2VK3A

Crystal structure of rat profilin 2a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
142
structure length
142
Chain Sequence
b'GSMAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPAEIDVIIGKDREGFFTNGLTLGGKKCSVIRDSLYVDSDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN-2
publication title Structure, Modifications and Ligand-Binding Properties of Rat Profilin 2A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 46
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2vk3A00
2PAVP 1HLUP 2PRFA 4QWOA 3CHWP 1K0KA 1SZVA 2ZL1A 1J3WA 3LEQA 2JKGA 3T1XA 3NECA 1YPRA 4X1LA 1Y4OA 4X25A 5EV0A 1CQAA 2BTFP 1VETA 1VEUB 3T12B 1F2KA 1SKOB 1A0KA 3CPTB 1G5UA 1D1JA 3MSHA 1FILA 3UB5P 2JKFA 3T1QB 1CJFA 3L7HA 1FIKA 4X1MA 1SKOA 3T1SA 2ZL1B 3MS6A 2ACGA 4D60A 2E8JA 5FDSA 2HZ5A 2V8FA 1Z09A 2B95A 5EM0A 3T1RA 1PFLA 5FEGA 3U4LP 1PRQA 2PBDP 5EM1A 2VK3A 3L9KA 1PNEA 2V8CA 1VEUA 1AWIA 3NULA 4ESPA 1CF0A 3CPTA 4FUWA 3DAVA 3LGOA 1ACFA 4FTXA 5EVEA 5FEFA 1VETB 3D9YA 3KYEA
chains in the Genus database with same CATH superfamily
1N9BA 1G6AA 4HIAA 2EWWA 3BJNA 5FAPA 1ESIA 3VMAA 4FH4A 4RYEA 4NXEA 3NECA 4GKUA 3FZCA 4H6JA 1BUEA 5HAPA 1JNUA 1KDWA 3UPPA 5KSHA 4EESA 4ETXA 3P98A 1XFQA 2OLUA 3ZHHA 1F98A 2R9WA 3ZGAB 2RL3A 3EEHA 3CPTB 1E4DA 3FV7A 4OLDA 2R9XA 4KQDA 3KSGA 3AGFA 1VB6A 1YAXA 5E2HA 2JKFA 2XA7M 4LRYC 3MXSA 2IWCA 3IS2A 4XT2A 1ODVA 1XGIA 4OPRA 5TFQA 2CC1A 5FDSA 2WK0A 4UA7A 4EUVA 3BYDA 3E2LA 3EQVA 5EM0A 4CLCB 2ZQ7A 5EVIC 5CHJA 2WKPA 3A3JA 3IWQA 2PBDP 3D72A 2ZC7A 4MLLA 2J3TD 1PYYA 1XKZA 2ZOIA 3BM6A 1BLCA 4S2IA 2W3GA 2PR6A 2L1MA 2WZXA 2XEPA 3PBTA 1CI8A 5E2FA 1XA7A 3ISGA 1ZHHB 3PBRA 1VETB 3MQ0A 3A3DA 2PRFA 4ETZA 4E6WA 2WKEA 5AVEA 3KSFA 2JBFA 2OSUA 3A3EA 1N9NA 2VV6A 4L9FA 3T1XA 5FQIA 4KG2A 3NIAA 4X25A 2XR0A 4WZ4A 5L10A 3UDFA 4KUOA 4ZRRA 1L0FA 3KSIA 4I5SA 1LL9A 3LI8A 5CGWA 1K6RA 1A0KA 4Y0UA 1IYQA 4QB8A 3HUNA 4R6LA 5EOOA 3ZFZA 1W5DA 2WKQA 1Z6FA 3ZCZA 3BWLA 3ZG5A 3IX8A 4HH2A 4DE2A 5TBMB 1GA9A 4R3AA 2NUPC 4LENA 3B33A 2K31A 5I5LA 3QHYA 3BW6A 4GOGA 3HLFA 1OT6A 5FEGA 2XF3A 2JKRM 1FOFA 1IKGA 2V8CA 2HV1A 2XFSA 3M6HA 3JVUA 4UA9A 3MKFA 2EX2A 4HQAA 3IF6C 3GECA 1ES4A 4FD8A 4EETB 2WKRA 5FQJA 3C5AA 2WGVA 1L0EA 5CTMA 3N6IA 3LGOA 3CG5A 5DFXA 1YLPA 2ZC4B 4EERA 4HH3A 1ES3A 4ARZA 2NUTC 4S2NA 4WZ5C 2W1RA 5DTSA 3MJQA 4AFIA 1K0KA 2J80A 1DJCA 1W8QA 1KGEA 1N9LA 1Y4OA 3K3CA 3ZQ5A 4B88A 1FSWA 4KENB 4BQMA 2XRNA 3C30A 4UAAA 2Y2QA 4DE0A 4JF5A 5DJUA 1JTGA 3NBLA 1VQQA 5CEBA 4KZ3A 4MN6A 1XJ2A 4IBXA 1UWPX 4DKIA 1T18A 3M6BA 5J3WA 3TSGA 1VM1A 1XJ4A 4EXOA 3LIBA 2P7JA 2DCFA 1H8MA 4EBLA 4PAUA 4E3LA 2V1AA 1L0GA 3H7WB 1ZTUA 2ZLYA 3OCLA 5FI7A 5AVFA 1SDEA 4JLFA 3NOUC 5CGSA 4MMNA 1QMFA 1S1YA 4QPRA 2B95A 4G3VA 2ZC6B 2CMNA 4GD6A 4L9GA 4Y15A 1WE4A 1K4FA 2C6WB 4R0QA 1AWIA 5GHXA 2QJ7A 3JVVA 1HVBA 3C8CA 3OPLA 4I39A 3VP4A 3BRMA 1PI5A 3CAXA 3KX0X 4FH2A 5HSQA 4LRXC 4YNRA 3P09A 1W63M 1SCWA 3IH9A 2PAVP 4I3JA 1PZOA 5GLCA 3HUOA 2ZL1A 1JVJA 1Q2PA 4UQIM 2WKIA 1MPLA 3OOVA 3M2JA 4Q0JA 1I5QA 2H5SA 1I2SA 2ZD8A 5HAQA 3BFCA 4E3KA 1CQAA 2X02A 3WRTA 3W8KA 3V67A 3N8SA 5CERA 3F1OB 3OBFA 3ZVWA 2H0YA 2XGNA 4U0XA 2HGVA 1ONHA 2BG1A 3CITA 1SKOB 3GTCA 1NRFA 3PYPA 3RJUA 1STZA 5DTKA 4S2MA 3C7VA 4E3JA 2KOIA 3KYQA 1ERQA 3GMWA 4ZTKA 1S4RA 2Y2OA 2D02A 3KSHA 1YKDA 1T1AA 3N8RA 4CLCC 4OQHA 1BZAA 1TS0A 1LSVA 4PMAA 4UA6A 3BEBA 3A3FA 3N4IA 1H0MA 2KDKA 1T1BA 4ID4A 1PIOA 1K38A 3A3IA 1FR1A 2Q9MA 4MDZA 2QKPA 3R7WA 3F1NB 3PR6A 5FDHA 3G30A 1IYPA 3JPUA 4GCZA 4LV0A 2WGWB 1XFNA 5F5YA 3IHAA 4KUKA 2LB5A 1PFLA 2XQZA 1KGGA 2A24A 2DNSA 3LR4A 5KZHA 1ZG4A 5E43A 3VP0A 4XUZA 3H82B 1YLWA 2V20A 3HLBA 5HWVA 4IHQA 3IT9A 2VZWA 4HEFA 3PBNA 2UV0E 5E2EA 4WEJA 1GSVA 5E2GA 1KVLA 2YKHA 1SHVA 4DDSA 3BQAA 2OAQ1 3CMZA 4BMWA 1NXYA 4Y0TA 4OLGA 5F1FA 5MC7A 3HCYA 1OTIA 1U60A 1PI4A 2IA2A 3Q82A 3R4KA 2PBYA 3SS5A 3O3VA 5HL6A 1LT0A 3MFXA 2Y2MA 3S7PA 1DJBA 3MBZA 1MKMA 3VP1A 2KLIA 5HWWA 1LSXA 3OCNA 4QY5A 3QNBA 3FG8A 5I94A 3RXXA 1X0OA 2IWBA 2VX8A 1XJ3A 4Z1WA 3LY4A 4OH0A 3MXRA 4LV3A 3BLSA 4B4XA 4R4RA 2INWA 5EUAA 3IF6A 3BFDA 1W8YA 4EWFA 3UB7A 1F2KA 4JGPA 1VHMA 4WF0A 2Y2GA 3N7WA 4OPZA 1H3QA 4WZ5A 4EU0A 4HY8A 4MNRA 2VJWA 4KG6A 3G2YA 1CEFA 2Y4AA 3B42A 2P9VA 1MWRA 1TF1A 1YLYA 2ZQCA 3VFFA 3P01A 2PD7A 4WM9A 1K57A 3MFDA 4IVKA 2O9CA 4GDNA 2C5WB 4S2KA 2HDSA 2EX8A 4OKPA 3MZFA 1GSWA 4QHCA 4B93A 4U3TA 2JKRI 5EM1A 1K4EA 1IKIA 4GW9A 1FCMA 3NULA 1ES2A 2M1CA 3DBAA 4OOLA 3O88A 4KZ5A 4KG5A 1YMSA 2ZM2A 3U2AA 5HL1A 5GHYA 1V9ZA 4NEED 3VOLA 3DAVA 5EVEA 1EWZA 1IELA 3GRJA 3D9YA 4PM7A 2VKSA 1HLUP 2VGLS 4M3KA 2GJ3A 2OAP1 3UE1A 1J3WA 4KZBA 2JCHA 3TG9A 1YPRA 3HJIA 2D01A 2Y2NA 2H28A 4Z9QA 3G2ZA 3JYIA 2A49A 2BTFP 3IXBA 3QP1A 1YQSA 4DXBA 4NK3A 4QU3A 3LR5A 4PKYG 4BL2A 1NZUA 4UHUA 3IBRA 1YLTA 4R4SA 2HJEA 4F3LA 3F1PA 1K56D 3ICYA 3C4OA 5FA7A 4WLAA 4EBPA 1ESUA 3MS6A 5A91A 2HZ5A 4H6JB 4Q0IA 4EQ1A 1KGFA 3WS5A 2QHKA 2ZM8A 5FATA 4HJ6A 1YM1A 1O7EA 3PBOA 1WA9A 1DJAA 3Q7ZA 4YOFA 5F82A 1E3UD 3LIDA 5IU1A 4L0LA 1PZPA 5D3OA 1FSYA 3EOIA 4E04A 4FTXA 4MEZA 2PU4A 4P87A 1CK3A 1E25A 1P9WA 3KYZA 3UPOA 5M18A 1DY6A 3PBQA 1G68A 2JHEA 5DVAA 2DRWA 4XT2B 3B47A 3GDIA 1S67L 2PDRA 3OPRA 1DP8A 4MBHA 5FQ9A 4BLMA 1S6RA 4BBUA 5EV0A 1YLZA 3DTEA 3HLDA 1JTDA 3V39A 3BLMA 1CEGA 1VETA 4Y2FA 4JPMA 4I3AA 2HP6A 5L2FA 3IF5A 1JWZA 1NLYA 5AQ7A 2VGLM 4EQIA 3IXGA 3CUEC 3NOPC 1LL5A 2G2WA 3UNWA 1G28A 5HDSA 3FYZA 2ZQ8A 1IOUA 1ALQA 5CXWA 2RCXA 3VSKA 1H5XA 3NOTC 4LLOB 4X68A 4QY6A 1OMEA 3FPVA 1N9OA 4B4ZA 2Y8HA 3UB5P 1H8YA 2HP9A 2M7VA 3ZDJA 3LO7A 4KZ6A 5FASA 4OQ0A 4LFUA 4X1MA 3LI9A 5F83A 5L8MA 3PHYA 4D60A 4HESA 4QJGA 3LEZA 5CX7A 1Z09A 2XD1A 2GDNA 5F69A 3U4LP 5G4YA 4O8GA 2P08A 2W1TA 3UE3A 3BFFA 3IQAA 4G3WA 1ES5A 3A0VA 4G3KA 3PXPA 3G32A 5TBMA 1ZKJA 2Z6DA 4EEUA 5EECA 2OLVA 4FUWA 3TOIA 5EFWA 5HPIA 4P6ZS 5GL9A 3MQOA 4E6XA 1TDLA 1YSPA 3S7NA 4JF6A 3S22A 3KO6A 5FQQA 1TS8A 3LUQA 3LY3A 2V9AA 4OQIA 4CPKA 1RGZA 4IEDA 4N1HA 3VP3A 3W2ZA 3QNCA 1OTEA 4X1LA 4CQHA 4HI4A 3H9WA 2WYXA 4CLCE 4JXVA 5F68A 4HHDA 4O7DA 1IYSA 3ZVTA 1IEMA 1MZUA 3E98A 4WYYA 5TJJA 1BYWA 3C38A 2J7VA 3MSHA 1JWPA 2GX5A 4BD1A 4ARZB 3HLGA 2FZ0A 3G6OA 4Y5FA 3C7UA 4IUKA 1P9RA 2WADA 4S2PA 4E3MA 1KE4A 2EXAA 1GHPA 2HDUA 5HD3A 4RVAA 3LICA 4KZAA 2W27A 2LB9A 3ZNTA 5AJGA 5DTTA 2MJ6A 2B02A 3UDXA 2B5RA 4ESPA 2Y2LA 3BFEA 2ZQ9A 4HNBA 1IYOA 5KIZA 3A0SA 5IHVA 1WYBA 5CHMA 2G7UA 4K0WA 1ACFA 2BLSA 2ZBBA 4DE1A 3UMDA 1DRMA 3HLWA 5EOEA 4BENA 2VA0A 5EE8A 4PM9A 2JN7A 3DTMA 3HJKA 1MXOA 5EPHA 1XP4A 3GQZA 1TEMA 5FAQA 3T4KA 3LR3A 1OTAA 3BY9A 4EBNA 3CWFA 2J3TC 3UN7A 3CLOA 1L0DA 4FOFA 3T4QA 4C6YA 2XK1A 3TE8A 1KVMA 2V2FF 5FQKA 5IT5A 2O99A 3TJZC 2JKTM 5GLBA 4GJ4A 5EVIA 1W63Q 1D1JA 2ZQAA 4IVIA 2FFFB 3FWLA 4NKPA 3ZG8B 3EWKA 1CI9A 4OP8A 2W3HA 4ME4A 3T1QB 2PR5A 4OVDA 3NY4A 1SKOA 3D3OA 4JF4A 2ZL1B 5A8BA 4E3OA 3V50A 4LPZA 2W3DA 2ZMFA 1FR6A 4E3IA 1OJ5A 3T1RA 5L09A 1F5MA 4BBVA 1S66L 3GVBA 3L9KA 1PNEA 4FSFA 1ZC2A 1TDGA 3S7QA 3F1NA 5J4EA 2G2UA 4XUXA 2JE5A 4GZBA 4PM6A 3ULFA 4EEPA 1BT5A 3WS0A 2Z2LB 4EW7A 4GHIB 3IXHA 3KYEA 4IUHA 1Y54A 3R7WB 1ONGA 4NETA 4BL3A 4N92A 4MN7A 2V0WA 3SOIA 3NI9A 3SH7A 4KQQA 1YT4A 4F94A 5HPFA 4O01A 5HX9A 3MKEA 1GHMA 4R23A 3T12B 1FCNA 1NYYA 2HJ9C 2I9VA 4PKYA 1FQGA 2Y55A 3WS4A 1DP6A 3ZNYA 3SS3A 1G5UA 1K6SA 5U47A 3Q7VB 2Y2KA 4RA7A 2K7SA 5CECA 3RH8B 4DXCA 1BTLA 4BJPA 2WGIA 1FIKA 1DP9A 5EVLA 2AVXA 2XROA 5HD5A 1TVFA 4ZJ3A 2P04A 3ZG0A 2J8YA 4PM5A 3P7NA 3IF6B 1VEUA 4U0TA 2O0YA 3FKWA 4ZBEA 3SS4A 5DF7A 2VGJA 4KZ8A 3Q1FA 1P0ZA 1UWNX 3MZDA 1NZOA 2XD5A 1WYCA 2P9VB 3NHQA 3IWOA 4DDYA 2EFUA 4LCMA 2L4RA 1LSWA 1S1ZA 1NY0A 2JKGA 4JXSA 4X56A 1RCJA 4A5RA 1F9IA 4YFMA 4DN0A 4IBRA 4O0PA 2Z2MB 3UB8A 1OTBA 3BFGA 1MKIA 4GS9A 1V9YA 3IXDA 1PW1A 2EX9A 2Y91A 5KSCA 3HLEA 1YSQA 1L3LA 4P0MA 4QD4A 4HJ3A 3BQ8A 5CHUA 1I2WA 1FCOA 3VP2A 2EFXA 4HP9A 2ZMVA 2WAEA 3BY8A 1W7FA 5FSRA 3V5MA 3OLOA 1P97A 3GV9A 2PYPA 5CRFA 4N9KA 3S7OA 3TRCA 1M40A 3FKVA 3VOYA 3LYXA 4S2JA 4FCFA 3C2WA 3LIAA 5AQAA 5FAOA 3UPNA 3DTIA 3Q07A 2PHYA 1T1CA 4DE3A 3UE0A 4KQRA 1Q2QA 3WS1A 5A90A 1GHIA 4I3IA 5GHZA 2A2LA 4Q8IA 3FPWA 1H8ZA 1S0WA 3CPTA 1XX2A 3E4QA 4F3LB 3F1PB 2WZZA 3W4OA 2PT7A 3IX3A 4WN5A 3Q81A 2VGKA 5GLDA 3EGDC 4PPRA 3E2KA 4H8RA 5LBRA 1SZVA 2PU2A 1KE3A 3UMEA 3O87A 1PWCA 3TW8A 2W0NA 4CLCA 2VV8A 2HP5A 3IH8A 2JC7A 5K5BA 4MN5A 3IS2B 3B3XA 2JKTI 4ZJ2A 2ZC5B 1UGUA 3EEAA 1OTDA 4JXWA 4ZJ1A 4MBKA 2P74A 4HJ4A 1NJ4A 2ZJ9A 2OWJA 3PAEA 2Y2JA 5FI6A 4MBFA 3HUMA 3HBRA 3T1SA 3ITBA 2ACGA 1K54C 3MQQA 1O07A 3RXWA 3T4JA 4PM8A 2Q0OA 2V0UA 3DW0A 3G31A 1EW0A 2B18A 3S4XA 4R1GA 4NG2A 3SZTA 3HLCA 4S2OA 1RP5A 2XH9A 4Y0OA 3CI6A 1ERMA 3VE4A 2J3WA 4GDBA 3LFVA 2Y59A 3LIFA 2VEAA 3BECA 4K08A 1K55C 4WMCA 5DKKA 3NDEA 3UDIA 4S2LA 5CEDA 2V1BA 4CLCD 4P6BA 5M1AA 5DJTA 3V3SA 2O9AA 3CHWP 2H0TA 4HBUA 4K0XA 1MWTA 3LEQA 2R78A 2J9OA 4I38A 2W1TB 3GR2A 5DFYA 4XXRA 2Z6CA 3MR0A 2XLNA 3LCEA 2L0WA 5HARA 2PD8A 1W79A 3N8LA 4DRTA 1PW8A 1YLJA 3VFHA 2DMWA 2VV7A 1FILA 2Y2IA 4JGOA 5DF9A 3M2KA 2OV5A 4WL9A 3W4PA 1CJFA 3L7HA 1G6OA 1HTZA 4UQIS 5HWTA 5FL3A 5CTNA 3SH8A 3CZDA 4UEYA 2V8FA 4IJGA 4D2OA 4OOYA 3ZG7B 3QP5A 4DF6A 3LR0A 3DWZA 3MZEA 1PRQA 2Q9NA 3HREA 4X6TA 1MY8A 4NXGA 5TR7A 4ZDXA 4BWIA 4LV2A 3E4OA 2ZM0A 4OP5A 3NDGA 2W3EA 4WMCD 5G4ZA 4BBTA 1NLZA 1K57C 1LI0A 3EQUA 1XGJA 1OPXA 1K25A 2EWVA 1N4OA 3MF0A 5FEFA 4OONA 2QPNA 1MWUA 1MC0A 5A93A 2GNXA 2XSSA 3C4PA 3H7WA 2XFTA 3ZG9B 1GCEA 3T50A 4QWOA 4LV1A 4L9EA 1HD8A 4C3QA 3UO9A 5KMWA 1GA0A 2YKFA 3W4QA 2VLGA 1IFQA 2XDMA 1BLPA 2Y2PA 4EUZA 1LL8A 3MXQA 3CJMA 1LLBA 5F1GA 5HDDA 4X55A 3GSGA 5FQMA 5A92A 2WKHA 2WUQA 1TS6A 3QP6A 3E0YA 2OWHA 3NJAA 2FH5A 4EV4A 4GLQA 4P6ZM 1NRJA 5DF8A 3WRZA 3ITAA 2EX6A 4KZ4A 1ZG6A 4LRZE 3NCKA 2ZQDA 3AGDA 1EROA 1S4SA 3T4TA 1T19A 2KX6A 4WELA 3MMHA 3K2NA 3IX4A 3S1YA 3T4LA 4WEKA 3F1OA 1BSGA 4BD0A 3O5YA 3PBSA 4N9LA 5J7EA 5FI2A 3VE3A 2GZAA 5EVIB 1TD5A 4Y3IA 2QZ6A 1XXMA 3OZHA 3OC2A 1HZOA 3FC7A 1JWVA 3QP4A 1L2SA 1K54A 4RX3A 2HDQA 2H10A 3CUEA 4HBTA 2ZC3B 2X01A 1TS7A 5C5KA 3NC8A 3UY6A 4Y7PA 1EI5A 1SKFA 2K2NA 4HP4A 1QMEA 2WGWA 2FFYA 5HZHA 1PWDA 3RTYA 5F6AA 3HVFA 4E3NA 5J8XA 4M4XA 3G35A 4GHIA 2I72A 2HPBA 2QYBA 3H82A 5CGXA 4X69A 3D4FA 4KZ9A 1K55A 4JBFA 3LIEA 4OPQA 1BLSA 5DKLA 5HDCA 2A3UA 2HF6A 4ZAMA 2A24B 1XJ6A 1Y28A 4NXBA 4MCWA 5GLAA 5HW3A 1XA1A 3IBJA 2Y2HA 2UWXA 1SDNA 5EVID 5M19A 3PTEA 2M7UA 2ZMAA 5IS1A 3VSLA 2E8JA 2PYRA 4GN2A 4DJ3A 3Q7VA 3G4PA 5L07A 3DWKA 4K91A 1D06A 3T4OA 4R3BA 4PHTA 5TGFA 4GB7A 1NWZA 3DTKA 3IHBA 1C3BA 2Y79A 3ZYTA 4HOIA 3V3RA 4JGRA 4X53A 1KOUA 2EXBA 2OOLA 3QP8A 1OT9A 1LHYA 4DJ2A 5HAIA 2IWDA 2W3FA 2BASA 2HDRA 3IWIA 2O9BA 4II7A 4LCLA 1AXBA 3QP2A 1RGYA 1J9MA 1MBLA 5JYOA 1OJGA 2J9PA 2XA7S 1NYMA 1VEUB 4WUJA 5BOHA 3VV4A 3A0RA 3AGEA 5AQBA 1M6KA 1K56A 5G18A 4NXFA 2X71A 4Y17A 1BULA 3PAGA 4OOMA 4RQ9A 4N1XA 4RX2A 5HFOA 3VOZA 4JKTA 2EA9A 4OPYA 3K3DA 4KZ7A 4GNUA 1PWGA 4GD8A 3O86A 3G34A 3UE6A 5JYPA 2QMIA 3I7JA 1MWSA 4S2NC 3OPHA 3OPPA 2QJ5A 1D7EA 1KE0A 3T4SA 3WWXA 4CJNA 4R38A 1E3UA 1BLHA 3SW1A 1KDSA 4B9OA 2V1ZA 3HL9A 4Q0HA 1YMXA 4JGQA 3E4PA 2VK3A 4JXGA 4YINA 4C75A 4YWZA 3SH9A 4GS9B 3EGXC 4R70A 4WBGA 4OQGA 4P85A 4LGWA 1XPBA 1GSXA 5AQ9A 4R3JA 1CF0A 2E8IA 2ZOHA 2WAFA 4DMZA 3UB6A 3WS2A 1LI9A 4KQOA 4Y13A 3UB9A 2QWSA 3RFBA
chains in the Genus database with same CATH topology
2PAVP 1HLUP 2PRFA 4QWOA 3CHWP 1K0KA 1SZVA 2ZL1A 1J3WA 3LEQA 2JKGA 3T1XA 3NECA 1YPRA 4X1LA 1Y4OA 4X25A 5EV0A 1CQAA 2BTFP 1VETA 1VEUB 3T12B 1F2KA 1SKOB 1A0KA 3CPTB 1G5UA 1D1JA 3MSHA 1FILA 3UB5P 2JKFA 3T1QB 1CJFA 3L7HA 1FIKA 4X1MA 1SKOA 3T1SA 2ZL1B 3MS6A 2ACGA 4D60A 2E8JA 5FDSA 2HZ5A 2V8FA 1Z09A 2B95A 5EM0A 3T1RA 1PFLA 5FEGA 3U4LP 1PRQA 2PBDP 5EM1A 2VK3A 3L9KA 1PNEA 2V8CA 1VEUA 1AWIA 3NULA 4ESPA 1CF0A 3CPTA 4FUWA 3DAVA 3LGOA 1ACFA 4FTXA 5EVEA 5FEFA 1VETB 3D9YA 3KYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PAV P;  1HLU P;  2PRF A;  4QWO A;  3CHW P;  1K0K A;  1SZV A;  2ZL1 A;  1J3W A;  3LEQ A;  2JKG A;  3T1X A;  3NEC A;  1YPR A;  4X1L A;  1Y4O A;  4X25 A;  5EV0 A;  1CQA A;  2BTF P;  1VET A;  1VEU B;  3T12 B;  1F2K A;  1SKO B;  1A0K A;  3CPT B;  1G5U A;  1D1J A;  3MSH A;  1FIL A;  3UB5 P;  2JKF A;  3T1Q B;  1CJF A;  3L7H A;  1FIK A;  4X1M A;  1SKO A;  3T1S A;  2ZL1 B;  3MS6 A;  2ACG A;  4D60 A;  2E8J A;  5FDS A;  2HZ5 A;  2V8F A;  1Z09 A;  2B95 A;  5EM0 A;  3T1R A;  1PFL A;  5FEG A;  3U4L P;  1PRQ A;  2PBD P;  5EM1 A;  2VK3 A;  3L9K A;  1PNE A;  2V8C A;  1VEU A;  1AWI A;  3NUL A;  4ESP A;  1CF0 A;  3CPT A;  4FUW A;  3DAV A;  3LGO A;  1ACF A;  4FTX A;  5EVE A;  5FEF A;  1VET B;  3D9Y A;  3KYE A; 
#chains in the Genus database with same CATH topology
 1N9B A;  1G6A A;  4HIA A;  2EWW A;  3BJN A;  5FAP A;  1ESI A;  3VMA A;  4FH4 A;  4RYE A;  4NXE A;  3NEC A;  4GKU A;  3FZC A;  4H6J A;  1BUE A;  5HAP A;  1JNU A;  1KDW A;  3UPP A;  5KSH A;  4EES A;  4ETX A;  3P98 A;  1XFQ A;  2OLU A;  3ZHH A;  1F98 A;  2R9W A;  3ZGA B;  2RL3 A;  3EEH A;  3CPT B;  1E4D A;  3FV7 A;  4OLD A;  2R9X A;  4KQD A;  3KSG A;  3AGF A;  1VB6 A;  1YAX A;  5E2H A;  2JKF A;  2XA7 M;  4LRY C;  3MXS A;  2IWC A;  3IS2 A;  4XT2 A;  1ODV A;  1XGI A;  4OPR A;  5TFQ A;  2CC1 A;  5FDS A;  2WK0 A;  4UA7 A;  4EUV A;  3BYD A;  3E2L A;  3EQV A;  5EM0 A;  4CLC B;  2ZQ7 A;  5EVI C;  5CHJ A;  2WKP A;  3A3J A;  3IWQ A;  2PBD P;  3D72 A;  2ZC7 A;  4MLL A;  2J3T D;  1PYY A;  1XKZ A;  2ZOI A;  3BM6 A;  1BLC A;  4S2I A;  2W3G A;  2PR6 A;  2L1M A;  2WZX A;  2XEP A;  3PBT A;  1CI8 A;  5E2F A;  1XA7 A;  3ISG A;  1ZHH B;  3PBR A;  1VET B;  3MQ0 A;  3A3D A;  2PRF A;  4ETZ A;  4E6W A;  2WKE A;  5AVE A;  3KSF A;  2JBF A;  2OSU A;  3A3E A;  1N9N A;  2VV6 A;  4L9F A;  3T1X A;  5FQI A;  4KG2 A;  3NIA A;  4X25 A;  2XR0 A;  4WZ4 A;  5L10 A;  3UDF A;  4KUO A;  4ZRR A;  1L0F A;  3KSI A;  4I5S A;  1LL9 A;  3LI8 A;  5CGW A;  1K6R A;  1A0K A;  4Y0U A;  1IYQ A;  4QB8 A;  3HUN A;  4R6L A;  5EOO A;  3ZFZ A;  1W5D A;  2WKQ A;  1Z6F A;  3ZCZ A;  3BWL A;  3ZG5 A;  3IX8 A;  4HH2 A;  4DE2 A;  5TBM B;  1GA9 A;  4R3A A;  2NUP C;  4LEN A;  3B33 A;  2K31 A;  5I5L A;  3QHY A;  3BW6 A;  4GOG A;  3HLF A;  1OT6 A;  5FEG A;  2XF3 A;  2JKR M;  1FOF A;  1IKG A;  2V8C A;  2HV1 A;  2XFS A;  3M6H A;  3JVU A;  4UA9 A;  3MKF A;  2EX2 A;  4HQA A;  3IF6 C;  3GEC A;  1ES4 A;  4FD8 A;  4EET B;  2WKR A;  5FQJ A;  3C5A A;  2WGV A;  1L0E A;  5CTM A;  3N6I A;  3LGO A;  3CG5 A;  5DFX A;  1YLP A;  2ZC4 B;  4EER A;  4HH3 A;  1ES3 A;  4ARZ A;  2NUT C;  4S2N A;  4WZ5 C;  2W1R A;  5DTS A;  3MJQ A;  4AFI A;  1K0K A;  2J80 A;  1DJC A;  1W8Q A;  1KGE A;  1N9L A;  1Y4O A;  3K3C A;  3ZQ5 A;  4B88 A;  1FSW A;  4KEN B;  4BQM A;  2XRN A;  3C30 A;  4UAA A;  2Y2Q A;  4DE0 A;  4JF5 A;  5DJU A;  1JTG A;  3NBL A;  1VQQ A;  5CEB A;  4KZ3 A;  4MN6 A;  1XJ2 A;  4IBX A;  1UWP X;  4DKI A;  1T18 A;  3M6B A;  5J3W A;  3TSG A;  1VM1 A;  1XJ4 A;  4EXO A;  3LIB A;  2P7J A;  2DCF A;  1H8M A;  4EBL A;  4PAU A;  4E3L A;  2V1A A;  1L0G A;  3H7W B;  1ZTU A;  2ZLY A;  3OCL A;  5FI7 A;  5AVF A;  1SDE A;  4JLF A;  3NOU C;  5CGS A;  4MMN A;  1QMF A;  1S1Y A;  4QPR A;  2B95 A;  4G3V A;  2ZC6 B;  2CMN A;  4GD6 A;  4L9G A;  4Y15 A;  1WE4 A;  1K4F A;  2C6W B;  4R0Q A;  1AWI A;  5GHX A;  2QJ7 A;  3JVV A;  1HVB A;  3C8C A;  3OPL A;  4I39 A;  3VP4 A;  3BRM A;  1PI5 A;  3CAX A;  3KX0 X;  4FH2 A;  5HSQ A;  4LRX C;  4YNR A;  3P09 A;  1W63 M;  1SCW A;  3IH9 A;  2PAV P;  4I3J A;  1PZO A;  5GLC A;  3HUO A;  2ZL1 A;  1JVJ A;  1Q2P A;  4UQI M;  2WKI A;  1MPL A;  3OOV A;  3M2J A;  4Q0J A;  1I5Q A;  2H5S A;  1I2S A;  2ZD8 A;  5HAQ A;  3BFC A;  4E3K A;  1CQA A;  2X02 A;  3WRT A;  3W8K A;  3V67 A;  3N8S A;  5CER A;  3F1O B;  3OBF A;  3ZVW A;  2H0Y A;  2XGN A;  4U0X A;  2HGV A;  1ONH A;  2BG1 A;  3CIT A;  1SKO B;  3GTC A;  1NRF A;  3PYP A;  3RJU A;  1STZ A;  5DTK A;  4S2M A;  3C7V A;  4E3J A;  2KOI A;  3KYQ A;  1ERQ A;  3GMW A;  4ZTK A;  1S4R A;  2Y2O A;  2D02 A;  3KSH A;  1YKD A;  1T1A A;  3N8R A;  4CLC C;  4OQH A;  1BZA A;  1TS0 A;  1LSV A;  4PMA A;  4UA6 A;  3BEB A;  3A3F A;  3N4I A;  1H0M A;  2KDK A;  1T1B A;  4ID4 A;  1PIO A;  1K38 A;  3A3I A;  1FR1 A;  2Q9M A;  4MDZ A;  2QKP A;  3R7W A;  3F1N B;  3PR6 A;  5FDH A;  3G30 A;  1IYP A;  3JPU A;  4GCZ A;  4LV0 A;  2WGW B;  1XFN A;  5F5Y A;  3IHA A;  4KUK A;  2LB5 A;  1PFL A;  2XQZ A;  1KGG A;  2A24 A;  2DNS A;  3LR4 A;  5KZH A;  1ZG4 A;  5E43 A;  3VP0 A;  4XUZ A;  3H82 B;  1YLW A;  2V20 A;  3HLB A;  5HWV A;  4IHQ A;  3IT9 A;  2VZW A;  4HEF A;  3PBN A;  2UV0 E;  5E2E A;  4WEJ A;  1GSV A;  5E2G A;  1KVL A;  2YKH A;  1SHV A;  4DDS A;  3BQA A;  2OAQ 1;  3CMZ A;  4BMW A;  1NXY A;  4Y0T A;  4OLG A;  5F1F A;  5MC7 A;  3HCY A;  1OTI A;  1U60 A;  1PI4 A;  2IA2 A;  3Q82 A;  3R4K A;  2PBY A;  3SS5 A;  3O3V A;  5HL6 A;  1LT0 A;  3MFX A;  2Y2M A;  3S7P A;  1DJB A;  3MBZ A;  1MKM A;  3VP1 A;  2KLI A;  5HWW A;  1LSX A;  3OCN A;  4QY5 A;  3QNB A;  3FG8 A;  5I94 A;  3RXX A;  1X0O A;  2IWB A;  2VX8 A;  1XJ3 A;  4Z1W A;  3LY4 A;  4OH0 A;  3MXR A;  4LV3 A;  3BLS A;  4B4X A;  4R4R A;  2INW A;  5EUA A;  3IF6 A;  3BFD A;  1W8Y A;  4EWF A;  3UB7 A;  1F2K A;  4JGP A;  1VHM A;  4WF0 A;  2Y2G A;  3N7W A;  4OPZ A;  1H3Q A;  4WZ5 A;  4EU0 A;  4HY8 A;  4MNR A;  2VJW A;  4KG6 A;  3G2Y A;  1CEF A;  2Y4A A;  3B42 A;  2P9V A;  1MWR A;  1TF1 A;  1YLY A;  2ZQC A;  3VFF A;  3P01 A;  2PD7 A;  4WM9 A;  1K57 A;  3MFD A;  4IVK A;  2O9C A;  4GDN A;  2C5W B;  4S2K A;  2HDS A;  2EX8 A;  4OKP A;  3MZF A;  1GSW A;  4QHC A;  4B93 A;  4U3T A;  2JKR I;  5EM1 A;  1K4E A;  1IKI A;  4GW9 A;  1FCM A;  3NUL A;  1ES2 A;  2M1C A;  3DBA A;  4OOL A;  3O88 A;  4KZ5 A;  4KG5 A;  1YMS A;  2ZM2 A;  3U2A A;  5HL1 A;  5GHY A;  1V9Z A;  4NEE D;  3VOL A;  3DAV A;  5EVE A;  1EWZ A;  1IEL A;  3GRJ A;  3D9Y A;  4PM7 A;  2VKS A;  1HLU P;  2VGL S;  4M3K A;  2GJ3 A;  2OAP 1;  3UE1 A;  1J3W A;  4KZB A;  2JCH A;  3TG9 A;  1YPR A;  3HJI A;  2D01 A;  2Y2N A;  2H28 A;  4Z9Q A;  3G2Z A;  3JYI A;  2A49 A;  2BTF P;  3IXB A;  3QP1 A;  1YQS A;  4DXB A;  4NK3 A;  4QU3 A;  3LR5 A;  4PKY G;  4BL2 A;  1NZU A;  4UHU A;  3IBR A;  1YLT A;  4R4S A;  2HJE A;  4F3L A;  3F1P A;  1K56 D;  3ICY A;  3C4O A;  5FA7 A;  4WLA A;  4EBP A;  1ESU A;  3MS6 A;  5A91 A;  2HZ5 A;  4H6J B;  4Q0I A;  4EQ1 A;  1KGF A;  3WS5 A;  2QHK A;  2ZM8 A;  5FAT A;  4HJ6 A;  1YM1 A;  1O7E A;  3PBO A;  1WA9 A;  1DJA A;  3Q7Z A;  4YOF A;  5F82 A;  1E3U D;  3LID A;  5IU1 A;  4L0L A;  1PZP A;  5D3O A;  1FSY A;  3EOI A;  4E04 A;  4FTX A;  4MEZ A;  2PU4 A;  4P87 A;  1CK3 A;  1E25 A;  1P9W A;  3KYZ A;  3UPO A;  5M18 A;  1DY6 A;  3PBQ A;  1G68 A;  2JHE A;  5DVA A;  2DRW A;  4XT2 B;  3B47 A;  3GDI A;  1S67 L;  2PDR A;  3OPR A;  1DP8 A;  4MBH A;  5FQ9 A;  4BLM A;  1S6R A;  4BBU A;  5EV0 A;  1YLZ A;  3DTE A;  3HLD A;  1JTD A;  3V39 A;  3BLM A;  1CEG A;  1VET A;  4Y2F A;  4JPM A;  4I3A A;  2HP6 A;  5L2F A;  3IF5 A;  1JWZ A;  1NLY A;  5AQ7 A;  2VGL M;  4EQI A;  3IXG A;  3CUE C;  3NOP C;  1LL5 A;  2G2W A;  3UNW A;  1G28 A;  5HDS A;  3FYZ A;  2ZQ8 A;  1IOU A;  1ALQ A;  5CXW A;  2RCX A;  3VSK A;  1H5X A;  3NOT C;  4LLO B;  4X68 A;  4QY6 A;  1OME A;  3FPV A;  1N9O A;  4B4Z A;  2Y8H A;  3UB5 P;  1H8Y A;  2HP9 A;  2M7V A;  3ZDJ A;  3LO7 A;  4KZ6 A;  5FAS A;  4OQ0 A;  4LFU A;  4X1M A;  3LI9 A;  5F83 A;  5L8M A;  3PHY A;  4D60 A;  4HES A;  4QJG A;  3LEZ A;  5CX7 A;  1Z09 A;  2XD1 A;  2GDN A;  5F69 A;  3U4L P;  5G4Y A;  4O8G A;  2P08 A;  2W1T A;  3UE3 A;  3BFF A;  3IQA A;  4G3W A;  1ES5 A;  3A0V A;  4G3K A;  3PXP A;  3G32 A;  5TBM A;  1ZKJ A;  2Z6D A;  4EEU A;  5EEC A;  2OLV A;  4FUW A;  3TOI A;  5EFW A;  5HPI A;  4P6Z S;  5GL9 A;  3MQO A;  4E6X A;  1TDL A;  1YSP A;  3S7N A;  4JF6 A;  3S22 A;  3KO6 A;  5FQQ A;  1TS8 A;  3LUQ A;  3LY3 A;  2V9A A;  4OQI A;  4CPK A;  1RGZ A;  4IED A;  4N1H A;  3VP3 A;  3W2Z A;  3QNC A;  1OTE A;  4X1L A;  4CQH A;  4HI4 A;  3H9W A;  2WYX A;  4CLC E;  4JXV A;  5F68 A;  4HHD A;  4O7D A;  1IYS A;  3ZVT A;  1IEM A;  1MZU A;  3E98 A;  4WYY A;  5TJJ A;  1BYW A;  3C38 A;  2J7V A;  3MSH A;  1JWP A;  2GX5 A;  4BD1 A;  4ARZ B;  3HLG A;  2FZ0 A;  3G6O A;  4Y5F A;  3C7U A;  4IUK A;  1P9R A;  2WAD A;  4S2P A;  4E3M A;  1KE4 A;  2EXA A;  1GHP A;  2HDU A;  5HD3 A;  4RVA A;  3LIC A;  4KZA A;  2W27 A;  2LB9 A;  3ZNT A;  5AJG A;  5DTT A;  2MJ6 A;  2B02 A;  3UDX A;  2B5R A;  4ESP A;  2Y2L A;  3BFE A;  2ZQ9 A;  4HNB A;  1IYO A;  5KIZ A;  3A0S A;  5IHV A;  1WYB A;  5CHM A;  2G7U A;  4K0W A;  1ACF A;  2BLS A;  2ZBB A;  4DE1 A;  3UMD A;  1DRM A;  3HLW A;  5EOE A;  4BEN A;  2VA0 A;  5EE8 A;  4PM9 A;  2JN7 A;  3DTM A;  3HJK A;  1MXO A;  5EPH A;  1XP4 A;  3GQZ A;  1TEM A;  5FAQ A;  3T4K A;  3LR3 A;  1OTA A;  3BY9 A;  4EBN A;  3CWF A;  2J3T C;  3UN7 A;  3CLO A;  1L0D A;  4FOF A;  3T4Q A;  4C6Y A;  2XK1 A;  3TE8 A;  1KVM A;  2V2F F;  5FQK A;  5IT5 A;  2O99 A;  3TJZ C;  2JKT M;  5GLB A;  4GJ4 A;  5EVI A;  1W63 Q;  1D1J A;  2ZQA A;  4IVI A;  2FFF B;  3FWL A;  4NKP A;  3ZG8 B;  3EWK A;  1CI9 A;  4OP8 A;  2W3H A;  4ME4 A;  3T1Q B;  2PR5 A;  4OVD A;  3NY4 A;  1SKO A;  3D3O A;  4JF4 A;  2ZL1 B;  5A8B A;  4E3O A;  3V50 A;  4LPZ A;  2W3D A;  2ZMF A;  1FR6 A;  4E3I A;  1OJ5 A;  3T1R A;  5L09 A;  1F5M A;  4BBV A;  1S66 L;  3GVB A;  3L9K A;  1PNE A;  4FSF A;  1ZC2 A;  1TDG A;  3S7Q A;  3F1N A;  5J4E A;  2G2U A;  4XUX A;  2JE5 A;  4GZB A;  4PM6 A;  3ULF A;  4EEP A;  1BT5 A;  3WS0 A;  2Z2L B;  4EW7 A;  4GHI B;  3IXH A;  3KYE A;  4IUH A;  1Y54 A;  3R7W B;  1ONG A;  4NET A;  4BL3 A;  4N92 A;  4MN7 A;  2V0W A;  3SOI A;  3NI9 A;  3SH7 A;  4KQQ A;  1YT4 A;  4F94 A;  5HPF A;  4O01 A;  5HX9 A;  3MKE A;  1GHM A;  4R23 A;  3T12 B;  1FCN A;  1NYY A;  2HJ9 C;  2I9V A;  4PKY A;  1FQG A;  2Y55 A;  3WS4 A;  1DP6 A;  3ZNY A;  3SS3 A;  1G5U A;  1K6S A;  5U47 A;  3Q7V B;  2Y2K A;  4RA7 A;  2K7S A;  5CEC A;  3RH8 B;  4DXC A;  1BTL A;  4BJP A;  2WGI A;  1FIK A;  1DP9 A;  5EVL A;  2AVX A;  2XRO A;  5HD5 A;  1TVF A;  4ZJ3 A;  2P04 A;  3ZG0 A;  2J8Y A;  4PM5 A;  3P7N A;  3IF6 B;  1VEU A;  4U0T A;  2O0Y A;  3FKW A;  4ZBE A;  3SS4 A;  5DF7 A;  2VGJ A;  4KZ8 A;  3Q1F A;  1P0Z A;  1UWN X;  3MZD A;  1NZO A;  2XD5 A;  1WYC A;  2P9V B;  3NHQ A;  3IWO A;  4DDY A;  2EFU A;  4LCM A;  2L4R A;  1LSW A;  1S1Z A;  1NY0 A;  2JKG A;  4JXS A;  4X56 A;  1RCJ A;  4A5R A;  1F9I A;  4YFM A;  4DN0 A;  4IBR A;  4O0P A;  2Z2M B;  3UB8 A;  1OTB A;  3BFG A;  1MKI A;  4GS9 A;  1V9Y A;  3IXD A;  1PW1 A;  2EX9 A;  2Y91 A;  5KSC A;  3HLE A;  1YSQ A;  1L3L A;  4P0M A;  4QD4 A;  4HJ3 A;  3BQ8 A;  5CHU A;  1I2W A;  1FCO A;  3VP2 A;  2EFX A;  4HP9 A;  2ZMV A;  2WAE A;  3BY8 A;  1W7F A;  5FSR A;  3V5M A;  3OLO A;  1P97 A;  3GV9 A;  2PYP A;  5CRF A;  4N9K A;  3S7O A;  3TRC A;  1M40 A;  3FKV A;  3VOY A;  3LYX A;  4S2J A;  4FCF A;  3C2W A;  3LIA A;  5AQA A;  5FAO A;  3UPN A;  3DTI A;  3Q07 A;  2PHY A;  1T1C A;  4DE3 A;  3UE0 A;  4KQR A;  1Q2Q A;  3WS1 A;  5A90 A;  1GHI A;  4I3I A;  5GHZ A;  2A2L A;  4Q8I A;  3FPW A;  1H8Z A;  1S0W A;  3CPT A;  1XX2 A;  3E4Q A;  4F3L B;  3F1P B;  2WZZ A;  3W4O A;  2PT7 A;  3IX3 A;  4WN5 A;  3Q81 A;  2VGK A;  5GLD A;  3EGD C;  4PPR A;  3E2K A;  4H8R A;  5LBR A;  1SZV A;  2PU2 A;  1KE3 A;  3UME A;  3O87 A;  1PWC A;  3TW8 A;  2W0N A;  4CLC A;  2VV8 A;  2HP5 A;  3IH8 A;  2JC7 A;  5K5B A;  4MN5 A;  3IS2 B;  3B3X A;  2JKT I;  4ZJ2 A;  2ZC5 B;  1UGU A;  3EEA A;  1OTD A;  4JXW A;  4ZJ1 A;  4MBK A;  2P74 A;  4HJ4 A;  1NJ4 A;  2ZJ9 A;  2OWJ A;  3PAE A;  2Y2J A;  5FI6 A;  4MBF A;  3HUM A;  3HBR A;  3T1S A;  3ITB A;  2ACG A;  1K54 C;  3MQQ A;  1O07 A;  3RXW A;  3T4J A;  4PM8 A;  2Q0O A;  2V0U A;  3DW0 A;  3G31 A;  1EW0 A;  2B18 A;  3S4X A;  4R1G A;  4NG2 A;  3SZT A;  3HLC A;  4S2O A;  1RP5 A;  2XH9 A;  4Y0O A;  3CI6 A;  1ERM A;  3VE4 A;  2J3W A;  4GDB A;  3LFV A;  2Y59 A;  3LIF A;  2VEA A;  3BEC A;  4K08 A;  1K55 C;  4WMC A;  5DKK A;  3NDE A;  3UDI A;  4S2L A;  5CED A;  2V1B A;  4CLC D;  4P6B A;  5M1A A;  5DJT A;  3V3S A;  2O9A A;  3CHW P;  2H0T A;  4HBU A;  4K0X A;  1MWT A;  3LEQ A;  2R78 A;  2J9O A;  4I38 A;  2W1T B;  3GR2 A;  5DFY A;  4XXR A;  2Z6C A;  3MR0 A;  2XLN A;  3LCE A;  2L0W A;  5HAR A;  2PD8 A;  1W79 A;  3N8L A;  4DRT A;  1PW8 A;  1YLJ A;  3VFH A;  2DMW A;  2VV7 A;  1FIL A;  2Y2I A;  4JGO A;  5DF9 A;  3M2K A;  2OV5 A;  4WL9 A;  3W4P A;  1CJF A;  3L7H A;  1G6O A;  1HTZ A;  4UQI S;  5HWT A;  5FL3 A;  5CTN A;  3SH8 A;  3CZD A;  4UEY A;  2V8F A;  4IJG A;  4D2O A;  4OOY A;  3ZG7 B;  3QP5 A;  4DF6 A;  3LR0 A;  3DWZ A;  3MZE A;  1PRQ A;  2Q9N A;  3HRE A;  4X6T A;  1MY8 A;  4NXG A;  5TR7 A;  4ZDX A;  4BWI A;  4LV2 A;  3E4O A;  2ZM0 A;  4OP5 A;  3NDG A;  2W3E A;  4WMC D;  5G4Z A;  4BBT A;  1NLZ A;  1K57 C;  1LI0 A;  3EQU A;  1XGJ A;  1OPX A;  1K25 A;  2EWV A;  1N4O A;  3MF0 A;  5FEF A;  4OON A;  2QPN A;  1MWU A;  1MC0 A;  5A93 A;  2GNX A;  2XSS A;  3C4P A;  3H7W A;  2XFT A;  3ZG9 B;  1GCE A;  3T50 A;  4QWO A;  4LV1 A;  4L9E A;  1HD8 A;  4C3Q A;  3UO9 A;  5KMW A;  1GA0 A;  2YKF A;  3W4Q A;  2VLG A;  1IFQ A;  2XDM A;  1BLP A;  2Y2P A;  4EUZ A;  1LL8 A;  3MXQ A;  3CJM A;  1LLB A;  5F1G A;  5HDD A;  4X55 A;  3GSG A;  5FQM A;  5A92 A;  2WKH A;  2WUQ A;  1TS6 A;  3QP6 A;  3E0Y A;  2OWH A;  3NJA A;  2FH5 A;  4EV4 A;  4GLQ A;  4P6Z M;  1NRJ A;  5DF8 A;  3WRZ A;  3ITA A;  2EX6 A;  4KZ4 A;  1ZG6 A;  4LRZ E;  3NCK A;  2ZQD A;  3AGD A;  1ERO A;  1S4S A;  3T4T A;  1T19 A;  2KX6 A;  4WEL A;  3MMH A;  3K2N A;  3IX4 A;  3S1Y A;  3T4L A;  4WEK A;  3F1O A;  1BSG A;  4BD0 A;  3O5Y A;  3PBS A;  4N9L A;  5J7E A;  5FI2 A;  3VE3 A;  2GZA A;  5EVI B;  1TD5 A;  4Y3I A;  2QZ6 A;  1XXM A;  3OZH A;  3OC2 A;  1HZO A;  3FC7 A;  1JWV A;  3QP4 A;  1L2S A;  1K54 A;  4RX3 A;  2HDQ A;  2H10 A;  3CUE A;  4HBT A;  2ZC3 B;  2X01 A;  1TS7 A;  5C5K A;  3NC8 A;  3UY6 A;  4Y7P A;  1EI5 A;  1SKF A;  2K2N A;  4HP4 A;  1QME A;  2WGW A;  2FFY A;  5HZH A;  1PWD A;  3RTY A;  5F6A A;  3HVF A;  4E3N A;  5J8X A;  4M4X A;  3G35 A;  4GHI A;  2I72 A;  2HPB A;  2QYB A;  3H82 A;  5CGX A;  4X69 A;  3D4F A;  4KZ9 A;  1K55 A;  4JBF A;  3LIE A;  4OPQ A;  1BLS A;  5DKL A;  5HDC A;  2A3U A;  2HF6 A;  4ZAM A;  2A24 B;  1XJ6 A;  1Y28 A;  4NXB A;  4MCW A;  5GLA A;  5HW3 A;  1XA1 A;  3IBJ A;  2Y2H A;  2UWX A;  1SDN A;  5EVI D;  5M19 A;  3PTE A;  2M7U A;  2ZMA A;  5IS1 A;  3VSL A;  2E8J A;  2PYR A;  4GN2 A;  4DJ3 A;  3Q7V A;  3G4P A;  5L07 A;  3DWK A;  4K91 A;  1D06 A;  3T4O A;  4R3B A;  4PHT A;  5TGF A;  4GB7 A;  1NWZ A;  3DTK A;  3IHB A;  1C3B A;  2Y79 A;  3ZYT A;  4HOI A;  3V3R A;  4JGR A;  4X53 A;  1KOU A;  2EXB A;  2OOL A;  3QP8 A;  1OT9 A;  1LHY A;  4DJ2 A;  5HAI A;  2IWD A;  2W3F A;  2BAS A;  2HDR A;  3IWI A;  2O9B A;  4II7 A;  4LCL A;  1AXB A;  3QP2 A;  1RGY A;  1J9M A;  1MBL A;  5JYO A;  1OJG A;  2J9P A;  2XA7 S;  1NYM A;  1VEU B;  4WUJ A;  5BOH A;  3VV4 A;  3A0R A;  3AGE A;  5AQB A;  1M6K A;  1K56 A;  5G18 A;  4NXF A;  2X71 A;  4Y17 A;  1BUL A;  3PAG A;  4OOM A;  4RQ9 A;  4N1X A;  4RX2 A;  5HFO A;  3VOZ A;  4JKT A;  2EA9 A;  4OPY A;  3K3D A;  4KZ7 A;  4GNU A;  1PWG A;  4GD8 A;  3O86 A;  3G34 A;  3UE6 A;  5JYP A;  2QMI A;  3I7J A;  1MWS A;  4S2N C;  3OPH A;  3OPP A;  2QJ5 A;  1D7E A;  1KE0 A;  3T4S A;  3WWX A;  4CJN A;  4R38 A;  1E3U A;  1BLH A;  3SW1 A;  1KDS A;  4B9O A;  2V1Z A;  3HL9 A;  4Q0H A;  1YMX A;  4JGQ A;  3E4P A;  2VK3 A;  4JXG A;  4YIN A;  4C75 A;  4YWZ A;  3SH9 A;  4GS9 B;  3EGX C;  4R70 A;  4WBG A;  4OQG A;  4P85 A;  4LGW A;  1XPB A;  1GSX A;  5AQ9 A;  4R3J A;  1CF0 A;  2E8I A;  2ZOH A;  2WAF A;  4DMZ A;  3UB6 A;  3WS2 A;  1LI9 A;  4KQO A;  4Y13 A;  3UB9 A;  2QWS A;  3RFB A; 
#chains in the Genus database with same CATH homology
 2PAV P;  1HLU P;  2PRF A;  4QWO A;  3CHW P;  1K0K A;  1SZV A;  2ZL1 A;  1J3W A;  3LEQ A;  2JKG A;  3T1X A;  3NEC A;  1YPR A;  4X1L A;  1Y4O A;  4X25 A;  5EV0 A;  1CQA A;  2BTF P;  1VET A;  1VEU B;  3T12 B;  1F2K A;  1SKO B;  1A0K A;  3CPT B;  1G5U A;  1D1J A;  3MSH A;  1FIL A;  3UB5 P;  2JKF A;  3T1Q B;  1CJF A;  3L7H A;  1FIK A;  4X1M A;  1SKO A;  3T1S A;  2ZL1 B;  3MS6 A;  2ACG A;  4D60 A;  2E8J A;  5FDS A;  2HZ5 A;  2V8F A;  1Z09 A;  2B95 A;  5EM0 A;  3T1R A;  1PFL A;  5FEG A;  3U4L P;  1PRQ A;  2PBD P;  5EM1 A;  2VK3 A;  3L9K A;  1PNE A;  2V8C A;  1VEU A;  1AWI A;  3NUL A;  4ESP A;  1CF0 A;  3CPT A;  4FUW A;  3DAV A;  3LGO A;  1ACF A;  4FTX A;  5EVE A;  5FEF A;  1VET B;  3D9Y A;  3KYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...