4HJ4A

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
177
structure length
177
Chain Sequence
b'AMDQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOV protein
molecule tags Signaling protein
source organism Rhodobacter sphaeroides
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
total genus 56
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hj4A00
4XT2A 4WL9A 4EESA 2PD8A 5HD3A 2PHYA 3BWLA 5J3WA 3VE4A 1OT9A 1XJ2A 2M1CA 1OJGA 3E4PA 4I3AA 2J80A 4GCZA 4KUKA 1D06A 2VV7A 3C8CA 2VV8A 3MXQA 3UB7A 2L0WA 2W0NA 2Z6CA 4HI4A 2D02A 2OWHA 4HIAA 5KIZA 1N9OA 2A24A 4HJ6A 1OTEA 3NJAA 4H6JA 1XJ4A 1DP9A 4HQAA 5IU1A 4EQ1A 1S1YA 4EXOA 5DKKA 4EW7A 5TBMB 3F1PB 3CAXA 1EW0A 1T19A 3LIFA 2V9AA 3A0RA 2WKQA 3D72A 3MFXA 2BASA 5HDDA 1OJ5A 3GDIA 3H82A 1GSXA 1XJ6A 2Z6DA 4EERA 3LYXA 1TS0A 4M4XA 1MZUA 2L1MA 4JGRA 4WLAA 5G4YA 2OOLA 4BBUA 2QJ5A 4R3AA 3RTYA 5AVFA 3E4QA 2VV6A 4NXEA 2KX6A 2JN7A 4WF0A 4LRZE 4I3IA 4XT2B 3BY8A 3LIEA 5HDSA 4LRXC 1T1AA 4EETB 3MQQA 4I3JA 5J7EA 2PR5A 1LSVA 4GW9A 4R6LA 5A8BA 2L4RA 4BBVA 4GS9B 4E04A 4DJ2A 2HV1A 5HWTA 3B33A 4HJ4A 5DKLA 3F1NB 2V0UA 4HJ3A 5AVEA 1S4RA 2QJ7A 3F1NA 2PDRA 1DP8A 1S67L 2ZOHA 3MQOA 1OTBA 3UB8A 3MR0A 4GHIA 1XFQA 3MJQA 1V9ZA 1F98A 3C2WA 3VOLA 4HH3A 3NHQA 2WKRA 4I38A 4L9EA 5F68A 3EEHA 1DP6A 4HP9A 4HY8A 3CLOA 5I5LA 5F69A 5G4ZA 5TBMA 4EEUA 1GSVA 4F3LB 4NXFA 1OTAA 4KUOA 4MN6A 1XFNA 1F9IA 2JHEA 3FG8A 2QWSA 3H7WB 3PYPA 5EFWA 1DRMA 3HJIA 4R70A 4WUJA 3H9WA 4JGQA 1NWZA 3LI8A 4L9GA 2W27A 3E4OA 1GSWA 5DJUA 3NOTC 5HDCA 1S66L 2A24B 4LLOB 1UGUA 3RH8B 1LT0A 1VB6A 5F5YA 3NOPC 3F1OB 3LIAA 3NOUC 2D01A 4GS9A 4L9FA 3G6OA 4NXGA 3OLOA 4K08A 3LI9A 5F6AA 1S4SA 3IS2A 3CWFA 1TS8A 2GJ3A 3P7NA 3H82B 3PHYA 5HSQA 1TS6A 4H6JB 4HH2A 3VE3A 3LICA 4HHDA 2KDKA 5IS1A 2QHKA 3UMDA 1T18A 2K7SA 3KX0X 3BY9A 1T1CA 1BYWA 1XJ3A 3LIDA 2R78A 3A0VA 4PKYG 1OT6A 2ZBBA 4NXBA 4EEPA 2VEAA 2V1AA 3LIBA 2H28A 1LSXA 4HP4A 4PKYA 5DJTA 5HD5A 3IBRA 4JGOA 4B9OA 1TS7A 3SW1A 1KOUA 2V0WA 3FC7A 1D7EA 2PYRA 3ULFA 1WA9A 1UWPX 2VLGA 3EWKA 3F1OA 4I39A 4HOIA 3LUQA 2I9VA 4WN5A 2V1BA 2OWJA 5HWVA 1G28A 1ODVA 3K3DA 2YKFA 3IS2B 3UB9A 2ZOIA 1X0OA 4KQDA 1UWNX 5HZHA 1JNUA 1P97A 2PD7A 3GECA 1V9YA 4GHIB 3UB6A 4RQ9A 5HWWA 2B02A 4LPZA 1OTIA 3HJKA 1LL8A 3ICYA 3K3CA 2PYPA 4YWZA 1S1ZA 2INWA 3ZQ5A 3UMEA 1N9NA 1T1BA 4MN5A 4DJ3A 1P0ZA 2EA9A 1N9LA 1Y28A 2WKPA 2CMNA 4R38A 3UE6A 1LSWA 3F1PA 4LRYC 4F3LA 4I5SA 4JGPA 3T50A 1OTDA 2PR6A 2QKPA 3A0SA 2P7JA 4HNBA 2YKHA 3H7WA 5J4EA 4BBTA
chains in the Genus database with same CATH superfamily
2JKTM 4PMAA 1NRJA 4OLDA 4ZBEA 4GCZA 4DN0A 2OAP1 2L0WA 4ZTKA 3KYQA 2WGWB 1Z6FA 1XPBA 2WGWA 2H5SA 5DF8A 4YFMA 4FH4A 1HD8A 3DTIA 3F1PB 1EW0A 2V9AA 1O7EA 4X1LA 1XJ6A 4M4XA 2C6WB 4PM6A 4ZJ2A 3WS4A 1MPLA 4NXEA 5TGFA 2M7VA 1GA9A 2VA0A 3UPNA 4ESPA 3FKWA 2QMIA 2QPNA 3T12B 3BQ8A 2WKEA 1AWIA 4EEUA 4KQQA 1E3UA 1MKIA 4JLFA 4L9GA 3SS5A 1VB6A 1SKOA 1VEUA 5EE8A 3LI9A 5CGSA 4CLCD 2HDSA 1TS6A 2O9BA 1E25A 2A2LA 3VE3A 5FI2A 3GRJA 2K7SA 5JYPA 3N7WA 4GD6A 3O3VA 2HP5A 2WYXA 5EVLA 4BD0A 2P9VA 3IWIA 4IEDA 1TS7A 5FATA 3JVUA 1ZTUA 5CTNA 3K3DA 1K56D 2H10A 4XUXA 5L09A 1W63M 1BTLA 1PNEA 4WEKA 5GLCA 5FDHA 3MXRA 1XXMA 3Q7VA 2HDRA 4R3JA 1SKOB 1XKZA 3T4KA 4D2OA 4DE3A 4HJ6A 4OKPA 2R9XA 1S6RA 1S1YA 3G4PA 3IXGA 2JKRI 3D72A 3DBAA 1KE4A 2Y8HA 3GDIA 2EWVA 1LI9A 4HBTA 5L10A 1LL5A 4IVIA 3LR4A 1NXYA 3M6BA 5FEFA 2HV1A 3B33A 4MBFA 4Y3IA 2ZOHA 4G3VA 1OTBA 5HAPA 2B18A 2RCXA 1XP4A 3HREA 4KUOA 1XFNA 3FG8A 3WRZA 2ZQAA 1IYSA 3T4OA 3E4OA 4DE0A 3F1OB 3NOUC 3BECA 3BLSA 2O9CA 3H82B 1ZKJA 1RGZA 3IWOA 1VHMA 3UMDA 1D1JA 2WUQA 4P6ZM 4OOLA 1NYMA 2HDQA 3SZTA 4E3KA 4B4XA 5HD5A 3IBRA 3IT9A 5J8XA 4QB8A 3W4QA 3MQ0A 3FWLA 1NY0A 3Q82A 3ULFA 1ODVA 4IBXA 3UB9A 5HZHA 3GECA 1G6AA 1OTIA 2PU2A 2INWA 1M6KA 2ZL1B 2Y59A 2K31A 5E43A 5FAQA 4QD4A 3MZEA 4BL3A 2V2FF 3PAEA 1IYOA 4QU3A 1YM1A 4IUKA 2PRFA 3PR6A 2P04A 4OLGA 4BJPA 1IELA 1CEGA 1I5QA 4EW7A 4YOFA 5F1FA 1PWDA 4R3BA 1YT4A 3BFDA 1DY6A 3BW6A 3EEAA 4WLAA 4JGRA 4S2MA 3VP3A 4II7A 3E0YA 3D4FA 2DNSA 3QP2A 5TR7A 3KYEA 5J7EA 1LSVA 4GW9A 4R6LA 4EU0A 2W3FA 4N1HA 4KG2A 3EOIA 3KSFA 3C2WA 4KZ4A 3NHQA 3NY4A 4UQIM 3BFGA 4F3LB 2Y2HA 2DRWA 4R70A 3HUOA 2W1RA 4JGQA 1K0KA 4O8GA 1GHIA 3B3XA 3VSLA 4FOFA 2E8JA 2EXBA 3LEQA 3RH8B 1FIKA 1ALQA 2OLVA 2RL3A 4BLMA 4QY6A 1S4SA 1N9BA 4QJGA 1YLTA 4E3MA 1BLPA 1H8ZA 3QP8A 2Y2GA 4PKYG 3LIBA 3HLBA 4UQIS 5C5KA 1KOUA 2EX6A 5AQAA 3UDXA 4HOIA 1TVFA 3LFVA 3OCLA 2BG1A 3UDIA 5AQBA 2J3TC 4KQDA 1JNUA 1P97A 3RJUA 3ZG9B 3FPWA 2X01A 1T1BA 1YMXA 4F3LA 4I5SA 4UEYA 4U0XA 4WEJA 1P9WA 1K55A 4MLLA 4FTXA 1L0EA 1XX2A 5EV0A 2J3TD 4GJ4A 2VV7A 2VV8A 1ERMA 3SH8A 5KIZA 2JKFA 1H8MA 1PZPA 4MBKA 4N1XA 2EX8A 3ZG8B 3T1QB 1SDEA 3H82A 4LV1A 4WMCD 4DE2A 4GNUA 2XROA 4QY5A 2P08A 4EV4A 1Q2QA 2ZJ9A 2Y55A 3JYIA 1W5DA 4YNRA 4KG5A 4DJ2A 3IF5A 2V0UA 1S4RA 3R7WA 2W3GA 3IH8A 1FSWA 3O87A 4L9EA 1KE0A 2OV5A 1MBLA 1OTAA 5EFWA 5TBMB 1ES4A 3VP1A 1GSWA 4WBGA 1ONHA 2JKRM 1WYCA 4ARZB 3GVBA 4GS9A 4WZ5C 3IF6C 2GJ3A 1T18A 1BYWA 5FA7A 5E2EA 3HLEA 5FQQA 3QHYA 4JGOA 4MMNA 2QZ6A 3ZGAB 2HDUA 1U60A 1W8QA 5HARA 4B4ZA 4LGWA 3HCYA 3T4LA 2PBDP 2ZMAA 3DW0A 2WKHA 3MKEA 1CJFA 5GLAA 2KLIA 4C75A 4HNBA 1KDWA 3BYDA 4WL9A 2UWXA 1JWVA 3E4PA 5FQJA 1MY8A 4GKUA 4LENA 2I72A 2ZQ7A 5IU1A 5EOOA 2Y2PA 4RX2A 2VGJA 2WKIA 2V1ZA 3CPTB 3MS6A 2AVXA 1GSXA 4DE1A 1FCOA 2JCHA 3RTYA 3E4QA 3UB5P 4IVKA 1OPXA 4QPRA 5EUAA 3VMAA 3OZHA 4UA9A 5HWTA 3T4TA 2EX2A 3UB8A 1OMEA 3MR0A 3BFFA 3EEHA 3Q81A 3H7WB 4R0QA 4MDZA 3GMWA 5DJUA 3ZDJA 3IXBA 3LO7A 3LIAA 3ZNTA 3G6OA 4IUHA 4NG2A 2HPBA 1HVBA 3A3FA 3E2LA 1PW1A 2Y4AA 1JWZA 1PYYA 3PAGA 3FC7A 4LV3A 3PBNA 4KQOA 1XA1A 4OOMA 1NYYA 4LPZA 4D60A 1FR1A 4N9LA 4FH2A 1Y28A 4PAUA 3F1PA 4CLCC 1QMFA 1K57C 3H7WA 1S0WA 2M1CA 2W3HA 3HLFA 1ZC2A 3MXQA 3IF6A 4NETA 5CGWA 3HUMA 4A5RA 4DF6A 1PFLA 2OWHA 4KENB 4HIAA 1SCWA 5AQ7A 3OPRA 4FSFA 3CI6A 3AGFA 4Z9QA 3CAXA 1L0DA 1BSGA 2V20A 3ITBA 4BL2A 1ES3A 4E3OA 2PT7A 2Y2NA 1VETB 3TG9A 4EERA 1MZUA 2L1MA 5AVFA 3VFFA 3WWXA 3GTCA 4X6TA 4EBPA 1CK3A 4KQRA 4E04A 1BLCA 3R4KA 4HJ3A 3R7WB 3LY4A 3UO9A 4LV0A 3VOLA 1AXBA 4IHQA 2Y2LA 2E8IA 1FCNA 1KGEA 4WUJA 3DAVA 3H9WA 5EM1A 5FDSA 3NOTC 4GB7A 3G34A 5EVEA 3IS2A 3CWFA 4XUZA 3I7JA 3LIDA 3C4PA 4OONA 3WS1A 4O0PA 1Q2PA 3JVVA 3HVFA 3LUQA 3KSGA 4GHIB 2WAEA 1CQAA 1S1ZA 3VOYA 3S7QA 3E98A 2XD1A 1PWGA 2EFXA 2Y2IA 1JWPA 1NZOA 5HW3A 5J3WA 1OT9A 2C5WB 3C8CA 2JC7A 4FUWA 4HI4A 3S1YA 5JYOA 3V50A 1H5XA 4KZ5A 1H0MA 3ZVWA 1KVMA 1TF1A 4U3TA 1SHVA 1LL9A 2XK1A 2OOLA 4Q8IA 4P85A 2XFTA 2VZWA 1YMSA 1SKFA 3TW8A 4R4SA 1K4EA 2A3UA 4GS9B 5F82A 3F1NB 2Y2OA 3CJMA 3ITAA 3PBQA 2ZM8A 1DP6A 4S2OA 4HY8A 3LR0A 2GDNA 1F9IA 2FH5A 3HJIA 3AGDA 2XFSA 4PM9A 5GL9A 3TJZC 4S2NA 4NXGA 3OLOA 2UV0E 1RCJA 4OQHA 3NULA 3D3OA 2QHKA 2J8YA 2ZBBA 4MN7A 4NXBA 3K2NA 3T4QA 3IX3A 1G68A 3NBLA 2MJ6A 2V0WA 2PYRA 2PU4A 3F1OA 3IBJA 4QWOA 4QHCA 4P0MA 3SW1A 5E2FA 3QNBA 1P0ZA 1PI4A 2XEPA 1LSWA 4LRYC 3T50A 1OTDA 2YKHA 5HD3A 3BQAA 4X68A 1GA0A 3ZG5A 4OQ0A 4WMCA 4IJGA 1MWRA 3IXHA 4LCLA 5EM0A 5FEGA 2FFYA 3BEBA 2ZM2A 3CPTA 3PTEA 3CZDA 4ETXA 1KDSA 3WS2A 3KSIA 3A3DA 3QNCA 3QP6A 1KGGA 5A92A 2J9OA 3OPLA 3BM6A 4P87A 4G3KA 4BD1A 2XLNA 1VM1A 2ZC5B 3P98A 5DF9A 1NLZA 4EETB 4I3JA 4CPKA 1YQSA 3UPPA 4GHIA 3MJQA 2Z2MB 2IWDA 1JTGA 4YINA 1K6SA 5F69A 5CEBA 4Y0UA 1L0FA 3G2ZA 3ZHHA 1CF0A 3GV9A 5CTMA 4MNRA 2ZLYA 3A3IA 4Y0TA 4GZBA 1NRFA 1MC0A 3B42A 3PHYA 4PM5A 5HSQA 3BLMA 2A49A 4HH2A 2OAQ1 2B95A 3T1SA 1FOFA 3BY9A 1ESIA 3MXSA 3HBRA 2H28A 4PKYA 1WA9A 3ZYTA 3ZQ5A 1XA7A 4FCFA 2PD7A 2FFFB 3Q1FA 3FZCA 2P74A 3FKVA 3UPOA 1LL8A 4ARZA 3S7OA 1GCEA 3UE6A 2LB9A 3V3RA 2WZZA 5J4EA 2WAFA 1ES2A 3MF0A 2PHYA 3VE4A 1NLYA 1OJGA 4I3AA 1F2KA 3Q07A 1O07A 1PRQA 5CRFA 3ZG0A 4CJNA 1I2SA 3ZVTA 4R23A 3NC8A 1WE4A 2BTFP 3LIFA 1EROA 3A0RA 5FI7A 5CERA 1GHMA 4OVDA 1L2SA 1TS0A 2WGVA 1Z09A 3PBTA 4K0XA 1IYPA 5AJGA 4OPQA 2PR5A 2WK0A 1BT5A 3DTKA 3KO6A 4NK3A 4DKIA 1ESUA 1NJ4A 4WELA 3GSGA 2H0TA 2ZC3B 2KOIA 3BJNA 4HP9A 4OQGA 1XGJA 2FZ0A 3M6HA 2ACGA 3LI8A 2HJ9C 1FR6A 1GHPA 3A3JA 3UE3A 4JXWA 1UGUA 4K0WA 3NOPC 3W4PA 4R1GA 1TS8A 3HLGA 1IFQA 4H6JB 3MZDA 5FI6A 3UY6A 2Y2MA 2XSSA 4MCWA 3U4LP 2VGLM 4BMWA 2V1AA 4Y0OA 1ERQA 1SZVA 5CEDA 3CMZA 1ACFA 1G28A 4Y7PA 1UWNX 5IT5A 1V9YA 1NZUA 3OCNA 3QP1A 1N9NA 2NUPC 5EVIC 1M40A 4Z1WA 4UA6A 5CHJA 4BENA 3T1XA 3T4JA 3MKFA 2ZL1A 1RGYA 4X69A 3FPVA 3MSHA 2EXAA 3N4IA 1W8YA 3HUNA 1VQQA 4H6JA 2VJWA 4OH0A 4S2PA 1T19A 1KE3A 3CUEC 5CHUA 1ES5A 1CI9A 3CUEA 2VX8A 4Q0HA 5G4YA 4N9KA 2VV6A 2JN7A 5L8MA 3UNWA 4G3WA 5DTKA 2J7VA 3Q7VB 4LRXC 4KZ6A 3C7VA 5FQKA 5A8BA 5MC7A 1VEUB 4NKPA 4HJ4A 1ZG6A 3B47A 1S67L 3W8KA 1ZHHB 4H8RA 2XRNA 3WS0A 4DMZA 3S7NA 2Z2LB 2DCFA 5F83A 1J3WA 2W27A 4LLOB 4WYYA 3V39A 3VFHA 2ZQDA 2GNXA 3Q7ZA 1K25A 4ETZA 4GD8A 3AGEA 2KDKA 4RA7A 5FASA 5HPFA 1XJ3A 2R78A 3LY3A 5GLBA 4EEPA 4HP4A 1LSXA 3KYZA 1EI5A 4WN5A 1UWPX 3EWKA 2I9VA 3IF6B 1K56A 2ZD8A 4RQ9A 3OPPA 3C7UA 4EWFA 4HBUA 2PYPA 1YKDA 4Q0IA 4YWZA 4MN5A 3NDEA 4CLCA 3A0SA 5EVIB 2P7JA 1HLUP 3S4XA 4EESA 4JPMA 4DXBA 2HP6A 2B5RA 4K91A 2GX5A 1A0KA 5TJJA 2VGKA 3NJAA 5D3OA 1K57A 5HL6A 4Y15A 1TD5A 4XXRA 5CXWA 1E3UD 2O0YA 1WYBA 4R3AA 4ME4A 1J9MA 4C3QA 4KG6A 1JTDA 4JF6A 3MMHA 4F94A 3T4SA 5HDSA 1YLWA 4DDYA 3F1NA 1V9ZA 1JVJA 2WKRA 4ZAMA 5I94A 5F68A 3U2AA 5HPIA 3G31A 5K5BA 3N8LA 2Y2JA 3DTEA 4MN6A 2R9WA 4CLCE 5M18A 3SH9A 3V3SA 2ZQCA 1KVLA 4PHTA 1N4OA 3WRTA 5KMWA 2D01A 4L9FA 4WZ4A 1ONGA 4EQIA 3N8RA 4Y5FA 5F6AA 3NECA 3IHBA 1P9RA 2CC1A 3G30A 5EECA 5A90A 2DMWA 2WADA 1H3QA 4B9OA 3FYZA 5KZHA 2W1TB 1D7EA 3UE1A 1IEMA 4OPRA 3N6IA 3IS2B 3VP0A 2ZOIA 5HWWA 3HL9A 3LGOA 3UB6A 3HJKA 1MWUA 5KSHA 1PWCA 2G2WA 3UMEA 3RFBA 2EA9A 1N9LA 3A3EA 2WKPA 3IX8A 1TEMA 5DTSA 3CITA 4E3JA 4XT2A 2PBYA 2PD8A 4KZ9A 1XJ2A 5EOEA 2ZMVA 3V67A 3EGXC 3C4OA 2J3WA 5LBRA 3CG5A 3OPHA 2M7UA 2Q0OA 2JKGA 4BQMA 2X71A 3PBOA 2XQZA 5DFYA 5DFXA 4DRTA 3UDFA 1W7FA 2OSUA 3LYXA 4EQ1A 3DWZA 3L7HA 5IHVA 2QJ5A 4WF0A 4HESA 1LLBA 5TFQA 3LIEA 1T1AA 1HZOA 5HAQA 1CI8A 4ZRRA 4E6WA 4C6YA 4ZDXA 1DP8A 5DF7A 2V8FA 3WS5A 3IXDA 4PM8A 5I5LA 2EWWA 1XGIA 3CLOA 3PYPA 2ZC4B 2XA7M 4JXGA 5HDCA 3NDGA 3HLCA 1LT0A 3OBFA 3TSGA 1DJAA 3MBZA 4DXCA 3G2YA 1FILA 5FL3A 1Y4OA 1K38A 5U47A 2ZC7A 4EUZA 3KX0X 3V5MA 1C3BA 1OT6A 4OP8A 3JPUA 5FQ9A 4DDSA 1L3LA 4O01A 3DTMA 2QYBA 3PBRA 3DWKA 4OP5A 4I39A 1EWZA 5HWVA 3ZCZA 5EPHA 5L07A 1X0OA 4LV2A 2Q9NA 1MWTA 3IHAA 4S2KA 3M2KA 4X55A 4MEZA 3C30A 4R38A 2QKPA 2XF3A 1IOUA 1G5UA 3ZNYA 4OPZA 3PXPA 2D02A 4JBFA 4U0TA 2NUTC 3EQUA 4X1MA 5F1GA 4EUVA 5AQ9A 1K55C 3RXWA 5HL1A 1I2WA 3C5AA 3QP5A 2KX6A 1YSQA 2O9AA 1DJCA 4AFIA 4WZ5A 2P9VB 2IA2A 3SOIA 2W3EA 3TOIA 5EVIA 3VSKA 2HJEA 5A93A 1BUEA 2VGLS 3TRCA 5G4ZA 1GSVA 3GR2A 3TE8A 4B93A 4P6BA 2O99A 4M3KA 4Y2FA 2WGIA 3UN7A 5M1AA 1S66L 1YLJA 4GDNA 3G35A 4S2JA 3BFCA 3P7NA 4JKTA 2JE5A 5CX7A 2J9PA 2Y79A 2XA7S 2G2UA 3LR3A 4IBRA 2G7UA 4Y17A 4NEED 3O5YA 5DJTA 1W63Q 5HX9A 1LHYA 3NI9A 3E2KA 2OWJA 2WZXA 1FSYA 1HTZA 1K54C 4X53A 2EX9A 4JGPA 3OC2A 2K2NA 4MBHA 2J80A 1ZG4A 4KUKA 1BZAA 1IKIA 2Z6CA 4KZ8A 4OQIA 1OTEA 1DP9A 4HQAA 5FQMA 1STZA 1PW8A 5FQIA 1K6RA 5BOHA 3VP4A 4I3IA 3BY8A 4JXSA 3SS3A 1TDLA 5KSCA 3P09A 2XD5A 3LEZA 2L4RA 3GQZA 2VK3A 2X02A 2HP9A 5AVEA 2Y91A 1F98A 4I38A 1TDGA 4NXFA 2JHEA 3W4OA 3S22A 2JKTI 3MFDA 3HLWA 4OOYA 5CHMA 4JF5A 1RP5A 5GHZA 5IS1A 5FAPA 4WM9A 4N92A 2XDMA 2LB5A 4BWIA 3M2JA 3S7PA 4E3LA 2IWCA 1CEFA 5M19A 5E2HA 4JF4A 1PI5A 2V1BA 3BRMA 2Q9MA 2YKFA 1DJBA 4B88A 3MZFA 2ZQ8A 4Y13A 2CMNA 4CLCB 4JXVA 3EQVA 3P01A 4BBTA 3VOZA 1QMEA 4EBNA 4RVAA 4GOGA 2XR0A 1LI0A 3VP2A 4X56A 3UB7A 4CQHA 2W0NA 1N9OA 1K4FA 1YLPA 4LCMA 4E6XA 1E4DA 1KGFA 1VETA 4EXOA 2HGVA 5DKKA 1L0GA 5EVID 2ZMFA 1MKMA 3MFXA 2BASA 2VKSA 3T1RA 1K54A 4UHUA 3VV4A 2Z6DA 4UA7A 4BBUA 3LCEA 1FQGA 4FD8A 1MXOA 3IX4A 5CGXA 1YLZA 5HFOA 1W79A 3MQQA 4S2IA 1BLHA 4Q0JA 5DKLA 2QJ7A 1XFQA 3NCKA 3UE0A 2QWSA 1DRMA 4KZ3A 2IWBA 5GHYA 1NWZA 3IH9A 1IYQA 2JBFA 4S2LA 3N8SA 2W3DA 4K08A 3O88A 4ZJ1A 5FAOA 1MWSA 2V8CA 5GLDA 4HHDA 4KZ7A 4R4RA 1SDNA 1PZOA 1H8YA 1T1CA 3KSHA 3A0VA 5A91A 2VEAA 2BLSA 2ZC6B 4S2NC 2VLGA 3OOVA 3EGDC 2H0YA 3IQAA 4GLQA 2PAVP 3ICYA 3K3CA 5L2FA 4DJ3A 2XH9A 4KZAA 3BWLA 3C38A 3QP4A 1D06A 4ID4A 3G32A 3O86A 3L9KA 5E2GA 3ZFZA 2A24A 3ISGA 1YSPA 4E3NA 2W1TA 3CHWP 1XJ4A 5GHXA 1BULA 3IWQA 4EBLA 2WKQA 4GN2A 5HDDA 1OJ5A 2HF6A 3PBSA 1YLYA 2GZAA 3NIAA 4RYEA 2EFUA 5FSRA 1YPRA 4LRZE 1G6OA 4XT2B 3W2ZA 3LR5A 3D9YA 2OLUA 2Y2KA 3HLDA 4LFUA 4BBVA 4KZBA 1F5MA 3SH7A 2PDRA 3MQOA 4HEFA 1YAXA 4UAAA 4GDBA 4HH3A 4RX3A 5TBMA 5G18A 2A24B 2XGNA 5F5YA 4P6ZS 1PIOA 2ZM0A 1FCMA 5HAIA 4OPYA 3LICA 1Y54A 4O7DA 4PPRA 4E3IA 1IKGA 5DVAA 4ZJ3A 4X25A 3FV7A 5DTTA 2Y2QA 3SS4A 2B02A 5CECA 4PM7A 2HZ5A 3ZG7B 4L0LA 3RXXA 1BLSA 2PR6A 2ZQ9A 3BFEA
chains in the Genus database with same CATH topology
2JKTM 4WL9A 1NRJA 3MF0A 2PHYA 3VE4A 1IOUA 1NLYA 1OJGA 3E4PA 4I3AA 4GCZA 4DN0A 2OAP1 2L0WA 3KYQA 3PXPA 2D02A 2NUTC 3EQUA 5IU1A 4EUVA 3F1PB 3LIFA 1EW0A 2V9AA 3A0RA 1GSXA 1XJ6A 1TS0A 4M4XA 3RTYA 3PBTA 3E4QA 4NXEA 2KX6A 2M7VA 1YSQA 2O9AA 5AJGA 2VA0A 4AFIA 1OPXA 4QPRA 2IA2A 2PR5A 2W3EA 5HWTA 3KO6A 3T4TA 2HJEA 3UB8A 3BQ8A 3MR0A 4WELA 2KOIA 3BJNA 2VGLS 3EEHA 4HP9A 3TRCA 4EEUA 5G4ZA 1GSVA 3H7WB 2FZ0A 3TE8A 4B93A 4MDZA 2O99A 5DJUA 3LI8A 4L9GA 2HJ9C 4Y2FA 1S66L 3UE3A 1UGUA 1VB6A 3NOPC 3LIAA 3G6OA 4IUHA 3LI9A 4CLCD 1TS8A 3P7NA 1TS6A 1IFQA 4H6JB 5CX7A 2Y79A 2O9BA 2A2LA 3VE3A 2XA7S 2K7SA 3LR3A 2XSSA 4MCWA 2G7UA 2VGLM 4BMWA 2V1AA 4NEED 3O5YA 5DJTA 1W63Q 1TS7A 3JVUA 3FC7A 3PBNA 1ZTUA 2OWJA 1G28A 3K3DA 1UWNX 1W63M 4KQOA 5IT5A 1V9YA 4OOMA 4LPZA 4WEKA 3OCNA 1N9NA 2NUPC 1Y28A 4PAUA 3F1PA 4JGPA 4CLCC 4Z1WA 3H7WA 3OC2A 2K2NA 3T4JA 2M1CA 2W3HA 2J80A 4KUKA 3FPVA 3MXQA 2Z6CA 2OWHA 3T4KA 4HIAA 4HJ6A 1OTEA 4FSFA 4H6JA 2VJWA 1DP9A 3CI6A 4HQAA 1S1YA 1STZA 3CAXA 1T19A 2JKRI 3D72A 3CUEC 3DBAA 2Y8HA 3GDIA 2PT7A 3CUEA 2EWVA 4EERA 1MZUA 2L1MA 2VX8A 4Q0HA 5G4YA 5AVFA 2VV6A 2JN7A 5L8MA 4G3WA 4I3IA 3BY8A 4LRXC 3LR4A 5A8BA 5MC7A 2L4RA 4E04A 4NKPA 2HV1A 3R4KA 3B33A 4HJ4A 4HJ3A 4Y3IA 5AVEA 3R7WB 3B47A 1S67L 2ZOHA 4G3VA 1OTBA 1ZHHB 2XRNA 4DMZA 3VOLA 1F98A 2B18A 4IHQA 4I38A 3S7NA 4NXFA 4KUOA 1XFNA 2JHEA 3FG8A 4WUJA 3H9WA 3T4OA 2W27A 3E4OA 3NOTC 4LLOB 2JKTI 3F1OB 3NOUC 2GNXA 3IS2A 3CWFA 2O9CA 3H82B 4ETZA 1VHMA 2KDKA 5IS1A 3UMDA 4P6ZM 4OOLA 5HPFA 2LB5A 4BWIA 1XJ3A 3LIDA 2R78A 4EEPA 3S7PA 4HP4A 1LSXA 4O0PA 5HD5A 3IBRA 3KYZA 3JVVA 3MQ0A 3ULFA 4WN5A 1UWPX 3EWKA 3LUQA 2I9VA 3KSGA 2V1BA 1ODVA 2YKFA 3UB9A 5HZHA 4GHIB 3GECA 4RQ9A 1OTIA 2PYPA 1YKDA 1S1ZA 2INWA 4Q0IA 4YWZA 4MN5A 3S7QA 3E98A 4CLCA 2CMNA 4CLCB 3A0SA 2K31A 3EQVA 2P7JA 3P01A 4BBTA 4EESA 5J3WA 1OT9A 3C8CA 3UB7A 2GX5A 4CQHA 2W0NA 4HI4A 4IUKA 1N9OA 3PR6A 5TJJA 2P04A 3NJAA 4BJPA 4EXOA 4EW7A 2HGVA 5DKKA 2ZMFA 4YOFA 1MKMA 3MFXA 2BASA 2VKSA 5HL6A 1TD5A 3VV4A 3BW6A 1TF1A 2Z6DA 3EEAA 2O0YA 4JGRA 4WLAA 2OOLA 4BBUA 4R3AA 4ME4A 4II7A 3E0YA 2VZWA 3MMHA 3T4SA 3TW8A 5HDSA 3MQQA 5J7EA 1LSVA 4GW9A 4R6LA 4EU0A 2W3FA 4GS9B 3EOIA 4Q0JA 5DKLA 3F1NB 3F1NA 2QJ7A 3PBQA 3KSFA 1XFQA 1V9ZA 3C2WA 3NHQA 2WKRA 4UQIM 5F68A 3U2AA 1DP6A 5HPIA 4HY8A 4F3LB 5K5BA 3LR0A 4MN6A 1F9IA 2FH5A 2QWSA 1DRMA 3HJIA 4R70A 4CLCE 2W1RA 1NWZA 4JGQA 4O8GA 3TJZC 4FOFA 3RH8B 4PHTA 2W3DA 2D01A 4L9FA 4NXGA 3OLOA 4K08A 4Y5FA 5F6AA 1S4SA 1P9RA 4HHDA 3D3OA 2QHKA 2DMWA 1T1CA 3KSHA 3A0VA 4PKYG 2ZBBA 4MN7A 4NXBA 2VEAA 3K2NA 3T4QA 3LIBA 1H3QA 4UQIS 4B9OA 2MJ6A 2W1TB 5C5KA 1KOUA 2V0WA 1D7EA 2PYRA 3F1OA 2VLGA 4HOIA 3LFVA 3OOVA 3IBJA 3EGDC 3OCLA 3IS2B 2J3TC 2ZOIA 4KQDA 1JNUA 1P97A 5HWWA 3UB6A 4GLQA 3HJKA 3ICYA 3SW1A 3K3CA 3FPWA 4DJ3A 5KSHA 3UMEA 1T1BA 3RFBA 1P0ZA 2EA9A 1N9LA 2WKPA 4F3LA 1LSWA 4LRYC 4I5SA 4UEYA 3T50A 1OTDA 4WEJA 3CITA 2YKHA 1P9WA 4XT2A 2PD8A 5HD3A 3BQAA 3BWLA 3C38A 1XJ2A 2J3TD 2ZMVA 3V67A 3EGXC 4GJ4A 4IJGA 1D06A 2VV7A 2VV8A 2J3WA 5KIZA 1H8MA 2A24A 5LBRA 1YSPA 4ETXA 2W1TA 1XJ4A 2M7UA 3KSIA 3PBOA 5DFYA 5DFXA 2WKQA 5HDDA 1OJ5A 2HF6A 3H82A 3PBSA 3LYXA 4EQ1A 2QJ5A 4G3KA 2XROA 2GZAA 4WF0A 2P08A 4LRZE 1G6OA 4XT2B 3W2ZA 3LIEA 1NLZA 1T1AA 3LR5A 5DF9A 4EETB 4I3JA 4YNRA 4BBVA 4ZRRA 4DJ2A 1F5MA 2V0UA 1S4RA 3R7WA 2PDRA 1DP8A 3MQOA 2W3GA 4GHIA 1YAXA 3MJQA 4HH3A 4L9EA 5I5LA 2EWWA 3CLOA 5F69A 5TBMA 1OTAA 5TBMB 5EFWA 3PYPA 2XA7M 1GSWA 2JKRM 5HDCA 2A24B 4ARZB 1LT0A 3OBFA 5F5YA 4P6ZS 4GS9A 1MC0A 3B42A 2GJ3A 3PHYA 5FL3A 5HSQA 4HH2A 2OAQ1 3LICA 1T18A 3KX0X 3BY9A 1BYWA 1OT6A 2H28A 4PKYA 4JGOA 4MMNA 4O01A 2QYBA 3PBRA 1WA9A 3ZYTA 4I39A 3ZQ5A 5HWVA 1X0OA 3HCYA 2PD7A 3T4LA 2B02A 1LL8A 4ARZA 4L0LA 3S7OA 3UE6A 3C30A 4R38A 2KLIA 2LB9A 2QKPA 2PR6A 4HNBA 5J4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XT2 A;  4WL9 A;  4EES A;  2PD8 A;  5HD3 A;  2PHY A;  3BWL A;  5J3W A;  3VE4 A;  1OT9 A;  1XJ2 A;  2M1C A;  1OJG A;  3E4P A;  4I3A A;  2J80 A;  4GCZ A;  4KUK A;  1D06 A;  2VV7 A;  3C8C A;  2VV8 A;  3MXQ A;  3UB7 A;  2L0W A;  2W0N A;  2Z6C A;  4HI4 A;  2D02 A;  2OWH A;  4HIA A;  5KIZ A;  1N9O A;  2A24 A;  4HJ6 A;  1OTE A;  3NJA A;  4H6J A;  1XJ4 A;  1DP9 A;  4HQA A;  5IU1 A;  4EQ1 A;  1S1Y A;  4EXO A;  5DKK A;  4EW7 A;  5TBM B;  3F1P B;  3CAX A;  1EW0 A;  1T19 A;  3LIF A;  2V9A A;  3A0R A;  2WKQ A;  3D72 A;  3MFX A;  2BAS A;  5HDD A;  1OJ5 A;  3GDI A;  3H82 A;  1GSX A;  1XJ6 A;  2Z6D A;  4EER A;  3LYX A;  1TS0 A;  4M4X A;  1MZU A;  2L1M A;  4JGR A;  4WLA A;  5G4Y A;  2OOL A;  4BBU A;  2QJ5 A;  4R3A A;  3RTY A;  5AVF A;  3E4Q A;  2VV6 A;  4NXE A;  2KX6 A;  2JN7 A;  4WF0 A;  4LRZ E;  4I3I A;  4XT2 B;  3BY8 A;  3LIE A;  5HDS A;  4LRX C;  1T1A A;  4EET B;  3MQQ A;  4I3J A;  5J7E A;  2PR5 A;  1LSV A;  4GW9 A;  4R6L A;  5A8B A;  2L4R A;  4BBV A;  4GS9 B;  4E04 A;  4DJ2 A;  2HV1 A;  5HWT A;  3B33 A;  4HJ4 A;  5DKL A;  3F1N B;  2V0U A;  4HJ3 A;  5AVE A;  1S4R A;  2QJ7 A;  3F1N A;  2PDR A;  1DP8 A;  1S67 L;  2ZOH A;  3MQO A;  1OTB A;  3UB8 A;  3MR0 A;  4GHI A;  1XFQ A;  3MJQ A;  1V9Z A;  1F98 A;  3C2W A;  3VOL A;  4HH3 A;  3NHQ A;  2WKR A;  4I38 A;  4L9E A;  5F68 A;  3EEH A;  1DP6 A;  4HP9 A;  4HY8 A;  3CLO A;  5I5L A;  5F69 A;  5G4Z A;  5TBM A;  4EEU A;  1GSV A;  4F3L B;  4NXF A;  1OTA A;  4KUO A;  4MN6 A;  1XFN A;  1F9I A;  2JHE A;  3FG8 A;  2QWS A;  3H7W B;  3PYP A;  5EFW A;  1DRM A;  3HJI A;  4R70 A;  4WUJ A;  3H9W A;  4JGQ A;  1NWZ A;  3LI8 A;  4L9G A;  2W27 A;  3E4O A;  1GSW A;  5DJU A;  3NOT C;  5HDC A;  1S66 L;  2A24 B;  4LLO B;  1UGU A;  3RH8 B;  1LT0 A;  1VB6 A;  5F5Y A;  3NOP C;  3F1O B;  3LIA A;  3NOU C;  2D01 A;  4GS9 A;  4L9F A;  3G6O A;  4NXG A;  3OLO A;  4K08 A;  3LI9 A;  5F6A A;  1S4S A;  3IS2 A;  3CWF A;  1TS8 A;  2GJ3 A;  3P7N A;  3H82 B;  3PHY A;  5HSQ A;  1TS6 A;  4H6J B;  4HH2 A;  3VE3 A;  3LIC A;  4HHD A;  2KDK A;  5IS1 A;  2QHK A;  3UMD A;  1T18 A;  2K7S A;  3KX0 X;  3BY9 A;  1T1C A;  1BYW A;  1XJ3 A;  3LID A;  2R78 A;  3A0V A;  4PKY G;  1OT6 A;  2ZBB A;  4NXB A;  4EEP A;  2VEA A;  2V1A A;  3LIB A;  2H28 A;  1LSX A;  4HP4 A;  4PKY A;  5DJT A;  5HD5 A;  3IBR A;  4JGO A;  4B9O A;  1TS7 A;  3SW1 A;  1KOU A;  2V0W A;  3FC7 A;  1D7E A;  2PYR A;  3ULF A;  1WA9 A;  1UWP X;  2VLG A;  3EWK A;  3F1O A;  4I39 A;  4HOI A;  3LUQ A;  2I9V A;  4WN5 A;  2V1B A;  2OWJ A;  5HWV A;  1G28 A;  1ODV A;  3K3D A;  2YKF A;  3IS2 B;  3UB9 A;  2ZOI A;  1X0O A;  4KQD A;  1UWN X;  5HZH A;  1JNU A;  1P97 A;  2PD7 A;  3GEC A;  1V9Y A;  4GHI B;  3UB6 A;  4RQ9 A;  5HWW A;  2B02 A;  4LPZ A;  1OTI A;  3HJK A;  1LL8 A;  3ICY A;  3K3C A;  2PYP A;  4YWZ A;  1S1Z A;  2INW A;  3ZQ5 A;  3UME A;  1N9N A;  1T1B A;  4MN5 A;  4DJ3 A;  1P0Z A;  2EA9 A;  1N9L A;  1Y28 A;  2WKP A;  2CMN A;  4R38 A;  3UE6 A;  1LSW A;  3F1P A;  4LRY C;  4F3L A;  4I5S A;  4JGP A;  3T50 A;  1OTD A;  2PR6 A;  2QKP A;  3A0S A;  2P7J A;  4HNB A;  2YKH A;  3H7W A;  5J4E A;  4BBT A; 
#chains in the Genus database with same CATH topology
 2JKT M;  4PMA A;  1NRJ A;  4OLD A;  4ZBE A;  4GCZ A;  4DN0 A;  2OAP 1;  2L0W A;  4ZTK A;  3KYQ A;  2WGW B;  1Z6F A;  1XPB A;  2WGW A;  2H5S A;  5DF8 A;  4YFM A;  4FH4 A;  1HD8 A;  3DTI A;  3F1P B;  1EW0 A;  2V9A A;  1O7E A;  4X1L A;  1XJ6 A;  4M4X A;  2C6W B;  4PM6 A;  4ZJ2 A;  3WS4 A;  1MPL A;  4NXE A;  5TGF A;  2M7V A;  1GA9 A;  2VA0 A;  3UPN A;  4ESP A;  3FKW A;  2QMI A;  2QPN A;  3T12 B;  3BQ8 A;  2WKE A;  1AWI A;  4EEU A;  4KQQ A;  1E3U A;  1MKI A;  4JLF A;  4L9G A;  3SS5 A;  1VB6 A;  1SKO A;  1VEU A;  5EE8 A;  3LI9 A;  5CGS A;  4CLC D;  2HDS A;  1TS6 A;  2O9B A;  1E25 A;  2A2L A;  3VE3 A;  5FI2 A;  3GRJ A;  2K7S A;  5JYP A;  3N7W A;  4GD6 A;  3O3V A;  2HP5 A;  2WYX A;  5EVL A;  4BD0 A;  2P9V A;  3IWI A;  4IED A;  1TS7 A;  5FAT A;  3JVU A;  1ZTU A;  5CTN A;  3K3D A;  1K56 D;  2H10 A;  4XUX A;  5L09 A;  1W63 M;  1BTL A;  1PNE A;  4WEK A;  5GLC A;  5FDH A;  3MXR A;  1XXM A;  3Q7V A;  2HDR A;  4R3J A;  1SKO B;  1XKZ A;  3T4K A;  4D2O A;  4DE3 A;  4HJ6 A;  4OKP A;  2R9X A;  1S6R A;  1S1Y A;  3G4P A;  3IXG A;  2JKR I;  3D72 A;  3DBA A;  1KE4 A;  2Y8H A;  3GDI A;  2EWV A;  1LI9 A;  4HBT A;  5L10 A;  1LL5 A;  4IVI A;  3LR4 A;  1NXY A;  3M6B A;  5FEF A;  2HV1 A;  3B33 A;  4MBF A;  4Y3I A;  2ZOH A;  4G3V A;  1OTB A;  5HAP A;  2B18 A;  2RCX A;  1XP4 A;  3HRE A;  4KUO A;  1XFN A;  3FG8 A;  3WRZ A;  2ZQA A;  1IYS A;  3T4O A;  3E4O A;  4DE0 A;  3F1O B;  3NOU C;  3BEC A;  3BLS A;  2O9C A;  3H82 B;  1ZKJ A;  1RGZ A;  3IWO A;  1VHM A;  3UMD A;  1D1J A;  2WUQ A;  4P6Z M;  4OOL A;  1NYM A;  2HDQ A;  3SZT A;  4E3K A;  4B4X A;  5HD5 A;  3IBR A;  3IT9 A;  5J8X A;  4QB8 A;  3W4Q A;  3MQ0 A;  3FWL A;  1NY0 A;  3Q82 A;  3ULF A;  1ODV A;  4IBX A;  3UB9 A;  5HZH A;  3GEC A;  1G6A A;  1OTI A;  2PU2 A;  2INW A;  1M6K A;  2ZL1 B;  2Y59 A;  2K31 A;  5E43 A;  5FAQ A;  4QD4 A;  3MZE A;  4BL3 A;  2V2F F;  3PAE A;  1IYO A;  4QU3 A;  1YM1 A;  4IUK A;  2PRF A;  3PR6 A;  2P04 A;  4OLG A;  4BJP A;  1IEL A;  1CEG A;  1I5Q A;  4EW7 A;  4YOF A;  5F1F A;  1PWD A;  4R3B A;  1YT4 A;  3BFD A;  1DY6 A;  3BW6 A;  3EEA A;  4WLA A;  4JGR A;  4S2M A;  3VP3 A;  4II7 A;  3E0Y A;  3D4F A;  2DNS A;  3QP2 A;  5TR7 A;  3KYE A;  5J7E A;  1LSV A;  4GW9 A;  4R6L A;  4EU0 A;  2W3F A;  4N1H A;  4KG2 A;  3EOI A;  3KSF A;  3C2W A;  4KZ4 A;  3NHQ A;  3NY4 A;  4UQI M;  3BFG A;  4F3L B;  2Y2H A;  2DRW A;  4R70 A;  3HUO A;  2W1R A;  4JGQ A;  1K0K A;  4O8G A;  1GHI A;  3B3X A;  3VSL A;  4FOF A;  2E8J A;  2EXB A;  3LEQ A;  3RH8 B;  1FIK A;  1ALQ A;  2OLV A;  2RL3 A;  4BLM A;  4QY6 A;  1S4S A;  1N9B A;  4QJG A;  1YLT A;  4E3M A;  1BLP A;  1H8Z A;  3QP8 A;  2Y2G A;  4PKY G;  3LIB A;  3HLB A;  4UQI S;  5C5K A;  1KOU A;  2EX6 A;  5AQA A;  3UDX A;  4HOI A;  1TVF A;  3LFV A;  3OCL A;  2BG1 A;  3UDI A;  5AQB A;  2J3T C;  4KQD A;  1JNU A;  1P97 A;  3RJU A;  3ZG9 B;  3FPW A;  2X01 A;  1T1B A;  1YMX A;  4F3L A;  4I5S A;  4UEY A;  4U0X A;  4WEJ A;  1P9W A;  1K55 A;  4MLL A;  4FTX A;  1L0E A;  1XX2 A;  5EV0 A;  2J3T D;  4GJ4 A;  2VV7 A;  2VV8 A;  1ERM A;  3SH8 A;  5KIZ A;  2JKF A;  1H8M A;  1PZP A;  4MBK A;  4N1X A;  2EX8 A;  3ZG8 B;  3T1Q B;  1SDE A;  3H82 A;  4LV1 A;  4WMC D;  4DE2 A;  4GNU A;  2XRO A;  4QY5 A;  2P08 A;  4EV4 A;  1Q2Q A;  2ZJ9 A;  2Y55 A;  3JYI A;  1W5D A;  4YNR A;  4KG5 A;  4DJ2 A;  3IF5 A;  2V0U A;  1S4R A;  3R7W A;  2W3G A;  3IH8 A;  1FSW A;  3O87 A;  4L9E A;  1KE0 A;  2OV5 A;  1MBL A;  1OTA A;  5EFW A;  5TBM B;  1ES4 A;  3VP1 A;  1GSW A;  4WBG A;  1ONH A;  2JKR M;  1WYC A;  4ARZ B;  3GVB A;  4GS9 A;  4WZ5 C;  3IF6 C;  2GJ3 A;  1T18 A;  1BYW A;  5FA7 A;  5E2E A;  3HLE A;  5FQQ A;  3QHY A;  4JGO A;  4MMN A;  2QZ6 A;  3ZGA B;  2HDU A;  1U60 A;  1W8Q A;  5HAR A;  4B4Z A;  4LGW A;  3HCY A;  3T4L A;  2PBD P;  2ZMA A;  3DW0 A;  2WKH A;  3MKE A;  1CJF A;  5GLA A;  2KLI A;  4C75 A;  4HNB A;  1KDW A;  3BYD A;  4WL9 A;  2UWX A;  1JWV A;  3E4P A;  5FQJ A;  1MY8 A;  4GKU A;  4LEN A;  2I72 A;  2ZQ7 A;  5IU1 A;  5EOO A;  2Y2P A;  4RX2 A;  2VGJ A;  2WKI A;  2V1Z A;  3CPT B;  3MS6 A;  2AVX A;  1GSX A;  4DE1 A;  1FCO A;  2JCH A;  3RTY A;  3E4Q A;  3UB5 P;  4IVK A;  1OPX A;  4QPR A;  5EUA A;  3VMA A;  3OZH A;  4UA9 A;  5HWT A;  3T4T A;  2EX2 A;  3UB8 A;  1OME A;  3MR0 A;  3BFF A;  3EEH A;  3Q81 A;  3H7W B;  4R0Q A;  4MDZ A;  3GMW A;  5DJU A;  3ZDJ A;  3IXB A;  3LO7 A;  3LIA A;  3ZNT A;  3G6O A;  4IUH A;  4NG2 A;  2HPB A;  1HVB A;  3A3F A;  3E2L A;  1PW1 A;  2Y4A A;  1JWZ A;  1PYY A;  3PAG A;  3FC7 A;  4LV3 A;  3PBN A;  4KQO A;  1XA1 A;  4OOM A;  1NYY A;  4LPZ A;  4D60 A;  1FR1 A;  4N9L A;  4FH2 A;  1Y28 A;  4PAU A;  3F1P A;  4CLC C;  1QMF A;  1K57 C;  3H7W A;  1S0W A;  2M1C A;  2W3H A;  3HLF A;  1ZC2 A;  3MXQ A;  3IF6 A;  4NET A;  5CGW A;  3HUM A;  4A5R A;  4DF6 A;  1PFL A;  2OWH A;  4KEN B;  4HIA A;  1SCW A;  5AQ7 A;  3OPR A;  4FSF A;  3CI6 A;  3AGF A;  4Z9Q A;  3CAX A;  1L0D A;  1BSG A;  2V20 A;  3ITB A;  4BL2 A;  1ES3 A;  4E3O A;  2PT7 A;  2Y2N A;  1VET B;  3TG9 A;  4EER A;  1MZU A;  2L1M A;  5AVF A;  3VFF A;  3WWX A;  3GTC A;  4X6T A;  4EBP A;  1CK3 A;  4KQR A;  4E04 A;  1BLC A;  3R4K A;  4HJ3 A;  3R7W B;  3LY4 A;  3UO9 A;  4LV0 A;  3VOL A;  1AXB A;  4IHQ A;  2Y2L A;  2E8I A;  1FCN A;  1KGE A;  4WUJ A;  3DAV A;  3H9W A;  5EM1 A;  5FDS A;  3NOT C;  4GB7 A;  3G34 A;  5EVE A;  3IS2 A;  3CWF A;  4XUZ A;  3I7J A;  3LID A;  3C4P A;  4OON A;  3WS1 A;  4O0P A;  1Q2P A;  3JVV A;  3HVF A;  3LUQ A;  3KSG A;  4GHI B;  2WAE A;  1CQA A;  1S1Z A;  3VOY A;  3S7Q A;  3E98 A;  2XD1 A;  1PWG A;  2EFX A;  2Y2I A;  1JWP A;  1NZO A;  5HW3 A;  5J3W A;  1OT9 A;  2C5W B;  3C8C A;  2JC7 A;  4FUW A;  4HI4 A;  3S1Y A;  5JYO A;  3V50 A;  1H5X A;  4KZ5 A;  1H0M A;  3ZVW A;  1KVM A;  1TF1 A;  4U3T A;  1SHV A;  1LL9 A;  2XK1 A;  2OOL A;  4Q8I A;  4P85 A;  2XFT A;  2VZW A;  1YMS A;  1SKF A;  3TW8 A;  4R4S A;  1K4E A;  2A3U A;  4GS9 B;  5F82 A;  3F1N B;  2Y2O A;  3CJM A;  3ITA A;  3PBQ A;  2ZM8 A;  1DP6 A;  4S2O A;  4HY8 A;  3LR0 A;  2GDN A;  1F9I A;  2FH5 A;  3HJI A;  3AGD A;  2XFS A;  4PM9 A;  5GL9 A;  3TJZ C;  4S2N A;  4NXG A;  3OLO A;  2UV0 E;  1RCJ A;  4OQH A;  3NUL A;  3D3O A;  2QHK A;  2J8Y A;  2ZBB A;  4MN7 A;  4NXB A;  3K2N A;  3T4Q A;  3IX3 A;  1G68 A;  3NBL A;  2MJ6 A;  2V0W A;  2PYR A;  2PU4 A;  3F1O A;  3IBJ A;  4QWO A;  4QHC A;  4P0M A;  3SW1 A;  5E2F A;  3QNB A;  1P0Z A;  1PI4 A;  2XEP A;  1LSW A;  4LRY C;  3T50 A;  1OTD A;  2YKH A;  5HD3 A;  3BQA A;  4X68 A;  1GA0 A;  3ZG5 A;  4OQ0 A;  4WMC A;  4IJG A;  1MWR A;  3IXH A;  4LCL A;  5EM0 A;  5FEG A;  2FFY A;  3BEB A;  2ZM2 A;  3CPT A;  3PTE A;  3CZD A;  4ETX A;  1KDS A;  3WS2 A;  3KSI A;  3A3D A;  3QNC A;  3QP6 A;  1KGG A;  5A92 A;  2J9O A;  3OPL A;  3BM6 A;  4P87 A;  4G3K A;  4BD1 A;  2XLN A;  1VM1 A;  2ZC5 B;  3P98 A;  5DF9 A;  1NLZ A;  4EET B;  4I3J A;  4CPK A;  1YQS A;  3UPP A;  4GHI A;  3MJQ A;  2Z2M B;  2IWD A;  1JTG A;  4YIN A;  1K6S A;  5F69 A;  5CEB A;  4Y0U A;  1L0F A;  3G2Z A;  3ZHH A;  1CF0 A;  3GV9 A;  5CTM A;  4MNR A;  2ZLY A;  3A3I A;  4Y0T A;  4GZB A;  1NRF A;  1MC0 A;  3B42 A;  3PHY A;  4PM5 A;  5HSQ A;  3BLM A;  2A49 A;  4HH2 A;  2OAQ 1;  2B95 A;  3T1S A;  1FOF A;  3BY9 A;  1ESI A;  3MXS A;  3HBR A;  2H28 A;  4PKY A;  1WA9 A;  3ZYT A;  3ZQ5 A;  1XA7 A;  4FCF A;  2PD7 A;  2FFF B;  3Q1F A;  3FZC A;  2P74 A;  3FKV A;  3UPO A;  1LL8 A;  4ARZ A;  3S7O A;  1GCE A;  3UE6 A;  2LB9 A;  3V3R A;  2WZZ A;  5J4E A;  2WAF A;  1ES2 A;  3MF0 A;  2PHY A;  3VE4 A;  1NLY A;  1OJG A;  4I3A A;  1F2K A;  3Q07 A;  1O07 A;  1PRQ A;  5CRF A;  3ZG0 A;  4CJN A;  1I2S A;  3ZVT A;  4R23 A;  3NC8 A;  1WE4 A;  2BTF P;  3LIF A;  1ERO A;  3A0R A;  5FI7 A;  5CER A;  1GHM A;  4OVD A;  1L2S A;  1TS0 A;  2WGV A;  1Z09 A;  3PBT A;  4K0X A;  1IYP A;  5AJG A;  4OPQ A;  2PR5 A;  2WK0 A;  1BT5 A;  3DTK A;  3KO6 A;  4NK3 A;  4DKI A;  1ESU A;  1NJ4 A;  4WEL A;  3GSG A;  2H0T A;  2ZC3 B;  2KOI A;  3BJN A;  4HP9 A;  4OQG A;  1XGJ A;  2FZ0 A;  3M6H A;  2ACG A;  3LI8 A;  2HJ9 C;  1FR6 A;  1GHP A;  3A3J A;  3UE3 A;  4JXW A;  1UGU A;  4K0W A;  3NOP C;  3W4P A;  4R1G A;  1TS8 A;  3HLG A;  1IFQ A;  4H6J B;  3MZD A;  5FI6 A;  3UY6 A;  2Y2M A;  2XSS A;  4MCW A;  3U4L P;  2VGL M;  4BMW A;  2V1A A;  4Y0O A;  1ERQ A;  1SZV A;  5CED A;  3CMZ A;  1ACF A;  1G28 A;  4Y7P A;  1UWN X;  5IT5 A;  1V9Y A;  1NZU A;  3OCN A;  3QP1 A;  1N9N A;  2NUP C;  5EVI C;  1M40 A;  4Z1W A;  4UA6 A;  5CHJ A;  4BEN A;  3T1X A;  3T4J A;  3MKF A;  2ZL1 A;  1RGY A;  4X69 A;  3FPV A;  3MSH A;  2EXA A;  3N4I A;  1W8Y A;  3HUN A;  1VQQ A;  4H6J A;  2VJW A;  4OH0 A;  4S2P A;  1T19 A;  1KE3 A;  3CUE C;  5CHU A;  1ES5 A;  1CI9 A;  3CUE A;  2VX8 A;  4Q0H A;  5G4Y A;  4N9K A;  2VV6 A;  2JN7 A;  5L8M A;  3UNW A;  4G3W A;  5DTK A;  2J7V A;  3Q7V B;  4LRX C;  4KZ6 A;  3C7V A;  5FQK A;  5A8B A;  5MC7 A;  1VEU B;  4NKP A;  4HJ4 A;  1ZG6 A;  3B47 A;  1S67 L;  3W8K A;  1ZHH B;  4H8R A;  2XRN A;  3WS0 A;  4DMZ A;  3S7N A;  2Z2L B;  2DCF A;  5F83 A;  1J3W A;  2W27 A;  4LLO B;  4WYY A;  3V39 A;  3VFH A;  2ZQD A;  2GNX A;  3Q7Z A;  1K25 A;  4ETZ A;  4GD8 A;  3AGE A;  2KDK A;  4RA7 A;  5FAS A;  5HPF A;  1XJ3 A;  2R78 A;  3LY3 A;  5GLB A;  4EEP A;  4HP4 A;  1LSX A;  3KYZ A;  1EI5 A;  4WN5 A;  1UWP X;  3EWK A;  2I9V A;  3IF6 B;  1K56 A;  2ZD8 A;  4RQ9 A;  3OPP A;  3C7U A;  4EWF A;  4HBU A;  2PYP A;  1YKD A;  4Q0I A;  4YWZ A;  4MN5 A;  3NDE A;  4CLC A;  3A0S A;  5EVI B;  2P7J A;  1HLU P;  3S4X A;  4EES A;  4JPM A;  4DXB A;  2HP6 A;  2B5R A;  4K91 A;  2GX5 A;  1A0K A;  5TJJ A;  2VGK A;  3NJA A;  5D3O A;  1K57 A;  5HL6 A;  4Y15 A;  1TD5 A;  4XXR A;  5CXW A;  1E3U D;  2O0Y A;  1WYB A;  4R3A A;  4ME4 A;  1J9M A;  4C3Q A;  4KG6 A;  1JTD A;  4JF6 A;  3MMH A;  4F94 A;  3T4S A;  5HDS A;  1YLW A;  4DDY A;  3F1N A;  1V9Z A;  1JVJ A;  2WKR A;  4ZAM A;  5I94 A;  5F68 A;  3U2A A;  5HPI A;  3G31 A;  5K5B A;  3N8L A;  2Y2J A;  3DTE A;  4MN6 A;  2R9W A;  4CLC E;  5M18 A;  3SH9 A;  3V3S A;  2ZQC A;  1KVL A;  4PHT A;  1N4O A;  3WRT A;  5KMW A;  2D01 A;  4L9F A;  4WZ4 A;  1ONG A;  4EQI A;  3N8R A;  4Y5F A;  5F6A A;  3NEC A;  3IHB A;  1P9R A;  2CC1 A;  3G30 A;  5EEC A;  5A90 A;  2DMW A;  2WAD A;  1H3Q A;  4B9O A;  3FYZ A;  5KZH A;  2W1T B;  1D7E A;  3UE1 A;  1IEM A;  4OPR A;  3N6I A;  3IS2 B;  3VP0 A;  2ZOI A;  5HWW A;  3HL9 A;  3LGO A;  3UB6 A;  3HJK A;  1MWU A;  5KSH A;  1PWC A;  2G2W A;  3UME A;  3RFB A;  2EA9 A;  1N9L A;  3A3E A;  2WKP A;  3IX8 A;  1TEM A;  5DTS A;  3CIT A;  4E3J A;  4XT2 A;  2PBY A;  2PD8 A;  4KZ9 A;  1XJ2 A;  5EOE A;  2ZMV A;  3V67 A;  3EGX C;  3C4O A;  2J3W A;  5LBR A;  3CG5 A;  3OPH A;  2M7U A;  2Q0O A;  2JKG A;  4BQM A;  2X71 A;  3PBO A;  2XQZ A;  5DFY A;  5DFX A;  4DRT A;  3UDF A;  1W7F A;  2OSU A;  3LYX A;  4EQ1 A;  3DWZ A;  3L7H A;  5IHV A;  2QJ5 A;  4WF0 A;  4HES A;  1LLB A;  5TFQ A;  3LIE A;  1T1A A;  1HZO A;  5HAQ A;  1CI8 A;  4ZRR A;  4E6W A;  4C6Y A;  4ZDX A;  1DP8 A;  5DF7 A;  2V8F A;  3WS5 A;  3IXD A;  4PM8 A;  5I5L A;  2EWW A;  1XGI A;  3CLO A;  3PYP A;  2ZC4 B;  2XA7 M;  4JXG A;  5HDC A;  3NDG A;  3HLC A;  1LT0 A;  3OBF A;  3TSG A;  1DJA A;  3MBZ A;  4DXC A;  3G2Y A;  1FIL A;  5FL3 A;  1Y4O A;  1K38 A;  5U47 A;  2ZC7 A;  4EUZ A;  3KX0 X;  3V5M A;  1C3B A;  1OT6 A;  4OP8 A;  3JPU A;  5FQ9 A;  4DDS A;  1L3L A;  4O01 A;  3DTM A;  2QYB A;  3PBR A;  3DWK A;  4OP5 A;  4I39 A;  1EWZ A;  5HWV A;  3ZCZ A;  5EPH A;  5L07 A;  1X0O A;  4LV2 A;  2Q9N A;  1MWT A;  3IHA A;  4S2K A;  3M2K A;  4X55 A;  4MEZ A;  3C30 A;  4R38 A;  2QKP A;  2XF3 A;  1IOU A;  1G5U A;  3ZNY A;  4OPZ A;  3PXP A;  2D02 A;  4JBF A;  4U0T A;  2NUT C;  3EQU A;  4X1M A;  5F1G A;  4EUV A;  5AQ9 A;  1K55 C;  3RXW A;  5HL1 A;  1I2W A;  3C5A A;  3QP5 A;  2KX6 A;  1YSQ A;  2O9A A;  1DJC A;  4AFI A;  4WZ5 A;  2P9V B;  2IA2 A;  3SOI A;  2W3E A;  3TOI A;  5EVI A;  3VSK A;  2HJE A;  5A93 A;  1BUE A;  2VGL S;  3TRC A;  5G4Z A;  1GSV A;  3GR2 A;  3TE8 A;  4B93 A;  4P6B A;  2O99 A;  4M3K A;  4Y2F A;  2WGI A;  3UN7 A;  5M1A A;  1S66 L;  1YLJ A;  4GDN A;  3G35 A;  4S2J A;  3BFC A;  3P7N A;  4JKT A;  2JE5 A;  5CX7 A;  2J9P A;  2Y79 A;  2XA7 S;  2G2U A;  3LR3 A;  4IBR A;  2G7U A;  4Y17 A;  4NEE D;  3O5Y A;  5DJT A;  1W63 Q;  5HX9 A;  1LHY A;  3NI9 A;  3E2K A;  2OWJ A;  2WZX A;  1FSY A;  1HTZ A;  1K54 C;  4X53 A;  2EX9 A;  4JGP A;  3OC2 A;  2K2N A;  4MBH A;  2J80 A;  1ZG4 A;  4KUK A;  1BZA A;  1IKI A;  2Z6C A;  4KZ8 A;  4OQI A;  1OTE A;  1DP9 A;  4HQA A;  5FQM A;  1STZ A;  1PW8 A;  5FQI A;  1K6R A;  5BOH A;  3VP4 A;  4I3I A;  3BY8 A;  4JXS A;  3SS3 A;  1TDL A;  5KSC A;  3P09 A;  2XD5 A;  3LEZ A;  2L4R A;  3GQZ A;  2VK3 A;  2X02 A;  2HP9 A;  5AVE A;  2Y91 A;  1F98 A;  4I38 A;  1TDG A;  4NXF A;  2JHE A;  3W4O A;  3S22 A;  2JKT I;  3MFD A;  3HLW A;  4OOY A;  5CHM A;  4JF5 A;  1RP5 A;  5GHZ A;  5IS1 A;  5FAP A;  4WM9 A;  4N92 A;  2XDM A;  2LB5 A;  4BWI A;  3M2J A;  3S7P A;  4E3L A;  2IWC A;  1CEF A;  5M19 A;  5E2H A;  4JF4 A;  1PI5 A;  2V1B A;  3BRM A;  2Q9M A;  2YKF A;  1DJB A;  4B88 A;  3MZF A;  2ZQ8 A;  4Y13 A;  2CMN A;  4CLC B;  4JXV A;  3EQV A;  3P01 A;  4BBT A;  3VOZ A;  1QME A;  4EBN A;  4RVA A;  4GOG A;  2XR0 A;  1LI0 A;  3VP2 A;  4X56 A;  3UB7 A;  4CQH A;  2W0N A;  1N9O A;  1K4F A;  1YLP A;  4LCM A;  4E6X A;  1E4D A;  1KGF A;  1VET A;  4EXO A;  2HGV A;  5DKK A;  1L0G A;  5EVI D;  2ZMF A;  1MKM A;  3MFX A;  2BAS A;  2VKS A;  3T1R A;  1K54 A;  4UHU A;  3VV4 A;  2Z6D A;  4UA7 A;  4BBU A;  3LCE A;  1FQG A;  4FD8 A;  1MXO A;  3IX4 A;  5CGX A;  1YLZ A;  5HFO A;  1W79 A;  3MQQ A;  4S2I A;  1BLH A;  4Q0J A;  5DKL A;  2QJ7 A;  1XFQ A;  3NCK A;  3UE0 A;  2QWS A;  1DRM A;  4KZ3 A;  2IWB A;  5GHY A;  1NWZ A;  3IH9 A;  1IYQ A;  2JBF A;  4S2L A;  3N8S A;  2W3D A;  4K08 A;  3O88 A;  4ZJ1 A;  5FAO A;  1MWS A;  2V8C A;  5GLD A;  4HHD A;  4KZ7 A;  4R4R A;  1SDN A;  1PZO A;  1H8Y A;  1T1C A;  3KSH A;  3A0V A;  5A91 A;  2VEA A;  2BLS A;  2ZC6 B;  4S2N C;  2VLG A;  3OOV A;  3EGD C;  2H0Y A;  3IQA A;  4GLQ A;  2PAV P;  3ICY A;  3K3C A;  5L2F A;  4DJ3 A;  2XH9 A;  4KZA A;  3BWL A;  3C38 A;  3QP4 A;  1D06 A;  4ID4 A;  3G32 A;  3O86 A;  3L9K A;  5E2G A;  3ZFZ A;  2A24 A;  3ISG A;  1YSP A;  4E3N A;  2W1T A;  3CHW P;  1XJ4 A;  5GHX A;  1BUL A;  3IWQ A;  4EBL A;  2WKQ A;  4GN2 A;  5HDD A;  1OJ5 A;  2HF6 A;  3PBS A;  1YLY A;  2GZA A;  3NIA A;  4RYE A;  2EFU A;  5FSR A;  1YPR A;  4LRZ E;  1G6O A;  4XT2 B;  3W2Z A;  3LR5 A;  3D9Y A;  2OLU A;  2Y2K A;  3HLD A;  4LFU A;  4BBV A;  4KZB A;  1F5M A;  3SH7 A;  2PDR A;  3MQO A;  4HEF A;  1YAX A;  4UAA A;  4GDB A;  4HH3 A;  4RX3 A;  5TBM A;  5G18 A;  2A24 B;  2XGN A;  5F5Y A;  4P6Z S;  1PIO A;  2ZM0 A;  1FCM A;  5HAI A;  4OPY A;  3LIC A;  1Y54 A;  4O7D A;  4PPR A;  4E3I A;  1IKG A;  5DVA A;  4ZJ3 A;  4X25 A;  3FV7 A;  5DTT A;  2Y2Q A;  3SS4 A;  2B02 A;  5CEC A;  4PM7 A;  2HZ5 A;  3ZG7 B;  4L0L A;  3RXX A;  1BLS A;  2PR6 A;  2ZQ9 A;  3BFE A; 
#chains in the Genus database with same CATH homology
 2JKT M;  4WL9 A;  1NRJ A;  3MF0 A;  2PHY A;  3VE4 A;  1IOU A;  1NLY A;  1OJG A;  3E4P A;  4I3A A;  4GCZ A;  4DN0 A;  2OAP 1;  2L0W A;  3KYQ A;  3PXP A;  2D02 A;  2NUT C;  3EQU A;  5IU1 A;  4EUV A;  3F1P B;  3LIF A;  1EW0 A;  2V9A A;  3A0R A;  1GSX A;  1XJ6 A;  1TS0 A;  4M4X A;  3RTY A;  3PBT A;  3E4Q A;  4NXE A;  2KX6 A;  2M7V A;  1YSQ A;  2O9A A;  5AJG A;  2VA0 A;  4AFI A;  1OPX A;  4QPR A;  2IA2 A;  2PR5 A;  2W3E A;  5HWT A;  3KO6 A;  3T4T A;  2HJE A;  3UB8 A;  3BQ8 A;  3MR0 A;  4WEL A;  2KOI A;  3BJN A;  2VGL S;  3EEH A;  4HP9 A;  3TRC A;  4EEU A;  5G4Z A;  1GSV A;  3H7W B;  2FZ0 A;  3TE8 A;  4B93 A;  4MDZ A;  2O99 A;  5DJU A;  3LI8 A;  4L9G A;  2HJ9 C;  4Y2F A;  1S66 L;  3UE3 A;  1UGU A;  1VB6 A;  3NOP C;  3LIA A;  3G6O A;  4IUH A;  3LI9 A;  4CLC D;  1TS8 A;  3P7N A;  1TS6 A;  1IFQ A;  4H6J B;  5CX7 A;  2Y79 A;  2O9B A;  2A2L A;  3VE3 A;  2XA7 S;  2K7S A;  3LR3 A;  2XSS A;  4MCW A;  2G7U A;  2VGL M;  4BMW A;  2V1A A;  4NEE D;  3O5Y A;  5DJT A;  1W63 Q;  1TS7 A;  3JVU A;  3FC7 A;  3PBN A;  1ZTU A;  2OWJ A;  1G28 A;  3K3D A;  1UWN X;  1W63 M;  4KQO A;  5IT5 A;  1V9Y A;  4OOM A;  4LPZ A;  4WEK A;  3OCN A;  1N9N A;  2NUP C;  1Y28 A;  4PAU A;  3F1P A;  4JGP A;  4CLC C;  4Z1W A;  3H7W A;  3OC2 A;  2K2N A;  3T4J A;  2M1C A;  2W3H A;  2J80 A;  4KUK A;  3FPV A;  3MXQ A;  2Z6C A;  2OWH A;  3T4K A;  4HIA A;  4HJ6 A;  1OTE A;  4FSF A;  4H6J A;  2VJW A;  1DP9 A;  3CI6 A;  4HQA A;  1S1Y A;  1STZ A;  3CAX A;  1T19 A;  2JKR I;  3D72 A;  3CUE C;  3DBA A;  2Y8H A;  3GDI A;  2PT7 A;  3CUE A;  2EWV A;  4EER A;  1MZU A;  2L1M A;  2VX8 A;  4Q0H A;  5G4Y A;  5AVF A;  2VV6 A;  2JN7 A;  5L8M A;  4G3W A;  4I3I A;  3BY8 A;  4LRX C;  3LR4 A;  5A8B A;  5MC7 A;  2L4R A;  4E04 A;  4NKP A;  2HV1 A;  3R4K A;  3B33 A;  4HJ4 A;  4HJ3 A;  4Y3I A;  5AVE A;  3R7W B;  3B47 A;  1S67 L;  2ZOH A;  4G3V A;  1OTB A;  1ZHH B;  2XRN A;  4DMZ A;  3VOL A;  1F98 A;  2B18 A;  4IHQ A;  4I38 A;  3S7N A;  4NXF A;  4KUO A;  1XFN A;  2JHE A;  3FG8 A;  4WUJ A;  3H9W A;  3T4O A;  2W27 A;  3E4O A;  3NOT C;  4LLO B;  2JKT I;  3F1O B;  3NOU C;  2GNX A;  3IS2 A;  3CWF A;  2O9C A;  3H82 B;  4ETZ A;  1VHM A;  2KDK A;  5IS1 A;  3UMD A;  4P6Z M;  4OOL A;  5HPF A;  2LB5 A;  4BWI A;  1XJ3 A;  3LID A;  2R78 A;  4EEP A;  3S7P A;  4HP4 A;  1LSX A;  4O0P A;  5HD5 A;  3IBR A;  3KYZ A;  3JVV A;  3MQ0 A;  3ULF A;  4WN5 A;  1UWP X;  3EWK A;  3LUQ A;  2I9V A;  3KSG A;  2V1B A;  1ODV A;  2YKF A;  3UB9 A;  5HZH A;  4GHI B;  3GEC A;  4RQ9 A;  1OTI A;  2PYP A;  1YKD A;  1S1Z A;  2INW A;  4Q0I A;  4YWZ A;  4MN5 A;  3S7Q A;  3E98 A;  4CLC A;  2CMN A;  4CLC B;  3A0S A;  2K31 A;  3EQV A;  2P7J A;  3P01 A;  4BBT A;  4EES A;  5J3W A;  1OT9 A;  3C8C A;  3UB7 A;  2GX5 A;  4CQH A;  2W0N A;  4HI4 A;  4IUK A;  1N9O A;  3PR6 A;  5TJJ A;  2P04 A;  3NJA A;  4BJP A;  4EXO A;  4EW7 A;  2HGV A;  5DKK A;  2ZMF A;  4YOF A;  1MKM A;  3MFX A;  2BAS A;  2VKS A;  5HL6 A;  1TD5 A;  3VV4 A;  3BW6 A;  1TF1 A;  2Z6D A;  3EEA A;  2O0Y A;  4JGR A;  4WLA A;  2OOL A;  4BBU A;  4R3A A;  4ME4 A;  4II7 A;  3E0Y A;  2VZW A;  3MMH A;  3T4S A;  3TW8 A;  5HDS A;  3MQQ A;  5J7E A;  1LSV A;  4GW9 A;  4R6L A;  4EU0 A;  2W3F A;  4GS9 B;  3EOI A;  4Q0J A;  5DKL A;  3F1N B;  3F1N A;  2QJ7 A;  3PBQ A;  3KSF A;  1XFQ A;  1V9Z A;  3C2W A;  3NHQ A;  2WKR A;  4UQI M;  5F68 A;  3U2A A;  1DP6 A;  5HPI A;  4HY8 A;  4F3L B;  5K5B A;  3LR0 A;  4MN6 A;  1F9I A;  2FH5 A;  2QWS A;  1DRM A;  3HJI A;  4R70 A;  4CLC E;  2W1R A;  1NWZ A;  4JGQ A;  4O8G A;  3TJZ C;  4FOF A;  3RH8 B;  4PHT A;  2W3D A;  2D01 A;  4L9F A;  4NXG A;  3OLO A;  4K08 A;  4Y5F A;  5F6A A;  1S4S A;  1P9R A;  4HHD A;  3D3O A;  2QHK A;  2DMW A;  1T1C A;  3KSH A;  3A0V A;  4PKY G;  2ZBB A;  4MN7 A;  4NXB A;  2VEA A;  3K2N A;  3T4Q A;  3LIB A;  1H3Q A;  4UQI S;  4B9O A;  2MJ6 A;  2W1T B;  5C5K A;  1KOU A;  2V0W A;  1D7E A;  2PYR A;  3F1O A;  2VLG A;  4HOI A;  3LFV A;  3OOV A;  3IBJ A;  3EGD C;  3OCL A;  3IS2 B;  2J3T C;  2ZOI A;  4KQD A;  1JNU A;  1P97 A;  5HWW A;  3UB6 A;  4GLQ A;  3HJK A;  3ICY A;  3SW1 A;  3K3C A;  3FPW A;  4DJ3 A;  5KSH A;  3UME A;  1T1B A;  3RFB A;  1P0Z A;  2EA9 A;  1N9L A;  2WKP A;  4F3L A;  1LSW A;  4LRY C;  4I5S A;  4UEY A;  3T50 A;  1OTD A;  4WEJ A;  3CIT A;  2YKH A;  1P9W A;  4XT2 A;  2PD8 A;  5HD3 A;  3BQA A;  3BWL A;  3C38 A;  1XJ2 A;  2J3T D;  2ZMV A;  3V67 A;  3EGX C;  4GJ4 A;  4IJG A;  1D06 A;  2VV7 A;  2VV8 A;  2J3W A;  5KIZ A;  1H8M A;  2A24 A;  5LBR A;  1YSP A;  4ETX A;  2W1T A;  1XJ4 A;  2M7U A;  3KSI A;  3PBO A;  5DFY A;  5DFX A;  2WKQ A;  5HDD A;  1OJ5 A;  2HF6 A;  3H82 A;  3PBS A;  3LYX A;  4EQ1 A;  2QJ5 A;  4G3K A;  2XRO A;  2GZA A;  4WF0 A;  2P08 A;  4LRZ E;  1G6O A;  4XT2 B;  3W2Z A;  3LIE A;  1NLZ A;  1T1A A;  3LR5 A;  5DF9 A;  4EET B;  4I3J A;  4YNR A;  4BBV A;  4ZRR A;  4DJ2 A;  1F5M A;  2V0U A;  1S4R A;  3R7W A;  2PDR A;  1DP8 A;  3MQO A;  2W3G A;  4GHI A;  1YAX A;  3MJQ A;  4HH3 A;  4L9E A;  5I5L A;  2EWW A;  3CLO A;  5F69 A;  5TBM A;  1OTA A;  5TBM B;  5EFW A;  3PYP A;  2XA7 M;  1GSW A;  2JKR M;  5HDC A;  2A24 B;  4ARZ B;  1LT0 A;  3OBF A;  5F5Y A;  4P6Z S;  4GS9 A;  1MC0 A;  3B42 A;  2GJ3 A;  3PHY A;  5FL3 A;  5HSQ A;  4HH2 A;  2OAQ 1;  3LIC A;  1T18 A;  3KX0 X;  3BY9 A;  1BYW A;  1OT6 A;  2H28 A;  4PKY A;  4JGO A;  4MMN A;  4O01 A;  2QYB A;  3PBR A;  1WA9 A;  3ZYT A;  4I39 A;  3ZQ5 A;  5HWV A;  1X0O A;  3HCY A;  2PD7 A;  3T4L A;  2B02 A;  1LL8 A;  4ARZ A;  4L0L A;  3S7O A;  3UE6 A;  3C30 A;  4R38 A;  2KLI A;  2LB9 A;  2QKP A;  2PR6 A;  4HNB A;  5J4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...