAXA 5HPFA 2ZBBA 5HWVA 1UWPX 3EOIA 4CLCB 3JVUA 4HHDA 3UMEA 2QHKA 2VV6A 3LYXA 1XJ3A 1GSVA 1YSQA 2W3EA 3PBRA 4HOIA 3MQ0A 3BW6A 3HJKA 4MDZA 3S7OA 3PBQA 1D06A 4XT2B 3OLOA 3KYZA 5A8BA 2VZWA 1T1AA 2PDRA 3D72A 3T4LA 3K3DA 5C5KA 4Q0IA 2J3WA 1ODVA 4EEPA 2CMNA 1G6OA 4NXBA 3OCLA 2XSSA 3LR3A 4JGOA 1XJ6A 4II7A 5HDDA 2R78A 2MJ6A 3CITA 3CUEC 2KX6A 2O0YA 1W63Q 3NOPC 2W1TA 3BY9A 3EEHA 4HNBA 1F9IA 3T4QA 4R6LA 4BBTA 2NUPC 2HGVA 1XJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSW A;  1V9Y A;  4NXG A;  1OJG A;  1LSW A;  2WKR A;  2WKQ A;  3FC7 A;  3PHY A;  4L9F A;  3UB7 A;  3C8C A;  4EER A;  5HD5 A;  5HWT A;  1T18 A;  4DJ2 A;  5J4E A;  4WLA A;  1GSX A;  1N9O A;  4HP9 A;  5DJU A;  4H6J B;  5G4Z A;  1T19 A;  5G4Y A;  1OTD A;  1OTE A;  1XFN A;  2WKP A;  5AVF A;  4HJ6 A;  1LT0 A;  3E4Q A;  1DP6 A;  3BWL A;  4H6J A;  3F1N A;  2QJ5 A;  4WF0 A;  3LUQ A;  1OT6 A;  3F1O B;  3NJA A;  1S4S A;  2BAS A;  2D02 A;  2V0W A;  5F6A A;  3GEC A;  2ZOI A;  3F1O A;  4B9O A;  1DRM A;  4EET B;  3B33 A;  1NWZ A;  3P7N A;  3H7W B;  4R70 A;  3F1N B;  3H82 B;  1MZU A;  2L4R A;  3UB6 A;  4E04 A;  4PKY G;  5F68 A;  4NXF A;  3LI9 A;  1OT9 A;  1XFQ A;  3UB8 A;  3VE4 A;  1DP9 A;  1N9N A;  3NHQ A;  3A0S A;  2YKH A;  1T1B A;  3CLO A;  5HSQ A;  3LIC A;  4LLO B;  3H82 A;  3CAX A;  3HJI A;  1F98 A;  3ICY A;  4BBV A;  3FG8 A;  5J3W A;  1D7E A;  5F5Y A;  4YWZ A;  2V0U A;  1T1C A;  2EA9 A;  3MJQ A;  3MXQ A;  3NOU C;  4KQD A;  1S1Y A;  2VV8 A;  1TS8 A;  3BY8 A;  4WUJ A;  1LL8 A;  3IBR A;  4I38 A;  4KUK A;  3G6O A;  1S67 L;  5DJT A;  3T50 A;  3K3C A;  4NXE A;  4XT2 A;  3PYP A;  5HWW A;  2OWH A;  4I39 A;  2V1A A;  2PYR A;  3IS2 A;  4WN5 A;  5TBM B;  2V9A A;  5HZH A;  2PYP A;  1OJ5 A;  4GS9 B;  4LPZ A;  1TS7 A;  4HH2 A;  2PR6 A;  4HI4 A;  2ZOH A;  1OTB A;  4JGQ A;  4K08 A;  4F3L B;  2W0N A;  2I9V A;  4HJ3 A;  5F69 A;  5J7E A;  5EFW A;  1Y28 A;  1UGU A;  2JHE A;  3LIA A;  2QJ7 A;  1DP8 A;  1N9L A;  3KX0 X;  5TBM A;  2Z6D A;  3UE6 A;  4EES A;  2PD7 A;  3F1P A;  3MQO A;  4MN6 A;  2K7S A;  4BBU A;  2PR5 A;  4KUO A;  3NOT C;  2QWS A;  4EXO A;  1LSV A;  2HV1 A;  2W27 A;  3C2W A;  3MR0 A;  3RH8 B;  1G28 A;  2YKF A;  1LSX A;  1VB6 A;  1S66 L;  2KDK A;  2ZBB A;  2L1M A;  4LRZ E;  5HWV A;  4I5S A;  2INW A;  1UWP X;  4I3A A;  1TS6 A;  4EQ1 A;  1TS0 A;  3EWK A;  5DKL A;  5IU1 A;  3ZQ5 A;  4HHD A;  3UME A;  4DJ3 A;  2QHK A;  1WA9 A;  2VV6 A;  3LYX A;  1XJ3 A;  2L0W A;  1GSV A;  2OOL A;  4HQA A;  4R3A A;  3UMD A;  3LIF A;  1S1Z A;  3SW1 A;  4HOI A;  5KIZ A;  1OTI A;  5HDC A;  2Z6C A;  3HJK A;  1XJ4 A;  2H28 A;  2D01 A;  4L9G A;  3A0R A;  1D06 A;  3H9W A;  2JN7 A;  3OLO A;  1V9Z A;  2V1B A;  1UWN X;  4M4X A;  4PKY A;  4R38 A;  3H7W A;  3VOL A;  5A8B A;  4GS9 A;  3GDI A;  2M1C A;  1T1A A;  2PDR A;  4GCZ A;  2VEA A;  3D72 A;  3CWF A;  4XT2 B;  2P7J A;  1EW0 A;  3K3D A;  2PD8 A;  4L9E A;  2PHY A;  1BYW A;  3VE3 A;  3LIE A;  4LRY C;  1ODV A;  3A0V A;  1X0O A;  2J80 A;  4EEP A;  1P97 A;  4EW7 A;  2CMN A;  3E4P A;  4NXB A;  3MQQ A;  1JNU A;  2QKP A;  4JGO A;  4HH3 A;  1XJ6 A;  5HDD A;  5I5L A;  4I3J A;  4JGP A;  4EEU A;  4HIA A;  3F1P B;  2VLG A;  2A24 A;  4HY8 A;  1S4R A;  3E4O A;  2R78 A;  3ULF A;  1OTA A;  4HP4 A;  2VV7 A;  1P0Z A;  2KX6 A;  3LI8 A;  2A24 B;  3EEH A;  3BY9 A;  3NOP C;  4HNB A;  4LRX C;  4RQ9 A;  1F9I A;  2B02 A;  2OWJ A;  5DKK A;  5HD3 A;  3RTY A;  4F3L A;  5HDS A;  4GW9 A;  3UB9 A;  4WL9 A;  4GHI A;  4MN5 A;  3LID A;  4JGR A;  4R6L A;  4HJ4 A;  4I3I A;  3IS2 B;  3MFX A;  5AVE A;  4BBT A;  2GJ3 A;  3LIB A;  5IS1 A;  1KOU A;  4GHI B;  1XJ2 A; 
#chains in the Genus database with same CATH topology
 1CQA A;  3LR0 A;  4DJ2 A;  3G30 A;  5G4Y A;  4N9K A;  3FWL A;  2WZZ A;  3BWL A;  1LI9 A;  3NC8 A;  4S2N A;  3FZC A;  3QNB A;  1L3L A;  4OPY A;  2ZOI A;  5FI7 A;  1O07 A;  3M6B A;  3ZHH A;  4DN0 A;  3NBL A;  1FSW A;  1N9N A;  5CTN A;  5EE8 A;  3V50 A;  4MLL A;  1W63 M;  2XFT A;  3Q82 A;  4UAA A;  4JBF A;  4OPZ A;  3HCY A;  3QP4 A;  5MC7 A;  2XA7 M;  4B4Z A;  4ZBE A;  1MBL A;  4OQ0 A;  3MR0 A;  3RH8 B;  4C3Q A;  1XX2 A;  4GJ4 A;  4BD0 A;  4LRZ E;  2ZQ9 A;  4KEN B;  3D9Y A;  5F1G A;  4KG6 A;  3A0R A;  3UN7 A;  1F2K A;  1ONG A;  4PKY A;  4OKP A;  2ZC7 A;  3O88 A;  3FPV A;  4OVD A;  4MN7 A;  5L07 A;  3JVV A;  1W5D A;  3G32 A;  4G3K A;  5FAS A;  4QY6 A;  3ZVW A;  3UDX A;  5CHM A;  5CXW A;  3QP6 A;  3ZCZ A;  3SOI A;  3WS0 A;  1P9W A;  1K6R A;  3IWI A;  1JTG A;  3SH9 A;  5HX9 A;  4HP9 A;  1LT0 A;  1VET B;  4H6J A;  4QHC A;  4DE2 A;  3HUO A;  4XXR A;  2XFS A;  2EX6 A;  2OV5 A;  5E2E A;  4GNU A;  4HBT A;  1AXB A;  5CGX A;  1YM1 A;  4E04 A;  4CPK A;  4BEN A;  2X02 A;  3T1S A;  2YKH A;  5HSQ A;  2DRW A;  5CED A;  1NJ4 A;  2A2L A;  2HJE A;  3CPT A;  3MXQ A;  2W1R A;  4GKU A;  4KG2 A;  4I38 A;  1YLW A;  3K3C A;  4I39 A;  2G2W A;  1GA9 A;  3IS2 A;  3T4O A;  2A3U A;  1OJ5 A;  2EX8 A;  4P85 A;  4XUZ A;  2JC7 A;  4X6T A;  1ZC2 A;  1K25 A;  4ME4 A;  4P87 A;  3L7H A;  3P01 A;  4AFI A;  3BQ8 A;  2WAD A;  2INW A;  2ZL1 A;  2VX8 A;  1KE4 A;  3ZQ5 A;  1PWC A;  2FFY A;  5KIZ A;  5DF9 A;  2H28 A;  3ZDJ A;  1W8Y A;  2Y2M A;  3EEA A;  1RCJ A;  3NIA A;  5HAQ A;  4WM9 A;  3O86 A;  2PHY A;  4EWF A;  5DF7 A;  5EOE A;  2XEP A;  2DNS A;  3F1P B;  2A49 A;  3MZD A;  3LI8 A;  1PI4 A;  4GHI A;  4HJ4 A;  1Z6F A;  3GV9 A;  4G3W A;  1GSW A;  3FC7 A;  3T4K A;  3E4Q A;  4LGW A;  2RCX A;  3NJA A;  5I94 A;  4NG2 A;  3QNC A;  1Y4O A;  2ZM8 A;  3H82 B;  2EFX A;  2W1T B;  3KSG A;  5F68 A;  3FPW A;  1OT9 A;  3VE4 A;  4RA7 A;  1T1B A;  2NUT C;  4WBG A;  5GLA A;  3ICY A;  5EPH A;  1E3U A;  4JXS A;  2VV8 A;  1IKG A;  3PAE A;  4DKI A;  2XDM A;  1S67 L;  1K38 A;  2V2F F;  3RXW A;  1PFL A;  2WGW A;  4KZ9 A;  3QP8 A;  3IXG A;  5EFW A;  2HP9 A;  2QJ7 A;  4RX3 A;  4MBH A;  3UDI A;  3JYI A;  4C6Y A;  3PAG A;  4FOF A;  4KZ5 A;  2LB5 A;  5DFX A;  4I3A A;  5L10 A;  1GHP A;  4HQA A;  4BMW A;  3OPR A;  2D01 A;  1BLS A;  4FUW A;  2PBY A;  3UPN A;  4OQI A;  2GNX A;  4EBN A;  2HDQ A;  3A0V A;  5FL3 A;  4B93 A;  4FH4 A;  4GLQ A;  3RFB A;  2XGN A;  2VLG A;  4YFM A;  3KYQ A;  4R3J A;  4HP4 A;  2ZMF A;  5HD3 A;  1H8Z A;  1HVB A;  1YSP A;  4F3L A;  5HPI A;  4Y17 A;  2HP6 A;  4MCW A;  4Z1W A;  3IX3 A;  4PM9 A;  1E4D A;  4E6W A;  4LFU A;  1SZV A;  3KO6 A;  5HWT A;  3OBF A;  1GSX A;  3LR5 A;  3DAV A;  3M6H A;  2J7V A;  1K55 C;  4YNR A;  1S4S A;  2VGJ A;  4BQM A;  3LI9 A;  3UB8 A;  3DWK A;  3ZVT A;  1K54 A;  2UWX A;  2EX9 A;  2Y91 A;  3H82 A;  1VEU A;  1M6K A;  5FI6 A;  3NOU C;  3OC2 A;  4S2M A;  2QPN A;  1LL8 A;  3ITA A;  4GOG A;  3W4Q A;  3NY4 A;  4GS9 B;  4HH2 A;  1MKM A;  4HI4 A;  1PWD A;  3D4F A;  3KX0 X;  1L0G A;  2OSU A;  3UPO A;  3T4S A;  4ESP A;  1EWZ A;  2WGW B;  4LV3 A;  4B4X A;  1G28 A;  1JTD A;  2YKF A;  4K0X A;  2WUQ A;  3HLF A;  4DRT A;  5HWV A;  3EOI A;  4KQQ A;  2JCH A;  2C6W B;  1XJ3 A;  2W3E A;  1PI5 A;  3BW6 A;  1FCO A;  5L09 A;  3PBQ A;  4XT2 B;  2H0Y A;  3KYE A;  2PDR A;  1NZU A;  3CHW P;  3T4L A;  4E3N A;  4Y13 A;  4Q0I A;  4KZA A;  3CIT A;  1BT5 A;  3CUE C;  3EEH A;  2VGK A;  3BY9 A;  2Z2L B;  3Q7Z A;  4R6L A;  1K56 A;  5HAI A;  2NUP C;  3C4O A;  4X25 A;  5TGF A;  4H6J B;  5FQI A;  3DTM A;  1H0M A;  4DF6 A;  1BTL A;  1K6S A;  2W3H A;  2OAP 1;  1VHM A;  1K4E A;  3GEC A;  4OON A;  4QPR A;  4KZ8 A;  1ES4 A;  5DFY A;  2XQZ A;  5EVI B;  4IUH A;  3MBZ A;  5EOO A;  1I2W A;  3IHA A;  3WRT A;  4YIN A;  1F98 A;  3LO7 A;  1BZA A;  2BLS A;  3MXS A;  3V67 A;  5FDH A;  1KVM A;  3O3V A;  3IHB A;  4GDN A;  2J9O A;  1ZG6 A;  4PM6 A;  2OLU A;  3KSI A;  5TJJ A;  2PBD P;  1AWI A;  5DTK A;  3NI9 A;  4DJ3 A;  2OOL A;  1I2S A;  1CF0 A;  3LIF A;  3IQA A;  5FI2 A;  3AGF A;  4KZ7 A;  4MMN A;  1HLU P;  1SKO A;  4FTX A;  3G31 A;  3PBS A;  1Y54 A;  1BYW A;  3IH8 A;  3HLD A;  5FAT A;  3C7V A;  3E4P A;  3C4P A;  4HIA A;  4WYY A;  4HY8 A;  3EQU A;  3A3D A;  3ZG7 B;  5L2F A;  3HRE A;  4X69 A;  2HJ9 C;  2Q9N A;  4LV2 A;  2B02 A;  2XRN A;  1SDE A;  3LCE A;  3D3O A;  5KZH A;  4RYE A;  4A5R A;  3LIB A;  1G5U A;  4PMA A;  4EER A;  1RGY A;  3OPL A;  5G4Z A;  3ZG8 B;  1K56 D;  3CUE A;  3VP2 A;  3BLS A;  3IBJ A;  2K31 A;  3S1Y A;  2Y2K A;  4ZRR A;  3F1O B;  4LCL A;  1WYB A;  1NWZ A;  1SCW A;  2L4R A;  3NCK A;  4PKY G;  2VJW A;  1PW1 A;  4LLO B;  2HZ5 A;  1H5X A;  3N7W A;  3TG9 A;  2V0U A;  1NRJ A;  4E3I A;  5CHJ A;  4R0Q A;  3G6O A;  4NXE A;  3PYP A;  1STZ A;  3BRM A;  3MF0 A;  1SKF A;  3G2Y A;  4QWO A;  5FQJ A;  1XJ2 A;  4EV4 A;  4F94 A;  4FCF A;  2G7U A;  4S2O A;  3MQO A;  3BEC A;  3MXR A;  4DMZ A;  3RJU A;  2KLI A;  2HV1 A;  1VB6 A;  2BTF P;  3LGO A;  1L0E A;  1WA9 A;  1NYM A;  1IFQ A;  1PZO A;  1FCM A;  2W3G A;  2Y4A A;  4L9G A;  1ZKJ A;  3BM6 A;  1ACF A;  1V9Z A;  2FFF B;  1FOF A;  4GS9 A;  2Y2G A;  1EW0 A;  2JKF A;  1K55 A;  2Y59 A;  5EVL A;  3BFD A;  1OTA A;  5D3O A;  5DKK A;  3UE0 A;  4KZ3 A;  4MN5 A;  3LID A;  4JGR A;  3HLC A;  5E2H A;  4LEN A;  1S6R A;  2WKQ A;  1W7F A;  4G3V A;  5AVF A;  5G18 A;  1TEM A;  1FIL A;  2QJ5 A;  1OT6 A;  1WYC A;  3N8R A;  3ZG0 A;  4MEZ A;  3B33 A;  3P7N A;  2IA2 A;  1PYY A;  2O9B A;  4N1H A;  5KMW A;  4CLC E;  3A0S A;  2O9C A;  2JE5 A;  3PBN A;  4WUJ A;  5GHZ A;  4KQD A;  5BOH A;  1YKD A;  1Q2P A;  3Q7V A;  3RXX A;  5A92 A;  3IX8 A;  1BLH A;  2V1Z A;  3W4P A;  5HWW A;  5TBM B;  1TS7 A;  3VP1 A;  5F69 A;  5J7E A;  4EUZ A;  2EFU A;  3TRC A;  4C75 A;  2VGL M;  3UE6 A;  4WMC A;  4MN6 A;  4BBU A;  1LSV A;  3BFG A;  5FQQ A;  4OOM A;  5A91 A;  1L2S A;  3HUN A;  3HVF A;  3UE1 A;  4D60 A;  5HDC A;  1XJ4 A;  2PAV P;  4KQR A;  2PU4 A;  4M4X A;  1XP4 A;  3C7U A;  3ZFZ A;  1UWN X;  3A3I A;  3GDI A;  3L9K A;  3LIE A;  5CEC A;  4IHQ A;  4JGP A;  5FQ9 A;  3IXB A;  1DJC A;  4R4S A;  2FH5 A;  3RTY A;  4N1X A;  3ZNT A;  2P74 A;  4WL9 A;  3V3R A;  1NY0 A;  4Q0J A;  2Q0O A;  4WEK A;  1GHI A;  2P9V B;  2ZQC A;  3WS5 A;  3IH9 A;  4Y5F A;  1OTD A;  2ZQD A;  3W4O A;  2WZX A;  5E2G A;  5TFQ A;  4FD8 A;  2ZC4 B;  4K91 A;  4NKP A;  3CG5 A;  3HLG A;  4EET B;  4U3T A;  5E2F A;  4OQH A;  5FAP A;  5CGW A;  2ZJ9 A;  4L0L A;  3B3X A;  4X56 A;  1FR1 A;  1D7E A;  1NLY A;  5HW3 A;  4CLC C;  3T50 A;  3MKE A;  2PRF A;  2Y2O A;  3IX4 A;  2PR6 A;  1GHM A;  2DCF A;  3SS5 A;  5TR7 A;  3MKF A;  3UB5 P;  2JHE A;  3SS3 A;  5A93 A;  1XKZ A;  2WAF A;  2VV6 A;  1BSG A;  1YSQ A;  1M40 A;  1PWG A;  4UA7 A;  3HLW A;  4Q8I A;  3S7O A;  1D06 A;  1H8Y A;  3OLO A;  1DY6 A;  3Q7V B;  2VZW A;  5F1F A;  4R23 A;  4IVI A;  3T1R A;  3K3D A;  2ZC3 B;  5HAR A;  4NXB A;  3TSG A;  5HDD A;  4II7 A;  1KVL A;  2ZC6 B;  2Y55 A;  4GN2 A;  2KX6 A;  1W63 Q;  4HNB A;  2W1T A;  4Y7P A;  1RP5 A;  4OQG A;  1ESI A;  5GLB A;  2HGV A;  4P6Z M;  1V9Y A;  2WKR A;  1VET A;  3C8C A;  3VP3 A;  3N8L A;  4WLA A;  3EGD C;  4E3O A;  4HJ6 A;  4ARZ B;  2OLV A;  1DP6 A;  3G35 A;  2J3T C;  2XR0 A;  4ETZ A;  4S2I A;  2XRO A;  3G2Z A;  4IJG A;  5EM0 A;  5AJG A;  3UE3 A;  4RX2 A;  4HEF A;  3R7W B;  5F83 A;  3CPT B;  4X55 A;  4U0T A;  1XA7 A;  5EUA A;  5FDS A;  1BLP A;  4Q0H A;  4ID4 A;  4MBF A;  2B95 A;  1ALQ A;  3FKW A;  3R7W A;  1IYS A;  1JWP A;  3U2A A;  4GB7 A;  2G2U A;  3CI6 A;  1JVJ A;  3K2N A;  1ZHH B;  5EVI C;  4GD8 A;  4HJ3 A;  1CI8 A;  5FEF A;  2GX5 A;  4BWI A;  1N9L A;  4IED A;  2AVX A;  5KSH A;  2JKR I;  2M7V A;  2L1M A;  4IVK A;  4PM5 A;  4P6B A;  1TS6 A;  4OP8 A;  3GQZ A;  5DKL A;  1JWV A;  1H3Q A;  2L0W A;  3TE8 A;  1LHY A;  3BLM A;  1H8M A;  5DVA A;  1KGF A;  5FAO A;  3VFH A;  2UV0 E;  1XXM A;  2GZA A;  4L9E A;  1EI5 A;  2EXB A;  3LEQ A;  2XLN A;  4HBU A;  4S2N C;  3E98 A;  4HH3 A;  1ESU A;  3E4O A;  5FSR A;  4E6X A;  1IOU A;  1RGZ A;  1CK3 A;  4X53 A;  5EVE A;  1CJF A;  3UB9 A;  2PU2 A;  1MPL A;  3GR2 A;  4WEJ A;  5IS1 A;  1KOU A;  3KSF A;  1OJG A;  3DTI A;  3BFE A;  3NDE A;  1Z09 A;  1OME A;  2QYB A;  5HD5 A;  3V3S A;  3VOY A;  5J4E A;  3KSH A;  1PW8 A;  2WKP A;  4BL3 A;  5EV0 A;  2GDN A;  4ZDX A;  3LUQ A;  4KZ4 A;  3O5Y A;  3BFF A;  3T4T A;  3H7W B;  3TJZ C;  1TDG A;  5E43 A;  1IEL A;  1N9B A;  3JPU A;  3S7Q A;  1BUE A;  3GRJ A;  5AQA A;  3UDF A;  1MWT A;  3BFC A;  3CAX A;  3NDG A;  3UB7 A;  2EA9 A;  5CRF A;  1S1Y A;  4DDS A;  1MY8 A;  1XGI A;  4S2P A;  4DE3 A;  4XT2 A;  2Z2M B;  4PHT A;  4WN5 A;  1ES2 A;  2V9A A;  2PYP A;  4BLM A;  2K2N A;  3DW0 A;  1SHV A;  5KSC A;  2Z6D A;  4EES A;  2PD7 A;  3MZF A;  4EXO A;  2XD1 A;  3I7J A;  5J8X A;  1TS0 A;  3HLB A;  2QMI A;  1YPR A;  1KE3 A;  1ONH A;  3H9W A;  5DTT A;  3E2K A;  4WMC D;  4DE0 A;  4JLF A;  1ES5 A;  3VE3 A;  3B42 A;  1X0O A;  2J80 A;  3HL9 A;  4P6Z S;  1LL5 A;  4Y0U A;  1TDL A;  2C5W B;  2M7U A;  3FV7 A;  2X71 A;  4EEU A;  3S7N A;  4JXV A;  4YOF A;  1PIO A;  2X01 A;  1OPX A;  4RVA A;  3LY4 A;  2A24 B;  2VKS A;  4RQ9 A;  1TF1 A;  4PPR A;  2LB9 A;  2HF6 A;  1E25 A;  5AVE A;  3QHY A;  1K0K A;  3PHY A;  1FSY A;  3N6I A;  1XFN A;  4ZJ2 A;  3T12 B;  1ES3 A;  3WWX A;  5K5B A;  3OZH A;  4Y15 A;  1MC0 A;  1YLZ A;  3F1O A;  4Y3I A;  1XPB A;  2ZMV A;  3UPP A;  4R1G A;  3WS4 A;  3IT9 A;  2ZM2 A;  4UQI S;  3V5M A;  3DTE A;  2EWV A;  3IXD A;  1U60 A;  3MJQ A;  1KDS A;  3IWQ A;  1F5M A;  3BY8 A;  4OPQ A;  1CI9 A;  2EWW A;  3DTK A;  3SS4 A;  3WS2 A;  2OWH A;  2PYR A;  5HZH A;  4E3K A;  4S2J A;  4MNR A;  3PXP A;  4B88 A;  1L0D A;  2Y2H A;  2ZOH A;  2JBF A;  4S2L A;  4XUX A;  4NET A;  1BLC A;  3LIA A;  4EUV A;  4M3K A;  2HP5 A;  1K57 C;  5CX7 A;  3C30 A;  3E0Y A;  2O9A A;  4R4R A;  5CTM A;  1MWS A;  3Q07 A;  1YMX A;  4I5S A;  5CER A;  5IU1 A;  1C3B A;  1D1J A;  2ZC5 B;  4Y0O A;  5CEB A;  3SW1 A;  4KZB A;  1OTI A;  1ERQ A;  2ACG A;  2ZL1 B;  1YQS A;  4D2O A;  1FIK A;  4IBR A;  2V1B A;  2JKT I;  2M1C A;  2P7J A;  3OPH A;  2W3F A;  1NYY A;  5HAP A;  1W8Q A;  2QKP A;  4E3J A;  5I5L A;  2HDR A;  3HBR A;  3ULF A;  2VV7 A;  1P0Z A;  4ZJ1 A;  1N4O A;  3SZT A;  3PR6 A;  1PNE A;  3PBT A;  2VA0 A;  4DXB A;  4ZJ3 A;  1NZO A;  1G6A A;  2J3T D;  4DDY A;  1ZG4 A;  1G68 A;  1T18 A;  2WK0 A;  2B5R A;  4DE1 A;  2WAE A;  5JYO A;  2IWB A;  3CZD A;  4WF0 A;  4ZAM A;  3LY3 A;  2Y2N A;  3Q81 A;  3TW8 A;  5DF8 A;  3FYZ A;  3TOI A;  5GL9 A;  4E3M A;  3PTE A;  1KGE A;  1MZU A;  4NXF A;  1DP9 A;  3HUM A;  2P08 A;  2Y2P A;  3HJI A;  3ZG5 A;  3HLE A;  3C38 A;  4O01 A;  4UA9 A;  5DJT A;  1NLZ A;  2XK1 A;  3M2J A;  2QZ6 A;  3CJM A;  1VEU B;  1KGG A;  4OH0 A;  4BJP A;  2R9W A;  1UGU A;  4QJG A;  3LR4 A;  5IHV A;  1FR6 A;  5F82 A;  3T1X A;  5L8M A;  1YAX A;  4OP5 A;  2ZBB A;  1GA0 A;  1XA1 A;  3Q1F A;  4CLC B;  1O7E A;  3JVU A;  3UME A;  2QHK A;  5U47 A;  1SDN A;  3MQ0 A;  3HJK A;  1J9M A;  3NUL A;  5A8B A;  1T1A A;  4LCM A;  4P0M A;  5A90 A;  4JF5 A;  2WGI A;  1G6O A;  3OCL A;  2XSS A;  4JGO A;  5GLD A;  2Q9M A;  5EEC A;  1JWZ A;  3NOP C;  4IBX A;  5M1A A;  1F9I A;  3T4Q A;  2WKE A;  5FEG A;  3IF6 B;  3U4L P;  1LSW A;  4BL2 A;  2JKT M;  5IT5 A;  4EBL A;  4OOY A;  4NK3 A;  4NEE D;  5JYP A;  1K54 C;  1FQG A;  5DTS A;  5EM1 A;  1QME A;  3F1N A;  3VV4 A;  3G34 A;  2D02 A;  4B9O A;  2RL3 A;  1DRM A;  2ZQ7 A;  2P04 A;  3BYD A;  4ARZ A;  4LV0 A;  1MWR A;  3T4J A;  1YLY A;  3FG8 A;  5J3W A;  3R4K A;  4EQI A;  4O0P A;  3NEC A;  3SH7 A;  5EVI A;  1IEM A;  1YLJ A;  4X1L A;  1W79 A;  1PRQ A;  3VSL A;  1K57 A;  1OTB A;  3ISG A;  2I9V A;  1Y28 A;  3DWZ A;  4WZ5 C;  2WGV A;  2K7S A;  4WZ4 A;  1TD5 A;  3A3E A;  2WYX A;  5AQB A;  1YLP A;  4EQ1 A;  3M2K A;  3LFV A;  2HPB A;  1SKO B;  5GHY A;  5HL1 A;  2ZM0 A;  4R3A A;  3UMD A;  3O87 A;  2Z6C A;  3P98 A;  4R38 A;  3H7W A;  4GZB A;  4GCZ A;  4R3B A;  1LLB A;  3A3J A;  1P97 A;  4QU3 A;  2Y8H A;  1JNU A;  5FQM A;  1CEG A;  2A24 A;  4ETX A;  4WZ5 A;  2OWJ A;  1KDW A;  5HDS A;  4GW9 A;  2V8F A;  3IS2 B;  3MFX A;  5FQK A;  4NXG A;  5HL6 A;  4Z9Q A;  3ZG9 B;  1T19 A;  1OTE A;  4IUK A;  3CMZ A;  2V0W A;  2V8C A;  2Y2Q A;  2HDU A;  4Y2F A;  4PAU A;  4R70 A;  1GCE A;  2IWD A;  3F1N B;  3UB6 A;  3VMA A;  1DJA A;  2R9X A;  3BQA A;  1HZO A;  3LIC A;  2XA7 S;  5GHX A;  4BBV A;  3BEB A;  4N92 A;  3IF6 A;  3MZE A;  3UY6 A;  1A0K A;  3IBR A;  4S2K A;  2DMW A;  5GLC A;  2ZQA A;  4U0X A;  2HDS A;  1QMF A;  2XD5 A;  5AQ7 A;  4JGQ A;  4K08 A;  5FAQ A;  2W0N A;  3IF5 A;  1DP8 A;  1PZP A;  3NOT C;  3C2W A;  2W27 A;  4E3L A;  1LSX A;  2KDK A;  4WEL A;  3OOV A;  1YMS A;  1S0W A;  2W3D A;  3W2Z A;  3WS1 A;  4JXG A;  3GTC A;  1XGJ A;  4UHU A;  4JKT A;  2P9V A;  4CLC D;  1L0F A;  3VOL A;  2XH9 A;  5FA7 A;  3P09 A;  3IF6 C;  1ERM A;  4EW7 A;  4OOL A;  2I72 A;  4I3J A;  4FH2 A;  2V20 A;  1S4R A;  1VM1 A;  1VQQ A;  3GSG A;  2E8I A;  3VFF A;  2CC1 A;  4OLD A;  1LI0 A;  4EBP A;  3MSH A;  1E3U D;  1WE4 A;  2H0T A;  4HES A;  4JF4 A;  3VSK A;  1NXY A;  2JKG A;  3AGE A;  4L9F A;  1TVF A;  2VK3 A;  5DJU A;  3VOZ A;  4KG5 A;  3S7P A;  1I5Q A;  1ZTU A;  1DJB A;  2BAS A;  2JKR M;  2J9P A;  4QD4 A;  4X1M A;  3N8S A;  5LBR A;  3V39 A;  3WRZ A;  1XFQ A;  4UQI M;  3NHQ A;  1NRF A;  3UNW A;  2ZLY A;  3BJN A;  2BG1 A;  1ERO A;  1T1C A;  1TS8 A;  3OCN A;  1MKI A;  3MMH A;  3A3F A;  3QP2 A;  2PT7 A;  3IXH A;  2Y79 A;  4F3L B;  1K4F A;  4UEY A;  1HTZ A;  4KUO A;  5CHU A;  1Q2Q A;  2B18 A;  2KOI A;  3VP4 A;  4CLC A;  4KZ6 A;  2EX2 A;  3ZNY A;  3QP5 A;  3EWK A;  1IYP A;  2OAQ 1;  1P9R A;  2Y2J A;  1S1Z A;  3GMW A;  3W8K A;  4BD1 A;  1MWU A;  4O7D A;  3C5A A;  2E8J A;  2WKI A;  2JN7 A;  2FZ0 A;  3T1Q B;  2J8Y A;  2VEA A;  4OPR A;  5HFO A;  3CWF A;  2PD8 A;  2ZD8 A;  4LRY C;  1IYQ A;  3MQQ A;  1HD8 A;  3AGD A;  4EU0 A;  1MXO A;  3PBO A;  4CJN A;  3ZYT A;  4LRX C;  5M18 A;  5AQ9 A;  4H8R A;  4I3I A;  3FKV A;  2GJ3 A;  1YLT A;  2O99 A;  4GHI B;  2H5S A;  1N9O A;  4N9L A;  1J3W A;  3N4I A;  1IKI A;  3ITB A;  3LEZ A;  2ZMA A;  2ZQ8 A;  5F6A A;  4FSF A;  4GD6 A;  4PM7 A;  3G4P A;  4KQO A;  4ZTK A;  3EGX C;  5CGS A;  3IWO A;  3CLO A;  3S4X A;  4DXC A;  3B47 A;  5F5Y A;  4YWZ A;  4JXW A;  3EQV A;  3DBA A;  3VP0 A;  4KUK A;  2XF3 A;  4K0W A;  4MBK A;  2V1A A;  4CQH A;  3OPP A;  4LPZ A;  4Y0T A;  3QP1 A;  4O8G A;  4PM8 A;  2Y2L A;  2VGL S;  5TBM A;  3F1P A;  2PR5 A;  2H10 A;  2QWS A;  1FCN A;  1S66 L;  5HPF A;  4JPM A;  1YT4 A;  1BUL A;  1UWP X;  4QY5 A;  3MS6 A;  2WKH A;  4HHD A;  3LYX A;  1GSV A;  4UA6 A;  3PBR A;  4HOI A;  3UO9 A;  5M19 A;  4MDZ A;  3KYZ A;  4QB8 A;  3D72 A;  2Y2I A;  5C5K A;  3S22 A;  2J3W A;  1ODV A;  1CEF A;  4EEP A;  2CMN A;  4OLG A;  3ZGA B;  3LR3 A;  4JF6 A;  1XJ6 A;  2R78 A;  2MJ6 A;  3GVB A;  1IYO A;  3SH8 A;  1KE0 A;  2O0Y A;  5EVI D;  2IWC A;  1LL9 A;  2EXA A;  4X68 A;  3E2L A;  4BBT A;  3MFD A;  4LV1 A;  4GDB A; 
#chains in the Genus database with same CATH homology
 1V9Y A;  1LSW A;  2WKR A;  2JKT M;  3C8C A;  3LR0 A;  5IT5 A;  4DJ2 A;  4NEE D;  4WLA A;  3EGD C;  4H6J B;  5G4Y A;  4HJ6 A;  4ARZ B;  1DP6 A;  3BWL A;  2J3T C;  3F1N A;  3VV4 A;  4ETZ A;  2W3H A;  2OAP 1;  1VHM A;  2D02 A;  3GEC A;  2XRO A;  4QPR A;  2ZOI A;  4B9O A;  4IJG A;  1DRM A;  5AJG A;  2P04 A;  5DFY A;  3UE3 A;  3R7W B;  4IUH A;  4DN0 A;  1N9N A;  4ARZ A;  4Q0H A;  1F98 A;  3T4J A;  3FG8 A;  5J3W A;  3R4K A;  4O0P A;  3V67 A;  3R7W A;  3U2A A;  1W63 M;  3CI6 A;  3K2N A;  1ZHH B;  3HCY A;  1OTB A;  4HJ3 A;  2I9V A;  3KSI A;  2GX5 A;  5MC7 A;  1Y28 A;  4BWI A;  2XA7 M;  1N9L A;  5TJJ A;  2K7S A;  5KSH A;  3MR0 A;  3RH8 B;  1TD5 A;  2JKR I;  2M7V A;  4GJ4 A;  2L1M A;  4LRZ E;  1TS6 A;  4EQ1 A;  3LFV A;  5DKL A;  1H3Q A;  4DJ3 A;  4R3A A;  2L0W A;  2OOL A;  3TE8 A;  3UMD A;  3LIF A;  2Z6C A;  1H8M A;  3A0R A;  4MMN A;  4PKY A;  4R38 A;  2GZA A;  3H7W A;  4GCZ A;  4L9E A;  3PBS A;  3FPV A;  1BYW A;  1P97 A;  3E4P A;  4MN7 A;  2Y8H A;  1JNU A;  3E98 A;  4HH3 A;  4HIA A;  2A24 A;  4HY8 A;  3E4O A;  3JVV A;  3EQU A;  4G3K A;  1IOU A;  4ETX A;  2HJ9 C;  2B02 A;  2XRN A;  2OWJ A;  5HDS A;  4GW9 A;  3UB9 A;  3D3O A;  3IS2 B;  3MFX A;  4WEJ A;  3LIB A;  5IS1 A;  1KOU A;  1P9W A;  3KSF A;  4NXG A;  5HL6 A;  1OJG A;  2QYB A;  4EER A;  5HD5 A;  5J4E A;  3KSH A;  4HP9 A;  5G4Z A;  1T19 A;  3CUE A;  1OTE A;  2WKP A;  4IUK A;  1LT0 A;  4H6J A;  3IBJ A;  2K31 A;  3LUQ A;  4ZRR A;  3O5Y A;  3F1O B;  2V0W A;  4Y2F A;  3T4T A;  4PAU A;  1NWZ A;  4R70 A;  3H7W B;  3F1N B;  2L4R A;  3TJZ C;  3UB6 A;  4E04 A;  4PKY G;  2VJW A;  2YKH A;  3BQA A;  3S7Q A;  5HSQ A;  3LIC A;  4LLO B;  2XA7 S;  3CAX A;  4BBV A;  2A2L A;  2HJE A;  2V0U A;  3UB7 A;  2EA9 A;  3MXQ A;  1NRJ A;  2W1R A;  1S1Y A;  3IBR A;  4I38 A;  3G6O A;  3K3C A;  4NXE A;  4XT2 A;  3PYP A;  2DMW A;  4I39 A;  3T4O A;  3IS2 A;  4PHT A;  1STZ A;  4WN5 A;  2V9A A;  2PYP A;  1OJ5 A;  3MF0 A;  2K2N A;  4JGQ A;  4K08 A;  2W0N A;  4ME4 A;  3P01 A;  1DP8 A;  4AFI A;  2Z6D A;  2G7U A;  4EES A;  2PD7 A;  3MQO A;  3BQ8 A;  4DMZ A;  3NOT C;  4EXO A;  2KLI A;  3C2W A;  2HV1 A;  2W27 A;  1LSX A;  1VB6 A;  2KDK A;  4WEL A;  3OOV A;  2INW A;  1TS0 A;  2VX8 A;  3ZQ5 A;  2W3D A;  1WA9 A;  3W2Z A;  1IFQ A;  5KIZ A;  2W3G A;  5DF9 A;  2H28 A;  4CLC D;  4L9G A;  3EEA A;  3H9W A;  3VOL A;  1V9Z A;  4P6Z M;  4GS9 A;  1EW0 A;  2PHY A;  3VE3 A;  3B42 A;  1X0O A;  2J80 A;  4P6Z S;  4EW7 A;  4OOL A;  2M7U A;  4I3J A;  4EEU A;  3F1P B;  3S7N A;  1S4R A;  1OTA A;  4YOF A;  1OPX A;  3LI8 A;  2A24 B;  2VKS A;  5DKK A;  4RQ9 A;  1TF1 A;  2LB9 A;  2HF6 A;  4GHI A;  4MN5 A;  3LID A;  4JGR A;  4HJ4 A;  5AVE A;  4G3W A;  1GSW A;  2WKQ A;  3FC7 A;  3PHY A;  4L9F A;  3T4K A;  5DJU A;  1XFN A;  4G3V A;  3S7P A;  5AVF A;  1ZTU A;  3E4Q A;  2QJ5 A;  1OT6 A;  3NJA A;  2BAS A;  5K5B A;  1MC0 A;  2JKR M;  3F1O A;  4Y3I A;  3B33 A;  3P7N A;  2IA2 A;  3H82 B;  5LBR A;  2W1T B;  3KSG A;  2ZMV A;  5F68 A;  2O9B A;  1OT9 A;  1XFQ A;  3FPW A;  3VE4 A;  4UQI M;  3NHQ A;  4CLC E;  3A0S A;  1T1B A;  2NUT C;  4UQI S;  3BJN A;  3ICY A;  2EWV A;  2O9C A;  1T1C A;  3PBN A;  3MJQ A;  1F5M A;  4WUJ A;  4KQD A;  2VV8 A;  3BY8 A;  1TS8 A;  1YKD A;  3OCN A;  3MMH A;  1S67 L;  2EWW A;  5HWW A;  2OWH A;  2PYR A;  2PT7 A;  5HZH A;  5TBM B;  1TS7 A;  3PXP A;  2Y79 A;  2ZOH A;  4F3L B;  5F69 A;  5J7E A;  3TRC A;  5EFW A;  3LIA A;  4EUV A;  2QJ7 A;  2VGL M;  3UE6 A;  5CX7 A;  4UEY A;  3C30 A;  4MN6 A;  4BBU A;  3E0Y A;  4KUO A;  2B18 A;  1LSV A;  2KOI A;  2O9A A;  4FOF A;  4CLC A;  2LB5 A;  4I5S A;  5DFX A;  4I3A A;  4OOM A;  3EWK A;  5IU1 A;  2OAQ 1;  4HQA A;  1P9R A;  1S1Z A;  3SW1 A;  1OTI A;  5HDC A;  4BMW A;  1XJ4 A;  2D01 A;  4M4X A;  2JN7 A;  2FZ0 A;  2JKT I;  1UWN X;  2V1B A;  3GDI A;  2M1C A;  2VEA A;  3CWF A;  2P7J A;  2PD8 A;  2GNX A;  3LIE A;  3A0V A;  2W3F A;  4LRY C;  5FL3 A;  3MQQ A;  2QKP A;  4IHQ A;  4B93 A;  4EU0 A;  4GLQ A;  5I5L A;  4JGP A;  3RFB A;  3PBO A;  2VLG A;  3ULF A;  3KYQ A;  4HP4 A;  2VV7 A;  1P0Z A;  3ZYT A;  4LRX C;  2ZMF A;  2FH5 A;  3PR6 A;  1YSP A;  3PBT A;  5HD3 A;  3RTY A;  4F3L A;  5HPI A;  2VA0 A;  4WL9 A;  4MCW A;  4Z1W A;  4I3I A;  2GJ3 A;  2O99 A;  2J3T D;  4GHI B;  4Q0J A;  4WEK A;  3KO6 A;  1T18 A;  5HWT A;  3OBF A;  1GSX A;  1N9O A;  4Y5F A;  1OTD A;  3LR5 A;  4WF0 A;  4YNR A;  1S4S A;  5F6A A;  3TW8 A;  4FSF A;  4NKP A;  4EET B;  1MZU A;  4KQO A;  4NXF A;  3LI9 A;  3UB8 A;  1DP9 A;  4L0L A;  3EGX C;  3CLO A;  2P08 A;  3H82 A;  3HJI A;  1D7E A;  3B47 A;  5F5Y A;  4YWZ A;  3C38 A;  3NOU C;  3OC2 A;  3EQV A;  3DBA A;  4O01 A;  1LL8 A;  1NLY A;  4KUK A;  5DJT A;  3T50 A;  4CLC C;  1NLZ A;  2V1A A;  4CQH A;  4GS9 B;  4LPZ A;  4HH2 A;  2PR6 A;  1MKM A;  4HI4 A;  4O8G A;  4BJP A;  1UGU A;  2JHE A;  3KX0 X;  2VGL S;  3LR4 A;  3T4S A;  5TBM A;  3F1P A;  2PR5 A;  2QWS A;  1G28 A;  2YKF A;  5L8M A;  1S66 L;  1YAX A;  5HPF A;  2ZBB A;  5HWV A;  1UWP X;  3EOI A;  4CLC B;  3JVU A;  4HHD A;  3UME A;  2QHK A;  2VV6 A;  3LYX A;  1XJ3 A;  1GSV A;  1YSQ A;  2W3E A;  3PBR A;  4HOI A;  3MQ0 A;  3BW6 A;  3HJK A;  4MDZ A;  3S7O A;  3PBQ A;  1D06 A;  4XT2 B;  3OLO A;  3KYZ A;  5A8B A;  2VZW A;  1T1A A;  2PDR A;  3D72 A;  3T4L A;  3K3D A;  5C5K A;  4Q0I A;  2J3W A;  1ODV A;  4EEP A;  2CMN A;  1G6O A;  4NXB A;  3OCL A;  2XSS A;  3LR3 A;  4JGO A;  1XJ6 A;  4II7 A;  5HDD A;  2R78 A;  2MJ6 A;  3CIT A;  3CUE C;  2KX6 A;  2O0Y A;  1W63 Q;  3NOP C;  2W1T A;  3BY9 A;  3EEH A;  4HNB A;  1F9I A;  3T4Q A;  4R6L A;  4BBT A;  2NUP C;  2HGV A;  1XJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...