2VK3A

Crystal structure of rat profilin 2a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
142
structure length
142
Chain Sequence
GSMAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPAEIDVIIGKDREGFFTNGLTLGGKKCSVIRDSLYVDSDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Modifications and Ligand-Binding Properties of Rat Profilin 2A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
molecule keywords PROFILIN-2
total genus 46
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2vk3A00
2HZ5A 3CPTA 3NULA 5EM0A 1CF0A 2ZL1A 1FILA 4X1MA 2E8JA 4QWOA 4D60A 1PRQA 4X25A 1FIKA 1SKOB 2VK3A 5FEGA 4FTXA 1D1JA 1VETA 1YPRA 2JKGA 2V8CA 1F2KA 3NECA 3D9YA 1G5UA 1AWIA 2PBDP 3L7HA 2ZL1B 1VETB 3T1QB 4ESPA 3KYEA 1CJFA 5EV0A 3CPTB 5FEFA 3T1XA 2B95A 1SKOA 2V8FA 2BTFP 3CHWP 1SZVA 1VEUA 1PFLA 1Y4OA 2ACGA 2JKFA 1CQAA 2PRFA 1ACFA 5EM1A 5FDSA 3MS6A 3T1RA 3T12B 3UB5P 1PNEA 1A0KA 1HLUP 3DAVA 3LGOA 1Z09A 3MSHA 4FUWA 1J3WA 2PAVP 4X1LA 3T1SA 1K0KA 3LEQA 3U4LP 1VEUB 3L9KA 5EVEA
chains in the Genus database with same CATH superfamily
1NZOA 4RX3A 1MWTA 1S66L 1TEMA 4P85A 2BASA 4GCZA 3NOTC 4YINA 4E3MA 1D06A 2DMWA 5DF7A 4BBTA 4ARZB 5EM1A 3DBAA 1DP6A 2C5WB 3KSHA 4QJGA 2G2UA 3FPVA 1CF0A 1STZA 1W8QA 2VLGA 4WZ4A 3E4OA 1T1BA 5F69A 4BL2A 1SKOB 1MY8A 5EVLA 1L0DA 5L2FA 4X55A 3IHAA 3MF0A 1FSWA 2ZLYA 3UB5P 3MS6A 5EE8A 1YLPA 1YAXA 2Y2OA 2E8IA 4KZAA 3IH8A 2C6WB 1T1AA 4EWFA 2J9OA 1ONHA 4DE1A 1K54A 2G2WA 1K6SA 2HV1A 3IX4A 3C5AA 3QP4A 3CLOA 3N8LA 3T4LA 5HAPA 1FR6A 3ZGAB 5F1GA 1GA0A 2ZJ9A 4PPRA 1Z6FA 2K7SA 1S0WA 4L9FA 2V1BA 3LI8A 2Y2KA 1XPBA 4R1GA 2HJEA 3Q81A 2H0TA 4JXVA 1WE4A 4HP9A 3E0YA 4MN5A 1NYMA 4Y15A 2A2LA 1TS8A 1H0MA 3PBRA 1VEUA 1N9NA 1CQAA 4NETA 4ZTKA 5CX7A 4GZBA 1IKGA 3NC8A 3W2ZA 2WZZA 1V9ZA 1XKZA 3RFBA 3SH8A 3BRMA 5CXWA 3FKWA 3M6HA 4EESA 3NCKA 3IBJA 2J3TD 4R3JA 2VGLM 5CTMA 3S7OA 5FAOA 4LENA 4U3TA 3LGOA 4L9GA 3IQAA 4MBHA 1VHMA 1ERQA 4HH3A 2O9BA 1K55C 2H10A 2K31A 5F5YA 1ERMA 4HESA 2K2NA 1S4SA 4UA9A 3CJMA 4CJNA 1SKOA 5L8MA 5FDSA 2M7VA 4QY6A 5AVFA 4JBFA 3LY3A 1I2SA 4ZAMA 1E3UD 3G2ZA 4S2OA 4UQIS 1BLHA 3BFGA 1JWPA 4WELA 4I5SA 1MWRA 5EVIB 4CLCA 4S2PA 2W3EA 3T12B 1HD8A 3IWQA 3WS2A 1JWVA 2VV7A 3E98A 3LEQA 3IS2B 4GW9A 1NXYA 3M6BA 4QD4A 2Y2GA 4GDNA 3TSGA 4XXRA 1SDEA 3V67A 2EXAA 3E4PA 3LI9A 2ZL1B 3Q7VB 4P6ZS 5HPIA 3V3SA 3V39A 2Z6DA 5DKLA 4BD0A 1ESUA 2M1CA 4DE2A 1ES3A 3V5MA 1OTBA 4S2LA 3S22A 4F3LB 4R70A 5FQKA 3ZCZA 2WAFA 4GJ4A 4RYEA 4WEKA 3UE1A 5GLDA 2JE5A 3T4KA 3WS5A 4FH4A 2QWSA 4H8RA 2A24B 5CGSA 1LI9A 3VP2A 2V0WA 3BQ8A 2OLUA 4GOGA 4CQHA 1HLUP 2Y2QA 4JF4A 5TR7A 4Y13A 3HBRA 2PBYA 2VA0A 1F2KA 2EX6A 3T1XA 1CEGA 3BFEA 1ODVA 1N9LA 2L0WA 2QZ6A 4KZ3A 4WM9A 1LSVA 1TDGA 5FDHA 5KSHA 3JPUA 3TG9A 3SS3A 5DJTA 2J3TC 5A8BA 1IELA 3V3RA 3FV7A 5A92A 4HJ6A 1XXMA 3VFHA 1TS0A 3LUQA 5U47A 2KDKA 1K57A 4MCWA 3O3VA 3V50A 5HD3A 1FOFA 1XA7A 3UPPA 2IWBA 1ZKJA 1BT5A 1GHIA 4EBLA 1H3QA 2X71A 4GS9A 3VFFA 2R78A 3IXGA 3W4OA 2JKFA 3HVFA 4DN0A 2JCHA 1IYPA 1XP4A 3G35A 2JKTI 4WYYA 4X1LA 4LV2A 5FASA 3RTYA 1YMXA 5TJJA 3BFFA 2EA9A 4HNBA 1PI5A 2RL3A 2DRWA 1KDWA 4NG2A 3RH8B 3IWOA 4KUOA 2L4RA 4Y0TA 1YKDA 2RCXA 2Y2HA 5KZHA 4N9LA 1W79A 4OLDA 4RVAA 5EVID 3Q1FA 3DTMA 2WKHA 1PYYA 1KOUA 3A0VA 2O99A 4GS9B 1RGZA 3BWLA 3VSKA 4DMZA 3F1OB 3OPLA 3DWKA 1IFQA 1PWCA 5CECA 3FYZA 1LT0A 2Y2NA 3LIAA 5TBMB 4ETXA 3P09A 1LSXA 2I9VA 3PTEA 2XFTA 3QP6A 5M19A 5F6AA 1PIOA 3O87A 4PM9A 3PBQA 1JVJA 4DF6A 5EOEA 3D9YA 1MC0A 5J7EA 3ZQ5A 3VOYA 5CHUA 3EEHA 3EGXC 5FQ9A 3QP5A 4ZRRA 3LIDA 4UQIM 5GLAA 1Q2QA 3L9KA 2HZ5A 3QP2A 5HZHA 4Z1WA 3ZDJA 1V9YA 2ZMAA 5HW3A 3BY9A 1CI9A 1K25A 2QKPA 2V1AA 4FCFA 1NY0A 3ZG5A 5IHVA 1T18A 3P98A 5HAIA 3B33A 2ZOIA 1CI8A 2ZBBA 3RXXA 2WGVA 1XA1A 3BW6A 2ZC6B 3IH9A 5TFQA 2JKGA 1OTIA 1T1CA 4G3VA 2ZQCA 1LL9A 4AFIA 4LV1A 3UB9A 3U2AA 2XLNA 3NBLA 3D3OA 1ONGA 2X02A 1YSQA 3C2WA 2PYPA 5MC7A 2ZMFA 4ARZA 4Q8IA 3MQQA 2WZXA 3UY6A 4E04A 2QMIA 2XRNA 1AWIA 4H6JB 4GHIB 1IYSA 3GRJA 1FQGA 1XFQA 1MKMA 4ID4A 4PMAA 2HP9A 1XGJA 2VV8A 4O8GA 2ZL1A 3GR2A 3MR0A 1RP5A 4MBKA 3JYIA 4UAAA 3F1NB 4KQDA 4UA6A 5DVAA 3DW0A 4K0WA 3PR6A 3IXHA 2PAVP 4NXEA 1CK3A 4WL9A 4JXGA 2D02A 4MDZA 5F83A 1KVMA 3OOVA 4E3LA 2FZ0A 3TE8A 5IT5A 4E3JA 4R4RA 2V1ZA 1T19A 4PKYG 5E43A 1L0GA 4DJ3A 3KX0X 3MZEA 1TS6A 1M6KA 4LCMA 4R4SA 3SW1A 5AQAA 4KQQA 1N9OA 4PM6A 4PHTA 3O5YA 5DKKA 1D1JA 4KZ5A 4HIAA 3ULFA 4RX2A 5EPHA 3FPWA 1XJ2A 2XFSA 3ZG8B 2PRFA 4BL3A 3G4PA 5L09A 2WADA 3GSGA 1H8ZA 3PBOA 1K38A 3T4SA 1QMFA 3D4FA 1AXBA 2VX8A 5GHYA 3O88A 3PBTA 1I5QA 3A3IA 4P0MA 3H82A 1MBLA 1IYQA 2WYXA 5J4EA 3F1NA 4KQOA 4EBPA 4O7DA 3ZYTA 1LSWA 3WRTA 2M7UA 1L3LA 1HZOA 5AQ9A 3CWFA 5C5KA 1DY6A 2W3HA 3FG8A 1N4OA 4LLOB 4OPYA 2WGWA 4I3IA 5IS1A 4N92A 2YKFA 5DTTA 3GMWA 5J8XA 2ZM2A 3FKVA 3NOUC 3PBSA 4KUKA 4CLCD 4CLCB 4QPRA 1KE0A 1GSXA 2INWA 3A3DA 4I38A 1A0KA 3T4TA 5F68A 2PU2A 1IKIA 4EU0A 4EERA 3QP8A 4DXBA 2EX2A 4WN5A 4ZJ3A 2GDNA 2Y2LA 3WS1A 4LRXC 2V8FA 1H8MA 1OT6A 2XD1A 3CUEA 1VQQA 4HHDA 2HP6A 1EI5A 4WUJA 4S2MA 3N8SA 1TD5A 4H6JA 3NIAA 3LIEA 4O0PA 3CMZA 3L7HA 1W7FA 1CJFA 2EFXA 5FEFA 3F1PA 2XEPA 4R38A 4CPKA 4EQIA 2HDQA 1J3WA 3A0RA 1VB6A 1W8YA 1G6AA 3G30A 2G7UA 3B42A 2E8JA 2ZM0A 2QHKA 1G28A 5A91A 4EEUA 2AVXA 2Z6CA 2ZM8A 3LY4A 5EECA 1PFLA 4MN6A 4N1HA 4ZJ1A 4LRYC 1XGIA 5CGXA 3G2YA 5K5BA 1FCNA 2VGLS 3OPHA 3MFDA 1NZUA 4MN7A 2B5RA 3PYPA 3TRCA 5HAQA 5FAQA 1K4FA 1OMEA 5BOHA 3QP1A 4BLMA 1F98A 4UHUA 2GNXA 4RA7A 4G3KA 5AVEA 2KOIA 4WEJA 3LR4A 2XD5A 5FAPA 2UV0E 5EVEA 3SH7A 3EOIA 2JN7A 2VGKA 2PDRA 4E3IA 2JHEA 3C38A 3D72A 2Q9MA 3NDEA 3GDIA 5GLCA 4BBVA 1ESIA 2HDRA 3IX8A 4KG5A 4NXFA 4IHQA 2OAQ1 5F82A 4ZBEA 4ME4A 1F9IA 1VM1A 2W3DA 3C4OA 2ZC4B 3HLBA 5TBMA 4GDBA 3DTIA 3F1PB 1Q2PA 3ITBA 3LYXA 3M2JA 1YSPA 5CTNA 5HFOA 3LEZA 3AGEA 1GHPA 1GA9A 4P87A 3WRZA 4DRTA 1NLYA 4LGWA 2P04A 3GQZA 2OWHA 3E4QA 1P9RA 3CHWP 2HF6A 3C30A 1XFNA 5L07A 4Y17A 5GHZA 5HL1A 4S2IA 3MKFA 4CLCC 1PW8A 1RCJA 5HPFA 2HJ9C 3UE6A 3NHQA 2ZQAA 3CZDA 1WA9A 3DTEA 4LV0A 2ZQ7A 1XJ3A 4KZ6A 1P97A 2L1MA 2B95A 4B93A 3R7WB 2O9AA 2PU4A 4IVKA 2DCFA 1YLJA 4HY8A 1BUEA 2OWJA 2XGNA 3MZFA 4KZBA 1DJBA 3OCLA 3A0SA 2BG1A 5FATA 3IXBA 2Z2LB 3VMAA 1G68A 4L9EA 1YLZA 4ZJ2A 4I3JA 3N6IA 1ES4A 4OPRA 4S2KA 5DTSA 2EFUA 1KE3A 2H5SA 4LFUA 1BZAA 1I2WA 5G4ZA 5HD5A 2CMNA 4DDSA 5I5LA 2PD7A 5GL9A 3VV4A 1KGFA 5HL6A 3CUEC 4IUHA 4DDYA 3VE4A 1S4RA 3S4XA 4Z9QA 4OP5A 1ACFA 1MWUA 3TOIA 1O7EA 1IOUA 3UB8A 1Y54A 3HLEA 5G4YA 1IYOA 2J7VA 1OT9A 3DTKA 4GD6A 3N7WA 4GLQA 4E6WA 1C3BA 2GX5A 5DF9A 2A24A 3BECA 1VETA 3IHBA 3ISGA 4PM7A 2OAP1 3UO9A 1NJ4A 3HREA 5EV0A 4NKPA 1K56D 4QWOA 3UMDA 4PKYA 4MBFA 2Y2PA 4JGOA 4YWZA 1NYYA 2ZC3B 3TW8A 2PYRA 2ZQ9A 4LV3A 5HDDA 3I7JA 4KZ4A 1HTZA 4GHIA 1ZG4A 2EWWA 1F5MA 1YPRA 1TS7A 4E3KA 3KYZA 4OKPA 3T4QA 3NJAA 4K91A 5DFXA 2CC1A 1KVLA 1OJ5A 3SZTA 1YLYA 2EX9A 3MMHA 3R4KA 1LI0A 3MZDA 3MXSA 4X1MA 4R23A 3DWZA 1EROA 4BMWA 2ZQDA 4X56A 2B02A 3OPPA 4I39A 3W8KA 3Q82A 3MKEA 3PAGA 3EEAA 4OONA 4X68A 2B18A 2OOLA 4DKIA 1LHYA 2Y59A 1FILA 3EGDC 4X69A 4XUXA 3A3JA 4DE0A 4CLCE 4S2JA 1PZOA 1UGUA 2PD8A 3H7WA 3LR3A 1SCWA 4EW7A 3FZCA 1CEFA 4XUZA 4X53A 4Y0UA 1NRFA 3UDXA 4JGRA 2LB9A 1NRJA 2Q0OA 5IU1A 3MQOA 2HDSA 2VK3A 2H0YA 1MKIA 1SHVA 5HDSA 3AGDA 1P0ZA 4N1XA 3GTCA 1PNEA 5AJGA 2HGVA 1E3UA 4EV4A 3DAVA 5LBRA 2XA7S 3N4IA 1K4EA 2XA7M 4S2NA 1U60A 2HDUA 4OOMA 4OOLA 1PRQA 2O0YA 2GJ3A 3BLMA 2Y79A 3BM6A 4II7A 5E2GA 4OP8A 3KYQA 2Y2JA 4R3AA 4A5RA 5HX9A 1FR1A 5GLBA 3K3CA 2J9PA 1LL8A 1EWZA 2HPBA 3B47A 1VEUB 1UWPX 3QNCA 3W4QA 3GV9A 2JC7A 1ES2A 3KSGA 3VOLA 1G5UA 4OLGA 3ZNTA 4QU3A 4P6BA 3WWXA 5FI7A 4JF6A 4NEED 1GSWA 5KMWA 4Q0JA 5CERA 3BJNA 3BFDA 2OSUA 3HLWA 4EQ1A 2OLVA 4D60A 2WUQA 4EETB 4UA7A 1TVFA 2WKIA 5FI6A 1L0FA 3LCEA 1KE4A 4S2NC 1O07A 5CGWA 2NUTC 4QB8A 1DP8A 4WMCD 2FFYA 3BEBA 4Y3IA 2JKRM 4MNRA 1P9WA 3G6OA 3T4JA 3FC7A 2ACGA 1S1YA 3KSIA 4C75A 2QJ7A 3MXQA 1DJAA 1E4DA 4JXSA 1D7EA 1W63Q 4JGQA 2ZMVA 1L0EA 1DRMA 2LB5A 4HH2A 3S7NA 2W1RA 4O01A 1G6OA 3WS4A 5HWWA 3H82B 2ZD8A 4HJ4A 3HUNA 3U4LP 3KO6A 5HWTA 1FCMA 4WBGA 2J3WA 5FQMA 3SOIA 4Y7PA 2P08A 3P01A 3IXDA 4DXCA 5E2EA 2V8CA 3FWLA 3SS5A 4JPMA 3F1OA 1ZTUA 3H9WA 4MLLA 1IEMA 4KG6A 2VJWA 3T1RA 2A49A 4NXBA 2V20A 3BY8A 1BTLA 3MJQA 2KX6A 3M2KA 3VOZA 1WYCA 3K2NA 2W3FA 5CHJA 2D01A 3N8RA 4FH2A 3UB7A 3IBRA 4FOFA 3H7WB 4NXGA 1JWZA 3PHYA 5EFWA 2IWDA 3B3XA 3LO7A 1SZVA 5HARA 4WZ5A 4YNRA 4L0LA 2WK0A 2XSSA 5EUAA 2W1TA 4LRZE 2VEAA 3HLFA 1ZC2A 4KZ7A 5CHMA 1MXOA 4R0QA 3LIBA 1ZHHB 1GCEA 1YLTA 3UE3A 3CAXA 1BLCA 4C3QA 4GNUA 3IF6A 3NDGA 2V0UA 4BENA 4IJGA 2PR6A 4BJPA 2GZAA 4G3WA 3IF6B 4YFMA 4EUZA 4K0XA 3CITA 4GN2A 4F3LA 5JYOA 4FD8A 4HJ3A 2ZOHA 3GVBA 2WAEA 2V9AA 4LPZA 3IWIA 3W4PA 3EQUA 3UDFA 3G34A 1FSYA 4DE3A 3PAEA 2O9CA 1Z09A 2J80A 4N9KA 2W1TB 1K0KA 3IX3A 2WGWB 3UPOA 2PHYA 2WKRA 5CEDA 1YLWA 1ES5A 4OQGA 4OOYA 3VP3A 1S6RA 1VETB 3UN7A 3ICYA 3JVVA 3JVUA 3CI6A 3GECA 5TGFA 2Y91A 3S7PA 4RQ9A 3HLDA 3CG5A 4YOFA 4I3AA 1H5XA 5EVIA 3OCNA 4BD1A 2ZC5B 3S7QA 1BULA 3HJKA 1OTDA 3HLCA 4B88A 1PZPA 4KQRA 5A90A 5J3WA 3VP1A 3K3DA 2IWCA 3OC2A 3SS4A 2Y2MA 4MMNA 4Y0OA 5M18A 1Y28A 4P6ZM 3E2LA 1MWSA 4KZ8A 5KIZA 2EX8A 4OPQA 2P9VA 3EQVA 4NK3A 3MSHA 3LR5A 3ZNYA 4Q0HA 4F94A 2XK1A 3P7NA 1BLSA 3CPTA 4OPZA 4HBTA 4E3OA 1SKFA 1OTEA 4HP4A 5DF8A 4WF0A 1K56A 1LLBA 2QYBA 4WLAA 3MBZA 3KYEA 4JKTA 3Q7ZA 2Y55A 2QJ5A 1JTGA 3A3FA 3IS2A 4B4XA 3HLGA 1FCOA 2VV6A 1N9BA 4B9OA 4FSFA 1JTDA 1MPLA 4X25A 3R7WA 1QMEA 2Y2IA 4FTXA 3ZG0A 3BQAA 1RGYA 3S1YA 5FQIA 2H28A 3G31A 3C4PA 1ALQA 5HSQA 3LFVA 5G18A 1X0OA 1W5DA 1YQSA 5DJUA 1L2SA 5EVIC 4LCLA 5M1AA 5F1FA 4PM8A 1S1ZA 3HL9A 1NLZA 4IUKA 1OTAA 3C8CA 4PM5A 4E3NA 3LIFA 3LR0A 3NECA 3UE0A 4Y2FA 2W27A 5FQQA 5FL3A 3RJUA 4OVDA 1K55A 1EW0A 3NOPC 4OH0A 2XDMA 2MJ6A 4HBUA 3WS0A 5HWVA 5I94A 1DJCA 1DP9A 1PW1A 3ZVWA 4HI4A 3ZHHA 4E6XA 5GHXA 2FH5A 4EXOA 5DFYA 4Y5FA 2VZWA 2R9XA 3T4OA 3HCYA 4HOIA 4B4ZA 3HJIA 1JNUA 2P9VB 2WKQA 4GKUA 2EXBA 1XJ4A 4ESPA 2PR5A 3UB6A 4EEPA 2FFFB 2BTFP 4X6TA 5CRFA 1MZUA 2DNSA 4WZ5C 3C7UA 1TF1A 1H8YA 3HUOA 3VP0A 2Z2MB 2YKHA 3VE3A 4IEDA 3IF5A 3O86A 3CPTB 3T50A 4JF5A 4KG2A 2P7JA 2KLIA 5FA7A 1BYWA 3ZFZA 3BYDA 4XT2B 1BLPA 2XROA 5FEGA 3KSFA 3UDIA 2ZC7A 5HDCA 3ZG9B 4QHCA 4GB7A 2W0NA 1LL5A 3IT9A 1ZG6A 4R3BA 2A3UA 2OV5A 2R9WA 4D2OA 1XJ6A 2XH9A 5FQJA 1XX2A 5E2HA 3BLSA 1GHMA 2W3GA 2WKPA 5E2FA 2X01A 3Q7VA 4OQIA 4OQHA 5KSCA 5CEBA 2I72A 4UEYA 1PWDA 1OPXA 4ZDXA 1SDNA 1UWNX 5L10A 3MQ0A 3Q07A 3QNBA 5AQ7A 3QHYA 3A3EA 1YT4A 2UWXA 2XQZA 4EUVA 4FUWA 1KGGA 2WKEA 1WYBA 2EWVA 2XR0A 4KENB 4HQAA 1PI4A 3SH9A 1BSGA 1K57C 1K6RA 4C6YA 4BQMA 1FIKA 4DJ2A 1KDSA 4IVIA 2PT7A 4M3KA 4M4XA 3VP4A 4IBXA 2V2FF 4BBUA 4PAUA 5AQBA 3T1SA 4U0TA 3ITAA 4IBRA 3NY4A 2HP5A 3ZG7B 1HVBA 3OLOA 2Y4AA 1TDLA 3RXWA 4GD8A 4ETZA 3HUMA 2P74A 2BLSA 3LICA 1YMSA 4MEZA 4U0XA 1M40A 3E2KA 2QPNA 2NUPC 3NULA 5JYPA 1NWZA 2XF3A 4K08A 2JBFA 5D3OA 4JLFA 3AGFA 2J8YA 4KZ9A 3MFXA 1W63M 4XT2A 5FI2A 4HEFA 2JKRI 2IA2A 1OJGA 2ZQ8A 3G32A 3OZHA 5FSRA 3OBFA 4QY5A 3UMEA 3MXRA 5EOOA 5EM0A 4R6LA 1E25A 4EBNA 1K54C 2PBDP 1KGEA 3EWKA 4JGPA 2WGIA 4OQ0A 2JKTM 2VKSA 5A93A 3VSLA 3BFCA 4BWIA 1GSVA 5DTKA 4WMCA 2VGJA 3PBNA 3TJZC 3NI9A 3UNWA 2Y8HA 3PXPA 1YM1A 3ZVTA 3IF6C 3T1QB 1S67L 1PWGA 1Y4OA 1J9MA 2Q9NA 4JXWA 4Q0IA 3UPNA 3C7VA 3OPRA
chains in the Genus database with same CATH topology
2HZ5A 3CPTA 3NULA 5EM0A 1CF0A 2ZL1A 1FILA 4X1MA 2E8JA 4QWOA 4D60A 1PRQA 4X25A 1FIKA 1SKOB 2VK3A 5FEGA 4FTXA 1D1JA 1VETA 1YPRA 2JKGA 2V8CA 1F2KA 3NECA 3D9YA 1G5UA 1AWIA 2PBDP 3L7HA 2ZL1B 1VETB 3T1QB 4ESPA 3KYEA 1CJFA 5EV0A 3CPTB 5FEFA 3T1XA 2B95A 1SKOA 2V8FA 2BTFP 3CHWP 1SZVA 1VEUA 1PFLA 1Y4OA 2ACGA 2JKFA 1CQAA 2PRFA 1ACFA 5EM1A 5FDSA 3MS6A 3T1RA 3T12B 3UB5P 1PNEA 1A0KA 1HLUP 3DAVA 3LGOA 1Z09A 3MSHA 4FUWA 1J3WA 2PAVP 4X1LA 3T1SA 1K0KA 3LEQA 3U4LP 1VEUB 3L9KA 5EVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZ5 A;  3CPT A;  3NUL A;  5EM0 A;  1CF0 A;  2ZL1 A;  1FIL A;  4X1M A;  2E8J A;  4QWO A;  4D60 A;  1PRQ A;  4X25 A;  1FIK A;  1SKO B;  2VK3 A;  5FEG A;  4FTX A;  1D1J A;  1VET A;  1YPR A;  2JKG A;  2V8C A;  1F2K A;  3NEC A;  3D9Y A;  1G5U A;  1AWI A;  2PBD P;  3L7H A;  2ZL1 B;  1VET B;  3T1Q B;  4ESP A;  3KYE A;  1CJF A;  5EV0 A;  3CPT B;  5FEF A;  3T1X A;  2B95 A;  1SKO A;  2V8F A;  2BTF P;  3CHW P;  1SZV A;  1VEU A;  1PFL A;  1Y4O A;  2ACG A;  2JKF A;  1CQA A;  2PRF A;  1ACF A;  5EM1 A;  5FDS A;  3MS6 A;  3T1R A;  3T12 B;  3UB5 P;  1PNE A;  1A0K A;  1HLU P;  3DAV A;  3LGO A;  1Z09 A;  3MSH A;  4FUW A;  1J3W A;  2PAV P;  4X1L A;  3T1S A;  1K0K A;  3LEQ A;  3U4L P;  1VEU B;  3L9K A;  5EVE A; 
#chains in the Genus database with same CATH topology
 1NZO A;  4RX3 A;  1MWT A;  1S66 L;  1TEM A;  4P85 A;  2BAS A;  4GCZ A;  3NOT C;  4YIN A;  4E3M A;  1D06 A;  2DMW A;  5DF7 A;  4BBT A;  4ARZ B;  5EM1 A;  3DBA A;  1DP6 A;  2C5W B;  3KSH A;  4QJG A;  2G2U A;  3FPV A;  1CF0 A;  1STZ A;  1W8Q A;  2VLG A;  4WZ4 A;  3E4O A;  1T1B A;  5F69 A;  4BL2 A;  1SKO B;  1MY8 A;  5EVL A;  1L0D A;  5L2F A;  4X55 A;  3IHA A;  3MF0 A;  1FSW A;  2ZLY A;  3UB5 P;  3MS6 A;  5EE8 A;  1YLP A;  1YAX A;  2Y2O A;  2E8I A;  4KZA A;  3IH8 A;  2C6W B;  1T1A A;  4EWF A;  2J9O A;  1ONH A;  4DE1 A;  1K54 A;  2G2W A;  1K6S A;  2HV1 A;  3IX4 A;  3C5A A;  3QP4 A;  3CLO A;  3N8L A;  3T4L A;  5HAP A;  1FR6 A;  3ZGA B;  5F1G A;  1GA0 A;  2ZJ9 A;  4PPR A;  1Z6F A;  2K7S A;  1S0W A;  4L9F A;  2V1B A;  3LI8 A;  2Y2K A;  1XPB A;  4R1G A;  2HJE A;  3Q81 A;  2H0T A;  4JXV A;  1WE4 A;  4HP9 A;  3E0Y A;  4MN5 A;  1NYM A;  4Y15 A;  2A2L A;  1TS8 A;  1H0M A;  3PBR A;  1VEU A;  1N9N A;  1CQA A;  4NET A;  4ZTK A;  5CX7 A;  4GZB A;  1IKG A;  3NC8 A;  3W2Z A;  2WZZ A;  1V9Z A;  1XKZ A;  3RFB A;  3SH8 A;  3BRM A;  5CXW A;  3FKW A;  3M6H A;  4EES A;  3NCK A;  3IBJ A;  2J3T D;  4R3J A;  2VGL M;  5CTM A;  3S7O A;  5FAO A;  4LEN A;  4U3T A;  3LGO A;  4L9G A;  3IQA A;  4MBH A;  1VHM A;  1ERQ A;  4HH3 A;  2O9B A;  1K55 C;  2H10 A;  2K31 A;  5F5Y A;  1ERM A;  4HES A;  2K2N A;  1S4S A;  4UA9 A;  3CJM A;  4CJN A;  1SKO A;  5L8M A;  5FDS A;  2M7V A;  4QY6 A;  5AVF A;  4JBF A;  3LY3 A;  1I2S A;  4ZAM A;  1E3U D;  3G2Z A;  4S2O A;  4UQI S;  1BLH A;  3BFG A;  1JWP A;  4WEL A;  4I5S A;  1MWR A;  5EVI B;  4CLC A;  4S2P A;  2W3E A;  3T12 B;  1HD8 A;  3IWQ A;  3WS2 A;  1JWV A;  2VV7 A;  3E98 A;  3LEQ A;  3IS2 B;  4GW9 A;  1NXY A;  3M6B A;  4QD4 A;  2Y2G A;  4GDN A;  3TSG A;  4XXR A;  1SDE A;  3V67 A;  2EXA A;  3E4P A;  3LI9 A;  2ZL1 B;  3Q7V B;  4P6Z S;  5HPI A;  3V3S A;  3V39 A;  2Z6D A;  5DKL A;  4BD0 A;  1ESU A;  2M1C A;  4DE2 A;  1ES3 A;  3V5M A;  1OTB A;  4S2L A;  3S22 A;  4F3L B;  4R70 A;  5FQK A;  3ZCZ A;  2WAF A;  4GJ4 A;  4RYE A;  4WEK A;  3UE1 A;  5GLD A;  2JE5 A;  3T4K A;  3WS5 A;  4FH4 A;  2QWS A;  4H8R A;  2A24 B;  5CGS A;  1LI9 A;  3VP2 A;  2V0W A;  3BQ8 A;  2OLU A;  4GOG A;  4CQH A;  1HLU P;  2Y2Q A;  4JF4 A;  5TR7 A;  4Y13 A;  3HBR A;  2PBY A;  2VA0 A;  1F2K A;  2EX6 A;  3T1X A;  1CEG A;  3BFE A;  1ODV A;  1N9L A;  2L0W A;  2QZ6 A;  4KZ3 A;  4WM9 A;  1LSV A;  1TDG A;  5FDH A;  5KSH A;  3JPU A;  3TG9 A;  3SS3 A;  5DJT A;  2J3T C;  5A8B A;  1IEL A;  3V3R A;  3FV7 A;  5A92 A;  4HJ6 A;  1XXM A;  3VFH A;  1TS0 A;  3LUQ A;  5U47 A;  2KDK A;  1K57 A;  4MCW A;  3O3V A;  3V50 A;  5HD3 A;  1FOF A;  1XA7 A;  3UPP A;  2IWB A;  1ZKJ A;  1BT5 A;  1GHI A;  4EBL A;  1H3Q A;  2X71 A;  4GS9 A;  3VFF A;  2R78 A;  3IXG A;  3W4O A;  2JKF A;  3HVF A;  4DN0 A;  2JCH A;  1IYP A;  1XP4 A;  3G35 A;  2JKT I;  4WYY A;  4X1L A;  4LV2 A;  5FAS A;  3RTY A;  1YMX A;  5TJJ A;  3BFF A;  2EA9 A;  4HNB A;  1PI5 A;  2RL3 A;  2DRW A;  1KDW A;  4NG2 A;  3RH8 B;  3IWO A;  4KUO A;  2L4R A;  4Y0T A;  1YKD A;  2RCX A;  2Y2H A;  5KZH A;  4N9L A;  1W79 A;  4OLD A;  4RVA A;  5EVI D;  3Q1F A;  3DTM A;  2WKH A;  1PYY A;  1KOU A;  3A0V A;  2O99 A;  4GS9 B;  1RGZ A;  3BWL A;  3VSK A;  4DMZ A;  3F1O B;  3OPL A;  3DWK A;  1IFQ A;  1PWC A;  5CEC A;  3FYZ A;  1LT0 A;  2Y2N A;  3LIA A;  5TBM B;  4ETX A;  3P09 A;  1LSX A;  2I9V A;  3PTE A;  2XFT A;  3QP6 A;  5M19 A;  5F6A A;  1PIO A;  3O87 A;  4PM9 A;  3PBQ A;  1JVJ A;  4DF6 A;  5EOE A;  3D9Y A;  1MC0 A;  5J7E A;  3ZQ5 A;  3VOY A;  5CHU A;  3EEH A;  3EGX C;  5FQ9 A;  3QP5 A;  4ZRR A;  3LID A;  4UQI M;  5GLA A;  1Q2Q A;  3L9K A;  2HZ5 A;  3QP2 A;  5HZH A;  4Z1W A;  3ZDJ A;  1V9Y A;  2ZMA A;  5HW3 A;  3BY9 A;  1CI9 A;  1K25 A;  2QKP A;  2V1A A;  4FCF A;  1NY0 A;  3ZG5 A;  5IHV A;  1T18 A;  3P98 A;  5HAI A;  3B33 A;  2ZOI A;  1CI8 A;  2ZBB A;  3RXX A;  2WGV A;  1XA1 A;  3BW6 A;  2ZC6 B;  3IH9 A;  5TFQ A;  2JKG A;  1OTI A;  1T1C A;  4G3V A;  2ZQC A;  1LL9 A;  4AFI A;  4LV1 A;  3UB9 A;  3U2A A;  2XLN A;  3NBL A;  3D3O A;  1ONG A;  2X02 A;  1YSQ A;  3C2W A;  2PYP A;  5MC7 A;  2ZMF A;  4ARZ A;  4Q8I A;  3MQQ A;  2WZX A;  3UY6 A;  4E04 A;  2QMI A;  2XRN A;  1AWI A;  4H6J B;  4GHI B;  1IYS A;  3GRJ A;  1FQG A;  1XFQ A;  1MKM A;  4ID4 A;  4PMA A;  2HP9 A;  1XGJ A;  2VV8 A;  4O8G A;  2ZL1 A;  3GR2 A;  3MR0 A;  1RP5 A;  4MBK A;  3JYI A;  4UAA A;  3F1N B;  4KQD A;  4UA6 A;  5DVA A;  3DW0 A;  4K0W A;  3PR6 A;  3IXH A;  2PAV P;  4NXE A;  1CK3 A;  4WL9 A;  4JXG A;  2D02 A;  4MDZ A;  5F83 A;  1KVM A;  3OOV A;  4E3L A;  2FZ0 A;  3TE8 A;  5IT5 A;  4E3J A;  4R4R A;  2V1Z A;  1T19 A;  4PKY G;  5E43 A;  1L0G A;  4DJ3 A;  3KX0 X;  3MZE A;  1TS6 A;  1M6K A;  4LCM A;  4R4S A;  3SW1 A;  5AQA A;  4KQQ A;  1N9O A;  4PM6 A;  4PHT A;  3O5Y A;  5DKK A;  1D1J A;  4KZ5 A;  4HIA A;  3ULF A;  4RX2 A;  5EPH A;  3FPW A;  1XJ2 A;  2XFS A;  3ZG8 B;  2PRF A;  4BL3 A;  3G4P A;  5L09 A;  2WAD A;  3GSG A;  1H8Z A;  3PBO A;  1K38 A;  3T4S A;  1QMF A;  3D4F A;  1AXB A;  2VX8 A;  5GHY A;  3O88 A;  3PBT A;  1I5Q A;  3A3I A;  4P0M A;  3H82 A;  1MBL A;  1IYQ A;  2WYX A;  5J4E A;  3F1N A;  4KQO A;  4EBP A;  4O7D A;  3ZYT A;  1LSW A;  3WRT A;  2M7U A;  1L3L A;  1HZO A;  5AQ9 A;  3CWF A;  5C5K A;  1DY6 A;  2W3H A;  3FG8 A;  1N4O A;  4LLO B;  4OPY A;  2WGW A;  4I3I A;  5IS1 A;  4N92 A;  2YKF A;  5DTT A;  3GMW A;  5J8X A;  2ZM2 A;  3FKV A;  3NOU C;  3PBS A;  4KUK A;  4CLC D;  4CLC B;  4QPR A;  1KE0 A;  1GSX A;  2INW A;  3A3D A;  4I38 A;  1A0K A;  3T4T A;  5F68 A;  2PU2 A;  1IKI A;  4EU0 A;  4EER A;  3QP8 A;  4DXB A;  2EX2 A;  4WN5 A;  4ZJ3 A;  2GDN A;  2Y2L A;  3WS1 A;  4LRX C;  2V8F A;  1H8M A;  1OT6 A;  2XD1 A;  3CUE A;  1VQQ A;  4HHD A;  2HP6 A;  1EI5 A;  4WUJ A;  4S2M A;  3N8S A;  1TD5 A;  4H6J A;  3NIA A;  3LIE A;  4O0P A;  3CMZ A;  3L7H A;  1W7F A;  1CJF A;  2EFX A;  5FEF A;  3F1P A;  2XEP A;  4R38 A;  4CPK A;  4EQI A;  2HDQ A;  1J3W A;  3A0R A;  1VB6 A;  1W8Y A;  1G6A A;  3G30 A;  2G7U A;  3B42 A;  2E8J A;  2ZM0 A;  2QHK A;  1G28 A;  5A91 A;  4EEU A;  2AVX A;  2Z6C A;  2ZM8 A;  3LY4 A;  5EEC A;  1PFL A;  4MN6 A;  4N1H A;  4ZJ1 A;  4LRY C;  1XGI A;  5CGX A;  3G2Y A;  5K5B A;  1FCN A;  2VGL S;  3OPH A;  3MFD A;  1NZU A;  4MN7 A;  2B5R A;  3PYP A;  3TRC A;  5HAQ A;  5FAQ A;  1K4F A;  1OME A;  5BOH A;  3QP1 A;  4BLM A;  1F98 A;  4UHU A;  2GNX A;  4RA7 A;  4G3K A;  5AVE A;  2KOI A;  4WEJ A;  3LR4 A;  2XD5 A;  5FAP A;  2UV0 E;  5EVE A;  3SH7 A;  3EOI A;  2JN7 A;  2VGK A;  2PDR A;  4E3I A;  2JHE A;  3C38 A;  3D72 A;  2Q9M A;  3NDE A;  3GDI A;  5GLC A;  4BBV A;  1ESI A;  2HDR A;  3IX8 A;  4KG5 A;  4NXF A;  4IHQ A;  2OAQ 1;  5F82 A;  4ZBE A;  4ME4 A;  1F9I A;  1VM1 A;  2W3D A;  3C4O A;  2ZC4 B;  3HLB A;  5TBM A;  4GDB A;  3DTI A;  3F1P B;  1Q2P A;  3ITB A;  3LYX A;  3M2J A;  1YSP A;  5CTN A;  5HFO A;  3LEZ A;  3AGE A;  1GHP A;  1GA9 A;  4P87 A;  3WRZ A;  4DRT A;  1NLY A;  4LGW A;  2P04 A;  3GQZ A;  2OWH A;  3E4Q A;  1P9R A;  3CHW P;  2HF6 A;  3C30 A;  1XFN A;  5L07 A;  4Y17 A;  5GHZ A;  5HL1 A;  4S2I A;  3MKF A;  4CLC C;  1PW8 A;  1RCJ A;  5HPF A;  2HJ9 C;  3UE6 A;  3NHQ A;  2ZQA A;  3CZD A;  1WA9 A;  3DTE A;  4LV0 A;  2ZQ7 A;  1XJ3 A;  4KZ6 A;  1P97 A;  2L1M A;  2B95 A;  4B93 A;  3R7W B;  2O9A A;  2PU4 A;  4IVK A;  2DCF A;  1YLJ A;  4HY8 A;  1BUE A;  2OWJ A;  2XGN A;  3MZF A;  4KZB A;  1DJB A;  3OCL A;  3A0S A;  2BG1 A;  5FAT A;  3IXB A;  2Z2L B;  3VMA A;  1G68 A;  4L9E A;  1YLZ A;  4ZJ2 A;  4I3J A;  3N6I A;  1ES4 A;  4OPR A;  4S2K A;  5DTS A;  2EFU A;  1KE3 A;  2H5S A;  4LFU A;  1BZA A;  1I2W A;  5G4Z A;  5HD5 A;  2CMN A;  4DDS A;  5I5L A;  2PD7 A;  5GL9 A;  3VV4 A;  1KGF A;  5HL6 A;  3CUE C;  4IUH A;  4DDY A;  3VE4 A;  1S4R A;  3S4X A;  4Z9Q A;  4OP5 A;  1ACF A;  1MWU A;  3TOI A;  1O7E A;  1IOU A;  3UB8 A;  1Y54 A;  3HLE A;  5G4Y A;  1IYO A;  2J7V A;  1OT9 A;  3DTK A;  4GD6 A;  3N7W A;  4GLQ A;  4E6W A;  1C3B A;  2GX5 A;  5DF9 A;  2A24 A;  3BEC A;  1VET A;  3IHB A;  3ISG A;  4PM7 A;  2OAP 1;  3UO9 A;  1NJ4 A;  3HRE A;  5EV0 A;  4NKP A;  1K56 D;  4QWO A;  3UMD A;  4PKY A;  4MBF A;  2Y2P A;  4JGO A;  4YWZ A;  1NYY A;  2ZC3 B;  3TW8 A;  2PYR A;  2ZQ9 A;  4LV3 A;  5HDD A;  3I7J A;  4KZ4 A;  1HTZ A;  4GHI A;  1ZG4 A;  2EWW A;  1F5M A;  1YPR A;  1TS7 A;  4E3K A;  3KYZ A;  4OKP A;  3T4Q A;  3NJA A;  4K91 A;  5DFX A;  2CC1 A;  1KVL A;  1OJ5 A;  3SZT A;  1YLY A;  2EX9 A;  3MMH A;  3R4K A;  1LI0 A;  3MZD A;  3MXS A;  4X1M A;  4R23 A;  3DWZ A;  1ERO A;  4BMW A;  2ZQD A;  4X56 A;  2B02 A;  3OPP A;  4I39 A;  3W8K A;  3Q82 A;  3MKE A;  3PAG A;  3EEA A;  4OON A;  4X68 A;  2B18 A;  2OOL A;  4DKI A;  1LHY A;  2Y59 A;  1FIL A;  3EGD C;  4X69 A;  4XUX A;  3A3J A;  4DE0 A;  4CLC E;  4S2J A;  1PZO A;  1UGU A;  2PD8 A;  3H7W A;  3LR3 A;  1SCW A;  4EW7 A;  3FZC A;  1CEF A;  4XUZ A;  4X53 A;  4Y0U A;  1NRF A;  3UDX A;  4JGR A;  2LB9 A;  1NRJ A;  2Q0O A;  5IU1 A;  3MQO A;  2HDS A;  2VK3 A;  2H0Y A;  1MKI A;  1SHV A;  5HDS A;  3AGD A;  1P0Z A;  4N1X A;  3GTC A;  1PNE A;  5AJG A;  2HGV A;  1E3U A;  4EV4 A;  3DAV A;  5LBR A;  2XA7 S;  3N4I A;  1K4E A;  2XA7 M;  4S2N A;  1U60 A;  2HDU A;  4OOM A;  4OOL A;  1PRQ A;  2O0Y A;  2GJ3 A;  3BLM A;  2Y79 A;  3BM6 A;  4II7 A;  5E2G A;  4OP8 A;  3KYQ A;  2Y2J A;  4R3A A;  4A5R A;  5HX9 A;  1FR1 A;  5GLB A;  3K3C A;  2J9P A;  1LL8 A;  1EWZ A;  2HPB A;  3B47 A;  1VEU B;  1UWP X;  3QNC A;  3W4Q A;  3GV9 A;  2JC7 A;  1ES2 A;  3KSG A;  3VOL A;  1G5U A;  4OLG A;  3ZNT A;  4QU3 A;  4P6B A;  3WWX A;  5FI7 A;  4JF6 A;  4NEE D;  1GSW A;  5KMW A;  4Q0J A;  5CER A;  3BJN A;  3BFD A;  2OSU A;  3HLW A;  4EQ1 A;  2OLV A;  4D60 A;  2WUQ A;  4EET B;  4UA7 A;  1TVF A;  2WKI A;  5FI6 A;  1L0F A;  3LCE A;  1KE4 A;  4S2N C;  1O07 A;  5CGW A;  2NUT C;  4QB8 A;  1DP8 A;  4WMC D;  2FFY A;  3BEB A;  4Y3I A;  2JKR M;  4MNR A;  1P9W A;  3G6O A;  3T4J A;  3FC7 A;  2ACG A;  1S1Y A;  3KSI A;  4C75 A;  2QJ7 A;  3MXQ A;  1DJA A;  1E4D A;  4JXS A;  1D7E A;  1W63 Q;  4JGQ A;  2ZMV A;  1L0E A;  1DRM A;  2LB5 A;  4HH2 A;  3S7N A;  2W1R A;  4O01 A;  1G6O A;  3WS4 A;  5HWW A;  3H82 B;  2ZD8 A;  4HJ4 A;  3HUN A;  3U4L P;  3KO6 A;  5HWT A;  1FCM A;  4WBG A;  2J3W A;  5FQM A;  3SOI A;  4Y7P A;  2P08 A;  3P01 A;  3IXD A;  4DXC A;  5E2E A;  2V8C A;  3FWL A;  3SS5 A;  4JPM A;  3F1O A;  1ZTU A;  3H9W A;  4MLL A;  1IEM A;  4KG6 A;  2VJW A;  3T1R A;  2A49 A;  4NXB A;  2V20 A;  3BY8 A;  1BTL A;  3MJQ A;  2KX6 A;  3M2K A;  3VOZ A;  1WYC A;  3K2N A;  2W3F A;  5CHJ A;  2D01 A;  3N8R A;  4FH2 A;  3UB7 A;  3IBR A;  4FOF A;  3H7W B;  4NXG A;  1JWZ A;  3PHY A;  5EFW A;  2IWD A;  3B3X A;  3LO7 A;  1SZV A;  5HAR A;  4WZ5 A;  4YNR A;  4L0L A;  2WK0 A;  2XSS A;  5EUA A;  2W1T A;  4LRZ E;  2VEA A;  3HLF A;  1ZC2 A;  4KZ7 A;  5CHM A;  1MXO A;  4R0Q A;  3LIB A;  1ZHH B;  1GCE A;  1YLT A;  3UE3 A;  3CAX A;  1BLC A;  4C3Q A;  4GNU A;  3IF6 A;  3NDG A;  2V0U A;  4BEN A;  4IJG A;  2PR6 A;  4BJP A;  2GZA A;  4G3W A;  3IF6 B;  4YFM A;  4EUZ A;  4K0X A;  3CIT A;  4GN2 A;  4F3L A;  5JYO A;  4FD8 A;  4HJ3 A;  2ZOH A;  3GVB A;  2WAE A;  2V9A A;  4LPZ A;  3IWI A;  3W4P A;  3EQU A;  3UDF A;  3G34 A;  1FSY A;  4DE3 A;  3PAE A;  2O9C A;  1Z09 A;  2J80 A;  4N9K A;  2W1T B;  1K0K A;  3IX3 A;  2WGW B;  3UPO A;  2PHY A;  2WKR A;  5CED A;  1YLW A;  1ES5 A;  4OQG A;  4OOY A;  3VP3 A;  1S6R A;  1VET B;  3UN7 A;  3ICY A;  3JVV A;  3JVU A;  3CI6 A;  3GEC A;  5TGF A;  2Y91 A;  3S7P A;  4RQ9 A;  3HLD A;  3CG5 A;  4YOF A;  4I3A A;  1H5X A;  5EVI A;  3OCN A;  4BD1 A;  2ZC5 B;  3S7Q A;  1BUL A;  3HJK A;  1OTD A;  3HLC A;  4B88 A;  1PZP A;  4KQR A;  5A90 A;  5J3W A;  3VP1 A;  3K3D A;  2IWC A;  3OC2 A;  3SS4 A;  2Y2M A;  4MMN A;  4Y0O A;  5M18 A;  1Y28 A;  4P6Z M;  3E2L A;  1MWS A;  4KZ8 A;  5KIZ A;  2EX8 A;  4OPQ A;  2P9V A;  3EQV A;  4NK3 A;  3MSH A;  3LR5 A;  3ZNY A;  4Q0H A;  4F94 A;  2XK1 A;  3P7N A;  1BLS A;  3CPT A;  4OPZ A;  4HBT A;  4E3O A;  1SKF A;  1OTE A;  4HP4 A;  5DF8 A;  4WF0 A;  1K56 A;  1LLB A;  2QYB A;  4WLA A;  3MBZ A;  3KYE A;  4JKT A;  3Q7Z A;  2Y55 A;  2QJ5 A;  1JTG A;  3A3F A;  3IS2 A;  4B4X A;  3HLG A;  1FCO A;  2VV6 A;  1N9B A;  4B9O A;  4FSF A;  1JTD A;  1MPL A;  4X25 A;  3R7W A;  1QME A;  2Y2I A;  4FTX A;  3ZG0 A;  3BQA A;  1RGY A;  3S1Y A;  5FQI A;  2H28 A;  3G31 A;  3C4P A;  1ALQ A;  5HSQ A;  3LFV A;  5G18 A;  1X0O A;  1W5D A;  1YQS A;  5DJU A;  1L2S A;  5EVI C;  4LCL A;  5M1A A;  5F1F A;  4PM8 A;  1S1Z A;  3HL9 A;  1NLZ A;  4IUK A;  1OTA A;  3C8C A;  4PM5 A;  4E3N A;  3LIF A;  3LR0 A;  3NEC A;  3UE0 A;  4Y2F A;  2W27 A;  5FQQ A;  5FL3 A;  3RJU A;  4OVD A;  1K55 A;  1EW0 A;  3NOP C;  4OH0 A;  2XDM A;  2MJ6 A;  4HBU A;  3WS0 A;  5HWV A;  5I94 A;  1DJC A;  1DP9 A;  1PW1 A;  3ZVW A;  4HI4 A;  3ZHH A;  4E6X A;  5GHX A;  2FH5 A;  4EXO A;  5DFY A;  4Y5F A;  2VZW A;  2R9X A;  3T4O A;  3HCY A;  4HOI A;  4B4Z A;  3HJI A;  1JNU A;  2P9V B;  2WKQ A;  4GKU A;  2EXB A;  1XJ4 A;  4ESP A;  2PR5 A;  3UB6 A;  4EEP A;  2FFF B;  2BTF P;  4X6T A;  5CRF A;  1MZU A;  2DNS A;  4WZ5 C;  3C7U A;  1TF1 A;  1H8Y A;  3HUO A;  3VP0 A;  2Z2M B;  2YKH A;  3VE3 A;  4IED A;  3IF5 A;  3O86 A;  3CPT B;  3T50 A;  4JF5 A;  4KG2 A;  2P7J A;  2KLI A;  5FA7 A;  1BYW A;  3ZFZ A;  3BYD A;  4XT2 B;  1BLP A;  2XRO A;  5FEG A;  3KSF A;  3UDI A;  2ZC7 A;  5HDC A;  3ZG9 B;  4QHC A;  4GB7 A;  2W0N A;  1LL5 A;  3IT9 A;  1ZG6 A;  4R3B A;  2A3U A;  2OV5 A;  2R9W A;  4D2O A;  1XJ6 A;  2XH9 A;  5FQJ A;  1XX2 A;  5E2H A;  3BLS A;  1GHM A;  2W3G A;  2WKP A;  5E2F A;  2X01 A;  3Q7V A;  4OQI A;  4OQH A;  5KSC A;  5CEB A;  2I72 A;  4UEY A;  1PWD A;  1OPX A;  4ZDX A;  1SDN A;  1UWN X;  5L10 A;  3MQ0 A;  3Q07 A;  3QNB A;  5AQ7 A;  3QHY A;  3A3E A;  1YT4 A;  2UWX A;  2XQZ A;  4EUV A;  4FUW A;  1KGG A;  2WKE A;  1WYB A;  2EWV A;  2XR0 A;  4KEN B;  4HQA A;  1PI4 A;  3SH9 A;  1BSG A;  1K57 C;  1K6R A;  4C6Y A;  4BQM A;  1FIK A;  4DJ2 A;  1KDS A;  4IVI A;  2PT7 A;  4M3K A;  4M4X A;  3VP4 A;  4IBX A;  2V2F F;  4BBU A;  4PAU A;  5AQB A;  3T1S A;  4U0T A;  3ITA A;  4IBR A;  3NY4 A;  2HP5 A;  3ZG7 B;  1HVB A;  3OLO A;  2Y4A A;  1TDL A;  3RXW A;  4GD8 A;  4ETZ A;  3HUM A;  2P74 A;  2BLS A;  3LIC A;  1YMS A;  4MEZ A;  4U0X A;  1M40 A;  3E2K A;  2QPN A;  2NUP C;  3NUL A;  5JYP A;  1NWZ A;  2XF3 A;  4K08 A;  2JBF A;  5D3O A;  4JLF A;  3AGF A;  2J8Y A;  4KZ9 A;  3MFX A;  1W63 M;  4XT2 A;  5FI2 A;  4HEF A;  2JKR I;  2IA2 A;  1OJG A;  2ZQ8 A;  3G32 A;  3OZH A;  5FSR A;  3OBF A;  4QY5 A;  3UME A;  3MXR A;  5EOO A;  5EM0 A;  4R6L A;  1E25 A;  4EBN A;  1K54 C;  2PBD P;  1KGE A;  3EWK A;  4JGP A;  2WGI A;  4OQ0 A;  2JKT M;  2VKS A;  5A93 A;  3VSL A;  3BFC A;  4BWI A;  1GSV A;  5DTK A;  4WMC A;  2VGJ A;  3PBN A;  3TJZ C;  3NI9 A;  3UNW A;  2Y8H A;  3PXP A;  1YM1 A;  3ZVT A;  3IF6 C;  3T1Q B;  1S67 L;  1PWG A;  1Y4O A;  1J9M A;  2Q9N A;  4JXW A;  4Q0I A;  3UPN A;  3C7V A;  3OPR A; 
#chains in the Genus database with same CATH homology
 2HZ5 A;  3CPT A;  3NUL A;  5EM0 A;  1CF0 A;  2ZL1 A;  1FIL A;  4X1M A;  2E8J A;  4QWO A;  4D60 A;  1PRQ A;  4X25 A;  1FIK A;  1SKO B;  2VK3 A;  5FEG A;  4FTX A;  1D1J A;  1VET A;  1YPR A;  2JKG A;  2V8C A;  1F2K A;  3NEC A;  3D9Y A;  1G5U A;  1AWI A;  2PBD P;  3L7H A;  2ZL1 B;  1VET B;  3T1Q B;  4ESP A;  3KYE A;  1CJF A;  5EV0 A;  3CPT B;  5FEF A;  3T1X A;  2B95 A;  1SKO A;  2V8F A;  2BTF P;  3CHW P;  1SZV A;  1VEU A;  1PFL A;  1Y4O A;  2ACG A;  2JKF A;  1CQA A;  2PRF A;  1ACF A;  5EM1 A;  5FDS A;  3MS6 A;  3T1R A;  3T12 B;  3UB5 P;  1PNE A;  1A0K A;  1HLU P;  3DAV A;  3LGO A;  1Z09 A;  3MSH A;  4FUW A;  1J3W A;  2PAV P;  4X1L A;  3T1S A;  1K0K A;  3LEQ A;  3U4L P;  1VEU B;  3L9K A;  5EVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...