4MEZA

Crystal structure of m68l/m69t double mutant tem-1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPLTSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
publication title Structure/Function correlation of TEM-1/PSE-4 beta-lactamase chimeras and their deconvoluted mutant
rcsb
source organism Escherichia coli
total genus 92
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4mezA00
5JYPA 4KG6A 4KZ3A 3VP4A 2Y2PA 1CK3A 4KG2A 3VOYA 4GDNA 2QPNA 3HUOA 4K91A 1PI4A 4OQ0A 4UA6A 3WS0A 3V3SA 4DE2A 3E2LA 3QHYA 3VSKA 1E3UD 5A90A 3P09A 2X02A 3UDFA 3UPPA 2JBFA 4IVKA 3UNWA 3MZDA 1ERQA 1FR1A 3GQZA 3IXGA 3FWLA 2EXAA 3CZDA 4Y0OA 1YLPA 2EXBA 4XUXA 5CHJA 2Z2MB 4IBXA 1JVJA 3OZHA 2EFXA 2ZM2A 3MKFA 5FQJA 3WS2A 1PIOA 3VFHA 4QY6A 2Y55A 5FATA 1SHVA 3ISGA 1IYOA 1OMEA 1K54C 5KSCA 1K4FA 1I2SA 3N6IA 4GD6A 4WEKA 1WYCA 4NETA 3W4QA 1MKIA 4BL3A 1NXYA 1RGYA 2CC1A 1E25A 3C4OA 5GHYA 3PBRA 3BEBA 1YLZA 4S2NC 4KZ6A 1MWUA 1Y54A 5CHMA 3WS1A 4JXVA 4GDBA 4GKUA 4GB7A 3A3IA 3HBRA 3G31A 5HARA 5FI6A 2WAEA 5CTNA 3VMAA 1TDLA 1NZOA 5EUAA 1ERMA 2HP6A 2RCXA 4KG5A 3MBZA 5GLCA 4MBKA 2ZC3B 4PMAA 3C4PA 4EBLA 3A3FA 4MEZA 4C6YA 1FSYA 1NYMA 4JF4A 4E3JA 4B4ZA 5CRFA 3NIAA 4BD1A 3OPLA 2JC7A 4OOYA 2OV5A 4OP8A 2R9WA 3N7WA 4BENA 3M6BA 1EROA 4OPYA 2J7VA 4OH0A 3Q07A 4OKPA 3EQUA 4RX3A 5FASA 3SS4A 1FQGA 2P9VB 1K6SA 3WRTA 4EV4A 2WGWA 1U60A 3W4PA 3WWXA 1NY0A 2FFYA 2Q9MA 1JWZA 4LV1A 4OQIA 4WZ5C 5GLAA 3Q81A 3D4FA 1YQSA 4JLFA 3DW0A 4PM6A 3C5AA 3NDEA 3WS4A 3G32A 5GHZA 5F1GA 5HX9A 2Y2OA 4KZ7A 4X6TA 1K38A 3Q7VB 3M2KA 3V5MA 4GN2A 2EX6A 4S2KA 3M2JA 5D3OA 2WGIA 1E3UA 4KENB 3W4OA 5JYOA 3MZFA 4KZAA 3IF6C 1TVFA 1WYBA 4LV2A 2XDMA 4DDSA 2H10A 3O88A 4N1HA 4S2JA 1Z6FA 2Y2MA 5EE8A 4Y0UA 4DE3A 3QNCA 4MLLA 3LY4A 3O3VA 3VSLA 4P6BA 1PW8A 4QB8A 5FAQA 2XK1A 1Q2PA 4DXBA 4WM9A 1BUEA 5F82A 3ITBA 1KDWA 3N4IA 2ZLYA 4GD8A 4BL2A 4WBGA 2ZM8A 1HTZA 3B3XA 3OPPA 1TEMA 1K4EA 2IWBA 2J9PA 3OC2A 3PBSA 4OOLA 1L0EA 4B4XA 3UDIA 4RA7A 5DTKA 4KZ4A 5KMWA 3NY4A 2WGVA 2Y2KA 1XX2A 4QHCA 1K54A 3SH8A 4LV0A 4NK3A 5EPHA 1MWTA 2ZQAA 5U47A 5FQIA 3G34A 2WAFA 3Q82A 4S2LA 3S4XA 1PWCA 5FQKA 1LL9A 4S2NA 1SCWA 4XUZA 5L2FA 3S22A 4ZDXA 4PM9A 3W8KA 3UPOA 1FSWA 4ZJ1A 5I94A 3LY3A 4R3JA 4E6WA 4OQHA 1CEGA 3CJMA 4WZ4A 1GA0A 1K57C 1YLYA 1TDGA 2A3UA 3DWZA 1Q2QA 5A93A 4DE1A 2Y2QA 2FFFB 3HLBA 1FCNA 2ZQDA 4R4SA 4R4RA 5CEDA 2V1ZA 3HLDA 1GHIA 2QMIA 2XF3A 3ZGAB 2Q9NA 4H8RA 2Y2GA 4LV3A 3ZNYA 3S1YA 2WK0A 1L0FA 4GNUA 4BLMA 4QU3A 3HUNA 3IF6B 1W7FA 4X69A 5CERA 4JKTA 1W79A 2HDSA 3VP2A 3NBLA 2Y91A 4FSFA 2Y2JA 1K6RA 4M3KA 3G35A 5EOEA 4IEDA 4WZ5A 1MBLA 4S2OA 3LO7A 1J9MA 3HUMA 1LI0A 4GZBA 4JXSA 3UO9A 3ZG7B 3DWKA 3UN7A 5E2HA 1PW1A 4X55A 4C75A 4BJPA 3PBOA 4E6XA 2BLSA 2XH9A 4N9LA 1GHPA 4OPQA 3UPNA 4PM8A 4A5RA 1ESIA 2WGWB 4KQQA 1ES4A 1XGJA 3ZVTA 4N9KA 3UY6A 5CXWA 3TOIA 4R1GA 5HL1A 3HLCA 3IF6A 3V39A 5FSRA 4S2PA 2EX9A 3BFDA 4ID4A 1L2SA 5DVAA 3MXRA 4RVAA 3Q1FA 3PAGA 1VM1A 5DF8A 4K0WA 2PBYA 4U0XA 3UE3A 4B88A 2WZZA 4QJGA 1BZAA 1MWRA 1GHMA 5HAQA 4U0TA 4EBPA 5FQMA 4MNRA 4WEJA 1BLPA 1K56D 3BECA 2XFTA 3VP0A 3UE0A 3UE1A 5CTMA 1LL5A 2BG1A 4ZAMA 4YFMA 4R23A 3ZDJA 4OPZA 1E4DA 5IHVA 4WYYA 3SOIA 1MXOA 3N8LA 3RJUA 5FA7A 3G4PA 2XD5A 1N4OA 3PBQA 1LHYA 1YMSA 1W8QA 1ZG4A 4JPMA 4OPRA 3PTEA 4P85A 4S2MA 5EVIC 3ZVWA 3P98A 4E3MA 1DY6A 4EBNA 1XXMA 2ZQ9A 1ALQA 4WMCD 3GRJA 4KZBA 5A91A 3BFEA 3BFCA 3HLGA 1NZUA 3BYDA 1SKFA 1H8ZA 5EECA 5M19A 3MXSA 4FD8A 2WADA 1ZKJA 1ESUA 4K0XA 2XQZA 3GMWA 3G2YA 5FAOA 5EVID 3NC8A 4HESA 2XFSA 5KZHA 3NI9A 2QZ6A 3TG9A 3JYIA 4L0LA 1BULA 1MWSA 3WS5A 2ZQ8A 4IVIA 5AQ7A 5G18A 1K57A 4R0QA 5HAPA 2XLNA 2XR0A 2DRWA 3ZG5A 3ZG8B 1HD8A 2UWXA 3IQAA 5DTTA 1DJAA 1EWZA 2HDUA 1JWVA 2V20A 3IXHA 3IWQA 2OSUA 2Y2HA 3GR2A 4LCLA 1KGEA 2PU4A 4ZJ2A 3FZCA 3IH8A 2WUQA 1VQQA 1FOFA 3FKWA 5EOOA 1W8YA 5TR7A 1O7EA 3GV9A 5F1FA 1S0WA 2ZMAA 5CEBA 4CPKA 5BOHA 2Y2NA 5E43A 1ES3A 1O07A 3HVFA 1YM1A 1KE3A 3WRZA 1G68A 1JTDA 1YT4A 3ZG0A 1K25A 3FV7A 5CHUA 4OOMA 3N8SA 3SH9A 1PWGA 3HLWA 3ZFZA 4Y7PA 5M1AA 4Z9QA 3G2ZA 4EWFA 4P0MA 3VOZA 3BFFA 4E3IA 3SS5A 5HFOA 5E2GA 2WKEA 1IELA 4CJNA 1K56A 1KVMA 3A3EA 4EQIA 4UAAA 4E3NA 4FH4A 4ZJ3A 4KZ9A 3VP1A 1BSGA 5A92A 1RP5A 4FH2A 2PU2A 3ZNTA 1YMXA 3AGDA 2Y2LA 1PWDA 2VGKA 5GLDA 4OLGA 5TFQA 4OQGA 1XA7A 3FYZA 3SS3A 2EX2A 5E2EA 3SH7A 5CGXA 1QMFA 1XGIA 4WMCA 4E3KA 4Q8IA 1KGGA 1NYYA 3NCKA 1M6KA 5GLBA 4X68A 2WKIA 3LCEA 4MBHA 5FI7A 4KZ5A 1IYPA 1IKGA 4MBFA 3V50A 3BM6A 2ZC6B 1DJCA 1FCOA 5EVIA 5EVLA 3VFFA 2JCHA 2G2WA 3C7UA 3ITAA 2XEPA 4DDYA 4KZ8A 3CMZA 1XKZA 2ZM0A 3I7JA 1YLTA 2WKHA 3HLFA 4OVDA 5FAPA 3TSGA 2HDRA 2C5WB 2ZC4B 1K55C 2DCFA 1XPBA 1IKIA 2P74A 3IHBA 3PBTA 4DXCA 1MY8A 2Z2LB 1XA1A 4DRTA 2ZQ7A 3M6HA 4KQRA 1PI5A 1KE0A 3OPHA 4DF6A 2C6WB 4YINA 1ZC2A 2H0TA 1NJ4A 3G30A 5M18A 2A49A 4ZBEA 4X53A 3IT9A 4FCFA 1IYSA 1NRFA 4PM5A 4F94A 1M40A 5AQBA 4X56A 2ZC5B 1S6RA 1C3BA 1IYQA 3IHAA 4JF6A 3MZEA 1KE4A 2WYXA 1JWPA 1SDEA 3CG5A 3DTMA 2XGNA 3BLSA 3IXBA 3QNBA 5GHXA 4BQMA 4E3OA 3E2KA 1LI9A 1H5XA 3MFDA 5HAIA 1ES2A 1AXBA 3BRMA 2E8IA 1QMEA 4N92A 4E3LA 4JF5A 4QD4A 1EI5A 3NDGA 3A3DA 2J8YA 3PBNA 2HDQA 1BLSA 2ZD8A 3ZG9B 1L0GA 1KDSA 4GOGA 5FQQA 2X71A 1GCEA 3EQVA 4JXWA 5AQ9A 1WE4A 4HBUA 1H8YA 2B5RA 3GTCA 1HVBA 2HPBA 3O87A 5E2FA 1PZOA 4OLDA 4DKIA 5AQAA 3N8RA 3OPRA 4C3QA 3UDXA 1XP4A 1JTGA 2GDNA 3MKEA 4N1XA 3HLEA 1CEFA 2RL3A 2H0YA 4IBRA 1IEMA 2EFUA 4QY5A 2ZC7A 1SDNA 3LEZA 4DE0A 4O7DA 2DNSA 2OLUA 4S2IA 3ZCZA 1PYYA 4D2OA 3BLMA 5GL9A 4P87A 3ZHHA 2IWDA 5TGFA 1W5DA 4UHUA 4LENA 3IH9A 4EUZA 3Q7ZA 3BFGA 4R3BA 4KQOA 1G6AA 2R9XA 2Y59A 1FCMA 4OONA 2ZQCA 1I5QA 4RYEA 4RX2A 3IXDA 1ZG6A 2X01A 4Y0TA 1BTLA 2J9OA 4JBFA 4XXRA 2P9VA 2JE5A 3HL9A 1CI8A 1L0DA 4JXGA 4PM7A 3HREA 4ZTKA 5FQ9A 1LLBA 1I2WA 1GA9A 3RXXA 3RXWA 4BD0A 2Y2IA 1BLCA 2G2UA 4HEFA 1YLJA 3IF5A 1PZPA 3OCLA 2WZXA 5FDHA 1ES5A 1CI9A 5J8XA 1ONGA 1RGZA 4PPRA 2HP5A 2OLVA 1MPLA 1FR6A 5CGWA 1N9BA 2EX8A 3A3JA 1YLWA 3Q7VA 4HBTA 4LCMA 5HW3A 1K55A 5KSHA 4OP5A 5FI2A 3VP3A 2I72A 2IWCA 3PAEA 3O86A 3OCNA 4UA7A 4U3TA 5EVIB 3GVBA 5DF7A 3GSGA 2V2FF 3AGFA 3FKVA 5DF9A 3AGEA 1HZOA 1KVLA 4WELA 1ONHA 2Y4AA 2ZJ9A 5F83A 1BLHA 1RCJA 5CGSA 5DTSA 2XD1A 3V3RA 2HP9A 1KGFA 1DJBA 2H5SA 4UA9A 1BT5A 5CECA 2VGJA 3IWIA 3IWOA 3C7VA
chains in the Genus database with same CATH superfamily
2L1MA 3T4JA 4KG2A 3VOYA 3HUOA 4JGQA 4UA6A 3V3SA 1E3UD 5A90A 3P09A 3UDFA 2JBFA 3UNWA 3FWLA 2EXBA 5CHJA 2J3TD 3MKFA 2Y55A 5HDCA 1OMEA 1FIKA 1MKIA 1NXYA 2CC1A 1E25A 3C4OA 4EUVA 1Y54A 2XA7M 4EERA 4GDBA 3HBRA 5HARA 2WAEA 5CTNA 4KG5A 5GLCA 4PMAA 3A3FA 5CRFA 4IUKA 2JC7A 4HP9A 3Q07A 4RX3A 5FASA 2P9VB 2PHYA 1NY0A 3QP5A 2Q9MA 4I5SA 1JWZA 1VHMA 4LV1A 4WZ5C 4YNRA 3Q81A 3EEHA 4JLFA 3DW0A 3T1QB 3C5AA 3LYXA 3RH8B 5F1GA 4KZ7A 2V0WA 3KSHA 2HZ5A 2EX6A 4PHTA 2WGIA 4KENB 5JYOA 1WYBA 4NEED 4N1HA 4S2JA 1T19A 5EE8A 3QNCA 2Z6DA 5HD5A 3O3VA 4QB8A 3MS6A 4X1MA 5FAQA 2XK1A 2QJ7A 3ITBA 4EEPA 1XJ3A 1HTZA 2KOIA 4HJ3A 2VV6A 2J80A 3TW8A 1K4EA 3UB7A 1L0EA 5DTKA 4KZ4A 5KMWA 3NY4A 1F5MA 3KX0X 5FQIA 2O9AA 4KQDA 1LL9A 3IX8A 3W8KA 3NECA 1FSWA 5I94A 4OQHA 1CEGA 1GSWA 4R4SA 1DP6A 1TS6A 2V1ZA 3HLDA 2XF3A 3ZGAB 2Q9NA 4H8RA 4LV3A 2W3DA 2HV1A 1ZTUA 1VETB 3IF6B 4X69A 2Q0OA 3FG8A 4JKTA 5C5KA 5L07A 3S7OA 3VP2A 2Y91A 1SZVA 4XT2B 5EOEA 4DJ2A 2I9VA 1LI0A 3UO9A 3DWKA 5E2HA 4C75A 4E6XA 4N9LA 1GHPA 1J3WA 2WGWB 4KQQA 2P08A 4N9KA 4ARZB 4CLCE 1VETA 4GCZA 3IF6A 4HOIA 3SZTA 4R3AA 2FH5A 5DVAA 1MWRA 4U0TA 2AVXA 1TS7A 1BLPA 4WEJA 3D9YA 1K56D 3UE0A 3UE1A 2M7VA 2GX5A 4ZAMA 3FPVA 1NLZA 1E4DA 4WYYA 3PR6A 1MXOA 3N8LA 3V67A 1P0ZA 3PTEA 3FPWA 4EBNA 5K5BA 3C2WA 5FEFA 1ACFA 4MDZA 5A91A 5M19A 3MXSA 4FD8A 2WADA 2XQZA 1UGUA 5EVID 3NC8A 2XFSA 4IVIA 1K57A 3ZG8B 1LL8A 2UWXA 4HY8A 3IXHA 5DFXA 2QHKA 3FKWA 5EOOA 2ZOHA 2ZMAA 4CPKA 4WL9A 1YM1A 2QJ5A 3ZG0A 3FV7A 2NUPC 3N8SA 3SH9A 2ZMFA 3JVVA 4Z9QA 3G2ZA 4P0MA 3BFFA 2KX6A 5HFOA 5J7EA 2WKEA 2JKTM 1IELA 3S7PA 5MC7A 5DKKA 4E3NA 1D06A 4CLCD 3GDIA 2PU2A 5EM1A 3E98A 3LIFA 1PWDA 5F5YA 4GLQA 3SS3A 3QP1A 2EX2A 4WMCA 4Q8IA 3BY8A 1NYYA 3NCKA 1M6KA 5GLBA 4X68A 4KZ5A 1IKGA 4R70A 3VFFA 2G2WA 3ITAA 3CMZA 1XKZA 2ZM0A 3I7JA 3HLFA 3A0RA 3T50A 2HDRA 3IHBA 4DXCA 2Z2LB 1XA1A 1KE0A 3OPHA 4YINA 1ZC2A 3MR0A 1IYSA 1IOUA 3NJAA 2W1TB 2ZC5B 1S6RA 1C3BA 3MZEA 4NXEA 1KE4A 2WYXA 3CG5A 2CMNA 3DTMA 2OWHA 3C30A 3MFDA 2VZWA 1AXBA 3BRMA 2E8IA 1QMEA 4E3LA 2W3FA 3A3DA 2J8YA 2GJ3A 1TF1A 1WE4A 3BWLA 1H8YA 3GTCA 1TS0A 3MF0A 5HPIA 3NHQA 2ZL1B 3MKEA 1OPXA 1CEFA 3HLEA 2H0YA 4S2IA 1PYYA 2IWDA 5TGFA 1W5DA 4FOFA 2D02A 4R3BA 4KQOA 2R9XA 1I5QA 3IXDA 2XSSA 2ZL1A 4Y5FA 2X01A 1LSWA 3HL9A 1CI8A 3NOUC 1LLBA 1I2WA 1DRMA 1GA9A 4IHQA 3IF5A 1PZPA 1CI9A 4P6ZS 1ONGA 1RGZA 1F98A 2HP5A 4BWIA 1FR6A 4LCMA 4EESA 1K55A 5KSHA 4OP5A 3L9KA 3IS2B 5FDSA 5EVIB 5DF7A 4DMZA 3AGFA 3FKVA 1YAXA 1HZOA 1KVLA 5EVEA 1ONHA 2Y4AA 2ZJ9A 3QP6A 3V3RA 2HP9A 1KGFA 2H5SA 5CECA 1BT5A 4G3WA 2VGJA 5JYPA 3VP4A 5HWVA 4R38A 3A0VA 2QPNA 4II7A 1PI4A 3WS0A 3P01A 4DE2A 3VSKA 3MZDA 1ERQA 3IXGA 4NXGA 3JVUA 2Z2MB 3LR0A 3PXPA 4IBXA 1Z09A 1JVJA 5FQJA 3VFHA 1K54C 1NLYA 1WA9A 5KSCA 4PAUA 2ACGA 5HD3A 1RGYA 3BEBA 1YLZA 4KZ6A 5CHMA 3WS1A 3U4LP 4JXVA 4GKUA 5TBMA 2HGVA 3VMAA 1TDLA 1A0KA 1LSXA 5EUAA 2HP6A 5HSQA 3QP4A 4LGWA 4E3JA 3NIAA 1ZHHB 2OV5A 3M6BA 4OPYA 2J7VA 3PHYA 3EQUA 3SS4A 5DJUA 1U60A 4I3JA 5CX7A 4OQIA 4FTXA 3D4FA 4X1LA 1DP9A 2OAP1 1K38A 3Q7VB 5D3OA 3W4OA 4KZAA 4MN5A 1TVFA 3K3DA 2XDMA 3O88A 2VGLM 3CITA 2VLGA 4MLLA 3VSLA 4P6BA 1CQAA 3DTEA 4KUOA 1Q2PA 1G5UA 3T1XA 1KOUA 2OOLA 3OPPA 2IWBA 2J9PA 4B4XA 4RA7A 1XX2A 4QHCA 5EPHA 2ZQAA 1OTIA 2WAFA 3Q82A 4S2LA 1S4SA 4S2NA 4XUZA 2PYRA 4ZDXA 3T4LA 4R3JA 4WZ4A 1GA0A 1TDGA 5A93A 2V0UA 2Y2QA 2FFFB 3B47A 3HLBA 3UB5P 2QMIA 5FL3A 3ZNYA 5DJTA 3S1YA 1L0FA 3DTKA 4QU3A 4YOFA 3L7HA 2VV7A 1T1AA 2QKPA 4ZRRA 1G6OA 4IEDA 5HL6A 3T4OA 3OOVA 4S2OA 1J9MA 3MXQA 4JGPA 3UN7A 5DKLA 1PW1A 4BJPA 3PBOA 1ESIA 4LFUA 3ZVTA 5CXWA 3TOIA 4M4XA 3LI9A 1Y28A 1YSQA 4EXOA 3BFDA 4ID4A 1L2SA 3Q1FA 5DF8A 3LI8A 4K0WA 4U0XA 3UE3A 2WZZA 3CI6A 5CTMA 4GJ4A 3ZDJA 4OPZA 3KSFA 5IHVA 1G28A 3DAVA 3G4PA 3MMHA 1YMSA 1W8QA 4OPRA 4P85A 3ZVWA 5EVIC 4E3MA 5HZHA 4JGOA 1DY6A 2B18A 3A0SA 4BBTA 4WMCD 3GRJA 3BFCA 3HJIA 5EECA 3DTIA 4K0XA 3GMWA 3G2YA 4I39A 4NXFA 5KZHA 1N9OA 2QZ6A 3TG9A 5AQ7A 4Q0IA 2XR0A 3ZG5A 2BTFP 3IQAA 3UMDA 2V20A 3RFBA 2Y2HA 4LCLA 1KGEA 4ZJ2A 3ULFA 3FZCA 3IH8A 1W8YA 5TR7A 2M7UA 1O7EA 1S0WA 5CEBA 1K0KA 5E43A 1KE3A 3IBRA 1G68A 1JTDA 1YT4A 1K25A 4OOMA 1PWGA 3HLWA 4CLCC 4NKPA 3BJNA 5G4ZA 5E2GA 4Y3IA 4NXBA 5A92A 4LRYC 2FZ0A 1XJ2A 1YMXA 3AGDA 4HI4A 2B95A 5GLDA 1NRJA 1XA7A 3SH7A 5CGXA 1XGIA 3R7WA 2WKIA 3LCEA 4MBFA 3BM6A 1DJCA 2JKRI 2JCHA 3C7UA 2XEPA 4DDYA 1YLTA 4Y2FA 2W3GA 1PFLA 1UWNX 3TSGA 1D7EA 2ZC4B 2K7SA 1IKIA 1HLUP 3LGOA 3QP8A 4DF6A 2H0TA 5J3WA 3G30A 1Y4OA 5M18A 4X53A 2R78A 1NRFA 4F94A 1M40A 4DJ3A 1XJ4A 1IYQA 4JF6A 1SDEA 2G7UA 2XGNA 5GHXA 1LI9A 3EGXC 4N92A 3G6OA 1BLSA 3ZG9B 1KDSA 1T1BA 5FQQA 3EQVA 5HWWA 5L8MA 1X0OA 4OLDA 5AQAA 3VOLA 3D3OA 3OPRA 3BW6A 1XP4A 5LBRA 4QY5A 1SDNA 3B42A 3U2AA 3BLMA 2L0WA 5GL9A 4O01A 3ZHHA 2VK3A 4UHUA 3IH9A 3MQOA 3Q7ZA 4JGRA 2WKPA 2Y59A 1FCMA 1VB6A 4OONA 1OTAA 4Y0TA 1BTLA 4XXRA 4JXGA 4PKYA 4PM7A 3LR3A 4ZTKA 1BLCA 1W63M 3OCLA 3TE8A 3NOPC 3ZYTA 3MFXA 2EX8A 2O9CA 3PAEA 3O86A 2V2FF 2VJWA 5DF9A 4WELA 3CUEA 4UQIS 5CGSA 2JKGA 2Y8HA 5F69A 3C7VA 4KG6A 4KZ3A 4LRZE 1CK3A 3CWFA 1T18A 3BQAA 4K91A 2EWWA 4DN0A 1PNEA 3E2LA 1OTDA 2JKFA 4IVKA 3UMEA 3CZDA 4Y0OA 4XUXA 4EW7A 2EFXA 2ZM2A 3WS2A 4HHDA 2INWA 4QY6A 4HP4A 1IYOA 1K4FA 1YPRA 3N6IA 4WEKA 5L10A 1WYCA 2JN7A 3F1NB 3OLOA 3W4QA 4BL3A 5GHYA 4E04A 2Y79A 4BMWA 3A3IA 3G31A 1NZOA 1ERMA 2ZC3B 2PT7A 3C4PA 4MEZA 2W3EA 3S7NA 4C6YA 1FSYA 1NYMA 2WKRA 4B4ZA 4L9GA 1S1YA 1V9YA 3F1NA 2R9WA 3N7WA 4BENA 5HPFA 4OH0A 2B02A 3IX4A 1FQGA 1K6SA 3WRTA 4EV4A 4D60A 3R4KA 3WWXA 2FFYA 5GLAA 2XA7S 4B9OA 1YQSA 1V9ZA 3NDEA 5IS1A 2O99A 5GHZA 1NWZA 4X6TA 3M2KA 4G3VA 3O5YA 3MZFA 3IF6C 5DFYA 4LV2A 4DDSA 3T1RA 1T1CA 2Y2MA 5HWTA 5AJGA 2L4RA 5AVEA 3LY4A 1PW8A 4G3KA 1BUEA 1ODVA 2M1CA 1KDWA 3N4IA 2ZLYA 4BL2A 2ZM8A 3P7NA 2O0YA 1TEMA 3OC2A 3PBSA 4OOLA 2W1RA 3UDIA 2V1BA 2WGVA 2Y2KA 3CPTA 3SH8A 4LV0A 1MWTA 3KYEA 5U47A 1VEUA 3S4XA 3MQQA 5FQKA 1SCWA 4PM9A 2HJ9C 4ZJ1A 2OWJA 1STZA 1K57C 3F1PA 1Q2QA 2HJEA 4ME4A 4R4RA 4DE1A 2PRFA 5TBMB 2KLIA 3LIEA 3HUNA 5CERA 1MZUA 3H7WB 1W79A 3F1OA 2HDSA 3NBLA 4FSFA 2W3HA 2Y2JA 5HDDA 4M3KA 4GHIB 1JNUA 2UV0E 4WZ5A 3KO6A 3H82B 4GZBA 2VEAA 1H8MA 2BLSA 2W0NA 1XGJA 4H6JA 4R1GA 3HLCA 4MN7A 1IFQA 5FSRA 2EX9A 3H7WA 3LR4A 4RVAA 1EW0A 4HH2A 5AVFA 4B88A 5EV0A 4QJGA 1BZAA 4WUJA 1GHMA 3ZQ5A 4GHIA 5FQMA 4ESPA 3H82A 2XFTA 3VP0A 1LSVA 4YFMA 3TJZC 2O9BA 3PYPA 3RJUA 5FA7A 2XD5A 1N4OA 3P98A 3HJKA 1XXMA 1ALQA 4KZBA 3BFEA 1NZUA 3BYDA 1SKFA 1TD5A 1ZKJA 5FAOA 3QP2A 4HESA 1S67L 2XROA 1TS8A 3FC7A 3JYIA 5FEGA 3WS5A 1MWSA 5TJJA 5G18A 4R0QA 5HAPA 4WF0A 1HD8A 5DTTA 4O0PA 1DJAA 1EWZA 2HDUA 1P9RA 2WUQA 4UQIM 2PAVP 5BOHA 3HVFA 1S4RA 3CAXA 1OT6A 5CHUA 3TRCA 4F3LA 3ZFZA 5IU1A 5M1AA 4EWFA 1CF0A 3K3CA 3VOZA 2H28A 3OBFA 4E3IA 3EOIA 4CJNA 3C38A 1OJGA 3A3EA 4EQIA 4UAAA 2ZBBA 4ZJ3A 4KZ9A 1BSGA 1OTEA 1BYWA 1W63Q 4FH2A 3ZNTA 2GNXA 4QPRA 4UEYA 4R6LA 5A8BA 2VGKA 3B33A 4OLGA 1P9WA 3SW1A 3FYZA 5E2EA 4NG2A 4E3KA 4B93A 2EWVA 4MBHA 1IYPA 3V50A 2ZC6B 3IBJA 2XRNA 3VV4A 4Q0JA 1F2KA 5HDSA 2WKHA 5FAPA 2C5WB 1K55C 2DCFA 1XPBA 4DRTA 4K08A 3M6HA 3BY9A 1PI5A 1DP8A 1NJ4A 3MQ0A 4ZBEA 5J4EA 2A2LA 4X56A 4KUKA 1JWPA 3BLSA 3IXBA 3QNBA 2PR5A 3E0YA 3KYQA 1H5XA 5HAIA 4JF5A 4QD4A 1EI5A 2LB5A 2P7JA 4I3IA 3NDGA 2HDQA 2MJ6A 2X71A 1GCEA 4JXWA 5AQ9A 2JKTI 2B5RA 2HF6A 4GS9B 4BBVA 1HVBA 2HPBA 1PZOA 4DKIA 4HNBA 3T4QA 5KIZA 1OTBA 4C3QA 3UDXA 2DMWA 5IT5A 1JTGA 2GDNA 4N1XA 4P6ZM 2ZC7A 5I5LA 3LEZA 4MN6A 4O7DA 1OT9A 4P87A 2D01A 2PBDP 4EUZA 3BFGA 4GS9A 1G6AA 1H0MA 2VA0A 4JBFA 2P9VA 2JE5A 2W27A 1L0DA 3HREA 3RXWA 2Y2IA 2G2UA 1YLJA 3IX3A 4X25A 5FDHA 1ES5A 4Q0HA 4O8GA 3R7WB 2ZMVA 3E4OA 4PPRA 1MPLA 2I72A 2V8CA 3OCNA 1N9LA 3GVBA 1LT0A 3T4KA 1RCJA 5DTSA 1DJBA 3MSHA 3IWOA 4MMNA 2Y2PA 4GDNA 2K2NA 4OQ0A 3QHYA 3LEQA 3MJQA 2X02A 3UPPA 1FR1A 3GQZA 3LUQA 2EXAA 1YLPA 4ETXA 3OZHA 2YKFA 1PIOA 5FATA 1SHVA 1PRQA 3ISGA 3LR5A 1I2SA 4GD6A 4WLAA 4LRXC 4NETA 3PBRA 4S2NC 1MWUA 1UWPX 4QWOA 4GB7A 3UE6A 3C8CA 5FI6A 2RCXA 1OJ5A 3CHWP 3MBZA 3EWKA 4MBKA 4EBLA 2V8FA 1XJ6A 4XT2A 3RTYA 4JF4A 4CQHA 3W2ZA 3LIDA 1XFNA 4BD1A 4WN5A 3OPLA 4RQ9A 4OOYA 4OP8A 1EROA 4OKPA 4Y13A 2WGWA 3W4PA 4ARZA 2WKQA 3BQ8A 4PM6A 3WS4A 3G32A 5HX9A 2P04A 2Y2OA 3H9WA 4HH3A 1S66L 5EFWA 3V5MA 4GN2A 4S2KA 3M2JA 1CJFA 1E3UA 3NOTC 2NUTC 5F6AA 2KDKA 2H10A 4BBUA 1SKOB 1Z6FA 4Y0UA 1XFQA 4DE3A 4DXBA 4WM9A 1N9NA 5F82A 4GD8A 4L9EA 4WBGA 3B3XA 1GSVA 1YSPA 1K54A 4NK3A 1SKOA 3G34A 1PWCA 2OAQ1 3T12B 5L2FA 3S22A 2VGLS 3NULA 3UPOA 1AWIA 3ICYA 3LY3A 2PD7A 4E6WA 3CJMA 1YLYA 2A3UA 3DWZA 1FCNA 2ZQDA 5CEDA 1GHIA 2Y2GA 2WK0A 4GNUA 4LLOB 4BLMA 2A24B 2V1AA 1W7FA 2QWSA 1K6RA 3G35A 1S1ZA 1MBLA 3LO7A 3HUMA 4JXSA 3ZG7B 2K31A 4X55A 4OPQA 2XH9A 3UPNA 4A5RA 1L3LA 4PM8A 1ES4A 3UY6A 1MC0A 2A24A 3VE3A 5HL1A 3V39A 4S2PA 2PD8A 1P97A 3MXRA 4L9FA 3PAGA 1H3QA 2E8JA 1VM1A 2PBYA 5HAQA 3LIBA 4EBPA 2PYPA 4MNRA 4IUHA 3BECA 4PKYG 1LL5A 2BG1A 4R23A 3T4SA 2PDRA 3PBQA 1LHYA 4JPMA 1ZG4A 4S2MA 2V9AA 2ZQ9A 2GZAA 1YKDA 3HLGA 3S7QA 1H8ZA 2W1TA 2ZOIA 1ESUA 3KYZA 2JKRM 4Z1WA 4HIAA 3NI9A 3CPTB 1F9IA 4L0LA 1BULA 2ZQ8A 2XLNA 1VEUB 2DRWA 2EA9A 1JWVA 3VE4A 3EGDC 3IWQA 2OSUA 3GR2A 2PU4A 2LB9A 1VQQA 1FOFA 3F1PB 3GV9A 4EEUA 5F1FA 2JHEA 2Y2NA 3K2NA 1ES3A 1O07A 2BASA 3WRZA 3UB6A 3JPUA 4HJ6A 4Y7PA 2Z6CA 3UB8A 3F1OB 3SS5A 5EM0A 4EETB 3UB9A 1K56A 1KVMA 3E4PA 4FH4A 3VP1A 1RP5A 4GW9A 3LFVA 3E4QA 4HJ4A 2Y2LA 4HQAA 4H6JB 3KSGA 5TFQA 4OQGA 1QMFA 1MKMA 3D72A 3LICA 1KGGA 3EEAA 3LIAA 2J3TC 5FI7A 3IS2A 1FCOA 5EVIA 5EVLA 4KZ8A 4OVDA 4AFIA 1D1JA 4EU0A 2P74A 3PBTA 1MY8A 2ZQ7A 4KQRA 2C6WB 2A49A 3IT9A 4FCFA 3CUEC 5G4YA 3GECA 4PM5A 5AQBA 4CLCB 4FUWA 4IJGA 3IHAA 4I3AA 4I38A 2J3WA 4E3OA 4BQMA 3E2KA 1ES2A 3PBNA 4Y15A 2ZD8A 1L0GA 4GOGA 1FILA 2YKHA 4HBUA 2IA2A 5L09A 3O87A 5E2FA 4CLCA 4EQ1A 3N8RA 5F68A 4LPZA 2RL3A 2VKSA 4IBRA 1IEMA 2EFUA 4MCWA 3KSIA 4DE0A 3HCYA 2DNSA 2OLUA 3ZCZA 4F3LB 4D2OA 3DBAA 4LENA 2QYBA 2ZQCA 4RYEA 4RX2A 1ZG6A 4YWZA 2J9OA 4ETZA 5FQ9A 3RXXA 4BD0A 2PR6A 4HEFA 3T1SA 2WZXA 5J8XA 2OLVA 2VX8A 5CGWA 1N9BA 3A3JA 5HW3A 1YLWA 3Q7VA 4HBTA 5FI2A 3VP3A 2IWCA 4UA7A 4U3TA 3GSGA 1GSXA 3AGEA 3CLOA 5F83A 1BLHA 3T4TA 2XD1A 2VV8A 4Y17A 4UA9A 3IWIA 3SOIA
chains in the Genus database with same CATH topology
5JYPA 4KG6A 4KZ3A 3VP4A 2Y2PA 1CK3A 4KG2A 3VOYA 4GDNA 2QPNA 3HUOA 4K91A 1PI4A 4OQ0A 4UA6A 3WS0A 3V3SA 4DE2A 3E2LA 3QHYA 3VSKA 1E3UD 5A90A 3P09A 2X02A 3UDFA 3UPPA 2JBFA 4IVKA 3UNWA 3MZDA 1ERQA 1FR1A 3GQZA 3IXGA 3FWLA 2EXAA 3CZDA 4Y0OA 1YLPA 2EXBA 4XUXA 5CHJA 2Z2MB 4IBXA 1JVJA 3OZHA 2EFXA 2ZM2A 3MKFA 5FQJA 3WS2A 1PIOA 3VFHA 4QY6A 2Y55A 5FATA 1SHVA 3ISGA 1IYOA 1OMEA 1K54C 5KSCA 1K4FA 1I2SA 3N6IA 4GD6A 4WEKA 1WYCA 4NETA 3W4QA 1MKIA 4BL3A 1NXYA 1RGYA 2CC1A 1E25A 3C4OA 5GHYA 3PBRA 3BEBA 1YLZA 4S2NC 4KZ6A 1MWUA 1Y54A 5CHMA 3WS1A 4JXVA 4GDBA 4GKUA 4GB7A 3A3IA 3HBRA 3G31A 5HARA 5FI6A 2WAEA 5CTNA 3VMAA 1TDLA 1NZOA 5EUAA 1ERMA 2HP6A 2RCXA 4KG5A 3MBZA 5GLCA 4MBKA 2ZC3B 4PMAA 3C4PA 4EBLA 3A3FA 4MEZA 4C6YA 1FSYA 1NYMA 4JF4A 4E3JA 4B4ZA 5CRFA 3NIAA 4BD1A 3OPLA 2JC7A 4OOYA 2OV5A 4OP8A 2R9WA 3N7WA 4BENA 3M6BA 1EROA 4OPYA 2J7VA 4OH0A 3Q07A 4OKPA 3EQUA 4RX3A 5FASA 3SS4A 1FQGA 2P9VB 1K6SA 3WRTA 4EV4A 2WGWA 1U60A 3W4PA 3WWXA 1NY0A 2FFYA 2Q9MA 1JWZA 4LV1A 4OQIA 4WZ5C 5GLAA 3Q81A 3D4FA 1YQSA 4JLFA 3DW0A 4PM6A 3C5AA 3NDEA 3WS4A 3G32A 5GHZA 5F1GA 5HX9A 2Y2OA 4KZ7A 4X6TA 1K38A 3Q7VB 3M2KA 3V5MA 4GN2A 2EX6A 4S2KA 3M2JA 5D3OA 2WGIA 1E3UA 4KENB 3W4OA 5JYOA 3MZFA 4KZAA 3IF6C 1TVFA 1WYBA 4LV2A 2XDMA 4DDSA 2H10A 3O88A 4N1HA 4S2JA 1Z6FA 2Y2MA 5EE8A 4Y0UA 4DE3A 3QNCA 4MLLA 3LY4A 3O3VA 3VSLA 4P6BA 1PW8A 4QB8A 5FAQA 2XK1A 1Q2PA 4DXBA 4WM9A 1BUEA 5F82A 3ITBA 1KDWA 3N4IA 2ZLYA 4GD8A 4BL2A 4WBGA 2ZM8A 1HTZA 3B3XA 3OPPA 1TEMA 1K4EA 2IWBA 2J9PA 3OC2A 3PBSA 4OOLA 1L0EA 4B4XA 3UDIA 4RA7A 5DTKA 4KZ4A 5KMWA 3NY4A 2WGVA 2Y2KA 1XX2A 4QHCA 1K54A 3SH8A 4LV0A 4NK3A 5EPHA 1MWTA 2ZQAA 5U47A 5FQIA 3G34A 2WAFA 3Q82A 4S2LA 3S4XA 1PWCA 5FQKA 1LL9A 4S2NA 1SCWA 4XUZA 5L2FA 3S22A 4ZDXA 4PM9A 3W8KA 3UPOA 1FSWA 4ZJ1A 5I94A 3LY3A 4R3JA 4E6WA 4OQHA 1CEGA 3CJMA 4WZ4A 1GA0A 1K57C 1YLYA 1TDGA 2A3UA 3DWZA 1Q2QA 5A93A 4DE1A 2Y2QA 2FFFB 3HLBA 1FCNA 2ZQDA 4R4SA 4R4RA 5CEDA 2V1ZA 3HLDA 1GHIA 2QMIA 2XF3A 3ZGAB 2Q9NA 4H8RA 2Y2GA 4LV3A 3ZNYA 3S1YA 2WK0A 1L0FA 4GNUA 4BLMA 4QU3A 3HUNA 3IF6B 1W7FA 4X69A 5CERA 4JKTA 1W79A 2HDSA 3VP2A 3NBLA 2Y91A 4FSFA 2Y2JA 1K6RA 4M3KA 3G35A 5EOEA 4IEDA 4WZ5A 1MBLA 4S2OA 3LO7A 1J9MA 3HUMA 1LI0A 4GZBA 4JXSA 3UO9A 3ZG7B 3DWKA 3UN7A 5E2HA 1PW1A 4X55A 4C75A 4BJPA 3PBOA 4E6XA 2BLSA 2XH9A 4N9LA 1GHPA 4OPQA 3UPNA 4PM8A 4A5RA 1ESIA 2WGWB 4KQQA 1ES4A 1XGJA 3ZVTA 4N9KA 3UY6A 5CXWA 3TOIA 4R1GA 5HL1A 3HLCA 3IF6A 3V39A 5FSRA 4S2PA 2EX9A 3BFDA 4ID4A 1L2SA 5DVAA 3MXRA 4RVAA 3Q1FA 3PAGA 1VM1A 5DF8A 4K0WA 2PBYA 4U0XA 3UE3A 4B88A 2WZZA 4QJGA 1BZAA 1MWRA 1GHMA 5HAQA 4U0TA 4EBPA 5FQMA 4MNRA 4WEJA 1BLPA 1K56D 3BECA 2XFTA 3VP0A 3UE0A 3UE1A 5CTMA 1LL5A 2BG1A 4ZAMA 4YFMA 4R23A 3ZDJA 4OPZA 1E4DA 5IHVA 4WYYA 3SOIA 1MXOA 3N8LA 3RJUA 5FA7A 3G4PA 2XD5A 1N4OA 3PBQA 1LHYA 1YMSA 1W8QA 1ZG4A 4JPMA 4OPRA 3PTEA 4P85A 4S2MA 5EVIC 3ZVWA 3P98A 4E3MA 1DY6A 4EBNA 1XXMA 2ZQ9A 1ALQA 4WMCD 3GRJA 4KZBA 5A91A 3BFEA 3BFCA 3HLGA 1NZUA 3BYDA 1SKFA 1H8ZA 5EECA 5M19A 3MXSA 4FD8A 2WADA 1ZKJA 1ESUA 4K0XA 2XQZA 3GMWA 3G2YA 5FAOA 5EVID 3NC8A 4HESA 2XFSA 5KZHA 3NI9A 2QZ6A 3TG9A 3JYIA 4L0LA 1BULA 1MWSA 3WS5A 2ZQ8A 4IVIA 5AQ7A 5G18A 1K57A 4R0QA 5HAPA 2XLNA 2XR0A 2DRWA 3ZG5A 3ZG8B 1HD8A 2UWXA 3IQAA 5DTTA 1DJAA 1EWZA 2HDUA 1JWVA 2V20A 3IXHA 3IWQA 2OSUA 2Y2HA 3GR2A 4LCLA 1KGEA 2PU4A 4ZJ2A 3FZCA 3IH8A 2WUQA 1VQQA 1FOFA 3FKWA 5EOOA 1W8YA 5TR7A 1O7EA 3GV9A 5F1FA 1S0WA 2ZMAA 5CEBA 4CPKA 5BOHA 2Y2NA 5E43A 1ES3A 1O07A 3HVFA 1YM1A 1KE3A 3WRZA 1G68A 1JTDA 1YT4A 3ZG0A 1K25A 3FV7A 5CHUA 4OOMA 3N8SA 3SH9A 1PWGA 3HLWA 3ZFZA 4Y7PA 5M1AA 4Z9QA 3G2ZA 4EWFA 4P0MA 3VOZA 3BFFA 4E3IA 3SS5A 5HFOA 5E2GA 2WKEA 1IELA 4CJNA 1K56A 1KVMA 3A3EA 4EQIA 4UAAA 4E3NA 4FH4A 4ZJ3A 4KZ9A 3VP1A 1BSGA 5A92A 1RP5A 4FH2A 2PU2A 3ZNTA 1YMXA 3AGDA 2Y2LA 1PWDA 2VGKA 5GLDA 4OLGA 5TFQA 4OQGA 1XA7A 3FYZA 3SS3A 2EX2A 5E2EA 3SH7A 5CGXA 1QMFA 1XGIA 4WMCA 4E3KA 4Q8IA 1KGGA 1NYYA 3NCKA 1M6KA 5GLBA 4X68A 2WKIA 3LCEA 4MBHA 5FI7A 4KZ5A 1IYPA 1IKGA 4MBFA 3V50A 3BM6A 2ZC6B 1DJCA 1FCOA 5EVIA 5EVLA 3VFFA 2JCHA 2G2WA 3C7UA 3ITAA 2XEPA 4DDYA 4KZ8A 3CMZA 1XKZA 2ZM0A 3I7JA 1YLTA 2WKHA 3HLFA 4OVDA 5FAPA 3TSGA 2HDRA 2C5WB 2ZC4B 1K55C 2DCFA 1XPBA 1IKIA 2P74A 3IHBA 3PBTA 4DXCA 1MY8A 2Z2LB 1XA1A 4DRTA 2ZQ7A 3M6HA 4KQRA 1PI5A 1KE0A 3OPHA 4DF6A 2C6WB 4YINA 1ZC2A 2H0TA 1NJ4A 3G30A 5M18A 2A49A 4ZBEA 4X53A 3IT9A 4FCFA 1IYSA 1NRFA 4PM5A 4F94A 1M40A 5AQBA 4X56A 2ZC5B 1S6RA 1C3BA 1IYQA 3IHAA 4JF6A 3MZEA 1KE4A 2WYXA 1JWPA 1SDEA 3CG5A 3DTMA 2XGNA 3BLSA 3IXBA 3QNBA 5GHXA 4BQMA 4E3OA 3E2KA 1LI9A 1H5XA 3MFDA 5HAIA 1ES2A 1AXBA 3BRMA 2E8IA 1QMEA 4N92A 4E3LA 4JF5A 4QD4A 1EI5A 3NDGA 3A3DA 2J8YA 3PBNA 2HDQA 1BLSA 2ZD8A 3ZG9B 1L0GA 1KDSA 4GOGA 5FQQA 2X71A 1GCEA 3EQVA 4JXWA 5AQ9A 1WE4A 4HBUA 1H8YA 2B5RA 3GTCA 1HVBA 2HPBA 3O87A 5E2FA 1PZOA 4OLDA 4DKIA 5AQAA 3N8RA 3OPRA 4C3QA 3UDXA 1XP4A 1JTGA 2GDNA 3MKEA 4N1XA 3HLEA 1CEFA 2RL3A 2H0YA 4IBRA 1IEMA 2EFUA 4QY5A 2ZC7A 1SDNA 3LEZA 4DE0A 4O7DA 2DNSA 2OLUA 4S2IA 3ZCZA 1PYYA 4D2OA 3BLMA 5GL9A 4P87A 3ZHHA 2IWDA 5TGFA 1W5DA 4UHUA 4LENA 3IH9A 4EUZA 3Q7ZA 3BFGA 4R3BA 4KQOA 1G6AA 2R9XA 2Y59A 1FCMA 4OONA 2ZQCA 1I5QA 4RYEA 4RX2A 3IXDA 1ZG6A 2X01A 4Y0TA 1BTLA 2J9OA 4JBFA 4XXRA 2P9VA 2JE5A 3HL9A 1CI8A 1L0DA 4JXGA 4PM7A 3HREA 4ZTKA 5FQ9A 1LLBA 1I2WA 1GA9A 3RXXA 3RXWA 4BD0A 2Y2IA 1BLCA 2G2UA 4HEFA 1YLJA 3IF5A 1PZPA 3OCLA 2WZXA 5FDHA 1ES5A 1CI9A 5J8XA 1ONGA 1RGZA 4PPRA 2HP5A 2OLVA 1MPLA 1FR6A 5CGWA 1N9BA 2EX8A 3A3JA 1YLWA 3Q7VA 4HBTA 4LCMA 5HW3A 1K55A 5KSHA 4OP5A 5FI2A 3VP3A 2I72A 2IWCA 3PAEA 3O86A 3OCNA 4UA7A 4U3TA 5EVIB 3GVBA 5DF7A 3GSGA 2V2FF 3AGFA 3FKVA 5DF9A 3AGEA 1HZOA 1KVLA 4WELA 1ONHA 2Y4AA 2ZJ9A 5F83A 1BLHA 1RCJA 5CGSA 5DTSA 2XD1A 3V3RA 2HP9A 1KGFA 1DJBA 2H5SA 4UA9A 1BT5A 5CECA 2VGJA 3IWIA 3IWOA 3C7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JYP A;  4KG6 A;  4KZ3 A;  3VP4 A;  2Y2P A;  1CK3 A;  4KG2 A;  3VOY A;  4GDN A;  2QPN A;  3HUO A;  4K91 A;  1PI4 A;  4OQ0 A;  4UA6 A;  3WS0 A;  3V3S A;  4DE2 A;  3E2L A;  3QHY A;  3VSK A;  1E3U D;  5A90 A;  3P09 A;  2X02 A;  3UDF A;  3UPP A;  2JBF A;  4IVK A;  3UNW A;  3MZD A;  1ERQ A;  1FR1 A;  3GQZ A;  3IXG A;  3FWL A;  2EXA A;  3CZD A;  4Y0O A;  1YLP A;  2EXB A;  4XUX A;  5CHJ A;  2Z2M B;  4IBX A;  1JVJ A;  3OZH A;  2EFX A;  2ZM2 A;  3MKF A;  5FQJ A;  3WS2 A;  1PIO A;  3VFH A;  4QY6 A;  2Y55 A;  5FAT A;  1SHV A;  3ISG A;  1IYO A;  1OME A;  1K54 C;  5KSC A;  1K4F A;  1I2S A;  3N6I A;  4GD6 A;  4WEK A;  1WYC A;  4NET A;  3W4Q A;  1MKI A;  4BL3 A;  1NXY A;  1RGY A;  2CC1 A;  1E25 A;  3C4O A;  5GHY A;  3PBR A;  3BEB A;  1YLZ A;  4S2N C;  4KZ6 A;  1MWU A;  1Y54 A;  5CHM A;  3WS1 A;  4JXV A;  4GDB A;  4GKU A;  4GB7 A;  3A3I A;  3HBR A;  3G31 A;  5HAR A;  5FI6 A;  2WAE A;  5CTN A;  3VMA A;  1TDL A;  1NZO A;  5EUA A;  1ERM A;  2HP6 A;  2RCX A;  4KG5 A;  3MBZ A;  5GLC A;  4MBK A;  2ZC3 B;  4PMA A;  3C4P A;  4EBL A;  3A3F A;  4MEZ A;  4C6Y A;  1FSY A;  1NYM A;  4JF4 A;  4E3J A;  4B4Z A;  5CRF A;  3NIA A;  4BD1 A;  3OPL A;  2JC7 A;  4OOY A;  2OV5 A;  4OP8 A;  2R9W A;  3N7W A;  4BEN A;  3M6B A;  1ERO A;  4OPY A;  2J7V A;  4OH0 A;  3Q07 A;  4OKP A;  3EQU A;  4RX3 A;  5FAS A;  3SS4 A;  1FQG A;  2P9V B;  1K6S A;  3WRT A;  4EV4 A;  2WGW A;  1U60 A;  3W4P A;  3WWX A;  1NY0 A;  2FFY A;  2Q9M A;  1JWZ A;  4LV1 A;  4OQI A;  4WZ5 C;  5GLA A;  3Q81 A;  3D4F A;  1YQS A;  4JLF A;  3DW0 A;  4PM6 A;  3C5A A;  3NDE A;  3WS4 A;  3G32 A;  5GHZ A;  5F1G A;  5HX9 A;  2Y2O A;  4KZ7 A;  4X6T A;  1K38 A;  3Q7V B;  3M2K A;  3V5M A;  4GN2 A;  2EX6 A;  4S2K A;  3M2J A;  5D3O A;  2WGI A;  1E3U A;  4KEN B;  3W4O A;  5JYO A;  3MZF A;  4KZA A;  3IF6 C;  1TVF A;  1WYB A;  4LV2 A;  2XDM A;  4DDS A;  2H10 A;  3O88 A;  4N1H A;  4S2J A;  1Z6F A;  2Y2M A;  5EE8 A;  4Y0U A;  4DE3 A;  3QNC A;  4MLL A;  3LY4 A;  3O3V A;  3VSL A;  4P6B A;  1PW8 A;  4QB8 A;  5FAQ A;  2XK1 A;  1Q2P A;  4DXB A;  4WM9 A;  1BUE A;  5F82 A;  3ITB A;  1KDW A;  3N4I A;  2ZLY A;  4GD8 A;  4BL2 A;  4WBG A;  2ZM8 A;  1HTZ A;  3B3X A;  3OPP A;  1TEM A;  1K4E A;  2IWB A;  2J9P A;  3OC2 A;  3PBS A;  4OOL A;  1L0E A;  4B4X A;  3UDI A;  4RA7 A;  5DTK A;  4KZ4 A;  5KMW A;  3NY4 A;  2WGV A;  2Y2K A;  1XX2 A;  4QHC A;  1K54 A;  3SH8 A;  4LV0 A;  4NK3 A;  5EPH A;  1MWT A;  2ZQA A;  5U47 A;  5FQI A;  3G34 A;  2WAF A;  3Q82 A;  4S2L A;  3S4X A;  1PWC A;  5FQK A;  1LL9 A;  4S2N A;  1SCW A;  4XUZ A;  5L2F A;  3S22 A;  4ZDX A;  4PM9 A;  3W8K A;  3UPO A;  1FSW A;  4ZJ1 A;  5I94 A;  3LY3 A;  4R3J A;  4E6W A;  4OQH A;  1CEG A;  3CJM A;  4WZ4 A;  1GA0 A;  1K57 C;  1YLY A;  1TDG A;  2A3U A;  3DWZ A;  1Q2Q A;  5A93 A;  4DE1 A;  2Y2Q A;  2FFF B;  3HLB A;  1FCN A;  2ZQD A;  4R4S A;  4R4R A;  5CED A;  2V1Z A;  3HLD A;  1GHI A;  2QMI A;  2XF3 A;  3ZGA B;  2Q9N A;  4H8R A;  2Y2G A;  4LV3 A;  3ZNY A;  3S1Y A;  2WK0 A;  1L0F A;  4GNU A;  4BLM A;  4QU3 A;  3HUN A;  3IF6 B;  1W7F A;  4X69 A;  5CER A;  4JKT A;  1W79 A;  2HDS A;  3VP2 A;  3NBL A;  2Y91 A;  4FSF A;  2Y2J A;  1K6R A;  4M3K A;  3G35 A;  5EOE A;  4IED A;  4WZ5 A;  1MBL A;  4S2O A;  3LO7 A;  1J9M A;  3HUM A;  1LI0 A;  4GZB A;  4JXS A;  3UO9 A;  3ZG7 B;  3DWK A;  3UN7 A;  5E2H A;  1PW1 A;  4X55 A;  4C75 A;  4BJP A;  3PBO A;  4E6X A;  2BLS A;  2XH9 A;  4N9L A;  1GHP A;  4OPQ A;  3UPN A;  4PM8 A;  4A5R A;  1ESI A;  2WGW B;  4KQQ A;  1ES4 A;  1XGJ A;  3ZVT A;  4N9K A;  3UY6 A;  5CXW A;  3TOI A;  4R1G A;  5HL1 A;  3HLC A;  3IF6 A;  3V39 A;  5FSR A;  4S2P A;  2EX9 A;  3BFD A;  4ID4 A;  1L2S A;  5DVA A;  3MXR A;  4RVA A;  3Q1F A;  3PAG A;  1VM1 A;  5DF8 A;  4K0W A;  2PBY A;  4U0X A;  3UE3 A;  4B88 A;  2WZZ A;  4QJG A;  1BZA A;  1MWR A;  1GHM A;  5HAQ A;  4U0T A;  4EBP A;  5FQM A;  4MNR A;  4WEJ A;  1BLP A;  1K56 D;  3BEC A;  2XFT A;  3VP0 A;  3UE0 A;  3UE1 A;  5CTM A;  1LL5 A;  2BG1 A;  4ZAM A;  4YFM A;  4R23 A;  3ZDJ A;  4OPZ A;  1E4D A;  5IHV A;  4WYY A;  3SOI A;  1MXO A;  3N8L A;  3RJU A;  5FA7 A;  3G4P A;  2XD5 A;  1N4O A;  3PBQ A;  1LHY A;  1YMS A;  1W8Q A;  1ZG4 A;  4JPM A;  4OPR A;  3PTE A;  4P85 A;  4S2M A;  5EVI C;  3ZVW A;  3P98 A;  4E3M A;  1DY6 A;  4EBN A;  1XXM A;  2ZQ9 A;  1ALQ A;  4WMC D;  3GRJ A;  4KZB A;  5A91 A;  3BFE A;  3BFC A;  3HLG A;  1NZU A;  3BYD A;  1SKF A;  1H8Z A;  5EEC A;  5M19 A;  3MXS A;  4FD8 A;  2WAD A;  1ZKJ A;  1ESU A;  4K0X A;  2XQZ A;  3GMW A;  3G2Y A;  5FAO A;  5EVI D;  3NC8 A;  4HES A;  2XFS A;  5KZH A;  3NI9 A;  2QZ6 A;  3TG9 A;  3JYI A;  4L0L A;  1BUL A;  1MWS A;  3WS5 A;  2ZQ8 A;  4IVI A;  5AQ7 A;  5G18 A;  1K57 A;  4R0Q A;  5HAP A;  2XLN A;  2XR0 A;  2DRW A;  3ZG5 A;  3ZG8 B;  1HD8 A;  2UWX A;  3IQA A;  5DTT A;  1DJA A;  1EWZ A;  2HDU A;  1JWV A;  2V20 A;  3IXH A;  3IWQ A;  2OSU A;  2Y2H A;  3GR2 A;  4LCL A;  1KGE A;  2PU4 A;  4ZJ2 A;  3FZC A;  3IH8 A;  2WUQ A;  1VQQ A;  1FOF A;  3FKW A;  5EOO A;  1W8Y A;  5TR7 A;  1O7E A;  3GV9 A;  5F1F A;  1S0W A;  2ZMA A;  5CEB A;  4CPK A;  5BOH A;  2Y2N A;  5E43 A;  1ES3 A;  1O07 A;  3HVF A;  1YM1 A;  1KE3 A;  3WRZ A;  1G68 A;  1JTD A;  1YT4 A;  3ZG0 A;  1K25 A;  3FV7 A;  5CHU A;  4OOM A;  3N8S A;  3SH9 A;  1PWG A;  3HLW A;  3ZFZ A;  4Y7P A;  5M1A A;  4Z9Q A;  3G2Z A;  4EWF A;  4P0M A;  3VOZ A;  3BFF A;  4E3I A;  3SS5 A;  5HFO A;  5E2G A;  2WKE A;  1IEL A;  4CJN A;  1K56 A;  1KVM A;  3A3E A;  4EQI A;  4UAA A;  4E3N A;  4FH4 A;  4ZJ3 A;  4KZ9 A;  3VP1 A;  1BSG A;  5A92 A;  1RP5 A;  4FH2 A;  2PU2 A;  3ZNT A;  1YMX A;  3AGD A;  2Y2L A;  1PWD A;  2VGK A;  5GLD A;  4OLG A;  5TFQ A;  4OQG A;  1XA7 A;  3FYZ A;  3SS3 A;  2EX2 A;  5E2E A;  3SH7 A;  5CGX A;  1QMF A;  1XGI A;  4WMC A;  4E3K A;  4Q8I A;  1KGG A;  1NYY A;  3NCK A;  1M6K A;  5GLB A;  4X68 A;  2WKI A;  3LCE A;  4MBH A;  5FI7 A;  4KZ5 A;  1IYP A;  1IKG A;  4MBF A;  3V50 A;  3BM6 A;  2ZC6 B;  1DJC A;  1FCO A;  5EVI A;  5EVL A;  3VFF A;  2JCH A;  2G2W A;  3C7U A;  3ITA A;  2XEP A;  4DDY A;  4KZ8 A;  3CMZ A;  1XKZ A;  2ZM0 A;  3I7J A;  1YLT A;  2WKH A;  3HLF A;  4OVD A;  5FAP A;  3TSG A;  2HDR A;  2C5W B;  2ZC4 B;  1K55 C;  2DCF A;  1XPB A;  1IKI A;  2P74 A;  3IHB A;  3PBT A;  4DXC A;  1MY8 A;  2Z2L B;  1XA1 A;  4DRT A;  2ZQ7 A;  3M6H A;  4KQR A;  1PI5 A;  1KE0 A;  3OPH A;  4DF6 A;  2C6W B;  4YIN A;  1ZC2 A;  2H0T A;  1NJ4 A;  3G30 A;  5M18 A;  2A49 A;  4ZBE A;  4X53 A;  3IT9 A;  4FCF A;  1IYS A;  1NRF A;  4PM5 A;  4F94 A;  1M40 A;  5AQB A;  4X56 A;  2ZC5 B;  1S6R A;  1C3B A;  1IYQ A;  3IHA A;  4JF6 A;  3MZE A;  1KE4 A;  2WYX A;  1JWP A;  1SDE A;  3CG5 A;  3DTM A;  2XGN A;  3BLS A;  3IXB A;  3QNB A;  5GHX A;  4BQM A;  4E3O A;  3E2K A;  1LI9 A;  1H5X A;  3MFD A;  5HAI A;  1ES2 A;  1AXB A;  3BRM A;  2E8I A;  1QME A;  4N92 A;  4E3L A;  4JF5 A;  4QD4 A;  1EI5 A;  3NDG A;  3A3D A;  2J8Y A;  3PBN A;  2HDQ A;  1BLS A;  2ZD8 A;  3ZG9 B;  1L0G A;  1KDS A;  4GOG A;  5FQQ A;  2X71 A;  1GCE A;  3EQV A;  4JXW A;  5AQ9 A;  1WE4 A;  4HBU A;  1H8Y A;  2B5R A;  3GTC A;  1HVB A;  2HPB A;  3O87 A;  5E2F A;  1PZO A;  4OLD A;  4DKI A;  5AQA A;  3N8R A;  3OPR A;  4C3Q A;  3UDX A;  1XP4 A;  1JTG A;  2GDN A;  3MKE A;  4N1X A;  3HLE A;  1CEF A;  2RL3 A;  2H0Y A;  4IBR A;  1IEM A;  2EFU A;  4QY5 A;  2ZC7 A;  1SDN A;  3LEZ A;  4DE0 A;  4O7D A;  2DNS A;  2OLU A;  4S2I A;  3ZCZ A;  1PYY A;  4D2O A;  3BLM A;  5GL9 A;  4P87 A;  3ZHH A;  2IWD A;  5TGF A;  1W5D A;  4UHU A;  4LEN A;  3IH9 A;  4EUZ A;  3Q7Z A;  3BFG A;  4R3B A;  4KQO A;  1G6A A;  2R9X A;  2Y59 A;  1FCM A;  4OON A;  2ZQC A;  1I5Q A;  4RYE A;  4RX2 A;  3IXD A;  1ZG6 A;  2X01 A;  4Y0T A;  1BTL A;  2J9O A;  4JBF A;  4XXR A;  2P9V A;  2JE5 A;  3HL9 A;  1CI8 A;  1L0D A;  4JXG A;  4PM7 A;  3HRE A;  4ZTK A;  5FQ9 A;  1LLB A;  1I2W A;  1GA9 A;  3RXX A;  3RXW A;  4BD0 A;  2Y2I A;  1BLC A;  2G2U A;  4HEF A;  1YLJ A;  3IF5 A;  1PZP A;  3OCL A;  2WZX A;  5FDH A;  1ES5 A;  1CI9 A;  5J8X A;  1ONG A;  1RGZ A;  4PPR A;  2HP5 A;  2OLV A;  1MPL A;  1FR6 A;  5CGW A;  1N9B A;  2EX8 A;  3A3J A;  1YLW A;  3Q7V A;  4HBT A;  4LCM A;  5HW3 A;  1K55 A;  5KSH A;  4OP5 A;  5FI2 A;  3VP3 A;  2I72 A;  2IWC A;  3PAE A;  3O86 A;  3OCN A;  4UA7 A;  4U3T A;  5EVI B;  3GVB A;  5DF7 A;  3GSG A;  2V2F F;  3AGF A;  3FKV A;  5DF9 A;  3AGE A;  1HZO A;  1KVL A;  4WEL A;  1ONH A;  2Y4A A;  2ZJ9 A;  5F83 A;  1BLH A;  1RCJ A;  5CGS A;  5DTS A;  2XD1 A;  3V3R A;  2HP9 A;  1KGF A;  1DJB A;  2H5S A;  4UA9 A;  1BT5 A;  5CEC A;  2VGJ A;  3IWI A;  3IWO A;  3C7V A; 
#chains in the Genus database with same CATH topology
 2L1M A;  3T4J A;  4KG2 A;  3VOY A;  3HUO A;  4JGQ A;  4UA6 A;  3V3S A;  1E3U D;  5A90 A;  3P09 A;  3UDF A;  2JBF A;  3UNW A;  3FWL A;  2EXB A;  5CHJ A;  2J3T D;  3MKF A;  2Y55 A;  5HDC A;  1OME A;  1FIK A;  1MKI A;  1NXY A;  2CC1 A;  1E25 A;  3C4O A;  4EUV A;  1Y54 A;  2XA7 M;  4EER A;  4GDB A;  3HBR A;  5HAR A;  2WAE A;  5CTN A;  4KG5 A;  5GLC A;  4PMA A;  3A3F A;  5CRF A;  4IUK A;  2JC7 A;  4HP9 A;  3Q07 A;  4RX3 A;  5FAS A;  2P9V B;  2PHY A;  1NY0 A;  3QP5 A;  2Q9M A;  4I5S A;  1JWZ A;  1VHM A;  4LV1 A;  4WZ5 C;  4YNR A;  3Q81 A;  3EEH A;  4JLF A;  3DW0 A;  3T1Q B;  3C5A A;  3LYX A;  3RH8 B;  5F1G A;  4KZ7 A;  2V0W A;  3KSH A;  2HZ5 A;  2EX6 A;  4PHT A;  2WGI A;  4KEN B;  5JYO A;  1WYB A;  4NEE D;  4N1H A;  4S2J A;  1T19 A;  5EE8 A;  3QNC A;  2Z6D A;  5HD5 A;  3O3V A;  4QB8 A;  3MS6 A;  4X1M A;  5FAQ A;  2XK1 A;  2QJ7 A;  3ITB A;  4EEP A;  1XJ3 A;  1HTZ A;  2KOI A;  4HJ3 A;  2VV6 A;  2J80 A;  3TW8 A;  1K4E A;  3UB7 A;  1L0E A;  5DTK A;  4KZ4 A;  5KMW A;  3NY4 A;  1F5M A;  3KX0 X;  5FQI A;  2O9A A;  4KQD A;  1LL9 A;  3IX8 A;  3W8K A;  3NEC A;  1FSW A;  5I94 A;  4OQH A;  1CEG A;  1GSW A;  4R4S A;  1DP6 A;  1TS6 A;  2V1Z A;  3HLD A;  2XF3 A;  3ZGA B;  2Q9N A;  4H8R A;  4LV3 A;  2W3D A;  2HV1 A;  1ZTU A;  1VET B;  3IF6 B;  4X69 A;  2Q0O A;  3FG8 A;  4JKT A;  5C5K A;  5L07 A;  3S7O A;  3VP2 A;  2Y91 A;  1SZV A;  4XT2 B;  5EOE A;  4DJ2 A;  2I9V A;  1LI0 A;  3UO9 A;  3DWK A;  5E2H A;  4C75 A;  4E6X A;  4N9L A;  1GHP A;  1J3W A;  2WGW B;  4KQQ A;  2P08 A;  4N9K A;  4ARZ B;  4CLC E;  1VET A;  4GCZ A;  3IF6 A;  4HOI A;  3SZT A;  4R3A A;  2FH5 A;  5DVA A;  1MWR A;  4U0T A;  2AVX A;  1TS7 A;  1BLP A;  4WEJ A;  3D9Y A;  1K56 D;  3UE0 A;  3UE1 A;  2M7V A;  2GX5 A;  4ZAM A;  3FPV A;  1NLZ A;  1E4D A;  4WYY A;  3PR6 A;  1MXO A;  3N8L A;  3V67 A;  1P0Z A;  3PTE A;  3FPW A;  4EBN A;  5K5B A;  3C2W A;  5FEF A;  1ACF A;  4MDZ A;  5A91 A;  5M19 A;  3MXS A;  4FD8 A;  2WAD A;  2XQZ A;  1UGU A;  5EVI D;  3NC8 A;  2XFS A;  4IVI A;  1K57 A;  3ZG8 B;  1LL8 A;  2UWX A;  4HY8 A;  3IXH A;  5DFX A;  2QHK A;  3FKW A;  5EOO A;  2ZOH A;  2ZMA A;  4CPK A;  4WL9 A;  1YM1 A;  2QJ5 A;  3ZG0 A;  3FV7 A;  2NUP C;  3N8S A;  3SH9 A;  2ZMF A;  3JVV A;  4Z9Q A;  3G2Z A;  4P0M A;  3BFF A;  2KX6 A;  5HFO A;  5J7E A;  2WKE A;  2JKT M;  1IEL A;  3S7P A;  5MC7 A;  5DKK A;  4E3N A;  1D06 A;  4CLC D;  3GDI A;  2PU2 A;  5EM1 A;  3E98 A;  3LIF A;  1PWD A;  5F5Y A;  4GLQ A;  3SS3 A;  3QP1 A;  2EX2 A;  4WMC A;  4Q8I A;  3BY8 A;  1NYY A;  3NCK A;  1M6K A;  5GLB A;  4X68 A;  4KZ5 A;  1IKG A;  4R70 A;  3VFF A;  2G2W A;  3ITA A;  3CMZ A;  1XKZ A;  2ZM0 A;  3I7J A;  3HLF A;  3A0R A;  3T50 A;  2HDR A;  3IHB A;  4DXC A;  2Z2L B;  1XA1 A;  1KE0 A;  3OPH A;  4YIN A;  1ZC2 A;  3MR0 A;  1IYS A;  1IOU A;  3NJA A;  2W1T B;  2ZC5 B;  1S6R A;  1C3B A;  3MZE A;  4NXE A;  1KE4 A;  2WYX A;  3CG5 A;  2CMN A;  3DTM A;  2OWH A;  3C30 A;  3MFD A;  2VZW A;  1AXB A;  3BRM A;  2E8I A;  1QME A;  4E3L A;  2W3F A;  3A3D A;  2J8Y A;  2GJ3 A;  1TF1 A;  1WE4 A;  3BWL A;  1H8Y A;  3GTC A;  1TS0 A;  3MF0 A;  5HPI A;  3NHQ A;  2ZL1 B;  3MKE A;  1OPX A;  1CEF A;  3HLE A;  2H0Y A;  4S2I A;  1PYY A;  2IWD A;  5TGF A;  1W5D A;  4FOF A;  2D02 A;  4R3B A;  4KQO A;  2R9X A;  1I5Q A;  3IXD A;  2XSS A;  2ZL1 A;  4Y5F A;  2X01 A;  1LSW A;  3HL9 A;  1CI8 A;  3NOU C;  1LLB A;  1I2W A;  1DRM A;  1GA9 A;  4IHQ A;  3IF5 A;  1PZP A;  1CI9 A;  4P6Z S;  1ONG A;  1RGZ A;  1F98 A;  2HP5 A;  4BWI A;  1FR6 A;  4LCM A;  4EES A;  1K55 A;  5KSH A;  4OP5 A;  3L9K A;  3IS2 B;  5FDS A;  5EVI B;  5DF7 A;  4DMZ A;  3AGF A;  3FKV A;  1YAX A;  1HZO A;  1KVL A;  5EVE A;  1ONH A;  2Y4A A;  2ZJ9 A;  3QP6 A;  3V3R A;  2HP9 A;  1KGF A;  2H5S A;  5CEC A;  1BT5 A;  4G3W A;  2VGJ A;  5JYP A;  3VP4 A;  5HWV A;  4R38 A;  3A0V A;  2QPN A;  4II7 A;  1PI4 A;  3WS0 A;  3P01 A;  4DE2 A;  3VSK A;  3MZD A;  1ERQ A;  3IXG A;  4NXG A;  3JVU A;  2Z2M B;  3LR0 A;  3PXP A;  4IBX A;  1Z09 A;  1JVJ A;  5FQJ A;  3VFH A;  1K54 C;  1NLY A;  1WA9 A;  5KSC A;  4PAU A;  2ACG A;  5HD3 A;  1RGY A;  3BEB A;  1YLZ A;  4KZ6 A;  5CHM A;  3WS1 A;  3U4L P;  4JXV A;  4GKU A;  5TBM A;  2HGV A;  3VMA A;  1TDL A;  1A0K A;  1LSX A;  5EUA A;  2HP6 A;  5HSQ A;  3QP4 A;  4LGW A;  4E3J A;  3NIA A;  1ZHH B;  2OV5 A;  3M6B A;  4OPY A;  2J7V A;  3PHY A;  3EQU A;  3SS4 A;  5DJU A;  1U60 A;  4I3J A;  5CX7 A;  4OQI A;  4FTX A;  3D4F A;  4X1L A;  1DP9 A;  2OAP 1;  1K38 A;  3Q7V B;  5D3O A;  3W4O A;  4KZA A;  4MN5 A;  1TVF A;  3K3D A;  2XDM A;  3O88 A;  2VGL M;  3CIT A;  2VLG A;  4MLL A;  3VSL A;  4P6B A;  1CQA A;  3DTE A;  4KUO A;  1Q2P A;  1G5U A;  3T1X A;  1KOU A;  2OOL A;  3OPP A;  2IWB A;  2J9P A;  4B4X A;  4RA7 A;  1XX2 A;  4QHC A;  5EPH A;  2ZQA A;  1OTI A;  2WAF A;  3Q82 A;  4S2L A;  1S4S A;  4S2N A;  4XUZ A;  2PYR A;  4ZDX A;  3T4L A;  4R3J A;  4WZ4 A;  1GA0 A;  1TDG A;  5A93 A;  2V0U A;  2Y2Q A;  2FFF B;  3B47 A;  3HLB A;  3UB5 P;  2QMI A;  5FL3 A;  3ZNY A;  5DJT A;  3S1Y A;  1L0F A;  3DTK A;  4QU3 A;  4YOF A;  3L7H A;  2VV7 A;  1T1A A;  2QKP A;  4ZRR A;  1G6O A;  4IED A;  5HL6 A;  3T4O A;  3OOV A;  4S2O A;  1J9M A;  3MXQ A;  4JGP A;  3UN7 A;  5DKL A;  1PW1 A;  4BJP A;  3PBO A;  1ESI A;  4LFU A;  3ZVT A;  5CXW A;  3TOI A;  4M4X A;  3LI9 A;  1Y28 A;  1YSQ A;  4EXO A;  3BFD A;  4ID4 A;  1L2S A;  3Q1F A;  5DF8 A;  3LI8 A;  4K0W A;  4U0X A;  3UE3 A;  2WZZ A;  3CI6 A;  5CTM A;  4GJ4 A;  3ZDJ A;  4OPZ A;  3KSF A;  5IHV A;  1G28 A;  3DAV A;  3G4P A;  3MMH A;  1YMS A;  1W8Q A;  4OPR A;  4P85 A;  3ZVW A;  5EVI C;  4E3M A;  5HZH A;  4JGO A;  1DY6 A;  2B18 A;  3A0S A;  4BBT A;  4WMC D;  3GRJ A;  3BFC A;  3HJI A;  5EEC A;  3DTI A;  4K0X A;  3GMW A;  3G2Y A;  4I39 A;  4NXF A;  5KZH A;  1N9O A;  2QZ6 A;  3TG9 A;  5AQ7 A;  4Q0I A;  2XR0 A;  3ZG5 A;  2BTF P;  3IQA A;  3UMD A;  2V20 A;  3RFB A;  2Y2H A;  4LCL A;  1KGE A;  4ZJ2 A;  3ULF A;  3FZC A;  3IH8 A;  1W8Y A;  5TR7 A;  2M7U A;  1O7E A;  1S0W A;  5CEB A;  1K0K A;  5E43 A;  1KE3 A;  3IBR A;  1G68 A;  1JTD A;  1YT4 A;  1K25 A;  4OOM A;  1PWG A;  3HLW A;  4CLC C;  4NKP A;  3BJN A;  5G4Z A;  5E2G A;  4Y3I A;  4NXB A;  5A92 A;  4LRY C;  2FZ0 A;  1XJ2 A;  1YMX A;  3AGD A;  4HI4 A;  2B95 A;  5GLD A;  1NRJ A;  1XA7 A;  3SH7 A;  5CGX A;  1XGI A;  3R7W A;  2WKI A;  3LCE A;  4MBF A;  3BM6 A;  1DJC A;  2JKR I;  2JCH A;  3C7U A;  2XEP A;  4DDY A;  1YLT A;  4Y2F A;  2W3G A;  1PFL A;  1UWN X;  3TSG A;  1D7E A;  2ZC4 B;  2K7S A;  1IKI A;  1HLU P;  3LGO A;  3QP8 A;  4DF6 A;  2H0T A;  5J3W A;  3G30 A;  1Y4O A;  5M18 A;  4X53 A;  2R78 A;  1NRF A;  4F94 A;  1M40 A;  4DJ3 A;  1XJ4 A;  1IYQ A;  4JF6 A;  1SDE A;  2G7U A;  2XGN A;  5GHX A;  1LI9 A;  3EGX C;  4N92 A;  3G6O A;  1BLS A;  3ZG9 B;  1KDS A;  1T1B A;  5FQQ A;  3EQV A;  5HWW A;  5L8M A;  1X0O A;  4OLD A;  5AQA A;  3VOL A;  3D3O A;  3OPR A;  3BW6 A;  1XP4 A;  5LBR A;  4QY5 A;  1SDN A;  3B42 A;  3U2A A;  3BLM A;  2L0W A;  5GL9 A;  4O01 A;  3ZHH A;  2VK3 A;  4UHU A;  3IH9 A;  3MQO A;  3Q7Z A;  4JGR A;  2WKP A;  2Y59 A;  1FCM A;  1VB6 A;  4OON A;  1OTA A;  4Y0T A;  1BTL A;  4XXR A;  4JXG A;  4PKY A;  4PM7 A;  3LR3 A;  4ZTK A;  1BLC A;  1W63 M;  3OCL A;  3TE8 A;  3NOP C;  3ZYT A;  3MFX A;  2EX8 A;  2O9C A;  3PAE A;  3O86 A;  2V2F F;  2VJW A;  5DF9 A;  4WEL A;  3CUE A;  4UQI S;  5CGS A;  2JKG A;  2Y8H A;  5F69 A;  3C7V A;  4KG6 A;  4KZ3 A;  4LRZ E;  1CK3 A;  3CWF A;  1T18 A;  3BQA A;  4K91 A;  2EWW A;  4DN0 A;  1PNE A;  3E2L A;  1OTD A;  2JKF A;  4IVK A;  3UME A;  3CZD A;  4Y0O A;  4XUX A;  4EW7 A;  2EFX A;  2ZM2 A;  3WS2 A;  4HHD A;  2INW A;  4QY6 A;  4HP4 A;  1IYO A;  1K4F A;  1YPR A;  3N6I A;  4WEK A;  5L10 A;  1WYC A;  2JN7 A;  3F1N B;  3OLO A;  3W4Q A;  4BL3 A;  5GHY A;  4E04 A;  2Y79 A;  4BMW A;  3A3I A;  3G31 A;  1NZO A;  1ERM A;  2ZC3 B;  2PT7 A;  3C4P A;  4MEZ A;  2W3E A;  3S7N A;  4C6Y A;  1FSY A;  1NYM A;  2WKR A;  4B4Z A;  4L9G A;  1S1Y A;  1V9Y A;  3F1N A;  2R9W A;  3N7W A;  4BEN A;  5HPF A;  4OH0 A;  2B02 A;  3IX4 A;  1FQG A;  1K6S A;  3WRT A;  4EV4 A;  4D60 A;  3R4K A;  3WWX A;  2FFY A;  5GLA A;  2XA7 S;  4B9O A;  1YQS A;  1V9Z A;  3NDE A;  5IS1 A;  2O99 A;  5GHZ A;  1NWZ A;  4X6T A;  3M2K A;  4G3V A;  3O5Y A;  3MZF A;  3IF6 C;  5DFY A;  4LV2 A;  4DDS A;  3T1R A;  1T1C A;  2Y2M A;  5HWT A;  5AJG A;  2L4R A;  5AVE A;  3LY4 A;  1PW8 A;  4G3K A;  1BUE A;  1ODV A;  2M1C A;  1KDW A;  3N4I A;  2ZLY A;  4BL2 A;  2ZM8 A;  3P7N A;  2O0Y A;  1TEM A;  3OC2 A;  3PBS A;  4OOL A;  2W1R A;  3UDI A;  2V1B A;  2WGV A;  2Y2K A;  3CPT A;  3SH8 A;  4LV0 A;  1MWT A;  3KYE A;  5U47 A;  1VEU A;  3S4X A;  3MQQ A;  5FQK A;  1SCW A;  4PM9 A;  2HJ9 C;  4ZJ1 A;  2OWJ A;  1STZ A;  1K57 C;  3F1P A;  1Q2Q A;  2HJE A;  4ME4 A;  4R4R A;  4DE1 A;  2PRF A;  5TBM B;  2KLI A;  3LIE A;  3HUN A;  5CER A;  1MZU A;  3H7W B;  1W79 A;  3F1O A;  2HDS A;  3NBL A;  4FSF A;  2W3H A;  2Y2J A;  5HDD A;  4M3K A;  4GHI B;  1JNU A;  2UV0 E;  4WZ5 A;  3KO6 A;  3H82 B;  4GZB A;  2VEA A;  1H8M A;  2BLS A;  2W0N A;  1XGJ A;  4H6J A;  4R1G A;  3HLC A;  4MN7 A;  1IFQ A;  5FSR A;  2EX9 A;  3H7W A;  3LR4 A;  4RVA A;  1EW0 A;  4HH2 A;  5AVF A;  4B88 A;  5EV0 A;  4QJG A;  1BZA A;  4WUJ A;  1GHM A;  3ZQ5 A;  4GHI A;  5FQM A;  4ESP A;  3H82 A;  2XFT A;  3VP0 A;  1LSV A;  4YFM A;  3TJZ C;  2O9B A;  3PYP A;  3RJU A;  5FA7 A;  2XD5 A;  1N4O A;  3P98 A;  3HJK A;  1XXM A;  1ALQ A;  4KZB A;  3BFE A;  1NZU A;  3BYD A;  1SKF A;  1TD5 A;  1ZKJ A;  5FAO A;  3QP2 A;  4HES A;  1S67 L;  2XRO A;  1TS8 A;  3FC7 A;  3JYI A;  5FEG A;  3WS5 A;  1MWS A;  5TJJ A;  5G18 A;  4R0Q A;  5HAP A;  4WF0 A;  1HD8 A;  5DTT A;  4O0P A;  1DJA A;  1EWZ A;  2HDU A;  1P9R A;  2WUQ A;  4UQI M;  2PAV P;  5BOH A;  3HVF A;  1S4R A;  3CAX A;  1OT6 A;  5CHU A;  3TRC A;  4F3L A;  3ZFZ A;  5IU1 A;  5M1A A;  4EWF A;  1CF0 A;  3K3C A;  3VOZ A;  2H28 A;  3OBF A;  4E3I A;  3EOI A;  4CJN A;  3C38 A;  1OJG A;  3A3E A;  4EQI A;  4UAA A;  2ZBB A;  4ZJ3 A;  4KZ9 A;  1BSG A;  1OTE A;  1BYW A;  1W63 Q;  4FH2 A;  3ZNT A;  2GNX A;  4QPR A;  4UEY A;  4R6L A;  5A8B A;  2VGK A;  3B33 A;  4OLG A;  1P9W A;  3SW1 A;  3FYZ A;  5E2E A;  4NG2 A;  4E3K A;  4B93 A;  2EWV A;  4MBH A;  1IYP A;  3V50 A;  2ZC6 B;  3IBJ A;  2XRN A;  3VV4 A;  4Q0J A;  1F2K A;  5HDS A;  2WKH A;  5FAP A;  2C5W B;  1K55 C;  2DCF A;  1XPB A;  4DRT A;  4K08 A;  3M6H A;  3BY9 A;  1PI5 A;  1DP8 A;  1NJ4 A;  3MQ0 A;  4ZBE A;  5J4E A;  2A2L A;  4X56 A;  4KUK A;  1JWP A;  3BLS A;  3IXB A;  3QNB A;  2PR5 A;  3E0Y A;  3KYQ A;  1H5X A;  5HAI A;  4JF5 A;  4QD4 A;  1EI5 A;  2LB5 A;  2P7J A;  4I3I A;  3NDG A;  2HDQ A;  2MJ6 A;  2X71 A;  1GCE A;  4JXW A;  5AQ9 A;  2JKT I;  2B5R A;  2HF6 A;  4GS9 B;  4BBV A;  1HVB A;  2HPB A;  1PZO A;  4DKI A;  4HNB A;  3T4Q A;  5KIZ A;  1OTB A;  4C3Q A;  3UDX A;  2DMW A;  5IT5 A;  1JTG A;  2GDN A;  4N1X A;  4P6Z M;  2ZC7 A;  5I5L A;  3LEZ A;  4MN6 A;  4O7D A;  1OT9 A;  4P87 A;  2D01 A;  2PBD P;  4EUZ A;  3BFG A;  4GS9 A;  1G6A A;  1H0M A;  2VA0 A;  4JBF A;  2P9V A;  2JE5 A;  2W27 A;  1L0D A;  3HRE A;  3RXW A;  2Y2I A;  2G2U A;  1YLJ A;  3IX3 A;  4X25 A;  5FDH A;  1ES5 A;  4Q0H A;  4O8G A;  3R7W B;  2ZMV A;  3E4O A;  4PPR A;  1MPL A;  2I72 A;  2V8C A;  3OCN A;  1N9L A;  3GVB A;  1LT0 A;  3T4K A;  1RCJ A;  5DTS A;  1DJB A;  3MSH A;  3IWO A;  4MMN A;  2Y2P A;  4GDN A;  2K2N A;  4OQ0 A;  3QHY A;  3LEQ A;  3MJQ A;  2X02 A;  3UPP A;  1FR1 A;  3GQZ A;  3LUQ A;  2EXA A;  1YLP A;  4ETX A;  3OZH A;  2YKF A;  1PIO A;  5FAT A;  1SHV A;  1PRQ A;  3ISG A;  3LR5 A;  1I2S A;  4GD6 A;  4WLA A;  4LRX C;  4NET A;  3PBR A;  4S2N C;  1MWU A;  1UWP X;  4QWO A;  4GB7 A;  3UE6 A;  3C8C A;  5FI6 A;  2RCX A;  1OJ5 A;  3CHW P;  3MBZ A;  3EWK A;  4MBK A;  4EBL A;  2V8F A;  1XJ6 A;  4XT2 A;  3RTY A;  4JF4 A;  4CQH A;  3W2Z A;  3LID A;  1XFN A;  4BD1 A;  4WN5 A;  3OPL A;  4RQ9 A;  4OOY A;  4OP8 A;  1ERO A;  4OKP A;  4Y13 A;  2WGW A;  3W4P A;  4ARZ A;  2WKQ A;  3BQ8 A;  4PM6 A;  3WS4 A;  3G32 A;  5HX9 A;  2P04 A;  2Y2O A;  3H9W A;  4HH3 A;  1S66 L;  5EFW A;  3V5M A;  4GN2 A;  4S2K A;  3M2J A;  1CJF A;  1E3U A;  3NOT C;  2NUT C;  5F6A A;  2KDK A;  2H10 A;  4BBU A;  1SKO B;  1Z6F A;  4Y0U A;  1XFQ A;  4DE3 A;  4DXB A;  4WM9 A;  1N9N A;  5F82 A;  4GD8 A;  4L9E A;  4WBG A;  3B3X A;  1GSV A;  1YSP A;  1K54 A;  4NK3 A;  1SKO A;  3G34 A;  1PWC A;  2OAQ 1;  3T12 B;  5L2F A;  3S22 A;  2VGL S;  3NUL A;  3UPO A;  1AWI A;  3ICY A;  3LY3 A;  2PD7 A;  4E6W A;  3CJM A;  1YLY A;  2A3U A;  3DWZ A;  1FCN A;  2ZQD A;  5CED A;  1GHI A;  2Y2G A;  2WK0 A;  4GNU A;  4LLO B;  4BLM A;  2A24 B;  2V1A A;  1W7F A;  2QWS A;  1K6R A;  3G35 A;  1S1Z A;  1MBL A;  3LO7 A;  3HUM A;  4JXS A;  3ZG7 B;  2K31 A;  4X55 A;  4OPQ A;  2XH9 A;  3UPN A;  4A5R A;  1L3L A;  4PM8 A;  1ES4 A;  3UY6 A;  1MC0 A;  2A24 A;  3VE3 A;  5HL1 A;  3V39 A;  4S2P A;  2PD8 A;  1P97 A;  3MXR A;  4L9F A;  3PAG A;  1H3Q A;  2E8J A;  1VM1 A;  2PBY A;  5HAQ A;  3LIB A;  4EBP A;  2PYP A;  4MNR A;  4IUH A;  3BEC A;  4PKY G;  1LL5 A;  2BG1 A;  4R23 A;  3T4S A;  2PDR A;  3PBQ A;  1LHY A;  4JPM A;  1ZG4 A;  4S2M A;  2V9A A;  2ZQ9 A;  2GZA A;  1YKD A;  3HLG A;  3S7Q A;  1H8Z A;  2W1T A;  2ZOI A;  1ESU A;  3KYZ A;  2JKR M;  4Z1W A;  4HIA A;  3NI9 A;  3CPT B;  1F9I A;  4L0L A;  1BUL A;  2ZQ8 A;  2XLN A;  1VEU B;  2DRW A;  2EA9 A;  1JWV A;  3VE4 A;  3EGD C;  3IWQ A;  2OSU A;  3GR2 A;  2PU4 A;  2LB9 A;  1VQQ A;  1FOF A;  3F1P B;  3GV9 A;  4EEU A;  5F1F A;  2JHE A;  2Y2N A;  3K2N A;  1ES3 A;  1O07 A;  2BAS A;  3WRZ A;  3UB6 A;  3JPU A;  4HJ6 A;  4Y7P A;  2Z6C A;  3UB8 A;  3F1O B;  3SS5 A;  5EM0 A;  4EET B;  3UB9 A;  1K56 A;  1KVM A;  3E4P A;  4FH4 A;  3VP1 A;  1RP5 A;  4GW9 A;  3LFV A;  3E4Q A;  4HJ4 A;  2Y2L A;  4HQA A;  4H6J B;  3KSG A;  5TFQ A;  4OQG A;  1QMF A;  1MKM A;  3D72 A;  3LIC A;  1KGG A;  3EEA A;  3LIA A;  2J3T C;  5FI7 A;  3IS2 A;  1FCO A;  5EVI A;  5EVL A;  4KZ8 A;  4OVD A;  4AFI A;  1D1J A;  4EU0 A;  2P74 A;  3PBT A;  1MY8 A;  2ZQ7 A;  4KQR A;  2C6W B;  2A49 A;  3IT9 A;  4FCF A;  3CUE C;  5G4Y A;  3GEC A;  4PM5 A;  5AQB A;  4CLC B;  4FUW A;  4IJG A;  3IHA A;  4I3A A;  4I38 A;  2J3W A;  4E3O A;  4BQM A;  3E2K A;  1ES2 A;  3PBN A;  4Y15 A;  2ZD8 A;  1L0G A;  4GOG A;  1FIL A;  2YKH A;  4HBU A;  2IA2 A;  5L09 A;  3O87 A;  5E2F A;  4CLC A;  4EQ1 A;  3N8R A;  5F68 A;  4LPZ A;  2RL3 A;  2VKS A;  4IBR A;  1IEM A;  2EFU A;  4MCW A;  3KSI A;  4DE0 A;  3HCY A;  2DNS A;  2OLU A;  3ZCZ A;  4F3L B;  4D2O A;  3DBA A;  4LEN A;  2QYB A;  2ZQC A;  4RYE A;  4RX2 A;  1ZG6 A;  4YWZ A;  2J9O A;  4ETZ A;  5FQ9 A;  3RXX A;  4BD0 A;  2PR6 A;  4HEF A;  3T1S A;  2WZX A;  5J8X A;  2OLV A;  2VX8 A;  5CGW A;  1N9B A;  3A3J A;  5HW3 A;  1YLW A;  3Q7V A;  4HBT A;  5FI2 A;  3VP3 A;  2IWC A;  4UA7 A;  4U3T A;  3GSG A;  1GSX A;  3AGE A;  3CLO A;  5F83 A;  1BLH A;  3T4T A;  2XD1 A;  2VV8 A;  4Y17 A;  4UA9 A;  3IWI A;  3SOI A; 
#chains in the Genus database with same CATH homology
 5JYP A;  4KG6 A;  4KZ3 A;  3VP4 A;  2Y2P A;  1CK3 A;  4KG2 A;  3VOY A;  4GDN A;  2QPN A;  3HUO A;  4K91 A;  1PI4 A;  4OQ0 A;  4UA6 A;  3WS0 A;  3V3S A;  4DE2 A;  3E2L A;  3QHY A;  3VSK A;  1E3U D;  5A90 A;  3P09 A;  2X02 A;  3UDF A;  3UPP A;  2JBF A;  4IVK A;  3UNW A;  3MZD A;  1ERQ A;  1FR1 A;  3GQZ A;  3IXG A;  3FWL A;  2EXA A;  3CZD A;  4Y0O A;  1YLP A;  2EXB A;  4XUX A;  5CHJ A;  2Z2M B;  4IBX A;  1JVJ A;  3OZH A;  2EFX A;  2ZM2 A;  3MKF A;  5FQJ A;  3WS2 A;  1PIO A;  3VFH A;  4QY6 A;  2Y55 A;  5FAT A;  1SHV A;  3ISG A;  1IYO A;  1OME A;  1K54 C;  5KSC A;  1K4F A;  1I2S A;  3N6I A;  4GD6 A;  4WEK A;  1WYC A;  4NET A;  3W4Q A;  1MKI A;  4BL3 A;  1NXY A;  1RGY A;  2CC1 A;  1E25 A;  3C4O A;  5GHY A;  3PBR A;  3BEB A;  1YLZ A;  4S2N C;  4KZ6 A;  1MWU A;  1Y54 A;  5CHM A;  3WS1 A;  4JXV A;  4GDB A;  4GKU A;  4GB7 A;  3A3I A;  3HBR A;  3G31 A;  5HAR A;  5FI6 A;  2WAE A;  5CTN A;  3VMA A;  1TDL A;  1NZO A;  5EUA A;  1ERM A;  2HP6 A;  2RCX A;  4KG5 A;  3MBZ A;  5GLC A;  4MBK A;  2ZC3 B;  4PMA A;  3C4P A;  4EBL A;  3A3F A;  4MEZ A;  4C6Y A;  1FSY A;  1NYM A;  4JF4 A;  4E3J A;  4B4Z A;  5CRF A;  3NIA A;  4BD1 A;  3OPL A;  2JC7 A;  4OOY A;  2OV5 A;  4OP8 A;  2R9W A;  3N7W A;  4BEN A;  3M6B A;  1ERO A;  4OPY A;  2J7V A;  4OH0 A;  3Q07 A;  4OKP A;  3EQU A;  4RX3 A;  5FAS A;  3SS4 A;  1FQG A;  2P9V B;  1K6S A;  3WRT A;  4EV4 A;  2WGW A;  1U60 A;  3W4P A;  3WWX A;  1NY0 A;  2FFY A;  2Q9M A;  1JWZ A;  4LV1 A;  4OQI A;  4WZ5 C;  5GLA A;  3Q81 A;  3D4F A;  1YQS A;  4JLF A;  3DW0 A;  4PM6 A;  3C5A A;  3NDE A;  3WS4 A;  3G32 A;  5GHZ A;  5F1G A;  5HX9 A;  2Y2O A;  4KZ7 A;  4X6T A;  1K38 A;  3Q7V B;  3M2K A;  3V5M A;  4GN2 A;  2EX6 A;  4S2K A;  3M2J A;  5D3O A;  2WGI A;  1E3U A;  4KEN B;  3W4O A;  5JYO A;  3MZF A;  4KZA A;  3IF6 C;  1TVF A;  1WYB A;  4LV2 A;  2XDM A;  4DDS A;  2H10 A;  3O88 A;  4N1H A;  4S2J A;  1Z6F A;  2Y2M A;  5EE8 A;  4Y0U A;  4DE3 A;  3QNC A;  4MLL A;  3LY4 A;  3O3V A;  3VSL A;  4P6B A;  1PW8 A;  4QB8 A;  5FAQ A;  2XK1 A;  1Q2P A;  4DXB A;  4WM9 A;  1BUE A;  5F82 A;  3ITB A;  1KDW A;  3N4I A;  2ZLY A;  4GD8 A;  4BL2 A;  4WBG A;  2ZM8 A;  1HTZ A;  3B3X A;  3OPP A;  1TEM A;  1K4E A;  2IWB A;  2J9P A;  3OC2 A;  3PBS A;  4OOL A;  1L0E A;  4B4X A;  3UDI A;  4RA7 A;  5DTK A;  4KZ4 A;  5KMW A;  3NY4 A;  2WGV A;  2Y2K A;  1XX2 A;  4QHC A;  1K54 A;  3SH8 A;  4LV0 A;  4NK3 A;  5EPH A;  1MWT A;  2ZQA A;  5U47 A;  5FQI A;  3G34 A;  2WAF A;  3Q82 A;  4S2L A;  3S4X A;  1PWC A;  5FQK A;  1LL9 A;  4S2N A;  1SCW A;  4XUZ A;  5L2F A;  3S22 A;  4ZDX A;  4PM9 A;  3W8K A;  3UPO A;  1FSW A;  4ZJ1 A;  5I94 A;  3LY3 A;  4R3J A;  4E6W A;  4OQH A;  1CEG A;  3CJM A;  4WZ4 A;  1GA0 A;  1K57 C;  1YLY A;  1TDG A;  2A3U A;  3DWZ A;  1Q2Q A;  5A93 A;  4DE1 A;  2Y2Q A;  2FFF B;  3HLB A;  1FCN A;  2ZQD A;  4R4S A;  4R4R A;  5CED A;  2V1Z A;  3HLD A;  1GHI A;  2QMI A;  2XF3 A;  3ZGA B;  2Q9N A;  4H8R A;  2Y2G A;  4LV3 A;  3ZNY A;  3S1Y A;  2WK0 A;  1L0F A;  4GNU A;  4BLM A;  4QU3 A;  3HUN A;  3IF6 B;  1W7F A;  4X69 A;  5CER A;  4JKT A;  1W79 A;  2HDS A;  3VP2 A;  3NBL A;  2Y91 A;  4FSF A;  2Y2J A;  1K6R A;  4M3K A;  3G35 A;  5EOE A;  4IED A;  4WZ5 A;  1MBL A;  4S2O A;  3LO7 A;  1J9M A;  3HUM A;  1LI0 A;  4GZB A;  4JXS A;  3UO9 A;  3ZG7 B;  3DWK A;  3UN7 A;  5E2H A;  1PW1 A;  4X55 A;  4C75 A;  4BJP A;  3PBO A;  4E6X A;  2BLS A;  2XH9 A;  4N9L A;  1GHP A;  4OPQ A;  3UPN A;  4PM8 A;  4A5R A;  1ESI A;  2WGW B;  4KQQ A;  1ES4 A;  1XGJ A;  3ZVT A;  4N9K A;  3UY6 A;  5CXW A;  3TOI A;  4R1G A;  5HL1 A;  3HLC A;  3IF6 A;  3V39 A;  5FSR A;  4S2P A;  2EX9 A;  3BFD A;  4ID4 A;  1L2S A;  5DVA A;  3MXR A;  4RVA A;  3Q1F A;  3PAG A;  1VM1 A;  5DF8 A;  4K0W A;  2PBY A;  4U0X A;  3UE3 A;  4B88 A;  2WZZ A;  4QJG A;  1BZA A;  1MWR A;  1GHM A;  5HAQ A;  4U0T A;  4EBP A;  5FQM A;  4MNR A;  4WEJ A;  1BLP A;  1K56 D;  3BEC A;  2XFT A;  3VP0 A;  3UE0 A;  3UE1 A;  5CTM A;  1LL5 A;  2BG1 A;  4ZAM A;  4YFM A;  4R23 A;  3ZDJ A;  4OPZ A;  1E4D A;  5IHV A;  4WYY A;  3SOI A;  1MXO A;  3N8L A;  3RJU A;  5FA7 A;  3G4P A;  2XD5 A;  1N4O A;  3PBQ A;  1LHY A;  1YMS A;  1W8Q A;  1ZG4 A;  4JPM A;  4OPR A;  3PTE A;  4P85 A;  4S2M A;  5EVI C;  3ZVW A;  3P98 A;  4E3M A;  1DY6 A;  4EBN A;  1XXM A;  2ZQ9 A;  1ALQ A;  4WMC D;  3GRJ A;  4KZB A;  5A91 A;  3BFE A;  3BFC A;  3HLG A;  1NZU A;  3BYD A;  1SKF A;  1H8Z A;  5EEC A;  5M19 A;  3MXS A;  4FD8 A;  2WAD A;  1ZKJ A;  1ESU A;  4K0X A;  2XQZ A;  3GMW A;  3G2Y A;  5FAO A;  5EVI D;  3NC8 A;  4HES A;  2XFS A;  5KZH A;  3NI9 A;  2QZ6 A;  3TG9 A;  3JYI A;  4L0L A;  1BUL A;  1MWS A;  3WS5 A;  2ZQ8 A;  4IVI A;  5AQ7 A;  5G18 A;  1K57 A;  4R0Q A;  5HAP A;  2XLN A;  2XR0 A;  2DRW A;  3ZG5 A;  3ZG8 B;  1HD8 A;  2UWX A;  3IQA A;  5DTT A;  1DJA A;  1EWZ A;  2HDU A;  1JWV A;  2V20 A;  3IXH A;  3IWQ A;  2OSU A;  2Y2H A;  3GR2 A;  4LCL A;  1KGE A;  2PU4 A;  4ZJ2 A;  3FZC A;  3IH8 A;  2WUQ A;  1VQQ A;  1FOF A;  3FKW A;  5EOO A;  1W8Y A;  5TR7 A;  1O7E A;  3GV9 A;  5F1F A;  1S0W A;  2ZMA A;  5CEB A;  4CPK A;  5BOH A;  2Y2N A;  5E43 A;  1ES3 A;  1O07 A;  3HVF A;  1YM1 A;  1KE3 A;  3WRZ A;  1G68 A;  1JTD A;  1YT4 A;  3ZG0 A;  1K25 A;  3FV7 A;  5CHU A;  4OOM A;  3N8S A;  3SH9 A;  1PWG A;  3HLW A;  3ZFZ A;  4Y7P A;  5M1A A;  4Z9Q A;  3G2Z A;  4EWF A;  4P0M A;  3VOZ A;  3BFF A;  4E3I A;  3SS5 A;  5HFO A;  5E2G A;  2WKE A;  1IEL A;  4CJN A;  1K56 A;  1KVM A;  3A3E A;  4EQI A;  4UAA A;  4E3N A;  4FH4 A;  4ZJ3 A;  4KZ9 A;  3VP1 A;  1BSG A;  5A92 A;  1RP5 A;  4FH2 A;  2PU2 A;  3ZNT A;  1YMX A;  3AGD A;  2Y2L A;  1PWD A;  2VGK A;  5GLD A;  4OLG A;  5TFQ A;  4OQG A;  1XA7 A;  3FYZ A;  3SS3 A;  2EX2 A;  5E2E A;  3SH7 A;  5CGX A;  1QMF A;  1XGI A;  4WMC A;  4E3K A;  4Q8I A;  1KGG A;  1NYY A;  3NCK A;  1M6K A;  5GLB A;  4X68 A;  2WKI A;  3LCE A;  4MBH A;  5FI7 A;  4KZ5 A;  1IYP A;  1IKG A;  4MBF A;  3V50 A;  3BM6 A;  2ZC6 B;  1DJC A;  1FCO A;  5EVI A;  5EVL A;  3VFF A;  2JCH A;  2G2W A;  3C7U A;  3ITA A;  2XEP A;  4DDY A;  4KZ8 A;  3CMZ A;  1XKZ A;  2ZM0 A;  3I7J A;  1YLT A;  2WKH A;  3HLF A;  4OVD A;  5FAP A;  3TSG A;  2HDR A;  2C5W B;  2ZC4 B;  1K55 C;  2DCF A;  1XPB A;  1IKI A;  2P74 A;  3IHB A;  3PBT A;  4DXC A;  1MY8 A;  2Z2L B;  1XA1 A;  4DRT A;  2ZQ7 A;  3M6H A;  4KQR A;  1PI5 A;  1KE0 A;  3OPH A;  4DF6 A;  2C6W B;  4YIN A;  1ZC2 A;  2H0T A;  1NJ4 A;  3G30 A;  5M18 A;  2A49 A;  4ZBE A;  4X53 A;  3IT9 A;  4FCF A;  1IYS A;  1NRF A;  4PM5 A;  4F94 A;  1M40 A;  5AQB A;  4X56 A;  2ZC5 B;  1S6R A;  1C3B A;  1IYQ A;  3IHA A;  4JF6 A;  3MZE A;  1KE4 A;  2WYX A;  1JWP A;  1SDE A;  3CG5 A;  3DTM A;  2XGN A;  3BLS A;  3IXB A;  3QNB A;  5GHX A;  4BQM A;  4E3O A;  3E2K A;  1LI9 A;  1H5X A;  3MFD A;  5HAI A;  1ES2 A;  1AXB A;  3BRM A;  2E8I A;  1QME A;  4N92 A;  4E3L A;  4JF5 A;  4QD4 A;  1EI5 A;  3NDG A;  3A3D A;  2J8Y A;  3PBN A;  2HDQ A;  1BLS A;  2ZD8 A;  3ZG9 B;  1L0G A;  1KDS A;  4GOG A;  5FQQ A;  2X71 A;  1GCE A;  3EQV A;  4JXW A;  5AQ9 A;  1WE4 A;  4HBU A;  1H8Y A;  2B5R A;  3GTC A;  1HVB A;  2HPB A;  3O87 A;  5E2F A;  1PZO A;  4OLD A;  4DKI A;  5AQA A;  3N8R A;  3OPR A;  4C3Q A;  3UDX A;  1XP4 A;  1JTG A;  2GDN A;  3MKE A;  4N1X A;  3HLE A;  1CEF A;  2RL3 A;  2H0Y A;  4IBR A;  1IEM A;  2EFU A;  4QY5 A;  2ZC7 A;  1SDN A;  3LEZ A;  4DE0 A;  4O7D A;  2DNS A;  2OLU A;  4S2I A;  3ZCZ A;  1PYY A;  4D2O A;  3BLM A;  5GL9 A;  4P87 A;  3ZHH A;  2IWD A;  5TGF A;  1W5D A;  4UHU A;  4LEN A;  3IH9 A;  4EUZ A;  3Q7Z A;  3BFG A;  4R3B A;  4KQO A;  1G6A A;  2R9X A;  2Y59 A;  1FCM A;  4OON A;  2ZQC A;  1I5Q A;  4RYE A;  4RX2 A;  3IXD A;  1ZG6 A;  2X01 A;  4Y0T A;  1BTL A;  2J9O A;  4JBF A;  4XXR A;  2P9V A;  2JE5 A;  3HL9 A;  1CI8 A;  1L0D A;  4JXG A;  4PM7 A;  3HRE A;  4ZTK A;  5FQ9 A;  1LLB A;  1I2W A;  1GA9 A;  3RXX A;  3RXW A;  4BD0 A;  2Y2I A;  1BLC A;  2G2U A;  4HEF A;  1YLJ A;  3IF5 A;  1PZP A;  3OCL A;  2WZX A;  5FDH A;  1ES5 A;  1CI9 A;  5J8X A;  1ONG A;  1RGZ A;  4PPR A;  2HP5 A;  2OLV A;  1MPL A;  1FR6 A;  5CGW A;  1N9B A;  2EX8 A;  3A3J A;  1YLW A;  3Q7V A;  4HBT A;  4LCM A;  5HW3 A;  1K55 A;  5KSH A;  4OP5 A;  5FI2 A;  3VP3 A;  2I72 A;  2IWC A;  3PAE A;  3O86 A;  3OCN A;  4UA7 A;  4U3T A;  5EVI B;  3GVB A;  5DF7 A;  3GSG A;  2V2F F;  3AGF A;  3FKV A;  5DF9 A;  3AGE A;  1HZO A;  1KVL A;  4WEL A;  1ONH A;  2Y4A A;  2ZJ9 A;  5F83 A;  1BLH A;  1RCJ A;  5CGS A;  5DTS A;  2XD1 A;  3V3R A;  2HP9 A;  1KGF A;  1DJB A;  2H5S A;  4UA9 A;  1BT5 A;  5CEC A;  2VGJ A;  3IWI A;  3IWO A;  3C7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...