4MEZA

Crystal structure of m68l/m69t double mutant tem-1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPLTSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Structure/Function correlation of TEM-1/PSE-4 beta-lactamase chimeras and their deconvoluted mutant
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 92
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4mezA00
1KVLA 1L0FA 3V50A 3DWKA 1JTDA 3OPLA 3CJMA 4E3NA 1ES4A 2OV5A 5HAPA 3FYZA 4LCLA 5DTTA 3HREA 5CGXA 5GL9A 5HW3A 4OQGA 4O7DA 2ZQCA 3IXGA 3I7JA 3CMZA 4XXRA 3WRZA 1WYBA 4B4XA 4QU3A 1DY6A 4OKPA 2WZXA 4ZBEA 4PMAA 1H8YA 1FCNA 3G4PA 3N8RA 3ZCZA 1K57C 4H8RA 2X01A 1K4EA 1IYQA 4QD4A 5EVIB 3A3DA 3V3RA 3QNBA 4KZAA 4KG2A 4OP8A 1GA0A 5E2HA 3BECA 4GDBA 3HL9A 4JXWA 2Y2JA 5FQMA 4ZJ2A 3M2JA 4IVIA 4KZ6A 4OOMA 1FSYA 2Y2MA 5D3OA 4E3LA 4C3QA 4LV3A 5AQ9A 4RA7A 3UPPA 2XR0A 5G18A 1FSWA 2Y4AA 2P9VA 2Q9MA 1NJ4A 1RGZA 1SDNA 1HTZA 1I5QA 2HP6A 2HDQA 2EXAA 3MZEA 3NDEA 4QHCA 1IYSA 5EVIC 4ZTKA 2PU2A 1FR1A 3NDGA 3AGDA 5FAPA 4P85A 1NY0A 3AGFA 5JYOA 1XXMA 3AGEA 4FD8A 4N1HA 4S2NA 2XLNA 2Y2LA 3IXHA 4KZ5A 4WZ5A 2EX9A 1ERQA 2X02A 1SHVA 2IWDA 1CEGA 4EBNA 1RGYA 1M6KA 2Y2QA 2DCFA 5DVAA 2ZM2A 5EOOA 2HDSA 2QPNA 4ZDXA 3G31A 1LHYA 3WS4A 5TR7A 3GVBA 3E2LA 1KE0A 1LLBA 4KZ3A 2Y2PA 3A3EA 1XGJA 3OCLA 4QY5A 1K6SA 2J9OA 4UHUA 1E25A 3VFFA 5FASA 5M19A 2G2UA 1XA1A 4JF5A 4DE1A 3O87A 3BM6A 3LY3A 4DE3A 2WUQA 2ZQAA 5U47A 1G68A 4IBRA 2Y2NA 4XUZA 5CXWA 4EV4A 5FI6A 4N9KA 3VOYA 5GLDA 2V2FF 1YMSA 5FAQA 1PWCA 4M3KA 4LENA 2PU4A 2CC1A 1PYYA 4GKUA 4RX3A 3NIAA 5E2FA 4KG6A 3M6HA 1PWDA 4E6XA 5HAIA 3GSGA 2Y91A 1N4OA 3BFCA 3MZDA 5EUAA 2VGKA 3UDXA 2Y55A 5EVIA 3WS2A 5EPHA 3IF6B 4JXGA 2C5WB 4Y0UA 2IWCA 4E3IA 1O07A 3LO7A 4DDSA 4Y7PA 3IXDA 1EI5A 2EX6A 2WYXA 1Q2QA 2ZQ8A 1I2SA 5CHUA 4RX2A 3WRTA 3G32A 3HLFA 1ZKJA 4WMCD 2RCXA 2WKEA 1BTLA 1YLWA 4R4SA 2XFSA 3PBRA 2J8YA 2DRWA 5HARA 4B88A 1NXYA 3LEZA 3Q7VB 4WEJA 3SH7A 1EROA 2G2WA 3IF6C 1Y54A 3UE0A 1Z6FA 4CPKA 5HX9A 1ESUA 1MY8A 5KSCA 1BULA 4N9LA 4X55A 4BENA 2JC7A 3ZG8B 4BJPA 1H8ZA 1K56A 3HLGA 1K54C 3FZCA 5HFOA 3C4OA 1BSGA 3LCEA 1L0EA 3A3FA 4IBXA 1KE3A 2XD5A 1W8YA 1YLPA 1ZG4A 1FOFA 1VM1A 2ZJ9A 5IHVA 1BLPA 4MNRA 1MWTA 5DF7A 5FSRA 5JYPA 4R1GA 2XFTA 2ZQ9A 5GHZA 3ZG0A 5I94A 1PI5A 4C6YA 3IHBA 1MWRA 5FA7A 3ZG5A 3EQVA 4EBLA 1QMFA 3O3VA 4JLFA 5CEDA 3IQAA 4RVAA 5DF8A 5F82A 1FR6A 4OQIA 1E3UA 3W4QA 3Q1FA 1CEFA 4OQ0A 2OSUA 3PBSA 3QNCA 4PM6A 3V3SA 4K0WA 4NETA 1PW8A 5EECA 1ES5A 2C6WB 5DTKA 2ZQ7A 4WZ4A 3Q7ZA 1SCWA 3W8KA 1RP5A 3BLSA 1U60A 5A92A 4EUZA 3UPOA 1KGEA 4HESA 2XK1A 3G30A 2WGVA 3SS5A 3C5AA 5GHXA 3IWOA 5KMWA 1JTGA 1JWPA 3PBTA 3S1YA 1NZUA 3BLMA 1PIOA 4KQOA 5E43A 5F1GA 3UE1A 3OPRA 3PBQA 5FI7A 2WGIA 2EFXA 5A93A 3C7VA 4DE2A 2ZMAA 2H5SA 3IF6A 3SH8A 4KENB 1XGIA 5FQJA 4DXBA 5FAOA 2WADA 2QMIA 4JXVA 3ZDJA 4WYYA 5CHJA 4BQMA 1TDGA 4UA9A 4K91A 3N4IA 1O7EA 4GN2A 5L2FA 2XF3A 2E8IA 2H0TA 3IHAA 2Y2IA 3HBRA 4IEDA 3SH9A 3W4PA 3ZFZA 3GMWA 1IYOA 2ZM8A 2ZM0A 3A3IA 3IXBA 4KQQA 3ZVWA 4ZJ3A 2ZQDA 4FH2A 4KQRA 3ZNTA 1DJCA 5M1AA 5KZHA 3FV7A 2XGNA 4R3BA 1MWSA 4X56A 3LY4A 4U0TA 4WELA 1MBLA 3PAEA 3V5MA 1K57A 3EQUA 3DTMA 2XEPA 1PZOA 5CRFA 2ZC5B 3P09A 3ITAA 5AQ7A 4C75A 4OVDA 4KZ7A 4OOYA 1PI4A 4FH4A 2WKHA 1BZAA 3BEBA 2A49A 1LI0A 3GR2A 3IT9A 4DDYA 1GCEA 4OPRA 3TOIA 3M6BA 2WKIA 4GD8A 1IEMA 4HBUA 5CHMA 1ESIA 2A3UA 3RXWA 1NYYA 1TEMA 5FQIA 1KGGA 5TFQA 3OZHA 3HVFA 4ZJ1A 5F1FA 4JF4A 1IKGA 2XQZA 4GDNA 3HLEA 1C3BA 3C7UA 3JYIA 4DE0A 3NBLA 4EWFA 5GHYA 3UN7A 3HLCA 1K38A 2Y2HA 5FQQA 1WYCA 3M2KA 1L0GA 1KDWA 1LI9A 3UDIA 3ZGAB 4KZ4A 2ZC4B 2JE5A 3NCKA 1BT5A 1AXBA 2J7VA 2HDRA 1K25A 4R0QA 3QHYA 3IF5A 4S2KA 1PZPA 3S22A 1DJBA 2ZLYA 1LL9A 3BRMA 3NC8A 3IWIA 4OOLA 5EOEA 2XDMA 2V20A 1PW1A 5CTMA 4RYEA 3OPPA 1ONGA 4JPMA 1FCMA 1ONHA 5A91A 3SS4A 1SDEA 3VSLA 4DF6A 1HZOA 2HPBA 4OLDA 1YLZA 1MPLA 1S0WA 4WBGA 3ZG9B 3MKFA 3MXSA 4OPZA 3N6IA 4GOGA 1NYMA 4FSFA 5E2EA 5EE8A 3NY4A 5GLCA 3BFDA 3PBOA 1TDLA 1IKIA 3C4PA 3NI9A 3VMAA 4OP5A 5FDHA 1G6AA 2UWXA 4WEKA 1XP4A 4HBTA 1YM1A 3A3JA 3CG5A 3Q81A 4LV0A 4OQHA 3PBNA 4N92A 1H5XA 2P74A 3RJUA 1M40A 1NZOA 5FQKA 1YLYA 1KE4A 4JBFA 1ES2A 4QB8A 3G35A 3ZHHA 3CZDA 3ZG7B 1IELA 3MZFA 3PTEA 1W5DA 4DXCA 4OPYA 5EVID 3GTCA 2WGWB 5CGWA 4A5RA 4Y0TA 4EQIA 1BLCA 2PBYA 1VQQA 4LV1A 4S2NC 1BUEA 3VP0A 4WZ5C 1XA7A 4DKIA 5HL1A 1DJAA 4OPQA 3VP1A 5E2GA 4E6WA 1GHIA 1ZG6A 2FFYA 1GHPA 5FQ9A 4MLLA 1ES3A 3UY6A 2EXBA 4MBHA 1N9BA 4UA6A 3FWLA 4U0XA 1ZC2A 1RCJA 4P6BA 3VP4A 3DW0A 5TGFA 2VGJA 2WAEA 4ID4A 1KVMA 3MKEA 4S2PA 2IWBA 3UO9A 5AQBA 1TVFA 2QZ6A 1HVBA 4B4ZA 4Q8IA 5J8XA 3IH9A 2JCHA 1L2SA 2Y59A 3UPNA 1K4FA 5CECA 5CTNA 1K56D 1W7FA 1W79A 1MXOA 1K54A 3N8SA 1KGFA 3SS3A 4BD0A 3GRJA 4S2MA 2Z2MB 3HLDA 5DF9A 3WS1A 3VP2A 4X68A 3RXXA 3ZNYA 3GV9A 2WZZA 3E2KA 4CJNA 3Q7VA 3DWZA 2V1ZA 1BLHA 1EWZA 3FKVA 4S2IA 1FQGA 4JXSA 1XPBA 4LV2A 2JBFA 2OLVA 3OC2A 5AQAA 2WAFA 4BD1A 5A90A 1NRFA 2J9PA 1ALQA 1LL5A 2X71A 3S4XA 1E3UD 5M18A 3SOIA 3MFDA 4OONA 3N7WA 5GLBA 1MKIA 3HUNA 2GDNA 2ZD8A 4P87A 1SKFA 1OMEA 3ISGA 4FCFA 4PM7A 2HDUA 3HUMA 4KZ9A 4PM8A 5GLAA 2BG1A 3HUOA 1FCOA 4WMCA 4PPRA 4GNUA 2WK0A 4X6TA 2Y2KA 3BFFA 1YLJA 2FFFB 4UA7A 4JF6A 5KSHA 2H10A 3N8LA 1K55C 5FI2A 3D4FA 3PAGA 2R9XA 2WGWA 2Z2LB 1YT4A 1L0DA 3MXRA 1ERMA 1QMEA 3HLWA 3TSGA 3FKWA 3WWXA 2HP5A 4E3OA 3O86A 3OPHA 3V39A 4P0MA 1YQSA 4Z9QA 5EVLA 1MWUA 2ZC7A 3ITBA 4MEZA 4QY6A 4PM5A 1PWGA 4OH0A 1BLSA 4EBPA 3IH8A 1IYPA 2XD1A 3G2ZA 2XH9A 2I72A 4D2OA 3UDFA 1CK3A 2ZC6B 4X69A 3TG9A 4DRTA 4S2OA 1I2WA 4L0LA 5DTSA 2ZC3B 3VFHA 1YLTA 1CI9A 5CERA 4F94A 1XKZA 1E4DA 2B5RA 1CI8A 3Q82A 3IWQA 4KZBA 4S2LA 5CGSA 4S2JA 1JWZA 4X53A 4R23A 4N1XA 2H0YA 2P9VB 3B3XA 5HAQA 1WE4A 5CEBA 3VOZA 4KZ8A 4E3KA 4BL2A 1J9MA 3O88A 3P98A 4BL3A 3OCNA 2RL3A 2Y2OA 4GB7A 1S6RA 2EX2A 4YFMA 4JKTA 5FATA 5BOHA 2DNSA 3UNWA 1XX2A 1Q2PA 1YMXA 4Y0OA 4MBKA 4XUXA 1HD8A 3HLBA 2R9WA 1K55A 4ZAMA 1KDSA 1W8QA 2OLUA 3G34A 4LCMA 4BLMA 4E3JA 4QJGA 4MBFA 3WS5A 2EX8A 3UE3A 3MBZA 3WS0A 1JVJA 4GZBA 4K0XA 4OLGA 4UAAA 1GA9A 2BLSA 3VSKA 2EFUA 2HP9A 3ZVTA 5F83A 4R3JA 4U3TA 3BFEA 2Q9NA 4KG5A 3GQZA 4WM9A 3BFGA 3G2YA 4IVKA 3VP3A 4E3MA 1K6RA 4R4RA 3BYDA 3W4OA 1JWVA 4HEFA 1GHMA 3Q07A 4GD6A 4NK3A 2Y2GA 4YINA 4PM9A
chains in the Genus database with same CATH superfamily
1YAXA 1MKMA 5HAPA 5L07A 4LCLA 5DTTA 5GL9A 3RFBA 4OQGA 4WL9A 3I7JA 4XXRA 3C30A 4QU3A 2BTFP 1H8YA 2ACGA 3N8RA 2W3GA 2X01A 3QNBA 4KZAA 2QJ7A 2MJ6A 3BECA 4GDBA 3HL9A 3NHQA 3T1XA 2HV1A 5L09A 4LV3A 5HWTA 2XR0A 1OJGA 2Q9MA 3MZEA 4QHCA 2HDQA 1IYSA 3A0SA 3NDGA 2VV7A 4P85A 3AGFA 2B95A 3A0RA 3T4OA 2EX9A 5IS1A 1D7EA 4FTXA 1CEGA 1S67L 5DVAA 2ZM2A 5EOOA 3WS4A 1LHYA 1KE0A 1F98A 2Y2PA 3OCLA 3L9KA 5TBMA 3S7OA 4JF5A 3LY3A 2M7UA 4I5SA 3F1PB 2Y2NA 5FI6A 4N9KA 4PKYA 4RQ9A 4M3KA 5AVEA 1PWDA 3QP6A 3F1NB 3GSGA 1N4OA 1AWIA 2VGKA 4Y0UA 2C5WB 1DRMA 3IXDA 2PR5A 1EI5A 4NXBA 5FL3A 2EX6A 4GS9A 1I2SA 1VHMA 2ZBBA 2XFSA 2J8YA 3KSHA 4B88A 1NXYA 4WEJA 1EROA 2YKFA 1Z6FA 1MY8A 4X55A 3T4JA 1K56A 1K54C 4Y13A 3PXPA 1W8YA 5J4EA 1ZG4A 1VM1A 5IHVA 4R1GA 4R3AA 5I94A 4C6YA 5FA7A 3EQVA 4EBLA 1QMFA 1VETB 1W63Q 3IQAA 4RVAA 5DF8A 3Q1FA 2KLIA 3QNCA 3V3SA 4K0WA 4NETA 3IBRA 5EECA 2C6WB 2R78A 5F6AA 3D72A 3A0VA 2XK1A 3SS5A 5GHXA 5KMWA 3S1YA 1JWPA 1NZUA 1PIOA 2WGIA 3C7VA 2ZMAA 3SH8A 4NXFA 1XGIA 1V9ZA 5FQJA 4DXBA 2QMIA 1TDGA 4K91A 3N4IA 5L2FA 2XF3A 3IHAA 3EEHA 3LIDA 3HBRA 4IEDA 1IYOA 2ZM8A 3CUEA 3UB6A 3ZNTA 1DP8A 1W63M 2W1TB 3C38A 3F1OA 3DBAA 3VV4A 3T1RA 3P09A 4KZ7A 4OOYA 4DDYA 1LI0A 5HPIA 3TOIA 3K3DA 3M6BA 2WKIA 2W3DA 1IEMA 4HBUA 5CHMA 5J7EA 4EW7A 1UGUA 1TEMA 4GHIA 3OZHA 5IU1A 2VJWA 2XQZA 2Z6DA 3IS2B 3JYIA 5GHYA 4GW9A 1K38A 3NOUC 4ETZA 1GSVA 1WYCA 4NG2A 1L0GA 1TS0A 5DFXA 3T12B 1AXBA 5G4ZA 2J7VA 2HDRA 3T1QB 4R0QA 4CLCD 1T18A 3MQQA 2OWHA 2PT7A 5CTMA 4MN6A 4JPMA 1FCMA 2XRNA 5A91A 3LGOA 3VSLA 4DF6A 4CLCE 3MXSA 5EVEA 3NY4A 5GLCA 3C4PA 4LRXC 3KYZA 3IBJA 1G6AA 4WEKA 1YM1A 4IUKA 4OQHA 3RJUA 4EXOA 1H5XA 2P74A 3LR5A 2PRFA 3LEQA 3ZHHA 1YLYA 1ES2A 4JGOA 3ZG7B 1W5DA 5EVID 5CGWA 4EQIA 1Y28A 3MSHA 1BLCA 2VX8A 2EWWA 1XA7A 4H6JA 4DKIA 3VP1A 3JVVA 1GHIA 3UY6A 1N9BA 3FWLA 3DAVA 1ZC2A 3G6OA 4KUKA 3DW0A 1STZA 5TGFA 2VGJA 2WAEA 2IWBA 3MKEA 5J8XA 4Q8IA 4Y17A 3TW8A 2Y59A 4UEYA 2AVXA 3GRJA 1CQAA 2PDRA 1CF0A 4WLAA 3E2KA 3MS6A 3Q7VA 2EA9A 3DWZA 1BLHA 1EWZA 4IUHA 2JKTI 2OLVA 2QJ5A 4NEED 5GLBA 2ZD8A 4BBUA 4Y5FA 4L9FA 3H7WA 4PM7A 5GLAA 4WMCA 5KIZA 4PPRA 2HF6A 3E98A 3BFFA 4UA7A 4JF6A 2V0WA 2R9XA 2WGWA 1YT4A 1SKOB 5DFYA 3ITBA 1PWGA 3NULA 1JNUA 3IH8A 1CK3A 2ZC6B 3KSIA 3VFHA 1YLTA 3BW6A 5CERA 3MQOA 2KOIA 1P9RA 3E4OA 4R23A 5EM0A 4LFUA 1WE4A 5HAQA 4KZ8A 4BL2A 3OCNA 1S6RA 2E8JA 4YFMA 3S7PA 5BOHA 1XX2A 3BQ8A 4MBKA 4ZAMA 1KDSA 2OLUA 2PBDP 2P04A 4MBFA 2EX8A 4UAAA 1H3QA 2BLSA 5I5LA 5F83A 4PKYG 3GQZA 3BFGA 3G2YA 3VP3A 4E3MA 4R4RA 3H82B 1S1YA 3CUEC 4PM9A 1KVLA 3V50A 3OPLA 5HZHA 2OV5A 1S1ZA 4HH2A 4CLCC 3MR0A 5CGXA 3E4PA 4XT2B 1DY6A 4ZBEA 4PMAA 1IYQA 3A3DA 4Q0JA 1GA0A 3NECA 3BQAA 5HSQA 3K2NA 4ZJ2A 1YSQA 4KZ6A 1VEUA 2Y2MA 4E3LA 4C3QA 1Y4OA 3MFXA 2H28A 4L9GA 5G18A 2P9VA 5CHUA 5EVIC 3B42A 4Y15A 2PU2A 1FR1A 2W0NA 4EUVA 1XXMA 4NKPA 2Y2LA 4KZ5A 4ARZA 1SHVA 4X1LA 4I3IA 2GJ3A 3CPTB 4ZDXA 4KQDA 2Y79A 1ODVA 1DP9A 4KZ3A 4PHTA 3LIFA 3A3EA 1XGJA 2J9OA 5FASA 1E25A 3VFFA 2QWSA 2G2UA 2HJEA 2WKRA 1XA1A 4DE1A 3O87A 4HY8A 2W3HA 2ZQAA 5U47A 1G68A 5CXWA 2J80A 4O01A 2V2FF 1YMSA 5FAQA 4LENA 4GKUA 2CC1A 1PYYA 2W3FA 3NIAA 1F2KA 5HAIA 1XJ4A 2Y91A 5EUAA 2I9VA 3WS2A 5EPHA 3UB7A 2IWCA 1D1JA 4Y7PA 2ZL1B 2ZQ8A 4RX2A 3HLFA 2J3WA 1ZKJA 2L0WA 3MF0A 2LB5A 2WKEA 3TJZC 2A24B 1BTLA 3PBRA 2Z6CA 5HARA 3SH7A 1BYWA 1N9NA 3IF6C 1K0KA 5EFWA 4B93A 1Y54A 3MJQA 4N9LA 2JC7A 2UV0E 4CQHA 4BJPA 1H8ZA 3HLGA 1PFLA 2JN7A 5HFOA 3LCEA 4Z1WA 2W1RA 4K08A 1FOFA 2ZJ9A 1BLPA 5FSRA 5JYPA 5GHZA 3ZG0A 1PI5A 1MWRA 2M7VA 3ZG5A 2P7JA 3LR3A 3FPVA 4MDZA 5F82A 1FR6A 3W4QA 1E3UA 1LT0A 2OSUA 3F1PA 2ZQ7A 2KX6A 3Q7ZA 3W8KA 1RP5A 1U60A 3UPOA 1KGEA 4P6ZS 2ZOHA 1TS8A 3G30A 3F1NA 5E43A 3BLMA 3PBQA 3T4LA 2EFXA 1TD5A 5A93A 5IT5A 1PNEA 5F68A 3QP5A 1XFQA 5FAOA 3ZDJA 4WUJA 1O7EA 4GN2A 2E8IA 2H0TA 3MQ0A 2Y2IA 2ZM0A 3NJAA 5EM1A 1TS7A 4NXEA 2CMNA 4X56A 4U0TA 2L4RA 2ZC5B 3ICYA 4FH4A 3BEBA 3GR2A 3IT9A 1GCEA 4PAUA 3KX0X 4GD8A 4EU0A 3CITA 2A3UA 3RXWA 5FQIA 5TFQA 5F1FA 4GDNA 5DJTA 4R6LA 3NBLA 4EWFA 3UN7A 3QP8A 3LR0A 2V1AA 3ZGAB 1KDWA 2JE5A 3NCKA 2PD8A 2V1BA 2JKRM 2JKGA 1NWZA 1K25A 3IF5A 2VGLS 4S2KA 3S22A 2D02A 2ZLYA 1LL9A 1OJ5A 4G3KA 4OOLA 4P6ZM 2XDMA 2V20A 3NOTC 5EOEA 4FUWA 3OPPA 1ONGA 1ONHA 3KYEA 3SS4A 1SDEA 3LUQA 5K5BA 1MPLA 4UQIS 4X1MA 5E2EA 1YKDA 3PBOA 4HBTA 2W1TA 3A3JA 5DKLA 3UMEA 1M40A 1IELA 3MZFA 4DXCA 4OPYA 3GTCA 4LLOB 1WA9A 1VQQA 4F3LB 3VP0A 2O9BA 5HL1A 5E2GA 1FILA 4D60A 1ES3A 1OT6A 2OWJA 1RCJA 4P6BA 3IS2A 4ID4A 2QZ6A 4QWOA 3ZYTA 4BBVA 1L2SA 5CECA 3T4QA 1K56D 1W7FA 1MXOA 2Z2MB 3HLDA 2KDKA 3GV9A 2WZZA 4CJNA 2A2LA 4JXSA 2JBFA 5AQAA 3OC2A 1Z09A 1VB6A 3N7WA 1MKIA 3HUNA 2B02A 2VGLM 3ISGA 4FCFA 2HDUA 4PM8A 3V67A 4GJ4A 2BG1A 2WK0A 2VKSA 2Y2KA 1YLJA 2FFFB 2H10A 3N8LA 1K55C 5FI2A 3D4FA 3LIEA 4JGRA 3HLWA 3TSGA 2O0YA 3WWXA 2HP5A 3V39A 5EVLA 1MWUA 2ZC7A 1T19A 4OH0A 2QKPA 2XD1A 4D2OA 4HOIA 3TG9A 3LIAA 1I2WA 5J3WA 3EEAA 5DTSA 1CI9A 4F94A 1XKZA 1CI8A 3Q82A 1JWZA 2XA7S 1OT9A 3P98A 2LB9A 4JKTA 2DNSA 1YMXA 4Y0OA 3CLOA 3H9WA 3T4KA 2R9WA 1PRQA 4QJGA 1GSWA 3JVUA 3WS0A 1JVJA 4GZBA 4OLGA 4CLCB 4M4XA 2EFUA 3F1OB 2Q9NA 2V9AA 4IVKA 1G6OA 3BYDA 4HEFA 2BASA 1L3LA 1L0FA 1V9YA 2PYPA 3ULFA 5FEGA 1ES4A 1SKOA 2DMWA 2B18A 3IXGA 3T1SA 3WRZA 1WYBA 4B4XA 4OKPA 2WZXA 3G4PA 5HDSA 2VV6A 3P01A 2K7SA 4H8RA 3S7NA 4ETXA 4QD4A 5EVIB 1P97A 4KG2A 4OP8A 4G3VA 5E2HA 3KYQA 2Y2JA 3M2JA 4OOMA 1FSYA 3HJIA 4HNBA 5AQ9A 1LSXA 1SDNA 1RGZA 2HP6A 3NDEA 2EXAA 3TE8A 2O9AA 3AGDA 4E04A 5FAPA 1NY0A 5JYOA 3AGEA 3UE6A 3D9YA 1SZVA 1ERQA 2X02A 2IWDA 3FC7A 2XA7M 4EBNA 1RGYA 3SZTA 2NUPC 3BY8A 2HDSA 2QPNA 3G31A 2VEAA 5TR7A 4R70A 1LLBA 1K6SA 4UHUA 5M19A 3H82A 4ESPA 3U2AA 1T1CA 1IOUA 3BM6A 2WUQA 2HJ9C 4EV4A 3VOYA 5GLDA 4H6JB 1PWCA 3GDIA 2PU4A 4RX3A 4XT2A 5HD5A 1T1AA 2XROA 3UDXA 4EQ1A 3IF6B 4JXGA 4E3IA 2WYXA 1Q2QA 4IJGA 1EW0A 3WRTA 3G32A 1X0OA 4WMCD 4R4SA 2JKFA 2DRWA 2GZAA 3LEZA 3Q7VB 2G2WA 2PAVP 1ESUA 5KSCA 1BULA 4BENA 5A8BA 3EGDC 1BSGA 1L0EA 3A3FA 2EWVA 1YLPA 3B47A 1P9WA 4HP4A 4MNRA 1MWTA 5DF7A 3CPTA 2XFTA 2ZQ9A 3IHBA 4JLFA 3O3VA 5CEDA 3GECA 2PR6A 3PBSA 4PM6A 3PR6A 1PW8A 1TS6A 4WZ4A 1SCWA 4HQAA 4HESA 2O9CA 4X25A 2VLGA 2WGVA 3IWOA 1JTGA 3PBTA 4KQOA 4EETB 3OPRA 3T4TA 4DE2A 3EOIA 2WADA 5CHJA 1NLYA 2ZL1A 3UMDA 2YKHA 3SH9A 3ZFZA 2NUTC 4KQQA 3A3IA 3ZVWA 3LFVA 2J3TD 2ZQDA 4KQRA 4I3JA 1DJCA 4BBTA 3FV7A 4R3BA 1MWSA 3PAEA 3V5MA 1K57A 3DTMA 3ITAA 4OVDA 1PI4A 2WKHA 1BZAA 4KUOA 3E4QA 1NYYA 3CAXA 3R4KA 1KGGA 1N9LA 2GX5A 3HVFA 3FPWA 4ZJ1A 4JF4A 1IKGA 1ZHHB 3C7UA 3R7WB 4DE0A 2Y2HA 4MMNA 4ZRRA 5LBRA 5FQQA 3UDIA 1LI9A 2ZC4B 3LICA 3RH8B 3QHYA 1P0ZA 1A0KA 1DJBA 1VEUB 1S66L 4O0PA 3BRMA 3NC8A 1PW1A 4HHDA 4RYEA 1HZOA 2HPBA 4OLDA 1S0WA 3ZG9B 4OPZA 5EE8A 3BFDA 1TDLA 3VMAA 2P08A 4OP5A 3CG5A 3Q81A 4LV0A 4N92A 3VOLA 1NZOA 4QB8A 3CI6A 1S4SA 1LL8A 3KSGA 4LV1A 1BUEA 1DJAA 4OPQA 3UB8A 4E6WA 1GHPA 3KSFA 3LR4A 4MBHA 1F9IA 2JKRI 3B33A 4U0XA 5FDSA 5G4YA 5C5KA 4HJ6A 1KVMA 4S2PA 3UO9A 1HVBA 2XSSA 2JCHA 5HWWA 5DF9A 4X68A 3RXXA 3ZNYA 4LGWA 2V1ZA 2K2NA 3K3CA 4S2IA 1FQGA 1XPBA 3CWFA 4BD1A 5CX7A 4G3WA 1NRFA 1ALQA 1LL5A 1IFQA 1E3UD 5HDCA 3U4LP 2GDNA 3LI8A 1SKFA 3HUMA 2VV8A 1VETA 4X6TA 3C2WA 3ZQ5A 3CHWP 3PAGA 1L0DA 1QMEA 3FKWA 2G7UA 3O86A 4JGPA 3OPHA 4F3LA 4P0MA 1YQSA 4Z9QA 4LRZE 1NLZA 4MEZA 4PM5A 4QY6A 1BLSA 4EBPA 4MCWA 3RTYA 3FG8A 4Q0HA 2XH9A 4X69A 2J3TC 4AFIA 1MZUA 4L0LA 2ZC3B 2QYBA 1N9OA 3PHYA 1E4DA 1TF1A 5CGSA 4S2LA 4I39A 4FOFA 2H0YA 3UB9A 3B3XA 5CEBA 3VOZA 1DP6A 4BL3A 1YSPA 2RL3A 3DTEA 2Y2OA 2EX2A 1Q2PA 3QP2A 4E3JA 4BLMA 1W8QA 3UE3A 4K0XA 2HP9A 1S4RA 4U3TA 3BFEA 3HJKA 1GHMA 4NK3A 5TBMB 4DJ3A 3G34A 2Y2GA 3DWKA 1JTDA 3CJMA 4E3NA 2Q0OA 4YOFA 3FYZA 3HCYA 2V8FA 3HREA 5HPFA 5HW3A 2WKPA 4O7DA 2ZQCA 3CMZA 1G5UA 2M1CA 1J3WA 1FCNA 3ZCZA 1K57C 1K4EA 3SW1A 3V3RA 4R38A 2IA2A 3LI9A 4JXWA 5FQMA 4IVIA 4BWIA 5D3OA 4GS9B 4HJ4A 4RA7A 2OAQ1 3UPPA 1H0MA 5DKKA 1FSWA 2Y4AA 1NJ4A 1YPRA 1HTZA 1G28A 1I5QA 3P7NA 4ZTKA 3IX4A 3EWKA 4DMZA 4N1HA 4FD8A 4S2NA 2XLNA 4I3AA 3IXHA 4WZ5A 5DJUA 2D01A 1HLUP 1M6KA 2Y2QA 4CLCA 5MC7A 2DCFA 3PYPA 1OTBA 3BWLA 4LRYC 2HZ5A 3GVBA 3E2LA 4QY5A 4UQIM 3LIBA 3UB5P 4DE3A 4IBRA 2V0UA 4XUZA 3S7QA 3VE4A 5HL6A 5E2FA 3DTKA 4KG6A 3M6HA 1NRJA 3E0YA 4E6XA 1GSXA 4GCZA 1OTEA 3BFCA 5L8MA 3MZDA 3O5YA 2Y55A 5EVIA 1O07A 3LO7A 5AVFA 4DDSA 2ZOIA 4NXGA 2PD7A 1F5MA 2RCXA 1XJ2A 4GLQA 1YLWA 2ZMVA 4LPZA 3KO6A 3UE0A 4CPKA 1D06A 4O8GA 5HX9A 2PYRA 3ZG8B 3FZCA 4WN5A 3C4OA 4IBXA 1KE3A 2XD5A 3OBFA 3QP1A 4Y2FA 3T4SA 4OQIA 1XFNA 1CEFA 4OQ0A 4GHIB 4EEUA 5DTKA 1ES5A 3BLSA 5A92A 5HDDA 4EUZA 3DTIA 2ZMFA 3C5AA 5L10A 1XJ3A 3UE1A 5F1GA 5FI7A 5EV0A 5TJJA 2H5SA 3IF6A 4KENB 4JXVA 2INWA 4WYYA 4BQMA 4UA9A 1T1BA 2WKQA 2K31A 4YWZA 1UWPX 3MXQA 3W4PA 4DJ2A 3GMWA 3IXBA 4ZJ3A 4DN0A 1CJFA 4EESA 4FH2A 2FZ0A 5M1AA 5KZHA 2XGNA 1XJ6A 3LY4A 2JHEA 4WELA 1MBLA 3EQUA 4QPRA 2XEPA 4BMWA 1PZOA 5CRFA 5AQ7A 4C75A 2VA0A 1UWNX 2A49A 1OTIA 4OPRA 5F69A 4B9OA 1ESIA 2GNXA 3BY9A 3HLEA 1C3BA 3HLCA 3M2KA 3VE3A 4KZ4A 1BT5A 4HIAA 1PZPA 3IX8A 1LSVA 3IWIA 1OPXA 1ZTUA 2FH5A 1YLZA 2OOLA 4WBGA 3MKFA 3N6IA 4GOGA 1NYMA 4FSFA 3NI9A 1IKIA 3H7WB 5FDHA 2UWXA 4EERA 1XP4A 3TRCA 2JKTM 3PBNA 5FQKA 1KE4A 4JBFA 3G35A 3CZDA 5AJGA 3JPUA 3PTEA 2WGWB 4Q0IA 4A5RA 4Y0TA 2PBYA 1FIKA 2HGVA 4S2NC 2QHKA 2Y8HA 3OOVA 4JGQA 4WZ5C 3NOPC 2FFYA 1ZG6A 5FQ9A 4MLLA 2EXBA 4UA6A 4II7A 3VP4A 3R7WA 5AQBA 1TVFA 4B4ZA 3IH9A 3EGXC 3UPNA 1K4FA 5CTNA 1W79A 1K54A 3N8SA 4L9EA 1KGFA 3SS3A 4BD0A 4S2MA 3MMHA 2V8CA 2A24A 3WS1A 3VP2A 4YNRA 3FKVA 2OAP1 4LV2A 3OLOA 2L1MA 2WAFA 5A90A 2J9PA 2X71A 4I38A 3S4XA 3BJNA 5M18A 2W3EA 4WF0A 3SOIA 3MFDA 4OONA 4MN5A 4ME4A 4HI4A 2W27A 4HP9A 4P87A 1OMEA 4KZ9A 1KOUA 3HUOA 1FCOA 4GNUA 4EEPA 1MC0A 5KSHA 5HWVA 5F5YA 2Z2LB 3MXRA 1ERMA 3C8CA 5HD3A 3L7HA 3D3OA 4IHQA 2VK3A 4E3OA 4HJ3A 1IYPA 3G2ZA 2I72A 3UDFA 4DRTA 2O99A 4S2OA 1ACFA 2B5RA 3IWQA 4KZBA 4S2JA 4X53A 4MN7A 5FEFA 1H8MA 4N1XA 2P9VB 4E3KA 1J9MA 3O88A 4GB7A 1OTDA 3QP4A 5FATA 3UNWA 2PHYA 4HH3A 4XUXA 4ARZB 1HD8A 3HLBA 1K55A 4LCMA 4Y3IA 3T50A 3WS5A 3MBZA 3LYXA 1LSWA 1GA9A 3IX3A 3VSKA 3ZVTA 2VZWA 4R3JA 1OTAA 4KG5A 4WM9A 1K6RA 3W2ZA 1JWVA 3W4OA 3Q07A 4GD6A 4YINA
chains in the Genus database with same CATH topology
1KVLA 1L0FA 3V50A 3DWKA 1JTDA 3OPLA 3CJMA 4E3NA 1ES4A 2OV5A 5HAPA 3FYZA 4LCLA 5DTTA 3HREA 5CGXA 5GL9A 5HW3A 4OQGA 4O7DA 2ZQCA 3IXGA 3I7JA 3CMZA 4XXRA 3WRZA 1WYBA 4B4XA 4QU3A 1DY6A 4OKPA 2WZXA 4ZBEA 4PMAA 1H8YA 1FCNA 3G4PA 3N8RA 3ZCZA 1K57C 4H8RA 2X01A 1K4EA 1IYQA 4QD4A 5EVIB 3A3DA 3V3RA 3QNBA 4KZAA 4KG2A 4OP8A 1GA0A 5E2HA 3BECA 4GDBA 3HL9A 4JXWA 2Y2JA 5FQMA 4ZJ2A 3M2JA 4IVIA 4KZ6A 4OOMA 1FSYA 2Y2MA 5D3OA 4E3LA 4C3QA 4LV3A 5AQ9A 4RA7A 3UPPA 2XR0A 5G18A 1FSWA 2Y4AA 2P9VA 2Q9MA 1NJ4A 1RGZA 1SDNA 1HTZA 1I5QA 2HP6A 2HDQA 2EXAA 3MZEA 3NDEA 4QHCA 1IYSA 5EVIC 4ZTKA 2PU2A 1FR1A 3NDGA 3AGDA 5FAPA 4P85A 1NY0A 3AGFA 5JYOA 1XXMA 3AGEA 4FD8A 4N1HA 4S2NA 2XLNA 2Y2LA 3IXHA 4KZ5A 4WZ5A 2EX9A 1ERQA 2X02A 1SHVA 2IWDA 1CEGA 4EBNA 1RGYA 1M6KA 2Y2QA 2DCFA 5DVAA 2ZM2A 5EOOA 2HDSA 2QPNA 4ZDXA 3G31A 1LHYA 3WS4A 5TR7A 3GVBA 3E2LA 1KE0A 1LLBA 4KZ3A 2Y2PA 3A3EA 1XGJA 3OCLA 4QY5A 1K6SA 2J9OA 4UHUA 1E25A 3VFFA 5FASA 5M19A 2G2UA 1XA1A 4JF5A 4DE1A 3O87A 3BM6A 3LY3A 4DE3A 2WUQA 2ZQAA 5U47A 1G68A 4IBRA 2Y2NA 4XUZA 5CXWA 4EV4A 5FI6A 4N9KA 3VOYA 5GLDA 2V2FF 1YMSA 5FAQA 1PWCA 4M3KA 4LENA 2PU4A 2CC1A 1PYYA 4GKUA 4RX3A 3NIAA 5E2FA 4KG6A 3M6HA 1PWDA 4E6XA 5HAIA 3GSGA 2Y91A 1N4OA 3BFCA 3MZDA 5EUAA 2VGKA 3UDXA 2Y55A 5EVIA 3WS2A 5EPHA 3IF6B 4JXGA 2C5WB 4Y0UA 2IWCA 4E3IA 1O07A 3LO7A 4DDSA 4Y7PA 3IXDA 1EI5A 2EX6A 2WYXA 1Q2QA 2ZQ8A 1I2SA 5CHUA 4RX2A 3WRTA 3G32A 3HLFA 1ZKJA 4WMCD 2RCXA 2WKEA 1BTLA 1YLWA 4R4SA 2XFSA 3PBRA 2J8YA 2DRWA 5HARA 4B88A 1NXYA 3LEZA 3Q7VB 4WEJA 3SH7A 1EROA 2G2WA 3IF6C 1Y54A 3UE0A 1Z6FA 4CPKA 5HX9A 1ESUA 1MY8A 5KSCA 1BULA 4N9LA 4X55A 4BENA 2JC7A 3ZG8B 4BJPA 1H8ZA 1K56A 3HLGA 1K54C 3FZCA 5HFOA 3C4OA 1BSGA 3LCEA 1L0EA 3A3FA 4IBXA 1KE3A 2XD5A 1W8YA 1YLPA 1ZG4A 1FOFA 1VM1A 2ZJ9A 5IHVA 1BLPA 4MNRA 1MWTA 5DF7A 5FSRA 5JYPA 4R1GA 2XFTA 2ZQ9A 5GHZA 3ZG0A 5I94A 1PI5A 4C6YA 3IHBA 1MWRA 5FA7A 3ZG5A 3EQVA 4EBLA 1QMFA 3O3VA 4JLFA 5CEDA 3IQAA 4RVAA 5DF8A 5F82A 1FR6A 4OQIA 1E3UA 3W4QA 3Q1FA 1CEFA 4OQ0A 2OSUA 3PBSA 3QNCA 4PM6A 3V3SA 4K0WA 4NETA 1PW8A 5EECA 1ES5A 2C6WB 5DTKA 2ZQ7A 4WZ4A 3Q7ZA 1SCWA 3W8KA 1RP5A 3BLSA 1U60A 5A92A 4EUZA 3UPOA 1KGEA 4HESA 2XK1A 3G30A 2WGVA 3SS5A 3C5AA 5GHXA 3IWOA 5KMWA 1JTGA 1JWPA 3PBTA 3S1YA 1NZUA 3BLMA 1PIOA 4KQOA 5E43A 5F1GA 3UE1A 3OPRA 3PBQA 5FI7A 2WGIA 2EFXA 5A93A 3C7VA 4DE2A 2ZMAA 2H5SA 3IF6A 3SH8A 4KENB 1XGIA 5FQJA 4DXBA 5FAOA 2WADA 2QMIA 4JXVA 3ZDJA 4WYYA 5CHJA 4BQMA 1TDGA 4UA9A 4K91A 3N4IA 1O7EA 4GN2A 5L2FA 2XF3A 2E8IA 2H0TA 3IHAA 2Y2IA 3HBRA 4IEDA 3SH9A 3W4PA 3ZFZA 3GMWA 1IYOA 2ZM8A 2ZM0A 3A3IA 3IXBA 4KQQA 3ZVWA 4ZJ3A 2ZQDA 4FH2A 4KQRA 3ZNTA 1DJCA 5M1AA 5KZHA 3FV7A 2XGNA 4R3BA 1MWSA 4X56A 3LY4A 4U0TA 4WELA 1MBLA 3PAEA 3V5MA 1K57A 3EQUA 3DTMA 2XEPA 1PZOA 5CRFA 2ZC5B 3P09A 3ITAA 5AQ7A 4C75A 4OVDA 4KZ7A 4OOYA 1PI4A 4FH4A 2WKHA 1BZAA 3BEBA 2A49A 1LI0A 3GR2A 3IT9A 4DDYA 1GCEA 4OPRA 3TOIA 3M6BA 2WKIA 4GD8A 1IEMA 4HBUA 5CHMA 1ESIA 2A3UA 3RXWA 1NYYA 1TEMA 5FQIA 1KGGA 5TFQA 3OZHA 3HVFA 4ZJ1A 5F1FA 4JF4A 1IKGA 2XQZA 4GDNA 3HLEA 1C3BA 3C7UA 3JYIA 4DE0A 3NBLA 4EWFA 5GHYA 3UN7A 3HLCA 1K38A 2Y2HA 5FQQA 1WYCA 3M2KA 1L0GA 1KDWA 1LI9A 3UDIA 3ZGAB 4KZ4A 2ZC4B 2JE5A 3NCKA 1BT5A 1AXBA 2J7VA 2HDRA 1K25A 4R0QA 3QHYA 3IF5A 4S2KA 1PZPA 3S22A 1DJBA 2ZLYA 1LL9A 3BRMA 3NC8A 3IWIA 4OOLA 5EOEA 2XDMA 2V20A 1PW1A 5CTMA 4RYEA 3OPPA 1ONGA 4JPMA 1FCMA 1ONHA 5A91A 3SS4A 1SDEA 3VSLA 4DF6A 1HZOA 2HPBA 4OLDA 1YLZA 1MPLA 1S0WA 4WBGA 3ZG9B 3MKFA 3MXSA 4OPZA 3N6IA 4GOGA 1NYMA 4FSFA 5E2EA 5EE8A 3NY4A 5GLCA 3BFDA 3PBOA 1TDLA 1IKIA 3C4PA 3NI9A 3VMAA 4OP5A 5FDHA 1G6AA 2UWXA 4WEKA 1XP4A 4HBTA 1YM1A 3A3JA 3CG5A 3Q81A 4LV0A 4OQHA 3PBNA 4N92A 1H5XA 2P74A 3RJUA 1M40A 1NZOA 5FQKA 1YLYA 1KE4A 4JBFA 1ES2A 4QB8A 3G35A 3ZHHA 3CZDA 3ZG7B 1IELA 3MZFA 3PTEA 1W5DA 4DXCA 4OPYA 5EVID 3GTCA 2WGWB 5CGWA 4A5RA 4Y0TA 4EQIA 1BLCA 2PBYA 1VQQA 4LV1A 4S2NC 1BUEA 3VP0A 4WZ5C 1XA7A 4DKIA 5HL1A 1DJAA 4OPQA 3VP1A 5E2GA 4E6WA 1GHIA 1ZG6A 2FFYA 1GHPA 5FQ9A 4MLLA 1ES3A 3UY6A 2EXBA 4MBHA 1N9BA 4UA6A 3FWLA 4U0XA 1ZC2A 1RCJA 4P6BA 3VP4A 3DW0A 5TGFA 2VGJA 2WAEA 4ID4A 1KVMA 3MKEA 4S2PA 2IWBA 3UO9A 5AQBA 1TVFA 2QZ6A 1HVBA 4B4ZA 4Q8IA 5J8XA 3IH9A 2JCHA 1L2SA 2Y59A 3UPNA 1K4FA 5CECA 5CTNA 1K56D 1W7FA 1W79A 1MXOA 1K54A 3N8SA 1KGFA 3SS3A 4BD0A 3GRJA 4S2MA 2Z2MB 3HLDA 5DF9A 3WS1A 3VP2A 4X68A 3RXXA 3ZNYA 3GV9A 2WZZA 3E2KA 4CJNA 3Q7VA 3DWZA 2V1ZA 1BLHA 1EWZA 3FKVA 4S2IA 1FQGA 4JXSA 1XPBA 4LV2A 2JBFA 2OLVA 3OC2A 5AQAA 2WAFA 4BD1A 5A90A 1NRFA 2J9PA 1ALQA 1LL5A 2X71A 3S4XA 1E3UD 5M18A 3SOIA 3MFDA 4OONA 3N7WA 5GLBA 1MKIA 3HUNA 2GDNA 2ZD8A 4P87A 1SKFA 1OMEA 3ISGA 4FCFA 4PM7A 2HDUA 3HUMA 4KZ9A 4PM8A 5GLAA 2BG1A 3HUOA 1FCOA 4WMCA 4PPRA 4GNUA 2WK0A 4X6TA 2Y2KA 3BFFA 1YLJA 2FFFB 4UA7A 4JF6A 5KSHA 2H10A 3N8LA 1K55C 5FI2A 3D4FA 3PAGA 2R9XA 2WGWA 2Z2LB 1YT4A 1L0DA 3MXRA 1ERMA 1QMEA 3HLWA 3TSGA 3FKWA 3WWXA 2HP5A 4E3OA 3O86A 3OPHA 3V39A 4P0MA 1YQSA 4Z9QA 5EVLA 1MWUA 2ZC7A 3ITBA 4MEZA 4QY6A 4PM5A 1PWGA 4OH0A 1BLSA 4EBPA 3IH8A 1IYPA 2XD1A 3G2ZA 2XH9A 2I72A 4D2OA 3UDFA 1CK3A 2ZC6B 4X69A 3TG9A 4DRTA 4S2OA 1I2WA 4L0LA 5DTSA 2ZC3B 3VFHA 1YLTA 1CI9A 5CERA 4F94A 1XKZA 1E4DA 2B5RA 1CI8A 3Q82A 3IWQA 4KZBA 4S2LA 5CGSA 4S2JA 1JWZA 4X53A 4R23A 4N1XA 2H0YA 2P9VB 3B3XA 5HAQA 1WE4A 5CEBA 3VOZA 4KZ8A 4E3KA 4BL2A 1J9MA 3O88A 3P98A 4BL3A 3OCNA 2RL3A 2Y2OA 4GB7A 1S6RA 2EX2A 4YFMA 4JKTA 5FATA 5BOHA 2DNSA 3UNWA 1XX2A 1Q2PA 1YMXA 4Y0OA 4MBKA 4XUXA 1HD8A 3HLBA 2R9WA 1K55A 4ZAMA 1KDSA 1W8QA 2OLUA 3G34A 4LCMA 4BLMA 4E3JA 4QJGA 4MBFA 3WS5A 2EX8A 3UE3A 3MBZA 3WS0A 1JVJA 4GZBA 4K0XA 4OLGA 4UAAA 1GA9A 2BLSA 3VSKA 2EFUA 2HP9A 3ZVTA 5F83A 4R3JA 4U3TA 3BFEA 2Q9NA 4KG5A 3GQZA 4WM9A 3BFGA 3G2YA 4IVKA 3VP3A 4E3MA 1K6RA 4R4RA 3BYDA 3W4OA 1JWVA 4HEFA 1GHMA 3Q07A 4GD6A 4NK3A 2Y2GA 4YINA 4PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KVL A;  1L0F A;  3V50 A;  3DWK A;  1JTD A;  3OPL A;  3CJM A;  4E3N A;  1ES4 A;  2OV5 A;  5HAP A;  3FYZ A;  4LCL A;  5DTT A;  3HRE A;  5CGX A;  5GL9 A;  5HW3 A;  4OQG A;  4O7D A;  2ZQC A;  3IXG A;  3I7J A;  3CMZ A;  4XXR A;  3WRZ A;  1WYB A;  4B4X A;  4QU3 A;  1DY6 A;  4OKP A;  2WZX A;  4ZBE A;  4PMA A;  1H8Y A;  1FCN A;  3G4P A;  3N8R A;  3ZCZ A;  1K57 C;  4H8R A;  2X01 A;  1K4E A;  1IYQ A;  4QD4 A;  5EVI B;  3A3D A;  3V3R A;  3QNB A;  4KZA A;  4KG2 A;  4OP8 A;  1GA0 A;  5E2H A;  3BEC A;  4GDB A;  3HL9 A;  4JXW A;  2Y2J A;  5FQM A;  4ZJ2 A;  3M2J A;  4IVI A;  4KZ6 A;  4OOM A;  1FSY A;  2Y2M A;  5D3O A;  4E3L A;  4C3Q A;  4LV3 A;  5AQ9 A;  4RA7 A;  3UPP A;  2XR0 A;  5G18 A;  1FSW A;  2Y4A A;  2P9V A;  2Q9M A;  1NJ4 A;  1RGZ A;  1SDN A;  1HTZ A;  1I5Q A;  2HP6 A;  2HDQ A;  2EXA A;  3MZE A;  3NDE A;  4QHC A;  1IYS A;  5EVI C;  4ZTK A;  2PU2 A;  1FR1 A;  3NDG A;  3AGD A;  5FAP A;  4P85 A;  1NY0 A;  3AGF A;  5JYO A;  1XXM A;  3AGE A;  4FD8 A;  4N1H A;  4S2N A;  2XLN A;  2Y2L A;  3IXH A;  4KZ5 A;  4WZ5 A;  2EX9 A;  1ERQ A;  2X02 A;  1SHV A;  2IWD A;  1CEG A;  4EBN A;  1RGY A;  1M6K A;  2Y2Q A;  2DCF A;  5DVA A;  2ZM2 A;  5EOO A;  2HDS A;  2QPN A;  4ZDX A;  3G31 A;  1LHY A;  3WS4 A;  5TR7 A;  3GVB A;  3E2L A;  1KE0 A;  1LLB A;  4KZ3 A;  2Y2P A;  3A3E A;  1XGJ A;  3OCL A;  4QY5 A;  1K6S A;  2J9O A;  4UHU A;  1E25 A;  3VFF A;  5FAS A;  5M19 A;  2G2U A;  1XA1 A;  4JF5 A;  4DE1 A;  3O87 A;  3BM6 A;  3LY3 A;  4DE3 A;  2WUQ A;  2ZQA A;  5U47 A;  1G68 A;  4IBR A;  2Y2N A;  4XUZ A;  5CXW A;  4EV4 A;  5FI6 A;  4N9K A;  3VOY A;  5GLD A;  2V2F F;  1YMS A;  5FAQ A;  1PWC A;  4M3K A;  4LEN A;  2PU4 A;  2CC1 A;  1PYY A;  4GKU A;  4RX3 A;  3NIA A;  5E2F A;  4KG6 A;  3M6H A;  1PWD A;  4E6X A;  5HAI A;  3GSG A;  2Y91 A;  1N4O A;  3BFC A;  3MZD A;  5EUA A;  2VGK A;  3UDX A;  2Y55 A;  5EVI A;  3WS2 A;  5EPH A;  3IF6 B;  4JXG A;  2C5W B;  4Y0U A;  2IWC A;  4E3I A;  1O07 A;  3LO7 A;  4DDS A;  4Y7P A;  3IXD A;  1EI5 A;  2EX6 A;  2WYX A;  1Q2Q A;  2ZQ8 A;  1I2S A;  5CHU A;  4RX2 A;  3WRT A;  3G32 A;  3HLF A;  1ZKJ A;  4WMC D;  2RCX A;  2WKE A;  1BTL A;  1YLW A;  4R4S A;  2XFS A;  3PBR A;  2J8Y A;  2DRW A;  5HAR A;  4B88 A;  1NXY A;  3LEZ A;  3Q7V B;  4WEJ A;  3SH7 A;  1ERO A;  2G2W A;  3IF6 C;  1Y54 A;  3UE0 A;  1Z6F A;  4CPK A;  5HX9 A;  1ESU A;  1MY8 A;  5KSC A;  1BUL A;  4N9L A;  4X55 A;  4BEN A;  2JC7 A;  3ZG8 B;  4BJP A;  1H8Z A;  1K56 A;  3HLG A;  1K54 C;  3FZC A;  5HFO A;  3C4O A;  1BSG A;  3LCE A;  1L0E A;  3A3F A;  4IBX A;  1KE3 A;  2XD5 A;  1W8Y A;  1YLP A;  1ZG4 A;  1FOF A;  1VM1 A;  2ZJ9 A;  5IHV A;  1BLP A;  4MNR A;  1MWT A;  5DF7 A;  5FSR A;  5JYP A;  4R1G A;  2XFT A;  2ZQ9 A;  5GHZ A;  3ZG0 A;  5I94 A;  1PI5 A;  4C6Y A;  3IHB A;  1MWR A;  5FA7 A;  3ZG5 A;  3EQV A;  4EBL A;  1QMF A;  3O3V A;  4JLF A;  5CED A;  3IQA A;  4RVA A;  5DF8 A;  5F82 A;  1FR6 A;  4OQI A;  1E3U A;  3W4Q A;  3Q1F A;  1CEF A;  4OQ0 A;  2OSU A;  3PBS A;  3QNC A;  4PM6 A;  3V3S A;  4K0W A;  4NET A;  1PW8 A;  5EEC A;  1ES5 A;  2C6W B;  5DTK A;  2ZQ7 A;  4WZ4 A;  3Q7Z A;  1SCW A;  3W8K A;  1RP5 A;  3BLS A;  1U60 A;  5A92 A;  4EUZ A;  3UPO A;  1KGE A;  4HES A;  2XK1 A;  3G30 A;  2WGV A;  3SS5 A;  3C5A A;  5GHX A;  3IWO A;  5KMW A;  1JTG A;  1JWP A;  3PBT A;  3S1Y A;  1NZU A;  3BLM A;  1PIO A;  4KQO A;  5E43 A;  5F1G A;  3UE1 A;  3OPR A;  3PBQ A;  5FI7 A;  2WGI A;  2EFX A;  5A93 A;  3C7V A;  4DE2 A;  2ZMA A;  2H5S A;  3IF6 A;  3SH8 A;  4KEN B;  1XGI A;  5FQJ A;  4DXB A;  5FAO A;  2WAD A;  2QMI A;  4JXV A;  3ZDJ A;  4WYY A;  5CHJ A;  4BQM A;  1TDG A;  4UA9 A;  4K91 A;  3N4I A;  1O7E A;  4GN2 A;  5L2F A;  2XF3 A;  2E8I A;  2H0T A;  3IHA A;  2Y2I A;  3HBR A;  4IED A;  3SH9 A;  3W4P A;  3ZFZ A;  3GMW A;  1IYO A;  2ZM8 A;  2ZM0 A;  3A3I A;  3IXB A;  4KQQ A;  3ZVW A;  4ZJ3 A;  2ZQD A;  4FH2 A;  4KQR A;  3ZNT A;  1DJC A;  5M1A A;  5KZH A;  3FV7 A;  2XGN A;  4R3B A;  1MWS A;  4X56 A;  3LY4 A;  4U0T A;  4WEL A;  1MBL A;  3PAE A;  3V5M A;  1K57 A;  3EQU A;  3DTM A;  2XEP A;  1PZO A;  5CRF A;  2ZC5 B;  3P09 A;  3ITA A;  5AQ7 A;  4C75 A;  4OVD A;  4KZ7 A;  4OOY A;  1PI4 A;  4FH4 A;  2WKH A;  1BZA A;  3BEB A;  2A49 A;  1LI0 A;  3GR2 A;  3IT9 A;  4DDY A;  1GCE A;  4OPR A;  3TOI A;  3M6B A;  2WKI A;  4GD8 A;  1IEM A;  4HBU A;  5CHM A;  1ESI A;  2A3U A;  3RXW A;  1NYY A;  1TEM A;  5FQI A;  1KGG A;  5TFQ A;  3OZH A;  3HVF A;  4ZJ1 A;  5F1F A;  4JF4 A;  1IKG A;  2XQZ A;  4GDN A;  3HLE A;  1C3B A;  3C7U A;  3JYI A;  4DE0 A;  3NBL A;  4EWF A;  5GHY A;  3UN7 A;  3HLC A;  1K38 A;  2Y2H A;  5FQQ A;  1WYC A;  3M2K A;  1L0G A;  1KDW A;  1LI9 A;  3UDI A;  3ZGA B;  4KZ4 A;  2ZC4 B;  2JE5 A;  3NCK A;  1BT5 A;  1AXB A;  2J7V A;  2HDR A;  1K25 A;  4R0Q A;  3QHY A;  3IF5 A;  4S2K A;  1PZP A;  3S22 A;  1DJB A;  2ZLY A;  1LL9 A;  3BRM A;  3NC8 A;  3IWI A;  4OOL A;  5EOE A;  2XDM A;  2V20 A;  1PW1 A;  5CTM A;  4RYE A;  3OPP A;  1ONG A;  4JPM A;  1FCM A;  1ONH A;  5A91 A;  3SS4 A;  1SDE A;  3VSL A;  4DF6 A;  1HZO A;  2HPB A;  4OLD A;  1YLZ A;  1MPL A;  1S0W A;  4WBG A;  3ZG9 B;  3MKF A;  3MXS A;  4OPZ A;  3N6I A;  4GOG A;  1NYM A;  4FSF A;  5E2E A;  5EE8 A;  3NY4 A;  5GLC A;  3BFD A;  3PBO A;  1TDL A;  1IKI A;  3C4P A;  3NI9 A;  3VMA A;  4OP5 A;  5FDH A;  1G6A A;  2UWX A;  4WEK A;  1XP4 A;  4HBT A;  1YM1 A;  3A3J A;  3CG5 A;  3Q81 A;  4LV0 A;  4OQH A;  3PBN A;  4N92 A;  1H5X A;  2P74 A;  3RJU A;  1M40 A;  1NZO A;  5FQK A;  1YLY A;  1KE4 A;  4JBF A;  1ES2 A;  4QB8 A;  3G35 A;  3ZHH A;  3CZD A;  3ZG7 B;  1IEL A;  3MZF A;  3PTE A;  1W5D A;  4DXC A;  4OPY A;  5EVI D;  3GTC A;  2WGW B;  5CGW A;  4A5R A;  4Y0T A;  4EQI A;  1BLC A;  2PBY A;  1VQQ A;  4LV1 A;  4S2N C;  1BUE A;  3VP0 A;  4WZ5 C;  1XA7 A;  4DKI A;  5HL1 A;  1DJA A;  4OPQ A;  3VP1 A;  5E2G A;  4E6W A;  1GHI A;  1ZG6 A;  2FFY A;  1GHP A;  5FQ9 A;  4MLL A;  1ES3 A;  3UY6 A;  2EXB A;  4MBH A;  1N9B A;  4UA6 A;  3FWL A;  4U0X A;  1ZC2 A;  1RCJ A;  4P6B A;  3VP4 A;  3DW0 A;  5TGF A;  2VGJ A;  2WAE A;  4ID4 A;  1KVM A;  3MKE A;  4S2P A;  2IWB A;  3UO9 A;  5AQB A;  1TVF A;  2QZ6 A;  1HVB A;  4B4Z A;  4Q8I A;  5J8X A;  3IH9 A;  2JCH A;  1L2S A;  2Y59 A;  3UPN A;  1K4F A;  5CEC A;  5CTN A;  1K56 D;  1W7F A;  1W79 A;  1MXO A;  1K54 A;  3N8S A;  1KGF A;  3SS3 A;  4BD0 A;  3GRJ A;  4S2M A;  2Z2M B;  3HLD A;  5DF9 A;  3WS1 A;  3VP2 A;  4X68 A;  3RXX A;  3ZNY A;  3GV9 A;  2WZZ A;  3E2K A;  4CJN A;  3Q7V A;  3DWZ A;  2V1Z A;  1BLH A;  1EWZ A;  3FKV A;  4S2I A;  1FQG A;  4JXS A;  1XPB A;  4LV2 A;  2JBF A;  2OLV A;  3OC2 A;  5AQA A;  2WAF A;  4BD1 A;  5A90 A;  1NRF A;  2J9P A;  1ALQ A;  1LL5 A;  2X71 A;  3S4X A;  1E3U D;  5M18 A;  3SOI A;  3MFD A;  4OON A;  3N7W A;  5GLB A;  1MKI A;  3HUN A;  2GDN A;  2ZD8 A;  4P87 A;  1SKF A;  1OME A;  3ISG A;  4FCF A;  4PM7 A;  2HDU A;  3HUM A;  4KZ9 A;  4PM8 A;  5GLA A;  2BG1 A;  3HUO A;  1FCO A;  4WMC A;  4PPR A;  4GNU A;  2WK0 A;  4X6T A;  2Y2K A;  3BFF A;  1YLJ A;  2FFF B;  4UA7 A;  4JF6 A;  5KSH A;  2H10 A;  3N8L A;  1K55 C;  5FI2 A;  3D4F A;  3PAG A;  2R9X A;  2WGW A;  2Z2L B;  1YT4 A;  1L0D A;  3MXR A;  1ERM A;  1QME A;  3HLW A;  3TSG A;  3FKW A;  3WWX A;  2HP5 A;  4E3O A;  3O86 A;  3OPH A;  3V39 A;  4P0M A;  1YQS A;  4Z9Q A;  5EVL A;  1MWU A;  2ZC7 A;  3ITB A;  4MEZ A;  4QY6 A;  4PM5 A;  1PWG A;  4OH0 A;  1BLS A;  4EBP A;  3IH8 A;  1IYP A;  2XD1 A;  3G2Z A;  2XH9 A;  2I72 A;  4D2O A;  3UDF A;  1CK3 A;  2ZC6 B;  4X69 A;  3TG9 A;  4DRT A;  4S2O A;  1I2W A;  4L0L A;  5DTS A;  2ZC3 B;  3VFH A;  1YLT A;  1CI9 A;  5CER A;  4F94 A;  1XKZ A;  1E4D A;  2B5R A;  1CI8 A;  3Q82 A;  3IWQ A;  4KZB A;  4S2L A;  5CGS A;  4S2J A;  1JWZ A;  4X53 A;  4R23 A;  4N1X A;  2H0Y A;  2P9V B;  3B3X A;  5HAQ A;  1WE4 A;  5CEB A;  3VOZ A;  4KZ8 A;  4E3K A;  4BL2 A;  1J9M A;  3O88 A;  3P98 A;  4BL3 A;  3OCN A;  2RL3 A;  2Y2O A;  4GB7 A;  1S6R A;  2EX2 A;  4YFM A;  4JKT A;  5FAT A;  5BOH A;  2DNS A;  3UNW A;  1XX2 A;  1Q2P A;  1YMX A;  4Y0O A;  4MBK A;  4XUX A;  1HD8 A;  3HLB A;  2R9W A;  1K55 A;  4ZAM A;  1KDS A;  1W8Q A;  2OLU A;  3G34 A;  4LCM A;  4BLM A;  4E3J A;  4QJG A;  4MBF A;  3WS5 A;  2EX8 A;  3UE3 A;  3MBZ A;  3WS0 A;  1JVJ A;  4GZB A;  4K0X A;  4OLG A;  4UAA A;  1GA9 A;  2BLS A;  3VSK A;  2EFU A;  2HP9 A;  3ZVT A;  5F83 A;  4R3J A;  4U3T A;  3BFE A;  2Q9N A;  4KG5 A;  3GQZ A;  4WM9 A;  3BFG A;  3G2Y A;  4IVK A;  3VP3 A;  4E3M A;  1K6R A;  4R4R A;  3BYD A;  3W4O A;  1JWV A;  4HEF A;  1GHM A;  3Q07 A;  4GD6 A;  4NK3 A;  2Y2G A;  4YIN A;  4PM9 A; 
#chains in the Genus database with same CATH topology
 1YAX A;  1MKM A;  5HAP A;  5L07 A;  4LCL A;  5DTT A;  5GL9 A;  3RFB A;  4OQG A;  4WL9 A;  3I7J A;  4XXR A;  3C30 A;  4QU3 A;  2BTF P;  1H8Y A;  2ACG A;  3N8R A;  2W3G A;  2X01 A;  3QNB A;  4KZA A;  2QJ7 A;  2MJ6 A;  3BEC A;  4GDB A;  3HL9 A;  3NHQ A;  3T1X A;  2HV1 A;  5L09 A;  4LV3 A;  5HWT A;  2XR0 A;  1OJG A;  2Q9M A;  3MZE A;  4QHC A;  2HDQ A;  1IYS A;  3A0S A;  3NDG A;  2VV7 A;  4P85 A;  3AGF A;  2B95 A;  3A0R A;  3T4O A;  2EX9 A;  5IS1 A;  1D7E A;  4FTX A;  1CEG A;  1S67 L;  5DVA A;  2ZM2 A;  5EOO A;  3WS4 A;  1LHY A;  1KE0 A;  1F98 A;  2Y2P A;  3OCL A;  3L9K A;  5TBM A;  3S7O A;  4JF5 A;  3LY3 A;  2M7U A;  4I5S A;  3F1P B;  2Y2N A;  5FI6 A;  4N9K A;  4PKY A;  4RQ9 A;  4M3K A;  5AVE A;  1PWD A;  3QP6 A;  3F1N B;  3GSG A;  1N4O A;  1AWI A;  2VGK A;  4Y0U A;  2C5W B;  1DRM A;  3IXD A;  2PR5 A;  1EI5 A;  4NXB A;  5FL3 A;  2EX6 A;  4GS9 A;  1I2S A;  1VHM A;  2ZBB A;  2XFS A;  2J8Y A;  3KSH A;  4B88 A;  1NXY A;  4WEJ A;  1ERO A;  2YKF A;  1Z6F A;  1MY8 A;  4X55 A;  3T4J A;  1K56 A;  1K54 C;  4Y13 A;  3PXP A;  1W8Y A;  5J4E A;  1ZG4 A;  1VM1 A;  5IHV A;  4R1G A;  4R3A A;  5I94 A;  4C6Y A;  5FA7 A;  3EQV A;  4EBL A;  1QMF A;  1VET B;  1W63 Q;  3IQA A;  4RVA A;  5DF8 A;  3Q1F A;  2KLI A;  3QNC A;  3V3S A;  4K0W A;  4NET A;  3IBR A;  5EEC A;  2C6W B;  2R78 A;  5F6A A;  3D72 A;  3A0V A;  2XK1 A;  3SS5 A;  5GHX A;  5KMW A;  3S1Y A;  1JWP A;  1NZU A;  1PIO A;  2WGI A;  3C7V A;  2ZMA A;  3SH8 A;  4NXF A;  1XGI A;  1V9Z A;  5FQJ A;  4DXB A;  2QMI A;  1TDG A;  4K91 A;  3N4I A;  5L2F A;  2XF3 A;  3IHA A;  3EEH A;  3LID A;  3HBR A;  4IED A;  1IYO A;  2ZM8 A;  3CUE A;  3UB6 A;  3ZNT A;  1DP8 A;  1W63 M;  2W1T B;  3C38 A;  3F1O A;  3DBA A;  3VV4 A;  3T1R A;  3P09 A;  4KZ7 A;  4OOY A;  4DDY A;  1LI0 A;  5HPI A;  3TOI A;  3K3D A;  3M6B A;  2WKI A;  2W3D A;  1IEM A;  4HBU A;  5CHM A;  5J7E A;  4EW7 A;  1UGU A;  1TEM A;  4GHI A;  3OZH A;  5IU1 A;  2VJW A;  2XQZ A;  2Z6D A;  3IS2 B;  3JYI A;  5GHY A;  4GW9 A;  1K38 A;  3NOU C;  4ETZ A;  1GSV A;  1WYC A;  4NG2 A;  1L0G A;  1TS0 A;  5DFX A;  3T12 B;  1AXB A;  5G4Z A;  2J7V A;  2HDR A;  3T1Q B;  4R0Q A;  4CLC D;  1T18 A;  3MQQ A;  2OWH A;  2PT7 A;  5CTM A;  4MN6 A;  4JPM A;  1FCM A;  2XRN A;  5A91 A;  3LGO A;  3VSL A;  4DF6 A;  4CLC E;  3MXS A;  5EVE A;  3NY4 A;  5GLC A;  3C4P A;  4LRX C;  3KYZ A;  3IBJ A;  1G6A A;  4WEK A;  1YM1 A;  4IUK A;  4OQH A;  3RJU A;  4EXO A;  1H5X A;  2P74 A;  3LR5 A;  2PRF A;  3LEQ A;  3ZHH A;  1YLY A;  1ES2 A;  4JGO A;  3ZG7 B;  1W5D A;  5EVI D;  5CGW A;  4EQI A;  1Y28 A;  3MSH A;  1BLC A;  2VX8 A;  2EWW A;  1XA7 A;  4H6J A;  4DKI A;  3VP1 A;  3JVV A;  1GHI A;  3UY6 A;  1N9B A;  3FWL A;  3DAV A;  1ZC2 A;  3G6O A;  4KUK A;  3DW0 A;  1STZ A;  5TGF A;  2VGJ A;  2WAE A;  2IWB A;  3MKE A;  5J8X A;  4Q8I A;  4Y17 A;  3TW8 A;  2Y59 A;  4UEY A;  2AVX A;  3GRJ A;  1CQA A;  2PDR A;  1CF0 A;  4WLA A;  3E2K A;  3MS6 A;  3Q7V A;  2EA9 A;  3DWZ A;  1BLH A;  1EWZ A;  4IUH A;  2JKT I;  2OLV A;  2QJ5 A;  4NEE D;  5GLB A;  2ZD8 A;  4BBU A;  4Y5F A;  4L9F A;  3H7W A;  4PM7 A;  5GLA A;  4WMC A;  5KIZ A;  4PPR A;  2HF6 A;  3E98 A;  3BFF A;  4UA7 A;  4JF6 A;  2V0W A;  2R9X A;  2WGW A;  1YT4 A;  1SKO B;  5DFY A;  3ITB A;  1PWG A;  3NUL A;  1JNU A;  3IH8 A;  1CK3 A;  2ZC6 B;  3KSI A;  3VFH A;  1YLT A;  3BW6 A;  5CER A;  3MQO A;  2KOI A;  1P9R A;  3E4O A;  4R23 A;  5EM0 A;  4LFU A;  1WE4 A;  5HAQ A;  4KZ8 A;  4BL2 A;  3OCN A;  1S6R A;  2E8J A;  4YFM A;  3S7P A;  5BOH A;  1XX2 A;  3BQ8 A;  4MBK A;  4ZAM A;  1KDS A;  2OLU A;  2PBD P;  2P04 A;  4MBF A;  2EX8 A;  4UAA A;  1H3Q A;  2BLS A;  5I5L A;  5F83 A;  4PKY G;  3GQZ A;  3BFG A;  3G2Y A;  3VP3 A;  4E3M A;  4R4R A;  3H82 B;  1S1Y A;  3CUE C;  4PM9 A;  1KVL A;  3V50 A;  3OPL A;  5HZH A;  2OV5 A;  1S1Z A;  4HH2 A;  4CLC C;  3MR0 A;  5CGX A;  3E4P A;  4XT2 B;  1DY6 A;  4ZBE A;  4PMA A;  1IYQ A;  3A3D A;  4Q0J A;  1GA0 A;  3NEC A;  3BQA A;  5HSQ A;  3K2N A;  4ZJ2 A;  1YSQ A;  4KZ6 A;  1VEU A;  2Y2M A;  4E3L A;  4C3Q A;  1Y4O A;  3MFX A;  2H28 A;  4L9G A;  5G18 A;  2P9V A;  5CHU A;  5EVI C;  3B42 A;  4Y15 A;  2PU2 A;  1FR1 A;  2W0N A;  4EUV A;  1XXM A;  4NKP A;  2Y2L A;  4KZ5 A;  4ARZ A;  1SHV A;  4X1L A;  4I3I A;  2GJ3 A;  3CPT B;  4ZDX A;  4KQD A;  2Y79 A;  1ODV A;  1DP9 A;  4KZ3 A;  4PHT A;  3LIF A;  3A3E A;  1XGJ A;  2J9O A;  5FAS A;  1E25 A;  3VFF A;  2QWS A;  2G2U A;  2HJE A;  2WKR A;  1XA1 A;  4DE1 A;  3O87 A;  4HY8 A;  2W3H A;  2ZQA A;  5U47 A;  1G68 A;  5CXW A;  2J80 A;  4O01 A;  2V2F F;  1YMS A;  5FAQ A;  4LEN A;  4GKU A;  2CC1 A;  1PYY A;  2W3F A;  3NIA A;  1F2K A;  5HAI A;  1XJ4 A;  2Y91 A;  5EUA A;  2I9V A;  3WS2 A;  5EPH A;  3UB7 A;  2IWC A;  1D1J A;  4Y7P A;  2ZL1 B;  2ZQ8 A;  4RX2 A;  3HLF A;  2J3W A;  1ZKJ A;  2L0W A;  3MF0 A;  2LB5 A;  2WKE A;  3TJZ C;  2A24 B;  1BTL A;  3PBR A;  2Z6C A;  5HAR A;  3SH7 A;  1BYW A;  1N9N A;  3IF6 C;  1K0K A;  5EFW A;  4B93 A;  1Y54 A;  3MJQ A;  4N9L A;  2JC7 A;  2UV0 E;  4CQH A;  4BJP A;  1H8Z A;  3HLG A;  1PFL A;  2JN7 A;  5HFO A;  3LCE A;  4Z1W A;  2W1R A;  4K08 A;  1FOF A;  2ZJ9 A;  1BLP A;  5FSR A;  5JYP A;  5GHZ A;  3ZG0 A;  1PI5 A;  1MWR A;  2M7V A;  3ZG5 A;  2P7J A;  3LR3 A;  3FPV A;  4MDZ A;  5F82 A;  1FR6 A;  3W4Q A;  1E3U A;  1LT0 A;  2OSU A;  3F1P A;  2ZQ7 A;  2KX6 A;  3Q7Z A;  3W8K A;  1RP5 A;  1U60 A;  3UPO A;  1KGE A;  4P6Z S;  2ZOH A;  1TS8 A;  3G30 A;  3F1N A;  5E43 A;  3BLM A;  3PBQ A;  3T4L A;  2EFX A;  1TD5 A;  5A93 A;  5IT5 A;  1PNE A;  5F68 A;  3QP5 A;  1XFQ A;  5FAO A;  3ZDJ A;  4WUJ A;  1O7E A;  4GN2 A;  2E8I A;  2H0T A;  3MQ0 A;  2Y2I A;  2ZM0 A;  3NJA A;  5EM1 A;  1TS7 A;  4NXE A;  2CMN A;  4X56 A;  4U0T A;  2L4R A;  2ZC5 B;  3ICY A;  4FH4 A;  3BEB A;  3GR2 A;  3IT9 A;  1GCE A;  4PAU A;  3KX0 X;  4GD8 A;  4EU0 A;  3CIT A;  2A3U A;  3RXW A;  5FQI A;  5TFQ A;  5F1F A;  4GDN A;  5DJT A;  4R6L A;  3NBL A;  4EWF A;  3UN7 A;  3QP8 A;  3LR0 A;  2V1A A;  3ZGA B;  1KDW A;  2JE5 A;  3NCK A;  2PD8 A;  2V1B A;  2JKR M;  2JKG A;  1NWZ A;  1K25 A;  3IF5 A;  2VGL S;  4S2K A;  3S22 A;  2D02 A;  2ZLY A;  1LL9 A;  1OJ5 A;  4G3K A;  4OOL A;  4P6Z M;  2XDM A;  2V20 A;  3NOT C;  5EOE A;  4FUW A;  3OPP A;  1ONG A;  1ONH A;  3KYE A;  3SS4 A;  1SDE A;  3LUQ A;  5K5B A;  1MPL A;  4UQI S;  4X1M A;  5E2E A;  1YKD A;  3PBO A;  4HBT A;  2W1T A;  3A3J A;  5DKL A;  3UME A;  1M40 A;  1IEL A;  3MZF A;  4DXC A;  4OPY A;  3GTC A;  4LLO B;  1WA9 A;  1VQQ A;  4F3L B;  3VP0 A;  2O9B A;  5HL1 A;  5E2G A;  1FIL A;  4D60 A;  1ES3 A;  1OT6 A;  2OWJ A;  1RCJ A;  4P6B A;  3IS2 A;  4ID4 A;  2QZ6 A;  4QWO A;  3ZYT A;  4BBV A;  1L2S A;  5CEC A;  3T4Q A;  1K56 D;  1W7F A;  1MXO A;  2Z2M B;  3HLD A;  2KDK A;  3GV9 A;  2WZZ A;  4CJN A;  2A2L A;  4JXS A;  2JBF A;  5AQA A;  3OC2 A;  1Z09 A;  1VB6 A;  3N7W A;  1MKI A;  3HUN A;  2B02 A;  2VGL M;  3ISG A;  4FCF A;  2HDU A;  4PM8 A;  3V67 A;  4GJ4 A;  2BG1 A;  2WK0 A;  2VKS A;  2Y2K A;  1YLJ A;  2FFF B;  2H10 A;  3N8L A;  1K55 C;  5FI2 A;  3D4F A;  3LIE A;  4JGR A;  3HLW A;  3TSG A;  2O0Y A;  3WWX A;  2HP5 A;  3V39 A;  5EVL A;  1MWU A;  2ZC7 A;  1T19 A;  4OH0 A;  2QKP A;  2XD1 A;  4D2O A;  4HOI A;  3TG9 A;  3LIA A;  1I2W A;  5J3W A;  3EEA A;  5DTS A;  1CI9 A;  4F94 A;  1XKZ A;  1CI8 A;  3Q82 A;  1JWZ A;  2XA7 S;  1OT9 A;  3P98 A;  2LB9 A;  4JKT A;  2DNS A;  1YMX A;  4Y0O A;  3CLO A;  3H9W A;  3T4K A;  2R9W A;  1PRQ A;  4QJG A;  1GSW A;  3JVU A;  3WS0 A;  1JVJ A;  4GZB A;  4OLG A;  4CLC B;  4M4X A;  2EFU A;  3F1O B;  2Q9N A;  2V9A A;  4IVK A;  1G6O A;  3BYD A;  4HEF A;  2BAS A;  1L3L A;  1L0F A;  1V9Y A;  2PYP A;  3ULF A;  5FEG A;  1ES4 A;  1SKO A;  2DMW A;  2B18 A;  3IXG A;  3T1S A;  3WRZ A;  1WYB A;  4B4X A;  4OKP A;  2WZX A;  3G4P A;  5HDS A;  2VV6 A;  3P01 A;  2K7S A;  4H8R A;  3S7N A;  4ETX A;  4QD4 A;  5EVI B;  1P97 A;  4KG2 A;  4OP8 A;  4G3V A;  5E2H A;  3KYQ A;  2Y2J A;  3M2J A;  4OOM A;  1FSY A;  3HJI A;  4HNB A;  5AQ9 A;  1LSX A;  1SDN A;  1RGZ A;  2HP6 A;  3NDE A;  2EXA A;  3TE8 A;  2O9A A;  3AGD A;  4E04 A;  5FAP A;  1NY0 A;  5JYO A;  3AGE A;  3UE6 A;  3D9Y A;  1SZV A;  1ERQ A;  2X02 A;  2IWD A;  3FC7 A;  2XA7 M;  4EBN A;  1RGY A;  3SZT A;  2NUP C;  3BY8 A;  2HDS A;  2QPN A;  3G31 A;  2VEA A;  5TR7 A;  4R70 A;  1LLB A;  1K6S A;  4UHU A;  5M19 A;  3H82 A;  4ESP A;  3U2A A;  1T1C A;  1IOU A;  3BM6 A;  2WUQ A;  2HJ9 C;  4EV4 A;  3VOY A;  5GLD A;  4H6J B;  1PWC A;  3GDI A;  2PU4 A;  4RX3 A;  4XT2 A;  5HD5 A;  1T1A A;  2XRO A;  3UDX A;  4EQ1 A;  3IF6 B;  4JXG A;  4E3I A;  2WYX A;  1Q2Q A;  4IJG A;  1EW0 A;  3WRT A;  3G32 A;  1X0O A;  4WMC D;  4R4S A;  2JKF A;  2DRW A;  2GZA A;  3LEZ A;  3Q7V B;  2G2W A;  2PAV P;  1ESU A;  5KSC A;  1BUL A;  4BEN A;  5A8B A;  3EGD C;  1BSG A;  1L0E A;  3A3F A;  2EWV A;  1YLP A;  3B47 A;  1P9W A;  4HP4 A;  4MNR A;  1MWT A;  5DF7 A;  3CPT A;  2XFT A;  2ZQ9 A;  3IHB A;  4JLF A;  3O3V A;  5CED A;  3GEC A;  2PR6 A;  3PBS A;  4PM6 A;  3PR6 A;  1PW8 A;  1TS6 A;  4WZ4 A;  1SCW A;  4HQA A;  4HES A;  2O9C A;  4X25 A;  2VLG A;  2WGV A;  3IWO A;  1JTG A;  3PBT A;  4KQO A;  4EET B;  3OPR A;  3T4T A;  4DE2 A;  3EOI A;  2WAD A;  5CHJ A;  1NLY A;  2ZL1 A;  3UMD A;  2YKH A;  3SH9 A;  3ZFZ A;  2NUT C;  4KQQ A;  3A3I A;  3ZVW A;  3LFV A;  2J3T D;  2ZQD A;  4KQR A;  4I3J A;  1DJC A;  4BBT A;  3FV7 A;  4R3B A;  1MWS A;  3PAE A;  3V5M A;  1K57 A;  3DTM A;  3ITA A;  4OVD A;  1PI4 A;  2WKH A;  1BZA A;  4KUO A;  3E4Q A;  1NYY A;  3CAX A;  3R4K A;  1KGG A;  1N9L A;  2GX5 A;  3HVF A;  3FPW A;  4ZJ1 A;  4JF4 A;  1IKG A;  1ZHH B;  3C7U A;  3R7W B;  4DE0 A;  2Y2H A;  4MMN A;  4ZRR A;  5LBR A;  5FQQ A;  3UDI A;  1LI9 A;  2ZC4 B;  3LIC A;  3RH8 B;  3QHY A;  1P0Z A;  1A0K A;  1DJB A;  1VEU B;  1S66 L;  4O0P A;  3BRM A;  3NC8 A;  1PW1 A;  4HHD A;  4RYE A;  1HZO A;  2HPB A;  4OLD A;  1S0W A;  3ZG9 B;  4OPZ A;  5EE8 A;  3BFD A;  1TDL A;  3VMA A;  2P08 A;  4OP5 A;  3CG5 A;  3Q81 A;  4LV0 A;  4N92 A;  3VOL A;  1NZO A;  4QB8 A;  3CI6 A;  1S4S A;  1LL8 A;  3KSG A;  4LV1 A;  1BUE A;  1DJA A;  4OPQ A;  3UB8 A;  4E6W A;  1GHP A;  3KSF A;  3LR4 A;  4MBH A;  1F9I A;  2JKR I;  3B33 A;  4U0X A;  5FDS A;  5G4Y A;  5C5K A;  4HJ6 A;  1KVM A;  4S2P A;  3UO9 A;  1HVB A;  2XSS A;  2JCH A;  5HWW A;  5DF9 A;  4X68 A;  3RXX A;  3ZNY A;  4LGW A;  2V1Z A;  2K2N A;  3K3C A;  4S2I A;  1FQG A;  1XPB A;  3CWF A;  4BD1 A;  5CX7 A;  4G3W A;  1NRF A;  1ALQ A;  1LL5 A;  1IFQ A;  1E3U D;  5HDC A;  3U4L P;  2GDN A;  3LI8 A;  1SKF A;  3HUM A;  2VV8 A;  1VET A;  4X6T A;  3C2W A;  3ZQ5 A;  3CHW P;  3PAG A;  1L0D A;  1QME A;  3FKW A;  2G7U A;  3O86 A;  4JGP A;  3OPH A;  4F3L A;  4P0M A;  1YQS A;  4Z9Q A;  4LRZ E;  1NLZ A;  4MEZ A;  4PM5 A;  4QY6 A;  1BLS A;  4EBP A;  4MCW A;  3RTY A;  3FG8 A;  4Q0H A;  2XH9 A;  4X69 A;  2J3T C;  4AFI A;  1MZU A;  4L0L A;  2ZC3 B;  2QYB A;  1N9O A;  3PHY A;  1E4D A;  1TF1 A;  5CGS A;  4S2L A;  4I39 A;  4FOF A;  2H0Y A;  3UB9 A;  3B3X A;  5CEB A;  3VOZ A;  1DP6 A;  4BL3 A;  1YSP A;  2RL3 A;  3DTE A;  2Y2O A;  2EX2 A;  1Q2P A;  3QP2 A;  4E3J A;  4BLM A;  1W8Q A;  3UE3 A;  4K0X A;  2HP9 A;  1S4R A;  4U3T A;  3BFE A;  3HJK A;  1GHM A;  4NK3 A;  5TBM B;  4DJ3 A;  3G34 A;  2Y2G A;  3DWK A;  1JTD A;  3CJM A;  4E3N A;  2Q0O A;  4YOF A;  3FYZ A;  3HCY A;  2V8F A;  3HRE A;  5HPF A;  5HW3 A;  2WKP A;  4O7D A;  2ZQC A;  3CMZ A;  1G5U A;  2M1C A;  1J3W A;  1FCN A;  3ZCZ A;  1K57 C;  1K4E A;  3SW1 A;  3V3R A;  4R38 A;  2IA2 A;  3LI9 A;  4JXW A;  5FQM A;  4IVI A;  4BWI A;  5D3O A;  4GS9 B;  4HJ4 A;  4RA7 A;  2OAQ 1;  3UPP A;  1H0M A;  5DKK A;  1FSW A;  2Y4A A;  1NJ4 A;  1YPR A;  1HTZ A;  1G28 A;  1I5Q A;  3P7N A;  4ZTK A;  3IX4 A;  3EWK A;  4DMZ A;  4N1H A;  4FD8 A;  4S2N A;  2XLN A;  4I3A A;  3IXH A;  4WZ5 A;  5DJU A;  2D01 A;  1HLU P;  1M6K A;  2Y2Q A;  4CLC A;  5MC7 A;  2DCF A;  3PYP A;  1OTB A;  3BWL A;  4LRY C;  2HZ5 A;  3GVB A;  3E2L A;  4QY5 A;  4UQI M;  3LIB A;  3UB5 P;  4DE3 A;  4IBR A;  2V0U A;  4XUZ A;  3S7Q A;  3VE4 A;  5HL6 A;  5E2F A;  3DTK A;  4KG6 A;  3M6H A;  1NRJ A;  3E0Y A;  4E6X A;  1GSX A;  4GCZ A;  1OTE A;  3BFC A;  5L8M A;  3MZD A;  3O5Y A;  2Y55 A;  5EVI A;  1O07 A;  3LO7 A;  5AVF A;  4DDS A;  2ZOI A;  4NXG A;  2PD7 A;  1F5M A;  2RCX A;  1XJ2 A;  4GLQ A;  1YLW A;  2ZMV A;  4LPZ A;  3KO6 A;  3UE0 A;  4CPK A;  1D06 A;  4O8G A;  5HX9 A;  2PYR A;  3ZG8 B;  3FZC A;  4WN5 A;  3C4O A;  4IBX A;  1KE3 A;  2XD5 A;  3OBF A;  3QP1 A;  4Y2F A;  3T4S A;  4OQI A;  1XFN A;  1CEF A;  4OQ0 A;  4GHI B;  4EEU A;  5DTK A;  1ES5 A;  3BLS A;  5A92 A;  5HDD A;  4EUZ A;  3DTI A;  2ZMF A;  3C5A A;  5L10 A;  1XJ3 A;  3UE1 A;  5F1G A;  5FI7 A;  5EV0 A;  5TJJ A;  2H5S A;  3IF6 A;  4KEN B;  4JXV A;  2INW A;  4WYY A;  4BQM A;  4UA9 A;  1T1B A;  2WKQ A;  2K31 A;  4YWZ A;  1UWP X;  3MXQ A;  3W4P A;  4DJ2 A;  3GMW A;  3IXB A;  4ZJ3 A;  4DN0 A;  1CJF A;  4EES A;  4FH2 A;  2FZ0 A;  5M1A A;  5KZH A;  2XGN A;  1XJ6 A;  3LY4 A;  2JHE A;  4WEL A;  1MBL A;  3EQU A;  4QPR A;  2XEP A;  4BMW A;  1PZO A;  5CRF A;  5AQ7 A;  4C75 A;  2VA0 A;  1UWN X;  2A49 A;  1OTI A;  4OPR A;  5F69 A;  4B9O A;  1ESI A;  2GNX A;  3BY9 A;  3HLE A;  1C3B A;  3HLC A;  3M2K A;  3VE3 A;  4KZ4 A;  1BT5 A;  4HIA A;  1PZP A;  3IX8 A;  1LSV A;  3IWI A;  1OPX A;  1ZTU A;  2FH5 A;  1YLZ A;  2OOL A;  4WBG A;  3MKF A;  3N6I A;  4GOG A;  1NYM A;  4FSF A;  3NI9 A;  1IKI A;  3H7W B;  5FDH A;  2UWX A;  4EER A;  1XP4 A;  3TRC A;  2JKT M;  3PBN A;  5FQK A;  1KE4 A;  4JBF A;  3G35 A;  3CZD A;  5AJG A;  3JPU A;  3PTE A;  2WGW B;  4Q0I A;  4A5R A;  4Y0T A;  2PBY A;  1FIK A;  2HGV A;  4S2N C;  2QHK A;  2Y8H A;  3OOV A;  4JGQ A;  4WZ5 C;  3NOP C;  2FFY A;  1ZG6 A;  5FQ9 A;  4MLL A;  2EXB A;  4UA6 A;  4II7 A;  3VP4 A;  3R7W A;  5AQB A;  1TVF A;  4B4Z A;  3IH9 A;  3EGX C;  3UPN A;  1K4F A;  5CTN A;  1W79 A;  1K54 A;  3N8S A;  4L9E A;  1KGF A;  3SS3 A;  4BD0 A;  4S2M A;  3MMH A;  2V8C A;  2A24 A;  3WS1 A;  3VP2 A;  4YNR A;  3FKV A;  2OAP 1;  4LV2 A;  3OLO A;  2L1M A;  2WAF A;  5A90 A;  2J9P A;  2X71 A;  4I38 A;  3S4X A;  3BJN A;  5M18 A;  2W3E A;  4WF0 A;  3SOI A;  3MFD A;  4OON A;  4MN5 A;  4ME4 A;  4HI4 A;  2W27 A;  4HP9 A;  4P87 A;  1OME A;  4KZ9 A;  1KOU A;  3HUO A;  1FCO A;  4GNU A;  4EEP A;  1MC0 A;  5KSH A;  5HWV A;  5F5Y A;  2Z2L B;  3MXR A;  1ERM A;  3C8C A;  5HD3 A;  3L7H A;  3D3O A;  4IHQ A;  2VK3 A;  4E3O A;  4HJ3 A;  1IYP A;  3G2Z A;  2I72 A;  3UDF A;  4DRT A;  2O99 A;  4S2O A;  1ACF A;  2B5R A;  3IWQ A;  4KZB A;  4S2J A;  4X53 A;  4MN7 A;  5FEF A;  1H8M A;  4N1X A;  2P9V B;  4E3K A;  1J9M A;  3O88 A;  4GB7 A;  1OTD A;  3QP4 A;  5FAT A;  3UNW A;  2PHY A;  4HH3 A;  4XUX A;  4ARZ B;  1HD8 A;  3HLB A;  1K55 A;  4LCM A;  4Y3I A;  3T50 A;  3WS5 A;  3MBZ A;  3LYX A;  1LSW A;  1GA9 A;  3IX3 A;  3VSK A;  3ZVT A;  2VZW A;  4R3J A;  1OTA A;  4KG5 A;  4WM9 A;  1K6R A;  3W2Z A;  1JWV A;  3W4O A;  3Q07 A;  4GD6 A;  4YIN A; 
#chains in the Genus database with same CATH homology
 1KVL A;  1L0F A;  3V50 A;  3DWK A;  1JTD A;  3OPL A;  3CJM A;  4E3N A;  1ES4 A;  2OV5 A;  5HAP A;  3FYZ A;  4LCL A;  5DTT A;  3HRE A;  5CGX A;  5GL9 A;  5HW3 A;  4OQG A;  4O7D A;  2ZQC A;  3IXG A;  3I7J A;  3CMZ A;  4XXR A;  3WRZ A;  1WYB A;  4B4X A;  4QU3 A;  1DY6 A;  4OKP A;  2WZX A;  4ZBE A;  4PMA A;  1H8Y A;  1FCN A;  3G4P A;  3N8R A;  3ZCZ A;  1K57 C;  4H8R A;  2X01 A;  1K4E A;  1IYQ A;  4QD4 A;  5EVI B;  3A3D A;  3V3R A;  3QNB A;  4KZA A;  4KG2 A;  4OP8 A;  1GA0 A;  5E2H A;  3BEC A;  4GDB A;  3HL9 A;  4JXW A;  2Y2J A;  5FQM A;  4ZJ2 A;  3M2J A;  4IVI A;  4KZ6 A;  4OOM A;  1FSY A;  2Y2M A;  5D3O A;  4E3L A;  4C3Q A;  4LV3 A;  5AQ9 A;  4RA7 A;  3UPP A;  2XR0 A;  5G18 A;  1FSW A;  2Y4A A;  2P9V A;  2Q9M A;  1NJ4 A;  1RGZ A;  1SDN A;  1HTZ A;  1I5Q A;  2HP6 A;  2HDQ A;  2EXA A;  3MZE A;  3NDE A;  4QHC A;  1IYS A;  5EVI C;  4ZTK A;  2PU2 A;  1FR1 A;  3NDG A;  3AGD A;  5FAP A;  4P85 A;  1NY0 A;  3AGF A;  5JYO A;  1XXM A;  3AGE A;  4FD8 A;  4N1H A;  4S2N A;  2XLN A;  2Y2L A;  3IXH A;  4KZ5 A;  4WZ5 A;  2EX9 A;  1ERQ A;  2X02 A;  1SHV A;  2IWD A;  1CEG A;  4EBN A;  1RGY A;  1M6K A;  2Y2Q A;  2DCF A;  5DVA A;  2ZM2 A;  5EOO A;  2HDS A;  2QPN A;  4ZDX A;  3G31 A;  1LHY A;  3WS4 A;  5TR7 A;  3GVB A;  3E2L A;  1KE0 A;  1LLB A;  4KZ3 A;  2Y2P A;  3A3E A;  1XGJ A;  3OCL A;  4QY5 A;  1K6S A;  2J9O A;  4UHU A;  1E25 A;  3VFF A;  5FAS A;  5M19 A;  2G2U A;  1XA1 A;  4JF5 A;  4DE1 A;  3O87 A;  3BM6 A;  3LY3 A;  4DE3 A;  2WUQ A;  2ZQA A;  5U47 A;  1G68 A;  4IBR A;  2Y2N A;  4XUZ A;  5CXW A;  4EV4 A;  5FI6 A;  4N9K A;  3VOY A;  5GLD A;  2V2F F;  1YMS A;  5FAQ A;  1PWC A;  4M3K A;  4LEN A;  2PU4 A;  2CC1 A;  1PYY A;  4GKU A;  4RX3 A;  3NIA A;  5E2F A;  4KG6 A;  3M6H A;  1PWD A;  4E6X A;  5HAI A;  3GSG A;  2Y91 A;  1N4O A;  3BFC A;  3MZD A;  5EUA A;  2VGK A;  3UDX A;  2Y55 A;  5EVI A;  3WS2 A;  5EPH A;  3IF6 B;  4JXG A;  2C5W B;  4Y0U A;  2IWC A;  4E3I A;  1O07 A;  3LO7 A;  4DDS A;  4Y7P A;  3IXD A;  1EI5 A;  2EX6 A;  2WYX A;  1Q2Q A;  2ZQ8 A;  1I2S A;  5CHU A;  4RX2 A;  3WRT A;  3G32 A;  3HLF A;  1ZKJ A;  4WMC D;  2RCX A;  2WKE A;  1BTL A;  1YLW A;  4R4S A;  2XFS A;  3PBR A;  2J8Y A;  2DRW A;  5HAR A;  4B88 A;  1NXY A;  3LEZ A;  3Q7V B;  4WEJ A;  3SH7 A;  1ERO A;  2G2W A;  3IF6 C;  1Y54 A;  3UE0 A;  1Z6F A;  4CPK A;  5HX9 A;  1ESU A;  1MY8 A;  5KSC A;  1BUL A;  4N9L A;  4X55 A;  4BEN A;  2JC7 A;  3ZG8 B;  4BJP A;  1H8Z A;  1K56 A;  3HLG A;  1K54 C;  3FZC A;  5HFO A;  3C4O A;  1BSG A;  3LCE A;  1L0E A;  3A3F A;  4IBX A;  1KE3 A;  2XD5 A;  1W8Y A;  1YLP A;  1ZG4 A;  1FOF A;  1VM1 A;  2ZJ9 A;  5IHV A;  1BLP A;  4MNR A;  1MWT A;  5DF7 A;  5FSR A;  5JYP A;  4R1G A;  2XFT A;  2ZQ9 A;  5GHZ A;  3ZG0 A;  5I94 A;  1PI5 A;  4C6Y A;  3IHB A;  1MWR A;  5FA7 A;  3ZG5 A;  3EQV A;  4EBL A;  1QMF A;  3O3V A;  4JLF A;  5CED A;  3IQA A;  4RVA A;  5DF8 A;  5F82 A;  1FR6 A;  4OQI A;  1E3U A;  3W4Q A;  3Q1F A;  1CEF A;  4OQ0 A;  2OSU A;  3PBS A;  3QNC A;  4PM6 A;  3V3S A;  4K0W A;  4NET A;  1PW8 A;  5EEC A;  1ES5 A;  2C6W B;  5DTK A;  2ZQ7 A;  4WZ4 A;  3Q7Z A;  1SCW A;  3W8K A;  1RP5 A;  3BLS A;  1U60 A;  5A92 A;  4EUZ A;  3UPO A;  1KGE A;  4HES A;  2XK1 A;  3G30 A;  2WGV A;  3SS5 A;  3C5A A;  5GHX A;  3IWO A;  5KMW A;  1JTG A;  1JWP A;  3PBT A;  3S1Y A;  1NZU A;  3BLM A;  1PIO A;  4KQO A;  5E43 A;  5F1G A;  3UE1 A;  3OPR A;  3PBQ A;  5FI7 A;  2WGI A;  2EFX A;  5A93 A;  3C7V A;  4DE2 A;  2ZMA A;  2H5S A;  3IF6 A;  3SH8 A;  4KEN B;  1XGI A;  5FQJ A;  4DXB A;  5FAO A;  2WAD A;  2QMI A;  4JXV A;  3ZDJ A;  4WYY A;  5CHJ A;  4BQM A;  1TDG A;  4UA9 A;  4K91 A;  3N4I A;  1O7E A;  4GN2 A;  5L2F A;  2XF3 A;  2E8I A;  2H0T A;  3IHA A;  2Y2I A;  3HBR A;  4IED A;  3SH9 A;  3W4P A;  3ZFZ A;  3GMW A;  1IYO A;  2ZM8 A;  2ZM0 A;  3A3I A;  3IXB A;  4KQQ A;  3ZVW A;  4ZJ3 A;  2ZQD A;  4FH2 A;  4KQR A;  3ZNT A;  1DJC A;  5M1A A;  5KZH A;  3FV7 A;  2XGN A;  4R3B A;  1MWS A;  4X56 A;  3LY4 A;  4U0T A;  4WEL A;  1MBL A;  3PAE A;  3V5M A;  1K57 A;  3EQU A;  3DTM A;  2XEP A;  1PZO A;  5CRF A;  2ZC5 B;  3P09 A;  3ITA A;  5AQ7 A;  4C75 A;  4OVD A;  4KZ7 A;  4OOY A;  1PI4 A;  4FH4 A;  2WKH A;  1BZA A;  3BEB A;  2A49 A;  1LI0 A;  3GR2 A;  3IT9 A;  4DDY A;  1GCE A;  4OPR A;  3TOI A;  3M6B A;  2WKI A;  4GD8 A;  1IEM A;  4HBU A;  5CHM A;  1ESI A;  2A3U A;  3RXW A;  1NYY A;  1TEM A;  5FQI A;  1KGG A;  5TFQ A;  3OZH A;  3HVF A;  4ZJ1 A;  5F1F A;  4JF4 A;  1IKG A;  2XQZ A;  4GDN A;  3HLE A;  1C3B A;  3C7U A;  3JYI A;  4DE0 A;  3NBL A;  4EWF A;  5GHY A;  3UN7 A;  3HLC A;  1K38 A;  2Y2H A;  5FQQ A;  1WYC A;  3M2K A;  1L0G A;  1KDW A;  1LI9 A;  3UDI A;  3ZGA B;  4KZ4 A;  2ZC4 B;  2JE5 A;  3NCK A;  1BT5 A;  1AXB A;  2J7V A;  2HDR A;  1K25 A;  4R0Q A;  3QHY A;  3IF5 A;  4S2K A;  1PZP A;  3S22 A;  1DJB A;  2ZLY A;  1LL9 A;  3BRM A;  3NC8 A;  3IWI A;  4OOL A;  5EOE A;  2XDM A;  2V20 A;  1PW1 A;  5CTM A;  4RYE A;  3OPP A;  1ONG A;  4JPM A;  1FCM A;  1ONH A;  5A91 A;  3SS4 A;  1SDE A;  3VSL A;  4DF6 A;  1HZO A;  2HPB A;  4OLD A;  1YLZ A;  1MPL A;  1S0W A;  4WBG A;  3ZG9 B;  3MKF A;  3MXS A;  4OPZ A;  3N6I A;  4GOG A;  1NYM A;  4FSF A;  5E2E A;  5EE8 A;  3NY4 A;  5GLC A;  3BFD A;  3PBO A;  1TDL A;  1IKI A;  3C4P A;  3NI9 A;  3VMA A;  4OP5 A;  5FDH A;  1G6A A;  2UWX A;  4WEK A;  1XP4 A;  4HBT A;  1YM1 A;  3A3J A;  3CG5 A;  3Q81 A;  4LV0 A;  4OQH A;  3PBN A;  4N92 A;  1H5X A;  2P74 A;  3RJU A;  1M40 A;  1NZO A;  5FQK A;  1YLY A;  1KE4 A;  4JBF A;  1ES2 A;  4QB8 A;  3G35 A;  3ZHH A;  3CZD A;  3ZG7 B;  1IEL A;  3MZF A;  3PTE A;  1W5D A;  4DXC A;  4OPY A;  5EVI D;  3GTC A;  2WGW B;  5CGW A;  4A5R A;  4Y0T A;  4EQI A;  1BLC A;  2PBY A;  1VQQ A;  4LV1 A;  4S2N C;  1BUE A;  3VP0 A;  4WZ5 C;  1XA7 A;  4DKI A;  5HL1 A;  1DJA A;  4OPQ A;  3VP1 A;  5E2G A;  4E6W A;  1GHI A;  1ZG6 A;  2FFY A;  1GHP A;  5FQ9 A;  4MLL A;  1ES3 A;  3UY6 A;  2EXB A;  4MBH A;  1N9B A;  4UA6 A;  3FWL A;  4U0X A;  1ZC2 A;  1RCJ A;  4P6B A;  3VP4 A;  3DW0 A;  5TGF A;  2VGJ A;  2WAE A;  4ID4 A;  1KVM A;  3MKE A;  4S2P A;  2IWB A;  3UO9 A;  5AQB A;  1TVF A;  2QZ6 A;  1HVB A;  4B4Z A;  4Q8I A;  5J8X A;  3IH9 A;  2JCH A;  1L2S A;  2Y59 A;  3UPN A;  1K4F A;  5CEC A;  5CTN A;  1K56 D;  1W7F A;  1W79 A;  1MXO A;  1K54 A;  3N8S A;  1KGF A;  3SS3 A;  4BD0 A;  3GRJ A;  4S2M A;  2Z2M B;  3HLD A;  5DF9 A;  3WS1 A;  3VP2 A;  4X68 A;  3RXX A;  3ZNY A;  3GV9 A;  2WZZ A;  3E2K A;  4CJN A;  3Q7V A;  3DWZ A;  2V1Z A;  1BLH A;  1EWZ A;  3FKV A;  4S2I A;  1FQG A;  4JXS A;  1XPB A;  4LV2 A;  2JBF A;  2OLV A;  3OC2 A;  5AQA A;  2WAF A;  4BD1 A;  5A90 A;  1NRF A;  2J9P A;  1ALQ A;  1LL5 A;  2X71 A;  3S4X A;  1E3U D;  5M18 A;  3SOI A;  3MFD A;  4OON A;  3N7W A;  5GLB A;  1MKI A;  3HUN A;  2GDN A;  2ZD8 A;  4P87 A;  1SKF A;  1OME A;  3ISG A;  4FCF A;  4PM7 A;  2HDU A;  3HUM A;  4KZ9 A;  4PM8 A;  5GLA A;  2BG1 A;  3HUO A;  1FCO A;  4WMC A;  4PPR A;  4GNU A;  2WK0 A;  4X6T A;  2Y2K A;  3BFF A;  1YLJ A;  2FFF B;  4UA7 A;  4JF6 A;  5KSH A;  2H10 A;  3N8L A;  1K55 C;  5FI2 A;  3D4F A;  3PAG A;  2R9X A;  2WGW A;  2Z2L B;  1YT4 A;  1L0D A;  3MXR A;  1ERM A;  1QME A;  3HLW A;  3TSG A;  3FKW A;  3WWX A;  2HP5 A;  4E3O A;  3O86 A;  3OPH A;  3V39 A;  4P0M A;  1YQS A;  4Z9Q A;  5EVL A;  1MWU A;  2ZC7 A;  3ITB A;  4MEZ A;  4QY6 A;  4PM5 A;  1PWG A;  4OH0 A;  1BLS A;  4EBP A;  3IH8 A;  1IYP A;  2XD1 A;  3G2Z A;  2XH9 A;  2I72 A;  4D2O A;  3UDF A;  1CK3 A;  2ZC6 B;  4X69 A;  3TG9 A;  4DRT A;  4S2O A;  1I2W A;  4L0L A;  5DTS A;  2ZC3 B;  3VFH A;  1YLT A;  1CI9 A;  5CER A;  4F94 A;  1XKZ A;  1E4D A;  2B5R A;  1CI8 A;  3Q82 A;  3IWQ A;  4KZB A;  4S2L A;  5CGS A;  4S2J A;  1JWZ A;  4X53 A;  4R23 A;  4N1X A;  2H0Y A;  2P9V B;  3B3X A;  5HAQ A;  1WE4 A;  5CEB A;  3VOZ A;  4KZ8 A;  4E3K A;  4BL2 A;  1J9M A;  3O88 A;  3P98 A;  4BL3 A;  3OCN A;  2RL3 A;  2Y2O A;  4GB7 A;  1S6R A;  2EX2 A;  4YFM A;  4JKT A;  5FAT A;  5BOH A;  2DNS A;  3UNW A;  1XX2 A;  1Q2P A;  1YMX A;  4Y0O A;  4MBK A;  4XUX A;  1HD8 A;  3HLB A;  2R9W A;  1K55 A;  4ZAM A;  1KDS A;  1W8Q A;  2OLU A;  3G34 A;  4LCM A;  4BLM A;  4E3J A;  4QJG A;  4MBF A;  3WS5 A;  2EX8 A;  3UE3 A;  3MBZ A;  3WS0 A;  1JVJ A;  4GZB A;  4K0X A;  4OLG A;  4UAA A;  1GA9 A;  2BLS A;  3VSK A;  2EFU A;  2HP9 A;  3ZVT A;  5F83 A;  4R3J A;  4U3T A;  3BFE A;  2Q9N A;  4KG5 A;  3GQZ A;  4WM9 A;  3BFG A;  3G2Y A;  4IVK A;  3VP3 A;  4E3M A;  1K6R A;  4R4R A;  3BYD A;  3W4O A;  1JWV A;  4HEF A;  1GHM A;  3Q07 A;  4GD6 A;  4NK3 A;  2Y2G A;  4YIN A;  4PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...