1W63Q

Ap1 clathrin adaptor core
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
148
structure length
148
Chain Sequence
MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADAPTER-RELATED PROTEIN COMPLEX 1 GAMMA 1 SUBUNIT
publication title Crystal Structure of the Clathrin Adaptor Protein 1 Core
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 45
structure length 148
sequence length 148
chains with identical sequence S, T, U, W, X
ec nomenclature
pdb deposition date 2004-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1w63Q00
4UQIS 1NRJA 2FH5A 2JKTI 1W63M 5MC7A 3TJZC 2JKRI 4P6ZM 2XA7M 2JKTM 2HF6A 4NEED 2XA7S 4P6ZS 2VGLM 1W63Q 2JKRM 2VGLS 4UQIM
chains in the Genus database with same CATH superfamily
5L8MA 1I2SA 2MJ6A 5DF9A 2W3FA 4F3LB 4ZDXA 1E25A 2W3GA 3CWFA 3TJZC 3G32A 1FCMA 3HJKA 1SDNA 3PBOA 4IVKA 1OTAA 2Q9MA 3M6BA 3E0YA 5HAPA 4GNUA 4JXGA 1K4EA 5DFXA 4HJ4A 2Q9NA 5F69A 1JNUA 3IQAA 2WKQA 4MN7A 4DJ3A 4IHQA 3VOYA 1P9RA 1ZG6A 3MS6A 1P0ZA 2H10A 2XA7M 4PKYG 1SKOB 1ONGA 4OKPA 1Y4OA 4MNRA 5K5BA 5GLCA 5HDSA 1PW8A 4D60A 4EEPA 3AGDA 3HL9A 4S2NA 4U0TA 1MKMA 5HZHA 4DN0A 2INWA 1BSGA 3ICYA 1CI9A 3IX3A 1TDLA 3UPPA 4DE1A 3FV7A 3HLFA 3DTIA 1TS6A 4WMCA 2HDQA 1UGUA 3MQOA 2OV5A 2A49A 2XROA 4DE3A 1YLYA 4X68A 3IXGA 3HLBA 4EBNA 1I2WA 3MFXA 1FIKA 1MWSA 5EVIC 5HL6A 3QP4A 3SOIA 4GDNA 4U3TA 4X25A 5DJTA 2HGVA 1OPXA 5CTMA 2JN7A 1LL9A 1XJ2A 1GA9A 5DFYA 2IWDA 4F3LA 5CTNA 1PFLA 2ZC7A 5AQ9A 4OP5A 4EW7A 4BD0A 3ZFZA 2JBFA 3L9KA 2UV0E 1O7EA 4FH4A 3FWLA 1F2KA 5U47A 4RX3A 4ZTKA 2V9AA 3C7UA 3PTEA 3WRZA 2D01A 3E4OA 2IWBA 1KE3A 5CGWA 1G6OA 2G2UA 1SKFA 1PYYA 3B47A 1SKOA 5EE8A 3PR6A 1CK3A 2XEPA 1T18A 3SS5A 2W27A 1K56D 3PBTA 2VGKA 4XUXA 4PAUA 1XKZA 3HCYA 1GSXA 3SH9A 1VQQA 3O3VA 3LCEA 2WGWB 3MKEA 3RH8B 1V9ZA 3V3RA 3KSFA 3BWLA 2P74A 4OH0A 3NECA 4OP8A 3LO7A 2Y2PA 4KZ3A 4IUKA 3UB8A 4HESA 3Q82A 3ZVWA 1P97A 2XGNA 4EQ1A 2VGJA 2J80A 4S2OA 3FPVA 2G7UA 5G4ZA 2W3EA 3IX4A 4ESPA 2LB9A 2KOIA 5FA7A 3OPRA 3TE8A 4NXFA 4E3NA 5F1GA 4DF6A 5M19A 1PW1A 5L2FA 3UMEA 5AQBA 4ZJ3A 4PPRA 4GJ4A 1S4SA 2Y2GA 3H9WA 3T4KA 3N8LA 3C5AA 2OLVA 3AGEA 1CI8A 2XF3A 2PBDP 4Q0HA 4KQOA 3TSGA 3C4OA 5HPFA 4JF6A 3KSIA 3E2LA 3F1PB 2ZL1B 3CLOA 1LL8A 3IBJA 1V9YA 2ZC4B 3WWXA 1ODVA 4E3OA 1PZPA 3VP1A 5EPHA 2XSSA 2W1TB 1OJGA 2VV8A 3N8SA 3TW8A 3OPHA 5CRFA 1OTBA 3H82B 4X56A 3E2KA 1GCEA 1E3UD 4JKTA 4X6TA 1FCNA 3ZVTA 2RL3A 4ARZA 4B4ZA 1GSVA 1BYWA 1ERMA 2WGWA 4OLDA 1MKIA 3WS5A 4HBUA 2QKPA 2JKRI 3S7PA 3MSHA 1PWCA 4HH3A 2ZQDA 2WAEA 1PNEA 4OPRA 2V0WA 1N9NA 2XFTA 1BUEA 1W79A 3PBRA 4Z9QA 5DVAA 4E04A 3G2ZA 4BBTA 4EU0A 4QPRA 1PI5A 3S1YA 2HJEA 1H0MA 3UY6A 3UDXA 3LI8A 2GZAA 2Y2IA 1WYBA 4H8RA 5EVIB 2Y2MA 2HDRA 4MMNA 1BLCA 4JPMA 4KG2A 4GCZA 5TFQA 2NUPC 3G2YA 1VETB 1L2SA 4MCWA 2PU2A 5FASA 2EFUA 1H8YA 3VP4A 3PBQA 3G6OA 2JKTM 2GX5A 3F1PA 3KYZA 4EUZA 1S4RA 2XDMA 2YKFA 3RXWA 3LR0A 1P9WA 3ZG8B 4JGRA 2ZQCA 3SH8A 2IWCA 1T1AA 4NXEA 5DTSA 4GDBA 4R70A 5DF7A 3QP1A 4OQIA 1PWDA 4DRTA 3T4LA 1RGZA 4P6ZS 2W1TA 1YAXA 4KENB 5EV0A 3MBZA 3BLSA 1W7FA 3NOUC 5FSRA 1XJ4A 1K25A 1K6SA 1GHPA 4N1HA 3C7VA 5EECA 5HD3A 5FDSA 4FH2A 2YKHA 1K38A 4R3AA 2WKIA 5IS1A 3VSLA 4WM9A 5TR7A 5HAQA 1NWZA 3FC7A 4LENA 4B9OA 4Q0IA 3VFFA 4DE2A 2OWJA 3A0SA 1EI5A 4QY6A 4NG2A 1KE0A 4LRYC 3NBLA 5G18A 2DRWA 4R4SA 1CEGA 5EVIA 2GJ3A 5CHJA 3HLWA 2V2FF 4UA6A 3HVFA 5FQ9A 4ME4A 2H0TA 4I5SA 1VETA 2Y2HA 3BRMA 5FI7A 3NOPC 1BLHA 3C30A 1YSPA 2W0NA 1T19A 2WKPA 3S22A 2Y2JA 1DY6A 2EX2A 4OVDA 1ZHHB 1DRMA 2C6WB 1M40A 4EXOA 3GTCA 4EV4A 2ZBBA 4HP4A 3V5MA 2NUTC 4CLCD 2VEAA 4E6XA 2Y59A 3U2AA 1K54C 2B5RA 4QHCA 1LLBA 3R7WA 4BWIA 4IUHA 3K3DA 4BL2A 2X71A 4DMZA 5HDCA 3A3DA 3GV9A 4FTXA 4LLOB 4BJPA 3BY9A 3G35A 4Y0OA 3NOTC 3OBFA 3HBRA 1KVLA 5IHVA 4GW9A 1GSWA 3BJNA 3C8CA 1T1CA 5CERA 2M7UA 5GHZA 4PKYA 3NDGA 5EOOA 2A24B 4QB8A 3GDIA 4CLCA 4DE0A 1I5QA 3BY8A 5LBRA 4P87A 3G31A 1LT0A 2R78A 5FEGA 2ZC3B 3EGDC 1VB6A 3A3JA 2KLIA 3IWQA 1Y28A 3BFFA 3C4PA 4JGQA 4E3LA 1FQGA 4RYEA 4EWFA 4OPQA 5L09A 4ID4A 3VFHA 4N92A 2Y2OA 4R1GA 3LICA 4X55A 5J4EA 5HWVA 5A92A 3CHWP 1JVJA 4O8GA 3KSGA 2ZC6B 3ZYTA 1MXOA 4I39A 2XK1A 4OPYA 3T1RA 3CAXA 5F6AA 4GHIB 5F1FA 1YT4A 4UQIS 5TJJA 3OZHA 3LIBA 2J9OA 4DXBA 1LSVA 2PDRA 3UDIA 4RX2A 1HZOA 1YPRA 4WBGA 3W4QA 1PZOA 5D3OA 1HTZA 3VOLA 3O5YA 4Y0TA 5FQJA 1TS8A 2HPBA 4Y3IA 3UE6A 4KZBA 3OLOA 5GHYA 4MBHA 4WZ5A 4ETZA 1ONHA 5L07A 3N4IA 2HJ9C 2OLUA 5CGSA 3LR5A 3BQAA 5AVEA 3T4QA 1XPBA 3QP5A 3ZDJA 3D72A 4R3BA 5CHUA 3NULA 3FG8A 1TEMA 2Y79A 5TGFA 2PBYA 3NDEA 4DDSA 2WGIA 2EXBA 5KZHA 1IYSA 2A24A 1W8QA 3SZTA 2PT7A 3RXXA 1YKDA 1DJBA 5C5KA 3ZCZA 1GHIA 4EBLA 2XQZA 5EM1A 3V3SA 4LV1A 3NJAA 1YLZA 3B42A 2Y55A 4LV0A 3F1NB 3K2NA 1ES3A 1YM1A 2L4RA 3O87A 5DTTA 1IKGA 3PXPA 2PRFA 1S1YA 3SH7A 4K08A 2OAP1 1S0WA 2EWWA 2P08A 5A8BA 1XGJA 3CPTB 3LR3A 3M2JA 1KGEA 2R9WA 3MR0A 2H28A 4GHIA 2QYBA 2I9VA 1BLSA 3BM6A 3A3FA 5DKLA 2V20A 1RGYA 3VOZA 4ARZB 3EEAA 1KOUA 4ETXA 2JKRM 3UE1A 3RJUA 4Z1WA 4JGPA 4N9LA 2CMNA 2O0YA 1IYPA 3BEBA 2XH9A 3HLCA 4MBFA 3C2WA 2A3UA 3BFEA 3NC8A 3IF5A 4FCFA 3QNBA 4Y13A 4MDZA 4UA7A 1OTDA 2J9PA 4OQGA 2JE5A 4B88A 1JWZA 2Y2QA 2J8YA 2J3WA 4CLCC 3T1XA 4H6JB 1ES5A 4JXSA 3CI6A 4D2OA 2FH5A 4X69A 1G5UA 4KQRA 2ZD8A 5FI6A 4P6ZM 2PU4A 1EW0A 3FKVA 3V67A 2BLSA 2O9AA 3BQ8A 1OMEA 1PWGA 1K56A 1L3LA 1STZA 3P98A 3IBRA 5FL3A 3NHQA 4KG5A 3E4PA 3A3IA 3HLGA 1NLZA 5EOEA 3K3CA 3KYQA 3SW1A 1ES4A 3PAEA 4BMWA 3OC2A 1DJCA 4X1LA 4HNBA 5JYPA 4Y0UA 2V1ZA 3F1NA 2M1CA 3MXQA 4UAAA 1IYQA 4HEFA 4EESA 4A5RA 3VE3A 3ZG5A 1HD8A 3Q7ZA 4FSFA 2Y2NA 2B02A 4FD8A 1L0GA 2V1BA 2V8FA 2VK3A 1NLYA 1XFNA 1XJ6A 4Y7PA 1FR6A 2P7JA 3OPPA 1K55C 1XGIA 3CPTA 5FAQA 2JKFA 4I38A 4Y2FA 3PAGA 4MBKA 4E3MA 4LPZA 2PAVP 1U60A 5HWTA 4PM5A 1X0OA 4BLMA 1NY0A 5I5LA 1K54A 1C3BA 5KMWA 3IHAA 5FEFA 2ZOIA 3H7WB 3NIAA 4KZAA 4WZ5C 3E4QA 3TRCA 1FSYA 2A2LA 4OQHA 2ZMAA 3IF6C 2QJ5A 4FOFA 4ZJ1A 2VKSA 1KDSA 2XD1A 3DW0A 2WK0A 3MZFA 5HFOA 2BTFP 3TG9A 1Q2PA 4LRXC 4M3KA 2B18A 4ZRRA 3UE3A 4H6JA 2K7SA 3QNCA 5JYOA 3KX0X 5KSCA 2QWSA 2VLGA 2JCHA 3UB6A 1PRQA 5CGXA 4S2IA 3DTKA 2E8JA 1OTEA 1E3UA 2P9VB 3DAVA 1H5XA 1WE4A 3A3EA 3D9YA 3KYEA 2GNXA 3BW6A 3VSKA 2ZMFA 2HP6A 3GRJA 3UDFA 2ZM0A 3AGFA 3HUNA 2ZM8A 2ZQAA 3IXBA 2ACGA 4DKIA 2X02A 4HY8A 2OSUA 3NI9A 2FZ0A 3GSGA 3MFDA 2ZQ9A 2PR6A 4Y17A 4QWOA 1N4OA 5F5YA 3T1SA 2O99A 2OWHA 1W5DA 1IEMA 5F82A 5GLBA 2VZWA 4BL3A 4WELA 3LGOA 4GS9B 1L0DA 2WKHA 3R7WB 5FQIA 3IXHA 4HOIA 5FQQA 3BFGA 1W63M 4Y15A 4EQIA 5CEBA 3H7WA 1FSWA 3ITBA 4E3JA 1NXYA 4L9EA 1HLUP 4P6BA 2XRNA 3DWZA 3T4OA 3IH9A 1TS0A 4MN5A 5M1AA 5E43A 3LUQA 4EBPA 3M6HA 3RFBA 3W4OA 1EWZA 4WN5A 5FDHA 4C3QA 3G30A 1KE4A 4JLFA 4RQ9A 3S7NA 4CLCB 1FILA 2VGLS 1CJFA 2BG1A 2VV6A 3PHYA 4HI4A 2P9VA 3O86A 3B33A 3CUEC 4GOGA 5M18A 1UWPX 1YQSA 4S2MA 5IU1A 3DTMA 5FQMA 1XXMA 4LFUA 1JTDA 3ZG7B 3Q81A 5A90A 4HJ3A 2PYRA 1XP4A 1XA7A 4EETB 3CITA 1GHMA 3IWIA 1ERQA 1H3QA 4YINA 3UO9A 1S1ZA 2EX9A 4OLGA 3RTYA 4O0PA 2QPNA 4YWZA 4R3JA 2WZXA 3LIEA 3A0VA 1F5MA 4E3IA 1UWNX 3CZDA 5HDDA 5CEDA 3ZG0A 3KO6A 1NZOA 2H0YA 4GS9A 4X53A 2ZLYA 1OJ5A 1MZUA 4WYYA 2JKGA 4OOMA 3LR4A 1K57C 2G2WA 2Y4AA 2R9XA 3GQZA 1FR1A 4MLLA 4S2LA 3MZEA 1NYMA 4QU3A 2QHKA 4KQQA 4X1MA 2EFXA 1T1BA 1IELA 4IJGA 4LCMA 4OQ0A 2E8IA 3MJQA 3R4KA 3T4SA 3IF6B 2HP9A 2EX6A 5GHXA 3D4FA 3BYDA 1N9LA 2ZQ7A 4JGOA 3IT9A 4K91A 1PIOA 3BECA 1NZUA 4RVAA 1ZG4A 1S67L 3EGXC 2ZJ9A 1J9MA 1K4FA 3LY4A 2ZQ8A 4PHTA 2HF6A 4LV2A 4OONA 5E2GA 4NEED 3W8KA 4EERA 1WYCA 5DKKA 1FCOA 2Y2LA 5EFWA 5AQAA 1Q2QA 2JHEA 4E6WA 4L9GA 4HJ6A 2OAQ1 2Y91A 1IYOA 1MY8A 1NJ4A 3UB9A 2HP5A 1BULA 1KVMA 3QP6A 4LCLA 1YLTA 4N1XA 3P09A 3JVUA 4WMCD 3LIDA 5KSHA 5HWWA 2W3HA 4GKUA 4E3KA 4WLAA 4CQHA 4ZBEA 3EQUA 4II7A 1LI0A 4XUZA 1PI4A 2I72A 2V8CA 2Z6DA 1K55A 3HUOA 2HDSA 1F9IA 3TOIA 4YFMA 2RCXA 1D1JA 4YNRA 1O07A 2V1AA 2EWVA 1N9BA 4Y5FA 2K31A 3W2ZA 4DXCA 1SDEA 1JWVA 3IF6A 3D3OA 1JTGA 1VHMA 3LI9A 5GLAA 4JF5A 2Y8HA 2ZMVA 3WS4A 3PBSA 2GDNA 3E98A 1TF1A 5TBMA 3OCNA 1YLJA 4NXGA 1VEUB 2XFSA 3OOVA 1LHYA 4KZ5A 3S7QA 4KZ8A 3UB7A 2WYXA 3P01A 1NYYA 2WKRA 4WUJA 5AJGA 4F94A 2O9BA 1IFQA 2DMWA 4PM9A 2J3TD 1K6RA 4YOFA 1MBLA 4CJNA 5HX9A 1DP9A 1RP5A 3DBAA 3VMAA 4IEDA 2D02A 1W8YA 3KSHA 4CLCE 3CJMA 1TD5A 5HAIA 1ALQA 2VA0A 3QHYA 4KZ4A 2VJWA 1GA0A 1J3WA 5FAPA 4UHUA 5AVFA 3UE0A 4WL9A 1FOFA 3VV4A 5J8XA 4JBFA 3T12B 1IOUA 2FFYA 3IWOA 1YMSA 1LI9A 5AQ7A 3N7WA 4M4XA 3ZQ5A 3MXSA 4IBRA 3OPLA 5A91A 3HREA 4NETA 1Z6FA 4KG6A 2L0WA 3WS2A 4DDYA 3ULFA 3LIAA 3U4LP 2DNSA 4HQAA 3W4PA 3IX8A 3NCKA 1YLWA 2XR0A 3BFCA 5GL9A 3EEHA 2WKEA 3FYZA 4HH2A 2VX8A 3UMDA 4U0XA 3WRTA 5HW3A 3MMHA 4S2KA 3JPUA 2CC1A 2P04A 4GB7A 3GVBA 2JC7A 1G68A 2W3DA 3BFDA 3MZDA 5MC7A 1BTLA 1KDWA 4UEYA 4KQDA 2XA7S 1VEUA 2Z6CA 3UN7A 5F68A 4R38A 3EOIA 4JF4A 2Q0OA 1K0KA 1TDGA 3ISGA 4B93A 1NRJA 1MPLA 3BLMA 1BLPA 4Q0JA 5I94A 3HLDA 3LEQA 4I3JA 1VM1A 3IS2B 5IT5A 2AVXA 3EQVA 3F1OB 3CUEA 1KGGA 4O01A 3VP0A 5CECA 3JVVA 3MKFA 1ES2A 5CHMA 3B3XA 1DP6A 3LEZA 3WS0A 2O9CA 2XD5A 4BD1A 3WS1A 3P7NA 3IXDA 4OPZA 4R4RA 3HLEA 3GMWA 4JXVA 4QJGA 1H8MA 2V0UA 2VGLM 1ESIA 2HZ5A 3LIFA 1XJ3A 1MC0A 3ZG9B 4XT2B 1MWTA 5HPIA 1QMFA 4XXRA 2B95A 1YLPA 2X01A 4S2NC 1YMXA 4KZ9A 3MXRA 4JXWA 4HHDA 4UA9A 3I7JA 3T50A 4RA7A 2PD8A 1K57A 1OT6A 1YSQA 3N8RA 3PBNA 4OOYA 3CMZA 4WEKA 1ZKJA 2XLNA 4R6LA 5EM0A 4IVIA 4PM8A 4S2JA 4ZAMA 1ZTUA 4GD8A 3T1QB 2EX8A 1WA9A 5FQKA 4R23A 3QP2A 3V50A 2QMIA 1L0FA 4FUWA 3EWKA 5DF8A 5A93A 5EUAA 5FAOA 2WZZA 4LRZE 4AFIA 3SS3A 2UWXA 4C75A 1HVBA 4L9FA 4HBTA 3GR2A 3IH8A 3Q7VB 4HIAA 1S6RA 3V39A 2Z2LB 1IKIA 2WGVA 2EXAA 4BBVA 1XX2A 3IS2A 1SZVA 3S7OA 4MN6A 2PD7A 3F1OA 1RCJA 1BZAA 4KZ6A 2C5WB 1DJAA 3QP8A 4L0LA 4EUVA 4BENA 3DTEA 1BT5A 3MQ0A 3Q07A 4P0MA 1NRFA 5J7EA 3N6IA 3FPWA 3Q1FA 2ZL1A 4N9KA 1L0EA 4NK3A 4WZ4A 3LFVA 2WUQA 2FFFB 5CX7A 2QZ6A 4I3AA 1ACFA 3FZCA 5HARA 2ZC5B 2J3TC 3DWKA 3VE4A 3PYPA 4G3VA 4XT2A 3T4TA 1CF0A 3HJIA 1TS7A 5EVID 4NKPA 4GD6A 5FI2A 1W63Q 3ZNYA 3H82A 1MWRA 2WAFA 4GLQA 5EVLA 3ITAA 4PM7A 4Q8IA 2Y2KA 4GZBA 2H5SA 3ZNTA 4GN2A 5L10A 1XA1A 3IHBA 1LL5A 5KIZA 3A0RA 1G28A 4BQMA 1SCWA 2LB5A 2Z2MB 3SS4A 3ZHHA 5DTKA 1EROA 1DP8A 4S2PA 5HD5A 3UNWA 4UQIM 1TVFA 2ZM2A 3FKWA 4OOLA 5HL1A 1F98A 4I3IA 2K2NA 5BOHA 4DJ2A 5F83A 3HUMA 4ZJ2A 4HP9A 5GLDA 2W1RA 3G4PA 5E2FA 3Q7VA 5E2EA 4KUOA 1KGFA 1Z09A 4MEZA 4R0QA 1G6AA 1LSWA 4QY5A 3VP2A 3LYXA 1AXBA 2KDKA 3MF0A 3VP3A 3ZGAB 2ZOHA 4KZ7A 5J3WA 2PHYA 1D7EA 3O88A 1JWPA 2KX6A 3UB5P 1N9OA 3GECA 1H8ZA 1OTIA 2DCFA 2HDUA 2JKTI 1A0KA 4PMAA 1QMEA 2PR5A 2L1MA 4B4XA 2M7VA 4WF0A 3M2KA 4NXBA 4C6YA 4LGWA 1ESUA 4O7DA 3L7HA 2OOLA 4WEJA 3UPNA 1CEFA 1XFQA 5G4YA 4G3KA 2QJ7A 2HV1A 3LY3A 4P85A 4LV3A 1M6KA 2PYPA 1SHVA 3MQQA 1MWUA 1AWIA 1Y54A 2IA2A 2VV7A 5FATA 1CQAA 5DJUA 3G34A 1D06A 4G3WA 4QD4A 5TBMB 1OT9A 4KUKA 3S4XA 1LSXA 5E2HA 4K0XA 3NY4A 5EVEA 3C38A 3T4JA 1S66L 2BASA 2WADA 4IBXA 5HSQA 3CG5A 3UPOA 4CPKA 2J7VA 3JYIA 3OCLA 4BBUA 4K0WA 4EEUA 1ZC2A 5CXWA 1E4DA 2EA9A 4PM6A
chains in the Genus database with same CATH topology
5L8MA 5I5LA 4B9OA 2MJ6A 5DF9A 5AVFA 2W3FA 4F3LB 4WL9A 4Q0IA 2W3GA 2ZOIA 3H7WB 3CWFA 3VV4A 3E4QA 3TRCA 2A2LA 2OWJA 3TJZC 3A0SA 2QJ5A 3HJKA 4FOFA 3PBOA 2VKSA 1OTAA 1IOUA 3E0YA 4LRYC 5DFXA 4M4XA 4HJ4A 4LRXC 5F69A 3ZQ5A 2GJ3A 1JNUA 2WKQA 4MN7A 4DJ3A 4IHQA 2B18A 4ME4A 4ZRRA 2L0WA 3UE3A 1P9RA 4H6JA 2K7SA 4I5SA 1P0ZA 3ULFA 2XA7M 3KX0X 3LIAA 3NOPC 4PKYG 2QWSA 4HQAA 2VLGA 3C30A 1YSPA 3UB6A 2W0NA 3EEHA 5K5BA 4HH2A 1OTEA 1T19A 2VX8A 3UMDA 2WKPA 5HDSA 3MMHA 2GNXA 3BW6A 2P04A 4EEPA 1ZHHB 1DRMA 4EXOA 2ZMFA 2W3DA 5MC7A 1MKMA 2ZBBA 5HZHA 4UEYA 4HP4A 4DN0A 2INWA 4KQDA 2XA7S 2Z6CA 3ICYA 2NUTC 4CLCD 4HY8A 2VEAA 2FZ0A 5F68A 4R38A 3U2AA 3EOIA 2PR6A 4B93A 1TS6A 1NRJA 1UGUA 3MQOA 5F5YA 3R7WA 4BWIA 4Q0JA 2O99A 2XROA 2OWHA 4IUHA 4I3JA 3IS2B 3K3DA 5IT5A 3EQVA 3F1OB 3CUEA 4O01A 4DMZA 3MFXA 3JVVA 2VZWA 5HDCA 4WELA 5HL6A 4GS9B 5DJTA 2HGVA 4LLOB 1DP6A 3R7WB 1OPXA 4BJPA 3BY9A 2JN7A 3NOTC 2O9CA 3OBFA 3P7NA 1XJ2A 4HOIA 1W63M 5DFYA 4GW9A 4F3LA 1GSWA 3BJNA 3C8CA 3H7WA 1H8MA 1T1CA 2V0UA 2VGLM 4EW7A 4L9EA 2M7UA 3LIFA 4PKYA 2XRNA 1XJ3A 1MC0A 3T4OA 2A24B 3GDIA 1TS0A 4XT2B 4CLCA 5HPIA 4MN5A 3BY8A 3LUQA 5LBRA 2V9AA 1LT0A 4HHDA 2R78A 3EGDC 3RFBA 3T50A 1VB6A 4WN5A 2PD8A 2KLIA 1Y28A 2D01A 4RQ9A 3S7NA 1OT6A 4JGQA 3E4OA 4CLCB 1YSQA 1G6OA 3PBNA 3B47A 4WEKA 2VGLS 3PR6A 4R6LA 2VV6A 3PHYA 1ZTUA 1T18A 4HI4A 2W27A 1WA9A 3LICA 3PBTA 5J4EA 4PAUA 5HWVA 3B33A 3HCYA 1GSXA 3CUEC 4O8GA 3KSGA 1UWPX 3EWKA 5IU1A 3RH8B 3ZYTA 1V9ZA 4I39A 3KSFA 3BWLA 3CAXA 4LRZE 4HJ3A 5F6AA 2PYRA 4AFIA 4GHIB 4UQIS 4IUKA 4EETB 3CITA 3UB8A 5TJJA 1P97A 4L9FA 3LIBA 1H3QA 1LSVA 4EQ1A 1S1ZA 2J80A 2PDRA 4HIAA 3RTYA 4O0PA 3FPVA 4YWZA 3LIEA 3A0VA 2G7UA 1F5MA 5G4ZA 1UWNX 2W3EA 5HDDA 4BBVA 3IS2A 3S7OA 3VOLA 4MN6A 2LB9A 3O5YA 2PD7A 3F1OA 1TS8A 2KOIA 4Y3IA 3UE6A 3KO6A 3TE8A 4NXFA 3OLOA 4L0LA 4GS9A 4EUVA 3UMEA 1OJ5A 3MQ0A 4ETZA 1MZUA 4OOMA 4GJ4A 2HJ9C 1S4SA 3H9WA 3LR4A 3T4KA 3LR5A 5J7EA 3BQAA 5AVEA 3FPWA 2QHKA 3T4QA 1T1BA 3D72A 3FG8A 3LFVA 4IJGA 2Y79A 5CX7A 3MJQA 3R4KA 4I3AA 4Q0HA 4KQOA 3T4SA 2J3TC 3VE4A 2A24A 3PYPA 5HPFA 4G3VA 4XT2A 3T4TA 3KSIA 3F1PB 3HJIA 1TS7A 2PT7A 4NKPA 1YKDA 3CLOA 1W63Q 1N9LA 3H82A 1LL8A 3IBJA 1V9YA 4JGOA 5C5KA 4GLQA 1ODVA 1S67L 3NJAA 2XSSA 3EGXC 3B42A 3F1NB 2W1TB 1OJGA 2VV8A 3K2NA 3TW8A 5KIZA 2L4RA 1OTBA 1G28A 3A0RA 4PHTA 3H82B 2HF6A 3PXPA 1S1YA 4NEED 2LB5A 4EERA 5DKKA 4K08A 5EFWA 1DP8A 2OAP1 4ARZA 5HD5A 2JHEA 4UQIM 1GSVA 1BYWA 2P08A 2EWWA 4L9GA 5A8BA 4HJ6A 4OOLA 3LR3A 2OAQ1 1F98A 4I3IA 3UB9A 3MR0A 2QKPA 2H28A 2K2NA 2JKRI 3S7PA 4GHIA 2QYBA 4DJ2A 2I9VA 4HH3A 5DKLA 4ARZB 2V0WA 3EEAA 1N9NA 4HP9A 1KOUA 4ETXA 3JVUA 2JKRM 3PBRA 2W1RA 3LIDA 5KSHA 5HWWA 2W3HA 4E04A 4KUOA 4BBTA 4WLAA 4Z1WA 4EU0A 4JGPA 4CQHA 4QPRA 3EQUA 2CMNA 2O0YA 2HJEA 4II7A 1LSWA 3C2WA 3LI8A 3LYXA 2GZAA 2KDKA 3MF0A 2Z6DA 2ZOHA 1F9IA 4MDZA 5J3WA 2PHYA 1OTDA 1D7EA 4MMNA 2KX6A 4YNRA 2J3WA 1N9OA 4CLCC 4GCZA 3GECA 4H6JB 2NUPC 2V1AA 2EWVA 4MCWA 3CI6A 1OTIA 2FH5A 2JKTI 4Y5FA 2K31A 2PR5A 2L1MA 3W2ZA 2M7VA 4WF0A 4P6ZM 3PBQA 1EW0A 3G6OA 3V67A 2JKTM 2O9AA 3BQ8A 3D3OA 2GX5A 4NXBA 1STZA 2OOLA 4WEJA 1VHMA 3LI9A 3F1PA 3KYZA 3IBRA 1S4RA 2Y8HA 1XFQA 2ZMVA 2YKFA 5G4YA 4G3KA 3LR0A 1P9WA 3NHQA 5FL3A 2QJ7A 4JGRA 3PBSA 2HV1A 3E4PA 3E98A 1TF1A 5TBMA 1T1AA 3OCNA 4NXGA 1NLZA 3K3CA 3KYQA 4NXEA 3OOVA 2PYPA 3SW1A 3MQQA 3S7QA 4BMWA 4R70A 3OC2A 3UB7A 4HNBA 3P01A 3F1NA 2M1CA 3T4LA 4P6ZS 2WKRA 2W1TA 3MXQA 2IA2A 4WUJA 5AJGA 2VV7A 2O9BA 1YAXA 1IFQA 4EESA 2DMWA 5DJUA 1D06A 4G3WA 3VE3A 5TBMB 4FSFA 1OT9A 2B02A 4KUKA 2J3TD 3NOUC 2V1BA 1LSXA 4YOFA 1XJ4A 1NLYA 1XFNA 1XJ6A 2P7JA 1DP9A 5HD3A 3C38A 3DBAA 3T4JA 1S66L 2BASA 2YKHA 4I38A 2D02A 4R3AA 4Y2FA 5HSQA 3KSHA 4CLCE 4LPZA 5HWTA 5IS1A 1TD5A 3OCLA 2VA0A 4BBUA 4EEUA 1X0OA 2VJWA 1NWZA 3FC7A 2EA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UQI S;  1NRJ A;  2FH5 A;  2JKT I;  1W63 M;  5MC7 A;  3TJZ C;  2JKR I;  4P6Z M;  2XA7 M;  2JKT M;  2HF6 A;  4NEE D;  2XA7 S;  4P6Z S;  2VGL M;  1W63 Q;  2JKR M;  2VGL S;  4UQI M; 
#chains in the Genus database with same CATH topology
 5L8M A;  1I2S A;  2MJ6 A;  5DF9 A;  2W3F A;  4F3L B;  4ZDX A;  1E25 A;  2W3G A;  3CWF A;  3TJZ C;  3G32 A;  1FCM A;  3HJK A;  1SDN A;  3PBO A;  4IVK A;  1OTA A;  2Q9M A;  3M6B A;  3E0Y A;  5HAP A;  4GNU A;  4JXG A;  1K4E A;  5DFX A;  4HJ4 A;  2Q9N A;  5F69 A;  1JNU A;  3IQA A;  2WKQ A;  4MN7 A;  4DJ3 A;  4IHQ A;  3VOY A;  1P9R A;  1ZG6 A;  3MS6 A;  1P0Z A;  2H10 A;  2XA7 M;  4PKY G;  1SKO B;  1ONG A;  4OKP A;  1Y4O A;  4MNR A;  5K5B A;  5GLC A;  5HDS A;  1PW8 A;  4D60 A;  4EEP A;  3AGD A;  3HL9 A;  4S2N A;  4U0T A;  1MKM A;  5HZH A;  4DN0 A;  2INW A;  1BSG A;  3ICY A;  1CI9 A;  3IX3 A;  1TDL A;  3UPP A;  4DE1 A;  3FV7 A;  3HLF A;  3DTI A;  1TS6 A;  4WMC A;  2HDQ A;  1UGU A;  3MQO A;  2OV5 A;  2A49 A;  2XRO A;  4DE3 A;  1YLY A;  4X68 A;  3IXG A;  3HLB A;  4EBN A;  1I2W A;  3MFX A;  1FIK A;  1MWS A;  5EVI C;  5HL6 A;  3QP4 A;  3SOI A;  4GDN A;  4U3T A;  4X25 A;  5DJT A;  2HGV A;  1OPX A;  5CTM A;  2JN7 A;  1LL9 A;  1XJ2 A;  1GA9 A;  5DFY A;  2IWD A;  4F3L A;  5CTN A;  1PFL A;  2ZC7 A;  5AQ9 A;  4OP5 A;  4EW7 A;  4BD0 A;  3ZFZ A;  2JBF A;  3L9K A;  2UV0 E;  1O7E A;  4FH4 A;  3FWL A;  1F2K A;  5U47 A;  4RX3 A;  4ZTK A;  2V9A A;  3C7U A;  3PTE A;  3WRZ A;  2D01 A;  3E4O A;  2IWB A;  1KE3 A;  5CGW A;  1G6O A;  2G2U A;  1SKF A;  1PYY A;  3B47 A;  1SKO A;  5EE8 A;  3PR6 A;  1CK3 A;  2XEP A;  1T18 A;  3SS5 A;  2W27 A;  1K56 D;  3PBT A;  2VGK A;  4XUX A;  4PAU A;  1XKZ A;  3HCY A;  1GSX A;  3SH9 A;  1VQQ A;  3O3V A;  3LCE A;  2WGW B;  3MKE A;  3RH8 B;  1V9Z A;  3V3R A;  3KSF A;  3BWL A;  2P74 A;  4OH0 A;  3NEC A;  4OP8 A;  3LO7 A;  2Y2P A;  4KZ3 A;  4IUK A;  3UB8 A;  4HES A;  3Q82 A;  3ZVW A;  1P97 A;  2XGN A;  4EQ1 A;  2VGJ A;  2J80 A;  4S2O A;  3FPV A;  2G7U A;  5G4Z A;  2W3E A;  3IX4 A;  4ESP A;  2LB9 A;  2KOI A;  5FA7 A;  3OPR A;  3TE8 A;  4NXF A;  4E3N A;  5F1G A;  4DF6 A;  5M19 A;  1PW1 A;  5L2F A;  3UME A;  5AQB A;  4ZJ3 A;  4PPR A;  4GJ4 A;  1S4S A;  2Y2G A;  3H9W A;  3T4K A;  3N8L A;  3C5A A;  2OLV A;  3AGE A;  1CI8 A;  2XF3 A;  2PBD P;  4Q0H A;  4KQO A;  3TSG A;  3C4O A;  5HPF A;  4JF6 A;  3KSI A;  3E2L A;  3F1P B;  2ZL1 B;  3CLO A;  1LL8 A;  3IBJ A;  1V9Y A;  2ZC4 B;  3WWX A;  1ODV A;  4E3O A;  1PZP A;  3VP1 A;  5EPH A;  2XSS A;  2W1T B;  1OJG A;  2VV8 A;  3N8S A;  3TW8 A;  3OPH A;  5CRF A;  1OTB A;  3H82 B;  4X56 A;  3E2K A;  1GCE A;  1E3U D;  4JKT A;  4X6T A;  1FCN A;  3ZVT A;  2RL3 A;  4ARZ A;  4B4Z A;  1GSV A;  1BYW A;  1ERM A;  2WGW A;  4OLD A;  1MKI A;  3WS5 A;  4HBU A;  2QKP A;  2JKR I;  3S7P A;  3MSH A;  1PWC A;  4HH3 A;  2ZQD A;  2WAE A;  1PNE A;  4OPR A;  2V0W A;  1N9N A;  2XFT A;  1BUE A;  1W79 A;  3PBR A;  4Z9Q A;  5DVA A;  4E04 A;  3G2Z A;  4BBT A;  4EU0 A;  4QPR A;  1PI5 A;  3S1Y A;  2HJE A;  1H0M A;  3UY6 A;  3UDX A;  3LI8 A;  2GZA A;  2Y2I A;  1WYB A;  4H8R A;  5EVI B;  2Y2M A;  2HDR A;  4MMN A;  1BLC A;  4JPM A;  4KG2 A;  4GCZ A;  5TFQ A;  2NUP C;  3G2Y A;  1VET B;  1L2S A;  4MCW A;  2PU2 A;  5FAS A;  2EFU A;  1H8Y A;  3VP4 A;  3PBQ A;  3G6O A;  2JKT M;  2GX5 A;  3F1P A;  3KYZ A;  4EUZ A;  1S4R A;  2XDM A;  2YKF A;  3RXW A;  3LR0 A;  1P9W A;  3ZG8 B;  4JGR A;  2ZQC A;  3SH8 A;  2IWC A;  1T1A A;  4NXE A;  5DTS A;  4GDB A;  4R70 A;  5DF7 A;  3QP1 A;  4OQI A;  1PWD A;  4DRT A;  3T4L A;  1RGZ A;  4P6Z S;  2W1T A;  1YAX A;  4KEN B;  5EV0 A;  3MBZ A;  3BLS A;  1W7F A;  3NOU C;  5FSR A;  1XJ4 A;  1K25 A;  1K6S A;  1GHP A;  4N1H A;  3C7V A;  5EEC A;  5HD3 A;  5FDS A;  4FH2 A;  2YKH A;  1K38 A;  4R3A A;  2WKI A;  5IS1 A;  3VSL A;  4WM9 A;  5TR7 A;  5HAQ A;  1NWZ A;  3FC7 A;  4LEN A;  4B9O A;  4Q0I A;  3VFF A;  4DE2 A;  2OWJ A;  3A0S A;  1EI5 A;  4QY6 A;  4NG2 A;  1KE0 A;  4LRY C;  3NBL A;  5G18 A;  2DRW A;  4R4S A;  1CEG A;  5EVI A;  2GJ3 A;  5CHJ A;  3HLW A;  2V2F F;  4UA6 A;  3HVF A;  5FQ9 A;  4ME4 A;  2H0T A;  4I5S A;  1VET A;  2Y2H A;  3BRM A;  5FI7 A;  3NOP C;  1BLH A;  3C30 A;  1YSP A;  2W0N A;  1T19 A;  2WKP A;  3S22 A;  2Y2J A;  1DY6 A;  2EX2 A;  4OVD A;  1ZHH B;  1DRM A;  2C6W B;  1M40 A;  4EXO A;  3GTC A;  4EV4 A;  2ZBB A;  4HP4 A;  3V5M A;  2NUT C;  4CLC D;  2VEA A;  4E6X A;  2Y59 A;  3U2A A;  1K54 C;  2B5R A;  4QHC A;  1LLB A;  3R7W A;  4BWI A;  4IUH A;  3K3D A;  4BL2 A;  2X71 A;  4DMZ A;  5HDC A;  3A3D A;  3GV9 A;  4FTX A;  4LLO B;  4BJP A;  3BY9 A;  3G35 A;  4Y0O A;  3NOT C;  3OBF A;  3HBR A;  1KVL A;  5IHV A;  4GW9 A;  1GSW A;  3BJN A;  3C8C A;  1T1C A;  5CER A;  2M7U A;  5GHZ A;  4PKY A;  3NDG A;  5EOO A;  2A24 B;  4QB8 A;  3GDI A;  4CLC A;  4DE0 A;  1I5Q A;  3BY8 A;  5LBR A;  4P87 A;  3G31 A;  1LT0 A;  2R78 A;  5FEG A;  2ZC3 B;  3EGD C;  1VB6 A;  3A3J A;  2KLI A;  3IWQ A;  1Y28 A;  3BFF A;  3C4P A;  4JGQ A;  4E3L A;  1FQG A;  4RYE A;  4EWF A;  4OPQ A;  5L09 A;  4ID4 A;  3VFH A;  4N92 A;  2Y2O A;  4R1G A;  3LIC A;  4X55 A;  5J4E A;  5HWV A;  5A92 A;  3CHW P;  1JVJ A;  4O8G A;  3KSG A;  2ZC6 B;  3ZYT A;  1MXO A;  4I39 A;  2XK1 A;  4OPY A;  3T1R A;  3CAX A;  5F6A A;  4GHI B;  5F1F A;  1YT4 A;  4UQI S;  5TJJ A;  3OZH A;  3LIB A;  2J9O A;  4DXB A;  1LSV A;  2PDR A;  3UDI A;  4RX2 A;  1HZO A;  1YPR A;  4WBG A;  3W4Q A;  1PZO A;  5D3O A;  1HTZ A;  3VOL A;  3O5Y A;  4Y0T A;  5FQJ A;  1TS8 A;  2HPB A;  4Y3I A;  3UE6 A;  4KZB A;  3OLO A;  5GHY A;  4MBH A;  4WZ5 A;  4ETZ A;  1ONH A;  5L07 A;  3N4I A;  2HJ9 C;  2OLU A;  5CGS A;  3LR5 A;  3BQA A;  5AVE A;  3T4Q A;  1XPB A;  3QP5 A;  3ZDJ A;  3D72 A;  4R3B A;  5CHU A;  3NUL A;  3FG8 A;  1TEM A;  2Y79 A;  5TGF A;  2PBY A;  3NDE A;  4DDS A;  2WGI A;  2EXB A;  5KZH A;  1IYS A;  2A24 A;  1W8Q A;  3SZT A;  2PT7 A;  3RXX A;  1YKD A;  1DJB A;  5C5K A;  3ZCZ A;  1GHI A;  4EBL A;  2XQZ A;  5EM1 A;  3V3S A;  4LV1 A;  3NJA A;  1YLZ A;  3B42 A;  2Y55 A;  4LV0 A;  3F1N B;  3K2N A;  1ES3 A;  1YM1 A;  2L4R A;  3O87 A;  5DTT A;  1IKG A;  3PXP A;  2PRF A;  1S1Y A;  3SH7 A;  4K08 A;  2OAP 1;  1S0W A;  2EWW A;  2P08 A;  5A8B A;  1XGJ A;  3CPT B;  3LR3 A;  3M2J A;  1KGE A;  2R9W A;  3MR0 A;  2H28 A;  4GHI A;  2QYB A;  2I9V A;  1BLS A;  3BM6 A;  3A3F A;  5DKL A;  2V20 A;  1RGY A;  3VOZ A;  4ARZ B;  3EEA A;  1KOU A;  4ETX A;  2JKR M;  3UE1 A;  3RJU A;  4Z1W A;  4JGP A;  4N9L A;  2CMN A;  2O0Y A;  1IYP A;  3BEB A;  2XH9 A;  3HLC A;  4MBF A;  3C2W A;  2A3U A;  3BFE A;  3NC8 A;  3IF5 A;  4FCF A;  3QNB A;  4Y13 A;  4MDZ A;  4UA7 A;  1OTD A;  2J9P A;  4OQG A;  2JE5 A;  4B88 A;  1JWZ A;  2Y2Q A;  2J8Y A;  2J3W A;  4CLC C;  3T1X A;  4H6J B;  1ES5 A;  4JXS A;  3CI6 A;  4D2O A;  2FH5 A;  4X69 A;  1G5U A;  4KQR A;  2ZD8 A;  5FI6 A;  4P6Z M;  2PU4 A;  1EW0 A;  3FKV A;  3V67 A;  2BLS A;  2O9A A;  3BQ8 A;  1OME A;  1PWG A;  1K56 A;  1L3L A;  1STZ A;  3P98 A;  3IBR A;  5FL3 A;  3NHQ A;  4KG5 A;  3E4P A;  3A3I A;  3HLG A;  1NLZ A;  5EOE A;  3K3C A;  3KYQ A;  3SW1 A;  1ES4 A;  3PAE A;  4BMW A;  3OC2 A;  1DJC A;  4X1L A;  4HNB A;  5JYP A;  4Y0U A;  2V1Z A;  3F1N A;  2M1C A;  3MXQ A;  4UAA A;  1IYQ A;  4HEF A;  4EES A;  4A5R A;  3VE3 A;  3ZG5 A;  1HD8 A;  3Q7Z A;  4FSF A;  2Y2N A;  2B02 A;  4FD8 A;  1L0G A;  2V1B A;  2V8F A;  2VK3 A;  1NLY A;  1XFN A;  1XJ6 A;  4Y7P A;  1FR6 A;  2P7J A;  3OPP A;  1K55 C;  1XGI A;  3CPT A;  5FAQ A;  2JKF A;  4I38 A;  4Y2F A;  3PAG A;  4MBK A;  4E3M A;  4LPZ A;  2PAV P;  1U60 A;  5HWT A;  4PM5 A;  1X0O A;  4BLM A;  1NY0 A;  5I5L A;  1K54 A;  1C3B A;  5KMW A;  3IHA A;  5FEF A;  2ZOI A;  3H7W B;  3NIA A;  4KZA A;  4WZ5 C;  3E4Q A;  3TRC A;  1FSY A;  2A2L A;  4OQH A;  2ZMA A;  3IF6 C;  2QJ5 A;  4FOF A;  4ZJ1 A;  2VKS A;  1KDS A;  2XD1 A;  3DW0 A;  2WK0 A;  3MZF A;  5HFO A;  2BTF P;  3TG9 A;  1Q2P A;  4LRX C;  4M3K A;  2B18 A;  4ZRR A;  3UE3 A;  4H6J A;  2K7S A;  3QNC A;  5JYO A;  3KX0 X;  5KSC A;  2QWS A;  2VLG A;  2JCH A;  3UB6 A;  1PRQ A;  5CGX A;  4S2I A;  3DTK A;  2E8J A;  1OTE A;  1E3U A;  2P9V B;  3DAV A;  1H5X A;  1WE4 A;  3A3E A;  3D9Y A;  3KYE A;  2GNX A;  3BW6 A;  3VSK A;  2ZMF A;  2HP6 A;  3GRJ A;  3UDF A;  2ZM0 A;  3AGF A;  3HUN A;  2ZM8 A;  2ZQA A;  3IXB A;  2ACG A;  4DKI A;  2X02 A;  4HY8 A;  2OSU A;  3NI9 A;  2FZ0 A;  3GSG A;  3MFD A;  2ZQ9 A;  2PR6 A;  4Y17 A;  4QWO A;  1N4O A;  5F5Y A;  3T1S A;  2O99 A;  2OWH A;  1W5D A;  1IEM A;  5F82 A;  5GLB A;  2VZW A;  4BL3 A;  4WEL A;  3LGO A;  4GS9 B;  1L0D A;  2WKH A;  3R7W B;  5FQI A;  3IXH A;  4HOI A;  5FQQ A;  3BFG A;  1W63 M;  4Y15 A;  4EQI A;  5CEB A;  3H7W A;  1FSW A;  3ITB A;  4E3J A;  1NXY A;  4L9E A;  1HLU P;  4P6B A;  2XRN A;  3DWZ A;  3T4O A;  3IH9 A;  1TS0 A;  4MN5 A;  5M1A A;  5E43 A;  3LUQ A;  4EBP A;  3M6H A;  3RFB A;  3W4O A;  1EWZ A;  4WN5 A;  5FDH A;  4C3Q A;  3G30 A;  1KE4 A;  4JLF A;  4RQ9 A;  3S7N A;  4CLC B;  1FIL A;  2VGL S;  1CJF A;  2BG1 A;  2VV6 A;  3PHY A;  4HI4 A;  2P9V A;  3O86 A;  3B33 A;  3CUE C;  4GOG A;  5M18 A;  1UWP X;  1YQS A;  4S2M A;  5IU1 A;  3DTM A;  5FQM A;  1XXM A;  4LFU A;  1JTD A;  3ZG7 B;  3Q81 A;  5A90 A;  4HJ3 A;  2PYR A;  1XP4 A;  1XA7 A;  4EET B;  3CIT A;  1GHM A;  3IWI A;  1ERQ A;  1H3Q A;  4YIN A;  3UO9 A;  1S1Z A;  2EX9 A;  4OLG A;  3RTY A;  4O0P A;  2QPN A;  4YWZ A;  4R3J A;  2WZX A;  3LIE A;  3A0V A;  1F5M A;  4E3I A;  1UWN X;  3CZD A;  5HDD A;  5CED A;  3ZG0 A;  3KO6 A;  1NZO A;  2H0Y A;  4GS9 A;  4X53 A;  2ZLY A;  1OJ5 A;  1MZU A;  4WYY A;  2JKG A;  4OOM A;  3LR4 A;  1K57 C;  2G2W A;  2Y4A A;  2R9X A;  3GQZ A;  1FR1 A;  4MLL A;  4S2L A;  3MZE A;  1NYM A;  4QU3 A;  2QHK A;  4KQQ A;  4X1M A;  2EFX A;  1T1B A;  1IEL A;  4IJG A;  4LCM A;  4OQ0 A;  2E8I A;  3MJQ A;  3R4K A;  3T4S A;  3IF6 B;  2HP9 A;  2EX6 A;  5GHX A;  3D4F A;  3BYD A;  1N9L A;  2ZQ7 A;  4JGO A;  3IT9 A;  4K91 A;  1PIO A;  3BEC A;  1NZU A;  4RVA A;  1ZG4 A;  1S67 L;  3EGX C;  2ZJ9 A;  1J9M A;  1K4F A;  3LY4 A;  2ZQ8 A;  4PHT A;  2HF6 A;  4LV2 A;  4OON A;  5E2G A;  4NEE D;  3W8K A;  4EER A;  1WYC A;  5DKK A;  1FCO A;  2Y2L A;  5EFW A;  5AQA A;  1Q2Q A;  2JHE A;  4E6W A;  4L9G A;  4HJ6 A;  2OAQ 1;  2Y91 A;  1IYO A;  1MY8 A;  1NJ4 A;  3UB9 A;  2HP5 A;  1BUL A;  1KVM A;  3QP6 A;  4LCL A;  1YLT A;  4N1X A;  3P09 A;  3JVU A;  4WMC D;  3LID A;  5KSH A;  5HWW A;  2W3H A;  4GKU A;  4E3K A;  4WLA A;  4CQH A;  4ZBE A;  3EQU A;  4II7 A;  1LI0 A;  4XUZ A;  1PI4 A;  2I72 A;  2V8C A;  2Z6D A;  1K55 A;  3HUO A;  2HDS A;  1F9I A;  3TOI A;  4YFM A;  2RCX A;  1D1J A;  4YNR A;  1O07 A;  2V1A A;  2EWV A;  1N9B A;  4Y5F A;  2K31 A;  3W2Z A;  4DXC A;  1SDE A;  1JWV A;  3IF6 A;  3D3O A;  1JTG A;  1VHM A;  3LI9 A;  5GLA A;  4JF5 A;  2Y8H A;  2ZMV A;  3WS4 A;  3PBS A;  2GDN A;  3E98 A;  1TF1 A;  5TBM A;  3OCN A;  1YLJ A;  4NXG A;  1VEU B;  2XFS A;  3OOV A;  1LHY A;  4KZ5 A;  3S7Q A;  4KZ8 A;  3UB7 A;  2WYX A;  3P01 A;  1NYY A;  2WKR A;  4WUJ A;  5AJG A;  4F94 A;  2O9B A;  1IFQ A;  2DMW A;  4PM9 A;  2J3T D;  1K6R A;  4YOF A;  1MBL A;  4CJN A;  5HX9 A;  1DP9 A;  1RP5 A;  3DBA A;  3VMA A;  4IED A;  2D02 A;  1W8Y A;  3KSH A;  4CLC E;  3CJM A;  1TD5 A;  5HAI A;  1ALQ A;  2VA0 A;  3QHY A;  4KZ4 A;  2VJW A;  1GA0 A;  1J3W A;  5FAP A;  4UHU A;  5AVF A;  3UE0 A;  4WL9 A;  1FOF A;  3VV4 A;  5J8X A;  4JBF A;  3T12 B;  1IOU A;  2FFY A;  3IWO A;  1YMS A;  1LI9 A;  5AQ7 A;  3N7W A;  4M4X A;  3ZQ5 A;  3MXS A;  4IBR A;  3OPL A;  5A91 A;  3HRE A;  4NET A;  1Z6F A;  4KG6 A;  2L0W A;  3WS2 A;  4DDY A;  3ULF A;  3LIA A;  3U4L P;  2DNS A;  4HQA A;  3W4P A;  3IX8 A;  3NCK A;  1YLW A;  2XR0 A;  3BFC A;  5GL9 A;  3EEH A;  2WKE A;  3FYZ A;  4HH2 A;  2VX8 A;  3UMD A;  4U0X A;  3WRT A;  5HW3 A;  3MMH A;  4S2K A;  3JPU A;  2CC1 A;  2P04 A;  4GB7 A;  3GVB A;  2JC7 A;  1G68 A;  2W3D A;  3BFD A;  3MZD A;  5MC7 A;  1BTL A;  1KDW A;  4UEY A;  4KQD A;  2XA7 S;  1VEU A;  2Z6C A;  3UN7 A;  5F68 A;  4R38 A;  3EOI A;  4JF4 A;  2Q0O A;  1K0K A;  1TDG A;  3ISG A;  4B93 A;  1NRJ A;  1MPL A;  3BLM A;  1BLP A;  4Q0J A;  5I94 A;  3HLD A;  3LEQ A;  4I3J A;  1VM1 A;  3IS2 B;  5IT5 A;  2AVX A;  3EQV A;  3F1O B;  3CUE A;  1KGG A;  4O01 A;  3VP0 A;  5CEC A;  3JVV A;  3MKF A;  1ES2 A;  5CHM A;  3B3X A;  1DP6 A;  3LEZ A;  3WS0 A;  2O9C A;  2XD5 A;  4BD1 A;  3WS1 A;  3P7N A;  3IXD A;  4OPZ A;  4R4R A;  3HLE A;  3GMW A;  4JXV A;  4QJG A;  1H8M A;  2V0U A;  2VGL M;  1ESI A;  2HZ5 A;  3LIF A;  1XJ3 A;  1MC0 A;  3ZG9 B;  4XT2 B;  1MWT A;  5HPI A;  1QMF A;  4XXR A;  2B95 A;  1YLP A;  2X01 A;  4S2N C;  1YMX A;  4KZ9 A;  3MXR A;  4JXW A;  4HHD A;  4UA9 A;  3I7J A;  3T50 A;  4RA7 A;  2PD8 A;  1K57 A;  1OT6 A;  1YSQ A;  3N8R A;  3PBN A;  4OOY A;  3CMZ A;  4WEK A;  1ZKJ A;  2XLN A;  4R6L A;  5EM0 A;  4IVI A;  4PM8 A;  4S2J A;  4ZAM A;  1ZTU A;  4GD8 A;  3T1Q B;  2EX8 A;  1WA9 A;  5FQK A;  4R23 A;  3QP2 A;  3V50 A;  2QMI A;  1L0F A;  4FUW A;  3EWK A;  5DF8 A;  5A93 A;  5EUA A;  5FAO A;  2WZZ A;  4LRZ E;  4AFI A;  3SS3 A;  2UWX A;  4C75 A;  1HVB A;  4L9F A;  4HBT A;  3GR2 A;  3IH8 A;  3Q7V B;  4HIA A;  1S6R A;  3V39 A;  2Z2L B;  1IKI A;  2WGV A;  2EXA A;  4BBV A;  1XX2 A;  3IS2 A;  1SZV A;  3S7O A;  4MN6 A;  2PD7 A;  3F1O A;  1RCJ A;  1BZA A;  4KZ6 A;  2C5W B;  1DJA A;  3QP8 A;  4L0L A;  4EUV A;  4BEN A;  3DTE A;  1BT5 A;  3MQ0 A;  3Q07 A;  4P0M A;  1NRF A;  5J7E A;  3N6I A;  3FPW A;  3Q1F A;  2ZL1 A;  4N9K A;  1L0E A;  4NK3 A;  4WZ4 A;  3LFV A;  2WUQ A;  2FFF B;  5CX7 A;  2QZ6 A;  4I3A A;  1ACF A;  3FZC A;  5HAR A;  2ZC5 B;  2J3T C;  3DWK A;  3VE4 A;  3PYP A;  4G3V A;  4XT2 A;  3T4T A;  1CF0 A;  3HJI A;  1TS7 A;  5EVI D;  4NKP A;  4GD6 A;  5FI2 A;  1W63 Q;  3ZNY A;  3H82 A;  1MWR A;  2WAF A;  4GLQ A;  5EVL A;  3ITA A;  4PM7 A;  4Q8I A;  2Y2K A;  4GZB A;  2H5S A;  3ZNT A;  4GN2 A;  5L10 A;  1XA1 A;  3IHB A;  1LL5 A;  5KIZ A;  3A0R A;  1G28 A;  4BQM A;  1SCW A;  2LB5 A;  2Z2M B;  3SS4 A;  3ZHH A;  5DTK A;  1ERO A;  1DP8 A;  4S2P A;  5HD5 A;  3UNW A;  4UQI M;  1TVF A;  2ZM2 A;  3FKW A;  4OOL A;  5HL1 A;  1F98 A;  4I3I A;  2K2N A;  5BOH A;  4DJ2 A;  5F83 A;  3HUM A;  4ZJ2 A;  4HP9 A;  5GLD A;  2W1R A;  3G4P A;  5E2F A;  3Q7V A;  5E2E A;  4KUO A;  1KGF A;  1Z09 A;  4MEZ A;  4R0Q A;  1G6A A;  1LSW A;  4QY5 A;  3VP2 A;  3LYX A;  1AXB A;  2KDK A;  3MF0 A;  3VP3 A;  3ZGA B;  2ZOH A;  4KZ7 A;  5J3W A;  2PHY A;  1D7E A;  3O88 A;  1JWP A;  2KX6 A;  3UB5 P;  1N9O A;  3GEC A;  1H8Z A;  1OTI A;  2DCF A;  2HDU A;  2JKT I;  1A0K A;  4PMA A;  1QME A;  2PR5 A;  2L1M A;  4B4X A;  2M7V A;  4WF0 A;  3M2K A;  4NXB A;  4C6Y A;  4LGW A;  1ESU A;  4O7D A;  3L7H A;  2OOL A;  4WEJ A;  3UPN A;  1CEF A;  1XFQ A;  5G4Y A;  4G3K A;  2QJ7 A;  2HV1 A;  3LY3 A;  4P85 A;  4LV3 A;  1M6K A;  2PYP A;  1SHV A;  3MQQ A;  1MWU A;  1AWI A;  1Y54 A;  2IA2 A;  2VV7 A;  5FAT A;  1CQA A;  5DJU A;  3G34 A;  1D06 A;  4G3W A;  4QD4 A;  5TBM B;  1OT9 A;  4KUK A;  3S4X A;  1LSX A;  5E2H A;  4K0X A;  3NY4 A;  5EVE A;  3C38 A;  3T4J A;  1S66 L;  2BAS A;  2WAD A;  4IBX A;  5HSQ A;  3CG5 A;  3UPO A;  4CPK A;  2J7V A;  3JYI A;  3OCL A;  4BBU A;  4K0W A;  4EEU A;  1ZC2 A;  5CXW A;  1E4D A;  2EA9 A;  4PM6 A; 
#chains in the Genus database with same CATH homology
 5L8M A;  5I5L A;  4B9O A;  2MJ6 A;  5DF9 A;  5AVF A;  2W3F A;  4F3L B;  4WL9 A;  4Q0I A;  2W3G A;  2ZOI A;  3H7W B;  3CWF A;  3VV4 A;  3E4Q A;  3TRC A;  2A2L A;  2OWJ A;  3TJZ C;  3A0S A;  2QJ5 A;  3HJK A;  4FOF A;  3PBO A;  2VKS A;  1OTA A;  1IOU A;  3E0Y A;  4LRY C;  5DFX A;  4M4X A;  4HJ4 A;  4LRX C;  5F69 A;  3ZQ5 A;  2GJ3 A;  1JNU A;  2WKQ A;  4MN7 A;  4DJ3 A;  4IHQ A;  2B18 A;  4ME4 A;  4ZRR A;  2L0W A;  3UE3 A;  1P9R A;  4H6J A;  2K7S A;  4I5S A;  1P0Z A;  3ULF A;  2XA7 M;  3KX0 X;  3LIA A;  3NOP C;  4PKY G;  2QWS A;  4HQA A;  2VLG A;  3C30 A;  1YSP A;  3UB6 A;  2W0N A;  3EEH A;  5K5B A;  4HH2 A;  1OTE A;  1T19 A;  2VX8 A;  3UMD A;  2WKP A;  5HDS A;  3MMH A;  2GNX A;  3BW6 A;  2P04 A;  4EEP A;  1ZHH B;  1DRM A;  4EXO A;  2ZMF A;  2W3D A;  5MC7 A;  1MKM A;  2ZBB A;  5HZH A;  4UEY A;  4HP4 A;  4DN0 A;  2INW A;  4KQD A;  2XA7 S;  2Z6C A;  3ICY A;  2NUT C;  4CLC D;  4HY8 A;  2VEA A;  2FZ0 A;  5F68 A;  4R38 A;  3U2A A;  3EOI A;  2PR6 A;  4B93 A;  1TS6 A;  1NRJ A;  1UGU A;  3MQO A;  5F5Y A;  3R7W A;  4BWI A;  4Q0J A;  2O99 A;  2XRO A;  2OWH A;  4IUH A;  4I3J A;  3IS2 B;  3K3D A;  5IT5 A;  3EQV A;  3F1O B;  3CUE A;  4O01 A;  4DMZ A;  3MFX A;  3JVV A;  2VZW A;  5HDC A;  4WEL A;  5HL6 A;  4GS9 B;  5DJT A;  2HGV A;  4LLO B;  1DP6 A;  3R7W B;  1OPX A;  4BJP A;  3BY9 A;  2JN7 A;  3NOT C;  2O9C A;  3OBF A;  3P7N A;  1XJ2 A;  4HOI A;  1W63 M;  5DFY A;  4GW9 A;  4F3L A;  1GSW A;  3BJN A;  3C8C A;  3H7W A;  1H8M A;  1T1C A;  2V0U A;  2VGL M;  4EW7 A;  4L9E A;  2M7U A;  3LIF A;  4PKY A;  2XRN A;  1XJ3 A;  1MC0 A;  3T4O A;  2A24 B;  3GDI A;  1TS0 A;  4XT2 B;  4CLC A;  5HPI A;  4MN5 A;  3BY8 A;  3LUQ A;  5LBR A;  2V9A A;  1LT0 A;  4HHD A;  2R78 A;  3EGD C;  3RFB A;  3T50 A;  1VB6 A;  4WN5 A;  2PD8 A;  2KLI A;  1Y28 A;  2D01 A;  4RQ9 A;  3S7N A;  1OT6 A;  4JGQ A;  3E4O A;  4CLC B;  1YSQ A;  1G6O A;  3PBN A;  3B47 A;  4WEK A;  2VGL S;  3PR6 A;  4R6L A;  2VV6 A;  3PHY A;  1ZTU A;  1T18 A;  4HI4 A;  2W27 A;  1WA9 A;  3LIC A;  3PBT A;  5J4E A;  4PAU A;  5HWV A;  3B33 A;  3HCY A;  1GSX A;  3CUE C;  4O8G A;  3KSG A;  1UWP X;  3EWK A;  5IU1 A;  3RH8 B;  3ZYT A;  1V9Z A;  4I39 A;  3KSF A;  3BWL A;  3CAX A;  4LRZ E;  4HJ3 A;  5F6A A;  2PYR A;  4AFI A;  4GHI B;  4UQI S;  4IUK A;  4EET B;  3CIT A;  3UB8 A;  5TJJ A;  1P97 A;  4L9F A;  3LIB A;  1H3Q A;  1LSV A;  4EQ1 A;  1S1Z A;  2J80 A;  2PDR A;  4HIA A;  3RTY A;  4O0P A;  3FPV A;  4YWZ A;  3LIE A;  3A0V A;  2G7U A;  1F5M A;  5G4Z A;  1UWN X;  2W3E A;  5HDD A;  4BBV A;  3IS2 A;  3S7O A;  3VOL A;  4MN6 A;  2LB9 A;  3O5Y A;  2PD7 A;  3F1O A;  1TS8 A;  2KOI A;  4Y3I A;  3UE6 A;  3KO6 A;  3TE8 A;  4NXF A;  3OLO A;  4L0L A;  4GS9 A;  4EUV A;  3UME A;  1OJ5 A;  3MQ0 A;  4ETZ A;  1MZU A;  4OOM A;  4GJ4 A;  2HJ9 C;  1S4S A;  3H9W A;  3LR4 A;  3T4K A;  3LR5 A;  5J7E A;  3BQA A;  5AVE A;  3FPW A;  2QHK A;  3T4Q A;  1T1B A;  3D72 A;  3FG8 A;  3LFV A;  4IJG A;  2Y79 A;  5CX7 A;  3MJQ A;  3R4K A;  4I3A A;  4Q0H A;  4KQO A;  3T4S A;  2J3T C;  3VE4 A;  2A24 A;  3PYP A;  5HPF A;  4G3V A;  4XT2 A;  3T4T A;  3KSI A;  3F1P B;  3HJI A;  1TS7 A;  2PT7 A;  4NKP A;  1YKD A;  3CLO A;  1W63 Q;  1N9L A;  3H82 A;  1LL8 A;  3IBJ A;  1V9Y A;  4JGO A;  5C5K A;  4GLQ A;  1ODV A;  1S67 L;  3NJA A;  2XSS A;  3EGX C;  3B42 A;  3F1N B;  2W1T B;  1OJG A;  2VV8 A;  3K2N A;  3TW8 A;  5KIZ A;  2L4R A;  1OTB A;  1G28 A;  3A0R A;  4PHT A;  3H82 B;  2HF6 A;  3PXP A;  1S1Y A;  4NEE D;  2LB5 A;  4EER A;  5DKK A;  4K08 A;  5EFW A;  1DP8 A;  2OAP 1;  4ARZ A;  5HD5 A;  2JHE A;  4UQI M;  1GSV A;  1BYW A;  2P08 A;  2EWW A;  4L9G A;  5A8B A;  4HJ6 A;  4OOL A;  3LR3 A;  2OAQ 1;  1F98 A;  4I3I A;  3UB9 A;  3MR0 A;  2QKP A;  2H28 A;  2K2N A;  2JKR I;  3S7P A;  4GHI A;  2QYB A;  4DJ2 A;  2I9V A;  4HH3 A;  5DKL A;  4ARZ B;  2V0W A;  3EEA A;  1N9N A;  4HP9 A;  1KOU A;  4ETX A;  3JVU A;  2JKR M;  3PBR A;  2W1R A;  3LID A;  5KSH A;  5HWW A;  2W3H A;  4E04 A;  4KUO A;  4BBT A;  4WLA A;  4Z1W A;  4EU0 A;  4JGP A;  4CQH A;  4QPR A;  3EQU A;  2CMN A;  2O0Y A;  2HJE A;  4II7 A;  1LSW A;  3C2W A;  3LI8 A;  3LYX A;  2GZA A;  2KDK A;  3MF0 A;  2Z6D A;  2ZOH A;  1F9I A;  4MDZ A;  5J3W A;  2PHY A;  1OTD A;  1D7E A;  4MMN A;  2KX6 A;  4YNR A;  2J3W A;  1N9O A;  4CLC C;  4GCZ A;  3GEC A;  4H6J B;  2NUP C;  2V1A A;  2EWV A;  4MCW A;  3CI6 A;  1OTI A;  2FH5 A;  2JKT I;  4Y5F A;  2K31 A;  2PR5 A;  2L1M A;  3W2Z A;  2M7V A;  4WF0 A;  4P6Z M;  3PBQ A;  1EW0 A;  3G6O A;  3V67 A;  2JKT M;  2O9A A;  3BQ8 A;  3D3O A;  2GX5 A;  4NXB A;  1STZ A;  2OOL A;  4WEJ A;  1VHM A;  3LI9 A;  3F1P A;  3KYZ A;  3IBR A;  1S4R A;  2Y8H A;  1XFQ A;  2ZMV A;  2YKF A;  5G4Y A;  4G3K A;  3LR0 A;  1P9W A;  3NHQ A;  5FL3 A;  2QJ7 A;  4JGR A;  3PBS A;  2HV1 A;  3E4P A;  3E98 A;  1TF1 A;  5TBM A;  1T1A A;  3OCN A;  4NXG A;  1NLZ A;  3K3C A;  3KYQ A;  4NXE A;  3OOV A;  2PYP A;  3SW1 A;  3MQQ A;  3S7Q A;  4BMW A;  4R70 A;  3OC2 A;  3UB7 A;  4HNB A;  3P01 A;  3F1N A;  2M1C A;  3T4L A;  4P6Z S;  2WKR A;  2W1T A;  3MXQ A;  2IA2 A;  4WUJ A;  5AJG A;  2VV7 A;  2O9B A;  1YAX A;  1IFQ A;  4EES A;  2DMW A;  5DJU A;  1D06 A;  4G3W A;  3VE3 A;  5TBM B;  4FSF A;  1OT9 A;  2B02 A;  4KUK A;  2J3T D;  3NOU C;  2V1B A;  1LSX A;  4YOF A;  1XJ4 A;  1NLY A;  1XFN A;  1XJ6 A;  2P7J A;  1DP9 A;  5HD3 A;  3C38 A;  3DBA A;  3T4J A;  1S66 L;  2BAS A;  2YKH A;  4I38 A;  2D02 A;  4R3A A;  4Y2F A;  5HSQ A;  3KSH A;  4CLC E;  4LPZ A;  5HWT A;  5IS1 A;  1TD5 A;  3OCL A;  2VA0 A;  4BBU A;  4EEU A;  1X0O A;  2VJW A;  1NWZ A;  3FC7 A;  2EA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...