4HJ4A

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
177
structure length
177
Chain Sequence
AMDQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOV protein
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
total genus 56
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hj4A00
4H6JA 3F1PB 3UB9A 3LI8A 3K3DA 1WA9A 2CMNA 2I9VA 2PDRA 5HWTA 5DKKA 5F6AA 2QJ7A 1LSXA 3F1PA 4HQAA 1BYWA 3HJIA 2D02A 4WUJA 1LSWA 3UMEA 1OTBA 2M1CA 3F1OB 4NXBA 4LRYC 2KDKA 5IU1A 3UB6A 3C8CA 4LRXC 3F1NB 3K3CA 5DJUA 3LICA 3EEHA 4YWZA 1N9LA 2K7SA 1GSXA 5HWVA 1OT9A 3F1OA 4NXEA 3IS2B 3UB8A 4DJ3A 1T1CA 1D7EA 1XJ3A 4LPZA 5EFWA 5IS1A 2V0WA 5F69A 4EEPA 2J80A 3F1NA 3ULFA 2PYPA 2V1AA 1LL8A 1TS6A 3MQOA 2B02A 3VE3A 1T19A 2QJ5A 1N9OA 1S1ZA 2BASA 2EA9A 3IS2A 1OTIA 3CAXA 1XJ6A 3A0VA 3MFXA 5AVEA 4BBTA 4I38A 4I3AA 4NXGA 2ZBBA 3KX0X 4JGPA 4BBUA 1DP9A 5G4ZA 2QKPA 4GHIB 5DJTA 3ZQ5A 1TS7A 2VLGA 1OT6A 1S4SA 2VEAA 2W0NA 3GECA 1UWPX 3FG8A 4GHIA 4KUKA 2H28A 3LI9A 4LRZE 3PYPA 4K08A 2V0UA 4RQ9A 3NJAA 1JNUA 1Y28A 4WF0A 4R70A 3BY9A 3VOLA 2VV7A 1F98A 3CLOA 2R78A 1T18A 2YKHA 2WKQA 1GSWA 1V9ZA 5HZHA 3P7NA 2PR6A 3FC7A 2V9AA 1GSVA 4GW9A 4L9GA 1T1AA 2YKFA 2PD8A 2P7JA 5J7EA 4EQ1A 4HI4A 4XT2B 4HIAA 3ICYA 1LSVA 2PYRA 4L9FA 1DRMA 3RH8B 1T1BA 3UB7A 2OWHA 5F68A 3NOTC 4WLAA 3UMDA 4XT2A 3T50A 5F5YA 4EEUA 1P97A 4HNBA 3LYXA 4HJ6A 3A0RA 3LIEA 3H9WA 1S1YA 1KOUA 4WN5A 1DP8A 4HJ3A 4HH3A 2KX6A 4JGRA 4HP4A 4R6LA 3E4PA 5KIZA 2OOLA 5J3WA 4EETB 3OLOA 3NHQA 3LIAA 2PD7A 5HSQA 4HHDA 2L0WA 1VB6A 4WL9A 3D72A 4F3LB 1ODVA 2QHKA 4R3AA 2VV8A 3HJKA 3VE4A 3SW1A 4HOIA 5DKLA 1OJ5A 5HD3A 3A0SA 1XJ2A 2A24B 5G4YA 2L1MA 3MXQA 4HJ4A 3GDIA 2L4RA 4F3LA 1OTEA 1V9YA 2PHYA 1NWZA 2WKPA 4HY8A 2QWSA 5A8BA 2A24A 4B9OA 5HD5A 1EW0A 4GS9B 4MN6A 3BY8A 4I5SA 4KQDA 1XFQA 4I3JA 2JN7A 3LIDA 1XFNA 4R38A 1D06A 2GJ3A 4HH2A 2Z6CA 2PR5A 4PKYG 3RTYA 1UGUA 4JGQA 4GS9A 4GCZA 3LIFA 3MJQA 4MN5A 4LLOB 4M4XA 3UE6A 4EESA 1DP6A 5HDCA 1S67L 2V1BA 5I5LA 3MQQA 4E04A 2Z6DA 2OWJA 1S4RA 5HDSA 3B33A 1OTAA 3LIBA 4EXOA 4EW7A 5J4EA 4BBVA 5TBMB 1S66L 3LUQA 4HP9A 4DJ2A 1N9NA 3E4OA 1X0OA 2W27A 2VV6A 1LT0A 5HWWA 5TBMA 1TS0A 1XJ4A 2INWA 4L9EA 4I3IA 1OJGA 3BWLA 1TS8A 4NXFA 3CWFA 3IBRA 3H7WB 2WKRA 5HDDA 4I39A 3C2WA 3H82B 1OTDA 3E4QA 2JHEA 1P0ZA 4JGOA 4H6JB 4PKYA 3H7WA 1G28A 3EWKA 3NOUC 2ZOHA 3PHYA 2HV1A 1MZUA 2ZOIA 3H82A 3MR0A 1F9IA 4EERA 5AVFA 2D01A 3G6OA 3NOPC 1UWNX 4KUOA
chains in the Genus database with same CATH superfamily
3M2KA 3WRZA 3F1PB 4KQRA 2PBDP 1KVLA 4KZ5A 1WA9A 4OKPA 5HWTA 2Y2OA 2JCHA 4HQAA 1W79A 1JWZA 5M19A 3HJIA 1LSWA 3DTMA 4P6ZS 1GA0A 5CHMA 3UB5P 1K55C 4CLCB 1AXBA 3D9YA 2KDKA 5JYOA 3T1RA 4K0WA 3PR6A 3B42A 4FSFA 4CLCD 4LV2A 3WWXA 3R7WB 3ITBA 3F1OA 4Z1WA 1T1CA 1G6OA 4K0XA 1ESUA 2G7UA 4GJ4A 4EEPA 2J80A 3F1NA 3EQUA 2PYPA 2PU4A 3FV7A 3IF5A 3T4SA 1T19A 4O7DA 4PAUA 2EA9A 3UPNA 4B4XA 3IS2A 1LHYA 4OQHA 4S2KA 5FQQA 3HVFA 1CEGA 4KZ6A 1I2SA 2LB5A 2JBFA 4OQIA 2Y2IA 1XKZA 5AVEA 3HLDA 4BBTA 4DE1A 4I3AA 4NXGA 3C7UA 1WYCA 4ZTKA 3QP2A 5EUAA 2EX9A 3WS2A 1YSQA 1KE0A 2OV5A 3N7WA 3V3RA 2XFSA 3NI9A 1VEUB 4MNRA 4II7A 5FATA 2IA2A 2BG1A 5EV0A 1IYPA 3ITAA 4GHIA 3QP8A 2JC7A 3LI9A 4LRZE 2J9OA 5FI7A 3HLWA 3ZG9B 3SZTA 1Y4OA 3NJAA 4JLFA 4QJGA 1JNUA 4ZRRA 4QWOA 1YPRA 3Q7VB 3UDIA 4R70A 4KENB 1NJ4A 4CQHA 1NYYA 5FQJA 3W2ZA 4Q0JA 1C3BA 1PZPA 2WGIA 1GCEA 2WKQA 2A3UA 2WYXA 2KOIA 1GSWA 3V67A 3UE1A 4LGWA 1O07A 2ZC5B 3OC2A 4DXBA 3FC7A 3BJNA 2V9AA 3MZEA 1T1AA 3WS0A 1K57C 3E0YA 3ZG0A 4EQ1A 4ZDXA 4X6TA 1HVBA 1GHIA 3S7PA 2E8IA 3LR4A 1SKOB 1IELA 1K56D 4P87A 4BD1A 4C3QA 4L9FA 5L8MA 1DRMA 3NBLA 5DF8A 1M40A 4KZ4A 3VMAA 3UB7A 5DF7A 4U3TA 4WLAA 4PM6A 3UMDA 4XT2A 2P08A 3IF6A 3Q1FA 3NIAA 5EM0A 3ZVWA 4OPZA 2X01A 4YNRA 3CPTA 4X56A 1IKGA 3H9WA 1S1YA 5DFYA 1PWDA 2O0YA 2WGWA 3OCNA 4HH3A 4FH4A 4KZBA 4DE0A 4JGRA 4MBKA 3GQZA 4HP4A 4R6LA 2GNXA 1HZOA 4U0TA 5DTSA 2JKFA 3JVVA 5L10A 3LIAA 2PD7A 2V8FA 1P9WA 1G68A 5HL1A 2OLVA 1MC0A 3D72A 2VGLS 1YM1A 1ODVA 4R3AA 3VE4A 2VV8A 5HD3A 4BMWA 3W4OA 4CLCC 5G4YA 4X1LA 3MXQA 4EWFA 4N92A 2K31A 5FDHA 3HL9A 3GDIA 4DN0A 3IT9A 1NWZA 2WKPA 1W63M 2V20A 1IEMA 3QP4A 4KG6A 1PRQA 4IEDA 3UNWA 4IBRA 3IX4A 1O7EA 1NXYA 4GS9B 4R4RA 1GA9A 3ZVTA 4Y5FA 4EBLA 4I3JA 1DJBA 1D06A 4HH2A 2Z6CA 1S0WA 3RTYA 4JGQA 2Y59A 4GCZA 1ZTUA 1K25A 3ISGA 1G5UA 2XDMA 3G30A 4ZJ2A 1S67L 4B4ZA 5CEBA 1ES5A 2V1BA 3BLSA 4LV0A 3SH9A 3MQQA 3GTCA 2OWJA 3G32A 1SHVA 4G3WA 3LIBA 1KE3A 4PHTA 4EW7A 5TGFA 5J4EA 4ZJ1A 4BBVA 1S66L 2ZQAA 3LY3A 2KLIA 1JVJA 1K6SA 1YLZA 2BTFP 2Y2PA 4HP9A 4DJ2A 4WZ5A 5C5KA 1DJCA 3KSGA 5GLDA 1N9NA 3G34A 1L0EA 1NZOA 3HLEA 1TVFA 3CZDA 3V50A 1RGYA 1YLJA 2J8YA 5CX7A 2WUQA 3PTEA 1TS8A 1PIOA 3CWFA 1JTGA 2QZ6A 3H7WB 4FCFA 4OOYA 4CPKA 4I39A 4EBPA 3Q81A 2UV0E 3LGOA 1BTLA 3VV4A 1P0ZA 4KQOA 5EECA 4BJPA 4KZ7A 4UQIM 4GKUA 1YLWA 2J9PA 4OOMA 4OPQA 3NOUC 4DF6A 2ZOHA 5F83A 1ZKJA 3H82A 1ALQA 2RL3A 3FKVA 4NEED 2O9CA 3GMWA 3NOPC 2X02A 5CGSA 1UWNX 4KUOA 4H6JA 4MCWA 1J9MA 3TJZC 3TG9A 4WELA 5A92A 1PW1A 4E6WA 4KG5A 5F6AA 2QJ7A 3OPPA 4JXVA 3UPOA 1ZC2A 4H8RA 1OTBA 2EXAA 2M1CA 4LRYC 1LL9A 4ESPA 1KE4A 3LEZA 2ZC7A 3UB6A 5FAQA 4LRXC 3K3CA 5DJUA 3LICA 2IWCA 1MPLA 3WS4A 4OP8A 4N1HA 2G2UA 4NXEA 4IVIA 1H0MA 3FKWA 3KYZA 2XGNA 1D7EA 4LPZA 5EFWA 5IS1A 1LI0A 5A93A 4FOFA 1LL8A 1TS6A 4E3MA 1S1ZA 2BASA 3BLMA 2W3GA 3NCKA 2ZL1B 1OTIA 1Z6FA 3IHBA 3S4XA 1XJ6A 4X68A 1BULA 1ES4A 3PBNA 4RX2A 3Q7ZA 4RA7A 4FH2A 4RVAA 3UDFA 2VX8A 1FIKA 5KSHA 2VGKA 4OQ0A 4CLCE 2HP6A 3CG5A 1PI4A 4Y13A 3T4LA 3CJMA 4K91A 5IT5A 1TDGA 1W5DA 1TS7A 2WAEA 3Q07A 4GDBA 2ZQ8A 1F5MA 1OT6A 4PM9A 1NZUA 1ERMA 4OH0A 4O0PA 4ZAMA 3HCYA 1XP4A 3FWLA 5E2FA 1PNEA 3IHAA 4KUKA 4N1XA 2H28A 5CTNA 3SH7A 2QPNA 3RXWA 1I2WA 4X69A 3PYPA 2M7UA 3IXDA 2PT7A 4RQ9A 1QMFA 1W8QA 1AWIA 3IWQA 4UA7A 3VOYA 4JF6A 3NY4A 4LENA 2Z2LB 2VV7A 1FQGA 3LR5A 3IWOA 3HBRA 2YKHA 4Y17A 5BOHA 4R3BA 3ZG8B 2P04A 1TF1A 1V9ZA 1K54A 5HZHA 2VJWA 2Q9NA 3U4LP 3JYIA 3KYEA 3T4KA 2PBYA 4L9GA 4Q0IA 4Y0TA 4CJNA 4YFMA 4DE3A 5EM1A 2FH5A 3DW0A 1IYSA 4HI4A 1LSVA 3ZNYA 4S2OA 3KO6A 2JKRM 2B5RA 3N4IA 5DTTA 1Q2QA 2OWHA 4S2IA 3W4QA 3FPVA 2JE5A 1CI8A 4N9LA 3TW8A 2W1TA 1VETA 5CXWA 2VA0A 2B18A 4KZ3A 4R0QA 5HW3A 3T4JA 3MSHA 4B88A 4HJ6A 5HFOA 4QB8A 1P9RA 4OPRA 3VP0A 4EUZA 3UN7A 2W3DA 3A0RA 2ZQ9A 3SS3A 1NLYA 3GV9A 1F2KA 3N8RA 2XA7S 4JXSA 5EE8A 3IWIA 5TR7A 3BFFA 4E3OA 4OPYA 3HUOA 1K55A 3PXPA 3UE3A 1PWGA 5J3WA 4QY6A 1LL5A 4RX3A 4EETB 5FQKA 3NHQA 1XGIA 3BFGA 4GD6A 1E3UD 1ESIA 2L0WA 4Y0OA 3MZFA 2P9VB 2XQZA 3MQ0A 4X55A 2Y79A 4F3LB 4EBNA 4PPRA 2UWXA 5G18A 3HJKA 1QMEA 2H0YA 4GNUA 1XJ2A 1L0FA 2A49A 3TRCA 4WZ4A 1MY8A 2ZD8A 1N4OA 2B95A 1GHPA 2HF6A 1RCJA 2ZM2A 2Q0OA 3C30A 3G2YA 1OTEA 1V9YA 4AFIA 4GB7A 2NUPC 2A24A 4B9OA 1KDWA 3L7HA 5HL6A 3BY8A 4YOFA 4KQDA 4OLGA 2Q9MA 2JN7A 3VSKA 4S2MA 2WKEA 2Y2HA 4PKYG 3ZDJA 2RCXA 3G35A 1UGUA 2O99A 2EX8A 3C4PA 3TE8A 3CI6A 1E4DA 2HP9A 4LLOB 4M4XA 1GHMA 3UE6A 3CHWP 1DP6A 4JF4A 2DRWA 1PZOA 3DTKA 3TSGA 1KDSA 4GZBA 1D1JA 1LI9A 1S4RA 4ZJ3A 4KZ8A 3S7OA 4X53A 5HDSA 3LFVA 5DTKA 4EXOA 4IHQA 3LR0A 2EX2A 3HUNA 3WRTA 4EU0A 3LUQA 1IKIA 3V39A 4KQQA 3HLBA 4FTXA 1MWSA 2ZC6B 2ZQ7A 4JXGA 3E4OA 3N8SA 2M7VA 1X0OA 2W27A 4S2JA 3UO9A 4S2NC 5TBMA 1RP5A 4KZ9A 1TS0A 4X25A 2J3WA 4ARZA 3O3VA 1XJ4A 2W3FA 4L9EA 1K57A 4MBHA 1OJGA 3QHYA 4NXFA 3KSFA 1CQAA 4FD8A 2R9XA 3PBSA 2VK3A 2Y2GA 3O5YA 3KYQA 2WKRA 5HDDA 3AGDA 3T4OA 5AQAA 4WMCA 3ZYTA 1OTDA 2WAFA 3E4QA 1K38A 4WYYA 5EVIB 4NKPA 5KSCA 3BYDA 2V2FF 4UA6A 5FA7A 3HREA 2HDSA 1EI5A 5FI2A 1L3LA 3VFFA 3D3OA 5EVID 3T1XA 1MZUA 3BRMA 3NULA 4WEKA 3NDGA 1F9IA 1MWUA 1SCWA 2JKTI 1S6RA 2D01A 4UEYA 4KG2A 2XFTA 1SDNA 5KZHA 1E25A 3V5MA 3K3DA 2WZXA 4OVDA 5HPFA 2ZMVA 3ZHHA 4C75A 2G2WA 2CMNA 3KSIA 2I9VA 3E2KA 5DKKA 2DCFA 4LV1A 3DTEA 1LSXA 4DE2A 3F1PA 1BYWA 2IWDA 4C6YA 2HDUA 1ZG4A 3W8KA 3TOIA 3UMEA 3F1OB 1YKDA 5GLCA 5F82A 5IU1A 3EGXC 3BW6A 3F1NB 4YWZA 1N9LA 3IXGA 3ZCZA 3C7VA 3O87A 4G3KA 1GSXA 3A3FA 4P85A 1OT9A 5HAPA 1FCNA 3IS2B 4CLCA 5IHVA 2LB9A 3UB8A 2I72A 1G6AA 5M18A 1HTZA 2ZM8A 4QHCA 4XXRA 1ZG6A 1EROA 1YMSA 3VE3A 2W1RA 3HLGA 4NK3A 3R7WA 1YQSA 5GHZA 3OOVA 1ES3A 4M3KA 4IJGA 4QD4A 3A0VA 3M2JA 3MFXA 4ZBEA 3SS4A 1KVMA 4Y2FA 4MDZA 3MZDA 4I38A 2FFFB 2J3TD 1IFQA 2ZBBA 3O86A 4P6ZM 3KX0X 3MKEA 4JGPA 4BBUA 5GHYA 5TFQA 3M6BA 4GHIB 5DF9A 1PFLA 5DJTA 1KGGA 3T4QA 3CUEC 3KSHA 4Q8IA 4BQMA 2HJEA 1EWZA 2OAP1 4P0MA 2H10A 2W0NA 1PI5A 2AVXA 2JKTM 2ZQCA 2EWWA 1E3UA 3FYZA 1YLPA 5FAPA 1VEUA 2ZM0A 1BLCA 2WKIA 3V3SA 4B93A 4WF0A 2OLUA 3EEAA 3VOLA 1F98A 4KZAA 3CLOA 2R78A 1T18A 2XROA 5U47A 4YINA 3S22A 3Q7VA 4Y15A 2PAVP 1MKMA 4U0XA 3OBFA 3P7NA 3Q82A 3UY6A 3P09A 1KGEA 4GW9A 1HD8A 2YKFA 2EXBA 1YMXA 5J7EA 1YT4A 5CRFA 4DXCA 4XT2B 3ZGAB 4BENA 1MBLA 5L09A 3ICYA 3IF6B 1FCOA 3BQAA 1K56A 3DBAA 3RH8B 3BM6A 5L2FA 1M6KA 3NOTC 2E8JA 1HLUP 3EOIA 3CPTB 4GOGA 3T50A 3B47A 2HDRA 1SKOA 1L2SA 4EEUA 1P97A 1STZA 3CITA 2WGWB 5LBRA 5HARA 4HNBA 3P98A 2V8CA 5EVIC 2H5SA 2HJ9C 4MMNA 4R4SA 1XX2A 1JTDA 3IX3A 5J8XA 4DDSA 3JPUA 4WN5A 1DP8A 4HJ3A 2ZLYA 2KX6A 1CEFA 2J7VA 5DVAA 3C38A 3NDEA 3SOIA 5KIZA 5E2EA 5GHXA 3AGEA 4HHDA 4G3VA 4WL9A 3M6HA 1LLBA 3S7QA 2Y55A 3GSGA 4EV4A 2EFXA 3DAVA 5CHJA 4BWIA 5FL3A 5DFXA 5DKLA 4BL2A 3RJUA 1BZAA 3A0SA 3DWKA 1CJFA 2L1MA 5CGWA 1I5QA 5AQ9A 3SS5A 3E2LA 1KGFA 4O01A 2PHYA 1Q2PA 4JKTA 5A8BA 3MS6A 4IUKA 1H8MA 1FR1A 1EW0A 1SDEA 1JWPA 4I5SA 4DMZA 1XFQA 4XUXA 5GLBA 1NY0A 3QNCA 1XFNA 3OPLA 4R38A 4MBFA 1L0GA 1CK3A 4LV3A 2ZC4B 5CGXA 3BECA 5CERA 4DKIA 4GS9A 2HPBA 2J3TC 3MJQA 4MN5A 2VGLM 2Y2MA 2XF3A 1BSGA 1ERQA 2JKGA 4EESA 3QNBA 4WM9A 5HDCA 5FDSA 2CC1A 5I5LA 3IBJA 4UQIS 2DMWA 2VGJA 3B33A 1OTAA 2XH9A 3GRJA 4RYEA 1FSWA 5I94A 2O9BA 4GD8A 2WZZA 3PBQA 5F1GA 2XK1A 3P01A 2ZMAA 1Y54A 2VV6A 3HLCA 1LT0A 1ACFA 3A3IA 3CMZA 1H5XA 3MXRA 3R4KA 2X71A 3IX8A 3HLFA 4N9KA 1XPBA 3OCLA 3I7JA 1RGZA 2R9WA 1BUEA 3IBRA 4PM8A 2EFUA 2WK0A 1H8YA 3S7NA 3H82B 3ZFZA 1BLHA 4JGOA 3RFBA 4E3LA 1A0KA 3A3DA 4WBGA 3FZCA 1IOUA 4H6JB 4PKYA 4JF5A 3H7WA 5AJGA 1G28A 2XSSA 5EOEA 3EWKA 1L0DA 2PRFA 3PHYA 3BEBA 2ZOIA 3VSLA 3MR0A 4EERA 2H0TA 4ETZA 1NRJA 3G6OA 3IF6C 3ZG5A 3IXHA 3UB9A 3LI8A 4OONA 2W3HA 4GN2A 1ZHHB 2PU2A 4OQGA 1YLYA 1K0KA 2A2LA 2MJ6A 1K4FA 2WGVA 3EQVA 2PDRA 5FQMA 3RXXA 1K4EA 4ETXA 4WUJA 2D02A 3ZG7B 4S2LA 3PBRA 4NXBA 4WEJA 2FZ0A 3IH8A 3OZHA 1ES2A 4GLQA 2Y2QA 3C8CA 3N6IA 3IXBA 1XA1A 1YLTA 3EEHA 4E3KA 2EWVA 3NC8A 2GX5A 3BFCA 3T1SA 2K7SA 3EGDC 5HWVA 2DNSA 5CHUA 1FR6A 2Y2LA 3PBTA 4E3JA 4DJ3A 1N9BA 3LR3A 1XJ3A 4A5RA 2V0WA 5F69A 3ULFA 4NG2A 4IVKA 2V1AA 2XD1A 2B02A 3MQOA 5EVEA 3LEQA 1W7FA 2QJ5A 1N9OA 2XD5A 1TEMA 4Q0HA 3CAXA 1Z09A 4LCLA 3FPWA 3SH8A 3C5AA 1FCMA 3QP6A 1W8YA 4JXWA 3OPRA 1OMEA 2ZL1A 5M1AA 1DP9A 5G4ZA 2QKPA 1XGJA 2Y2NA 3ZQ5A 4IUHA 2Y8HA 4MEZA 1VQQA 1FILA 2VLGA 3BQ8A 1S4SA 2VEAA 1K6RA 5JYPA 3VFHA 2ZQDA 4QU3A 1PYYA 2GDNA 5HPIA 3GECA 1UWPX 2HDQA 5FEFA 3FG8A 2VZWA 4LFUA 1MWTA 3B3XA 2ZMFA 3LCEA 4K08A 5EOOA 2V0UA 2QYBA 1PW8A 1J3WA 1DY6A 4UHUA 1Y28A 1TDLA 5GL9A 2XRNA 2XEPA 5TJJA 2GZAA 3QP5A 3BY9A 4JPMA 5GLAA 5E43A 3T4TA 2ZJ9A 3A3JA 5HAIA 5FAOA 5FI6A 4WZ5C 3PAEA 2IWBA 5FASA 3MFDA 5MC7A 4S2NA 1ONHA 2Z2MB 4OOLA 2XLNA 1FSYA 2C6WB 2PR6A 3MKFA 1GSVA 4LCMA 4ID4A 3S1YA 2PD8A 3L9KA 3LO7A 4BD0A 2P7JA 4UA9A 1NYMA 2Y2JA 4Z9QA 5AQ7A 2W1TB 1VETB 4HIAA 2ACGA 2PYRA 5F1FA 2Y4AA 5E2HA 4FUWA 3O88A 1T1BA 4ME4A 5D3OA 5F68A 3LY4A 4BLMA 2WKHA 4S2PA 3JVUA 5F5YA 4Y3IA 3VOZA 2OAQ1 2C5WB 2OSUA 4PM5A 4GDNA 1XXMA 3U2AA 3T12B 2NUTC 3PAGA 3LYXA 1YSPA 3IQAA 3T1QB 2Y2KA 4XUZA 1BT5A 3UE0A 3VP1A 4HESA 3LIEA 3W4PA 2Y91A 4HBUA 1YAXA 3UPPA 1KOUA 1OPXA 2HGVA 2VKSA 4PMAA 3BFDA 3E4PA 2FFYA 1BLSA 4DDYA 4JBFA 3DWZA 2OOLA 3G4PA 3OLOA 5HSQA 3G2ZA 3OPHA 1VB6A 3QP1A 3HUMA 4NETA 4X1MA 4D2OA 1WYBA 2QHKA 2HZ5A 3SW1A 2EX6A 4HOIA 5EPHA 1OJ5A 3K2NA 2A24B 1MXOA 1W63Q 2P9VA 4D60A 4HJ4A 2HP5A 3D4FA 2L4RA 5AQBA 3UDXA 4F3LA 4EUVA 1DJAA 1MWRA 4HY8A 4BL3A 1CF0A 4Y0UA 2QWSA 3VP4A 5KMWA 3BFEA 2XA7M 5HD5A 4E3IA 1VHMA 2W3EA 4MN6A 1NRFA 3C4OA 4MN7A 4QPRA 3LIDA 4PM7A 3DTIA 2GJ3A 2PR5A 5A90A 3ZNTA 3MMHA 3CUEA 5EVLA 3LIFA 4E3NA 3IH9A 2WADA 5CEDA 3VP3A 2XR0A 4IBXA 3MF0A 5L07A 4QY5A 4R3JA 3G31A 1SKFA 4E04A 1WE4A 2Z6DA 1VM1A 5K5BA 3AGFA 1SZVA 2ZC3B 4R1GA 5TBMB 2V1ZA 4ARZB 4UAAA 3A3EA 2BLSA 2JKRI 3VP2A 4MLLA 3PBOA 4HBTA 1IYOA 5HWWA 4OP5A 4R23A 1PWCA 4E6XA 1K54C 1NLZA 5FQ9A 3MXSA 2INWA 4I3IA 5CTMA 4Y7PA 3BWLA 5CECA 1H8ZA 1XA7A 1IYQA 3WS5A 4WMCD 3WS1A 1MKIA 4OLDA 4EQIA 5HX9A 2O9AA 3C2WA 2P74A 1H3QA 5FQIA 2JHEA 5HAQA 4O8GA 1CI9A 3NECA 3E98A 3GR2A 4P6BA 4HEFA 1FOFA 3MBZA 1U60A 1TD5A 1BLPA 4DRTA 1ONGA 2QMIA 2HV1A 3N8LA 4F94A 5A91A 1JWVA 5FSRA 5AVFA 5FEGA 5EVIA 3GVBA 2K2NA 5E2GA 4L0LA
chains in the Genus database with same CATH topology
4H6JA 3F1PB 3UB9A 4MCWA 3LI8A 2W3HA 3K3DA 3TJZC 5HPFA 1ZHHB 2ZMVA 1WA9A 2A2LA 2MJ6A 4WELA 2CMNA 3KSIA 3EQVA 2I9VA 2PDRA 5HWTA 5DKKA 5F6AA 2QJ7A 1LSXA 3F1PA 4HQAA 1BYWA 4ETXA 3HJIA 2D02A 4WUJA 1LSWA 3UMEA 1OTBA 4P6ZS 2M1CA 3F1OB 3PBRA 4NXBA 4LRYC 1YKDA 4CLCB 4WEJA 2KDKA 2FZ0A 5IU1A 4GLQA 3UB6A 3EGXC 3C8CA 3BW6A 4LRXC 3F1NB 3K3CA 3PR6A 3B42A 5DJUA 3LICA 3EEHA 2EWVA 1N9LA 4FSFA 4YWZA 4CLCD 2GX5A 2K7SA 4G3KA 3EGDC 3R7WB 1GSXA 5HWVA 1OT9A 3F1OA 4Z1WA 4NXEA 3IS2B 3KYZA 4CLCA 3PBTA 2LB9A 3UB8A 1T1CA 4DJ3A 1G6OA 3LR3A 1D7EA 1XJ3A 4LPZA 5EFWA 5IS1A 2G7UA 2V0WA 4GJ4A 5F69A 4EEPA 2J80A 3F1NA 3EQUA 2PYPA 3ULFA 4FOFA 2V1AA 1LL8A 1TS6A 3MQOA 2B02A 3T4SA 3VE3A 2W1RA 3R7WA 1T19A 2QJ5A 4PAUA 1N9OA 1S1ZA 2BASA 2EA9A 3OOVA 2W3GA 3IS2A 4Q0HA 1OTIA 3CAXA 3FPWA 2LB5A 4IJGA 1XJ6A 3A0VA 3MFXA 4Y2FA 3PBNA 5AVEA 4MDZA 4BBTA 2VX8A 4I38A 5KSHA 4CLCE 4I3AA 4NXGA 2J3TD 1IFQA 2ZBBA 4P6ZM 3KX0X 4JGPA 4BBUA 1DP9A 5G4ZA 2QKPA 4GHIB 5DF9A 5DJTA 3ZQ5A 4IUHA 3T4LA 5IT5A 2Y8HA 1YSQA 1TS7A 2VLGA 1F5MA 3BQ8A 3T4QA 3CUEC 1OT6A 3KSHA 1S4SA 2VEAA 4II7A 2HJEA 2IA2A 2OAP1 4O0PA 5HPIA 2W0NA 3GECA 1UWPX 3HCYA 2JKTM 3FG8A 2VZWA 4GHIA 2EWWA 4KUKA 2H28A 3LI9A 4LRZE 3PYPA 2ZMFA 2M7UA 4K08A 2PT7A 2V0UA 4RQ9A 2QYBA 3NJAA 1JNUA 4ZRRA 1Y28A 2XRNA 5TJJA 4B93A 2GZAA 4WF0A 4R70A 3BY9A 3VOLA 3EEAA 3T4TA 4CQHA 2VV7A 1F98A 3W2ZA 4Q0JA 3LR5A 3CLOA 5MC7A 2R78A 1T18A 2YKHA 2XROA 2WKQA 2P04A 2KOIA 1TF1A 1V9ZA 1GSWA 4OOLA 3V67A 1MKMA 5HZHA 2VJWA 3OBFA 3P7NA 2PR6A 3OC2A 3FC7A 3BJNA 2V9AA 3T4KA 1GSVA 4GW9A 4L9GA 1T1AA 2YKFA 4Q0IA 2PD8A 3E0YA 2P7JA 5J7EA 4EQ1A 2FH5A 3S7PA 4HI4A 2W1TB 4XT2B 3LR4A 4HIAA 3ICYA 1LSVA 2PYRA 4L9FA 3KO6A 2JKRM 3BQAA 5L8MA 1DRMA 3DBAA 3RH8B 1T1BA 4ME4A 3UB7A 2OWHA 5F68A 3FPVA 3NOTC 3TW8A 4WLAA 3EOIA 3JVUA 2W1TA 4XT2A 3UMDA 3T50A 5F5YA 4Y3IA 3B47A 2VA0A 2B18A 2OAQ1 2P08A 4EEUA 1P97A 1STZA 3CITA 3T4JA 5LBRA 4HNBA 3U2AA 2NUTC 3LYXA 4HJ6A 1YSPA 1P9RA 2HJ9C 2W3DA 3A0RA 4MMNA 4YNRA 1NLYA 3LIEA 3H9WA 1YAXA 1S1YA 5DFYA 1KOUA 2O0YA 4WN5A 1DP8A 4HJ3A 3OCNA 2XA7S 1OPXA 4HH3A 2KX6A 2HGVA 2VKSA 4JGRA 4HP4A 4R6LA 3E4PA 3C38A 2GNXA 5KIZA 3PXPA 3UE3A 2OOLA 5J3WA 4EETB 3OLOA 3JVVA 3NHQA 3LIAA 2PD7A 5HSQA 4HHDA 2L0WA 1P9WA 4G3VA 1VB6A 4WL9A 3MQ0A 3S7QA 1MC0A 3D72A 2Y79A 2VGLS 4F3LB 1ODVA 2QHKA 4R3AA 2VV8A 3HJKA 3VE4A 3SW1A 4BWIA 4HOIA 5FL3A 5DFXA 5DKLA 1OJ5A 5HD3A 3A0SA 3K2NA 1XJ2A 2A24B 4BMWA 1W63Q 3TRCA 4CLCC 5G4YA 2L1MA 3MXQA 2K31A 4HJ4A 3GDIA 2HF6A 2L4RA 4O01A 4DN0A 4F3LA 4EUVA 3C30A 1OTEA 1V9YA 2PHYA 1NWZA 4AFIA 2WKPA 4HY8A 1W63M 2QWSA 2NUPC 5A8BA 2A24A 4IUKA 1H8MA 4B9OA 2XA7M 5HD5A 1EW0A 1VHMA 4GS9B 2W3EA 4MN6A 5HL6A 3BY8A 4I5SA 4YOFA 4KQDA 4DMZA 4MN7A 1XFQA 4QPRA 4Y5FA 4I3JA 2JN7A 3LIDA 1XFNA 4R38A 1D06A 2GJ3A 4HH2A 2Z6CA 2PR5A 4PKYG 3MMHA 3RTYA 1UGUA 4JGQA 2O99A 3CUEA 4GS9A 3TE8A 4GCZA 2J3TC 3LIFA 1ZTUA 3MJQA 4MN5A 2VGLM 3CI6A 4LLOB 3MF0A 4M4XA 3UE6A 4EESA 1DP6A 5HDCA 1S67L 2V1BA 5I5LA 3IBJA 3MQQA 4UQIS 4E04A 2DMWA 2Z6DA 2OWJA 1S4RA 3S7OA 4G3WA 5K5BA 5HDSA 3B33A 1OTAA 3LFVA 3LIBA 4PHTA 4EXOA 4IHQA 4EW7A 5J4EA 3LR0A 4BBVA 2O9BA 5TBMB 1S66L 4EU0A 3LUQA 2KLIA 3PBQA 4ARZB 4HP9A 4DJ2A 2JKRI 5C5KA 3KSGA 1N9NA 3E4OA 3P01A 2M7VA 3PBOA 1X0OA 2W27A 2VV6A 1LT0A 5HWWA 5TBMA 1TS0A 2J3WA 4ARZA 3R4KA 1XJ4A 1NLZA 5CX7A 2W3FA 2INWA 4L9EA 4I3IA 1OJGA 3BWLA 1TS8A 4NXFA 3OCLA 3KSFA 3CWFA 3PBSA 3IBRA 3H7WB 3O5YA 3KYQA 2WKRA 5HDDA 4I39A 2O9AA 3T4OA 3C2WA 3S7NA 1H3QA 3H82B 1OTDA 3ZYTA 3E4QA 2JHEA 3VV4A 4O8GA 1P0ZA 4KQOA 4JGOA 4BJPA 3RFBA 4UQIM 4NKPA 3E98A 1IOUA 4H6JB 4PKYA 3H7WA 5AJGA 1G28A 2XSSA 4OOMA 1TD5A 3EWKA 3NOUC 2ZOHA 3D3OA 3PHYA 2HV1A 1MZUA 2ZOIA 4WEKA 3H82A 4NEED 3MR0A 1F9IA 4EERA 2JKTI 5AVFA 4ETZA 1NRJA 2O9CA 2D01A 2K2NA 3G6OA 3NOPC 4UEYA 1UWNX 4KUOA 4L0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6J A;  3F1P B;  3UB9 A;  3LI8 A;  3K3D A;  1WA9 A;  2CMN A;  2I9V A;  2PDR A;  5HWT A;  5DKK A;  5F6A A;  2QJ7 A;  1LSX A;  3F1P A;  4HQA A;  1BYW A;  3HJI A;  2D02 A;  4WUJ A;  1LSW A;  3UME A;  1OTB A;  2M1C A;  3F1O B;  4NXB A;  4LRY C;  2KDK A;  5IU1 A;  3UB6 A;  3C8C A;  4LRX C;  3F1N B;  3K3C A;  5DJU A;  3LIC A;  3EEH A;  4YWZ A;  1N9L A;  2K7S A;  1GSX A;  5HWV A;  1OT9 A;  3F1O A;  4NXE A;  3IS2 B;  3UB8 A;  4DJ3 A;  1T1C A;  1D7E A;  1XJ3 A;  4LPZ A;  5EFW A;  5IS1 A;  2V0W A;  5F69 A;  4EEP A;  2J80 A;  3F1N A;  3ULF A;  2PYP A;  2V1A A;  1LL8 A;  1TS6 A;  3MQO A;  2B02 A;  3VE3 A;  1T19 A;  2QJ5 A;  1N9O A;  1S1Z A;  2BAS A;  2EA9 A;  3IS2 A;  1OTI A;  3CAX A;  1XJ6 A;  3A0V A;  3MFX A;  5AVE A;  4BBT A;  4I38 A;  4I3A A;  4NXG A;  2ZBB A;  3KX0 X;  4JGP A;  4BBU A;  1DP9 A;  5G4Z A;  2QKP A;  4GHI B;  5DJT A;  3ZQ5 A;  1TS7 A;  2VLG A;  1OT6 A;  1S4S A;  2VEA A;  2W0N A;  3GEC A;  1UWP X;  3FG8 A;  4GHI A;  4KUK A;  2H28 A;  3LI9 A;  4LRZ E;  3PYP A;  4K08 A;  2V0U A;  4RQ9 A;  3NJA A;  1JNU A;  1Y28 A;  4WF0 A;  4R70 A;  3BY9 A;  3VOL A;  2VV7 A;  1F98 A;  3CLO A;  2R78 A;  1T18 A;  2YKH A;  2WKQ A;  1GSW A;  1V9Z A;  5HZH A;  3P7N A;  2PR6 A;  3FC7 A;  2V9A A;  1GSV A;  4GW9 A;  4L9G A;  1T1A A;  2YKF A;  2PD8 A;  2P7J A;  5J7E A;  4EQ1 A;  4HI4 A;  4XT2 B;  4HIA A;  3ICY A;  1LSV A;  2PYR A;  4L9F A;  1DRM A;  3RH8 B;  1T1B A;  3UB7 A;  2OWH A;  5F68 A;  3NOT C;  4WLA A;  3UMD A;  4XT2 A;  3T50 A;  5F5Y A;  4EEU A;  1P97 A;  4HNB A;  3LYX A;  4HJ6 A;  3A0R A;  3LIE A;  3H9W A;  1S1Y A;  1KOU A;  4WN5 A;  1DP8 A;  4HJ3 A;  4HH3 A;  2KX6 A;  4JGR A;  4HP4 A;  4R6L A;  3E4P A;  5KIZ A;  2OOL A;  5J3W A;  4EET B;  3OLO A;  3NHQ A;  3LIA A;  2PD7 A;  5HSQ A;  4HHD A;  2L0W A;  1VB6 A;  4WL9 A;  3D72 A;  4F3L B;  1ODV A;  2QHK A;  4R3A A;  2VV8 A;  3HJK A;  3VE4 A;  3SW1 A;  4HOI A;  5DKL A;  1OJ5 A;  5HD3 A;  3A0S A;  1XJ2 A;  2A24 B;  5G4Y A;  2L1M A;  3MXQ A;  4HJ4 A;  3GDI A;  2L4R A;  4F3L A;  1OTE A;  1V9Y A;  2PHY A;  1NWZ A;  2WKP A;  4HY8 A;  2QWS A;  5A8B A;  2A24 A;  4B9O A;  5HD5 A;  1EW0 A;  4GS9 B;  4MN6 A;  3BY8 A;  4I5S A;  4KQD A;  1XFQ A;  4I3J A;  2JN7 A;  3LID A;  1XFN A;  4R38 A;  1D06 A;  2GJ3 A;  4HH2 A;  2Z6C A;  2PR5 A;  4PKY G;  3RTY A;  1UGU A;  4JGQ A;  4GS9 A;  4GCZ A;  3LIF A;  3MJQ A;  4MN5 A;  4LLO B;  4M4X A;  3UE6 A;  4EES A;  1DP6 A;  5HDC A;  1S67 L;  2V1B A;  5I5L A;  3MQQ A;  4E04 A;  2Z6D A;  2OWJ A;  1S4R A;  5HDS A;  3B33 A;  1OTA A;  3LIB A;  4EXO A;  4EW7 A;  5J4E A;  4BBV A;  5TBM B;  1S66 L;  3LUQ A;  4HP9 A;  4DJ2 A;  1N9N A;  3E4O A;  1X0O A;  2W27 A;  2VV6 A;  1LT0 A;  5HWW A;  5TBM A;  1TS0 A;  1XJ4 A;  2INW A;  4L9E A;  4I3I A;  1OJG A;  3BWL A;  1TS8 A;  4NXF A;  3CWF A;  3IBR A;  3H7W B;  2WKR A;  5HDD A;  4I39 A;  3C2W A;  3H82 B;  1OTD A;  3E4Q A;  2JHE A;  1P0Z A;  4JGO A;  4H6J B;  4PKY A;  3H7W A;  1G28 A;  3EWK A;  3NOU C;  2ZOH A;  3PHY A;  2HV1 A;  1MZU A;  2ZOI A;  3H82 A;  3MR0 A;  1F9I A;  4EER A;  5AVF A;  2D01 A;  3G6O A;  3NOP C;  1UWN X;  4KUO A; 
#chains in the Genus database with same CATH topology
 3M2K A;  3WRZ A;  3F1P B;  4KQR A;  2PBD P;  1KVL A;  4KZ5 A;  1WA9 A;  4OKP A;  5HWT A;  2Y2O A;  2JCH A;  4HQA A;  1W79 A;  1JWZ A;  5M19 A;  3HJI A;  1LSW A;  3DTM A;  4P6Z S;  1GA0 A;  5CHM A;  3UB5 P;  1K55 C;  4CLC B;  1AXB A;  3D9Y A;  2KDK A;  5JYO A;  3T1R A;  4K0W A;  3PR6 A;  3B42 A;  4FSF A;  4CLC D;  4LV2 A;  3WWX A;  3R7W B;  3ITB A;  3F1O A;  4Z1W A;  1T1C A;  1G6O A;  4K0X A;  1ESU A;  2G7U A;  4GJ4 A;  4EEP A;  2J80 A;  3F1N A;  3EQU A;  2PYP A;  2PU4 A;  3FV7 A;  3IF5 A;  3T4S A;  1T19 A;  4O7D A;  4PAU A;  2EA9 A;  3UPN A;  4B4X A;  3IS2 A;  1LHY A;  4OQH A;  4S2K A;  5FQQ A;  3HVF A;  1CEG A;  4KZ6 A;  1I2S A;  2LB5 A;  2JBF A;  4OQI A;  2Y2I A;  1XKZ A;  5AVE A;  3HLD A;  4BBT A;  4DE1 A;  4I3A A;  4NXG A;  3C7U A;  1WYC A;  4ZTK A;  3QP2 A;  5EUA A;  2EX9 A;  3WS2 A;  1YSQ A;  1KE0 A;  2OV5 A;  3N7W A;  3V3R A;  2XFS A;  3NI9 A;  1VEU B;  4MNR A;  4II7 A;  5FAT A;  2IA2 A;  2BG1 A;  5EV0 A;  1IYP A;  3ITA A;  4GHI A;  3QP8 A;  2JC7 A;  3LI9 A;  4LRZ E;  2J9O A;  5FI7 A;  3HLW A;  3ZG9 B;  3SZT A;  1Y4O A;  3NJA A;  4JLF A;  4QJG A;  1JNU A;  4ZRR A;  4QWO A;  1YPR A;  3Q7V B;  3UDI A;  4R70 A;  4KEN B;  1NJ4 A;  4CQH A;  1NYY A;  5FQJ A;  3W2Z A;  4Q0J A;  1C3B A;  1PZP A;  2WGI A;  1GCE A;  2WKQ A;  2A3U A;  2WYX A;  2KOI A;  1GSW A;  3V67 A;  3UE1 A;  4LGW A;  1O07 A;  2ZC5 B;  3OC2 A;  4DXB A;  3FC7 A;  3BJN A;  2V9A A;  3MZE A;  1T1A A;  3WS0 A;  1K57 C;  3E0Y A;  3ZG0 A;  4EQ1 A;  4ZDX A;  4X6T A;  1HVB A;  1GHI A;  3S7P A;  2E8I A;  3LR4 A;  1SKO B;  1IEL A;  1K56 D;  4P87 A;  4BD1 A;  4C3Q A;  4L9F A;  5L8M A;  1DRM A;  3NBL A;  5DF8 A;  1M40 A;  4KZ4 A;  3VMA A;  3UB7 A;  5DF7 A;  4U3T A;  4WLA A;  4PM6 A;  3UMD A;  4XT2 A;  2P08 A;  3IF6 A;  3Q1F A;  3NIA A;  5EM0 A;  3ZVW A;  4OPZ A;  2X01 A;  4YNR A;  3CPT A;  4X56 A;  1IKG A;  3H9W A;  1S1Y A;  5DFY A;  1PWD A;  2O0Y A;  2WGW A;  3OCN A;  4HH3 A;  4FH4 A;  4KZB A;  4DE0 A;  4JGR A;  4MBK A;  3GQZ A;  4HP4 A;  4R6L A;  2GNX A;  1HZO A;  4U0T A;  5DTS A;  2JKF A;  3JVV A;  5L10 A;  3LIA A;  2PD7 A;  2V8F A;  1P9W A;  1G68 A;  5HL1 A;  2OLV A;  1MC0 A;  3D72 A;  2VGL S;  1YM1 A;  1ODV A;  4R3A A;  3VE4 A;  2VV8 A;  5HD3 A;  4BMW A;  3W4O A;  4CLC C;  5G4Y A;  4X1L A;  3MXQ A;  4EWF A;  4N92 A;  2K31 A;  5FDH A;  3HL9 A;  3GDI A;  4DN0 A;  3IT9 A;  1NWZ A;  2WKP A;  1W63 M;  2V20 A;  1IEM A;  3QP4 A;  4KG6 A;  1PRQ A;  4IED A;  3UNW A;  4IBR A;  3IX4 A;  1O7E A;  1NXY A;  4GS9 B;  4R4R A;  1GA9 A;  3ZVT A;  4Y5F A;  4EBL A;  4I3J A;  1DJB A;  1D06 A;  4HH2 A;  2Z6C A;  1S0W A;  3RTY A;  4JGQ A;  2Y59 A;  4GCZ A;  1ZTU A;  1K25 A;  3ISG A;  1G5U A;  2XDM A;  3G30 A;  4ZJ2 A;  1S67 L;  4B4Z A;  5CEB A;  1ES5 A;  2V1B A;  3BLS A;  4LV0 A;  3SH9 A;  3MQQ A;  3GTC A;  2OWJ A;  3G32 A;  1SHV A;  4G3W A;  3LIB A;  1KE3 A;  4PHT A;  4EW7 A;  5TGF A;  5J4E A;  4ZJ1 A;  4BBV A;  1S66 L;  2ZQA A;  3LY3 A;  2KLI A;  1JVJ A;  1K6S A;  1YLZ A;  2BTF P;  2Y2P A;  4HP9 A;  4DJ2 A;  4WZ5 A;  5C5K A;  1DJC A;  3KSG A;  5GLD A;  1N9N A;  3G34 A;  1L0E A;  1NZO A;  3HLE A;  1TVF A;  3CZD A;  3V50 A;  1RGY A;  1YLJ A;  2J8Y A;  5CX7 A;  2WUQ A;  3PTE A;  1TS8 A;  1PIO A;  3CWF A;  1JTG A;  2QZ6 A;  3H7W B;  4FCF A;  4OOY A;  4CPK A;  4I39 A;  4EBP A;  3Q81 A;  2UV0 E;  3LGO A;  1BTL A;  3VV4 A;  1P0Z A;  4KQO A;  5EEC A;  4BJP A;  4KZ7 A;  4UQI M;  4GKU A;  1YLW A;  2J9P A;  4OOM A;  4OPQ A;  3NOU C;  4DF6 A;  2ZOH A;  5F83 A;  1ZKJ A;  3H82 A;  1ALQ A;  2RL3 A;  3FKV A;  4NEE D;  2O9C A;  3GMW A;  3NOP C;  2X02 A;  5CGS A;  1UWN X;  4KUO A;  4H6J A;  4MCW A;  1J9M A;  3TJZ C;  3TG9 A;  4WEL A;  5A92 A;  1PW1 A;  4E6W A;  4KG5 A;  5F6A A;  2QJ7 A;  3OPP A;  4JXV A;  3UPO A;  1ZC2 A;  4H8R A;  1OTB A;  2EXA A;  2M1C A;  4LRY C;  1LL9 A;  4ESP A;  1KE4 A;  3LEZ A;  2ZC7 A;  3UB6 A;  5FAQ A;  4LRX C;  3K3C A;  5DJU A;  3LIC A;  2IWC A;  1MPL A;  3WS4 A;  4OP8 A;  4N1H A;  2G2U A;  4NXE A;  4IVI A;  1H0M A;  3FKW A;  3KYZ A;  2XGN A;  1D7E A;  4LPZ A;  5EFW A;  5IS1 A;  1LI0 A;  5A93 A;  4FOF A;  1LL8 A;  1TS6 A;  4E3M A;  1S1Z A;  2BAS A;  3BLM A;  2W3G A;  3NCK A;  2ZL1 B;  1OTI A;  1Z6F A;  3IHB A;  3S4X A;  1XJ6 A;  4X68 A;  1BUL A;  1ES4 A;  3PBN A;  4RX2 A;  3Q7Z A;  4RA7 A;  4FH2 A;  4RVA A;  3UDF A;  2VX8 A;  1FIK A;  5KSH A;  2VGK A;  4OQ0 A;  4CLC E;  2HP6 A;  3CG5 A;  1PI4 A;  4Y13 A;  3T4L A;  3CJM A;  4K91 A;  5IT5 A;  1TDG A;  1W5D A;  1TS7 A;  2WAE A;  3Q07 A;  4GDB A;  2ZQ8 A;  1F5M A;  1OT6 A;  4PM9 A;  1NZU A;  1ERM A;  4OH0 A;  4O0P A;  4ZAM A;  3HCY A;  1XP4 A;  3FWL A;  5E2F A;  1PNE A;  3IHA A;  4KUK A;  4N1X A;  2H28 A;  5CTN A;  3SH7 A;  2QPN A;  3RXW A;  1I2W A;  4X69 A;  3PYP A;  2M7U A;  3IXD A;  2PT7 A;  4RQ9 A;  1QMF A;  1W8Q A;  1AWI A;  3IWQ A;  4UA7 A;  3VOY A;  4JF6 A;  3NY4 A;  4LEN A;  2Z2L B;  2VV7 A;  1FQG A;  3LR5 A;  3IWO A;  3HBR A;  2YKH A;  4Y17 A;  5BOH A;  4R3B A;  3ZG8 B;  2P04 A;  1TF1 A;  1V9Z A;  1K54 A;  5HZH A;  2VJW A;  2Q9N A;  3U4L P;  3JYI A;  3KYE A;  3T4K A;  2PBY A;  4L9G A;  4Q0I A;  4Y0T A;  4CJN A;  4YFM A;  4DE3 A;  5EM1 A;  2FH5 A;  3DW0 A;  1IYS A;  4HI4 A;  1LSV A;  3ZNY A;  4S2O A;  3KO6 A;  2JKR M;  2B5R A;  3N4I A;  5DTT A;  1Q2Q A;  2OWH A;  4S2I A;  3W4Q A;  3FPV A;  2JE5 A;  1CI8 A;  4N9L A;  3TW8 A;  2W1T A;  1VET A;  5CXW A;  2VA0 A;  2B18 A;  4KZ3 A;  4R0Q A;  5HW3 A;  3T4J A;  3MSH A;  4B88 A;  4HJ6 A;  5HFO A;  4QB8 A;  1P9R A;  4OPR A;  3VP0 A;  4EUZ A;  3UN7 A;  2W3D A;  3A0R A;  2ZQ9 A;  3SS3 A;  1NLY A;  3GV9 A;  1F2K A;  3N8R A;  2XA7 S;  4JXS A;  5EE8 A;  3IWI A;  5TR7 A;  3BFF A;  4E3O A;  4OPY A;  3HUO A;  1K55 A;  3PXP A;  3UE3 A;  1PWG A;  5J3W A;  4QY6 A;  1LL5 A;  4RX3 A;  4EET B;  5FQK A;  3NHQ A;  1XGI A;  3BFG A;  4GD6 A;  1E3U D;  1ESI A;  2L0W A;  4Y0O A;  3MZF A;  2P9V B;  2XQZ A;  3MQ0 A;  4X55 A;  2Y79 A;  4F3L B;  4EBN A;  4PPR A;  2UWX A;  5G18 A;  3HJK A;  1QME A;  2H0Y A;  4GNU A;  1XJ2 A;  1L0F A;  2A49 A;  3TRC A;  4WZ4 A;  1MY8 A;  2ZD8 A;  1N4O A;  2B95 A;  1GHP A;  2HF6 A;  1RCJ A;  2ZM2 A;  2Q0O A;  3C30 A;  3G2Y A;  1OTE A;  1V9Y A;  4AFI A;  4GB7 A;  2NUP C;  2A24 A;  4B9O A;  1KDW A;  3L7H A;  5HL6 A;  3BY8 A;  4YOF A;  4KQD A;  4OLG A;  2Q9M A;  2JN7 A;  3VSK A;  4S2M A;  2WKE A;  2Y2H A;  4PKY G;  3ZDJ A;  2RCX A;  3G35 A;  1UGU A;  2O99 A;  2EX8 A;  3C4P A;  3TE8 A;  3CI6 A;  1E4D A;  2HP9 A;  4LLO B;  4M4X A;  1GHM A;  3UE6 A;  3CHW P;  1DP6 A;  4JF4 A;  2DRW A;  1PZO A;  3DTK A;  3TSG A;  1KDS A;  4GZB A;  1D1J A;  1LI9 A;  1S4R A;  4ZJ3 A;  4KZ8 A;  3S7O A;  4X53 A;  5HDS A;  3LFV A;  5DTK A;  4EXO A;  4IHQ A;  3LR0 A;  2EX2 A;  3HUN A;  3WRT A;  4EU0 A;  3LUQ A;  1IKI A;  3V39 A;  4KQQ A;  3HLB A;  4FTX A;  1MWS A;  2ZC6 B;  2ZQ7 A;  4JXG A;  3E4O A;  3N8S A;  2M7V A;  1X0O A;  2W27 A;  4S2J A;  3UO9 A;  4S2N C;  5TBM A;  1RP5 A;  4KZ9 A;  1TS0 A;  4X25 A;  2J3W A;  4ARZ A;  3O3V A;  1XJ4 A;  2W3F A;  4L9E A;  1K57 A;  4MBH A;  1OJG A;  3QHY A;  4NXF A;  3KSF A;  1CQA A;  4FD8 A;  2R9X A;  3PBS A;  2VK3 A;  2Y2G A;  3O5Y A;  3KYQ A;  2WKR A;  5HDD A;  3AGD A;  3T4O A;  5AQA A;  4WMC A;  3ZYT A;  1OTD A;  2WAF A;  3E4Q A;  1K38 A;  4WYY A;  5EVI B;  4NKP A;  5KSC A;  3BYD A;  2V2F F;  4UA6 A;  5FA7 A;  3HRE A;  2HDS A;  1EI5 A;  5FI2 A;  1L3L A;  3VFF A;  3D3O A;  5EVI D;  3T1X A;  1MZU A;  3BRM A;  3NUL A;  4WEK A;  3NDG A;  1F9I A;  1MWU A;  1SCW A;  2JKT I;  1S6R A;  2D01 A;  4UEY A;  4KG2 A;  2XFT A;  1SDN A;  5KZH A;  1E25 A;  3V5M A;  3K3D A;  2WZX A;  4OVD A;  5HPF A;  2ZMV A;  3ZHH A;  4C75 A;  2G2W A;  2CMN A;  3KSI A;  2I9V A;  3E2K A;  5DKK A;  2DCF A;  4LV1 A;  3DTE A;  1LSX A;  4DE2 A;  3F1P A;  1BYW A;  2IWD A;  4C6Y A;  2HDU A;  1ZG4 A;  3W8K A;  3TOI A;  3UME A;  3F1O B;  1YKD A;  5GLC A;  5F82 A;  5IU1 A;  3EGX C;  3BW6 A;  3F1N B;  4YWZ A;  1N9L A;  3IXG A;  3ZCZ A;  3C7V A;  3O87 A;  4G3K A;  1GSX A;  3A3F A;  4P85 A;  1OT9 A;  5HAP A;  1FCN A;  3IS2 B;  4CLC A;  5IHV A;  2LB9 A;  3UB8 A;  2I72 A;  1G6A A;  5M18 A;  1HTZ A;  2ZM8 A;  4QHC A;  4XXR A;  1ZG6 A;  1ERO A;  1YMS A;  3VE3 A;  2W1R A;  3HLG A;  4NK3 A;  3R7W A;  1YQS A;  5GHZ A;  3OOV A;  1ES3 A;  4M3K A;  4IJG A;  4QD4 A;  3A0V A;  3M2J A;  3MFX A;  4ZBE A;  3SS4 A;  1KVM A;  4Y2F A;  4MDZ A;  3MZD A;  4I38 A;  2FFF B;  2J3T D;  1IFQ A;  2ZBB A;  3O86 A;  4P6Z M;  3KX0 X;  3MKE A;  4JGP A;  4BBU A;  5GHY A;  5TFQ A;  3M6B A;  4GHI B;  5DF9 A;  1PFL A;  5DJT A;  1KGG A;  3T4Q A;  3CUE C;  3KSH A;  4Q8I A;  4BQM A;  2HJE A;  1EWZ A;  2OAP 1;  4P0M A;  2H10 A;  2W0N A;  1PI5 A;  2AVX A;  2JKT M;  2ZQC A;  2EWW A;  1E3U A;  3FYZ A;  1YLP A;  5FAP A;  1VEU A;  2ZM0 A;  1BLC A;  2WKI A;  3V3S A;  4B93 A;  4WF0 A;  2OLU A;  3EEA A;  3VOL A;  1F98 A;  4KZA A;  3CLO A;  2R78 A;  1T18 A;  2XRO A;  5U47 A;  4YIN A;  3S22 A;  3Q7V A;  4Y15 A;  2PAV P;  1MKM A;  4U0X A;  3OBF A;  3P7N A;  3Q82 A;  3UY6 A;  3P09 A;  1KGE A;  4GW9 A;  1HD8 A;  2YKF A;  2EXB A;  1YMX A;  5J7E A;  1YT4 A;  5CRF A;  4DXC A;  4XT2 B;  3ZGA B;  4BEN A;  1MBL A;  5L09 A;  3ICY A;  3IF6 B;  1FCO A;  3BQA A;  1K56 A;  3DBA A;  3RH8 B;  3BM6 A;  5L2F A;  1M6K A;  3NOT C;  2E8J A;  1HLU P;  3EOI A;  3CPT B;  4GOG A;  3T50 A;  3B47 A;  2HDR A;  1SKO A;  1L2S A;  4EEU A;  1P97 A;  1STZ A;  3CIT A;  2WGW B;  5LBR A;  5HAR A;  4HNB A;  3P98 A;  2V8C A;  5EVI C;  2H5S A;  2HJ9 C;  4MMN A;  4R4S A;  1XX2 A;  1JTD A;  3IX3 A;  5J8X A;  4DDS A;  3JPU A;  4WN5 A;  1DP8 A;  4HJ3 A;  2ZLY A;  2KX6 A;  1CEF A;  2J7V A;  5DVA A;  3C38 A;  3NDE A;  3SOI A;  5KIZ A;  5E2E A;  5GHX A;  3AGE A;  4HHD A;  4G3V A;  4WL9 A;  3M6H A;  1LLB A;  3S7Q A;  2Y55 A;  3GSG A;  4EV4 A;  2EFX A;  3DAV A;  5CHJ A;  4BWI A;  5FL3 A;  5DFX A;  5DKL A;  4BL2 A;  3RJU A;  1BZA A;  3A0S A;  3DWK A;  1CJF A;  2L1M A;  5CGW A;  1I5Q A;  5AQ9 A;  3SS5 A;  3E2L A;  1KGF A;  4O01 A;  2PHY A;  1Q2P A;  4JKT A;  5A8B A;  3MS6 A;  4IUK A;  1H8M A;  1FR1 A;  1EW0 A;  1SDE A;  1JWP A;  4I5S A;  4DMZ A;  1XFQ A;  4XUX A;  5GLB A;  1NY0 A;  3QNC A;  1XFN A;  3OPL A;  4R38 A;  4MBF A;  1L0G A;  1CK3 A;  4LV3 A;  2ZC4 B;  5CGX A;  3BEC A;  5CER A;  4DKI A;  4GS9 A;  2HPB A;  2J3T C;  3MJQ A;  4MN5 A;  2VGL M;  2Y2M A;  2XF3 A;  1BSG A;  1ERQ A;  2JKG A;  4EES A;  3QNB A;  4WM9 A;  5HDC A;  5FDS A;  2CC1 A;  5I5L A;  3IBJ A;  4UQI S;  2DMW A;  2VGJ A;  3B33 A;  1OTA A;  2XH9 A;  3GRJ A;  4RYE A;  1FSW A;  5I94 A;  2O9B A;  4GD8 A;  2WZZ A;  3PBQ A;  5F1G A;  2XK1 A;  3P01 A;  2ZMA A;  1Y54 A;  2VV6 A;  3HLC A;  1LT0 A;  1ACF A;  3A3I A;  3CMZ A;  1H5X A;  3MXR A;  3R4K A;  2X71 A;  3IX8 A;  3HLF A;  4N9K A;  1XPB A;  3OCL A;  3I7J A;  1RGZ A;  2R9W A;  1BUE A;  3IBR A;  4PM8 A;  2EFU A;  2WK0 A;  1H8Y A;  3S7N A;  3H82 B;  3ZFZ A;  1BLH A;  4JGO A;  3RFB A;  4E3L A;  1A0K A;  3A3D A;  4WBG A;  3FZC A;  1IOU A;  4H6J B;  4PKY A;  4JF5 A;  3H7W A;  5AJG A;  1G28 A;  2XSS A;  5EOE A;  3EWK A;  1L0D A;  2PRF A;  3PHY A;  3BEB A;  2ZOI A;  3VSL A;  3MR0 A;  4EER A;  2H0T A;  4ETZ A;  1NRJ A;  3G6O A;  3IF6 C;  3ZG5 A;  3IXH A;  3UB9 A;  3LI8 A;  4OON A;  2W3H A;  4GN2 A;  1ZHH B;  2PU2 A;  4OQG A;  1YLY A;  1K0K A;  2A2L A;  2MJ6 A;  1K4F A;  2WGV A;  3EQV A;  2PDR A;  5FQM A;  3RXX A;  1K4E A;  4ETX A;  4WUJ A;  2D02 A;  3ZG7 B;  4S2L A;  3PBR A;  4NXB A;  4WEJ A;  2FZ0 A;  3IH8 A;  3OZH A;  1ES2 A;  4GLQ A;  2Y2Q A;  3C8C A;  3N6I A;  3IXB A;  1XA1 A;  1YLT A;  3EEH A;  4E3K A;  2EWV A;  3NC8 A;  2GX5 A;  3BFC A;  3T1S A;  2K7S A;  3EGD C;  5HWV A;  2DNS A;  5CHU A;  1FR6 A;  2Y2L A;  3PBT A;  4E3J A;  4DJ3 A;  1N9B A;  3LR3 A;  1XJ3 A;  4A5R A;  2V0W A;  5F69 A;  3ULF A;  4NG2 A;  4IVK A;  2V1A A;  2XD1 A;  2B02 A;  3MQO A;  5EVE A;  3LEQ A;  1W7F A;  2QJ5 A;  1N9O A;  2XD5 A;  1TEM A;  4Q0H A;  3CAX A;  1Z09 A;  4LCL A;  3FPW A;  3SH8 A;  3C5A A;  1FCM A;  3QP6 A;  1W8Y A;  4JXW A;  3OPR A;  1OME A;  2ZL1 A;  5M1A A;  1DP9 A;  5G4Z A;  2QKP A;  1XGJ A;  2Y2N A;  3ZQ5 A;  4IUH A;  2Y8H A;  4MEZ A;  1VQQ A;  1FIL A;  2VLG A;  3BQ8 A;  1S4S A;  2VEA A;  1K6R A;  5JYP A;  3VFH A;  2ZQD A;  4QU3 A;  1PYY A;  2GDN A;  5HPI A;  3GEC A;  1UWP X;  2HDQ A;  5FEF A;  3FG8 A;  2VZW A;  4LFU A;  1MWT A;  3B3X A;  2ZMF A;  3LCE A;  4K08 A;  5EOO A;  2V0U A;  2QYB A;  1PW8 A;  1J3W A;  1DY6 A;  4UHU A;  1Y28 A;  1TDL A;  5GL9 A;  2XRN A;  2XEP A;  5TJJ A;  2GZA A;  3QP5 A;  3BY9 A;  4JPM A;  5GLA A;  5E43 A;  3T4T A;  2ZJ9 A;  3A3J A;  5HAI A;  5FAO A;  5FI6 A;  4WZ5 C;  3PAE A;  2IWB A;  5FAS A;  3MFD A;  5MC7 A;  4S2N A;  1ONH A;  2Z2M B;  4OOL A;  2XLN A;  1FSY A;  2C6W B;  2PR6 A;  3MKF A;  1GSV A;  4LCM A;  4ID4 A;  3S1Y A;  2PD8 A;  3L9K A;  3LO7 A;  4BD0 A;  2P7J A;  4UA9 A;  1NYM A;  2Y2J A;  4Z9Q A;  5AQ7 A;  2W1T B;  1VET B;  4HIA A;  2ACG A;  2PYR A;  5F1F A;  2Y4A A;  5E2H A;  4FUW A;  3O88 A;  1T1B A;  4ME4 A;  5D3O A;  5F68 A;  3LY4 A;  4BLM A;  2WKH A;  4S2P A;  3JVU A;  5F5Y A;  4Y3I A;  3VOZ A;  2OAQ 1;  2C5W B;  2OSU A;  4PM5 A;  4GDN A;  1XXM A;  3U2A A;  3T12 B;  2NUT C;  3PAG A;  3LYX A;  1YSP A;  3IQA A;  3T1Q B;  2Y2K A;  4XUZ A;  1BT5 A;  3UE0 A;  3VP1 A;  4HES A;  3LIE A;  3W4P A;  2Y91 A;  4HBU A;  1YAX A;  3UPP A;  1KOU A;  1OPX A;  2HGV A;  2VKS A;  4PMA A;  3BFD A;  3E4P A;  2FFY A;  1BLS A;  4DDY A;  4JBF A;  3DWZ A;  2OOL A;  3G4P A;  3OLO A;  5HSQ A;  3G2Z A;  3OPH A;  1VB6 A;  3QP1 A;  3HUM A;  4NET A;  4X1M A;  4D2O A;  1WYB A;  2QHK A;  2HZ5 A;  3SW1 A;  2EX6 A;  4HOI A;  5EPH A;  1OJ5 A;  3K2N A;  2A24 B;  1MXO A;  1W63 Q;  2P9V A;  4D60 A;  4HJ4 A;  2HP5 A;  3D4F A;  2L4R A;  5AQB A;  3UDX A;  4F3L A;  4EUV A;  1DJA A;  1MWR A;  4HY8 A;  4BL3 A;  1CF0 A;  4Y0U A;  2QWS A;  3VP4 A;  5KMW A;  3BFE A;  2XA7 M;  5HD5 A;  4E3I A;  1VHM A;  2W3E A;  4MN6 A;  1NRF A;  3C4O A;  4MN7 A;  4QPR A;  3LID A;  4PM7 A;  3DTI A;  2GJ3 A;  2PR5 A;  5A90 A;  3ZNT A;  3MMH A;  3CUE A;  5EVL A;  3LIF A;  4E3N A;  3IH9 A;  2WAD A;  5CED A;  3VP3 A;  2XR0 A;  4IBX A;  3MF0 A;  5L07 A;  4QY5 A;  4R3J A;  3G31 A;  1SKF A;  4E04 A;  1WE4 A;  2Z6D A;  1VM1 A;  5K5B A;  3AGF A;  1SZV A;  2ZC3 B;  4R1G A;  5TBM B;  2V1Z A;  4ARZ B;  4UAA A;  3A3E A;  2BLS A;  2JKR I;  3VP2 A;  4MLL A;  3PBO A;  4HBT A;  1IYO A;  5HWW A;  4OP5 A;  4R23 A;  1PWC A;  4E6X A;  1K54 C;  1NLZ A;  5FQ9 A;  3MXS A;  2INW A;  4I3I A;  5CTM A;  4Y7P A;  3BWL A;  5CEC A;  1H8Z A;  1XA7 A;  1IYQ A;  3WS5 A;  4WMC D;  3WS1 A;  1MKI A;  4OLD A;  4EQI A;  5HX9 A;  2O9A A;  3C2W A;  2P74 A;  1H3Q A;  5FQI A;  2JHE A;  5HAQ A;  4O8G A;  1CI9 A;  3NEC A;  3E98 A;  3GR2 A;  4P6B A;  4HEF A;  1FOF A;  3MBZ A;  1U60 A;  1TD5 A;  1BLP A;  4DRT A;  1ONG A;  2QMI A;  2HV1 A;  3N8L A;  4F94 A;  5A91 A;  1JWV A;  5FSR A;  5AVF A;  5FEG A;  5EVI A;  3GVB A;  2K2N A;  5E2G A;  4L0L A; 
#chains in the Genus database with same CATH homology
 4H6J A;  3F1P B;  3UB9 A;  4MCW A;  3LI8 A;  2W3H A;  3K3D A;  3TJZ C;  5HPF A;  1ZHH B;  2ZMV A;  1WA9 A;  2A2L A;  2MJ6 A;  4WEL A;  2CMN A;  3KSI A;  3EQV A;  2I9V A;  2PDR A;  5HWT A;  5DKK A;  5F6A A;  2QJ7 A;  1LSX A;  3F1P A;  4HQA A;  1BYW A;  4ETX A;  3HJI A;  2D02 A;  4WUJ A;  1LSW A;  3UME A;  1OTB A;  4P6Z S;  2M1C A;  3F1O B;  3PBR A;  4NXB A;  4LRY C;  1YKD A;  4CLC B;  4WEJ A;  2KDK A;  2FZ0 A;  5IU1 A;  4GLQ A;  3UB6 A;  3EGX C;  3C8C A;  3BW6 A;  4LRX C;  3F1N B;  3K3C A;  3PR6 A;  3B42 A;  5DJU A;  3LIC A;  3EEH A;  2EWV A;  1N9L A;  4FSF A;  4YWZ A;  4CLC D;  2GX5 A;  2K7S A;  4G3K A;  3EGD C;  3R7W B;  1GSX A;  5HWV A;  1OT9 A;  3F1O A;  4Z1W A;  4NXE A;  3IS2 B;  3KYZ A;  4CLC A;  3PBT A;  2LB9 A;  3UB8 A;  1T1C A;  4DJ3 A;  1G6O A;  3LR3 A;  1D7E A;  1XJ3 A;  4LPZ A;  5EFW A;  5IS1 A;  2G7U A;  2V0W A;  4GJ4 A;  5F69 A;  4EEP A;  2J80 A;  3F1N A;  3EQU A;  2PYP A;  3ULF A;  4FOF A;  2V1A A;  1LL8 A;  1TS6 A;  3MQO A;  2B02 A;  3T4S A;  3VE3 A;  2W1R A;  3R7W A;  1T19 A;  2QJ5 A;  4PAU A;  1N9O A;  1S1Z A;  2BAS A;  2EA9 A;  3OOV A;  2W3G A;  3IS2 A;  4Q0H A;  1OTI A;  3CAX A;  3FPW A;  2LB5 A;  4IJG A;  1XJ6 A;  3A0V A;  3MFX A;  4Y2F A;  3PBN A;  5AVE A;  4MDZ A;  4BBT A;  2VX8 A;  4I38 A;  5KSH A;  4CLC E;  4I3A A;  4NXG A;  2J3T D;  1IFQ A;  2ZBB A;  4P6Z M;  3KX0 X;  4JGP A;  4BBU A;  1DP9 A;  5G4Z A;  2QKP A;  4GHI B;  5DF9 A;  5DJT A;  3ZQ5 A;  4IUH A;  3T4L A;  5IT5 A;  2Y8H A;  1YSQ A;  1TS7 A;  2VLG A;  1F5M A;  3BQ8 A;  3T4Q A;  3CUE C;  1OT6 A;  3KSH A;  1S4S A;  2VEA A;  4II7 A;  2HJE A;  2IA2 A;  2OAP 1;  4O0P A;  5HPI A;  2W0N A;  3GEC A;  1UWP X;  3HCY A;  2JKT M;  3FG8 A;  2VZW A;  4GHI A;  2EWW A;  4KUK A;  2H28 A;  3LI9 A;  4LRZ E;  3PYP A;  2ZMF A;  2M7U A;  4K08 A;  2PT7 A;  2V0U A;  4RQ9 A;  2QYB A;  3NJA A;  1JNU A;  4ZRR A;  1Y28 A;  2XRN A;  5TJJ A;  4B93 A;  2GZA A;  4WF0 A;  4R70 A;  3BY9 A;  3VOL A;  3EEA A;  3T4T A;  4CQH A;  2VV7 A;  1F98 A;  3W2Z A;  4Q0J A;  3LR5 A;  3CLO A;  5MC7 A;  2R78 A;  1T18 A;  2YKH A;  2XRO A;  2WKQ A;  2P04 A;  2KOI A;  1TF1 A;  1V9Z A;  1GSW A;  4OOL A;  3V67 A;  1MKM A;  5HZH A;  2VJW A;  3OBF A;  3P7N A;  2PR6 A;  3OC2 A;  3FC7 A;  3BJN A;  2V9A A;  3T4K A;  1GSV A;  4GW9 A;  4L9G A;  1T1A A;  2YKF A;  4Q0I A;  2PD8 A;  3E0Y A;  2P7J A;  5J7E A;  4EQ1 A;  2FH5 A;  3S7P A;  4HI4 A;  2W1T B;  4XT2 B;  3LR4 A;  4HIA A;  3ICY A;  1LSV A;  2PYR A;  4L9F A;  3KO6 A;  2JKR M;  3BQA A;  5L8M A;  1DRM A;  3DBA A;  3RH8 B;  1T1B A;  4ME4 A;  3UB7 A;  2OWH A;  5F68 A;  3FPV A;  3NOT C;  3TW8 A;  4WLA A;  3EOI A;  3JVU A;  2W1T A;  4XT2 A;  3UMD A;  3T50 A;  5F5Y A;  4Y3I A;  3B47 A;  2VA0 A;  2B18 A;  2OAQ 1;  2P08 A;  4EEU A;  1P97 A;  1STZ A;  3CIT A;  3T4J A;  5LBR A;  4HNB A;  3U2A A;  2NUT C;  3LYX A;  4HJ6 A;  1YSP A;  1P9R A;  2HJ9 C;  2W3D A;  3A0R A;  4MMN A;  4YNR A;  1NLY A;  3LIE A;  3H9W A;  1YAX A;  1S1Y A;  5DFY A;  1KOU A;  2O0Y A;  4WN5 A;  1DP8 A;  4HJ3 A;  3OCN A;  2XA7 S;  1OPX A;  4HH3 A;  2KX6 A;  2HGV A;  2VKS A;  4JGR A;  4HP4 A;  4R6L A;  3E4P A;  3C38 A;  2GNX A;  5KIZ A;  3PXP A;  3UE3 A;  2OOL A;  5J3W A;  4EET B;  3OLO A;  3JVV A;  3NHQ A;  3LIA A;  2PD7 A;  5HSQ A;  4HHD A;  2L0W A;  1P9W A;  4G3V A;  1VB6 A;  4WL9 A;  3MQ0 A;  3S7Q A;  1MC0 A;  3D72 A;  2Y79 A;  2VGL S;  4F3L B;  1ODV A;  2QHK A;  4R3A A;  2VV8 A;  3HJK A;  3VE4 A;  3SW1 A;  4BWI A;  4HOI A;  5FL3 A;  5DFX A;  5DKL A;  1OJ5 A;  5HD3 A;  3A0S A;  3K2N A;  1XJ2 A;  2A24 B;  4BMW A;  1W63 Q;  3TRC A;  4CLC C;  5G4Y A;  2L1M A;  3MXQ A;  2K31 A;  4HJ4 A;  3GDI A;  2HF6 A;  2L4R A;  4O01 A;  4DN0 A;  4F3L A;  4EUV A;  3C30 A;  1OTE A;  1V9Y A;  2PHY A;  1NWZ A;  4AFI A;  2WKP A;  4HY8 A;  1W63 M;  2QWS A;  2NUP C;  5A8B A;  2A24 A;  4IUK A;  1H8M A;  4B9O A;  2XA7 M;  5HD5 A;  1EW0 A;  1VHM A;  4GS9 B;  2W3E A;  4MN6 A;  5HL6 A;  3BY8 A;  4I5S A;  4YOF A;  4KQD A;  4DMZ A;  4MN7 A;  1XFQ A;  4QPR A;  4Y5F A;  4I3J A;  2JN7 A;  3LID A;  1XFN A;  4R38 A;  1D06 A;  2GJ3 A;  4HH2 A;  2Z6C A;  2PR5 A;  4PKY G;  3MMH A;  3RTY A;  1UGU A;  4JGQ A;  2O99 A;  3CUE A;  4GS9 A;  3TE8 A;  4GCZ A;  2J3T C;  3LIF A;  1ZTU A;  3MJQ A;  4MN5 A;  2VGL M;  3CI6 A;  4LLO B;  3MF0 A;  4M4X A;  3UE6 A;  4EES A;  1DP6 A;  5HDC A;  1S67 L;  2V1B A;  5I5L A;  3IBJ A;  3MQQ A;  4UQI S;  4E04 A;  2DMW A;  2Z6D A;  2OWJ A;  1S4R A;  3S7O A;  4G3W A;  5K5B A;  5HDS A;  3B33 A;  1OTA A;  3LFV A;  3LIB A;  4PHT A;  4EXO A;  4IHQ A;  4EW7 A;  5J4E A;  3LR0 A;  4BBV A;  2O9B A;  5TBM B;  1S66 L;  4EU0 A;  3LUQ A;  2KLI A;  3PBQ A;  4ARZ B;  4HP9 A;  4DJ2 A;  2JKR I;  5C5K A;  3KSG A;  1N9N A;  3E4O A;  3P01 A;  2M7V A;  3PBO A;  1X0O A;  2W27 A;  2VV6 A;  1LT0 A;  5HWW A;  5TBM A;  1TS0 A;  2J3W A;  4ARZ A;  3R4K A;  1XJ4 A;  1NLZ A;  5CX7 A;  2W3F A;  2INW A;  4L9E A;  4I3I A;  1OJG A;  3BWL A;  1TS8 A;  4NXF A;  3OCL A;  3KSF A;  3CWF A;  3PBS A;  3IBR A;  3H7W B;  3O5Y A;  3KYQ A;  2WKR A;  5HDD A;  4I39 A;  2O9A A;  3T4O A;  3C2W A;  3S7N A;  1H3Q A;  3H82 B;  1OTD A;  3ZYT A;  3E4Q A;  2JHE A;  3VV4 A;  4O8G A;  1P0Z A;  4KQO A;  4JGO A;  4BJP A;  3RFB A;  4UQI M;  4NKP A;  3E98 A;  1IOU A;  4H6J B;  4PKY A;  3H7W A;  5AJG A;  1G28 A;  2XSS A;  4OOM A;  1TD5 A;  3EWK A;  3NOU C;  2ZOH A;  3D3O A;  3PHY A;  2HV1 A;  1MZU A;  2ZOI A;  4WEK A;  3H82 A;  4NEE D;  3MR0 A;  1F9I A;  4EER A;  2JKT I;  5AVF A;  4ETZ A;  1NRJ A;  2O9C A;  2D01 A;  2K2N A;  3G6O A;  3NOP C;  4UEY A;  1UWN X;  4KUO A;  4L0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...