2VK3A

Crystal structure of rat profilin 2a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
142
structure length
142
Chain Sequence
GSMAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPAEIDVIIGKDREGFFTNGLTLGGKKCSVIRDSLYVDSDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Modifications and Ligand-Binding Properties of Rat Profilin 2A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
molecule keywords PROFILIN-2
total genus 46
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2vk3A00
1SZVA 3MSHA 5EM0A 3T1RA 1VEUA 1VEUB 2BTFP 2V8CA 2VK3A 3T12B 3KYEA 1F2KA 1A0KA 2HZ5A 5EV0A 2ZL1B 1Y4OA 1HLUP 2JKFA 1PNEA 3D9YA 1AWIA 1Z09A 2PAVP 1CJFA 1VETB 3L9KA 5EVEA 5EM1A 4X1LA 4D60A 3CPTA 5FDSA 5FEFA 4X1MA 4X25A 3T1XA 2ACGA 1YPRA 3T1QB 3DAVA 1SKOA 2PBDP 2E8JA 3LGOA 5FEGA 4FUWA 4QWOA 4FTXA 1D1JA 3UB5P 1PFLA 3NULA 1CQAA 3NECA 1K0KA 3CHWP 4ESPA 3MS6A 1FILA 2V8FA 3CPTB 1FIKA 2ZL1A 3T1SA 1VETA 1ACFA 1CF0A 2PRFA 3U4LP 1G5UA 1PRQA 1J3WA 3L7HA 2B95A 2JKGA 1SKOB 3LEQA
chains in the Genus database with same CATH superfamily
3WWXA 2D02A 4B9OA 2WKHA 3T4TA 3W8KA 2HV1A 2XROA 4CLCE 1KVLA 4KQRA 1YSPA 4DDYA 4CJNA 1CF0A 4JGOA 3MMHA 4JF4A 2JKGA 4MN7A 2DNSA 1AXBA 2XFTA 3K2NA 4CQHA 4B4XA 1WYCA 4G3VA 1TDLA 1W5DA 3OPLA 1CEFA 1U60A 3C7VA 4HNBA 1LL8A 2HJEA 3PYPA 2O9CA 4I3JA 1IYOA 3KYZA 5M1AA 2PR5A 4OQIA 5J8XA 5HD3A 4NG2A 3BEBA 2G7UA 5CHJA 4C75A 5F69A 2RL3A 1K54A 1ERMA 2E8JA 1CEGA 3LGOA 4DJ3A 3UMEA 4P87A 4H6JB 4K91A 3QHYA 3C30A 4FH2A 4S2NA 1XKZA 3D72A 5IHVA 3SH9A 1MWSA 4JXWA 4X69A 4O8GA 1DRMA 4CPKA 2W1RA 1ALQA 5E2FA 2Y2MA 1YLYA 2E8IA 1D06A 3S7NA 2WZZA 3S7OA 5LBRA 5J4EA 1TF1A 4KENB 5FQMA 3HCYA 3PBQA 5FQIA 5GLBA 2ZM0A 3ZVWA 4JGRA 5GLAA 2GX5A 1W8YA 4WZ4A 5EVLA 4JGQA 3W4PA 3T12B 1XGIA 4OQ0A 3UPPA 2Z6DA 3K3DA 3MQOA 1Z6FA 2EWVA 4ZJ1A 4A5RA 4KZAA 1CI8A 1G5UA 4KQQA 3NOTC 3Q7VB 3ZCZA 5M19A 4KZ9A 3IH9A 2XFSA 1FQGA 4ME4A 1ES2A 2Y4AA 3UPOA 2QJ7A 3HLWA 2OLUA 1JTGA 5FAPA 3Q7VA 4HQAA 3R7WB 1VEUA 4UA7A 4EETB 1HLUP 3UE6A 2FFYA 3G2ZA 4GKUA 4LCMA 5GHZA 4PKYG 2ZMFA 1GHIA 1Y54A 3CUEA 3HLDA 3ZDJA 4Q8IA 3ZG8B 4RYEA 4NXGA 3E4PA 3M6BA 3DBAA 1H8MA 1YPRA 3DAVA 5L10A 2WYXA 4OPRA 2Y2JA 1CI9A 2QWSA 5HDDA 1GSWA 4OP8A 1XA7A 4Y0UA 1EROA 3ZGAB 2Y59A 1ZHHB 3IXGA 3PAEA 2K7SA 1QMFA 5FI7A 1RCJA 1GA0A 1FSWA 4HJ3A 3OBFA 2XLNA 5F5YA 4PM8A 4MEZA 2ZL1A 2EA9A 1N9OA 5AQ9A 1SKOB 4BWIA 2WZXA 2XR0A 4KQDA 1Z09A 1N9LA 4D60A 2HDSA 3NJAA 5J3WA 4E6WA 3GVBA 4UAAA 2VX8A 5TBMB 5FEGA 4E3LA 2UWXA 5F1FA 3FWLA 5G18A 4Y0TA 4PAUA 2JC7A 4GN2A 2J80A 3VE4A 4N92A 2B02A 1K4EA 2V8CA 2VGJA 1G68A 1BLSA 1K55A 4ZJ2A 1PNEA 4WM9A 2Y2NA 1KGGA 3PBRA 2R78A 3IS2B 3UNWA 4KG6A 4QWOA 1BYWA 4UHUA 2RCXA 2XRNA 3HL9A 1KE3A 1L3LA 3S7QA 4KQOA 3FG8A 1JWPA 3T1RA 2INWA 3OCLA 5DJUA 1FR6A 5BOHA 2JKFA 3OZHA 1KDWA 4OKPA 2Y2PA 1XPBA 3G31A 4KZ8A 3UDIA 5F6AA 3M2KA 3IT9A 3IF5A 3S1YA 3A3IA 3IBRA 3GQZA 1LSVA 2ZC6B 5FAOA 4BBUA 4ETXA 5KSHA 4DE2A 4E3NA 5L8MA 1FCOA 1NRJA 3BQ8A 1S4SA 1UGUA 3MJQA 1FR1A 4UQIS 4XUZA 5HFOA 4LCLA 2ZQ8A 5FI2A 3CMZA 3MXRA 4GD6A 1TVFA 3B3XA 1LSWA 3BM6A 1PRQA 4WZ5A 3N8LA 4DDSA 4EBNA 1ZC2A 1PIOA 4HY8A 2PD7A 3BJNA 4YNRA 2BG1A 3LUQA 1UWPX 2ACGA 2M1CA 3A0SA 4GS9B 5DTTA 3A3EA 1WE4A 2GJ3A 3BRMA 3HREA 4PM5A 3CHWP 3WS2A 3IX4A 1K4FA 3O86A 2ZC7A 4XUXA 2H5SA 1KGEA 4S2IA 1GSVA 2PU2A 3E2KA 3N8RA 3GRJA 3FKVA 5DTSA 1PFLA 3R7WA 4EWFA 3FV7A 2VV8A 2X02A 1C3BA 1P97A 4HP9A 2EWWA 2PR6A 3HBRA 3OCNA 1VB6A 1A0KA 3ULFA 4E6XA 4I38A 1OTBA 5L2FA 4S2PA 3EGXC 2EFUA 4X25A 4PMAA 4NK3A 2M7UA 2V0UA 4LV3A 4HH3A 2WGWB 3K3CA 1FILA 2WKPA 3MS6A 3PBSA 1RP5A 4O01A 2ZQAA 4D2OA 3IWIA 5KZHA 1SCWA 1L0GA 4R1GA 1BTLA 3SH8A 4PPRA 3PAGA 3A0RA 5FEFA 1ESUA 3H7WB 2JN7A 3RFBA 2J7VA 5E2GA 4BJPA 1CQAA 1K0KA 4R38A 4PM7A 3WS5A 3P98A 4X6TA 3TRCA 5EVIC 4L9EA 1SZVA 3FPWA 2BTFP 5HPFA 3KX0X 3ZNYA 2W3HA 4BD1A 1NZUA 2XD1A 1L0EA 4MBKA 3O3VA 2GDNA 2EX2A 2HDQA 3M6HA 4CLCA 3F1NB 4R70A 4RA7A 3CAXA 1ZKJA 4B88A 5HL6A 3A3DA 1I5QA 2W1TA 2QPNA 3TSGA 1P9WA 1Y4OA 2XQZA 5DKKA 3VSKA 2PAVP 1YM1A 5EVEA 3RXXA 1S4RA 2FH5A 3WRZA 4DMZA 4PHTA 1PW1A 2H10A 3B42A 3T4JA 4UEYA 2X71A 2DMWA 4RVAA 1MWTA 4R6LA 1L0DA 2M7VA 5HWVA 3HLCA 4HBUA 2A3UA 4OOLA 1HD8A 1WYBA 2W1TB 1G6OA 3IH8A 4OOYA 3HLEA 2K31A 3ZNTA 5FAQA 1PWDA 3IF6C 4O0PA 2XSSA 1BSGA 4S2MA 3N6IA 1YLPA 5GL9A 2FFFB 2WKEA 3P01A 4GS9A 5F82A 4S2JA 5HAIA 3EOIA 4GCZA 3H82A 2ZL1B 1MY8A 3LIAA 2I72A 3C2WA 3V39A 3VSLA 4G3KA 5CECA 1QMEA 2QKPA 4YINA 5A90A 5KIZA 4GB7A 4QJGA 1NLZA 2H0TA 1SHVA 5EECA 1YT4A 3RXWA 5GLDA 3FC7A 1IOUA 4CLCC 3E2LA 3HLBA 2P08A 4HEFA 3G35A 1I2WA 1MWUA 2QHKA 3CPTA 4JBFA 2GNXA 3N8SA 1FCMA 1K54C 5A93A 4HIAA 3T50A 4P85A 2XDMA 3UPNA 3IXHA 1K56A 4O7DA 4E3IA 1IYPA 1OTDA 1IELA 4P6ZS 3WS0A 2IWDA 3E4QA 1IEMA 4MN5A 5DTKA 2QMIA 3EQUA 4N9LA 4XT2B 5F1GA 3VP3A 1HZOA 1YKDA 1W63Q 1OJ5A 3W4QA 4UQIM 4OPYA 4EXOA 3IQAA 1XJ2A 3ITAA 3VOLA 2PBYA 3MZDA 1XXMA 3MXSA 2HJ9C 3LIDA 1S1YA 4IVKA 2BASA 3C4OA 5DFXA 1D1JA 4FD8A 2WAEA 1NLYA 3ZHHA 3ZG0A 2A24A 4WF0A 3CG5A 1YLJA 3TJZC 4ZDXA 1OT6A 1P9RA 3JYIA 5FDHA 3LCEA 3LR3A 4E3OA 3EEAA 5FQKA 1FSYA 3ZQ5A 2V8FA 1MKIA 4JF6A 2XEPA 3V3RA 1OJGA 4EV4A 3HJKA 3T4SA 1KVMA 1LHYA 3MF0A 5FL3A 1K57C 3L9KA 1CJFA 1SKFA 3GDIA 4R23A 1XJ3A 1YSQA 2HGVA 3E98A 5FATA 3OC2A 3MR0A 4X68A 1CK3A 1YQSA 3IHBA 1O7EA 3I7JA 3ITBA 3L7HA 2PYRA 5CHMA 4X53A 1PZPA 5HDSA 3LIFA 2FZ0A 2W3FA 1S1ZA 4ZBEA 3CI6A 1NZOA 4GOGA 4Q0IA 1NYYA 4K0XA 1F98A 2P7JA 1K6RA 1MXOA 3NECA 4GJ4A 1K6SA 4L9GA 1VETA 5HWTA 4AFIA 3CLOA 4ETZA 2V20A 5EE8A 1H3QA 1S0WA 2MJ6A 2JCHA 4LPZA 2VEAA 1TS0A 3D4FA 3S4XA 1Y28A 3FYZA 3NULA 4JLFA 3LO7A 4MLLA 4OPQA 5CXWA 1DJCA 4MBHA 1H8YA 2HP6A 4XXRA 3AGFA 1PI4A 1F2KA 2X01A 5EPHA 5DF9A 4UA6A 2ZOIA 2P9VB 2PBDP 3DWZA 1LL5A 1JNUA 3VV4A 4BD0A 2L4RA 3EEHA 2JKRM 2BLSA 3LYXA 2YKFA 2Z6CA 2KLIA 2OAQ1 1BLHA 2Z2LB 2NUPC 4E04A 3SW1A 3NIAA 3RH8B 5GLCA 5FQQA 1XGJA 4QY5A 4YFMA 2KDKA 2A24B 4LV2A 5EM0A 4EQ1A 1T1AA 3UY6A 3JVVA 4S2OA 4K08A 1ZG4A 4QPRA 5JYOA 2QZ6A 1V9YA 2XF3A 2ZBBA 3DWKA 4K0WA 1T19A 1UWNX 3UE1A 1NWZA 2OSUA 4RX3A 2HDRA 3BFFA 4GD8A 4NETA 3UB7A 5JYPA 2J9OA 1OPXA 1PWGA 5HSQA 1LSXA 2W0NA 4HH2A 1DP9A 2KOIA 4DF6A 3T1SA 1P0ZA 3GV9A 4DRTA 4I39A 1N9NA 4HP4A 4ZJ3A 4U3TA 4IUHA 3W2ZA 4KZ6A 5IT5A 5CGXA 1H5XA 3KSHA 4OLDA 4Z9QA 5CRFA 4BQMA 4HESA 3SS5A 1F9IA 3ISGA 1YLZA 3JVUA 5EM1A 1OTAA 3WS4A 1GCEA 2YKHA 4GDBA 5HZHA 2DCFA 4JXVA 4LRXC 3V5MA 2ZC5B 1RGYA 3BY8A 3Q82A 4N9KA 1W63M 3ZG5A 3ZVTA 2LB5A 4EEUA 3QP8A 3S22A 4MNRA 3ZG7B 4FOFA 5AQBA 1OMEA 1XFQA 4OLGA 2A2LA 2LB9A 1HTZA 1BLCA 4JKTA 3G30A 1EWZA 1YMXA 1SDEA 1M6KA 2OV5A 4OH0A 4LFUA 4R4SA 1N9BA 4QB8A 2Y2OA 2Y2HA 3AGEA 1ES4A 2XGNA 2ZC4B 3NHQA 2HP9A 3F1NA 3RTYA 1PW8A 4QY6A 5CEBA 3HLFA 4M4XA 2CMNA 3PBNA 3OPPA 4N1HA 1K57A 5AVFA 1JWVA 4WZ5C 4WUJA 2VGLS 1S66L 1XX2A 3IS2A 3UMDA 2V2FF 4RX2A 1ES3A 3VFFA 1SDNA 5GHXA 1XJ6A 2XA7S 2OAP1 1EI5A 2B95A 4U0TA 3V3SA 3V50A 2R9WA 4ARZB 1VEUB 1T18A 2Q9NA 3PBTA 5DF8A 3OPRA 3JPUA 1BULA 4E3KA 5EOOA 1E3UA 5IS1A 3C38A 1MPLA 4HJ6A 1X0OA 4GW9A 4OQGA 4WBGA 4R3BA 1J3WA 1BZAA 1ZG6A 3IX8A 3C4PA 5F83A 5EV0A 1G28A 4EW7A 2IWCA 5CGSA 4B4ZA 1FCNA 5TFQA 3Q7ZA 2WGVA 4CLCB 1NRFA 3AGDA 3BW6A 4FTXA 1IKIA 1EW0A 3BLSA 2ZJ9A 3TOIA 3QNBA 4B93A 2ZM8A 3O87A 4LLOB 2J3TD 3UB8A 2EX8A 3P7NA 2Y2IA 4X1MA 4KZ3A 3LEZA 4S2NC 3BYDA 4EBLA 2PD8A 3IBJA 2P04A 3G2YA 2XA7M 4WLAA 5HAQA 1LI0A 4YOFA 4Y0OA 5A8BA 1NJ4A 3Q07A 3MXQA 3KSIA 4EU0A 3BFGA 4MMNA 1VETB 4N1XA 4ZAMA 2WKRA 1YLWA 2V1BA 3NCKA 3UDXA 4KZBA 4BL2A 1M40A 3QP6A 3EWKA 2W27A 4X56A 1ACFA 2PRFA 2V0WA 4KZ5A 1ONGA 4NXFA 1E3UD 4GDNA 3C5AA 3BY9A 3G34A 2ZMAA 3GTCA 1TDGA 4H6JA 3VOYA 4GLQA 3MZFA 1K56D 4U0XA 3C8CA 5A91A 1T1CA 1MC0A 1PYYA 3GECA 1IKGA 5CGWA 1E25A 4I5SA 4Y5FA 4IHQA 3F1PA 3BECA 1MKMA 1W8QA 3C7UA 3CUEC 5G4ZA 4MDZA 3SS3A 2B18A 4IBXA 2ZLYA 4GNUA 2KX6A 3LFVA 2B5RA 3P09A 5FA7A 3VP2A 5CTNA 2VZWA 5DKLA 5E43A 3UB6A 2QYBA 4Y7PA 3UE0A 1VM1A 3FZCA 4DJ2A 3TG9A 4H8RA 1RGZA 3OOVA 4OONA 3R4KA 1N4OA 4YWZA 3UDFA 3V67A 2Y2KA 4DE3A 3E4OA 2W3DA 2VGLM 3BWLA 1J9MA 4M3KA 2J3TC 4X1LA 2G2UA 2JKRI 3HUNA 1VHMA 5HD5A 2PDRA 1W79A 4MCWA 4FSFA 3NOPC 4BMWA 2VKSA 3D9YA 4R3AA 4C3QA 4EEPA 5FQJA 3QP2A 2Y2LA 2PT7A 1S6RA 4GHIB 2VA0A 4IJGA 3ZFZA 4OP5A 4ZTKA 4R0QA 3U2AA 2CC1A 3TW8A 1Q2QA 3CPTB 1IYSA 4P0MA 1JWZA 3H9WA 2O9BA 2HDUA 2WK0A 2WGIA 4NKPA 2HZ5A 4DE0A 3NOUC 2W3GA 2ZQ9A 4E3MA 4L9FA 3VE3A 1HVBA 4FUWA 3FPVA 5CHUA 4ARZA 3F1OB 3G6OA 5M18A 1OTIA 2D01A 1D7EA 3LR5A 2AVXA 5A92A 2DRWA 3LY4A 1YLTA 2EXAA 1AWIA 5CX7A 1K38A 2HP5A 4LRYC 4KZ7A 4R3JA 1GA9A 3FKWA 2ZQCA 3VFHA 2WKIA 4Q0HA 3HLGA 4EERA 3MSHA 4EUZA 3SOIA 2V1AA 3LR4A 4JF5A 1BLPA 5DJTA 3KYQA 3HUOA 3T1QB 3A0VA 4C6YA 1SKOA 3DTIA 4Z1WA 4DN0A 2L0WA 3LI9A 2GZAA 4F3LB 3IWOA 4WELA 5TGFA 3BFEA 2XD5A 1L2SA 5E2EA 2C6WB 1OT9A 4BENA 3NI9A 3VP1A 3SH7A 3BFDA 3F1PB 3UE3A 2OOLA 3HUMA 5U47A 3U4LP 2IA2A 4IBRA 4IVIA 3BFCA 2J8YA 1MZUA 3D3OA 3N7WA 4WEKA 2Y2QA 2XH9A 5HW3A 4DXBA 1DP6A 2JHEA 4KUKA 4LGWA 4Y13A 4KUOA 3UN7A 3MQ0A 5C5KA 2V9AA 2VLGA 5EVID 1MBLA 3KSFA 3PXPA 3GR2A 2ZQ7A 1ODVA 2J3WA 3UO9A 4RQ9A 1KE4A 3M2JA 5CTMA 4S2KA 5EVIA 2PU4A 2Q9MA 3VOZA 4GHIA 3T4LA 4JGPA 2K2NA 3SZTA 4ESPA 3TE8A 1O07A 3CWFA 4EQIA 1H8ZA 2PHYA 4S2LA 2I9VA 1ZTUA 3SS4A 3QP4A 1ESIA 3QP1A 1KE0A 3MKEA 2WAFA 3S7PA 3F1OA 3IHAA 4HOIA 3IX3A 4WL9A 2Y2GA 1VQQA 1G6AA 4HHDA 4UA9A 4II7A 2JKTM 3NY4A 4EBPA 2JKTI 1JTDA 1OTEA 4Q0JA 1LT0A 4ZRRA 3ZG9B 2WKQA 3OLOA 1XA1A 4HI4A 5DVAA 4OQHA 4KG5A 1YAXA 4CLCD 5AJGA 4WN5A 5K5BA 4BBTA 1IYQA 3W4OA 1TS8A 5AVEA 1KGFA 1TS6A 2P74A 2C5WB 4P6ZM 4OPZA 4OOMA 3T4OA 2R9XA 3Q81A 2Y79A 2NUTC 5HDCA 1WA9A 3QNCA 2L1MA 3ICYA 5HL1A 5FDSA 3Q1FA 4F3LA 1E4DA 3VP4A 2Y55A 4JXSA 2G2WA 2EXBA 4E3JA 4KZ4A 5FSRA 2Q0OA 1BUEA 3DTEA 3T4KA 2QJ5A 3GMWA 1LL9A 2EX9A 5DF7A 2HPBA 3LI8A 2ZOHA 2P9VA 1XJ4A 4OVDA 5HPIA 2EFXA 5HX9A 5CEDA 4Y2FA 1NYMA 1DY6A 4Y17A 3G32A 4NXEA 4DE1A 2O9AA 2VV6A 5FI6A 1L0FA 4XT2A 2OWHA 4HBTA 4WEJA 3MBZA 3EQVA 3DW0A 1PZOA 3BQAA 3MQQA 2H0YA 3T4QA 4F94A 1V9ZA 1GHMA 3ZYTA 5FQ9A 4BL3A 5I94A 3DTKA 3LIBA 2Y91A 5EVIB 4PM9A 5TR7A 3CZDA 4NXBA 4JPMA 2W3EA 4P6BA 5GHYA 3LR0A 1FIKA 1GHPA 5EUAA 3PTEA 2J9PA 3IXBA 5D3OA 4GZBA 1K55C 4HJ4A 3BLMA 5AQ7A 3RJUA 3WS1A 3A3FA 4Y15A 5EFWA 1Q2PA 4QD4A 4LV0A 5I5LA 3PBOA 4G3WA 1S67L 3UB5P 1TD5A 2JBFA 4KG2A 4IEDA 4I3IA 1DJAA 5HARA 3B33A 5HAPA 3G4PA 3O88A 3N4IA 3IF6A 3O5YA 1TEMA 4X55A 1ERQA 2ZD8A 2O99A 3H82B 3MZEA 2H28A 5FASA 2JE5A 2PYPA 1YMSA 2WGWA 3GSGA 3CJMA 4FCFA 4EESA 2IWBA 3IF6B 1H0MA 3UB9A 3KYEA 1LLBA 3WRTA 2OLVA 3LIEA 5F68A 3T1XA 2Z2MB 4L0LA 5DFYA 3H7WA 4IUKA 1NY0A 3CITA 1BT5A 1JVJA 2ZQDA 4Y3IA 1IFQA 2Y8HA 3KO6A 5TJJA 3LEQA 5L07A 1PWCA 4BBVA 3EGDC 4LENA 1T1BA 2A49A 4BLMA 1MWRA 1DP8A 4MBFA 4QU3A 1KOUA 4PM6A 3MKFA 5MC7A 1XP4A 3LY3A 1FOFA 2ZM2A 4I3AA 5AQAA 2WADA 3DTMA 2XK1A 2VV7A 4WMCA 1I2SA 5EOEA 5E2HA 2V1ZA 2VK3A 4WMCD 4LV1A 4R4RA 2VJWA 5CERA 4DKIA 3IXDA 2OWJA 3MFXA 5KSCA 3B47A 3NBLA 4DXCA 4JXGA 2EX6A 1NXYA 5J7EA 3NDEA 1TS7A 1K25A 5IU1A 5HWWA 3NC8A 3HVFA 5TBMA 1GSXA 3PR6A 4NEED 1XFNA 1PI5A 4EUVA 3OPHA 5L09A 1LI9A 3PHYA 4LRZE 3HJIA 5G4YA 2ZMVA 2O0YA 3VP0A 2WUQA 2UV0E 1STZA 3QP5A 3NDGA 3E0YA 2VGKA 3IWQA 4QHCA 3MFDA 3A3JA 2ZC3B 1W7FA 4ID4A 2HF6A 5KMWA 3LICA 4PKYA 4FH4A 1ONHA 1DJBA 4WYYA 1KDSA 1ES5A 1F5MA 3VMAA 4MN6A 3KSGA
chains in the Genus database with same CATH topology
1SZVA 3MSHA 5EM0A 3T1RA 1VEUA 1VEUB 2BTFP 2V8CA 2VK3A 3T12B 3KYEA 1F2KA 1A0KA 2HZ5A 5EV0A 2ZL1B 1Y4OA 1HLUP 2JKFA 1PNEA 3D9YA 1AWIA 1Z09A 2PAVP 1CJFA 1VETB 3L9KA 5EVEA 5EM1A 4X1LA 4D60A 3CPTA 5FDSA 5FEFA 4X1MA 4X25A 3T1XA 2ACGA 1YPRA 3T1QB 3DAVA 1SKOA 2PBDP 2E8JA 3LGOA 5FEGA 4FUWA 4QWOA 4FTXA 1D1JA 3UB5P 1PFLA 3NULA 1CQAA 3NECA 1K0KA 3CHWP 4ESPA 3MS6A 1FILA 2V8FA 3CPTB 1FIKA 2ZL1A 3T1SA 1VETA 1ACFA 1CF0A 2PRFA 3U4LP 1G5UA 1PRQA 1J3WA 3L7HA 2B95A 2JKGA 1SKOB 3LEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZV A;  3MSH A;  5EM0 A;  3T1R A;  1VEU A;  1VEU B;  2BTF P;  2V8C A;  2VK3 A;  3T12 B;  3KYE A;  1F2K A;  1A0K A;  2HZ5 A;  5EV0 A;  2ZL1 B;  1Y4O A;  1HLU P;  2JKF A;  1PNE A;  3D9Y A;  1AWI A;  1Z09 A;  2PAV P;  1CJF A;  1VET B;  3L9K A;  5EVE A;  5EM1 A;  4X1L A;  4D60 A;  3CPT A;  5FDS A;  5FEF A;  4X1M A;  4X25 A;  3T1X A;  2ACG A;  1YPR A;  3T1Q B;  3DAV A;  1SKO A;  2PBD P;  2E8J A;  3LGO A;  5FEG A;  4FUW A;  4QWO A;  4FTX A;  1D1J A;  3UB5 P;  1PFL A;  3NUL A;  1CQA A;  3NEC A;  1K0K A;  3CHW P;  4ESP A;  3MS6 A;  1FIL A;  2V8F A;  3CPT B;  1FIK A;  2ZL1 A;  3T1S A;  1VET A;  1ACF A;  1CF0 A;  2PRF A;  3U4L P;  1G5U A;  1PRQ A;  1J3W A;  3L7H A;  2B95 A;  2JKG A;  1SKO B;  3LEQ A; 
#chains in the Genus database with same CATH topology
 3WWX A;  2D02 A;  4B9O A;  2WKH A;  3T4T A;  3W8K A;  2HV1 A;  2XRO A;  4CLC E;  1KVL A;  4KQR A;  1YSP A;  4DDY A;  4CJN A;  1CF0 A;  4JGO A;  3MMH A;  4JF4 A;  2JKG A;  4MN7 A;  2DNS A;  1AXB A;  2XFT A;  3K2N A;  4CQH A;  4B4X A;  1WYC A;  4G3V A;  1TDL A;  1W5D A;  3OPL A;  1CEF A;  1U60 A;  3C7V A;  4HNB A;  1LL8 A;  2HJE A;  3PYP A;  2O9C A;  4I3J A;  1IYO A;  3KYZ A;  5M1A A;  2PR5 A;  4OQI A;  5J8X A;  5HD3 A;  4NG2 A;  3BEB A;  2G7U A;  5CHJ A;  4C75 A;  5F69 A;  2RL3 A;  1K54 A;  1ERM A;  2E8J A;  1CEG A;  3LGO A;  4DJ3 A;  3UME A;  4P87 A;  4H6J B;  4K91 A;  3QHY A;  3C30 A;  4FH2 A;  4S2N A;  1XKZ A;  3D72 A;  5IHV A;  3SH9 A;  1MWS A;  4JXW A;  4X69 A;  4O8G A;  1DRM A;  4CPK A;  2W1R A;  1ALQ A;  5E2F A;  2Y2M A;  1YLY A;  2E8I A;  1D06 A;  3S7N A;  2WZZ A;  3S7O A;  5LBR A;  5J4E A;  1TF1 A;  4KEN B;  5FQM A;  3HCY A;  3PBQ A;  5FQI A;  5GLB A;  2ZM0 A;  3ZVW A;  4JGR A;  5GLA A;  2GX5 A;  1W8Y A;  4WZ4 A;  5EVL A;  4JGQ A;  3W4P A;  3T12 B;  1XGI A;  4OQ0 A;  3UPP A;  2Z6D A;  3K3D A;  3MQO A;  1Z6F A;  2EWV A;  4ZJ1 A;  4A5R A;  4KZA A;  1CI8 A;  1G5U A;  4KQQ A;  3NOT C;  3Q7V B;  3ZCZ A;  5M19 A;  4KZ9 A;  3IH9 A;  2XFS A;  1FQG A;  4ME4 A;  1ES2 A;  2Y4A A;  3UPO A;  2QJ7 A;  3HLW A;  2OLU A;  1JTG A;  5FAP A;  3Q7V A;  4HQA A;  3R7W B;  1VEU A;  4UA7 A;  4EET B;  1HLU P;  3UE6 A;  2FFY A;  3G2Z A;  4GKU A;  4LCM A;  5GHZ A;  4PKY G;  2ZMF A;  1GHI A;  1Y54 A;  3CUE A;  3HLD A;  3ZDJ A;  4Q8I A;  3ZG8 B;  4RYE A;  4NXG A;  3E4P A;  3M6B A;  3DBA A;  1H8M A;  1YPR A;  3DAV A;  5L10 A;  2WYX A;  4OPR A;  2Y2J A;  1CI9 A;  2QWS A;  5HDD A;  1GSW A;  4OP8 A;  1XA7 A;  4Y0U A;  1ERO A;  3ZGA B;  2Y59 A;  1ZHH B;  3IXG A;  3PAE A;  2K7S A;  1QMF A;  5FI7 A;  1RCJ A;  1GA0 A;  1FSW A;  4HJ3 A;  3OBF A;  2XLN A;  5F5Y A;  4PM8 A;  4MEZ A;  2ZL1 A;  2EA9 A;  1N9O A;  5AQ9 A;  1SKO B;  4BWI A;  2WZX A;  2XR0 A;  4KQD A;  1Z09 A;  1N9L A;  4D60 A;  2HDS A;  3NJA A;  5J3W A;  4E6W A;  3GVB A;  4UAA A;  2VX8 A;  5TBM B;  5FEG A;  4E3L A;  2UWX A;  5F1F A;  3FWL A;  5G18 A;  4Y0T A;  4PAU A;  2JC7 A;  4GN2 A;  2J80 A;  3VE4 A;  4N92 A;  2B02 A;  1K4E A;  2V8C A;  2VGJ A;  1G68 A;  1BLS A;  1K55 A;  4ZJ2 A;  1PNE A;  4WM9 A;  2Y2N A;  1KGG A;  3PBR A;  2R78 A;  3IS2 B;  3UNW A;  4KG6 A;  4QWO A;  1BYW A;  4UHU A;  2RCX A;  2XRN A;  3HL9 A;  1KE3 A;  1L3L A;  3S7Q A;  4KQO A;  3FG8 A;  1JWP A;  3T1R A;  2INW A;  3OCL A;  5DJU A;  1FR6 A;  5BOH A;  2JKF A;  3OZH A;  1KDW A;  4OKP A;  2Y2P A;  1XPB A;  3G31 A;  4KZ8 A;  3UDI A;  5F6A A;  3M2K A;  3IT9 A;  3IF5 A;  3S1Y A;  3A3I A;  3IBR A;  3GQZ A;  1LSV A;  2ZC6 B;  5FAO A;  4BBU A;  4ETX A;  5KSH A;  4DE2 A;  4E3N A;  5L8M A;  1FCO A;  1NRJ A;  3BQ8 A;  1S4S A;  1UGU A;  3MJQ A;  1FR1 A;  4UQI S;  4XUZ A;  5HFO A;  4LCL A;  2ZQ8 A;  5FI2 A;  3CMZ A;  3MXR A;  4GD6 A;  1TVF A;  3B3X A;  1LSW A;  3BM6 A;  1PRQ A;  4WZ5 A;  3N8L A;  4DDS A;  4EBN A;  1ZC2 A;  1PIO A;  4HY8 A;  2PD7 A;  3BJN A;  4YNR A;  2BG1 A;  3LUQ A;  1UWP X;  2ACG A;  2M1C A;  3A0S A;  4GS9 B;  5DTT A;  3A3E A;  1WE4 A;  2GJ3 A;  3BRM A;  3HRE A;  4PM5 A;  3CHW P;  3WS2 A;  3IX4 A;  1K4F A;  3O86 A;  2ZC7 A;  4XUX A;  2H5S A;  1KGE A;  4S2I A;  1GSV A;  2PU2 A;  3E2K A;  3N8R A;  3GRJ A;  3FKV A;  5DTS A;  1PFL A;  3R7W A;  4EWF A;  3FV7 A;  2VV8 A;  2X02 A;  1C3B A;  1P97 A;  4HP9 A;  2EWW A;  2PR6 A;  3HBR A;  3OCN A;  1VB6 A;  1A0K A;  3ULF A;  4E6X A;  4I38 A;  1OTB A;  5L2F A;  4S2P A;  3EGX C;  2EFU A;  4X25 A;  4PMA A;  4NK3 A;  2M7U A;  2V0U A;  4LV3 A;  4HH3 A;  2WGW B;  3K3C A;  1FIL A;  2WKP A;  3MS6 A;  3PBS A;  1RP5 A;  4O01 A;  2ZQA A;  4D2O A;  3IWI A;  5KZH A;  1SCW A;  1L0G A;  4R1G A;  1BTL A;  3SH8 A;  4PPR A;  3PAG A;  3A0R A;  5FEF A;  1ESU A;  3H7W B;  2JN7 A;  3RFB A;  2J7V A;  5E2G A;  4BJP A;  1CQA A;  1K0K A;  4R38 A;  4PM7 A;  3WS5 A;  3P98 A;  4X6T A;  3TRC A;  5EVI C;  4L9E A;  1SZV A;  3FPW A;  2BTF P;  5HPF A;  3KX0 X;  3ZNY A;  2W3H A;  4BD1 A;  1NZU A;  2XD1 A;  1L0E A;  4MBK A;  3O3V A;  2GDN A;  2EX2 A;  2HDQ A;  3M6H A;  4CLC A;  3F1N B;  4R70 A;  4RA7 A;  3CAX A;  1ZKJ A;  4B88 A;  5HL6 A;  3A3D A;  1I5Q A;  2W1T A;  2QPN A;  3TSG A;  1P9W A;  1Y4O A;  2XQZ A;  5DKK A;  3VSK A;  2PAV P;  1YM1 A;  5EVE A;  3RXX A;  1S4R A;  2FH5 A;  3WRZ A;  4DMZ A;  4PHT A;  1PW1 A;  2H10 A;  3B42 A;  3T4J A;  4UEY A;  2X71 A;  2DMW A;  4RVA A;  1MWT A;  4R6L A;  1L0D A;  2M7V A;  5HWV A;  3HLC A;  4HBU A;  2A3U A;  4OOL A;  1HD8 A;  1WYB A;  2W1T B;  1G6O A;  3IH8 A;  4OOY A;  3HLE A;  2K31 A;  3ZNT A;  5FAQ A;  1PWD A;  3IF6 C;  4O0P A;  2XSS A;  1BSG A;  4S2M A;  3N6I A;  1YLP A;  5GL9 A;  2FFF B;  2WKE A;  3P01 A;  4GS9 A;  5F82 A;  4S2J A;  5HAI A;  3EOI A;  4GCZ A;  3H82 A;  2ZL1 B;  1MY8 A;  3LIA A;  2I72 A;  3C2W A;  3V39 A;  3VSL A;  4G3K A;  5CEC A;  1QME A;  2QKP A;  4YIN A;  5A90 A;  5KIZ A;  4GB7 A;  4QJG A;  1NLZ A;  2H0T A;  1SHV A;  5EEC A;  1YT4 A;  3RXW A;  5GLD A;  3FC7 A;  1IOU A;  4CLC C;  3E2L A;  3HLB A;  2P08 A;  4HEF A;  3G35 A;  1I2W A;  1MWU A;  2QHK A;  3CPT A;  4JBF A;  2GNX A;  3N8S A;  1FCM A;  1K54 C;  5A93 A;  4HIA A;  3T50 A;  4P85 A;  2XDM A;  3UPN A;  3IXH A;  1K56 A;  4O7D A;  4E3I A;  1IYP A;  1OTD A;  1IEL A;  4P6Z S;  3WS0 A;  2IWD A;  3E4Q A;  1IEM A;  4MN5 A;  5DTK A;  2QMI A;  3EQU A;  4N9L A;  4XT2 B;  5F1G A;  3VP3 A;  1HZO A;  1YKD A;  1W63 Q;  1OJ5 A;  3W4Q A;  4UQI M;  4OPY A;  4EXO A;  3IQA A;  1XJ2 A;  3ITA A;  3VOL A;  2PBY A;  3MZD A;  1XXM A;  3MXS A;  2HJ9 C;  3LID A;  1S1Y A;  4IVK A;  2BAS A;  3C4O A;  5DFX A;  1D1J A;  4FD8 A;  2WAE A;  1NLY A;  3ZHH A;  3ZG0 A;  2A24 A;  4WF0 A;  3CG5 A;  1YLJ A;  3TJZ C;  4ZDX A;  1OT6 A;  1P9R A;  3JYI A;  5FDH A;  3LCE A;  3LR3 A;  4E3O A;  3EEA A;  5FQK A;  1FSY A;  3ZQ5 A;  2V8F A;  1MKI A;  4JF6 A;  2XEP A;  3V3R A;  1OJG A;  4EV4 A;  3HJK A;  3T4S A;  1KVM A;  1LHY A;  3MF0 A;  5FL3 A;  1K57 C;  3L9K A;  1CJF A;  1SKF A;  3GDI A;  4R23 A;  1XJ3 A;  1YSQ A;  2HGV A;  3E98 A;  5FAT A;  3OC2 A;  3MR0 A;  4X68 A;  1CK3 A;  1YQS A;  3IHB A;  1O7E A;  3I7J A;  3ITB A;  3L7H A;  2PYR A;  5CHM A;  4X53 A;  1PZP A;  5HDS A;  3LIF A;  2FZ0 A;  2W3F A;  1S1Z A;  4ZBE A;  3CI6 A;  1NZO A;  4GOG A;  4Q0I A;  1NYY A;  4K0X A;  1F98 A;  2P7J A;  1K6R A;  1MXO A;  3NEC A;  4GJ4 A;  1K6S A;  4L9G A;  1VET A;  5HWT A;  4AFI A;  3CLO A;  4ETZ A;  2V20 A;  5EE8 A;  1H3Q A;  1S0W A;  2MJ6 A;  2JCH A;  4LPZ A;  2VEA A;  1TS0 A;  3D4F A;  3S4X A;  1Y28 A;  3FYZ A;  3NUL A;  4JLF A;  3LO7 A;  4MLL A;  4OPQ A;  5CXW A;  1DJC A;  4MBH A;  1H8Y A;  2HP6 A;  4XXR A;  3AGF A;  1PI4 A;  1F2K A;  2X01 A;  5EPH A;  5DF9 A;  4UA6 A;  2ZOI A;  2P9V B;  2PBD P;  3DWZ A;  1LL5 A;  1JNU A;  3VV4 A;  4BD0 A;  2L4R A;  3EEH A;  2JKR M;  2BLS A;  3LYX A;  2YKF A;  2Z6C A;  2KLI A;  2OAQ 1;  1BLH A;  2Z2L B;  2NUP C;  4E04 A;  3SW1 A;  3NIA A;  3RH8 B;  5GLC A;  5FQQ A;  1XGJ A;  4QY5 A;  4YFM A;  2KDK A;  2A24 B;  4LV2 A;  5EM0 A;  4EQ1 A;  1T1A A;  3UY6 A;  3JVV A;  4S2O A;  4K08 A;  1ZG4 A;  4QPR A;  5JYO A;  2QZ6 A;  1V9Y A;  2XF3 A;  2ZBB A;  3DWK A;  4K0W A;  1T19 A;  1UWN X;  3UE1 A;  1NWZ A;  2OSU A;  4RX3 A;  2HDR A;  3BFF A;  4GD8 A;  4NET A;  3UB7 A;  5JYP A;  2J9O A;  1OPX A;  1PWG A;  5HSQ A;  1LSX A;  2W0N A;  4HH2 A;  1DP9 A;  2KOI A;  4DF6 A;  3T1S A;  1P0Z A;  3GV9 A;  4DRT A;  4I39 A;  1N9N A;  4HP4 A;  4ZJ3 A;  4U3T A;  4IUH A;  3W2Z A;  4KZ6 A;  5IT5 A;  5CGX A;  1H5X A;  3KSH A;  4OLD A;  4Z9Q A;  5CRF A;  4BQM A;  4HES A;  3SS5 A;  1F9I A;  3ISG A;  1YLZ A;  3JVU A;  5EM1 A;  1OTA A;  3WS4 A;  1GCE A;  2YKH A;  4GDB A;  5HZH A;  2DCF A;  4JXV A;  4LRX C;  3V5M A;  2ZC5 B;  1RGY A;  3BY8 A;  3Q82 A;  4N9K A;  1W63 M;  3ZG5 A;  3ZVT A;  2LB5 A;  4EEU A;  3QP8 A;  3S22 A;  4MNR A;  3ZG7 B;  4FOF A;  5AQB A;  1OME A;  1XFQ A;  4OLG A;  2A2L A;  2LB9 A;  1HTZ A;  1BLC A;  4JKT A;  3G30 A;  1EWZ A;  1YMX A;  1SDE A;  1M6K A;  2OV5 A;  4OH0 A;  4LFU A;  4R4S A;  1N9B A;  4QB8 A;  2Y2O A;  2Y2H A;  3AGE A;  1ES4 A;  2XGN A;  2ZC4 B;  3NHQ A;  2HP9 A;  3F1N A;  3RTY A;  1PW8 A;  4QY6 A;  5CEB A;  3HLF A;  4M4X A;  2CMN A;  3PBN A;  3OPP A;  4N1H A;  1K57 A;  5AVF A;  1JWV A;  4WZ5 C;  4WUJ A;  2VGL S;  1S66 L;  1XX2 A;  3IS2 A;  3UMD A;  2V2F F;  4RX2 A;  1ES3 A;  3VFF A;  1SDN A;  5GHX A;  1XJ6 A;  2XA7 S;  2OAP 1;  1EI5 A;  2B95 A;  4U0T A;  3V3S A;  3V50 A;  2R9W A;  4ARZ B;  1VEU B;  1T18 A;  2Q9N A;  3PBT A;  5DF8 A;  3OPR A;  3JPU A;  1BUL A;  4E3K A;  5EOO A;  1E3U A;  5IS1 A;  3C38 A;  1MPL A;  4HJ6 A;  1X0O A;  4GW9 A;  4OQG A;  4WBG A;  4R3B A;  1J3W A;  1BZA A;  1ZG6 A;  3IX8 A;  3C4P A;  5F83 A;  5EV0 A;  1G28 A;  4EW7 A;  2IWC A;  5CGS A;  4B4Z A;  1FCN A;  5TFQ A;  3Q7Z A;  2WGV A;  4CLC B;  1NRF A;  3AGD A;  3BW6 A;  4FTX A;  1IKI A;  1EW0 A;  3BLS A;  2ZJ9 A;  3TOI A;  3QNB A;  4B93 A;  2ZM8 A;  3O87 A;  4LLO B;  2J3T D;  3UB8 A;  2EX8 A;  3P7N A;  2Y2I A;  4X1M A;  4KZ3 A;  3LEZ A;  4S2N C;  3BYD A;  4EBL A;  2PD8 A;  3IBJ A;  2P04 A;  3G2Y A;  2XA7 M;  4WLA A;  5HAQ A;  1LI0 A;  4YOF A;  4Y0O A;  5A8B A;  1NJ4 A;  3Q07 A;  3MXQ A;  3KSI A;  4EU0 A;  3BFG A;  4MMN A;  1VET B;  4N1X A;  4ZAM A;  2WKR A;  1YLW A;  2V1B A;  3NCK A;  3UDX A;  4KZB A;  4BL2 A;  1M40 A;  3QP6 A;  3EWK A;  2W27 A;  4X56 A;  1ACF A;  2PRF A;  2V0W A;  4KZ5 A;  1ONG A;  4NXF A;  1E3U D;  4GDN A;  3C5A A;  3BY9 A;  3G34 A;  2ZMA A;  3GTC A;  1TDG A;  4H6J A;  3VOY A;  4GLQ A;  3MZF A;  1K56 D;  4U0X A;  3C8C A;  5A91 A;  1T1C A;  1MC0 A;  1PYY A;  3GEC A;  1IKG A;  5CGW A;  1E25 A;  4I5S A;  4Y5F A;  4IHQ A;  3F1P A;  3BEC A;  1MKM A;  1W8Q A;  3C7U A;  3CUE C;  5G4Z A;  4MDZ A;  3SS3 A;  2B18 A;  4IBX A;  2ZLY A;  4GNU A;  2KX6 A;  3LFV A;  2B5R A;  3P09 A;  5FA7 A;  3VP2 A;  5CTN A;  2VZW A;  5DKL A;  5E43 A;  3UB6 A;  2QYB A;  4Y7P A;  3UE0 A;  1VM1 A;  3FZC A;  4DJ2 A;  3TG9 A;  4H8R A;  1RGZ A;  3OOV A;  4OON A;  3R4K A;  1N4O A;  4YWZ A;  3UDF A;  3V67 A;  2Y2K A;  4DE3 A;  3E4O A;  2W3D A;  2VGL M;  3BWL A;  1J9M A;  4M3K A;  2J3T C;  4X1L A;  2G2U A;  2JKR I;  3HUN A;  1VHM A;  5HD5 A;  2PDR A;  1W79 A;  4MCW A;  4FSF A;  3NOP C;  4BMW A;  2VKS A;  3D9Y A;  4R3A A;  4C3Q A;  4EEP A;  5FQJ A;  3QP2 A;  2Y2L A;  2PT7 A;  1S6R A;  4GHI B;  2VA0 A;  4IJG A;  3ZFZ A;  4OP5 A;  4ZTK A;  4R0Q A;  3U2A A;  2CC1 A;  3TW8 A;  1Q2Q A;  3CPT B;  1IYS A;  4P0M A;  1JWZ A;  3H9W A;  2O9B A;  2HDU A;  2WK0 A;  2WGI A;  4NKP A;  2HZ5 A;  4DE0 A;  3NOU C;  2W3G A;  2ZQ9 A;  4E3M A;  4L9F A;  3VE3 A;  1HVB A;  4FUW A;  3FPV A;  5CHU A;  4ARZ A;  3F1O B;  3G6O A;  5M18 A;  1OTI A;  2D01 A;  1D7E A;  3LR5 A;  2AVX A;  5A92 A;  2DRW A;  3LY4 A;  1YLT A;  2EXA A;  1AWI A;  5CX7 A;  1K38 A;  2HP5 A;  4LRY C;  4KZ7 A;  4R3J A;  1GA9 A;  3FKW A;  2ZQC A;  3VFH A;  2WKI A;  4Q0H A;  3HLG A;  4EER A;  3MSH A;  4EUZ A;  3SOI A;  2V1A A;  3LR4 A;  4JF5 A;  1BLP A;  5DJT A;  3KYQ A;  3HUO A;  3T1Q B;  3A0V A;  4C6Y A;  1SKO A;  3DTI A;  4Z1W A;  4DN0 A;  2L0W A;  3LI9 A;  2GZA A;  4F3L B;  3IWO A;  4WEL A;  5TGF A;  3BFE A;  2XD5 A;  1L2S A;  5E2E A;  2C6W B;  1OT9 A;  4BEN A;  3NI9 A;  3VP1 A;  3SH7 A;  3BFD A;  3F1P B;  3UE3 A;  2OOL A;  3HUM A;  5U47 A;  3U4L P;  2IA2 A;  4IBR A;  4IVI A;  3BFC A;  2J8Y A;  1MZU A;  3D3O A;  3N7W A;  4WEK A;  2Y2Q A;  2XH9 A;  5HW3 A;  4DXB A;  1DP6 A;  2JHE A;  4KUK A;  4LGW A;  4Y13 A;  4KUO A;  3UN7 A;  3MQ0 A;  5C5K A;  2V9A A;  2VLG A;  5EVI D;  1MBL A;  3KSF A;  3PXP A;  3GR2 A;  2ZQ7 A;  1ODV A;  2J3W A;  3UO9 A;  4RQ9 A;  1KE4 A;  3M2J A;  5CTM A;  4S2K A;  5EVI A;  2PU4 A;  2Q9M A;  3VOZ A;  4GHI A;  3T4L A;  4JGP A;  2K2N A;  3SZT A;  4ESP A;  3TE8 A;  1O07 A;  3CWF A;  4EQI A;  1H8Z A;  2PHY A;  4S2L A;  2I9V A;  1ZTU A;  3SS4 A;  3QP4 A;  1ESI A;  3QP1 A;  1KE0 A;  3MKE A;  2WAF A;  3S7P A;  3F1O A;  3IHA A;  4HOI A;  3IX3 A;  4WL9 A;  2Y2G A;  1VQQ A;  1G6A A;  4HHD A;  4UA9 A;  4II7 A;  2JKT M;  3NY4 A;  4EBP A;  2JKT I;  1JTD A;  1OTE A;  4Q0J A;  1LT0 A;  4ZRR A;  3ZG9 B;  2WKQ A;  3OLO A;  1XA1 A;  4HI4 A;  5DVA A;  4OQH A;  4KG5 A;  1YAX A;  4CLC D;  5AJG A;  4WN5 A;  5K5B A;  4BBT A;  1IYQ A;  3W4O A;  1TS8 A;  5AVE A;  1KGF A;  1TS6 A;  2P74 A;  2C5W B;  4P6Z M;  4OPZ A;  4OOM A;  3T4O A;  2R9X A;  3Q81 A;  2Y79 A;  2NUT C;  5HDC A;  1WA9 A;  3QNC A;  2L1M A;  3ICY A;  5HL1 A;  5FDS A;  3Q1F A;  4F3L A;  1E4D A;  3VP4 A;  2Y55 A;  4JXS A;  2G2W A;  2EXB A;  4E3J A;  4KZ4 A;  5FSR A;  2Q0O A;  1BUE A;  3DTE A;  3T4K A;  2QJ5 A;  3GMW A;  1LL9 A;  2EX9 A;  5DF7 A;  2HPB A;  3LI8 A;  2ZOH A;  2P9V A;  1XJ4 A;  4OVD A;  5HPI A;  2EFX A;  5HX9 A;  5CED A;  4Y2F A;  1NYM A;  1DY6 A;  4Y17 A;  3G32 A;  4NXE A;  4DE1 A;  2O9A A;  2VV6 A;  5FI6 A;  1L0F A;  4XT2 A;  2OWH A;  4HBT A;  4WEJ A;  3MBZ A;  3EQV A;  3DW0 A;  1PZO A;  3BQA A;  3MQQ A;  2H0Y A;  3T4Q A;  4F94 A;  1V9Z A;  1GHM A;  3ZYT A;  5FQ9 A;  4BL3 A;  5I94 A;  3DTK A;  3LIB A;  2Y91 A;  5EVI B;  4PM9 A;  5TR7 A;  3CZD A;  4NXB A;  4JPM A;  2W3E A;  4P6B A;  5GHY A;  3LR0 A;  1FIK A;  1GHP A;  5EUA A;  3PTE A;  2J9P A;  3IXB A;  5D3O A;  4GZB A;  1K55 C;  4HJ4 A;  3BLM A;  5AQ7 A;  3RJU A;  3WS1 A;  3A3F A;  4Y15 A;  5EFW A;  1Q2P A;  4QD4 A;  4LV0 A;  5I5L A;  3PBO A;  4G3W A;  1S67 L;  3UB5 P;  1TD5 A;  2JBF A;  4KG2 A;  4IED A;  4I3I A;  1DJA A;  5HAR A;  3B33 A;  5HAP A;  3G4P A;  3O88 A;  3N4I A;  3IF6 A;  3O5Y A;  1TEM A;  4X55 A;  1ERQ A;  2ZD8 A;  2O99 A;  3H82 B;  3MZE A;  2H28 A;  5FAS A;  2JE5 A;  2PYP A;  1YMS A;  2WGW A;  3GSG A;  3CJM A;  4FCF A;  4EES A;  2IWB A;  3IF6 B;  1H0M A;  3UB9 A;  3KYE A;  1LLB A;  3WRT A;  2OLV A;  3LIE A;  5F68 A;  3T1X A;  2Z2M B;  4L0L A;  5DFY A;  3H7W A;  4IUK A;  1NY0 A;  3CIT A;  1BT5 A;  1JVJ A;  2ZQD A;  4Y3I A;  1IFQ A;  2Y8H A;  3KO6 A;  5TJJ A;  3LEQ A;  5L07 A;  1PWC A;  4BBV A;  3EGD C;  4LEN A;  1T1B A;  2A49 A;  4BLM A;  1MWR A;  1DP8 A;  4MBF A;  4QU3 A;  1KOU A;  4PM6 A;  3MKF A;  5MC7 A;  1XP4 A;  3LY3 A;  1FOF A;  2ZM2 A;  4I3A A;  5AQA A;  2WAD A;  3DTM A;  2XK1 A;  2VV7 A;  4WMC A;  1I2S A;  5EOE A;  5E2H A;  2V1Z A;  2VK3 A;  4WMC D;  4LV1 A;  4R4R A;  2VJW A;  5CER A;  4DKI A;  3IXD A;  2OWJ A;  3MFX A;  5KSC A;  3B47 A;  3NBL A;  4DXC A;  4JXG A;  2EX6 A;  1NXY A;  5J7E A;  3NDE A;  1TS7 A;  1K25 A;  5IU1 A;  5HWW A;  3NC8 A;  3HVF A;  5TBM A;  1GSX A;  3PR6 A;  4NEE D;  1XFN A;  1PI5 A;  4EUV A;  3OPH A;  5L09 A;  1LI9 A;  3PHY A;  4LRZ E;  3HJI A;  5G4Y A;  2ZMV A;  2O0Y A;  3VP0 A;  2WUQ A;  2UV0 E;  1STZ A;  3QP5 A;  3NDG A;  3E0Y A;  2VGK A;  3IWQ A;  4QHC A;  3MFD A;  3A3J A;  2ZC3 B;  1W7F A;  4ID4 A;  2HF6 A;  5KMW A;  3LIC A;  4PKY A;  4FH4 A;  1ONH A;  1DJB A;  4WYY A;  1KDS A;  1ES5 A;  1F5M A;  3VMA A;  4MN6 A;  3KSG A; 
#chains in the Genus database with same CATH homology
 1SZV A;  3MSH A;  5EM0 A;  3T1R A;  1VEU A;  1VEU B;  2BTF P;  2V8C A;  2VK3 A;  3T12 B;  3KYE A;  1F2K A;  1A0K A;  2HZ5 A;  5EV0 A;  2ZL1 B;  1Y4O A;  1HLU P;  2JKF A;  1PNE A;  3D9Y A;  1AWI A;  1Z09 A;  2PAV P;  1CJF A;  1VET B;  3L9K A;  5EVE A;  5EM1 A;  4X1L A;  4D60 A;  3CPT A;  5FDS A;  5FEF A;  4X1M A;  4X25 A;  3T1X A;  2ACG A;  1YPR A;  3T1Q B;  3DAV A;  1SKO A;  2PBD P;  2E8J A;  3LGO A;  5FEG A;  4FUW A;  4QWO A;  4FTX A;  1D1J A;  3UB5 P;  1PFL A;  3NUL A;  1CQA A;  3NEC A;  1K0K A;  3CHW P;  4ESP A;  3MS6 A;  1FIL A;  2V8F A;  3CPT B;  1FIK A;  2ZL1 A;  3T1S A;  1VET A;  1ACF A;  1CF0 A;  2PRF A;  3U4L P;  1G5U A;  1PRQ A;  1J3W A;  3L7H A;  2B95 A;  2JKG A;  1SKO B;  3LEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...