2VK3A

Crystal structure of rat profilin 2a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
142
structure length
142
Chain Sequence
GSMAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPAEIDVIIGKDREGFFTNGLTLGGKKCSVIRDSLYVDSDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN-2
publication title Structure, Modifications and Ligand-Binding Properties of Rat Profilin 2A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 46
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2vk3A00
2ZL1B 2ACGA 1Y4OA 2JKFA 2E8JA 3T12B 4X1MA 3D9YA 1VEUB 3CHWP 3T1RA 1K0KA 3MSHA 1YPRA 5FEGA 3NULA 1D1JA 2BTFP 1CF0A 1FIKA 2V8CA 4X1LA 5EV0A 3LEQA 1G5UA 1AWIA 1VETB 4FTXA 1PRQA 2PRFA 3LGOA 1FILA 5EVEA 1CJFA 5EM1A 3T1SA 1ACFA 1PNEA 1A0KA 4D60A 4FUWA 3L9KA 3KYEA 3CPTA 3U4LP 4QWOA 1SZVA 3L7HA 5FDSA 3UB5P 4ESPA 2ZL1A 2HZ5A 1J3WA 2B95A 3T1XA 1VEUA 3T1QB 4X25A 3NECA 1CQAA 5FEFA 1PFLA 1Z09A 2JKGA 1SKOA 2PAVP 5EM0A 1VETA 3MS6A 3CPTB 2VK3A 1SKOB 2PBDP 2V8FA 1HLUP 3DAVA 1F2KA
chains in the Genus database with same CATH superfamily
1MY8A 1L0EA 3NC8A 4U0XA 4GCZA 1BTLA 3D9YA 4XUXA 1K55C 3KYQA 3PHYA 4Y7PA 4S2KA 5FL3A 2Y2IA 4DF6A 2WYXA 1BSGA 4OPQA 2A3UA 4Y3IA 2NUTC 4E3IA 4R0QA 4R3JA 1KDSA 4U0TA 3T4QA 3OCNA 4JLFA 4B93A 1FILA 3LCEA 5AVEA 1F9IA 1H0MA 4PKYA 2QWSA 4NXBA 2VLGA 2VV7A 1N9OA 1XJ6A 2VKSA 4EWFA 3UDFA 5HZHA 1CK3A 5GHYA 4OPRA 4B9OA 3Q7VA 1DJBA 4S2LA 4KQQA 1MWTA 3R4KA 4DE1A 4BLMA 4CJNA 2WKEA 4F94A 5EVIB 4FSFA 1KVLA 5EPHA 3L7HA 1YLJA 1L0DA 3BFEA 4Q8IA 4GHIA 4GOGA 1TF1A 2XLNA 5EE8A 4M3KA 4S2NC 3GDIA 5DJUA 5J7EA 5CGWA 5FQJA 3UMEA 3HJIA 2H0YA 4NG2A 5A93A 4JXSA 2W3GA 1YSQA 5FQIA 3EGXC 4GS9B 4NK3A 5HL1A 2O9AA 1ONGA 2H10A 1BULA 2ACGA 4UQIM 4GN2A 4KG2A 3E2KA 2XD1A 2Y59A 1NXYA 5M18A 2BTFP 4QU3A 4E3OA 2J3WA 2V8CA 2P9VB 3UDXA 1E4DA 4DJ3A 3D4FA 4E6WA 3SS3A 3EEHA 2V2FF 1ZG4A 5F69A 5CXWA 5CHUA 3ZVTA 5EOEA 1WYCA 4BJPA 3MFDA 4PM6A 3WS1A 1T19A 5TGFA 3Q7ZA 2G2UA 3ULFA 3KYEA 3RXXA 1O7EA 4FCFA 4G3WA 4OONA 4KENB 2Z2LB 2H0TA 2HF6A 4GJ4A 2L0WA 2Y2KA 4MDZA 2W1TB 3JPUA 4I3IA 1ZKJA 3ZG9B 1VEUA 2ZC4B 3EOIA 2FFYA 2Y8HA 3WRZA 3N8LA 2QMIA 4X25A 2RCXA 1M6KA 4QB8A 3UE6A 4WMCA 1FQGA 3F1PA 4BBTA 1OTBA 1L2SA 3W4PA 2R9XA 5G4ZA 4PM8A 1V9ZA 1VETA 1S1ZA 4EXOA 5AJGA 4Y2FA 5FI6A 3CITA 2PBDP 1SCWA 4UEYA 1OTEA 3NOTC 3MXRA 2LB9A 1DP9A 2VGKA 5HARA 4EW7A 4I38A 4E3KA 1YMXA 2Z6CA 4RQ9A 1W7FA 5EUAA 3N7WA 3GSGA 2CMNA 4BD1A 4GW9A 3B42A 3LR4A 1TS7A 5A8BA 2C6WB 3QP8A 4H6JB 4HP9A 4O0PA 3OZHA 4MN6A 4BMWA 4Q0IA 3E4OA 5HX9A 4EBNA 3S7NA 4LV1A 1PRQA 3LIAA 4OOYA 2L4RA 3M6HA 3RJUA 3A3FA 1NWZA 2VZWA 5EVEA 3RH8B 3SH7A 1CJFA 1DJAA 2KX6A 3MQ0A 4RVAA 4ETZA 5J8XA 1MWUA 3VP3A 3E0YA 4GD6A 3BEBA 4D60A 1LHYA 1P97A 2PT7A 2OLUA 3UN7A 2W1RA 1OTAA 4NEED 3F1OA 5HWWA 1XGJA 2Q0OA 4FH4A 3VE4A 3ZCZA 3WRTA 4PKYG 1FCOA 4I3AA 4OLDA 1XP4A 4OP8A 2OAQ1 4K08A 3T1XA 2ZMAA 2J8YA 2KLIA 2I9VA 1CQAA 1ZTUA 4KZ7A 1KGEA 1L0FA 4WBGA 2D01A 2PAVP 1LT0A 4CQHA 4DDYA 1NLYA 1P9WA 3TOIA 3V5MA 5TBMB 2M7UA 2VK3A 2WGVA 1CEFA 4B4ZA 3FKWA 2EFXA 2EFUA 2JCHA 2O9BA 4IHQA 3IF6B 3FV7A 2JKFA 3IWIA 5F68A 2W3EA 3P7NA 3DTIA 3PTEA 5A90A 3IX4A 5AQ9A 4CLCA 5HAPA 1GHPA 1H8YA 1XJ4A 3PBRA 4EEUA 1AWIA 2Q9NA 3LFVA 2XROA 2VV8A 1AXBA 3UE0A 5FAQA 3ZG8B 4YWZA 2ZM0A 1K56A 4R3AA 3OBFA 1FCNA 4JPMA 5FA7A 3T1SA 4E3LA 5CTNA 3H7WB 3VE3A 4HEFA 1NY0A 3QP1A 4BBVA 1ERMA 2ZC3B 3RXWA 4NXEA 2HDSA 2A2LA 1ZC2A 4JF6A 5GLCA 3FYZA 2XA7S 1MKIA 4UA7A 4X56A 3NBLA 3QP5A 4OQ0A 5HWVA 3A0RA 4KZ3A 1FR1A 1PW1A 3T1QB 3UPPA 1Z09A 2W0NA 2JKGA 2HGVA 1DRMA 3CJMA 4JXWA 4BL2A 4LRXC 2M7VA 4UA6A 4OVDA 1EW0A 1IYSA 4EERA 2EX2A 1K55A 2VX8A 1P0ZA 1BT5A 5GLAA 4DE3A 2RL3A 4N9LA 2JKRI 3A0VA 4ZJ2A 3ISGA 2V0WA 3MSHA 5FDHA 1ALQA 4L9EA 2QJ5A 5EV0A 4R1GA 4LGWA 3NOUC 2QPNA 3EWKA 3PXPA 3C4OA 3V67A 3S7QA 3FZCA 3O87A 1SDNA 4KZ4A 1XA1A 3MKEA 4LV3A 1EI5A 4X55A 4PHTA 1DY6A 2WK0A 4EETB 4E3NA 1PNEA 2WAFA 4LENA 5KSCA 1PWGA 3SH9A 1W63Q 3DTKA 2O9CA 2A24A 1TEMA 2V0UA 4P6ZM 5DTKA 3GECA 2B5RA 1Y54A 1TS0A 3DWZA 2XQZA 4S2NA 3U4LP 3P01A 2J9PA 4DE2A 3PBNA 5AVFA 3M2JA 5FDSA 3LIBA 4OOMA 2XK1A 1J3WA 5F82A 2PYRA 4HH3A 3PBTA 4ETXA 5EVID 5CHJA 2Y2PA 1KOUA 1TD5A 1OPXA 1XKZA 2WGWA 2ZQ8A 5CGXA 2QZ6A 1UWNX 3RFBA 3SS5A 3BY9A 5FASA 2XR0A 5EM0A 3HLEA 2X71A 4PM9A 3IF5A 4IEDA 3B33A 3JVUA 3OPLA 4KG6A 1K57C 3BFFA 2WZXA 3VSKA 2EWVA 3KYZA 3DW0A 3G35A 1G6OA 3KO6A 3VP2A 1Y4OA 3NOPC 2E8JA 3T12B 4KQDA 4ME4A 1G28A 3OLOA 3A3IA 1YMSA 1S4SA 4D2OA 1PZOA 2ZOIA 4EBPA 3SZTA 1CF0A 1KE0A 1I2WA 3QP6A 2Y2OA 4I3JA 2IWDA 2HDRA 3LY4A 4KUKA 1E3UD 2ZOHA 4S2PA 5J4EA 1IKIA 2WKIA 3UPNA 3T4JA 3HREA 4Y5FA 1BYWA 3BQAA 4HBTA 2IWBA 3OPPA 3IBJA 2ZMFA 5GHXA 4DKIA 4EEPA 5CRFA 3G2YA 2CC1A 2D02A 3B47A 4HNBA 5HSQA 4ZAMA 4MBFA 1V9YA 4WZ4A 1K6RA 5GLBA 3LI8A 3N6IA 1MWRA 3GTCA 2V1BA 4DJ2A 1S6RA 2WKRA 3Q81A 2J3TC 4IVIA 5E43A 4BENA 4XXRA 4Y15A 2HJEA 4HIAA 3Q7VB 1W79A 3MXSA 3EQUA 4EQ1A 1LI9A 3IH9A 3BWLA 5LBRA 3DAVA 4KZ9A 3C8CA 1F2KA 5CGSA 3S4XA 4GHIB 1JNUA 4KZ6A 4R70A 3CG5A 3UPOA 3IS2A 3T1RA 1K0KA 2BLSA 3O86A 2DMWA 5DF8A 4OQHA 3FC7A 1D7EA 2PR5A 3N8RA 3LICA 2J7VA 1HD8A 1Q2PA 3C30A 5KZHA 2PRFA 4N1HA 3NDGA 4R6LA 5JYOA 2Y2GA 1HVBA 1GA0A 2X02A 3QNCA 5TFQA 3LYXA 3RTYA 4OLGA 4E3JA 1JTDA 1JTGA 4JF4A 3DTEA 1U60A 4Q0HA 4YINA 4HJ3A 5HAQA 4ZTKA 1C3BA 4P87A 1MBLA 1S0WA 2ZMVA 3VP4A 5FATA 4DDSA 3PR6A 2INWA 1JWVA 3BLMA 4E3MA 2WKHA 3MR0A 4JXGA 3MZEA 3KSHA 3M6BA 5HDCA 3CMZA 4MLLA 1KGGA 2ZQ9A 4GDNA 2H5SA 4N9KA 3T4KA 1VQQA 1Q2QA 2XDMA 4MBKA 4E6XA 3MQOA 3H82A 2EXBA 2XEPA 3NY4A 3W2ZA 2UV0E 4BD0A 4HQAA 5DFYA 4LV0A 3E98A 3A0SA 4LCLA 4X1MA 2EWWA 1VEUB 2WKQA 3BYDA 3HLCA 1PI4A 5K5BA 4GKUA 3A3EA 4DN0A 3SS4A 3F1PB 4GLQA 4GNUA 1VETB 1YKDA 5CEBA 3HLGA 2O99A 4ZJ3A 2YKHA 5EVIC 3VOYA 3NDEA 4GDBA 4CLCD 2KDKA 1RGYA 1IELA 3IQAA 1K25A 3UMDA 3K3CA 5L09A 3C7UA 3HUOA 2GDNA 1GHMA 3TSGA 4LLOB 3ZYTA 1JVJA 4OQGA 3H9WA 3BQ8A 4JBFA 1N9BA 4WLAA 1K56D 5IT5A 3JYIA 1W63M 3UB5P 4ESPA 4YNRA 3OPHA 4EQIA 1HTZA 1TS6A 3LR0A 1LI0A 4FH2A 3HLWA 3OPRA 3VFFA 1XXMA 3F1NA 2ZQDA 2EX8A 1NLZA 2GNXA 1MZUA 1WA9A 1GA9A 4LRYC 3MZDA 3F1OB 3R7WA 5M19A 4WUJA 1H8MA 1HLUP 3HLBA 3G2ZA 3ZNYA 4WYYA 1TDLA 1WYBA 3O88A 4KQRA 2OWJA 4I5SA 4GD8A 3NHQA 2K7SA 4MMNA 4KUOA 3IWOA 4OQIA 5DKKA 3DTMA 2HP9A 5FQMA 1CI9A 3S7PA 3IX3A 1PI5A 3BFDA 2DNSA 4S2JA 2M1CA 4M4XA 2Y2JA 3D72A 3QP2A 4Y13A 4R23A 3UB8A 1T1BA 2XD5A 2VGLS 2ZC6B 5EM1A 4G3VA 3SW1A 1FOFA 5FQQA 2ZM8A 3VOLA 3FWLA 3UO9A 4OKPA 4MNRA 1YLYA 4FUWA 3L9KA 2Y2LA 2IA2A 3IH8A 5TR7A 4CLCB 1NZUA 3LY3A 2A49A 4OPYA 4Y0OA 1I2SA 1ES2A 1YSPA 2JKTI 4X6TA 1FSYA 4BL3A 4I39A 3LEZA 2HZ5A 2E8IA 2FH5A 1I5QA 4R38A 5EFWA 4KZ8A 2Z2MB 2OLVA 5FAOA 3AGFA 5FEFA 4Y0UA 5FI2A 2XA7M 3TE8A 1K57A 1SKOA 4LCMA 3UB9A 3FPWA 4O8GA 4B88A 5HPFA 1PWDA 4OPZA 3HUMA 4F3LA 2Y2NA 3V3SA 2WGIA 1SKOB 2V8FA 4YFMA 4IVKA 3ICYA 5DF9A 4MBHA 4F3LB 4HESA 1PZPA 4QHCA 3PAGA 4PMAA 2R9WA 4KG5A 2IWCA 1YM1A 1F98A 4DXBA 4U3TA 4OOLA 4PPRA 2OSUA 1H3QA 4MN5A 4B4XA 5A91A 4GZBA 4R4RA 4O7DA 5E2HA 3EGDC 4WL9A 1ES4A 4L9GA 3LEQA 4MEZA 2ZC5B 2PHYA 3IXDA 1NYYA 1G5UA 5GL9A 4NKPA 1HZOA 4HJ4A 2J80A 4HY8A 5CHMA 1LL8A 2EX9A 2EA9A 4JF5A 1YT4A 1OJGA 2B02A 3TRCA 1K38A 3Q82A 3PAEA 2GJ3A 3MZFA 3CPTA 1DP8A 3TJZC 5EECA 1H8ZA 3IX8A 4PAUA 1VHMA 1YQSA 3PBOA 3NCKA 5HAIA 2ZL1A 4PM7A 1WE4A 3G32A 2DCFA 3HJKA 3FKVA 4P6BA 4ZJ1A 4IUKA 5I5LA 4LPZA 2JKRM 3IWQA 2PYPA 4ARZA 4WN5A 4H8RA 2A24B 3CWFA 3FPVA 2P74A 3TG9A 4MCWA 2ZQ7A 3MS6A 2YKFA 3C2WA 1K54A 1IFQA 3KX0X 3G30A 4Z9QA 3V39A 2HP5A 3IXBA 3CUEA 5JYPA 4KQOA 1LL5A 3E4PA 5IU1A 1BLCA 1PW8A 1NZOA 4IUHA 5GHZA 3NULA 2WGWB 4JGOA 2W27A 4BQMA 3C38A 1LSXA 2ZJ9A 4Z1WA 1J9MA 2G2WA 1S67L 1YLPA 1NJ4A 1W5DA 3HCYA 3HLDA 3O5YA 1ES3A 3ZHHA 4HBUA 4PM5A 1ODVA 3GQZA 4Y0TA 4QY5A 3B3XA 1GSWA 3UY6A 3VOZA 3IBRA 4JKTA 2W3DA 4RX3A 3ZGAB 2K2NA 4XT2A 2NUPC 4KZBA 1H5XA 1UWPX 1GCEA 3DWKA 1K4EA 2P04A 1LLBA 5FQ9A 4WZ5C 1Y28A 1VB6A 2V1ZA 1SZVA 3A3DA 1F5MA 1NRJA 3SH8A 3BLSA 2GZAA 4C75A 2Q9MA 1MC0A 3IT9A 5HL6A 3GVBA 3CAXA 4RX2A 3GR2A 2Y91A 1RCJA 3C7VA 3E2LA 2W3HA 1NRFA 3QP4A 3KSGA 4OP5A 3LUQA 5D3OA 2JBFA 2XFTA 5TJJA 3LI9A 1CEGA 1X0OA 5E2GA 5HPIA 5I94A 2Y79A 1MPLA 1EROA 4KZ5A 5C5KA 4BBUA 1XJ2A 3T4OA 4P0MA 2VA0A 4LV2A 3W8KA 4C6YA 5A92A 1D1JA 1FSWA 1YLZA 4ZRRA 3I7JA 5EVIA 1T1AA 5HDDA 4C3QA 3HVFA 1BZAA 2JE5A 3AGEA 4WMCD 1GSXA 3ITBA 1K54C 3CZDA 4EUVA 1SHVA 2WUQA 3BM6A 3ZQ5A 3LIEA 4MN7A 2AVXA 3CUEC 2ZM2A 1OT9A 2I72A 3IS2B 3UNWA 2EXAA 1ESIA 3OCLA 1QMEA 2C5WB 1DP6A 5DTTA 5F83A 4GS9A 2K31A 3VFHA 3DBAA 1UGUA 3AGDA 3LR5A 5AQ7A 3LO7A 1LSVA 3S1YA 3ZVWA 5L10A 2V9AA 5HWTA 5F1GA 4Q0JA 4DRTA 2EX6A 3P98A 3BW6A 2P9VA 4UQIS 1OTIA 2QKPA 3WS0A 2QHKA 3LR3A 4OH0A 1ESUA 1G68A 1E3UA 3HLFA 3T4TA 4R4SA 4L9FA 1XGIA 5CX7A 3HUNA 1XFNA 4ZDXA 5CERA 4UHUA 5FSRA 3GMWA 4YOFA 1RGZA 3BFCA 1XX2A 2R78A 4LRZE 3WS5A 4JGQA 1O07A 5F1FA 4CPKA 5BOHA 4ID4A 4R3BA 4E04A 4WEJA 4DMZA 3WS2A 3UDIA 1PWCA 1D06A 3C4PA 1N9NA 1VM1A 5DKLA 1JWZA 4NETA 2BASA 3NI9A 2W1TA 5E2EA 2WADA 4FOFA 1STZA 2PU2A 3LGOA 4XUZA 3MJQA 1IOUA 3G34A 3MXQA 4RYEA 3JVVA 3H82B 1L0GA 1TVFA 3VP1A 3VMAA 4EV4A 1A0KA 5MC7A 3PYPA 4Y17A 1KVMA 1OMEA 2WZZA 3FG8A 3UE3A 1XFQA 4II7A 3D3OA 2JHEA 3KSFA 3P09A 1S4RA 3UB6A 4S2MA 1YLTA 3EEAA 1L3LA 1PYYA 4QJGA 4QWOA 3KSIA 4NXGA 4AFIA 3E4QA 5U47A 1MKMA 3IHAA 2VJWA 2H28A 5EVLA 5GLDA 1ONHA 5AQAA 2V20A 3S7OA 5KMWA 2JN7A 1NYMA 4HJ6A 1PFLA 1XA7A 4GB7A 4H6JA 3T4SA 2ZLYA 3VV4A 3QNBA 3Q07A 1KE4A 5J3WA 2PDRA 1Z6FA 3WS4A 3ZFZA 1IYQA 1P9RA 1S1YA 5G4YA 5F5YA 4WF0A 4JGRA 5CEDA 2G7UA 2ZBBA 5HDSA 4UAAA 3CHWP 1IYPA 1IYOA 4EU0A 4HI4A 3F1NB 2XFSA 4JGPA 4IJGA 4X68A 5E2FA 3GRJA 2PU4A 2XRNA 3R7WB 3PBQA 5L2FA 3G31A 1QMFA 3NIAA 2OAP1 3PBSA 2J9OA 2OWHA 4X53A 2ZD8A 5KSHA 5DTSA 1K6SA 5EOOA 5L07A 3BY8A 4N92A 5HD3A 4CLCE 5DJTA 3T4LA 5IS1A 1FCMA 2VGLM 1SKFA 5TBMA 3EQVA 3CLOA 1GSVA 2BG1A 1KE3A 1BLHA 3N8SA 2XF3A 1W8YA 3IF6A 4WELA 1JWPA 1BLPA 4P85A 2O0YA 3Q1FA 2Y2MA 2PD7A 5FQKA 2XSSA 4JXVA 4HHDA 3ZNTA 4LFUA 4NXFA 2W3FA 2VEAA 1SDEA 2FFFB 1IKGA 2J3TD 1MWSA 1XJ3A 1OJ5A 5IHVA 2VV6A 4EESA 1MXOA 1YLWA 1N9LA 3A3JA 3H7WA 3MMHA 3M2KA 1M40A 3MKFA 1RP5A 4ZBEA 3NJAA 3MQQA 2WKPA 3K2NA 4K91A 2ZQAA 3G4PA 3HL9A 3MFXA 2HDQA 3LIDA 4X1LA 5CECA 4HH2A 2HP6A 4L0LA 3BFGA 3C5AA 3UB7A 5G18A 2VGJA 1GHIA 1YAXA 4FD8A 1EWZA 1T18A 2UWXA 1OT6A 1CI8A 3IHBA 4QD4A 4WZ5A 4QPRA 2JKTM 4RA7A 3ITAA 5FI7A 3LIFA 5AQBA 1TDGA 2HV1A 2OOLA 5HD5A 3ZG7B 4K0WA 2QYBA 4K0XA 3IXGA 3V3RA 2L1MA 2Y55A 2JC7A 3BJNA 2DRWA 2XH9A 2GX5A 2P08A 4EBLA 1BUEA 5DF7A 3UE1A 1ES5A 4QY6A 4EUZA 3OOVA 4WEKA 1DJCA 1OTDA 2ZC7A 5F6AA 2Z6DA 3GV9A 2HDUA 4HP4A 2B18A 3O3VA 4DE0A 2Y4AA 4S2IA 3CI6A 3G6OA 1KDWA 1W8QA 3W4OA 5HFOA 3MBZA 1FR6A 1LL9A 3CPTB 1G6AA 4G3KA 4IBXA 1TS8A 3IXHA 1ZHHB 3HBRA 1LSWA 2ZL1B 3IF6C 1ZG6A 4O01A 1YPRA 5FEGA 3N4IA 4WM9A 2Y2HA 2PBYA 5CTMA 1FIKA 4S2OA 5L8MA 4ARZB 1PIOA 2LB5A 2QJ7A 1ERQA 1T1CA 4P6ZS 2FZ0A 4CLCC 4FTXA 5M1AA 3VP0A 2V1AA 1K4FA 1ACFA 4X69A 3QHYA 2Y2QA 2HJ9C 4A5RA 1XPBA 3ZDJA 2P7JA 3W4QA 3ZG0A 2OV5A 3TW8A 2PR6A 3S22A 3WWXA 1KGFA 3V50A 1N4OA 3OC2A 1IEMA 5FAPA 2MJ6A 2X01A 2B95A 3T50A 3ZG5A 4BWIA 4N1XA 3VSLA 5KIZA 3BRMA 4HOIA 4UA9A 5DFXA 3NECA 3MF0A 3BECA 4XT2B 5DVAA 3SOIA 1E25A 2KOIA 5HW3A 2ZQCA 2PD8A 4DXCA 3U2AA 4KZAA 2XGNA 4IBRA 2WAEA 3K3DA 1S66L 1BLSA 2HPBA
chains in the Genus database with same CATH topology
2ZL1B 2ACGA 1Y4OA 2JKFA 2E8JA 3T12B 4X1MA 3D9YA 1VEUB 3CHWP 3T1RA 1K0KA 3MSHA 1YPRA 5FEGA 3NULA 1D1JA 2BTFP 1CF0A 1FIKA 2V8CA 4X1LA 5EV0A 3LEQA 1G5UA 1AWIA 1VETB 4FTXA 1PRQA 2PRFA 3LGOA 1FILA 5EVEA 1CJFA 5EM1A 3T1SA 1ACFA 1PNEA 1A0KA 4D60A 4FUWA 3L9KA 3KYEA 3CPTA 3U4LP 4QWOA 1SZVA 3L7HA 5FDSA 3UB5P 4ESPA 2ZL1A 2HZ5A 1J3WA 2B95A 3T1XA 1VEUA 3T1QB 4X25A 3NECA 1CQAA 5FEFA 1PFLA 1Z09A 2JKGA 1SKOA 2PAVP 5EM0A 1VETA 3MS6A 3CPTB 2VK3A 1SKOB 2PBDP 2V8FA 1HLUP 3DAVA 1F2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZL1 B;  2ACG A;  1Y4O A;  2JKF A;  2E8J A;  3T12 B;  4X1M A;  3D9Y A;  1VEU B;  3CHW P;  3T1R A;  1K0K A;  3MSH A;  1YPR A;  5FEG A;  3NUL A;  1D1J A;  2BTF P;  1CF0 A;  1FIK A;  2V8C A;  4X1L A;  5EV0 A;  3LEQ A;  1G5U A;  1AWI A;  1VET B;  4FTX A;  1PRQ A;  2PRF A;  3LGO A;  1FIL A;  5EVE A;  1CJF A;  5EM1 A;  3T1S A;  1ACF A;  1PNE A;  1A0K A;  4D60 A;  4FUW A;  3L9K A;  3KYE A;  3CPT A;  3U4L P;  4QWO A;  1SZV A;  3L7H A;  5FDS A;  3UB5 P;  4ESP A;  2ZL1 A;  2HZ5 A;  1J3W A;  2B95 A;  3T1X A;  1VEU A;  3T1Q B;  4X25 A;  3NEC A;  1CQA A;  5FEF A;  1PFL A;  1Z09 A;  2JKG A;  1SKO A;  2PAV P;  5EM0 A;  1VET A;  3MS6 A;  3CPT B;  2VK3 A;  1SKO B;  2PBD P;  2V8F A;  1HLU P;  3DAV A;  1F2K A; 
#chains in the Genus database with same CATH topology
 1MY8 A;  1L0E A;  3NC8 A;  4U0X A;  4GCZ A;  1BTL A;  3D9Y A;  4XUX A;  1K55 C;  3KYQ A;  3PHY A;  4Y7P A;  4S2K A;  5FL3 A;  2Y2I A;  4DF6 A;  2WYX A;  1BSG A;  4OPQ A;  2A3U A;  4Y3I A;  2NUT C;  4E3I A;  4R0Q A;  4R3J A;  1KDS A;  4U0T A;  3T4Q A;  3OCN A;  4JLF A;  4B93 A;  1FIL A;  3LCE A;  5AVE A;  1F9I A;  1H0M A;  4PKY A;  2QWS A;  4NXB A;  2VLG A;  2VV7 A;  1N9O A;  1XJ6 A;  2VKS A;  4EWF A;  3UDF A;  5HZH A;  1CK3 A;  5GHY A;  4OPR A;  4B9O A;  3Q7V A;  1DJB A;  4S2L A;  4KQQ A;  1MWT A;  3R4K A;  4DE1 A;  4BLM A;  4CJN A;  2WKE A;  4F94 A;  5EVI B;  4FSF A;  1KVL A;  5EPH A;  3L7H A;  1YLJ A;  1L0D A;  3BFE A;  4Q8I A;  4GHI A;  4GOG A;  1TF1 A;  2XLN A;  5EE8 A;  4M3K A;  4S2N C;  3GDI A;  5DJU A;  5J7E A;  5CGW A;  5FQJ A;  3UME A;  3HJI A;  2H0Y A;  4NG2 A;  5A93 A;  4JXS A;  2W3G A;  1YSQ A;  5FQI A;  3EGX C;  4GS9 B;  4NK3 A;  5HL1 A;  2O9A A;  1ONG A;  2H10 A;  1BUL A;  2ACG A;  4UQI M;  4GN2 A;  4KG2 A;  3E2K A;  2XD1 A;  2Y59 A;  1NXY A;  5M18 A;  2BTF P;  4QU3 A;  4E3O A;  2J3W A;  2V8C A;  2P9V B;  3UDX A;  1E4D A;  4DJ3 A;  3D4F A;  4E6W A;  3SS3 A;  3EEH A;  2V2F F;  1ZG4 A;  5F69 A;  5CXW A;  5CHU A;  3ZVT A;  5EOE A;  1WYC A;  4BJP A;  3MFD A;  4PM6 A;  3WS1 A;  1T19 A;  5TGF A;  3Q7Z A;  2G2U A;  3ULF A;  3KYE A;  3RXX A;  1O7E A;  4FCF A;  4G3W A;  4OON A;  4KEN B;  2Z2L B;  2H0T A;  2HF6 A;  4GJ4 A;  2L0W A;  2Y2K A;  4MDZ A;  2W1T B;  3JPU A;  4I3I A;  1ZKJ A;  3ZG9 B;  1VEU A;  2ZC4 B;  3EOI A;  2FFY A;  2Y8H A;  3WRZ A;  3N8L A;  2QMI A;  4X25 A;  2RCX A;  1M6K A;  4QB8 A;  3UE6 A;  4WMC A;  1FQG A;  3F1P A;  4BBT A;  1OTB A;  1L2S A;  3W4P A;  2R9X A;  5G4Z A;  4PM8 A;  1V9Z A;  1VET A;  1S1Z A;  4EXO A;  5AJG A;  4Y2F A;  5FI6 A;  3CIT A;  2PBD P;  1SCW A;  4UEY A;  1OTE A;  3NOT C;  3MXR A;  2LB9 A;  1DP9 A;  2VGK A;  5HAR A;  4EW7 A;  4I38 A;  4E3K A;  1YMX A;  2Z6C A;  4RQ9 A;  1W7F A;  5EUA A;  3N7W A;  3GSG A;  2CMN A;  4BD1 A;  4GW9 A;  3B42 A;  3LR4 A;  1TS7 A;  5A8B A;  2C6W B;  3QP8 A;  4H6J B;  4HP9 A;  4O0P A;  3OZH A;  4MN6 A;  4BMW A;  4Q0I A;  3E4O A;  5HX9 A;  4EBN A;  3S7N A;  4LV1 A;  1PRQ A;  3LIA A;  4OOY A;  2L4R A;  3M6H A;  3RJU A;  3A3F A;  1NWZ A;  2VZW A;  5EVE A;  3RH8 B;  3SH7 A;  1CJF A;  1DJA A;  2KX6 A;  3MQ0 A;  4RVA A;  4ETZ A;  5J8X A;  1MWU A;  3VP3 A;  3E0Y A;  4GD6 A;  3BEB A;  4D60 A;  1LHY A;  1P97 A;  2PT7 A;  2OLU A;  3UN7 A;  2W1R A;  1OTA A;  4NEE D;  3F1O A;  5HWW A;  1XGJ A;  2Q0O A;  4FH4 A;  3VE4 A;  3ZCZ A;  3WRT A;  4PKY G;  1FCO A;  4I3A A;  4OLD A;  1XP4 A;  4OP8 A;  2OAQ 1;  4K08 A;  3T1X A;  2ZMA A;  2J8Y A;  2KLI A;  2I9V A;  1CQA A;  1ZTU A;  4KZ7 A;  1KGE A;  1L0F A;  4WBG A;  2D01 A;  2PAV P;  1LT0 A;  4CQH A;  4DDY A;  1NLY A;  1P9W A;  3TOI A;  3V5M A;  5TBM B;  2M7U A;  2VK3 A;  2WGV A;  1CEF A;  4B4Z A;  3FKW A;  2EFX A;  2EFU A;  2JCH A;  2O9B A;  4IHQ A;  3IF6 B;  3FV7 A;  2JKF A;  3IWI A;  5F68 A;  2W3E A;  3P7N A;  3DTI A;  3PTE A;  5A90 A;  3IX4 A;  5AQ9 A;  4CLC A;  5HAP A;  1GHP A;  1H8Y A;  1XJ4 A;  3PBR A;  4EEU A;  1AWI A;  2Q9N A;  3LFV A;  2XRO A;  2VV8 A;  1AXB A;  3UE0 A;  5FAQ A;  3ZG8 B;  4YWZ A;  2ZM0 A;  1K56 A;  4R3A A;  3OBF A;  1FCN A;  4JPM A;  5FA7 A;  3T1S A;  4E3L A;  5CTN A;  3H7W B;  3VE3 A;  4HEF A;  1NY0 A;  3QP1 A;  4BBV A;  1ERM A;  2ZC3 B;  3RXW A;  4NXE A;  2HDS A;  2A2L A;  1ZC2 A;  4JF6 A;  5GLC A;  3FYZ A;  2XA7 S;  1MKI A;  4UA7 A;  4X56 A;  3NBL A;  3QP5 A;  4OQ0 A;  5HWV A;  3A0R A;  4KZ3 A;  1FR1 A;  1PW1 A;  3T1Q B;  3UPP A;  1Z09 A;  2W0N A;  2JKG A;  2HGV A;  1DRM A;  3CJM A;  4JXW A;  4BL2 A;  4LRX C;  2M7V A;  4UA6 A;  4OVD A;  1EW0 A;  1IYS A;  4EER A;  2EX2 A;  1K55 A;  2VX8 A;  1P0Z A;  1BT5 A;  5GLA A;  4DE3 A;  2RL3 A;  4N9L A;  2JKR I;  3A0V A;  4ZJ2 A;  3ISG A;  2V0W A;  3MSH A;  5FDH A;  1ALQ A;  4L9E A;  2QJ5 A;  5EV0 A;  4R1G A;  4LGW A;  3NOU C;  2QPN A;  3EWK A;  3PXP A;  3C4O A;  3V67 A;  3S7Q A;  3FZC A;  3O87 A;  1SDN A;  4KZ4 A;  1XA1 A;  3MKE A;  4LV3 A;  1EI5 A;  4X55 A;  4PHT A;  1DY6 A;  2WK0 A;  4EET B;  4E3N A;  1PNE A;  2WAF A;  4LEN A;  5KSC A;  1PWG A;  3SH9 A;  1W63 Q;  3DTK A;  2O9C A;  2A24 A;  1TEM A;  2V0U A;  4P6Z M;  5DTK A;  3GEC A;  2B5R A;  1Y54 A;  1TS0 A;  3DWZ A;  2XQZ A;  4S2N A;  3U4L P;  3P01 A;  2J9P A;  4DE2 A;  3PBN A;  5AVF A;  3M2J A;  5FDS A;  3LIB A;  4OOM A;  2XK1 A;  1J3W A;  5F82 A;  2PYR A;  4HH3 A;  3PBT A;  4ETX A;  5EVI D;  5CHJ A;  2Y2P A;  1KOU A;  1TD5 A;  1OPX A;  1XKZ A;  2WGW A;  2ZQ8 A;  5CGX A;  2QZ6 A;  1UWN X;  3RFB A;  3SS5 A;  3BY9 A;  5FAS A;  2XR0 A;  5EM0 A;  3HLE A;  2X71 A;  4PM9 A;  3IF5 A;  4IED A;  3B33 A;  3JVU A;  3OPL A;  4KG6 A;  1K57 C;  3BFF A;  2WZX A;  3VSK A;  2EWV A;  3KYZ A;  3DW0 A;  3G35 A;  1G6O A;  3KO6 A;  3VP2 A;  1Y4O A;  3NOP C;  2E8J A;  3T12 B;  4KQD A;  4ME4 A;  1G28 A;  3OLO A;  3A3I A;  1YMS A;  1S4S A;  4D2O A;  1PZO A;  2ZOI A;  4EBP A;  3SZT A;  1CF0 A;  1KE0 A;  1I2W A;  3QP6 A;  2Y2O A;  4I3J A;  2IWD A;  2HDR A;  3LY4 A;  4KUK A;  1E3U D;  2ZOH A;  4S2P A;  5J4E A;  1IKI A;  2WKI A;  3UPN A;  3T4J A;  3HRE A;  4Y5F A;  1BYW A;  3BQA A;  4HBT A;  2IWB A;  3OPP A;  3IBJ A;  2ZMF A;  5GHX A;  4DKI A;  4EEP A;  5CRF A;  3G2Y A;  2CC1 A;  2D02 A;  3B47 A;  4HNB A;  5HSQ A;  4ZAM A;  4MBF A;  1V9Y A;  4WZ4 A;  1K6R A;  5GLB A;  3LI8 A;  3N6I A;  1MWR A;  3GTC A;  2V1B A;  4DJ2 A;  1S6R A;  2WKR A;  3Q81 A;  2J3T C;  4IVI A;  5E43 A;  4BEN A;  4XXR A;  4Y15 A;  2HJE A;  4HIA A;  3Q7V B;  1W79 A;  3MXS A;  3EQU A;  4EQ1 A;  1LI9 A;  3IH9 A;  3BWL A;  5LBR A;  3DAV A;  4KZ9 A;  3C8C A;  1F2K A;  5CGS A;  3S4X A;  4GHI B;  1JNU A;  4KZ6 A;  4R70 A;  3CG5 A;  3UPO A;  3IS2 A;  3T1R A;  1K0K A;  2BLS A;  3O86 A;  2DMW A;  5DF8 A;  4OQH A;  3FC7 A;  1D7E A;  2PR5 A;  3N8R A;  3LIC A;  2J7V A;  1HD8 A;  1Q2P A;  3C30 A;  5KZH A;  2PRF A;  4N1H A;  3NDG A;  4R6L A;  5JYO A;  2Y2G A;  1HVB A;  1GA0 A;  2X02 A;  3QNC A;  5TFQ A;  3LYX A;  3RTY A;  4OLG A;  4E3J A;  1JTD A;  1JTG A;  4JF4 A;  3DTE A;  1U60 A;  4Q0H A;  4YIN A;  4HJ3 A;  5HAQ A;  4ZTK A;  1C3B A;  4P87 A;  1MBL A;  1S0W A;  2ZMV A;  3VP4 A;  5FAT A;  4DDS A;  3PR6 A;  2INW A;  1JWV A;  3BLM A;  4E3M A;  2WKH A;  3MR0 A;  4JXG A;  3MZE A;  3KSH A;  3M6B A;  5HDC A;  3CMZ A;  4MLL A;  1KGG A;  2ZQ9 A;  4GDN A;  2H5S A;  4N9K A;  3T4K A;  1VQQ A;  1Q2Q A;  2XDM A;  4MBK A;  4E6X A;  3MQO A;  3H82 A;  2EXB A;  2XEP A;  3NY4 A;  3W2Z A;  2UV0 E;  4BD0 A;  4HQA A;  5DFY A;  4LV0 A;  3E98 A;  3A0S A;  4LCL A;  4X1M A;  2EWW A;  1VEU B;  2WKQ A;  3BYD A;  3HLC A;  1PI4 A;  5K5B A;  4GKU A;  3A3E A;  4DN0 A;  3SS4 A;  3F1P B;  4GLQ A;  4GNU A;  1VET B;  1YKD A;  5CEB A;  3HLG A;  2O99 A;  4ZJ3 A;  2YKH A;  5EVI C;  3VOY A;  3NDE A;  4GDB A;  4CLC D;  2KDK A;  1RGY A;  1IEL A;  3IQA A;  1K25 A;  3UMD A;  3K3C A;  5L09 A;  3C7U A;  3HUO A;  2GDN A;  1GHM A;  3TSG A;  4LLO B;  3ZYT A;  1JVJ A;  4OQG A;  3H9W A;  3BQ8 A;  4JBF A;  1N9B A;  4WLA A;  1K56 D;  5IT5 A;  3JYI A;  1W63 M;  3UB5 P;  4ESP A;  4YNR A;  3OPH A;  4EQI A;  1HTZ A;  1TS6 A;  3LR0 A;  1LI0 A;  4FH2 A;  3HLW A;  3OPR A;  3VFF A;  1XXM A;  3F1N A;  2ZQD A;  2EX8 A;  1NLZ A;  2GNX A;  1MZU A;  1WA9 A;  1GA9 A;  4LRY C;  3MZD A;  3F1O B;  3R7W A;  5M19 A;  4WUJ A;  1H8M A;  1HLU P;  3HLB A;  3G2Z A;  3ZNY A;  4WYY A;  1TDL A;  1WYB A;  3O88 A;  4KQR A;  2OWJ A;  4I5S A;  4GD8 A;  3NHQ A;  2K7S A;  4MMN A;  4KUO A;  3IWO A;  4OQI A;  5DKK A;  3DTM A;  2HP9 A;  5FQM A;  1CI9 A;  3S7P A;  3IX3 A;  1PI5 A;  3BFD A;  2DNS A;  4S2J A;  2M1C A;  4M4X A;  2Y2J A;  3D72 A;  3QP2 A;  4Y13 A;  4R23 A;  3UB8 A;  1T1B A;  2XD5 A;  2VGL S;  2ZC6 B;  5EM1 A;  4G3V A;  3SW1 A;  1FOF A;  5FQQ A;  2ZM8 A;  3VOL A;  3FWL A;  3UO9 A;  4OKP A;  4MNR A;  1YLY A;  4FUW A;  3L9K A;  2Y2L A;  2IA2 A;  3IH8 A;  5TR7 A;  4CLC B;  1NZU A;  3LY3 A;  2A49 A;  4OPY A;  4Y0O A;  1I2S A;  1ES2 A;  1YSP A;  2JKT I;  4X6T A;  1FSY A;  4BL3 A;  4I39 A;  3LEZ A;  2HZ5 A;  2E8I A;  2FH5 A;  1I5Q A;  4R38 A;  5EFW A;  4KZ8 A;  2Z2M B;  2OLV A;  5FAO A;  3AGF A;  5FEF A;  4Y0U A;  5FI2 A;  2XA7 M;  3TE8 A;  1K57 A;  1SKO A;  4LCM A;  3UB9 A;  3FPW A;  4O8G A;  4B88 A;  5HPF A;  1PWD A;  4OPZ A;  3HUM A;  4F3L A;  2Y2N A;  3V3S A;  2WGI A;  1SKO B;  2V8F A;  4YFM A;  4IVK A;  3ICY A;  5DF9 A;  4MBH A;  4F3L B;  4HES A;  1PZP A;  4QHC A;  3PAG A;  4PMA A;  2R9W A;  4KG5 A;  2IWC A;  1YM1 A;  1F98 A;  4DXB A;  4U3T A;  4OOL A;  4PPR A;  2OSU A;  1H3Q A;  4MN5 A;  4B4X A;  5A91 A;  4GZB A;  4R4R A;  4O7D A;  5E2H A;  3EGD C;  4WL9 A;  1ES4 A;  4L9G A;  3LEQ A;  4MEZ A;  2ZC5 B;  2PHY A;  3IXD A;  1NYY A;  1G5U A;  5GL9 A;  4NKP A;  1HZO A;  4HJ4 A;  2J80 A;  4HY8 A;  5CHM A;  1LL8 A;  2EX9 A;  2EA9 A;  4JF5 A;  1YT4 A;  1OJG A;  2B02 A;  3TRC A;  1K38 A;  3Q82 A;  3PAE A;  2GJ3 A;  3MZF A;  3CPT A;  1DP8 A;  3TJZ C;  5EEC A;  1H8Z A;  3IX8 A;  4PAU A;  1VHM A;  1YQS A;  3PBO A;  3NCK A;  5HAI A;  2ZL1 A;  4PM7 A;  1WE4 A;  3G32 A;  2DCF A;  3HJK A;  3FKV A;  4P6B A;  4ZJ1 A;  4IUK A;  5I5L A;  4LPZ A;  2JKR M;  3IWQ A;  2PYP A;  4ARZ A;  4WN5 A;  4H8R A;  2A24 B;  3CWF A;  3FPV A;  2P74 A;  3TG9 A;  4MCW A;  2ZQ7 A;  3MS6 A;  2YKF A;  3C2W A;  1K54 A;  1IFQ A;  3KX0 X;  3G30 A;  4Z9Q A;  3V39 A;  2HP5 A;  3IXB A;  3CUE A;  5JYP A;  4KQO A;  1LL5 A;  3E4P A;  5IU1 A;  1BLC A;  1PW8 A;  1NZO A;  4IUH A;  5GHZ A;  3NUL A;  2WGW B;  4JGO A;  2W27 A;  4BQM A;  3C38 A;  1LSX A;  2ZJ9 A;  4Z1W A;  1J9M A;  2G2W A;  1S67 L;  1YLP A;  1NJ4 A;  1W5D A;  3HCY A;  3HLD A;  3O5Y A;  1ES3 A;  3ZHH A;  4HBU A;  4PM5 A;  1ODV A;  3GQZ A;  4Y0T A;  4QY5 A;  3B3X A;  1GSW A;  3UY6 A;  3VOZ A;  3IBR A;  4JKT A;  2W3D A;  4RX3 A;  3ZGA B;  2K2N A;  4XT2 A;  2NUP C;  4KZB A;  1H5X A;  1UWP X;  1GCE A;  3DWK A;  1K4E A;  2P04 A;  1LLB A;  5FQ9 A;  4WZ5 C;  1Y28 A;  1VB6 A;  2V1Z A;  1SZV A;  3A3D A;  1F5M A;  1NRJ A;  3SH8 A;  3BLS A;  2GZA A;  4C75 A;  2Q9M A;  1MC0 A;  3IT9 A;  5HL6 A;  3GVB A;  3CAX A;  4RX2 A;  3GR2 A;  2Y91 A;  1RCJ A;  3C7V A;  3E2L A;  2W3H A;  1NRF A;  3QP4 A;  3KSG A;  4OP5 A;  3LUQ A;  5D3O A;  2JBF A;  2XFT A;  5TJJ A;  3LI9 A;  1CEG A;  1X0O A;  5E2G A;  5HPI A;  5I94 A;  2Y79 A;  1MPL A;  1ERO A;  4KZ5 A;  5C5K A;  4BBU A;  1XJ2 A;  3T4O A;  4P0M A;  2VA0 A;  4LV2 A;  3W8K A;  4C6Y A;  5A92 A;  1D1J A;  1FSW A;  1YLZ A;  4ZRR A;  3I7J A;  5EVI A;  1T1A A;  5HDD A;  4C3Q A;  3HVF A;  1BZA A;  2JE5 A;  3AGE A;  4WMC D;  1GSX A;  3ITB A;  1K54 C;  3CZD A;  4EUV A;  1SHV A;  2WUQ A;  3BM6 A;  3ZQ5 A;  3LIE A;  4MN7 A;  2AVX A;  3CUE C;  2ZM2 A;  1OT9 A;  2I72 A;  3IS2 B;  3UNW A;  2EXA A;  1ESI A;  3OCL A;  1QME A;  2C5W B;  1DP6 A;  5DTT A;  5F83 A;  4GS9 A;  2K31 A;  3VFH A;  3DBA A;  1UGU A;  3AGD A;  3LR5 A;  5AQ7 A;  3LO7 A;  1LSV A;  3S1Y A;  3ZVW A;  5L10 A;  2V9A A;  5HWT A;  5F1G A;  4Q0J A;  4DRT A;  2EX6 A;  3P98 A;  3BW6 A;  2P9V A;  4UQI S;  1OTI A;  2QKP A;  3WS0 A;  2QHK A;  3LR3 A;  4OH0 A;  1ESU A;  1G68 A;  1E3U A;  3HLF A;  3T4T A;  4R4S A;  4L9F A;  1XGI A;  5CX7 A;  3HUN A;  1XFN A;  4ZDX A;  5CER A;  4UHU A;  5FSR A;  3GMW A;  4YOF A;  1RGZ A;  3BFC A;  1XX2 A;  2R78 A;  4LRZ E;  3WS5 A;  4JGQ A;  1O07 A;  5F1F A;  4CPK A;  5BOH A;  4ID4 A;  4R3B A;  4E04 A;  4WEJ A;  4DMZ A;  3WS2 A;  3UDI A;  1PWC A;  1D06 A;  3C4P A;  1N9N A;  1VM1 A;  5DKL A;  1JWZ A;  4NET A;  2BAS A;  3NI9 A;  2W1T A;  5E2E A;  2WAD A;  4FOF A;  1STZ A;  2PU2 A;  3LGO A;  4XUZ A;  3MJQ A;  1IOU A;  3G34 A;  3MXQ A;  4RYE A;  3JVV A;  3H82 B;  1L0G A;  1TVF A;  3VP1 A;  3VMA A;  4EV4 A;  1A0K A;  5MC7 A;  3PYP A;  4Y17 A;  1KVM A;  1OME A;  2WZZ A;  3FG8 A;  3UE3 A;  1XFQ A;  4II7 A;  3D3O A;  2JHE A;  3KSF A;  3P09 A;  1S4R A;  3UB6 A;  4S2M A;  1YLT A;  3EEA A;  1L3L A;  1PYY A;  4QJG A;  4QWO A;  3KSI A;  4NXG A;  4AFI A;  3E4Q A;  5U47 A;  1MKM A;  3IHA A;  2VJW A;  2H28 A;  5EVL A;  5GLD A;  1ONH A;  5AQA A;  2V20 A;  3S7O A;  5KMW A;  2JN7 A;  1NYM A;  4HJ6 A;  1PFL A;  1XA7 A;  4GB7 A;  4H6J A;  3T4S A;  2ZLY A;  3VV4 A;  3QNB A;  3Q07 A;  1KE4 A;  5J3W A;  2PDR A;  1Z6F A;  3WS4 A;  3ZFZ A;  1IYQ A;  1P9R A;  1S1Y A;  5G4Y A;  5F5Y A;  4WF0 A;  4JGR A;  5CED A;  2G7U A;  2ZBB A;  5HDS A;  4UAA A;  3CHW P;  1IYP A;  1IYO A;  4EU0 A;  4HI4 A;  3F1N B;  2XFS A;  4JGP A;  4IJG A;  4X68 A;  5E2F A;  3GRJ A;  2PU4 A;  2XRN A;  3R7W B;  3PBQ A;  5L2F A;  3G31 A;  1QMF A;  3NIA A;  2OAP 1;  3PBS A;  2J9O A;  2OWH A;  4X53 A;  2ZD8 A;  5KSH A;  5DTS A;  1K6S A;  5EOO A;  5L07 A;  3BY8 A;  4N92 A;  5HD3 A;  4CLC E;  5DJT A;  3T4L A;  5IS1 A;  1FCM A;  2VGL M;  1SKF A;  5TBM A;  3EQV A;  3CLO A;  1GSV A;  2BG1 A;  1KE3 A;  1BLH A;  3N8S A;  2XF3 A;  1W8Y A;  3IF6 A;  4WEL A;  1JWP A;  1BLP A;  4P85 A;  2O0Y A;  3Q1F A;  2Y2M A;  2PD7 A;  5FQK A;  2XSS A;  4JXV A;  4HHD A;  3ZNT A;  4LFU A;  4NXF A;  2W3F A;  2VEA A;  1SDE A;  2FFF B;  1IKG A;  2J3T D;  1MWS A;  1XJ3 A;  1OJ5 A;  5IHV A;  2VV6 A;  4EES A;  1MXO A;  1YLW A;  1N9L A;  3A3J A;  3H7W A;  3MMH A;  3M2K A;  1M40 A;  3MKF A;  1RP5 A;  4ZBE A;  3NJA A;  3MQQ A;  2WKP A;  3K2N A;  4K91 A;  2ZQA A;  3G4P A;  3HL9 A;  3MFX A;  2HDQ A;  3LID A;  4X1L A;  5CEC A;  4HH2 A;  2HP6 A;  4L0L A;  3BFG A;  3C5A A;  3UB7 A;  5G18 A;  2VGJ A;  1GHI A;  1YAX A;  4FD8 A;  1EWZ A;  1T18 A;  2UWX A;  1OT6 A;  1CI8 A;  3IHB A;  4QD4 A;  4WZ5 A;  4QPR A;  2JKT M;  4RA7 A;  3ITA A;  5FI7 A;  3LIF A;  5AQB A;  1TDG A;  2HV1 A;  2OOL A;  5HD5 A;  3ZG7 B;  4K0W A;  2QYB A;  4K0X A;  3IXG A;  3V3R A;  2L1M A;  2Y55 A;  2JC7 A;  3BJN A;  2DRW A;  2XH9 A;  2GX5 A;  2P08 A;  4EBL A;  1BUE A;  5DF7 A;  3UE1 A;  1ES5 A;  4QY6 A;  4EUZ A;  3OOV A;  4WEK A;  1DJC A;  1OTD A;  2ZC7 A;  5F6A A;  2Z6D A;  3GV9 A;  2HDU A;  4HP4 A;  2B18 A;  3O3V A;  4DE0 A;  2Y4A A;  4S2I A;  3CI6 A;  3G6O A;  1KDW A;  1W8Q A;  3W4O A;  5HFO A;  3MBZ A;  1FR6 A;  1LL9 A;  3CPT B;  1G6A A;  4G3K A;  4IBX A;  1TS8 A;  3IXH A;  1ZHH B;  3HBR A;  1LSW A;  2ZL1 B;  3IF6 C;  1ZG6 A;  4O01 A;  1YPR A;  5FEG A;  3N4I A;  4WM9 A;  2Y2H A;  2PBY A;  5CTM A;  1FIK A;  4S2O A;  5L8M A;  4ARZ B;  1PIO A;  2LB5 A;  2QJ7 A;  1ERQ A;  1T1C A;  4P6Z S;  2FZ0 A;  4CLC C;  4FTX A;  5M1A A;  3VP0 A;  2V1A A;  1K4F A;  1ACF A;  4X69 A;  3QHY A;  2Y2Q A;  2HJ9 C;  4A5R A;  1XPB A;  3ZDJ A;  2P7J A;  3W4Q A;  3ZG0 A;  2OV5 A;  3TW8 A;  2PR6 A;  3S22 A;  3WWX A;  1KGF A;  3V50 A;  1N4O A;  3OC2 A;  1IEM A;  5FAP A;  2MJ6 A;  2X01 A;  2B95 A;  3T50 A;  3ZG5 A;  4BWI A;  4N1X A;  3VSL A;  5KIZ A;  3BRM A;  4HOI A;  4UA9 A;  5DFX A;  3NEC A;  3MF0 A;  3BEC A;  4XT2 B;  5DVA A;  3SOI A;  1E25 A;  2KOI A;  5HW3 A;  2ZQC A;  2PD8 A;  4DXC A;  3U2A A;  4KZA A;  2XGN A;  4IBR A;  2WAE A;  3K3D A;  1S66 L;  1BLS A;  2HPB A; 
#chains in the Genus database with same CATH homology
 2ZL1 B;  2ACG A;  1Y4O A;  2JKF A;  2E8J A;  3T12 B;  4X1M A;  3D9Y A;  1VEU B;  3CHW P;  3T1R A;  1K0K A;  3MSH A;  1YPR A;  5FEG A;  3NUL A;  1D1J A;  2BTF P;  1CF0 A;  1FIK A;  2V8C A;  4X1L A;  5EV0 A;  3LEQ A;  1G5U A;  1AWI A;  1VET B;  4FTX A;  1PRQ A;  2PRF A;  3LGO A;  1FIL A;  5EVE A;  1CJF A;  5EM1 A;  3T1S A;  1ACF A;  1PNE A;  1A0K A;  4D60 A;  4FUW A;  3L9K A;  3KYE A;  3CPT A;  3U4L P;  4QWO A;  1SZV A;  3L7H A;  5FDS A;  3UB5 P;  4ESP A;  2ZL1 A;  2HZ5 A;  1J3W A;  2B95 A;  3T1X A;  1VEU A;  3T1Q B;  4X25 A;  3NEC A;  1CQA A;  5FEF A;  1PFL A;  1Z09 A;  2JKG A;  1SKO A;  2PAV P;  5EM0 A;  1VET A;  3MS6 A;  3CPT B;  2VK3 A;  1SKO B;  2PBD P;  2V8F A;  1HLU P;  3DAV A;  1F2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...