2VK3A

Crystal structure of rat profilin 2a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
142
structure length
142
Chain Sequence
GSMAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPAEIDVIIGKDREGFFTNGLTLGGKKCSVIRDSLYVDSDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords PROFILIN-2
publication title Structure, Modifications and Ligand-Binding Properties of Rat Profilin 2A.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 46
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2vk3A00
3L7HA 2JKFA 1K0KA 5EM1A 1D1JA 2ZL1B 1PRQA 2E8JA 5FEFA 2PRFA 1FILA 4QWOA 3T1RA 3MSHA 3T1QB 3T1SA 3U4LP 1CQAA 5EVEA 1PNEA 3NECA 4D60A 1J3WA 5EM0A 3DAVA 1SZVA 3NULA 3LEQA 3D9YA 5FDSA 2PAVP 1AWIA 2V8CA 1VEUA 3MS6A 4ESPA 4X1LA 4FUWA 3CPTA 3LGOA 1HLUP 1G5UA 1Z09A 3CHWP 3T1XA 4X1MA 1CF0A 2B95A 2JKGA 1FIKA 1CJFA 3CPTB 1ACFA 5FEGA 2V8FA 3T12B 1F2KA 1YPRA 2ZL1A 4X25A 1SKOA 2ACGA 2HZ5A 1VEUB 1PFLA 1SKOB 2BTFP 5EV0A 3KYEA 1VETA 1Y4OA 1A0KA 2PBDP 3L9KA 1VETB 3UB5P 2VK3A 4FTXA
chains in the Genus database with same CATH superfamily
3IWIA 5DKLA 1XXMA 1UGUA 2C6WB 4DE2A 4GD8A 5J8XA 3OPHA 4G3VA 4PPRA 3BY9A 1PI4A 3EOIA 4ZJ2A 3H82B 2K2NA 1L3LA 2ZQ8A 2XDMA 3EGDC 4BWIA 2XROA 4LPZA 4R0QA 4IEDA 2PYPA 3VOLA 5J4EA 4EV4A 1OTBA 2VEAA 2WKRA 3T4LA 1H8ZA 4KZ8A 4UEYA 2IA2A 4GJ4A 2W1TB 2ZQ7A 3MJQA 3R7WB 3NY4A 4X6TA 3DTMA 4E6XA 4KZ4A 5HX9A 4JKTA 4GD6A 3IF6A 3NI9A 3ZG9B 2JKRM 2Y2JA 5LBRA 1CI9A 4RX2A 3CPTB 2XA7M 1E25A 2ZBBA 5HAPA 2ZM0A 1FCOA 1YPRA 1VHMA 4Z9QA 3O5YA 5L10A 3ZYTA 3BYDA 4X25A 3O88A 4HEFA 3A3FA 3MXRA 2A3UA 4OPRA 3ZHHA 2XD1A 2VGLM 1NZOA 5CGXA 3RJUA 2D02A 4KZ7A 4RA7A 2WKPA 5U47A 5EV0A 5M1AA 3KSHA 1CEGA 1NY0A 3W4QA 5HARA 4EU0A 4JBFA 2V1ZA 3PBQA 1G28A 4UQIS 3KSGA 4WZ4A 1VETB 3W8KA 3MXSA 2EWVA 1K57C 4QD4A 5EE8A 2V1BA 5C5KA 1T1AA 4UHUA 4E6WA 1Z6FA 3ZCZA 2DCFA 2H5SA 2ZQAA 1OMEA 3V3SA 4OKPA 5FQ9A 3EWKA 1UWNX 4X53A 3UB7A 5E2EA 1NLZA 2UWXA 2WGIA 3HJIA 1PNEA 2Y2PA 3BLSA 5AQBA 1GCEA 4IBXA 4D60A 2ZC5B 3NULA 3FPVA 3UPOA 3GMWA 3M6HA 4Y0TA 3PBRA 4GKUA 1N9BA 4WM9A 2A2LA 3Q1FA 4I38A 3JVVA 2OOLA 3CHWP 1FCMA 3BRMA 5CGSA 3HUOA 3O87A 1BSGA 2D01A 5DVAA 1FIKA 4NEED 4EBPA 1L0DA 3G30A 4BMWA 2RCXA 4XT2B 3QP4A 3S7QA 4Q0HA 3E98A 1H5XA 1SKOA 1W63M 2Z2LB 4BLMA 1IKGA 1TS8A 5BOHA 1EROA 1HD8A 2P7JA 1K4EA 2JKTI 2G7UA 2JKRI 4HY8A 2J80A 3V3RA 4KZAA 4P85A 4KQQA 2GZAA 3CZDA 1L0GA 2WGVA 3ZGAB 4R6LA 3UB5P 3ZG5A 1DJCA 3FZCA 1FR1A 1TD5A 4S2PA 2WZXA 5GLDA 2YKFA 1E3UA 2XEPA 3MXQA 5AJGA 3IBJA 1G6AA 2OWHA 5K5BA 2Y91A 5MC7A 3WS2A 2Y4AA 4KZ6A 4FCFA 4WL9A 4MBHA 4ETZA 5GL9A 1ZG6A 1GA0A 4UAAA 3PXPA 1HZOA 4FOFA 2HV1A 5EM0A 4LGWA 3DWKA 4H6JA 4I5SA 1BULA 1Q2PA 1VEUA 4K91A 3IS2B 1W63Q 1RGZA 2PBYA 2A24A 3EGXC 3W4PA 3IHAA 4BBTA 2C5WB 1ACFA 4R23A 3WRTA 3FKWA 1CK3A 5HDDA 3MZEA 4BJPA 4OP8A 5FL3A 1OTEA 3N7WA 3BLMA 2J3WA 2KLIA 2P04A 5F6AA 4I3AA 4Y3IA 3V39A 5HDSA 5F1FA 1EW0A 3AGFA 4KZ5A 3FWLA 3EQUA 2L1MA 4FTXA 1MWRA 1GHMA 4JLFA 2QYBA 4BD0A 3A3EA 4OP5A 1T18A 3N4IA 3SOIA 1W5DA 1GSWA 4HIAA 4LRZE 2ZLYA 2QKPA 5AQ9A 3T1QB 3NBLA 2CMNA 1PW8A 2EXAA 4FSFA 1OTAA 3ICYA 4EBLA 1JNUA 5D3OA 4P87A 2W3GA 2W27A 1AXBA 2ZC3B 3VOZA 1WYBA 3LICA 3C8CA 5FAQA 3PBTA 2GX5A 1H3QA 3UY6A 3M6BA 4OVDA 3VE3A 1O07A 3ITAA 4GDNA 4WF0A 4P6ZS 4HOIA 3HVFA 1TDLA 1LL8A 1YM1A 1OT9A 2XFSA 3MKEA 4DF6A 2WKIA 4OONA 1IFQA 1SHVA 4YFMA 1LL5A 4ZBEA 2OAQ1 1T1CA 3V50A 3MKFA 3E2KA 3UDFA 1C3BA 2R9XA 3MBZA 3CWFA 4DDSA 5KZHA 3E4QA 1IELA 5EFWA 3S1YA 2LB5A 3UB8A 3LFVA 3L9KA 2XK1A 4IVKA 3T4TA 2HPBA 3IF5A 4HP4A 3R4KA 5DJUA 4BL2A 1LSWA 4IBRA 4KZBA 2H28A 1YLTA 1K0KA 1XFNA 5EM1A 2G2UA 1UWPX 4QJGA 1K54C 4G3WA 2VGJA 4JGPA 3GVBA 4BENA 3HLDA 1NXYA 4X56A 2M1CA 3IWQA 5KSHA 3EEAA 3H7WB 2M7UA 3T1SA 3NECA 2V2FF 4ZJ1A 1J3WA 3SS3A 1SZVA 2PAVP 3IXGA 2WGWA 2VV8A 3OZHA 1VB6A 5EVIA 1W7FA 3S7PA 3BECA 4JGQA 1KOUA 1CF0A 3NDEA 3GRJA 2B95A 1NWZA 2PU4A 3VSLA 3QP5A 1CJFA 1XA1A 2O9CA 5DF8A 3RFBA 1SDNA 1T19A 5AVFA 3VP1A 4OQHA 3G2YA 2Z6CA 2RL3A 3IBRA 5HD3A 2VKSA 4XXRA 4Q8IA 4Y13A 3T4JA 4G3KA 2HP6A 3P98A 2Y2KA 1EI5A 1LLBA 1PFLA 1O7EA 3KO6A 1U60A 1LL9A 3HCYA 1OTDA 4IUKA 1N9LA 4PAUA 1FR6A 2HDRA 2XA7S 3MZDA 2EWWA 4WN5A 3HLFA 4OQIA 3U2AA 4N9KA 5CTNA 3BFDA 1YLYA 2MJ6A 2JHEA 3VP0A 2OSUA 1OTIA 4HJ6A 2VGLS 5TR7A 4UA6A 5TGFA 3UE6A 1K55A 5HSQA 3IWOA 3MMHA 3DTIA 1KGFA 5E2HA 5CXWA 1MWSA 4DN0A 4R4RA 3K3CA 1WA9A 1YAXA 1BYWA 4JPMA 4HJ4A 3G32A 3DWZA 3ZG7B 5FQKA 4B88A 1S4RA 2W1RA 3W2ZA 4DMZA 4WYYA 4S2LA 1PWDA 3WRZA 3W4OA 3ISGA 3A0SA 3LIDA 3T1XA 2WYXA 4U3TA 1H0MA 2XGNA 3MF0A 3UMEA 3V67A 1SKFA 2WZZA 5EOOA 1G6OA 5HFOA 5IHVA 4JXWA 4E3NA 5HL1A 4M3KA 4II7A 1ES2A 3A3DA 2VLGA 2ZMAA 1LI0A 2JBFA 4R1GA 1TS7A 2J3TD 5TFQA 4Q0JA 4S2NA 4KQOA 3FPWA 3KSIA 1P0ZA 5AQ7A 1H8MA 3FG8A 1SKOB 1TEMA 2L0WA 4S2NC 4R4SA 3IF6C 4B9OA 2YKHA 5M19A 3KX0X 4KZ9A 3SH8A 5IS1A 2Y2HA 3LR0A 4OH0A 1E3UD 1XGIA 1M6KA 1YT4A 1F98A 1ALQA 3LY3A 5FAOA 4B4XA 4KG5A 3HLWA 1T1BA 1YLZA 5DFXA 3PTEA 3F1OA 4HH3A 5FATA 3Q82A 5FI7A 4X68A 3SW1A 4HESA 4MEZA 1VQQA 3C5AA 4WZ5A 4JXSA 4EW7A 2XFTA 3FYZA 3UNWA 1EWZA 1TS0A 3F1PA 4OOLA 4IUHA 2DMWA 3NOUC 3HLEA 1YLJA 3ZVWA 4LRYC 3VFHA 5DKKA 4CLCA 5A93A 2V8CA 3IHBA 4EEPA 1N9NA 1Y54A 1IEMA 2Y2QA 1K56A 4X1LA 3ZFZA 5JYPA 4FUWA 3WS5A 4E3JA 4H6JB 4D2OA 5KIZA 3UPNA 4KZ3A 4DXCA 5CERA 5CEDA 2QPNA 1KDSA 3MQOA 3PAGA 4E3IA 4HBUA 2X71A 1GHIA 2A24B 2W3HA 4S2OA 4Q0IA 4K0XA 2V8FA 2FFFB 3C4PA 1MWUA 3MQ0A 1XPBA 1TDGA 4WBGA 5G4ZA 2W3DA 4EWFA 1NRFA 3SH7A 4ZRRA 2OLVA 1MPLA 3UPPA 5DTKA 2HF6A 3TG9A 1W8YA 2ZQ9A 3C38A 2FFYA 5A92A 2HJEA 2Q0OA 4S2MA 1JWPA 3HBRA 4KQDA 1YKDA 3F1NB 1IYQA 5L2FA 1DJBA 4N92A 3HLBA 5F5YA 4MNRA 4PKYG 2W1TA 3R7WA 4HI4A 1BTLA 3S7NA 4JGOA 2KOIA 4CLCE 3HUMA 3E4OA 1DRMA 3ZDJA 2J3TC 2V0UA 3MSHA 5F82A 2B5RA 4RX3A 1PZPA 5EVEA 4OLGA 3VP2A 4JGRA 5HL6A 2P9VA 2BG1A 3P09A 1PIOA 1DP9A 1BLCA 3PAEA 2IWCA 2Y2IA 4Y0OA 4PM8A 2ZOIA 3WWXA 4ESPA 4S2IA 4Y5FA 4X55A 1TF1A 3QP2A 2P74A 2K7SA 4KG2A 4OOMA 3GV9A 5FI2A 4O7DA 2J8YA 2WKQA 4WELA 4GOGA 5FEGA 1QMFA 2E8IA 4U0XA 2WKHA 3O3VA 2EA9A 2XRNA 2ZC6B 4LV3A 3SS4A 2ZMFA 5J7EA 3OBFA 2A49A 3UB6A 1ONGA 1Q2QA 1BZAA 1IKIA 3BY8A 3Q7VA 3LR3A 4KENB 4L9GA 5L09A 5DFYA 1XJ6A 1MZUA 2Q9MA 3GSGA 3DTKA 2EX6A 4OQ0A 3C30A 4LRXC 1BUEA 2PD7A 4IJGA 5FI6A 4LV1A 4MMNA 4OPYA 3FV7A 5EOEA 4BL3A 1KVLA 4OPQA 5GLBA 1PRQA 2HGVA 4R3JA 5DJTA 2VV6A 2QJ5A 5GHZA 4NXGA 2GJ3A 3UMDA 4R38A 3MFDA 4BQMA 4N9LA 3O86A 1ZG4A 3AGDA 3GTCA 3MR0A 3OC2A 4XT2A 4JF6A 1IOUA 2Z2MB 5HAIA 2O99A 3LEQA 4GZBA 2XF3A 2Z6DA 3LIBA 4GHIB 4Y17A 5EVID 3CAXA 5EECA 3UE1A 4R3AA 1P97A 3NOPC 3NC8A 4PM7A 4ID4A 5CHMA 3PHYA 2OV5A 3LYXA 3T4QA 1DP6A 2HDUA 4EUVA 4L9EA 5A8BA 3T12B 3QNBA 4CQHA 2W3EA 4GDBA 3OPRA 2H0YA 3IXBA 1IYPA 4GW9A 3RXWA 3ZG0A 4EESA 1KE0A 2PDRA 4WEKA 4CPKA 3QP6A 1IYOA 3CUEA 2JE5A 5GHYA 2BASA 2QHKA 2Y2NA 3A0VA 4WMCA 3PBOA 4K08A 3BW6A 3CUEC 1FOFA 2ZM2A 3Q7ZA 2NUPC 3LIEA 1S66L 4RVAA 3BFEA 3BM6A 4O0PA 1D1JA 2ZL1B 4U0TA 3CJMA 1Y28A 1K6SA 1W79A 3B3XA 2E8JA 3DBAA 1ZKJA 3HLCA 5CECA 1NRJA 1HVBA 2VGKA 5CEBA 1SCWA 4P6BA 1FQGA 5HWTA 3ITBA 4OOYA 2K31A 5F68A 1FSWA 3BEBA 4ZAMA 1CI8A 3TSGA 3I7JA 4Y0UA 2XQZA 4HHDA 1ESUA 1V9ZA 5A91A 2DRWA 1MWTA 2GNXA 4F3LA 3QP1A 2VA0A 4ZJ3A 5GLAA 1ES5A 2HDQA 1N9OA 5HPFA 3LGOA 1KDWA 2XH9A 4B4ZA 2AVXA 4X1MA 3S7OA 4RQ9A 3A0RA 1STZA 3HUNA 3A3IA 4GS9A 1BT5A 3LO7A 5DF9A 3IT9A 3G34A 5DTTA 5FQQA 1IYSA 4FH4A 3ZQ5A 2I9VA 5TJJA 5I94A 4JXGA 3V5MA 3RXXA 4GCZA 2IWDA 1GSXA 2PR5A 3BFGA 3VP4A 2L4RA 5EVIC 2VV7A 3KYEA 2XR0A 1Y4OA 5CX7A 4ARZA 1LI9A 5FASA 3VMAA 3IF6B 1S1ZA 3T50A 2EX2A 1MKMA 4PHTA 3SS5A 3E0YA 1XJ2A 3G4PA 5FEFA 1RCJA 2ZQCA 2O9AA 4MN7A 4I39A 4EETB 2XD5A 4E04A 5TBMA 1YMXA 3VSKA 4E3MA 2JC7A 3BWLA 3HREA 4NK3A 2PT7A 3DAVA 4CLCD 3HLGA 4BBVA 4LENA 2ZM8A 1K56D 3C2WA 3G31A 2JCHA 1D06A 3PR6A 2Y2MA 4I3IA 4JXVA 4QY5A 5JYOA 4DKIA 1W8QA 4CLCB 3QNCA 1K55C 2V1AA 4GLQA 2V0WA 4C3QA 3T4SA 3RTYA 3UE0A 3G35A 3IH8A 3S4XA 4OPZA 1V9YA 3JYIA 1TVFA 3D3OA 4R70A 2WKEA 3CITA 1L0FA 1KGGA 3BQAA 3LCEA 1JTDA 4MN5A 3LI8A 1GHPA 2VZWA 1LSVA 3H7WA 4OQGA 5HPIA 4L0LA 1I2WA 2EX8A 1K38A 1GA9A 1MBLA 3CI6A 4KUOA 1CEFA 4O8GA 1NZUA 3L7HA 4E3KA 5I5LA 5KSCA 3KYQA 5CTMA 3PBNA 2INWA 2ZJ9A 3VP3A 1K25A 3S22A 2NUTC 4S2JA 4EUZA 1FCNA 5L8MA 2VX8A 3NJAA 3WS4A 3PYPA 3T1RA 1MC0A 3OPPA 3LR5A 2GDNA 4XUZA 4HH2A 3QHYA 2JKTM 5HWVA 2CC1A 2H10A 3FKVA 3KYZA 3M2JA 5AQAA 5F83A 3UDXA 4LFUA 1PWGA 4UA9A 2WAFA 3GQZA 2EFUA 2P9VB 5EVLA 1YSQA 1ERQA 1I2SA 4GB7A 4M4XA 3UO9A 1XP4A 4PM6A 4S2KA 4HP9A 4WZ5C 4DXBA 3QP8A 2O9BA 2JKGA 2WAEA 3P7NA 1TS6A 5DTSA 2J9OA 4XUXA 1VM1A 2HDSA 4EEUA 4X69A 1K57A 2HP5A 3TW8A 1KVMA 2V20A 3LY4A 4CLCC 2G2WA 4KQRA 1RP5A 5CGWA 1VEUB 3M2KA 4KUKA 2BTFP 4PM5A 2PHYA 2WUQA 2OLUA 4EBNA 5EUAA 3IX3A 3Q7VB 1XJ4A 2PBDP 2X01A 1PWCA 3MQQA 1JWVA 3DW0A 5HAQA 1OJ5A 2QMIA 3KSFA 1H8YA 3H82A 2LB9A 4LV0A 4P0MA 1S4SA 1PI5A 5HDCA 4BD1A 1ES4A 4NG2A 1PYYA 4Y7PA 1MKIA 1ERMA 1HTZA 1MY8A 3BQ8A 2QZ6A 1ZTUA 4A5RA 3UE3A 3ZNTA 1YLWA 1AWIA 1ESIA 3OPLA 3NDGA 1DP8A 3E2LA 2PD8A 4MN6A 3CPTA 1G5UA 2BLSA 1Z09A 1ONHA 5IU1A 1S1YA 3IX4A 5CRFA 3B33A 2KX6A 5CHUA 5M18A 4NXBA 2ZQDA 1K4FA 3RH8B 5GLCA 2XSSA 5FA7A 2J9PA 1ES3A 3HL9A 1DJAA 4UQIM 1YQSA 3E4PA 4NXFA 4WEJA 4QPRA 3TE8A 1S0WA 2ACGA 4WLAA 4MCWA 1F9IA 4DJ3A 2O0YA 2HZ5A 3ZNYA 1JWZA 3WS0A 2M7VA 3UN7A 2ZOHA 3C7VA 4L9FA 4WMCD 1VETA 4GNUA 1P9WA 4N1XA 2JN7A 3VV4A 1E4DA 3AGEA 3NCKA 3G2ZA 3D72A 4JF4A 3N6IA 4CJNA 3LIFA 2WADA 1I5QA 1S67L 3LI9A 3IX8A 4MBKA 1FILA 3OCLA 4DE1A 1YLPA 4Y15A 4O01A 4C6YA 4BBUA 3K2NA 2R78A 5FSRA 2V9AA 3U4LP 4EXOA 1CQAA 3SZTA 2PYRA 4ME4A 4AFIA 3B47A 3B42A 4F94A 3DTEA 5GHXA 3D9YA 5FDSA 3SH9A 1OPXA 1L0EA 1N4OA 2ZC4B 3MS6A 1FSYA 1X0OA 3NIAA 2R9WA 2PU2A 1KE3A 4HBTA 4N1HA 2ZC7A 4JF5A 1BLPA 1HLUP 5DF7A 4F3LB 2Y8HA 5FAPA 4DJ2A 1BLHA 2ZD8A 3F1NA 5G18A 4QU3A 3IXDA 4YOFA 3T4KA 3N8RA 3GECA 1DY6A 3D4FA 4MBFA 4C75A 4HJ3A 1RGYA 1NYMA 1LHYA 4GS9B 1MXOA 1QMEA 2QJ7A 1SDEA 5A90A 1XFQA 2WGWB 1S6RA 2Y2LA 2ZMVA 5E43A 5J3WA 3EEHA 3MFXA 4NXEA 5EVIB 2KDKA 4KG6A 5CHJA 3P01A 3UDIA 2WK0A 4LLOB 2X02A 4UA7A 4YINA 3CLOA 5HZHA 1LSXA 2QWSA 2JKFA 1ZHHB 1LT0A 4EERA 1XA7A 4ARZB 2Y2OA 1NJ4A 3C4OA 3CG5A 2B18A 4B93A 2B02A 3TOIA 4IHQA 3BJNA 1M40A 1JVJA 2FH5A 1JTGA 2W3FA 3CMZA 2Y59A 4YNRA 3MZFA 3LEZA 3G6OA 2DNSA 3IS2A 5TBMB 2P08A 4LCLA 5FQMA 4OLDA 3WS1A 5E2GA 3NHQA 5HWWA 3A3JA 3GR2A 3ULFA 1KE4A 5EPHA 2HP9A 3H9WA 4RYEA 1PZOA 4ZDXA 4GN2A 1GSVA 1YMSA 4LV2A 2OAP1 3T4OA 4R3BA 3VE4A 4YWZA 3N8SA 5FQIA 3GDIA 2OWJA 1YSPA 1K54A 2EFXA 4HNBA 4LCMA 4DE3A 3TJZC 2Y79A 2Q9NA 3OOVA 2Y55A 5E2FA 3Q81A 3VOYA 3OLOA 1ZC2A 1A0KA 3LUQA 3LIAA 3TRCA 3HJKA 5G4YA 4DDYA 3FC7A 4PMAA 4K0WA 4GHIA 3Q07A 1XJ3A 1XGJA 3VFFA 2PR6A 5F1GA 1NLYA 3UB9A 4H8RA 2PRFA 4ZTKA 2FZ0A 4FH2A 2EXBA 4QWOA 4NKPA 4I3JA 1L2SA 3IH9A 3JVUA 5F69A 4P6ZM 3PBSA 4IVIA 2HJ9C 5IT5A 3BFFA 1F5MA 3ZG8B 3OCNA 1OJGA 4MLLA 1J9MA 4ETXA 4EQIA 2UV0E 5KMWA 4WUJA 2Y2GA 4E3OA 4QHCA 1KGEA 4DRTA 1K6RA 4FD8A 4DE0A 3F1OB 5HD5A 3IXHA 5FDHA 1D7EA 3NOTC 4QY6A 1XKZA 3EQVA 2VJWA 1G68A 3N8LA 3BFCA 4MDZA 2H0TA 1WE4A 1WYCA 4Y2FA 4Z1WA 1F2KA 3F1PB 4HQAA 1XX2A 2XLNA 2ZL1A 5FQJA 3LR4A 4E3LA 5L07A 1P9RA 4NETA 2W0NA 5HW3A 1PW1A 3JPUA 2I72A 3K3DA 3ZVTA 4PM9A 1ODVA 2EX9A 3C7UA 3IQAA 4PKYA 1OT6A 1BLSA 4EQ1A 1NYYA 5AVEA 2J7VA 2IWBA 4QB8A 2VK3A
chains in the Genus database with same CATH topology
3L7HA 2JKFA 1K0KA 5EM1A 1D1JA 2ZL1B 1PRQA 2E8JA 5FEFA 2PRFA 1FILA 4QWOA 3T1RA 3MSHA 3T1QB 3T1SA 3U4LP 1CQAA 5EVEA 1PNEA 3NECA 4D60A 1J3WA 5EM0A 3DAVA 1SZVA 3NULA 3LEQA 3D9YA 5FDSA 2PAVP 1AWIA 2V8CA 1VEUA 3MS6A 4ESPA 4X1LA 4FUWA 3CPTA 3LGOA 1HLUP 1G5UA 1Z09A 3CHWP 3T1XA 4X1MA 1CF0A 2B95A 2JKGA 1FIKA 1CJFA 3CPTB 1ACFA 5FEGA 2V8FA 3T12B 1F2KA 1YPRA 2ZL1A 4X25A 1SKOA 2ACGA 2HZ5A 1VEUB 1PFLA 1SKOB 2BTFP 5EV0A 3KYEA 1VETA 1Y4OA 1A0KA 2PBDP 3L9KA 1VETB 3UB5P 2VK3A 4FTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7H A;  2JKF A;  1K0K A;  5EM1 A;  1D1J A;  2ZL1 B;  1PRQ A;  2E8J A;  5FEF A;  2PRF A;  1FIL A;  4QWO A;  3T1R A;  3MSH A;  3T1Q B;  3T1S A;  3U4L P;  1CQA A;  5EVE A;  1PNE A;  3NEC A;  4D60 A;  1J3W A;  5EM0 A;  3DAV A;  1SZV A;  3NUL A;  3LEQ A;  3D9Y A;  5FDS A;  2PAV P;  1AWI A;  2V8C A;  1VEU A;  3MS6 A;  4ESP A;  4X1L A;  4FUW A;  3CPT A;  3LGO A;  1HLU P;  1G5U A;  1Z09 A;  3CHW P;  3T1X A;  4X1M A;  1CF0 A;  2B95 A;  2JKG A;  1FIK A;  1CJF A;  3CPT B;  1ACF A;  5FEG A;  2V8F A;  3T12 B;  1F2K A;  1YPR A;  2ZL1 A;  4X25 A;  1SKO A;  2ACG A;  2HZ5 A;  1VEU B;  1PFL A;  1SKO B;  2BTF P;  5EV0 A;  3KYE A;  1VET A;  1Y4O A;  1A0K A;  2PBD P;  3L9K A;  1VET B;  3UB5 P;  2VK3 A;  4FTX A; 
#chains in the Genus database with same CATH topology
 3IWI A;  5DKL A;  1XXM A;  1UGU A;  2C6W B;  4DE2 A;  4GD8 A;  5J8X A;  3OPH A;  4G3V A;  4PPR A;  3BY9 A;  1PI4 A;  3EOI A;  4ZJ2 A;  3H82 B;  2K2N A;  1L3L A;  2ZQ8 A;  2XDM A;  3EGD C;  4BWI A;  2XRO A;  4LPZ A;  4R0Q A;  4IED A;  2PYP A;  3VOL A;  5J4E A;  4EV4 A;  1OTB A;  2VEA A;  2WKR A;  3T4L A;  1H8Z A;  4KZ8 A;  4UEY A;  2IA2 A;  4GJ4 A;  2W1T B;  2ZQ7 A;  3MJQ A;  3R7W B;  3NY4 A;  4X6T A;  3DTM A;  4E6X A;  4KZ4 A;  5HX9 A;  4JKT A;  4GD6 A;  3IF6 A;  3NI9 A;  3ZG9 B;  2JKR M;  2Y2J A;  5LBR A;  1CI9 A;  4RX2 A;  3CPT B;  2XA7 M;  1E25 A;  2ZBB A;  5HAP A;  2ZM0 A;  1FCO A;  1YPR A;  1VHM A;  4Z9Q A;  3O5Y A;  5L10 A;  3ZYT A;  3BYD A;  4X25 A;  3O88 A;  4HEF A;  3A3F A;  3MXR A;  2A3U A;  4OPR A;  3ZHH A;  2XD1 A;  2VGL M;  1NZO A;  5CGX A;  3RJU A;  2D02 A;  4KZ7 A;  4RA7 A;  2WKP A;  5U47 A;  5EV0 A;  5M1A A;  3KSH A;  1CEG A;  1NY0 A;  3W4Q A;  5HAR A;  4EU0 A;  4JBF A;  2V1Z A;  3PBQ A;  1G28 A;  4UQI S;  3KSG A;  4WZ4 A;  1VET B;  3W8K A;  3MXS A;  2EWV A;  1K57 C;  4QD4 A;  5EE8 A;  2V1B A;  5C5K A;  1T1A A;  4UHU A;  4E6W A;  1Z6F A;  3ZCZ A;  2DCF A;  2H5S A;  2ZQA A;  1OME A;  3V3S A;  4OKP A;  5FQ9 A;  3EWK A;  1UWN X;  4X53 A;  3UB7 A;  5E2E A;  1NLZ A;  2UWX A;  2WGI A;  3HJI A;  1PNE A;  2Y2P A;  3BLS A;  5AQB A;  1GCE A;  4IBX A;  4D60 A;  2ZC5 B;  3NUL A;  3FPV A;  3UPO A;  3GMW A;  3M6H A;  4Y0T A;  3PBR A;  4GKU A;  1N9B A;  4WM9 A;  2A2L A;  3Q1F A;  4I38 A;  3JVV A;  2OOL A;  3CHW P;  1FCM A;  3BRM A;  5CGS A;  3HUO A;  3O87 A;  1BSG A;  2D01 A;  5DVA A;  1FIK A;  4NEE D;  4EBP A;  1L0D A;  3G30 A;  4BMW A;  2RCX A;  4XT2 B;  3QP4 A;  3S7Q A;  4Q0H A;  3E98 A;  1H5X A;  1SKO A;  1W63 M;  2Z2L B;  4BLM A;  1IKG A;  1TS8 A;  5BOH A;  1ERO A;  1HD8 A;  2P7J A;  1K4E A;  2JKT I;  2G7U A;  2JKR I;  4HY8 A;  2J80 A;  3V3R A;  4KZA A;  4P85 A;  4KQQ A;  2GZA A;  3CZD A;  1L0G A;  2WGV A;  3ZGA B;  4R6L A;  3UB5 P;  3ZG5 A;  1DJC A;  3FZC A;  1FR1 A;  1TD5 A;  4S2P A;  2WZX A;  5GLD A;  2YKF A;  1E3U A;  2XEP A;  3MXQ A;  5AJG A;  3IBJ A;  1G6A A;  2OWH A;  5K5B A;  2Y91 A;  5MC7 A;  3WS2 A;  2Y4A A;  4KZ6 A;  4FCF A;  4WL9 A;  4MBH A;  4ETZ A;  5GL9 A;  1ZG6 A;  1GA0 A;  4UAA A;  3PXP A;  1HZO A;  4FOF A;  2HV1 A;  5EM0 A;  4LGW A;  3DWK A;  4H6J A;  4I5S A;  1BUL A;  1Q2P A;  1VEU A;  4K91 A;  3IS2 B;  1W63 Q;  1RGZ A;  2PBY A;  2A24 A;  3EGX C;  3W4P A;  3IHA A;  4BBT A;  2C5W B;  1ACF A;  4R23 A;  3WRT A;  3FKW A;  1CK3 A;  5HDD A;  3MZE A;  4BJP A;  4OP8 A;  5FL3 A;  1OTE A;  3N7W A;  3BLM A;  2J3W A;  2KLI A;  2P04 A;  5F6A A;  4I3A A;  4Y3I A;  3V39 A;  5HDS A;  5F1F A;  1EW0 A;  3AGF A;  4KZ5 A;  3FWL A;  3EQU A;  2L1M A;  4FTX A;  1MWR A;  1GHM A;  4JLF A;  2QYB A;  4BD0 A;  3A3E A;  4OP5 A;  1T18 A;  3N4I A;  3SOI A;  1W5D A;  1GSW A;  4HIA A;  4LRZ E;  2ZLY A;  2QKP A;  5AQ9 A;  3T1Q B;  3NBL A;  2CMN A;  1PW8 A;  2EXA A;  4FSF A;  1OTA A;  3ICY A;  4EBL A;  1JNU A;  5D3O A;  4P87 A;  2W3G A;  2W27 A;  1AXB A;  2ZC3 B;  3VOZ A;  1WYB A;  3LIC A;  3C8C A;  5FAQ A;  3PBT A;  2GX5 A;  1H3Q A;  3UY6 A;  3M6B A;  4OVD A;  3VE3 A;  1O07 A;  3ITA A;  4GDN A;  4WF0 A;  4P6Z S;  4HOI A;  3HVF A;  1TDL A;  1LL8 A;  1YM1 A;  1OT9 A;  2XFS A;  3MKE A;  4DF6 A;  2WKI A;  4OON A;  1IFQ A;  1SHV A;  4YFM A;  1LL5 A;  4ZBE A;  2OAQ 1;  1T1C A;  3V50 A;  3MKF A;  3E2K A;  3UDF A;  1C3B A;  2R9X A;  3MBZ A;  3CWF A;  4DDS A;  5KZH A;  3E4Q A;  1IEL A;  5EFW A;  3S1Y A;  2LB5 A;  3UB8 A;  3LFV A;  3L9K A;  2XK1 A;  4IVK A;  3T4T A;  2HPB A;  3IF5 A;  4HP4 A;  3R4K A;  5DJU A;  4BL2 A;  1LSW A;  4IBR A;  4KZB A;  2H28 A;  1YLT A;  1K0K A;  1XFN A;  5EM1 A;  2G2U A;  1UWP X;  4QJG A;  1K54 C;  4G3W A;  2VGJ A;  4JGP A;  3GVB A;  4BEN A;  3HLD A;  1NXY A;  4X56 A;  2M1C A;  3IWQ A;  5KSH A;  3EEA A;  3H7W B;  2M7U A;  3T1S A;  3NEC A;  2V2F F;  4ZJ1 A;  1J3W A;  3SS3 A;  1SZV A;  2PAV P;  3IXG A;  2WGW A;  2VV8 A;  3OZH A;  1VB6 A;  5EVI A;  1W7F A;  3S7P A;  3BEC A;  4JGQ A;  1KOU A;  1CF0 A;  3NDE A;  3GRJ A;  2B95 A;  1NWZ A;  2PU4 A;  3VSL A;  3QP5 A;  1CJF A;  1XA1 A;  2O9C A;  5DF8 A;  3RFB A;  1SDN A;  1T19 A;  5AVF A;  3VP1 A;  4OQH A;  3G2Y A;  2Z6C A;  2RL3 A;  3IBR A;  5HD3 A;  2VKS A;  4XXR A;  4Q8I A;  4Y13 A;  3T4J A;  4G3K A;  2HP6 A;  3P98 A;  2Y2K A;  1EI5 A;  1LLB A;  1PFL A;  1O7E A;  3KO6 A;  1U60 A;  1LL9 A;  3HCY A;  1OTD A;  4IUK A;  1N9L A;  4PAU A;  1FR6 A;  2HDR A;  2XA7 S;  3MZD A;  2EWW A;  4WN5 A;  3HLF A;  4OQI A;  3U2A A;  4N9K A;  5CTN A;  3BFD A;  1YLY A;  2MJ6 A;  2JHE A;  3VP0 A;  2OSU A;  1OTI A;  4HJ6 A;  2VGL S;  5TR7 A;  4UA6 A;  5TGF A;  3UE6 A;  1K55 A;  5HSQ A;  3IWO A;  3MMH A;  3DTI A;  1KGF A;  5E2H A;  5CXW A;  1MWS A;  4DN0 A;  4R4R A;  3K3C A;  1WA9 A;  1YAX A;  1BYW A;  4JPM A;  4HJ4 A;  3G32 A;  3DWZ A;  3ZG7 B;  5FQK A;  4B88 A;  1S4R A;  2W1R A;  3W2Z A;  4DMZ A;  4WYY A;  4S2L A;  1PWD A;  3WRZ A;  3W4O A;  3ISG A;  3A0S A;  3LID A;  3T1X A;  2WYX A;  4U3T A;  1H0M A;  2XGN A;  3MF0 A;  3UME A;  3V67 A;  1SKF A;  2WZZ A;  5EOO A;  1G6O A;  5HFO A;  5IHV A;  4JXW A;  4E3N A;  5HL1 A;  4M3K A;  4II7 A;  1ES2 A;  3A3D A;  2VLG A;  2ZMA A;  1LI0 A;  2JBF A;  4R1G A;  1TS7 A;  2J3T D;  5TFQ A;  4Q0J A;  4S2N A;  4KQO A;  3FPW A;  3KSI A;  1P0Z A;  5AQ7 A;  1H8M A;  3FG8 A;  1SKO B;  1TEM A;  2L0W A;  4S2N C;  4R4S A;  3IF6 C;  4B9O A;  2YKH A;  5M19 A;  3KX0 X;  4KZ9 A;  3SH8 A;  5IS1 A;  2Y2H A;  3LR0 A;  4OH0 A;  1E3U D;  1XGI A;  1M6K A;  1YT4 A;  1F98 A;  1ALQ A;  3LY3 A;  5FAO A;  4B4X A;  4KG5 A;  3HLW A;  1T1B A;  1YLZ A;  5DFX A;  3PTE A;  3F1O A;  4HH3 A;  5FAT A;  3Q82 A;  5FI7 A;  4X68 A;  3SW1 A;  4HES A;  4MEZ A;  1VQQ A;  3C5A A;  4WZ5 A;  4JXS A;  4EW7 A;  2XFT A;  3FYZ A;  3UNW A;  1EWZ A;  1TS0 A;  3F1P A;  4OOL A;  4IUH A;  2DMW A;  3NOU C;  3HLE A;  1YLJ A;  3ZVW A;  4LRY C;  3VFH A;  5DKK A;  4CLC A;  5A93 A;  2V8C A;  3IHB A;  4EEP A;  1N9N A;  1Y54 A;  1IEM A;  2Y2Q A;  1K56 A;  4X1L A;  3ZFZ A;  5JYP A;  4FUW A;  3WS5 A;  4E3J A;  4H6J B;  4D2O A;  5KIZ A;  3UPN A;  4KZ3 A;  4DXC A;  5CER A;  5CED A;  2QPN A;  1KDS A;  3MQO A;  3PAG A;  4E3I A;  4HBU A;  2X71 A;  1GHI A;  2A24 B;  2W3H A;  4S2O A;  4Q0I A;  4K0X A;  2V8F A;  2FFF B;  3C4P A;  1MWU A;  3MQ0 A;  1XPB A;  1TDG A;  4WBG A;  5G4Z A;  2W3D A;  4EWF A;  1NRF A;  3SH7 A;  4ZRR A;  2OLV A;  1MPL A;  3UPP A;  5DTK A;  2HF6 A;  3TG9 A;  1W8Y A;  2ZQ9 A;  3C38 A;  2FFY A;  5A92 A;  2HJE A;  2Q0O A;  4S2M A;  1JWP A;  3HBR A;  4KQD A;  1YKD A;  3F1N B;  1IYQ A;  5L2F A;  1DJB A;  4N92 A;  3HLB A;  5F5Y A;  4MNR A;  4PKY G;  2W1T A;  3R7W A;  4HI4 A;  1BTL A;  3S7N A;  4JGO A;  2KOI A;  4CLC E;  3HUM A;  3E4O A;  1DRM A;  3ZDJ A;  2J3T C;  2V0U A;  3MSH A;  5F82 A;  2B5R A;  4RX3 A;  1PZP A;  5EVE A;  4OLG A;  3VP2 A;  4JGR A;  5HL6 A;  2P9V A;  2BG1 A;  3P09 A;  1PIO A;  1DP9 A;  1BLC A;  3PAE A;  2IWC A;  2Y2I A;  4Y0O A;  4PM8 A;  2ZOI A;  3WWX A;  4ESP A;  4S2I A;  4Y5F A;  4X55 A;  1TF1 A;  3QP2 A;  2P74 A;  2K7S A;  4KG2 A;  4OOM A;  3GV9 A;  5FI2 A;  4O7D A;  2J8Y A;  2WKQ A;  4WEL A;  4GOG A;  5FEG A;  1QMF A;  2E8I A;  4U0X A;  2WKH A;  3O3V A;  2EA9 A;  2XRN A;  2ZC6 B;  4LV3 A;  3SS4 A;  2ZMF A;  5J7E A;  3OBF A;  2A49 A;  3UB6 A;  1ONG A;  1Q2Q A;  1BZA A;  1IKI A;  3BY8 A;  3Q7V A;  3LR3 A;  4KEN B;  4L9G A;  5L09 A;  5DFY A;  1XJ6 A;  1MZU A;  2Q9M A;  3GSG A;  3DTK A;  2EX6 A;  4OQ0 A;  3C30 A;  4LRX C;  1BUE A;  2PD7 A;  4IJG A;  5FI6 A;  4LV1 A;  4MMN A;  4OPY A;  3FV7 A;  5EOE A;  4BL3 A;  1KVL A;  4OPQ A;  5GLB A;  1PRQ A;  2HGV A;  4R3J A;  5DJT A;  2VV6 A;  2QJ5 A;  5GHZ A;  4NXG A;  2GJ3 A;  3UMD A;  4R38 A;  3MFD A;  4BQM A;  4N9L A;  3O86 A;  1ZG4 A;  3AGD A;  3GTC A;  3MR0 A;  3OC2 A;  4XT2 A;  4JF6 A;  1IOU A;  2Z2M B;  5HAI A;  2O99 A;  3LEQ A;  4GZB A;  2XF3 A;  2Z6D A;  3LIB A;  4GHI B;  4Y17 A;  5EVI D;  3CAX A;  5EEC A;  3UE1 A;  4R3A A;  1P97 A;  3NOP C;  3NC8 A;  4PM7 A;  4ID4 A;  5CHM A;  3PHY A;  2OV5 A;  3LYX A;  3T4Q A;  1DP6 A;  2HDU A;  4EUV A;  4L9E A;  5A8B A;  3T12 B;  3QNB A;  4CQH A;  2W3E A;  4GDB A;  3OPR A;  2H0Y A;  3IXB A;  1IYP A;  4GW9 A;  3RXW A;  3ZG0 A;  4EES A;  1KE0 A;  2PDR A;  4WEK A;  4CPK A;  3QP6 A;  1IYO A;  3CUE A;  2JE5 A;  5GHY A;  2BAS A;  2QHK A;  2Y2N A;  3A0V A;  4WMC A;  3PBO A;  4K08 A;  3BW6 A;  3CUE C;  1FOF A;  2ZM2 A;  3Q7Z A;  2NUP C;  3LIE A;  1S66 L;  4RVA A;  3BFE A;  3BM6 A;  4O0P A;  1D1J A;  2ZL1 B;  4U0T A;  3CJM A;  1Y28 A;  1K6S A;  1W79 A;  3B3X A;  2E8J A;  3DBA A;  1ZKJ A;  3HLC A;  5CEC A;  1NRJ A;  1HVB A;  2VGK A;  5CEB A;  1SCW A;  4P6B A;  1FQG A;  5HWT A;  3ITB A;  4OOY A;  2K31 A;  5F68 A;  1FSW A;  3BEB A;  4ZAM A;  1CI8 A;  3TSG A;  3I7J A;  4Y0U A;  2XQZ A;  4HHD A;  1ESU A;  1V9Z A;  5A91 A;  2DRW A;  1MWT A;  2GNX A;  4F3L A;  3QP1 A;  2VA0 A;  4ZJ3 A;  5GLA A;  1ES5 A;  2HDQ A;  1N9O A;  5HPF A;  3LGO A;  1KDW A;  2XH9 A;  4B4Z A;  2AVX A;  4X1M A;  3S7O A;  4RQ9 A;  3A0R A;  1STZ A;  3HUN A;  3A3I A;  4GS9 A;  1BT5 A;  3LO7 A;  5DF9 A;  3IT9 A;  3G34 A;  5DTT A;  5FQQ A;  1IYS A;  4FH4 A;  3ZQ5 A;  2I9V A;  5TJJ A;  5I94 A;  4JXG A;  3V5M A;  3RXX A;  4GCZ A;  2IWD A;  1GSX A;  2PR5 A;  3BFG A;  3VP4 A;  2L4R A;  5EVI C;  2VV7 A;  3KYE A;  2XR0 A;  1Y4O A;  5CX7 A;  4ARZ A;  1LI9 A;  5FAS A;  3VMA A;  3IF6 B;  1S1Z A;  3T50 A;  2EX2 A;  1MKM A;  4PHT A;  3SS5 A;  3E0Y A;  1XJ2 A;  3G4P A;  5FEF A;  1RCJ A;  2ZQC A;  2O9A A;  4MN7 A;  4I39 A;  4EET B;  2XD5 A;  4E04 A;  5TBM A;  1YMX A;  3VSK A;  4E3M A;  2JC7 A;  3BWL A;  3HRE A;  4NK3 A;  2PT7 A;  3DAV A;  4CLC D;  3HLG A;  4BBV A;  4LEN A;  2ZM8 A;  1K56 D;  3C2W A;  3G31 A;  2JCH A;  1D06 A;  3PR6 A;  2Y2M A;  4I3I A;  4JXV A;  4QY5 A;  5JYO A;  4DKI A;  1W8Q A;  4CLC B;  3QNC A;  1K55 C;  2V1A A;  4GLQ A;  2V0W A;  4C3Q A;  3T4S A;  3RTY A;  3UE0 A;  3G35 A;  3IH8 A;  3S4X A;  4OPZ A;  1V9Y A;  3JYI A;  1TVF A;  3D3O A;  4R70 A;  2WKE A;  3CIT A;  1L0F A;  1KGG A;  3BQA A;  3LCE A;  1JTD A;  4MN5 A;  3LI8 A;  1GHP A;  2VZW A;  1LSV A;  3H7W A;  4OQG A;  5HPI A;  4L0L A;  1I2W A;  2EX8 A;  1K38 A;  1GA9 A;  1MBL A;  3CI6 A;  4KUO A;  1CEF A;  4O8G A;  1NZU A;  3L7H A;  4E3K A;  5I5L A;  5KSC A;  3KYQ A;  5CTM A;  3PBN A;  2INW A;  2ZJ9 A;  3VP3 A;  1K25 A;  3S22 A;  2NUT C;  4S2J A;  4EUZ A;  1FCN A;  5L8M A;  2VX8 A;  3NJA A;  3WS4 A;  3PYP A;  3T1R A;  1MC0 A;  3OPP A;  3LR5 A;  2GDN A;  4XUZ A;  4HH2 A;  3QHY A;  2JKT M;  5HWV A;  2CC1 A;  2H10 A;  3FKV A;  3KYZ A;  3M2J A;  5AQA A;  5F83 A;  3UDX A;  4LFU A;  1PWG A;  4UA9 A;  2WAF A;  3GQZ A;  2EFU A;  2P9V B;  5EVL A;  1YSQ A;  1ERQ A;  1I2S A;  4GB7 A;  4M4X A;  3UO9 A;  1XP4 A;  4PM6 A;  4S2K A;  4HP9 A;  4WZ5 C;  4DXB A;  3QP8 A;  2O9B A;  2JKG A;  2WAE A;  3P7N A;  1TS6 A;  5DTS A;  2J9O A;  4XUX A;  1VM1 A;  2HDS A;  4EEU A;  4X69 A;  1K57 A;  2HP5 A;  3TW8 A;  1KVM A;  2V20 A;  3LY4 A;  4CLC C;  2G2W A;  4KQR A;  1RP5 A;  5CGW A;  1VEU B;  3M2K A;  4KUK A;  2BTF P;  4PM5 A;  2PHY A;  2WUQ A;  2OLU A;  4EBN A;  5EUA A;  3IX3 A;  3Q7V B;  1XJ4 A;  2PBD P;  2X01 A;  1PWC A;  3MQQ A;  1JWV A;  3DW0 A;  5HAQ A;  1OJ5 A;  2QMI A;  3KSF A;  1H8Y A;  3H82 A;  2LB9 A;  4LV0 A;  4P0M A;  1S4S A;  1PI5 A;  5HDC A;  4BD1 A;  1ES4 A;  4NG2 A;  1PYY A;  4Y7P A;  1MKI A;  1ERM A;  1HTZ A;  1MY8 A;  3BQ8 A;  2QZ6 A;  1ZTU A;  4A5R A;  3UE3 A;  3ZNT A;  1YLW A;  1AWI A;  1ESI A;  3OPL A;  3NDG A;  1DP8 A;  3E2L A;  2PD8 A;  4MN6 A;  3CPT A;  1G5U A;  2BLS A;  1Z09 A;  1ONH A;  5IU1 A;  1S1Y A;  3IX4 A;  5CRF A;  3B33 A;  2KX6 A;  5CHU A;  5M18 A;  4NXB A;  2ZQD A;  1K4F A;  3RH8 B;  5GLC A;  2XSS A;  5FA7 A;  2J9P A;  1ES3 A;  3HL9 A;  1DJA A;  4UQI M;  1YQS A;  3E4P A;  4NXF A;  4WEJ A;  4QPR A;  3TE8 A;  1S0W A;  2ACG A;  4WLA A;  4MCW A;  1F9I A;  4DJ3 A;  2O0Y A;  2HZ5 A;  3ZNY A;  1JWZ A;  3WS0 A;  2M7V A;  3UN7 A;  2ZOH A;  3C7V A;  4L9F A;  4WMC D;  1VET A;  4GNU A;  1P9W A;  4N1X A;  2JN7 A;  3VV4 A;  1E4D A;  3AGE A;  3NCK A;  3G2Z A;  3D72 A;  4JF4 A;  3N6I A;  4CJN A;  3LIF A;  2WAD A;  1I5Q A;  1S67 L;  3LI9 A;  3IX8 A;  4MBK A;  1FIL A;  3OCL A;  4DE1 A;  1YLP A;  4Y15 A;  4O01 A;  4C6Y A;  4BBU A;  3K2N A;  2R78 A;  5FSR A;  2V9A A;  3U4L P;  4EXO A;  1CQA A;  3SZT A;  2PYR A;  4ME4 A;  4AFI A;  3B47 A;  3B42 A;  4F94 A;  3DTE A;  5GHX A;  3D9Y A;  5FDS A;  3SH9 A;  1OPX A;  1L0E A;  1N4O A;  2ZC4 B;  3MS6 A;  1FSY A;  1X0O A;  3NIA A;  2R9W A;  2PU2 A;  1KE3 A;  4HBT A;  4N1H A;  2ZC7 A;  4JF5 A;  1BLP A;  1HLU P;  5DF7 A;  4F3L B;  2Y8H A;  5FAP A;  4DJ2 A;  1BLH A;  2ZD8 A;  3F1N A;  5G18 A;  4QU3 A;  3IXD A;  4YOF A;  3T4K A;  3N8R A;  3GEC A;  1DY6 A;  3D4F A;  4MBF A;  4C75 A;  4HJ3 A;  1RGY A;  1NYM A;  1LHY A;  4GS9 B;  1MXO A;  1QME A;  2QJ7 A;  1SDE A;  5A90 A;  1XFQ A;  2WGW B;  1S6R A;  2Y2L A;  2ZMV A;  5E43 A;  5J3W A;  3EEH A;  3MFX A;  4NXE A;  5EVI B;  2KDK A;  4KG6 A;  5CHJ A;  3P01 A;  3UDI A;  2WK0 A;  4LLO B;  2X02 A;  4UA7 A;  4YIN A;  3CLO A;  5HZH A;  1LSX A;  2QWS A;  2JKF A;  1ZHH B;  1LT0 A;  4EER A;  1XA7 A;  4ARZ B;  2Y2O A;  1NJ4 A;  3C4O A;  3CG5 A;  2B18 A;  4B93 A;  2B02 A;  3TOI A;  4IHQ A;  3BJN A;  1M40 A;  1JVJ A;  2FH5 A;  1JTG A;  2W3F A;  3CMZ A;  2Y59 A;  4YNR A;  3MZF A;  3LEZ A;  3G6O A;  2DNS A;  3IS2 A;  5TBM B;  2P08 A;  4LCL A;  5FQM A;  4OLD A;  3WS1 A;  5E2G A;  3NHQ A;  5HWW A;  3A3J A;  3GR2 A;  3ULF A;  1KE4 A;  5EPH A;  2HP9 A;  3H9W A;  4RYE A;  1PZO A;  4ZDX A;  4GN2 A;  1GSV A;  1YMS A;  4LV2 A;  2OAP 1;  3T4O A;  4R3B A;  3VE4 A;  4YWZ A;  3N8S A;  5FQI A;  3GDI A;  2OWJ A;  1YSP A;  1K54 A;  2EFX A;  4HNB A;  4LCM A;  4DE3 A;  3TJZ C;  2Y79 A;  2Q9N A;  3OOV A;  2Y55 A;  5E2F A;  3Q81 A;  3VOY A;  3OLO A;  1ZC2 A;  1A0K A;  3LUQ A;  3LIA A;  3TRC A;  3HJK A;  5G4Y A;  4DDY A;  3FC7 A;  4PMA A;  4K0W A;  4GHI A;  3Q07 A;  1XJ3 A;  1XGJ A;  3VFF A;  2PR6 A;  5F1G A;  1NLY A;  3UB9 A;  4H8R A;  2PRF A;  4ZTK A;  2FZ0 A;  4FH2 A;  2EXB A;  4QWO A;  4NKP A;  4I3J A;  1L2S A;  3IH9 A;  3JVU A;  5F69 A;  4P6Z M;  3PBS A;  4IVI A;  2HJ9 C;  5IT5 A;  3BFF A;  1F5M A;  3ZG8 B;  3OCN A;  1OJG A;  4MLL A;  1J9M A;  4ETX A;  4EQI A;  2UV0 E;  5KMW A;  4WUJ A;  2Y2G A;  4E3O A;  4QHC A;  1KGE A;  4DRT A;  1K6R A;  4FD8 A;  4DE0 A;  3F1O B;  5HD5 A;  3IXH A;  5FDH A;  1D7E A;  3NOT C;  4QY6 A;  1XKZ A;  3EQV A;  2VJW A;  1G68 A;  3N8L A;  3BFC A;  4MDZ A;  2H0T A;  1WE4 A;  1WYC A;  4Y2F A;  4Z1W A;  1F2K A;  3F1P B;  4HQA A;  1XX2 A;  2XLN A;  2ZL1 A;  5FQJ A;  3LR4 A;  4E3L A;  5L07 A;  1P9R A;  4NET A;  2W0N A;  5HW3 A;  1PW1 A;  3JPU A;  2I72 A;  3K3D A;  3ZVT A;  4PM9 A;  1ODV A;  2EX9 A;  3C7U A;  3IQA A;  4PKY A;  1OT6 A;  1BLS A;  4EQ1 A;  1NYY A;  5AVE A;  2J7V A;  2IWB A;  4QB8 A;  2VK3 A; 
#chains in the Genus database with same CATH homology
 3L7H A;  2JKF A;  1K0K A;  5EM1 A;  1D1J A;  2ZL1 B;  1PRQ A;  2E8J A;  5FEF A;  2PRF A;  1FIL A;  4QWO A;  3T1R A;  3MSH A;  3T1Q B;  3T1S A;  3U4L P;  1CQA A;  5EVE A;  1PNE A;  3NEC A;  4D60 A;  1J3W A;  5EM0 A;  3DAV A;  1SZV A;  3NUL A;  3LEQ A;  3D9Y A;  5FDS A;  2PAV P;  1AWI A;  2V8C A;  1VEU A;  3MS6 A;  4ESP A;  4X1L A;  4FUW A;  3CPT A;  3LGO A;  1HLU P;  1G5U A;  1Z09 A;  3CHW P;  3T1X A;  4X1M A;  1CF0 A;  2B95 A;  2JKG A;  1FIK A;  1CJF A;  3CPT B;  1ACF A;  5FEG A;  2V8F A;  3T12 B;  1F2K A;  1YPR A;  2ZL1 A;  4X25 A;  1SKO A;  2ACG A;  2HZ5 A;  1VEU B;  1PFL A;  1SKO B;  2BTF P;  5EV0 A;  3KYE A;  1VET A;  1Y4O A;  1A0K A;  2PBD P;  3L9K A;  1VET B;  3UB5 P;  2VK3 A;  4FTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...