1W63Q

Ap1 clathrin adaptor core
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
148
structure length
148
Chain Sequence
MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords ADAPTER-RELATED PROTEIN COMPLEX 1 GAMMA 1 SUBUNIT
publication title Crystal Structure of the Clathrin Adaptor Protein 1 Core
pubmed doi rcsb
source organism Mus musculus
total genus 45
structure length 148
sequence length 148
chains with identical sequence S, T, U, W, X
ec nomenclature
pdb deposition date 2004-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1w63Q00
4NEED 4UQIS 1NRJA 2XA7S 4UQIM 4P6ZS 2HF6A 2XA7M 2VGLS 4P6ZM 2JKRM 2JKTM 1W63Q 3TJZC 2FH5A 2VGLM 2JKRI 1W63M 2JKTI 5MC7A
chains in the Genus database with same CATH superfamily
3HLCA 3NOUC 1L2SA 1UGUA 5FQMA 2Y2PA 1H5XA 3BLMA 1K25A 3A0SA 4KG6A 2E8JA 1PFLA 5TBMB 3V50A 3E4OA 4UA7A 3SW1A 3SZTA 3OPPA 4PKYA 1K38A 4O01A 3FPWA 2Q9MA 4PPRA 3HL9A 3KYZA 5EVLA 3IF6B 5AQ9A 3M6HA 2VV8A 5K5BA 3T1XA 3SS4A 3CLOA 5E2FA 3T4KA 3NY4A 1DJBA 3NOPC 1OTAA 3OCLA 2H0TA 2JHEA 4JXGA 1QMFA 1LL9A 1DP9A 1J3WA 4R23A 5EVID 1XJ2A 3H82A 1O07A 2A2LA 3EGXC 4DE3A 3UPPA 1AWIA 3U2AA 3PXPA 3M2JA 1CJFA 3O87A 3LIBA 3S1YA 3S7OA 2ZC3B 4L9FA 1CF0A 2EFUA 4P6BA 3MZDA 4HQAA 5FASA 3OCNA 5F1GA 4L0LA 1IYPA 4PAUA 4KQRA 5FL3A 3VE4A 2OAP1 5F69A 2J9PA 3GSGA 3SH9A 3ZYTA 2V1BA 3UPNA 2EXAA 2PD8A 4EBLA 3MMHA 4OOLA 4DMZA 2J80A 5DF9A 5FA7A 2HDUA 4ME4A 1P0ZA 3BFGA 5J7EA 3TRCA 1KVMA 3C8CA 1NZOA 4XT2B 3P7NA 4EXOA 3IH8A 3BRMA 4Y7PA 4KZ8A 5M18A 2D01A 4LRZE 4X25A 3EEAA 1P9RA 3LY4A 2OSUA 4EW7A 4OQHA 2I9VA 2WAEA 5DJUA 2Z6DA 4GKUA 4C6YA 1E3UD 4IVKA 3UE1A 5AQAA 3WRZA 4N9LA 3R4KA 4Z9QA 1GSXA 3S7QA 1KE0A 3U4LP 3PBTA 2ZC5B 2P9VA 4ID4A 4E04A 2UWXA 1G6AA 4EQ1A 4WEJA 3KO6A 3IS2A 4JXWA 2JKGA 2J7VA 2VV6A 4S2NC 3N4IA 2H0YA 3R7WB 3CITA 2Y59A 4OOYA 1XJ4A 2V0UA 4MDZA 4CLCB 2M7UA 3IT9A 3C7UA 4FH4A 3EWKA 2A24B 3W4PA 4ZTKA 4HP9A 3HLEA 5IT5A 1BLPA 2HDSA 3MF0A 3LIEA 3G6OA 1L0FA 4K91A 3HLWA 1E4DA 1GCEA 4EERA 1NRJA 4GD8A 1MWUA 1XXMA 2OV5A 3N6IA 4YNRA 3K3CA 5DFYA 1YLWA 3VE3A 5I94A 3PR6A 3V3RA 2J3TC 3MQ0A 4LRXC 2HGVA 3VSKA 2WKRA 1W8QA 3IHBA 2R78A 1MKMA 5FQ9A 1Q2PA 1CEFA 1MWSA 3T1RA 5CHJA 5FEGA 4ZJ3A 4HJ4A 3ZNTA 5FQIA 4BBVA 3L9KA 3FG8A 2HJ9C 2WGWA 1K56D 2INWA 2V2FF 2Z2LB 1VM1A 4GS9A 2ZQ9A 1SKOA 1PRQA 2W1RA 1H8YA 3HREA 5A8BA 4HP4A 4OPQA 1W7FA 3UB9A 1L0GA 2B95A 1ZG6A 1GSVA 3NOTC 5A93A 3MFXA 1STZA 3QNCA 3NDGA 4KUKA 2KX6A 3BECA 3IX8A 5FAQA 4IBRA 4DE2A 2O9BA 3T50A 5DTKA 3T4TA 3MFDA 5LBRA 3BYDA 5HWWA 2FFYA 2QPNA 1TEMA 1PW8A 5TJJA 3VOLA 4R1GA 3O86A 4Y0TA 2QZ6A 4KZ6A 3HCYA 1K56A 3MKEA 3S7PA 4JLFA 3Q82A 3KYEA 3MZFA 1K4FA 1L3LA 1NXYA 5DTTA 1HLUP 1S4RA 4Y15A 2DRWA 3T4LA 1OTEA 5JYPA 1SDEA 2PBYA 4X55A 3BQAA 1JNUA 4HHDA 2QJ7A 4PM7A 3HVFA 1FIKA 4Y0UA 2L4RA 3BM6A 2EX9A 3G32A 2RL3A 4GHIB 1JWZA 3RH8B 2G2WA 5EECA 3B33A 1I2SA 1YLJA 1M6KA 4WYYA 1GA9A 1BSGA 3FC7A 1N9NA 4KQDA 3PBNA 5E2GA 4NEED 4HJ6A 3A0VA 3T4SA 1IOUA 1FCNA 5L09A 4DN0A 2HP9A 3P01A 3IBRA 3IX4A 4F3LA 3T4OA 1YAXA 3TG9A 4E3KA 4R6LA 4HY8A 4P6ZM 3W2ZA 3IXGA 5IHVA 3UB6A 4ZRRA 3NDEA 1YSQA 3B3XA 1A0KA 1NLZA 1EW0A 2QKPA 4XUZA 5BOHA 4GZBA 5KZHA 1UWNX 3B47A 1XGIA 4WMCD 2OWJA 3A3IA 3DWKA 4HIAA 2PD7A 3LIDA 1VETB 4QU3A 4QWOA 3VSLA 4II7A 3QP2A 1I5QA 1MWTA 3ZGAB 1XP4A 4NK3A 5EOEA 4QHCA 3UDFA 4MNRA 3DTMA 2W0NA 1F5MA 4KZ9A 2B18A 1GA0A 2X71A 4MMNA 1DP6A 3V39A 3WS4A 2ZC7A 3KSIA 4EEUA 2Y2JA 3Q7VB 4PMAA 1U60A 5KIZA 5KSCA 1W63M 2J8YA 4UEYA 3QNBA 4PM8A 3D4FA 3UDXA 5JYOA 4L9GA 2VGJA 5EFWA 4ETXA 3QHYA 4P0MA 1BTLA 4X1MA 3GRJA 1BT5A 3QP4A 4JGPA 3LI8A 3W4OA 4BL2A 3VV4A 2K7SA 1NYYA 5GLDA 1VEUB 2CMNA 2Y4AA 1EI5A 1OPXA 4LCLA 1IYSA 1TS6A 3LR5A 4EETB 2R9XA 2VEAA 4RA7A 2J9OA 4Q0HA 2UV0E 2HPBA 2BTFP 3P98A 4E3JA 3KX0X 3Q1FA 4OOMA 1KDSA 5F82A 5FQKA 3V67A 1XX2A 3OBFA 3K3DA 2VJWA 2K31A 3ISGA 1K54A 5CXWA 4R4SA 4F94A 1AXBA 1F2KA 1JTGA 2JC7A 4RVAA 1ONHA 4ESPA 2VK3A 3VMAA 1H8MA 1FR1A 1KE4A 1HVBA 4I38A 3EGDC 4R0QA 1NJ4A 3CAXA 3VOZA 3CUEA 3RTYA 4WLAA 4IVIA 3B42A 3NI9A 4NKPA 3LIAA 4GJ4A 4QD4A 4CLCE 3PHYA 5CX7A 4I3AA 3GDIA 1EROA 5F6AA 3NIAA 4QY5A 4B4XA 4X1LA 3OOVA 3N8SA 3LR3A 3OPHA 4UAAA 5HFOA 5CECA 3ITBA 5HAQA 4JBFA 4OP5A 4IBXA 2DNSA 2Y2NA 1ZHHB 3IWIA 5DFXA 2R9WA 3BWLA 5FATA 3HLDA 4RX2A 3T1QB 3GECA 1KGFA 4P87A 1SCWA 2DMWA 2YKFA 3UNWA 3V5MA 2RCXA 2Y2OA 3IXBA 4ARZB 1G28A 4KZBA 4WN5A 2X01A 3LUQA 5AJGA 1ONGA 4D2OA 2OAQ1 1XA7A 3LR4A 2EXBA 2PR6A 3C38A 1IYQA 2WZXA 2ZOHA 1LL5A 3FKVA 4E3IA 4EU0A 4QY6A 2YKHA 2O99A 2EFXA 1PZPA 1FSYA 3IH9A 1LLBA 3HUNA 4GLQA 1ALQA 1V9YA 5TBMA 4ZJ2A 3E98A 2O9CA 2Y2GA 5L07A 3PTEA 3WS1A 4JPMA 4UQIS 1MWRA 3PBOA 3HUOA 4EQIA 3CI6A 4G3KA 3TW8A 1E25A 2VKSA 1TD5A 1LSWA 3SH8A 1PWDA 4DKIA 3LCEA 1SHVA 2WYXA 3V3SA 1ES4A 1XGJA 2VZWA 4KZAA 2IA2A 5AVEA 3KSGA 4OLDA 4IEDA 3H7WA 2PBDP 2EX6A 1WE4A 1D7EA 5EVIA 1MPLA 1OTBA 4HBTA 4N9KA 2WUQA 4M3KA 5CEBA 2P04A 4JF5A 1QMEA 1MY8A 5E43A 1ZC2A 3LEZA 4I3JA 5HL6A 2J3WA 2ZM8A 3KYQA 3F1NB 5G4ZA 1DY6A 4A5RA 3FKWA 5M19A 2PYRA 2OLVA 2BLSA 1PNEA 3GR2A 2WKQA 4OH0A 4DXCA 5CTNA 3D72A 2PU4A 2FFFB 1RGYA 2XR0A 3N8RA 1GHPA 4FOFA 4LCMA 3DW0A 4K0XA 5DF7A 3MXRA 1EWZA 4MEZA 1Y54A 1CEGA 1MKIA 5FDHA 4EV4A 4ZJ1A 2WKPA 4KQOA 1IEMA 3EOIA 4BWIA 4IUHA 3VP3A 4JKTA 1J9MA 2HDQA 4CLCD 3T4JA 3BFDA 4HBUA 1HZOA 4OPYA 2P74A 3F1OB 4HESA 4YOFA 3UE3A 1E3UA 1WA9A 4DJ3A 4R3AA 1K54C 1D06A 1N9BA 2WGWB 2HF6A 1XKZA 5CRFA 4E3NA 1VHMA 5FI2A 1YM1A 2ZM2A 1SKOB 1CI9A 4GDNA 5CHMA 3JVVA 4Y0OA 4X56A 2Q9NA 3S4XA 5CTMA 3CUEC 4Y13A 3IXDA 3R7WA 2VGKA 1YPRA 2HZ5A 1ES3A 4CLCA 4X69A 3E4QA 3O88A 2NUTC 4O7DA 1LHYA 2A24A 3JVUA 3ZG7B 2H28A 3A0RA 4GN2A 4LGWA 3P09A 1GHIA 2HV1A 3G4PA 3SH7A 4WELA 1SKFA 3TSGA 4N92A 4S2MA 2ZL1A 2C5WB 3NECA 1IFQA 1RP5A 3OPLA 4IJGA 4DXBA 4Y5FA 2LB9A 1MZUA 2M1CA 2W1TB 3RFBA 1K57A 3CJMA 3ZG8B 2KLIA 1G6OA 4R3JA 4PM5A 1OMEA 2JKTI 1K55A 1W79A 3AGFA 3D9YA 2X02A 5EM0A 1ERQA 2EA9A 5TGFA 4HNBA 1S6RA 1ESIA 2GDNA 3WWXA 1UWPX 1TDGA 1LI9A 3IWQA 4BLMA 4OLGA 3UY6A 2ZMFA 2B5RA 3T4QA 3DAVA 1XJ6A 2Z6CA 5G4YA 5IU1A 4WUJA 4NXEA 3EQVA 4JF6A 5DTSA 3H9WA 4JGOA 2PRFA 1O7EA 3C30A 3CPTB 4FSFA 4GOGA 1TF1A 1NY0A 1ES2A 5TR7A 2WGVA 4I5SA 4KZ3A 2DCFA 4KZ5A 2IWCA 4OVDA 5GLAA 4B4ZA 2V1AA 4YFMA 3UN7A 4RX3A 2Y2KA 4MBFA 3GV9A 1K4EA 4PHTA 5EV0A 4OQGA 3NHQA 2ZMVA 1LI0A 1NLYA 3C5AA 5AQ7A 2QMIA 4LLOB 4L9EA 5A91A 2PAVP 1Y4OA 5EVIC 2Q0OA 4S2LA 2XA7M 5KMWA 4OQIA 3GTCA 2OOLA 3S7NA 3WS0A 2ACGA 1N4OA 4BD1A 1CK3A 1ERMA 5D3OA 4KG2A 2MJ6A 3G34A 1OTIA 1YMSA 1FSWA 4GHIA 3F1PB 1W8YA 3LYXA 3MXSA 1IKGA 4S2KA 5FI6A 2VX8A 2GX5A 4EUZA 1KOUA 1S0WA 5FI7A 4LV0A 2ZMAA 1KDWA 1KVLA 1JVJA 1YLZA 4S2OA 1LT0A 2XFSA 3VP2A 2H10A 5F1FA 2W3DA 2ZQDA 5EM1A 4MBHA 5FDSA 5HSQA 5C5KA 2BASA 3G2ZA 3NJAA 3PBQA 1NYMA 3LIFA 2V20A 4WBGA 5FAOA 3C4OA 2XF3A 2QYBA 3T1SA 3PBSA 3LI9A 3QP8A 4WMCA 1PWCA 2JKTM 1VETA 3TOIA 1YLTA 4PKYG 1DRMA 3QP1A 3OZHA 4WZ4A 1ZTUA 4HEFA 1CI8A 1M40A 2H5SA 3FV7A 4OPZA 1BYWA 5J3WA 4MLLA 1DJAA 4Q0IA 4XUXA 5HDDA 1FOFA 3G30A 2ZQAA 2J3TD 2WAFA 1S1YA 2VGLM 4KZ4A 1X0OA 3QP6A 4WZ5A 4C3QA 2O0YA 3OC2A 2HP5A 3RXWA 5L10A 4HH3A 2ZC6B 1WYBA 3S22A 3BY9A 4CLCC 3LICA 3W4QA 2EX8A 4X6TA 1OTDA 4IHQA 4EESA 4NXFA 4YWZA 3LFVA 3LGOA 3UB5P 3MQOA 4H8RA 4BL3A 4WF0A 3PYPA 4HI4A 1VEUA 4E3LA 3DWZA 1BLSA 3UE6A 1C3BA 5HD5A 2JN7A 5M1AA 3RXXA 2E8IA 3Q07A 3QP5A 1HTZA 1ZKJA 4DE0A 1K57C 2L0WA 4K08A 4JGQA 5GLBA 2FH5A 4LV2A 3PAGA 3CHWP 1XFNA 2ZLYA 3O5YA 1PZOA 4R38A 5F5YA 4LPZA 3ZQ5A 1S67L 2V8CA 3E2LA 3BJNA 3IBJA 2VLGA 2ZJ9A 2Y2IA 3WS2A 1KE3A 3IHAA 4GD6A 1FQGA 5EUAA 5HPIA 3H82B 4H6JA 4NXGA 3ZVWA 1MBLA 3ULFA 3UMDA 3UPOA 1XFQA 3Q7ZA 2XLNA 3MQQA 3G2YA 4OKPA 2LB5A 3OLOA 2KDKA 2W27A 2XGNA 3CMZA 1PWGA 4KUOA 3WRTA 4E6XA 3MXQA 3IQAA 3GVBA 4UQIM 2L1MA 4DF6A 1CQAA 2V9AA 2AVXA 4N1HA 1NRFA 2JE5A 4R4RA 2W3HA 2JKRI 4I3IA 1I2WA 2Y2LA 3H7WB 2Y55A 4Y17A 5EVIB 1VQQA 4LV3A 2O9AA 2G2UA 4HJ3A 4CQHA 1XA1A 3IXHA 3W8KA 2Y2HA 4DE1A 4OQ0A 3ZG5A 2V0WA 4M4XA 3IF6A 4ARZA 2VV7A 1SDNA 4GNUA 3ZHHA 1T1AA 1YLYA 5HL1A 2GZAA 2WKIA 4BBUA 3ICYA 3A3FA 5DKKA 3NBLA 2OWHA 4B93A 2ZOIA 2P08A 2QWSA 4LRYC 4PM9A 4E6WA 1T19A 1YLPA 3JYIA 5DF8A 1NZUA 4EBNA 5IS1A 2Y91A 2WKHA 3DBAA 4CJNA 3AGDA 5GL9A 4DJ2A 3VP0A 1P97A 4BJPA 2ZQ8A 3ZG9B 2G7UA 4XXRA 4ZBEA 1V9ZA 4GCZA 4BD0A 3VP1A 3ZNYA 5CGSA 2P9VB 1KGEA 3BFFA 4X68A 5CHUA 3NCKA 2C6WB 3G31A 4RQ9A 3IS2B 4MN5A 5J4EA 1JTDA 5EE8A 2XDMA 2PDRA 1L0DA 4CPKA 3HLBA 1G5UA 3UB7A 4WEKA 3VFHA 4IUKA 3ITAA 4Q0JA 3ZDJA 3CG5A 5A90A 1HD8A 1K0KA 4UHUA 3T12B 1FILA 2IWBA 5U47A 1Q2QA 4BMWA 2BG1A 3HBRA 4O8GA 4E3MA 3RJUA 4XT2A 5GHZA 4DDSA 4KG5A 1YT4A 3BEBA 1OJGA 2V1ZA 2XD5A 1MXOA 3LY3A 4UA6A 3F1NA 2PT7A 4KQQA 2D02A 2Y2MA 4ZAMA 2I72A 2HDRA 1YKDA 1F98A 3VP4A 1S1ZA 1T18A 4WZ5C 5CEDA 4R3BA 4S2PA 1MC0A 3C7VA 4U0XA 3C4PA 1PW1A 5I5LA 4GS9B 4S2IA 5HARA 4Z1WA 1ODVA 2WKEA 5FEFA 4DRTA 3E4PA 1LSVA 5KSHA 3BFCA 1BUEA 3SS3A 1DP8A 3M6BA 3HLFA 2ZL1B 1W5DA 5CGXA 1F9IA 2JKRM 5L2FA 1K6RA 4MN7A 3GQZA 2HJEA 3BQ8A 5EOOA 4YINA 5FSRA 3F1OA 2W3FA 4P85A 2M7VA 4AFIA 1H0MA 1YSPA 2ZBBA 1FR6A 5DJTA 2XRNA 4E3OA 3KSFA 1TS8A 3ZCZA 2OLUA 3LR0A 1D1JA 3SOIA 1BZAA 5GHYA 4G3WA 3UE0A 4D60A 1PI5A 3MJQA 5HAIA 4ZDXA 2XFTA 2PU2A 3BFEA 5HD3A 5EVEA 4UA9A 5AVFA 4NG2A 5E2EA 1W63Q 2GJ3A 1JWPA 1XPBA 3WS5A 3ZG0A 1RGZA 1Z6FA 1T1CA 2WGIA 3UDIA 1SZVA 3PBRA 4LV1A 3IWOA 1KGGA 3VFFA 3DTEA 4EBPA 5FQQA 4FCFA 2B02A 3HJKA 4C75A 3N8LA 5F68A 1N9OA 1ACFA 1LL8A 1K6SA 4OPRA 3VOYA 2W1TA 1S66L 4Y2FA 2V8FA 3UMEA 2XK1A 4GB7A 2KOIA 4MCWA 2A49A 2HP6A 2PR5A 5HZHA 2WADA 4HOIA 3DTKA 3BY8A 4F3LB 1ZG4A 3CWFA 1Z09A 4MN6A 3IF6C 1YMXA 2NUPC 4JGRA 3L7HA 1TDLA 2W3GA 3NULA 3Q81A 1OT6A 4OONA 3TJZC 5G18A 3LEQA 5TFQA 2VA0A 1GSWA 3MKFA 2ZC4B 4RYEA 3HUMA 2CC1A 3MS6A 2XEPA 5CERA 1P9WA 1Y28A 1XJ3A 3HJIA 1NWZA 1YQSA 1OT9A 3MBZA 1N9LA 4Y3IA 2PYPA 5FAPA 1JWVA 3CZDA 5DKLA 2XSSA 3JPUA 4QJGA 3CPTA 2K2NA 4R70A 5AQBA 5HWVA 4JXVA 1H8ZA 1G68A 3G35A 4S2JA 5J8XA 2JBFA 1IELA 2QJ5A 3FWLA 4G3VA 4NXBA 3A3DA 2ZQCA 3M2KA 5HW3A 1BLHA 5MC7A 3MZEA 1TS7A 2XA7S 4P6ZS 4U0TA 3O3VA 2XQZA 4QB8A 1OJ5A 2ZQ7A 5HPFA 4U3TA 3FPVA 3EEHA 1PI4A 3EQUA 5GLCA 4B9OA 2JKFA 5A92A 3LO7A 1GHMA 3D3OA 4JF4A 5DVAA 3FYZA 4NETA 5F83A 3F1PA 1L0EA 4FUWA 4MBKA 2Y2QA 5EPHA 3OPRA 3PAEA 2PHYA 4OP8A 3C2WA 4FH2A 1IKIA 1PIOA 2W3EA 2EX2A 3N7WA 3A3JA 2EWWA 3UB8A 2Y8HA 2XD1A 3I7JA 4GDBA 3AGEA 4DDYA 2Z2MB 4BBTA 4BENA 3UO9A 4GW9A 4JXSA 3BW6A 1LSXA 4X53A 1S4SA 4HH2A 3Q7VA 3ZFZA 1PYYA 1DJCA 4FD8A 2XROA 5CGWA 2XH9A 4S2NA 3HLGA 3MR0A 5HX9A 1IYOA 1RCJA 4Q8IA 4EEPA 2WK0A 2A3UA 2FZ0A 3BLSA 1TVFA 4LENA 3FZCA 3E2KA 4KENB 1WYCA 3IF5A 1ESUA 5GHXA 1H3QA 3NC8A 2ZD8A 3GMWA 1TS0A 2P7JA 4FTXA 1FCOA 1VB6A 4ETZA 4WL9A 4PM6A 2WZZA 4EUVA 1T1BA 1BLCA 1BULA 5FQJA 4BQMA 2VGLS 3K2NA 4B88A 2QHKA 1ES5A 5HWTA 2ZM0A 4H6JB 1K55C 3MSHA 5HDCA 3IX3A 4N1XA 2EWVA 2IWDA 4KZ7A 4EWFA 3E0YA 5HAPA 5HDSA 4I39A 3KSHA 4O0PA 2JCHA 5E2HA 3SS5A 4K0WA 1FCMA 3DTIA 2Y79A 3ZVTA 5L8MA 3A3EA 4LFUA 4WM9A 2GNXA 4QPRA 3TE8A
chains in the Genus database with same CATH topology
4IUKA 3NOUC 4Q0JA 1UGUA 2W0NA 3A0SA 1F5MA 5TBMB 2B18A 3E4OA 2EA9A 4HNBA 4MMNA 1DP6A 3SW1A 3KSIA 4EEUA 4PKYA 1UWPX 4BMWA 4O01A 4O8GA 4XT2A 5KIZA 3FPWA 1W63M 2ZMFA 4UEYA 1OJGA 3T4QA 1XJ6A 2Z6CA 3KYZA 5G4YA 3F1NA 2PT7A 4L9GA 5IU1A 4WUJA 5EFWA 4NXEA 3EQVA 4ETXA 2D02A 1YKDA 1F98A 2VV8A 5K5BA 3CLOA 3H9WA 1S1ZA 4JGOA 3T4KA 1T18A 3C30A 3NOPC 1OTAA 4JGPA 3OCLA 3LI8A 4FSFA 2JHEA 3VV4A 2K7SA 1DP9A 1TF1A 2CMNA 1XJ2A 1MC0A 3H82A 1OPXA 4I5SA 2A2LA 3EGXC 1TS6A 3LR5A 4EETB 2V1AA 2VEAA 5I5LA 4GS9B 4PHTA 4Q0HA 4Z1WA 1ODVA 3U2AA 3PXPA 3NHQA 3LIBA 3KX0X 3S7OA 2ZMVA 3E4PA 1LSVA 5KSHA 4OOMA 1NLYA 4L9FA 1DP8A 4LLOB 4L9EA 3V67A 3OBFA 3K3DA 2VJWA 2K31A 4HQAA 3OCNA 2XA7M 4L0LA 1F9IA 2OOLA 2JKRM 3S7NA 4MN7A 4PAUA 2HJEA 5FL3A 3BQ8A 3VE4A 1H8MA 2OAP1 3F1OA 2W3FA 2MJ6A 5F69A 4I38A 3EGDC 2M7VA 3ZYTA 2V1BA 4AFIA 2PD8A 1OTIA 3CAXA 3MMHA 4OOLA 1YSPA 2J80A 5DF9A 4DMZA 2ZBBA 4GHIA 4ME4A 3F1PB 3CUEA 1P0ZA 5DJTA 3LYXA 3RTYA 4WLAA 2XRNA 3B42A 5J7EA 4NKPA 2VX8A 3TRCA 2GX5A 3LIAA 3KSFA 3C8CA 1TS8A 4GJ4A 4CLCE 3PHYA 5CX7A 3LR0A 4XT2B 3P7NA 4I3AA 4EXOA 1KOUA 4G3WA 3GDIA 2D01A 3MJQA 4LRZE 5F6AA 3EEAA 1P9RA 4EW7A 2I9VA 1LT0A 3OOVA 5DJUA 5HD3A 2W3DA 2Z6DA 3LR3A 5AVFA 5HSQA 5C5KA 1W63Q 2GJ3A 2BASA 3NJAA 3PBQA 3LIFA 3R4KA 1ZHHB 1T1CA 5DFXA 3PBRA 1GSXA 3BWLA 3S7QA 3GECA 2QYBA 3PBSA 2DMWA 2YKFA 2B02A 3HJKA 3PBTA 4ARZB 3LI9A 1G28A 4E04A 5F68A 1N9OA 1LL8A 4WN5A 2JKTM 4EQ1A 4WEJA 3KO6A 3LUQA 3IS2A 5AJGA 4PKYG 2W1TA 1DRMA 2OAQ1 1S66L 4Y2FA 3LR4A 3UMEA 2KOIA 2VV6A 4MCWA 2PR6A 3C38A 1ZTUA 2PR5A 2ZOHA 5HZHA 3R7WB 4HOIA 3CITA 4EU0A 2YKHA 2O99A 3BY8A 4F3LB 1XJ4A 2V0UA 3CWFA 4MDZA 1BYWA 5J3WA 4Q0IA 4CLCB 2M7UA 4MN6A 5HDDA 4GLQA 1V9YA 2J3TD 5TBMA 2NUPC 3EWKA 4JGRA 2A24B 2W3GA 1OT6A 3E98A 2O9CA 4HP9A 3TJZC 5IT5A 1S1YA 2VGLM 1X0OA 3MF0A 3LIEA 3G6OA 2O0YA 3OC2A 2VA0A 1GSWA 4UQIS 3PBOA 4HH3A 4EERA 1NRJA 3CI6A 4G3KA 1P9WA 3TW8A 4YNRA 1Y28A 3BY9A 3K3CA 5DFYA 2VKSA 1XJ3A 3HJIA 1NWZA 3VE3A 4CLCC 3LICA 1OT9A 1TD5A 1N9LA 4Y3IA 3PR6A 1LSWA 2PYPA 1OTDA 4IHQA 4EESA 4NXFA 2J3TC 5DKLA 4YWZA 2XSSA 3MQ0A 4LRXC 2HGVA 3LFVA 2WKRA 2R78A 2VZWA 1MKMA 3MQOA 2IA2A 2K2NA 4R70A 4WF0A 3PYPA 5AVEA 3KSGA 4HI4A 5HWVA 4HJ4A 4BBVA 3UE6A 3H7WA 5HD5A 2JN7A 1D7EA 1OTBA 3FG8A 2HJ9C 2QJ5A 4G3VA 4NXBA 2INWA 2L0WA 2P04A 4K08A 4JGQA 2FH5A 4GS9A 1XFNA 2W1RA 4I3JA 5MC7A 5HL6A 3O5YA 2J3WA 5A8BA 4HP4A 3KYQA 4R38A 3F1NB 5F5YA 5G4ZA 4LPZA 3ZQ5A 1TS7A 3UB9A 2XA7S 4P6ZS 1GSVA 3NOTC 1S67L 3MFXA 1STZA 3BJNA 3IBJA 2VLGA 2PYRA 1OJ5A 2WKQA 5HPFA 4KUKA 3D72A 2KX6A 3FPVA 3EEHA 3EQUA 5HPIA 3H82B 2O9BA 4H6JA 4NXGA 3T50A 4B9OA 4FOFA 3T4TA 3D3OA 5LBRA 5HWWA 3F1PA 3ULFA 3UMDA 1XFQA 5TJJA 2WKPA 3VOLA 3MQQA 3HCYA 4KQOA 2PHYA 3C2WA 2LB5A 3S7PA 3OLOA 2KDKA 2W27A 3EOIA 4BWIA 4KUOA 4IUHA 2W3EA 2EWWA 3MXQA 1S4RA 3UB8A 3T4LA 4UQIM 2Y8HA 1OTEA 4CLCD 2L1MA 3T4JA 2V9AA 4BBTA 4GW9A 3BQAA 1JNUA 3BW6A 1LSXA 3F1OB 4HHDA 2QJ7A 4YOFA 3UE3A 2W3HA 1S4SA 2JKRI 2L4RA 4I3IA 1WA9A 4HH2A 4DJ3A 4R3AA 3H7WB 2XROA 4GHIB 3RH8B 2O9AA 3MR0A 1D06A 3B33A 4HJ3A 4CQHA 4EEPA 2HF6A 2FZ0A 1VHMA 2V0WA 4M4XA 4ARZA 2VV7A 3FC7A 1H3QA 1T1AA 1N9NA 4KQDA 2GZAA 3PBNA 4BBUA 3ICYA 4NEED 3JVVA 4HJ6A 1TS0A 2P7JA 3A0VA 5DKKA 3T4SA 2OWHA 4B93A 2ZOIA 1VB6A 4ETZA 2P08A 2QWSA 3CUEC 4LRYC 4WL9A 1IOUA 4DN0A 3P01A 1T19A 3R7WA 3IBRA 4EUVA 4F3LA 3T4OA 1T1BA 1YAXA 5IS1A 4R6LA 4HY8A 3DBAA 3K2NA 2VGLS 4P6ZM 4CLCA 3W2ZA 2QHKA 3E4QA 2NUTC 3UB6A 2A24A 3JVUA 4ZRRA 4DJ2A 5HWTA 1P97A 2H28A 1YSQA 3A0RA 4BJPA 1NLZA 1EW0A 2QKPA 4H6JB 2G7UA 2HV1A 5HDCA 2EWVA 1V9ZA 3E0YA 4GCZA 1UWNX 3B47A 4WELA 4I39A 5HDSA 3KSHA 2OWJA 4O0PA 1IFQA 4HIAA 2PD7A 3LIDA 4IJGA 2Y79A 4Y5FA 4RQ9A 2LB9A 3IS2B 4MN5A 5J4EA 1MZUA 2M1CA 2W1TB 3RFBA 4II7A 5L8MA 2PDRA 2KLIA 1G6OA 2GNXA 4QPRA 3UB7A 4WEKA 3TE8A 2JKTI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEE D;  4UQI S;  1NRJ A;  2XA7 S;  4UQI M;  4P6Z S;  2HF6 A;  2XA7 M;  2VGL S;  4P6Z M;  2JKR M;  2JKT M;  1W63 Q;  3TJZ C;  2FH5 A;  2VGL M;  2JKR I;  1W63 M;  2JKT I;  5MC7 A; 
#chains in the Genus database with same CATH topology
 3HLC A;  3NOU C;  1L2S A;  1UGU A;  5FQM A;  2Y2P A;  1H5X A;  3BLM A;  1K25 A;  3A0S A;  4KG6 A;  2E8J A;  1PFL A;  5TBM B;  3V50 A;  3E4O A;  4UA7 A;  3SW1 A;  3SZT A;  3OPP A;  4PKY A;  1K38 A;  4O01 A;  3FPW A;  2Q9M A;  4PPR A;  3HL9 A;  3KYZ A;  5EVL A;  3IF6 B;  5AQ9 A;  3M6H A;  2VV8 A;  5K5B A;  3T1X A;  3SS4 A;  3CLO A;  5E2F A;  3T4K A;  3NY4 A;  1DJB A;  3NOP C;  1OTA A;  3OCL A;  2H0T A;  2JHE A;  4JXG A;  1QMF A;  1LL9 A;  1DP9 A;  1J3W A;  4R23 A;  5EVI D;  1XJ2 A;  3H82 A;  1O07 A;  2A2L A;  3EGX C;  4DE3 A;  3UPP A;  1AWI A;  3U2A A;  3PXP A;  3M2J A;  1CJF A;  3O87 A;  3LIB A;  3S1Y A;  3S7O A;  2ZC3 B;  4L9F A;  1CF0 A;  2EFU A;  4P6B A;  3MZD A;  4HQA A;  5FAS A;  3OCN A;  5F1G A;  4L0L A;  1IYP A;  4PAU A;  4KQR A;  5FL3 A;  3VE4 A;  2OAP 1;  5F69 A;  2J9P A;  3GSG A;  3SH9 A;  3ZYT A;  2V1B A;  3UPN A;  2EXA A;  2PD8 A;  4EBL A;  3MMH A;  4OOL A;  4DMZ A;  2J80 A;  5DF9 A;  5FA7 A;  2HDU A;  4ME4 A;  1P0Z A;  3BFG A;  5J7E A;  3TRC A;  1KVM A;  3C8C A;  1NZO A;  4XT2 B;  3P7N A;  4EXO A;  3IH8 A;  3BRM A;  4Y7P A;  4KZ8 A;  5M18 A;  2D01 A;  4LRZ E;  4X25 A;  3EEA A;  1P9R A;  3LY4 A;  2OSU A;  4EW7 A;  4OQH A;  2I9V A;  2WAE A;  5DJU A;  2Z6D A;  4GKU A;  4C6Y A;  1E3U D;  4IVK A;  3UE1 A;  5AQA A;  3WRZ A;  4N9L A;  3R4K A;  4Z9Q A;  1GSX A;  3S7Q A;  1KE0 A;  3U4L P;  3PBT A;  2ZC5 B;  2P9V A;  4ID4 A;  4E04 A;  2UWX A;  1G6A A;  4EQ1 A;  4WEJ A;  3KO6 A;  3IS2 A;  4JXW A;  2JKG A;  2J7V A;  2VV6 A;  4S2N C;  3N4I A;  2H0Y A;  3R7W B;  3CIT A;  2Y59 A;  4OOY A;  1XJ4 A;  2V0U A;  4MDZ A;  4CLC B;  2M7U A;  3IT9 A;  3C7U A;  4FH4 A;  3EWK A;  2A24 B;  3W4P A;  4ZTK A;  4HP9 A;  3HLE A;  5IT5 A;  1BLP A;  2HDS A;  3MF0 A;  3LIE A;  3G6O A;  1L0F A;  4K91 A;  3HLW A;  1E4D A;  1GCE A;  4EER A;  1NRJ A;  4GD8 A;  1MWU A;  1XXM A;  2OV5 A;  3N6I A;  4YNR A;  3K3C A;  5DFY A;  1YLW A;  3VE3 A;  5I94 A;  3PR6 A;  3V3R A;  2J3T C;  3MQ0 A;  4LRX C;  2HGV A;  3VSK A;  2WKR A;  1W8Q A;  3IHB A;  2R78 A;  1MKM A;  5FQ9 A;  1Q2P A;  1CEF A;  1MWS A;  3T1R A;  5CHJ A;  5FEG A;  4ZJ3 A;  4HJ4 A;  3ZNT A;  5FQI A;  4BBV A;  3L9K A;  3FG8 A;  2HJ9 C;  2WGW A;  1K56 D;  2INW A;  2V2F F;  2Z2L B;  1VM1 A;  4GS9 A;  2ZQ9 A;  1SKO A;  1PRQ A;  2W1R A;  1H8Y A;  3HRE A;  5A8B A;  4HP4 A;  4OPQ A;  1W7F A;  3UB9 A;  1L0G A;  2B95 A;  1ZG6 A;  1GSV A;  3NOT C;  5A93 A;  3MFX A;  1STZ A;  3QNC A;  3NDG A;  4KUK A;  2KX6 A;  3BEC A;  3IX8 A;  5FAQ A;  4IBR A;  4DE2 A;  2O9B A;  3T50 A;  5DTK A;  3T4T A;  3MFD A;  5LBR A;  3BYD A;  5HWW A;  2FFY A;  2QPN A;  1TEM A;  1PW8 A;  5TJJ A;  3VOL A;  4R1G A;  3O86 A;  4Y0T A;  2QZ6 A;  4KZ6 A;  3HCY A;  1K56 A;  3MKE A;  3S7P A;  4JLF A;  3Q82 A;  3KYE A;  3MZF A;  1K4F A;  1L3L A;  1NXY A;  5DTT A;  1HLU P;  1S4R A;  4Y15 A;  2DRW A;  3T4L A;  1OTE A;  5JYP A;  1SDE A;  2PBY A;  4X55 A;  3BQA A;  1JNU A;  4HHD A;  2QJ7 A;  4PM7 A;  3HVF A;  1FIK A;  4Y0U A;  2L4R A;  3BM6 A;  2EX9 A;  3G32 A;  2RL3 A;  4GHI B;  1JWZ A;  3RH8 B;  2G2W A;  5EEC A;  3B33 A;  1I2S A;  1YLJ A;  1M6K A;  4WYY A;  1GA9 A;  1BSG A;  3FC7 A;  1N9N A;  4KQD A;  3PBN A;  5E2G A;  4NEE D;  4HJ6 A;  3A0V A;  3T4S A;  1IOU A;  1FCN A;  5L09 A;  4DN0 A;  2HP9 A;  3P01 A;  3IBR A;  3IX4 A;  4F3L A;  3T4O A;  1YAX A;  3TG9 A;  4E3K A;  4R6L A;  4HY8 A;  4P6Z M;  3W2Z A;  3IXG A;  5IHV A;  3UB6 A;  4ZRR A;  3NDE A;  1YSQ A;  3B3X A;  1A0K A;  1NLZ A;  1EW0 A;  2QKP A;  4XUZ A;  5BOH A;  4GZB A;  5KZH A;  1UWN X;  3B47 A;  1XGI A;  4WMC D;  2OWJ A;  3A3I A;  3DWK A;  4HIA A;  2PD7 A;  3LID A;  1VET B;  4QU3 A;  4QWO A;  3VSL A;  4II7 A;  3QP2 A;  1I5Q A;  1MWT A;  3ZGA B;  1XP4 A;  4NK3 A;  5EOE A;  4QHC A;  3UDF A;  4MNR A;  3DTM A;  2W0N A;  1F5M A;  4KZ9 A;  2B18 A;  1GA0 A;  2X71 A;  4MMN A;  1DP6 A;  3V39 A;  3WS4 A;  2ZC7 A;  3KSI A;  4EEU A;  2Y2J A;  3Q7V B;  4PMA A;  1U60 A;  5KIZ A;  5KSC A;  1W63 M;  2J8Y A;  4UEY A;  3QNB A;  4PM8 A;  3D4F A;  3UDX A;  5JYO A;  4L9G A;  2VGJ A;  5EFW A;  4ETX A;  3QHY A;  4P0M A;  1BTL A;  4X1M A;  3GRJ A;  1BT5 A;  3QP4 A;  4JGP A;  3LI8 A;  3W4O A;  4BL2 A;  3VV4 A;  2K7S A;  1NYY A;  5GLD A;  1VEU B;  2CMN A;  2Y4A A;  1EI5 A;  1OPX A;  4LCL A;  1IYS A;  1TS6 A;  3LR5 A;  4EET B;  2R9X A;  2VEA A;  4RA7 A;  2J9O A;  4Q0H A;  2UV0 E;  2HPB A;  2BTF P;  3P98 A;  4E3J A;  3KX0 X;  3Q1F A;  4OOM A;  1KDS A;  5F82 A;  5FQK A;  3V67 A;  1XX2 A;  3OBF A;  3K3D A;  2VJW A;  2K31 A;  3ISG A;  1K54 A;  5CXW A;  4R4S A;  4F94 A;  1AXB A;  1F2K A;  1JTG A;  2JC7 A;  4RVA A;  1ONH A;  4ESP A;  2VK3 A;  3VMA A;  1H8M A;  1FR1 A;  1KE4 A;  1HVB A;  4I38 A;  3EGD C;  4R0Q A;  1NJ4 A;  3CAX A;  3VOZ A;  3CUE A;  3RTY A;  4WLA A;  4IVI A;  3B42 A;  3NI9 A;  4NKP A;  3LIA A;  4GJ4 A;  4QD4 A;  4CLC E;  3PHY A;  5CX7 A;  4I3A A;  3GDI A;  1ERO A;  5F6A A;  3NIA A;  4QY5 A;  4B4X A;  4X1L A;  3OOV A;  3N8S A;  3LR3 A;  3OPH A;  4UAA A;  5HFO A;  5CEC A;  3ITB A;  5HAQ A;  4JBF A;  4OP5 A;  4IBX A;  2DNS A;  2Y2N A;  1ZHH B;  3IWI A;  5DFX A;  2R9W A;  3BWL A;  5FAT A;  3HLD A;  4RX2 A;  3T1Q B;  3GEC A;  1KGF A;  4P87 A;  1SCW A;  2DMW A;  2YKF A;  3UNW A;  3V5M A;  2RCX A;  2Y2O A;  3IXB A;  4ARZ B;  1G28 A;  4KZB A;  4WN5 A;  2X01 A;  3LUQ A;  5AJG A;  1ONG A;  4D2O A;  2OAQ 1;  1XA7 A;  3LR4 A;  2EXB A;  2PR6 A;  3C38 A;  1IYQ A;  2WZX A;  2ZOH A;  1LL5 A;  3FKV A;  4E3I A;  4EU0 A;  4QY6 A;  2YKH A;  2O99 A;  2EFX A;  1PZP A;  1FSY A;  3IH9 A;  1LLB A;  3HUN A;  4GLQ A;  1ALQ A;  1V9Y A;  5TBM A;  4ZJ2 A;  3E98 A;  2O9C A;  2Y2G A;  5L07 A;  3PTE A;  3WS1 A;  4JPM A;  4UQI S;  1MWR A;  3PBO A;  3HUO A;  4EQI A;  3CI6 A;  4G3K A;  3TW8 A;  1E25 A;  2VKS A;  1TD5 A;  1LSW A;  3SH8 A;  1PWD A;  4DKI A;  3LCE A;  1SHV A;  2WYX A;  3V3S A;  1ES4 A;  1XGJ A;  2VZW A;  4KZA A;  2IA2 A;  5AVE A;  3KSG A;  4OLD A;  4IED A;  3H7W A;  2PBD P;  2EX6 A;  1WE4 A;  1D7E A;  5EVI A;  1MPL A;  1OTB A;  4HBT A;  4N9K A;  2WUQ A;  4M3K A;  5CEB A;  2P04 A;  4JF5 A;  1QME A;  1MY8 A;  5E43 A;  1ZC2 A;  3LEZ A;  4I3J A;  5HL6 A;  2J3W A;  2ZM8 A;  3KYQ A;  3F1N B;  5G4Z A;  1DY6 A;  4A5R A;  3FKW A;  5M19 A;  2PYR A;  2OLV A;  2BLS A;  1PNE A;  3GR2 A;  2WKQ A;  4OH0 A;  4DXC A;  5CTN A;  3D72 A;  2PU4 A;  2FFF B;  1RGY A;  2XR0 A;  3N8R A;  1GHP A;  4FOF A;  4LCM A;  3DW0 A;  4K0X A;  5DF7 A;  3MXR A;  1EWZ A;  4MEZ A;  1Y54 A;  1CEG A;  1MKI A;  5FDH A;  4EV4 A;  4ZJ1 A;  2WKP A;  4KQO A;  1IEM A;  3EOI A;  4BWI A;  4IUH A;  3VP3 A;  4JKT A;  1J9M A;  2HDQ A;  4CLC D;  3T4J A;  3BFD A;  4HBU A;  1HZO A;  4OPY A;  2P74 A;  3F1O B;  4HES A;  4YOF A;  3UE3 A;  1E3U A;  1WA9 A;  4DJ3 A;  4R3A A;  1K54 C;  1D06 A;  1N9B A;  2WGW B;  2HF6 A;  1XKZ A;  5CRF A;  4E3N A;  1VHM A;  5FI2 A;  1YM1 A;  2ZM2 A;  1SKO B;  1CI9 A;  4GDN A;  5CHM A;  3JVV A;  4Y0O A;  4X56 A;  2Q9N A;  3S4X A;  5CTM A;  3CUE C;  4Y13 A;  3IXD A;  3R7W A;  2VGK A;  1YPR A;  2HZ5 A;  1ES3 A;  4CLC A;  4X69 A;  3E4Q A;  3O88 A;  2NUT C;  4O7D A;  1LHY A;  2A24 A;  3JVU A;  3ZG7 B;  2H28 A;  3A0R A;  4GN2 A;  4LGW A;  3P09 A;  1GHI A;  2HV1 A;  3G4P A;  3SH7 A;  4WEL A;  1SKF A;  3TSG A;  4N92 A;  4S2M A;  2ZL1 A;  2C5W B;  3NEC A;  1IFQ A;  1RP5 A;  3OPL A;  4IJG A;  4DXB A;  4Y5F A;  2LB9 A;  1MZU A;  2M1C A;  2W1T B;  3RFB A;  1K57 A;  3CJM A;  3ZG8 B;  2KLI A;  1G6O A;  4R3J A;  4PM5 A;  1OME A;  2JKT I;  1K55 A;  1W79 A;  3AGF A;  3D9Y A;  2X02 A;  5EM0 A;  1ERQ A;  2EA9 A;  5TGF A;  4HNB A;  1S6R A;  1ESI A;  2GDN A;  3WWX A;  1UWP X;  1TDG A;  1LI9 A;  3IWQ A;  4BLM A;  4OLG A;  3UY6 A;  2ZMF A;  2B5R A;  3T4Q A;  3DAV A;  1XJ6 A;  2Z6C A;  5G4Y A;  5IU1 A;  4WUJ A;  4NXE A;  3EQV A;  4JF6 A;  5DTS A;  3H9W A;  4JGO A;  2PRF A;  1O7E A;  3C30 A;  3CPT B;  4FSF A;  4GOG A;  1TF1 A;  1NY0 A;  1ES2 A;  5TR7 A;  2WGV A;  4I5S A;  4KZ3 A;  2DCF A;  4KZ5 A;  2IWC A;  4OVD A;  5GLA A;  4B4Z A;  2V1A A;  4YFM A;  3UN7 A;  4RX3 A;  2Y2K A;  4MBF A;  3GV9 A;  1K4E A;  4PHT A;  5EV0 A;  4OQG A;  3NHQ A;  2ZMV A;  1LI0 A;  1NLY A;  3C5A A;  5AQ7 A;  2QMI A;  4LLO B;  4L9E A;  5A91 A;  2PAV P;  1Y4O A;  5EVI C;  2Q0O A;  4S2L A;  2XA7 M;  5KMW A;  4OQI A;  3GTC A;  2OOL A;  3S7N A;  3WS0 A;  2ACG A;  1N4O A;  4BD1 A;  1CK3 A;  1ERM A;  5D3O A;  4KG2 A;  2MJ6 A;  3G34 A;  1OTI A;  1YMS A;  1FSW A;  4GHI A;  3F1P B;  1W8Y A;  3LYX A;  3MXS A;  1IKG A;  4S2K A;  5FI6 A;  2VX8 A;  2GX5 A;  4EUZ A;  1KOU A;  1S0W A;  5FI7 A;  4LV0 A;  2ZMA A;  1KDW A;  1KVL A;  1JVJ A;  1YLZ A;  4S2O A;  1LT0 A;  2XFS A;  3VP2 A;  2H10 A;  5F1F A;  2W3D A;  2ZQD A;  5EM1 A;  4MBH A;  5FDS A;  5HSQ A;  5C5K A;  2BAS A;  3G2Z A;  3NJA A;  3PBQ A;  1NYM A;  3LIF A;  2V20 A;  4WBG A;  5FAO A;  3C4O A;  2XF3 A;  2QYB A;  3T1S A;  3PBS A;  3LI9 A;  3QP8 A;  4WMC A;  1PWC A;  2JKT M;  1VET A;  3TOI A;  1YLT A;  4PKY G;  1DRM A;  3QP1 A;  3OZH A;  4WZ4 A;  1ZTU A;  4HEF A;  1CI8 A;  1M40 A;  2H5S A;  3FV7 A;  4OPZ A;  1BYW A;  5J3W A;  4MLL A;  1DJA A;  4Q0I A;  4XUX A;  5HDD A;  1FOF A;  3G30 A;  2ZQA A;  2J3T D;  2WAF A;  1S1Y A;  2VGL M;  4KZ4 A;  1X0O A;  3QP6 A;  4WZ5 A;  4C3Q A;  2O0Y A;  3OC2 A;  2HP5 A;  3RXW A;  5L10 A;  4HH3 A;  2ZC6 B;  1WYB A;  3S22 A;  3BY9 A;  4CLC C;  3LIC A;  3W4Q A;  2EX8 A;  4X6T A;  1OTD A;  4IHQ A;  4EES A;  4NXF A;  4YWZ A;  3LFV A;  3LGO A;  3UB5 P;  3MQO A;  4H8R A;  4BL3 A;  4WF0 A;  3PYP A;  4HI4 A;  1VEU A;  4E3L A;  3DWZ A;  1BLS A;  3UE6 A;  1C3B A;  5HD5 A;  2JN7 A;  5M1A A;  3RXX A;  2E8I A;  3Q07 A;  3QP5 A;  1HTZ A;  1ZKJ A;  4DE0 A;  1K57 C;  2L0W A;  4K08 A;  4JGQ A;  5GLB A;  2FH5 A;  4LV2 A;  3PAG A;  3CHW P;  1XFN A;  2ZLY A;  3O5Y A;  1PZO A;  4R38 A;  5F5Y A;  4LPZ A;  3ZQ5 A;  1S67 L;  2V8C A;  3E2L A;  3BJN A;  3IBJ A;  2VLG A;  2ZJ9 A;  2Y2I A;  3WS2 A;  1KE3 A;  3IHA A;  4GD6 A;  1FQG A;  5EUA A;  5HPI A;  3H82 B;  4H6J A;  4NXG A;  3ZVW A;  1MBL A;  3ULF A;  3UMD A;  3UPO A;  1XFQ A;  3Q7Z A;  2XLN A;  3MQQ A;  3G2Y A;  4OKP A;  2LB5 A;  3OLO A;  2KDK A;  2W27 A;  2XGN A;  3CMZ A;  1PWG A;  4KUO A;  3WRT A;  4E6X A;  3MXQ A;  3IQA A;  3GVB A;  4UQI M;  2L1M A;  4DF6 A;  1CQA A;  2V9A A;  2AVX A;  4N1H A;  1NRF A;  2JE5 A;  4R4R A;  2W3H A;  2JKR I;  4I3I A;  1I2W A;  2Y2L A;  3H7W B;  2Y55 A;  4Y17 A;  5EVI B;  1VQQ A;  4LV3 A;  2O9A A;  2G2U A;  4HJ3 A;  4CQH A;  1XA1 A;  3IXH A;  3W8K A;  2Y2H A;  4DE1 A;  4OQ0 A;  3ZG5 A;  2V0W A;  4M4X A;  3IF6 A;  4ARZ A;  2VV7 A;  1SDN A;  4GNU A;  3ZHH A;  1T1A A;  1YLY A;  5HL1 A;  2GZA A;  2WKI A;  4BBU A;  3ICY A;  3A3F A;  5DKK A;  3NBL A;  2OWH A;  4B93 A;  2ZOI A;  2P08 A;  2QWS A;  4LRY C;  4PM9 A;  4E6W A;  1T19 A;  1YLP A;  3JYI A;  5DF8 A;  1NZU A;  4EBN A;  5IS1 A;  2Y91 A;  2WKH A;  3DBA A;  4CJN A;  3AGD A;  5GL9 A;  4DJ2 A;  3VP0 A;  1P97 A;  4BJP A;  2ZQ8 A;  3ZG9 B;  2G7U A;  4XXR A;  4ZBE A;  1V9Z A;  4GCZ A;  4BD0 A;  3VP1 A;  3ZNY A;  5CGS A;  2P9V B;  1KGE A;  3BFF A;  4X68 A;  5CHU A;  3NCK A;  2C6W B;  3G31 A;  4RQ9 A;  3IS2 B;  4MN5 A;  5J4E A;  1JTD A;  5EE8 A;  2XDM A;  2PDR A;  1L0D A;  4CPK A;  3HLB A;  1G5U A;  3UB7 A;  4WEK A;  3VFH A;  4IUK A;  3ITA A;  4Q0J A;  3ZDJ A;  3CG5 A;  5A90 A;  1HD8 A;  1K0K A;  4UHU A;  3T12 B;  1FIL A;  2IWB A;  5U47 A;  1Q2Q A;  4BMW A;  2BG1 A;  3HBR A;  4O8G A;  4E3M A;  3RJU A;  4XT2 A;  5GHZ A;  4DDS A;  4KG5 A;  1YT4 A;  3BEB A;  1OJG A;  2V1Z A;  2XD5 A;  1MXO A;  3LY3 A;  4UA6 A;  3F1N A;  2PT7 A;  4KQQ A;  2D02 A;  2Y2M A;  4ZAM A;  2I72 A;  2HDR A;  1YKD A;  1F98 A;  3VP4 A;  1S1Z A;  1T18 A;  4WZ5 C;  5CED A;  4R3B A;  4S2P A;  1MC0 A;  3C7V A;  4U0X A;  3C4P A;  1PW1 A;  5I5L A;  4GS9 B;  4S2I A;  5HAR A;  4Z1W A;  1ODV A;  2WKE A;  5FEF A;  4DRT A;  3E4P A;  1LSV A;  5KSH A;  3BFC A;  1BUE A;  3SS3 A;  1DP8 A;  3M6B A;  3HLF A;  2ZL1 B;  1W5D A;  5CGX A;  1F9I A;  2JKR M;  5L2F A;  1K6R A;  4MN7 A;  3GQZ A;  2HJE A;  3BQ8 A;  5EOO A;  4YIN A;  5FSR A;  3F1O A;  2W3F A;  4P85 A;  2M7V A;  4AFI A;  1H0M A;  1YSP A;  2ZBB A;  1FR6 A;  5DJT A;  2XRN A;  4E3O A;  3KSF A;  1TS8 A;  3ZCZ A;  2OLU A;  3LR0 A;  1D1J A;  3SOI A;  1BZA A;  5GHY A;  4G3W A;  3UE0 A;  4D60 A;  1PI5 A;  3MJQ A;  5HAI A;  4ZDX A;  2XFT A;  2PU2 A;  3BFE A;  5HD3 A;  5EVE A;  4UA9 A;  5AVF A;  4NG2 A;  5E2E A;  1W63 Q;  2GJ3 A;  1JWP A;  1XPB A;  3WS5 A;  3ZG0 A;  1RGZ A;  1Z6F A;  1T1C A;  2WGI A;  3UDI A;  1SZV A;  3PBR A;  4LV1 A;  3IWO A;  1KGG A;  3VFF A;  3DTE A;  4EBP A;  5FQQ A;  4FCF A;  2B02 A;  3HJK A;  4C75 A;  3N8L A;  5F68 A;  1N9O A;  1ACF A;  1LL8 A;  1K6S A;  4OPR A;  3VOY A;  2W1T A;  1S66 L;  4Y2F A;  2V8F A;  3UME A;  2XK1 A;  4GB7 A;  2KOI A;  4MCW A;  2A49 A;  2HP6 A;  2PR5 A;  5HZH A;  2WAD A;  4HOI A;  3DTK A;  3BY8 A;  4F3L B;  1ZG4 A;  3CWF A;  1Z09 A;  4MN6 A;  3IF6 C;  1YMX A;  2NUP C;  4JGR A;  3L7H A;  1TDL A;  2W3G A;  3NUL A;  3Q81 A;  1OT6 A;  4OON A;  3TJZ C;  5G18 A;  3LEQ A;  5TFQ A;  2VA0 A;  1GSW A;  3MKF A;  2ZC4 B;  4RYE A;  3HUM A;  2CC1 A;  3MS6 A;  2XEP A;  5CER A;  1P9W A;  1Y28 A;  1XJ3 A;  3HJI A;  1NWZ A;  1YQS A;  1OT9 A;  3MBZ A;  1N9L A;  4Y3I A;  2PYP A;  5FAP A;  1JWV A;  3CZD A;  5DKL A;  2XSS A;  3JPU A;  4QJG A;  3CPT A;  2K2N A;  4R70 A;  5AQB A;  5HWV A;  4JXV A;  1H8Z A;  1G68 A;  3G35 A;  4S2J A;  5J8X A;  2JBF A;  1IEL A;  2QJ5 A;  3FWL A;  4G3V A;  4NXB A;  3A3D A;  2ZQC A;  3M2K A;  5HW3 A;  1BLH A;  5MC7 A;  3MZE A;  1TS7 A;  2XA7 S;  4P6Z S;  4U0T A;  3O3V A;  2XQZ A;  4QB8 A;  1OJ5 A;  2ZQ7 A;  5HPF A;  4U3T A;  3FPV A;  3EEH A;  1PI4 A;  3EQU A;  5GLC A;  4B9O A;  2JKF A;  5A92 A;  3LO7 A;  1GHM A;  3D3O A;  4JF4 A;  5DVA A;  3FYZ A;  4NET A;  5F83 A;  3F1P A;  1L0E A;  4FUW A;  4MBK A;  2Y2Q A;  5EPH A;  3OPR A;  3PAE A;  2PHY A;  4OP8 A;  3C2W A;  4FH2 A;  1IKI A;  1PIO A;  2W3E A;  2EX2 A;  3N7W A;  3A3J A;  2EWW A;  3UB8 A;  2Y8H A;  2XD1 A;  3I7J A;  4GDB A;  3AGE A;  4DDY A;  2Z2M B;  4BBT A;  4BEN A;  3UO9 A;  4GW9 A;  4JXS A;  3BW6 A;  1LSX A;  4X53 A;  1S4S A;  4HH2 A;  3Q7V A;  3ZFZ A;  1PYY A;  1DJC A;  4FD8 A;  2XRO A;  5CGW A;  2XH9 A;  4S2N A;  3HLG A;  3MR0 A;  5HX9 A;  1IYO A;  1RCJ A;  4Q8I A;  4EEP A;  2WK0 A;  2A3U A;  2FZ0 A;  3BLS A;  1TVF A;  4LEN A;  3FZC A;  3E2K A;  4KEN B;  1WYC A;  3IF5 A;  1ESU A;  5GHX A;  1H3Q A;  3NC8 A;  2ZD8 A;  3GMW A;  1TS0 A;  2P7J A;  4FTX A;  1FCO A;  1VB6 A;  4ETZ A;  4WL9 A;  4PM6 A;  2WZZ A;  4EUV A;  1T1B A;  1BLC A;  1BUL A;  5FQJ A;  4BQM A;  2VGL S;  3K2N A;  4B88 A;  2QHK A;  1ES5 A;  5HWT A;  2ZM0 A;  4H6J B;  1K55 C;  3MSH A;  5HDC A;  3IX3 A;  4N1X A;  2EWV A;  2IWD A;  4KZ7 A;  4EWF A;  3E0Y A;  5HAP A;  5HDS A;  4I39 A;  3KSH A;  4O0P A;  2JCH A;  5E2H A;  3SS5 A;  4K0W A;  1FCM A;  3DTI A;  2Y79 A;  3ZVT A;  5L8M A;  3A3E A;  4LFU A;  4WM9 A;  2GNX A;  4QPR A;  3TE8 A; 
#chains in the Genus database with same CATH homology
 4IUK A;  3NOU C;  4Q0J A;  1UGU A;  2W0N A;  3A0S A;  1F5M A;  5TBM B;  2B18 A;  3E4O A;  2EA9 A;  4HNB A;  4MMN A;  1DP6 A;  3SW1 A;  3KSI A;  4EEU A;  4PKY A;  1UWP X;  4BMW A;  4O01 A;  4O8G A;  4XT2 A;  5KIZ A;  3FPW A;  1W63 M;  2ZMF A;  4UEY A;  1OJG A;  3T4Q A;  1XJ6 A;  2Z6C A;  3KYZ A;  5G4Y A;  3F1N A;  2PT7 A;  4L9G A;  5IU1 A;  4WUJ A;  5EFW A;  4NXE A;  3EQV A;  4ETX A;  2D02 A;  1YKD A;  1F98 A;  2VV8 A;  5K5B A;  3CLO A;  3H9W A;  1S1Z A;  4JGO A;  3T4K A;  1T18 A;  3C30 A;  3NOP C;  1OTA A;  4JGP A;  3OCL A;  3LI8 A;  4FSF A;  2JHE A;  3VV4 A;  2K7S A;  1DP9 A;  1TF1 A;  2CMN A;  1XJ2 A;  1MC0 A;  3H82 A;  1OPX A;  4I5S A;  2A2L A;  3EGX C;  1TS6 A;  3LR5 A;  4EET B;  2V1A A;  2VEA A;  5I5L A;  4GS9 B;  4PHT A;  4Q0H A;  4Z1W A;  1ODV A;  3U2A A;  3PXP A;  3NHQ A;  3LIB A;  3KX0 X;  3S7O A;  2ZMV A;  3E4P A;  1LSV A;  5KSH A;  4OOM A;  1NLY A;  4L9F A;  1DP8 A;  4LLO B;  4L9E A;  3V67 A;  3OBF A;  3K3D A;  2VJW A;  2K31 A;  4HQA A;  3OCN A;  2XA7 M;  4L0L A;  1F9I A;  2OOL A;  2JKR M;  3S7N A;  4MN7 A;  4PAU A;  2HJE A;  5FL3 A;  3BQ8 A;  3VE4 A;  1H8M A;  2OAP 1;  3F1O A;  2W3F A;  2MJ6 A;  5F69 A;  4I38 A;  3EGD C;  2M7V A;  3ZYT A;  2V1B A;  4AFI A;  2PD8 A;  1OTI A;  3CAX A;  3MMH A;  4OOL A;  1YSP A;  2J80 A;  5DF9 A;  4DMZ A;  2ZBB A;  4GHI A;  4ME4 A;  3F1P B;  3CUE A;  1P0Z A;  5DJT A;  3LYX A;  3RTY A;  4WLA A;  2XRN A;  3B42 A;  5J7E A;  4NKP A;  2VX8 A;  3TRC A;  2GX5 A;  3LIA A;  3KSF A;  3C8C A;  1TS8 A;  4GJ4 A;  4CLC E;  3PHY A;  5CX7 A;  3LR0 A;  4XT2 B;  3P7N A;  4I3A A;  4EXO A;  1KOU A;  4G3W A;  3GDI A;  2D01 A;  3MJQ A;  4LRZ E;  5F6A A;  3EEA A;  1P9R A;  4EW7 A;  2I9V A;  1LT0 A;  3OOV A;  5DJU A;  5HD3 A;  2W3D A;  2Z6D A;  3LR3 A;  5AVF A;  5HSQ A;  5C5K A;  1W63 Q;  2GJ3 A;  2BAS A;  3NJA A;  3PBQ A;  3LIF A;  3R4K A;  1ZHH B;  1T1C A;  5DFX A;  3PBR A;  1GSX A;  3BWL A;  3S7Q A;  3GEC A;  2QYB A;  3PBS A;  2DMW A;  2YKF A;  2B02 A;  3HJK A;  3PBT A;  4ARZ B;  3LI9 A;  1G28 A;  4E04 A;  5F68 A;  1N9O A;  1LL8 A;  4WN5 A;  2JKT M;  4EQ1 A;  4WEJ A;  3KO6 A;  3LUQ A;  3IS2 A;  5AJG A;  4PKY G;  2W1T A;  1DRM A;  2OAQ 1;  1S66 L;  4Y2F A;  3LR4 A;  3UME A;  2KOI A;  2VV6 A;  4MCW A;  2PR6 A;  3C38 A;  1ZTU A;  2PR5 A;  2ZOH A;  5HZH A;  3R7W B;  4HOI A;  3CIT A;  4EU0 A;  2YKH A;  2O99 A;  3BY8 A;  4F3L B;  1XJ4 A;  2V0U A;  3CWF A;  4MDZ A;  1BYW A;  5J3W A;  4Q0I A;  4CLC B;  2M7U A;  4MN6 A;  5HDD A;  4GLQ A;  1V9Y A;  2J3T D;  5TBM A;  2NUP C;  3EWK A;  4JGR A;  2A24 B;  2W3G A;  1OT6 A;  3E98 A;  2O9C A;  4HP9 A;  3TJZ C;  5IT5 A;  1S1Y A;  2VGL M;  1X0O A;  3MF0 A;  3LIE A;  3G6O A;  2O0Y A;  3OC2 A;  2VA0 A;  1GSW A;  4UQI S;  3PBO A;  4HH3 A;  4EER A;  1NRJ A;  3CI6 A;  4G3K A;  1P9W A;  3TW8 A;  4YNR A;  1Y28 A;  3BY9 A;  3K3C A;  5DFY A;  2VKS A;  1XJ3 A;  3HJI A;  1NWZ A;  3VE3 A;  4CLC C;  3LIC A;  1OT9 A;  1TD5 A;  1N9L A;  4Y3I A;  3PR6 A;  1LSW A;  2PYP A;  1OTD A;  4IHQ A;  4EES A;  4NXF A;  2J3T C;  5DKL A;  4YWZ A;  2XSS A;  3MQ0 A;  4LRX C;  2HGV A;  3LFV A;  2WKR A;  2R78 A;  2VZW A;  1MKM A;  3MQO A;  2IA2 A;  2K2N A;  4R70 A;  4WF0 A;  3PYP A;  5AVE A;  3KSG A;  4HI4 A;  5HWV A;  4HJ4 A;  4BBV A;  3UE6 A;  3H7W A;  5HD5 A;  2JN7 A;  1D7E A;  1OTB A;  3FG8 A;  2HJ9 C;  2QJ5 A;  4G3V A;  4NXB A;  2INW A;  2L0W A;  2P04 A;  4K08 A;  4JGQ A;  2FH5 A;  4GS9 A;  1XFN A;  2W1R A;  4I3J A;  5MC7 A;  5HL6 A;  3O5Y A;  2J3W A;  5A8B A;  4HP4 A;  3KYQ A;  4R38 A;  3F1N B;  5F5Y A;  5G4Z A;  4LPZ A;  3ZQ5 A;  1TS7 A;  3UB9 A;  2XA7 S;  4P6Z S;  1GSV A;  3NOT C;  1S67 L;  3MFX A;  1STZ A;  3BJN A;  3IBJ A;  2VLG A;  2PYR A;  1OJ5 A;  2WKQ A;  5HPF A;  4KUK A;  3D72 A;  2KX6 A;  3FPV A;  3EEH A;  3EQU A;  5HPI A;  3H82 B;  2O9B A;  4H6J A;  4NXG A;  3T50 A;  4B9O A;  4FOF A;  3T4T A;  3D3O A;  5LBR A;  5HWW A;  3F1P A;  3ULF A;  3UMD A;  1XFQ A;  5TJJ A;  2WKP A;  3VOL A;  3MQQ A;  3HCY A;  4KQO A;  2PHY A;  3C2W A;  2LB5 A;  3S7P A;  3OLO A;  2KDK A;  2W27 A;  3EOI A;  4BWI A;  4KUO A;  4IUH A;  2W3E A;  2EWW A;  3MXQ A;  1S4R A;  3UB8 A;  3T4L A;  4UQI M;  2Y8H A;  1OTE A;  4CLC D;  2L1M A;  3T4J A;  2V9A A;  4BBT A;  4GW9 A;  3BQA A;  1JNU A;  3BW6 A;  1LSX A;  3F1O B;  4HHD A;  2QJ7 A;  4YOF A;  3UE3 A;  2W3H A;  1S4S A;  2JKR I;  2L4R A;  4I3I A;  1WA9 A;  4HH2 A;  4DJ3 A;  4R3A A;  3H7W B;  2XRO A;  4GHI B;  3RH8 B;  2O9A A;  3MR0 A;  1D06 A;  3B33 A;  4HJ3 A;  4CQH A;  4EEP A;  2HF6 A;  2FZ0 A;  1VHM A;  2V0W A;  4M4X A;  4ARZ A;  2VV7 A;  3FC7 A;  1H3Q A;  1T1A A;  1N9N A;  4KQD A;  2GZA A;  3PBN A;  4BBU A;  3ICY A;  4NEE D;  3JVV A;  4HJ6 A;  1TS0 A;  2P7J A;  3A0V A;  5DKK A;  3T4S A;  2OWH A;  4B93 A;  2ZOI A;  1VB6 A;  4ETZ A;  2P08 A;  2QWS A;  3CUE C;  4LRY C;  4WL9 A;  1IOU A;  4DN0 A;  3P01 A;  1T19 A;  3R7W A;  3IBR A;  4EUV A;  4F3L A;  3T4O A;  1T1B A;  1YAX A;  5IS1 A;  4R6L A;  4HY8 A;  3DBA A;  3K2N A;  2VGL S;  4P6Z M;  4CLC A;  3W2Z A;  2QHK A;  3E4Q A;  2NUT C;  3UB6 A;  2A24 A;  3JVU A;  4ZRR A;  4DJ2 A;  5HWT A;  1P97 A;  2H28 A;  1YSQ A;  3A0R A;  4BJP A;  1NLZ A;  1EW0 A;  2QKP A;  4H6J B;  2G7U A;  2HV1 A;  5HDC A;  2EWV A;  1V9Z A;  3E0Y A;  4GCZ A;  1UWN X;  3B47 A;  4WEL A;  4I39 A;  5HDS A;  3KSH A;  2OWJ A;  4O0P A;  1IFQ A;  4HIA A;  2PD7 A;  3LID A;  4IJG A;  2Y79 A;  4Y5F A;  4RQ9 A;  2LB9 A;  3IS2 B;  4MN5 A;  5J4E A;  1MZU A;  2M1C A;  2W1T B;  3RFB A;  4II7 A;  5L8M A;  2PDR A;  2KLI A;  1G6O A;  2GNX A;  4QPR A;  3UB7 A;  4WEK A;  3TE8 A;  2JKT I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...