1W63Q

Ap1 clathrin adaptor core
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
148
structure length
148
Chain Sequence
MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADAPTER-RELATED PROTEIN COMPLEX 1 GAMMA 1 SUBUNIT
publication title Crystal Structure of the Clathrin Adaptor Protein 1 Core
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 45
structure length 148
sequence length 148
chains with identical sequence S, T, U, W, X
ec nomenclature
pdb deposition date 2004-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1w63Q00
1W63Q 2JKRM 2FH5A 2VGLS 2XA7S 3TJZC 2JKRI 4NEED 4P6ZS 2HF6A 4UQIM 1W63M 2JKTM 5MC7A 2VGLM 2XA7M 4P6ZM 1NRJA 2JKTI 4UQIS
chains in the Genus database with same CATH superfamily
2VEAA 2XSSA 1OMEA 5IHVA 4PM9A 3W4QA 1GHMA 5CHMA 2A24A 1QMFA 3C7VA 3M6HA 1PFLA 2ZJ9A 1G6AA 3BLMA 1CJFA 1PI4A 2D01A 5DKLA 1K6SA 4M3KA 4FD8A 2VV8A 2J80A 3LR3A 5FQIA 1K57A 1GSWA 3IXGA 3KO6A 1ZG4A 5EOEA 3E4OA 1FOFA 3MQQA 4II7A 4XXRA 5HD5A 3S7PA 3T12B 3HLWA 3SH7A 3T50A 3W8KA 1G28A 5AVEA 2ZC4B 3SS3A 4EQ1A 3Q7VB 1DP9A 2QWSA 3V3RA 3GQZA 1HD8A 2WUQA 3MQ0A 1W8QA 4KQRA 1BUEA 4OQGA 2P08A 1FCOA 1N9NA 1XA7A 1PYYA 4KZ8A 4GOGA 2V2FF 5F1GA 4E3IA 4MBHA 1VETB 5DJTA 2OWJA 1UWNX 4LGWA 4LCMA 3LFVA 1FIKA 1WA9A 4FOFA 3OOVA 4XUXA 3OLOA 4JXWA 1IFQA 4G3WA 1E3UA 3CZDA 1FILA 3BJNA 2MJ6A 3QHYA 1IYPA 1YSQA 2A3UA 1SHVA 3F1OA 4RA7A 2E8JA 3NJAA 2JE5A 1S6RA 1XXMA 3PAEA 1DJBA 2E8IA 1XJ2A 4KZ4A 4JXGA 3A3FA 1XFNA 2BASA 3H82B 4YOFA 3LEQA 2ZMVA 1Y54A 3IHBA 5BOHA 4WN5A 1RP5A 4FTXA 4NXEA 3MBZA 3IX8A 2FFFB 3ZDJA 3JPUA 2Y2OA 2ZC3B 4IVIA 4HH3A 1T18A 1W7FA 3JYIA 4X25A 2OAQ1 3M6BA 4HP9A 4PMAA 3ZHHA 2UWXA 4R0QA 4GDNA 4IUHA 3H7WA 2VKSA 4WZ5C 4NG2A 4H8RA 4S2KA 4PM6A 3BFFA 4KG2A 4QWOA 3VP4A 1BSGA 4IHQA 5TFQA 3IXBA 4S2OA 3S1YA 3LGOA 2B18A 4BL3A 4ARZA 2CC1A 5HPIA 1SCWA 4HHDA 5DJUA 5CTMA 1BLCA 3PBSA 3A0VA 4I38A 4JKTA 2V20A 2VV7A 3A3EA 1MC0A 3LIBA 5C5KA 4I39A 1C3BA 5HD3A 3VOZA 4XT2B 3EWKA 5HWTA 4DKIA 4MN5A 4CLCE 4OONA 3P7NA 1PWCA 2ZL1B 3HJIA 3A3IA 4JF6A 4OLGA 4C6YA 4PHTA 1IEMA 4S2PA 3IWQA 4EBPA 3S7OA 3WS0A 3T4QA 2Y2JA 4FSFA 2BLSA 1TF1A 3ZNTA 4D2OA 4C3QA 1S67L 1Z6FA 2XH9A 4WLAA 4KZ5A 4WF0A 2DCFA 2W3GA 3I7JA 1XKZA 4KZBA 3S22A 3ZG9B 3S4XA 1NJ4A 2HP6A 1PW1A 1LI9A 1JTDA 3R7WA 2DNSA 2J9OA 3UPPA 4KUOA 3FPWA 4K08A 3BECA 4JLFA 4B4ZA 3C4OA 3VV4A 4BL2A 3DW0A 3NOTC 2VGJA 4WMCD 3DTMA 1YPRA 1PNEA 1OTIA 3NOPC 3OZHA 4M4XA 1W79A 3BYDA 1JWVA 2ZMFA 2W0NA 4HJ6A 2QZ6A 2D02A 5DTSA 1K6RA 1ZC2A 3OBFA 1LSXA 3PHYA 1KOUA 2Y2HA 3DBAA 3NIAA 1NRJA 1FR6A 4DF6A 5EECA 4S2NA 3NCKA 4KQQA 3EQUA 3SZTA 1HLUP 5EVID 1DJAA 4IBRA 4YNRA 4ZDXA 3NHQA 1S0WA 4GD6A 4X55A 3B3XA 1N9BA 4JXSA 4WYYA 2V9AA 4F3LB 2HJEA 2ZOHA 3O5YA 3ZFZA 2J7VA 5AQ9A 2WZZA 3BFGA 2EXAA 4QJGA 1LT0A 1TDGA 5HDCA 3A3JA 3NULA 4LENA 3RFBA 4RVAA 3QNCA 3T4SA 3N4IA 3Q1FA 2R78A 4NXGA 1QMEA 3AGFA 4WZ4A 4HQAA 1DY6A 5J3WA 4GLQA 4D60A 2XEPA 3LIEA 1KVLA 4E3OA 3C4PA 3CUEC 3LYXA 4YWZA 4BBTA 5IS1A 4KZ3A 2X71A 2IWBA 4Y2FA 4ETZA 1IYSA 4N9KA 3VE3A 4OH0A 2ZC7A 3MXRA 5HPFA 4IUKA 3EGXC 3HLBA 4LV0A 2X02A 3LY3A 4WM9A 4UQIM 5E2FA 2A24B 1K56A 2QYBA 4BD1A 4G3VA 3KYQA 2XA7M 1PWDA 3VMAA 3F1PA 3CPTB 4ZTKA 5CXWA 5AQ7A 1GA9A 1VEUB 2JBFA 1H8YA 4RQ9A 2Y55A 1IELA 4UA7A 3KSGA 4P0MA 2WKEA 3GTCA 4OOYA 3L7HA 3V50A 5EVIC 2PR6A 5F6AA 5AJGA 1BLSA 3T4TA 1NYMA 1TVFA 3IF6B 2ZM0A 4YFMA 5FDHA 1VB6A 3UDIA 1F9IA 1XPBA 2W27A 2EFXA 1YKDA 3UE3A 1CEGA 2OOLA 2JKRI 2Q0OA 3N6IA 2I72A 3GV9A 1S66L 1VM1A 3ZG0A 2ZQCA 4X1LA 5AQBA 2HDSA 3NY4A 3WWXA 2PAVP 3K3CA 3G32A 5F69A 2EFUA 4I3IA 1WYBA 1OTDA 3KSHA 1H0MA 4FH4A 4MBKA 3WRTA 4QB8A 1VHMA 1I2WA 1TEMA 4QY5A 3DWZA 5HX9A 2VZWA 2PT7A 3IWOA 2XR0A 1VQQA 3IF6C 4EEUA 5CRFA 3ISGA 4GD8A 1S4SA 5L8MA 3ITAA 1KGFA 4GB7A 1I2SA 1K54A 4QHCA 5HZHA 1ZKJA 3LR0A 3MXSA 3DTEA 5CERA 1NLZA 1TS8A 1LHYA 4P87A 4E3JA 1T1AA 4DE1A 3CHWP 4GCZA 2EX9A 5CEDA 4E3KA 1K4FA 1L2SA 3MXQA 3SW1A 5FAOA 3MKEA 3F1OB 4OPYA 3L9KA 3GMWA 3FC7A 3MFXA 5MC7A 4Z1WA 1DP6A 2VV6A 1SKOA 4MCWA 4HIAA 1V9ZA 4S2MA 5IT5A 5G4ZA 3HLEA 4NKPA 2O0YA 4G3KA 3U4LP 4B4XA 5GLBA 4PPRA 1ONGA 4HP4A 5FQKA 3C5AA 1L0GA 3VP3A 1J3WA 3DTKA 2RL3A 3EEAA 3KYZA 3W4PA 4P85A 4R3JA 4OQ0A 4Y7PA 3IX4A 1WYCA 3E4PA 2PHYA 4N1HA 3V39A 4S2LA 3V67A 4OVDA 1D1JA 1BTLA 4GJ4A 5FEGA 3W4OA 3H7WB 2PD8A 3IS2B 5A91A 2B95A 3RJUA 3CWFA 3N8LA 2XGNA 2O9AA 4DRTA 2ZLYA 3PYPA 2FH5A 1BYWA 2PYPA 2V1BA 1Q2PA 1DJCA 5HL1A 4QPRA 5EE8A 4LRZE 4EWFA 2WAEA 4X68A 2R9XA 3DTIA 5KZHA 3RXXA 1YLWA 4P6ZM 4H6JA 3MZDA 3SH8A 4LRYC 4OQHA 3HBRA 1E4DA 3G2YA 2QKPA 2WKPA 3GDIA 4NEED 1KGGA 3T1SA 4OLDA 3LUQA 2H28A 1BULA 4PM5A 3G4PA 4WL9A 2JKTM 1T1BA 3UB9A 2Y2QA 5IU1A 4DDYA 2ZQDA 3E98A 3Q82A 5HAPA 1ES5A 4P6ZS 4UEYA 1ZTUA 4I5SA 4PAUA 1XP4A 3ITBA 4R4RA 4BBUA 1SDNA 5FDSA 5I94A 2ZM2A 2QJ5A 4U0TA 3Q7ZA 3TRCA 1ZG6A 4GHIA 1UWPX 2V8FA 4ESPA 2G2UA 4A5RA 2P9VA 3C8CA 4JXVA 3W2ZA 3PBNA 5D3OA 2Y2LA 2HP9A 3BFEA 1K25A 5DKKA 1LL8A 5M19A 3R7WB 1NXYA 3HUMA 2HV1A 3UPOA 4QY6A 1YLTA 4R3BA 4RYEA 3KX0X 3S7QA 1XJ6A 1XX2A 3E4QA 3ZCZA 1OT6A 4CLCA 4L9GA 3A3DA 3H9WA 2PBDP 5F68A 2WGVA 1EW0A 3ZYTA 2L0WA 5L07A 5F5YA 4GS9A 2IA2A 2H0YA 2XDMA 4MEZA 4MDZA 4WEJA 4Y5FA 3PAGA 1IYQA 3A0SA 2VJWA 3F1NA 1TS7A 3N8RA 1L0EA 5EPHA 4EQIA 4LRXC 4O7DA 3Q81A 1YSPA 3MF0A 4DJ2A 3NDGA 3AGEA 4AFIA 2PU4A 3GR2A 1O7EA 2V0UA 3JVUA 4KQDA 4WELA 4MMNA 1MWTA 4NXBA 1GHPA 3QP5A 3Q07A 4DE0A 2W1RA 5HL6A 4EBLA 1LI0A 3UDXA 1ALQA 1W63Q 4S2NC 4MLLA 2KOIA 3HJKA 1J9MA 3LIFA 5K5BA 4HJ4A 2K2NA 5E2HA 2OLUA 2M1CA 4GZBA 2KLIA 4N92A 5CGWA 3LI8A 4ZJ2A 5KMWA 3CG5A 2WGWA 3O3VA 5DFXA 4R4SA 1T1CA 2HPBA 5FEFA 3G31A 1YMXA 1MBLA 4E04A 3LO7A 4EW7A 3HVFA 2Z2LB 3VFFA 5TR7A 3UB5P 5FSRA 5A92A 2W1TA 4NETA 3LI9A 5GLAA 3UMEA 3BM6A 2JKRM 4F94A 4GN2A 4X1MA 5HSQA 3D72A 3PBOA 1CEFA 4X56A 3UO9A 3IBRA 3QP2A 4JGQA 2VLGA 3VSKA 1NZUA 3MQOA 4CQHA 4KENB 5EVEA 3IH9A 3WS2A 3NC8A 2WAFA 1MZUA 3OPHA 5CHJA 4BJPA 2HDUA 2VA0A 2CMNA 3BFDA 4KZ7A 1BZAA 2JHEA 3OC2A 1Y28A 2OWHA 1CI8A 1AWIA 3K2NA 1N9LA 1BLHA 4WZ5A 1XA1A 4Q0JA 1TDLA 1P0ZA 1F98A 4DXBA 3MZFA 2W3FA 4L0LA 2RCXA 1KE4A 3PXPA 3FZCA 1O07A 3UNWA 5CEBA 2J8YA 2QMIA 4LV3A 5DTTA 3HLFA 3LR4A 2ZC6B 1G5UA 5L09A 1KE0A 2KDKA 4ETXA 4EESA 1JWPA 2WKHA 5CECA 4Q0IA 3WS5A 2VX8A 4OOMA 2A2LA 2XFSA 1ESIA 2PD7A 3MFDA 1L0DA 2Y79A 4HH2A 5FATA 3FPVA 3MR0A 5L10A 3UB7A 4FUWA 3BQAA 3R4KA 3UE1A 3OCNA 5FI6A 4KG6A 4BD0A 3IXHA 5DF8A 4Q8IA 1SKOB 1ACFA 2PBYA 5A90A 4R70A 4Y17A 1ES2A 4HY8A 5FQ9A 2PRFA 3HREA 2ZQ9A 1DP8A 4Z9QA 3CAXA 1LL9A 4KUKA 5FAQA 3A0RA 4HEFA 1K4EA 5FI7A 1OPXA 3WS4A 1XGJA 1YAXA 2EWWA 2HF6A 1M6KA 3TG9A 4CJNA 1H8ZA 1OTEA 3DAVA 4O01A 5FQMA 3WS1A 2WZXA 3IWIA 3NBLA 3E0YA 3TW8A 5I5LA 3ZG7B 3LIAA 4K0WA 4PKYG 5KIZA 4E6WA 1KE3A 1MPLA 4HNBA 4NXFA 1LLBA 2M7UA 1E3UD 5TBMA 2G7UA 3PBTA 3FG8A 2EWVA 4HOIA 5F82A 2GDNA 3D9YA 1TD5A 3O87A 4YINA 1L3LA 1U60A 4H6JB 1PW8A 5FI2A 1MKIA 2EX6A 2LB9A 2ZD8A 2XQZA 3T1RA 2EX8A 4EV4A 4S2IA 2EX2A 3JVVA 3ZVWA 3TSGA 1XJ3A 3D3OA 2M7VA 2R9WA 2X01A 4OP5A 3C2WA 1K57C 2A49A 2H0TA 4S2JA 3BFCA 1T19A 3OPLA 1YLPA 5EFWA 4DXCA 1E25A 4E3MA 4Y3IA 1OTBA 4IJGA 1RCJA 1SZVA 3D4FA 5GHYA 1GSVA 1P9RA 4NK3A 1FSYA 3B47A 4KQOA 2XD5A 4DJ3A 4EETB 2XLNA 4E3NA 3SS5A 2VGLS 2PR5A 1P9WA 3UB6A 5J8XA 4GHIB 1S1YA 4I3JA 5TJJA 3CUEA 1XGIA 2Q9NA 4R23A 2OSUA 2P9VB 3B33A 4OPZA 1EI5A 1ES4A 3M2KA 4GKUA 4N9LA 3C30A 2JKFA 3ZG8B 5FL3A 1EWZA 2Z6CA 4HBTA 4O8GA 5AVFA 5FA7A 3MZEA 4WMCA 2JCHA 2HGVA 1MXOA 3C7UA 5DVAA 1W8YA 2Q9MA 2PU2A 1NWZA 3ULFA 3MKFA 3EGDC 4CLCB 2WKIA 1JVJA 1LL5A 2XD1A 4UA6A 2J9PA 4DE3A 4N1XA 1ZHHB 5F1FA 3OPPA 1BT5A 2BTFP 5EM1A 4E3LA 4GS9B 5CGSA 1OTAA 4Y15A 3BRMA 3LIDA 1Q2QA 2UV0E 5EVIA 3OPRA 3B42A 1CQAA 4X6TA 3F1NB 3LICA 2Y2PA 2HZ5A 2WKRA 1MKMA 2JKGA 4EBNA 3NOUC 1NZOA 3K3DA 4GDBA 2ZBBA 5LBRA 3NI9A 1YQSA 2WGIA 2P04A 3UDFA 4CLCC 3CPTA 2ZQAA 3QP4A 1OJ5A 5JYOA 1VEUA 4ZBEA 2XROA 2YKFA 1SDEA 3HLCA 1PRQA 4ARZB 3G34A 5HWWA 2P74A 3TJZC 2NUTC 3N8SA 4C75A 3TOIA 3PBQA 3IF6A 4EEPA 2Y8HA 3C38A 4R3AA 4L9FA 5FAPA 5HFOA 3UB8A 2WGWB 1TS6A 3VP0A 4PM7A 3VP2A 1XFQA 2LB5A 3T1QB 4K0XA 2Y91A 3CMZA 1MWUA 3NECA 1ES3A 3FYZA 3ZNYA 2K31A 4FH2A 2W1TB 3IHAA 2J3TC 4MN6A 1K55A 1JTGA 4JF4A 2VGKA 4FCFA 4LFUA 5U47A 1IKGA 3GSGA 4EUZA 1JNUA 3QNBA 3M2JA 2XFTA 3E2KA 3NDEA 3CJMA 4Q0HA 5F83A 1STZA 4ID4A 2PYRA 4OQIA 1K38A 2HDRA 5KSCA 4E6XA 2H10A 1YLJA 2L1MA 4RX3A 3BY9A 5FQQA 4WEKA 4BLMA 1YLZA 4BQMA 2NUPC 2O99A 3HCYA 4U0XA 3T4LA 4LV1A 1G68A 2ZQ8A 1YT4A 4HBUA 4X53A 4HJ3A 3TE8A 4B88A 1Y4OA 5E2GA 4BBVA 1OT9A 5HDSA 5HAQA 5KSHA 3IX3A 3GVBA 1LSWA 2DMWA 4JBFA 1PIOA 1ONHA 2WK0A 5HAIA 2B02A 3BQ8A 5CTNA 4R38A 2W3HA 4I3AA 1K56D 5CHUA 5GL9A 3HUOA 3DWKA 3GECA 3HL9A 2XK1A 3IBJA 2WKQA 3IS2A 1F5MA 5EUAA 2IWCA 5DTKA 1JWZA 3T4JA 3IH8A 3KSIA 2Z2MB 4O0PA 3IT9A 4JGPA 1D06A 3PR6A 2W3DA 3QP6A 1KVMA 5J7EA 3ZQ5A 4HI4A 4DN0A 2JN7A 2QJ7A 2Y2KA 3UMDA 3Q7VA 3PBRA 4BMWA 5GLDA 5HW3A 3G2ZA 3MJQA 3VSLA 1H5XA 4RX2A 3UY6A 2OV5A 4JGOA 4Y0TA 3P98A 1ODVA 5EM0A 4LV2A 3KSFA 2H5SA 4OPRA 4KZ6A 3GRJA 4BENA 1VETA 4LCLA 1DRMA 2KX6A 1V9YA 4ZAMA 4QU3A 3VOLA 1FQGA 3F1PB 4QD4A 4EU0A 2V0WA 4IVKA 2L4RA 3WRZA 5JYPA 1FCMA 3N7WA 2K7SA 4OPQA 4U3TA 1FSWA 1I5QA 1L0FA 1FR1A 4X69A 1NY0A 2JKTI 3HLGA 3E2LA 5TBMB 4R6LA 3V3SA 5HWVA 3IQAA 2ACGA 2OLVA 3SH9A 4L9EA 3LR5A 1SKFA 4JGRA 4DDSA 5GHXA 4KZAA 4OOLA 3ZVTA 5TGFA 1KDSA 4JPMA 3KYEA 4MN7A 5FQJA 2WADA 1H8MA 4ZRRA 1YM1A 3H82A 3LY4A 1ERMA 1FCNA 3T1XA 1NRFA 2GJ3A 2J3WA 4MBFA 5EVLA 4Y0OA 2B5RA 2WYXA 5M18A 4XUZA 2ZMAA 4OP8A 2IWDA 1PZPA 3ZG5A 3UPNA 4UAAA 3PTEA 5M1AA 3OCLA 5GHZA 3T4KA 3VP1A 1PI5A 3UE0A 3QP8A 3FV7A 1CK3A 2GX5A 4CPKA 2XF3A 1RGZA 2GZAA 2HP5A 4ZJ3A 3O86A 1IYOA 2V1ZA 2ZM8A 1HZOA 3RTYA 3U2AA 2XRNA 4WUJA 2EXBA 3MS6A 5DF9A 2Y59A 3SS4A 2EA9A 2Z6DA 4K91A 3BY8A 2W3EA 5AQAA 1KDWA 2ZQ7A 3UE6A 3MSHA 1S4RA 3VE4A 1ESUA 1BLPA 3HUNA 3IXDA 2ZOIA 4DE2A 4PKYA 2INWA 1K54C 3EQVA 5EV0A 3ICYA 4OKPA 1MY8A 1YMSA 3V5MA 4LPZA 4EUVA 4XT2A 4BWIA 3MMHA 3VOYA 5HARA 4UA9A 2ZL1A 2C6WB 5FASA 4Y0UA 5EVIB 5J4EA 1TS0A 5G18A 2FZ0A 4DMZA 4LLOB 1N9OA 1WE4A 1IKIA 1Z09A 3CLOA 3EOIA 1AXBA 1ERQA 3BEBA 1M40A 4JF5A 3RXWA 4KZ9A 3O88A 1H3QA 4R1GA 3VFHA 3G6OA 2DRWA 2O9BA 1MWSA 4EXOA 1PZOA 3AGDA 3FWLA 1NYYA 4WBGA 4ME4A 3LEZA 2I9VA 4IBXA 5CGXA 1HVBA 1P97A 3BLSA 3CI6A 2Y2GA 2HJ9C 1GCEA 2VGLM 3QP1A 2P7JA 1GA0A 1GSXA 2V8CA 3UN7A 5A93A 4UQIS 3LCEA 4B93A 3SOIA 2HDQA 5GLCA 4Y13A 2Y2IA 2XA7S 5DFYA 2Y2NA 4CLCD 1N4OA 3FKVA 1GHIA 1IOUA 1RGYA 1W63M 2O9CA 2QPNA 5HDDA 1S1ZA 1HTZA 4UHUA 1K0KA 1LSVA 4GNUA 3P09A 3HLDA 2ZC5B 5L2FA 2AVXA 4P6BA 4PM8A 3RH8B 1KGEA 4IEDA 2QHKA 3S7NA 1EROA 4F3LA 2C5WB 4HESA 3G30A 3CITA 3T4OA 3FKWA 1A0KA 1X0OA 5E2EA 4B9OA 2PDRA 3BW6A 1CF0A 2G2WA 3BWLA 1G6OA 3EEHA 5CX7A 1F2KA 3G35A 3P01A 5DF7A 2VK3A 1CI9A 5G4YA 2J3TD 1W5DA 5E43A 5A8BA 4KG5A 2FFYA 1MWRA 3ZGAB 1D7EA 2OAP1 1NLYA 1K55C 2YKHA 4ZJ1A 2V1AA 2Y4AA 4MNRA 5EOOA 1XJ4A 1UGUA 2Y2MA 2GNXA 4EERA 2JC7A 1OJGA 1YLYA 1PWGA 3IF5A 2BG1A 4GW9A
chains in the Genus database with same CATH topology
2VEAA 2XSSA 4HJ3A 1MZUA 3TE8A 4RQ9A 4BBVA 4BJPA 2VA0A 1OT9A 2CMNA 5HDSA 5KSHA 2A24A 3KSGA 2JHEA 3OC2A 1LSWA 1Y28A 2OWHA 2DMWA 3K2NA 1N9LA 2PR6A 5F6AA 5AJGA 4Q0JA 3T4TA 2D01A 5DKLA 1P0ZA 1F98A 2B02A 2VV8A 2J80A 3LR3A 1VB6A 1GSWA 3BQ8A 1F9IA 2W27A 4R38A 1YKDA 3UE3A 3KO6A 2W3FA 4L0LA 2OOLA 2JKRI 2W3HA 3E4OA 4I3AA 3GECA 3PXPA 3MQQA 4II7A 1S66L 5HD5A 3IBJA 3S7PA 2WKQA 3IS2A 1F5MA 3LR4A 3T50A 3K3CA 1G28A 3T4JA 2KDKA 5F69A 5AVEA 4ETXA 4EESA 4EQ1A 4I3IA 1DP9A 3KSIA 1OTDA 2QWSA 4Q0IA 2VX8A 3KSHA 4OOMA 2A2LA 4O0PA 4JGPA 3MQ0A 1VHMA 2PD7A 1D06A 3PR6A 2VZWA 2PT7A 2W3DA 2Y79A 5J7EA 4HH2A 3ZQ5A 4HI4A 2P08A 3FPVA 2JN7A 3MR0A 4DN0A 3UB7A 2QJ7A 4EEUA 3UMDA 3BQAA 3R4KA 1S4SA 5L8MA 1N9NA 3OCNA 3PBRA 4BMWA 5HZHA 3LR0A 1NLZA 1TS8A 3MJQA 1T1AA 4R70A 4GCZA 5DJTA 2OWJA 1UWNX 4JGOA 3MXQA 3SW1A 3LFVA 1ODVA 1WA9A 4HY8A 3F1OB 1DP8A 4FOFA 3KSFA 3FC7A 3MFXA 3OOVA 4Z1WA 3CAXA 1DP6A 2VV6A 5MC7A 3OLOA 4KUKA 1IFQA 3A0RA 4G3WA 4MCWA 4HIAA 3BJNA 1DRMA 1V9ZA 2MJ6A 2KX6A 1V9YA 1OPXA 3VOLA 5IT5A 1YSQA 3F1PB 5G4ZA 4EU0A 1YAXA 2V0WA 4NKPA 2EWWA 2L4RA 2O0YA 2HF6A 3F1OA 4G3KA 4O01A 1OTEA 2K7SA 3NJAA 4HP4A 1XJ2A 2JKTI 3E0YA 5TBMB 3TW8A 5I5LA 4R6LA 3EEAA 3KYZA 3LIAA 5HWVA 1XFNA 2BASA 3H82B 4YOFA 2ZMVA 4L9EA 3LR5A 4JGRA 3E4PA 4PKYG 5KIZA 2PHYA 4HNBA 4OOLA 4NXFA 3V67A 4WN5A 2M7UA 4NXEA 5TBMA 2G7UA 3PBTA 4GJ4A 3FG8A 4MN7A 2EWVA 1H8MA 3H7WB 4HOIA 4ZRRA 2PD8A 3IS2B 3H82A 1TD5A 3CWFA 2O9AA 4H6JB 4HH3A 3PYPA 2FH5A 1T18A 1BYWA 2PYPA 2LB9A 2GJ3A 2J3WA 2V1BA 2OAQ1 4QPRA 4HP9A 4LRZE 3JVVA 4IUHA 3H7WA 1XJ3A 3D3OA 2VKSA 2M7VA 4P6ZM 4H6JA 3C2WA 4LRYC 2QKPA 2WKPA 3GDIA 4NEED 1T19A 4IHQA 3OCLA 3T4KA 3LUQA 5EFWA 2H28A 4Y3IA 1OTBA 4IJGA 2B18A 4WL9A 1GSVA 2GX5A 1P9RA 2JKTM 4ARZA 5HPIA 2GZAA 1T1BA 3UB9A 4HHDA 5DJUA 5IU1A 3PBSA 3B47A 4KQOA 3E98A 3A0VA 4I38A 4DJ3A 4EETB 3RTYA 3U2AA 2VGLS 2PR5A 1P9WA 2XRNA 2VV7A 4WUJA 3UB6A 4GHIB 1S1YA 4I3JA 4P6ZS 4UEYA 1MC0A 1ZTUA 5DF9A 4I5SA 5TJJA 4PAUA 3LIBA 5C5KA 4I39A 5HD3A 3CUEA 2EA9A 2Z6DA 3BY8A 4BBUA 4XT2B 3EWKA 2W3EA 5HWTA 4MN5A 3B33A 3UE6A 4CLCE 3P7NA 1S4RA 3VE4A 2QJ5A 3HJIA 2ZOIA 4PKYA 2INWA 3C30A 3TRCA 3EQVA 4GHIA 1UWPX 3ICYA 5FL3A 2Z6CA 4O8GA 5AVFA 4PHTA 4LPZA 4EUVA 4XT2A 4BWIA 3MMHA 3C8CA 2HGVA 3S7OA 3W2ZA 3PBNA 3T4QA 4FSFA 1NWZA 5DKKA 3ULFA 1LL8A 1TF1A 3EGDC 3R7WB 4CLCB 5J4EA 1S67L 1TS0A 2HV1A 4WLAA 2FZ0A 4WF0A 1ZHHB 2W3GA 4DMZA 4LLOB 1N9OA 3KX0X 3S7QA 3CLOA 1XJ6A 3EOIA 4GS9B 1OTAA 3LIDA 3E4QA 1OT6A 3R7WA 4CLCA 4L9GA 4KUOA 3H9WA 3FPWA 3B42A 5F68A 4K08A 1EW0A 3ZYTA 3F1NB 3LICA 3VV4A 1H3QA 2L0WA 3NOTC 2WKRA 1MKMA 5F5YA 3G6OA 1OTIA 3NOPC 4M4XA 3NOUC 4GS9A 2O9BA 3K3DA 4EXOA 2ZBBA 5LBRA 2IA2A 2ZMFA 2W0NA 4HJ6A 4ME4A 2I9VA 4MDZA 4WEJA 4Y5FA 1P97A 2D02A 2P04A 3A0SA 2VJWA 3CI6A 3F1NA 4CLCC 2HJ9C 3OBFA 1LSXA 1TS7A 1KOUA 3PHYA 1OJ5A 2VGLM 3DBAA 2P7JA 1GSXA 1NRJA 2XROA 2YKFA 4LRXC 4UQIS 1YSPA 4B93A 3MF0A 4DJ2A 4ARZB 4AFIA 5HWWA 2XA7S 3EQUA 5DFYA 2NUTC 3TJZC 2V0UA 3JVUA 4KQDA 4CLCD 3PBQA 4WELA 4YNRA 1IOUA 3NHQA 1W63M 2O9CA 4MMNA 4NXBA 4EEPA 5HDDA 1S1ZA 2V9AA 2Y8HA 2W1RA 5HL6A 3C38A 4F3LB 2HJEA 4R3AA 2ZOHA 1LSVA 4L9FA 3O5YA 1W63Q 2KOIA 3HJKA 3UB8A 3LIFA 5K5BA 4HJ4A 2K2NA 1LT0A 1TS6A 1XFQA 2LB5A 2M1CA 5HDCA 3RH8B 2KLIA 2QHKA 3LI8A 3S7NA 3RFBA 4F3LA 3T4SA 2K31A 3CITA 3T4OA 2R78A 4NXGA 2W1TB 2J3TC 5DFXA 1X0OA 1T1CA 4MN6A 4HQAA 2PDRA 3BW6A 4B9OA 5J3WA 4GLQA 3BWLA 1G6OA 3EEHA 4E04A 5CX7A 4EW7A 3LIEA 3P01A 1JNUA 5G4YA 3CUEC 3LYXA 4YWZA 2J3TD 4BBTA 2W1TA 5IS1A 5A8BA 4Y2FA 3LI9A 4ETZA 4Q0HA 3UMEA 1STZA 3VE3A 1D7EA 2JKRM 2OAP1 2PYRA 1NLYA 2YKHA 5HPFA 4IUKA 2V1AA 3EGXC 5HSQA 1XJ4A 3D72A 1UGUA 3PBOA 2GNXA 4EERA 3IBRA 4JGQA 2VLGA 2L1MA 4UQIM 1OJGA 3BY9A 2A24B 4WEKA 2QYBA 2NUPC 2O99A 3HCYA 3KYQA 4G3VA 2XA7M 3MQOA 3T4LA 4CQHA 3F1PA 4GW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W63 Q;  2JKR M;  2FH5 A;  2VGL S;  2XA7 S;  3TJZ C;  2JKR I;  4NEE D;  4P6Z S;  2HF6 A;  4UQI M;  1W63 M;  2JKT M;  5MC7 A;  2VGL M;  2XA7 M;  4P6Z M;  1NRJ A;  2JKT I;  4UQI S; 
#chains in the Genus database with same CATH topology
 2VEA A;  2XSS A;  1OME A;  5IHV A;  4PM9 A;  3W4Q A;  1GHM A;  5CHM A;  2A24 A;  1QMF A;  3C7V A;  3M6H A;  1PFL A;  2ZJ9 A;  1G6A A;  3BLM A;  1CJF A;  1PI4 A;  2D01 A;  5DKL A;  1K6S A;  4M3K A;  4FD8 A;  2VV8 A;  2J80 A;  3LR3 A;  5FQI A;  1K57 A;  1GSW A;  3IXG A;  3KO6 A;  1ZG4 A;  5EOE A;  3E4O A;  1FOF A;  3MQQ A;  4II7 A;  4XXR A;  5HD5 A;  3S7P A;  3T12 B;  3HLW A;  3SH7 A;  3T50 A;  3W8K A;  1G28 A;  5AVE A;  2ZC4 B;  3SS3 A;  4EQ1 A;  3Q7V B;  1DP9 A;  2QWS A;  3V3R A;  3GQZ A;  1HD8 A;  2WUQ A;  3MQ0 A;  1W8Q A;  4KQR A;  1BUE A;  4OQG A;  2P08 A;  1FCO A;  1N9N A;  1XA7 A;  1PYY A;  4KZ8 A;  4GOG A;  2V2F F;  5F1G A;  4E3I A;  4MBH A;  1VET B;  5DJT A;  2OWJ A;  1UWN X;  4LGW A;  4LCM A;  3LFV A;  1FIK A;  1WA9 A;  4FOF A;  3OOV A;  4XUX A;  3OLO A;  4JXW A;  1IFQ A;  4G3W A;  1E3U A;  3CZD A;  1FIL A;  3BJN A;  2MJ6 A;  3QHY A;  1IYP A;  1YSQ A;  2A3U A;  1SHV A;  3F1O A;  4RA7 A;  2E8J A;  3NJA A;  2JE5 A;  1S6R A;  1XXM A;  3PAE A;  1DJB A;  2E8I A;  1XJ2 A;  4KZ4 A;  4JXG A;  3A3F A;  1XFN A;  2BAS A;  3H82 B;  4YOF A;  3LEQ A;  2ZMV A;  1Y54 A;  3IHB A;  5BOH A;  4WN5 A;  1RP5 A;  4FTX A;  4NXE A;  3MBZ A;  3IX8 A;  2FFF B;  3ZDJ A;  3JPU A;  2Y2O A;  2ZC3 B;  4IVI A;  4HH3 A;  1T18 A;  1W7F A;  3JYI A;  4X25 A;  2OAQ 1;  3M6B A;  4HP9 A;  4PMA A;  3ZHH A;  2UWX A;  4R0Q A;  4GDN A;  4IUH A;  3H7W A;  2VKS A;  4WZ5 C;  4NG2 A;  4H8R A;  4S2K A;  4PM6 A;  3BFF A;  4KG2 A;  4QWO A;  3VP4 A;  1BSG A;  4IHQ A;  5TFQ A;  3IXB A;  4S2O A;  3S1Y A;  3LGO A;  2B18 A;  4BL3 A;  4ARZ A;  2CC1 A;  5HPI A;  1SCW A;  4HHD A;  5DJU A;  5CTM A;  1BLC A;  3PBS A;  3A0V A;  4I38 A;  4JKT A;  2V20 A;  2VV7 A;  3A3E A;  1MC0 A;  3LIB A;  5C5K A;  4I39 A;  1C3B A;  5HD3 A;  3VOZ A;  4XT2 B;  3EWK A;  5HWT A;  4DKI A;  4MN5 A;  4CLC E;  4OON A;  3P7N A;  1PWC A;  2ZL1 B;  3HJI A;  3A3I A;  4JF6 A;  4OLG A;  4C6Y A;  4PHT A;  1IEM A;  4S2P A;  3IWQ A;  4EBP A;  3S7O A;  3WS0 A;  3T4Q A;  2Y2J A;  4FSF A;  2BLS A;  1TF1 A;  3ZNT A;  4D2O A;  4C3Q A;  1S67 L;  1Z6F A;  2XH9 A;  4WLA A;  4KZ5 A;  4WF0 A;  2DCF A;  2W3G A;  3I7J A;  1XKZ A;  4KZB A;  3S22 A;  3ZG9 B;  3S4X A;  1NJ4 A;  2HP6 A;  1PW1 A;  1LI9 A;  1JTD A;  3R7W A;  2DNS A;  2J9O A;  3UPP A;  4KUO A;  3FPW A;  4K08 A;  3BEC A;  4JLF A;  4B4Z A;  3C4O A;  3VV4 A;  4BL2 A;  3DW0 A;  3NOT C;  2VGJ A;  4WMC D;  3DTM A;  1YPR A;  1PNE A;  1OTI A;  3NOP C;  3OZH A;  4M4X A;  1W79 A;  3BYD A;  1JWV A;  2ZMF A;  2W0N A;  4HJ6 A;  2QZ6 A;  2D02 A;  5DTS A;  1K6R A;  1ZC2 A;  3OBF A;  1LSX A;  3PHY A;  1KOU A;  2Y2H A;  3DBA A;  3NIA A;  1NRJ A;  1FR6 A;  4DF6 A;  5EEC A;  4S2N A;  3NCK A;  4KQQ A;  3EQU A;  3SZT A;  1HLU P;  5EVI D;  1DJA A;  4IBR A;  4YNR A;  4ZDX A;  3NHQ A;  1S0W A;  4GD6 A;  4X55 A;  3B3X A;  1N9B A;  4JXS A;  4WYY A;  2V9A A;  4F3L B;  2HJE A;  2ZOH A;  3O5Y A;  3ZFZ A;  2J7V A;  5AQ9 A;  2WZZ A;  3BFG A;  2EXA A;  4QJG A;  1LT0 A;  1TDG A;  5HDC A;  3A3J A;  3NUL A;  4LEN A;  3RFB A;  4RVA A;  3QNC A;  3T4S A;  3N4I A;  3Q1F A;  2R78 A;  4NXG A;  1QME A;  3AGF A;  4WZ4 A;  4HQA A;  1DY6 A;  5J3W A;  4GLQ A;  4D60 A;  2XEP A;  3LIE A;  1KVL A;  4E3O A;  3C4P A;  3CUE C;  3LYX A;  4YWZ A;  4BBT A;  5IS1 A;  4KZ3 A;  2X71 A;  2IWB A;  4Y2F A;  4ETZ A;  1IYS A;  4N9K A;  3VE3 A;  4OH0 A;  2ZC7 A;  3MXR A;  5HPF A;  4IUK A;  3EGX C;  3HLB A;  4LV0 A;  2X02 A;  3LY3 A;  4WM9 A;  4UQI M;  5E2F A;  2A24 B;  1K56 A;  2QYB A;  4BD1 A;  4G3V A;  3KYQ A;  2XA7 M;  1PWD A;  3VMA A;  3F1P A;  3CPT B;  4ZTK A;  5CXW A;  5AQ7 A;  1GA9 A;  1VEU B;  2JBF A;  1H8Y A;  4RQ9 A;  2Y55 A;  1IEL A;  4UA7 A;  3KSG A;  4P0M A;  2WKE A;  3GTC A;  4OOY A;  3L7H A;  3V50 A;  5EVI C;  2PR6 A;  5F6A A;  5AJG A;  1BLS A;  3T4T A;  1NYM A;  1TVF A;  3IF6 B;  2ZM0 A;  4YFM A;  5FDH A;  1VB6 A;  3UDI A;  1F9I A;  1XPB A;  2W27 A;  2EFX A;  1YKD A;  3UE3 A;  1CEG A;  2OOL A;  2JKR I;  2Q0O A;  3N6I A;  2I72 A;  3GV9 A;  1S66 L;  1VM1 A;  3ZG0 A;  2ZQC A;  4X1L A;  5AQB A;  2HDS A;  3NY4 A;  3WWX A;  2PAV P;  3K3C A;  3G32 A;  5F69 A;  2EFU A;  4I3I A;  1WYB A;  1OTD A;  3KSH A;  1H0M A;  4FH4 A;  4MBK A;  3WRT A;  4QB8 A;  1VHM A;  1I2W A;  1TEM A;  4QY5 A;  3DWZ A;  5HX9 A;  2VZW A;  2PT7 A;  3IWO A;  2XR0 A;  1VQQ A;  3IF6 C;  4EEU A;  5CRF A;  3ISG A;  4GD8 A;  1S4S A;  5L8M A;  3ITA A;  1KGF A;  4GB7 A;  1I2S A;  1K54 A;  4QHC A;  5HZH A;  1ZKJ A;  3LR0 A;  3MXS A;  3DTE A;  5CER A;  1NLZ A;  1TS8 A;  1LHY A;  4P87 A;  4E3J A;  1T1A A;  4DE1 A;  3CHW P;  4GCZ A;  2EX9 A;  5CED A;  4E3K A;  1K4F A;  1L2S A;  3MXQ A;  3SW1 A;  5FAO A;  3MKE A;  3F1O B;  4OPY A;  3L9K A;  3GMW A;  3FC7 A;  3MFX A;  5MC7 A;  4Z1W A;  1DP6 A;  2VV6 A;  1SKO A;  4MCW A;  4HIA A;  1V9Z A;  4S2M A;  5IT5 A;  5G4Z A;  3HLE A;  4NKP A;  2O0Y A;  4G3K A;  3U4L P;  4B4X A;  5GLB A;  4PPR A;  1ONG A;  4HP4 A;  5FQK A;  3C5A A;  1L0G A;  3VP3 A;  1J3W A;  3DTK A;  2RL3 A;  3EEA A;  3KYZ A;  3W4P A;  4P85 A;  4R3J A;  4OQ0 A;  4Y7P A;  3IX4 A;  1WYC A;  3E4P A;  2PHY A;  4N1H A;  3V39 A;  4S2L A;  3V67 A;  4OVD A;  1D1J A;  1BTL A;  4GJ4 A;  5FEG A;  3W4O A;  3H7W B;  2PD8 A;  3IS2 B;  5A91 A;  2B95 A;  3RJU A;  3CWF A;  3N8L A;  2XGN A;  2O9A A;  4DRT A;  2ZLY A;  3PYP A;  2FH5 A;  1BYW A;  2PYP A;  2V1B A;  1Q2P A;  1DJC A;  5HL1 A;  4QPR A;  5EE8 A;  4LRZ E;  4EWF A;  2WAE A;  4X68 A;  2R9X A;  3DTI A;  5KZH A;  3RXX A;  1YLW A;  4P6Z M;  4H6J A;  3MZD A;  3SH8 A;  4LRY C;  4OQH A;  3HBR A;  1E4D A;  3G2Y A;  2QKP A;  2WKP A;  3GDI A;  4NEE D;  1KGG A;  3T1S A;  4OLD A;  3LUQ A;  2H28 A;  1BUL A;  4PM5 A;  3G4P A;  4WL9 A;  2JKT M;  1T1B A;  3UB9 A;  2Y2Q A;  5IU1 A;  4DDY A;  2ZQD A;  3E98 A;  3Q82 A;  5HAP A;  1ES5 A;  4P6Z S;  4UEY A;  1ZTU A;  4I5S A;  4PAU A;  1XP4 A;  3ITB A;  4R4R A;  4BBU A;  1SDN A;  5FDS A;  5I94 A;  2ZM2 A;  2QJ5 A;  4U0T A;  3Q7Z A;  3TRC A;  1ZG6 A;  4GHI A;  1UWP X;  2V8F A;  4ESP A;  2G2U A;  4A5R A;  2P9V A;  3C8C A;  4JXV A;  3W2Z A;  3PBN A;  5D3O A;  2Y2L A;  2HP9 A;  3BFE A;  1K25 A;  5DKK A;  1LL8 A;  5M19 A;  3R7W B;  1NXY A;  3HUM A;  2HV1 A;  3UPO A;  4QY6 A;  1YLT A;  4R3B A;  4RYE A;  3KX0 X;  3S7Q A;  1XJ6 A;  1XX2 A;  3E4Q A;  3ZCZ A;  1OT6 A;  4CLC A;  4L9G A;  3A3D A;  3H9W A;  2PBD P;  5F68 A;  2WGV A;  1EW0 A;  3ZYT A;  2L0W A;  5L07 A;  5F5Y A;  4GS9 A;  2IA2 A;  2H0Y A;  2XDM A;  4MEZ A;  4MDZ A;  4WEJ A;  4Y5F A;  3PAG A;  1IYQ A;  3A0S A;  2VJW A;  3F1N A;  1TS7 A;  3N8R A;  1L0E A;  5EPH A;  4EQI A;  4LRX C;  4O7D A;  3Q81 A;  1YSP A;  3MF0 A;  4DJ2 A;  3NDG A;  3AGE A;  4AFI A;  2PU4 A;  3GR2 A;  1O7E A;  2V0U A;  3JVU A;  4KQD A;  4WEL A;  4MMN A;  1MWT A;  4NXB A;  1GHP A;  3QP5 A;  3Q07 A;  4DE0 A;  2W1R A;  5HL6 A;  4EBL A;  1LI0 A;  3UDX A;  1ALQ A;  1W63 Q;  4S2N C;  4MLL A;  2KOI A;  3HJK A;  1J9M A;  3LIF A;  5K5B A;  4HJ4 A;  2K2N A;  5E2H A;  2OLU A;  2M1C A;  4GZB A;  2KLI A;  4N92 A;  5CGW A;  3LI8 A;  4ZJ2 A;  5KMW A;  3CG5 A;  2WGW A;  3O3V A;  5DFX A;  4R4S A;  1T1C A;  2HPB A;  5FEF A;  3G31 A;  1YMX A;  1MBL A;  4E04 A;  3LO7 A;  4EW7 A;  3HVF A;  2Z2L B;  3VFF A;  5TR7 A;  3UB5 P;  5FSR A;  5A92 A;  2W1T A;  4NET A;  3LI9 A;  5GLA A;  3UME A;  3BM6 A;  2JKR M;  4F94 A;  4GN2 A;  4X1M A;  5HSQ A;  3D72 A;  3PBO A;  1CEF A;  4X56 A;  3UO9 A;  3IBR A;  3QP2 A;  4JGQ A;  2VLG A;  3VSK A;  1NZU A;  3MQO A;  4CQH A;  4KEN B;  5EVE A;  3IH9 A;  3WS2 A;  3NC8 A;  2WAF A;  1MZU A;  3OPH A;  5CHJ A;  4BJP A;  2HDU A;  2VA0 A;  2CMN A;  3BFD A;  4KZ7 A;  1BZA A;  2JHE A;  3OC2 A;  1Y28 A;  2OWH A;  1CI8 A;  1AWI A;  3K2N A;  1N9L A;  1BLH A;  4WZ5 A;  1XA1 A;  4Q0J A;  1TDL A;  1P0Z A;  1F98 A;  4DXB A;  3MZF A;  2W3F A;  4L0L A;  2RCX A;  1KE4 A;  3PXP A;  3FZC A;  1O07 A;  3UNW A;  5CEB A;  2J8Y A;  2QMI A;  4LV3 A;  5DTT A;  3HLF A;  3LR4 A;  2ZC6 B;  1G5U A;  5L09 A;  1KE0 A;  2KDK A;  4ETX A;  4EES A;  1JWP A;  2WKH A;  5CEC A;  4Q0I A;  3WS5 A;  2VX8 A;  4OOM A;  2A2L A;  2XFS A;  1ESI A;  2PD7 A;  3MFD A;  1L0D A;  2Y79 A;  4HH2 A;  5FAT A;  3FPV A;  3MR0 A;  5L10 A;  3UB7 A;  4FUW A;  3BQA A;  3R4K A;  3UE1 A;  3OCN A;  5FI6 A;  4KG6 A;  4BD0 A;  3IXH A;  5DF8 A;  4Q8I A;  1SKO B;  1ACF A;  2PBY A;  5A90 A;  4R70 A;  4Y17 A;  1ES2 A;  4HY8 A;  5FQ9 A;  2PRF A;  3HRE A;  2ZQ9 A;  1DP8 A;  4Z9Q A;  3CAX A;  1LL9 A;  4KUK A;  5FAQ A;  3A0R A;  4HEF A;  1K4E A;  5FI7 A;  1OPX A;  3WS4 A;  1XGJ A;  1YAX A;  2EWW A;  2HF6 A;  1M6K A;  3TG9 A;  4CJN A;  1H8Z A;  1OTE A;  3DAV A;  4O01 A;  5FQM A;  3WS1 A;  2WZX A;  3IWI A;  3NBL A;  3E0Y A;  3TW8 A;  5I5L A;  3ZG7 B;  3LIA A;  4K0W A;  4PKY G;  5KIZ A;  4E6W A;  1KE3 A;  1MPL A;  4HNB A;  4NXF A;  1LLB A;  2M7U A;  1E3U D;  5TBM A;  2G7U A;  3PBT A;  3FG8 A;  2EWV A;  4HOI A;  5F82 A;  2GDN A;  3D9Y A;  1TD5 A;  3O87 A;  4YIN A;  1L3L A;  1U60 A;  4H6J B;  1PW8 A;  5FI2 A;  1MKI A;  2EX6 A;  2LB9 A;  2ZD8 A;  2XQZ A;  3T1R A;  2EX8 A;  4EV4 A;  4S2I A;  2EX2 A;  3JVV A;  3ZVW A;  3TSG A;  1XJ3 A;  3D3O A;  2M7V A;  2R9W A;  2X01 A;  4OP5 A;  3C2W A;  1K57 C;  2A49 A;  2H0T A;  4S2J A;  3BFC A;  1T19 A;  3OPL A;  1YLP A;  5EFW A;  4DXC A;  1E25 A;  4E3M A;  4Y3I A;  1OTB A;  4IJG A;  1RCJ A;  1SZV A;  3D4F A;  5GHY A;  1GSV A;  1P9R A;  4NK3 A;  1FSY A;  3B47 A;  4KQO A;  2XD5 A;  4DJ3 A;  4EET B;  2XLN A;  4E3N A;  3SS5 A;  2VGL S;  2PR5 A;  1P9W A;  3UB6 A;  5J8X A;  4GHI B;  1S1Y A;  4I3J A;  5TJJ A;  3CUE A;  1XGI A;  2Q9N A;  4R23 A;  2OSU A;  2P9V B;  3B33 A;  4OPZ A;  1EI5 A;  1ES4 A;  3M2K A;  4GKU A;  4N9L A;  3C30 A;  2JKF A;  3ZG8 B;  5FL3 A;  1EWZ A;  2Z6C A;  4HBT A;  4O8G A;  5AVF A;  5FA7 A;  3MZE A;  4WMC A;  2JCH A;  2HGV A;  1MXO A;  3C7U A;  5DVA A;  1W8Y A;  2Q9M A;  2PU2 A;  1NWZ A;  3ULF A;  3MKF A;  3EGD C;  4CLC B;  2WKI A;  1JVJ A;  1LL5 A;  2XD1 A;  4UA6 A;  2J9P A;  4DE3 A;  4N1X A;  1ZHH B;  5F1F A;  3OPP A;  1BT5 A;  2BTF P;  5EM1 A;  4E3L A;  4GS9 B;  5CGS A;  1OTA A;  4Y15 A;  3BRM A;  3LID A;  1Q2Q A;  2UV0 E;  5EVI A;  3OPR A;  3B42 A;  1CQA A;  4X6T A;  3F1N B;  3LIC A;  2Y2P A;  2HZ5 A;  2WKR A;  1MKM A;  2JKG A;  4EBN A;  3NOU C;  1NZO A;  3K3D A;  4GDB A;  2ZBB A;  5LBR A;  3NI9 A;  1YQS A;  2WGI A;  2P04 A;  3UDF A;  4CLC C;  3CPT A;  2ZQA A;  3QP4 A;  1OJ5 A;  5JYO A;  1VEU A;  4ZBE A;  2XRO A;  2YKF A;  1SDE A;  3HLC A;  1PRQ A;  4ARZ B;  3G34 A;  5HWW A;  2P74 A;  3TJZ C;  2NUT C;  3N8S A;  4C75 A;  3TOI A;  3PBQ A;  3IF6 A;  4EEP A;  2Y8H A;  3C38 A;  4R3A A;  4L9F A;  5FAP A;  5HFO A;  3UB8 A;  2WGW B;  1TS6 A;  3VP0 A;  4PM7 A;  3VP2 A;  1XFQ A;  2LB5 A;  3T1Q B;  4K0X A;  2Y91 A;  3CMZ A;  1MWU A;  3NEC A;  1ES3 A;  3FYZ A;  3ZNY A;  2K31 A;  4FH2 A;  2W1T B;  3IHA A;  2J3T C;  4MN6 A;  1K55 A;  1JTG A;  4JF4 A;  2VGK A;  4FCF A;  4LFU A;  5U47 A;  1IKG A;  3GSG A;  4EUZ A;  1JNU A;  3QNB A;  3M2J A;  2XFT A;  3E2K A;  3NDE A;  3CJM A;  4Q0H A;  5F83 A;  1STZ A;  4ID4 A;  2PYR A;  4OQI A;  1K38 A;  2HDR A;  5KSC A;  4E6X A;  2H10 A;  1YLJ A;  2L1M A;  4RX3 A;  3BY9 A;  5FQQ A;  4WEK A;  4BLM A;  1YLZ A;  4BQM A;  2NUP C;  2O99 A;  3HCY A;  4U0X A;  3T4L A;  4LV1 A;  1G68 A;  2ZQ8 A;  1YT4 A;  4HBU A;  4X53 A;  4HJ3 A;  3TE8 A;  4B88 A;  1Y4O A;  5E2G A;  4BBV A;  1OT9 A;  5HDS A;  5HAQ A;  5KSH A;  3IX3 A;  3GVB A;  1LSW A;  2DMW A;  4JBF A;  1PIO A;  1ONH A;  2WK0 A;  5HAI A;  2B02 A;  3BQ8 A;  5CTN A;  4R38 A;  2W3H A;  4I3A A;  1K56 D;  5CHU A;  5GL9 A;  3HUO A;  3DWK A;  3GEC A;  3HL9 A;  2XK1 A;  3IBJ A;  2WKQ A;  3IS2 A;  1F5M A;  5EUA A;  2IWC A;  5DTK A;  1JWZ A;  3T4J A;  3IH8 A;  3KSI A;  2Z2M B;  4O0P A;  3IT9 A;  4JGP A;  1D06 A;  3PR6 A;  2W3D A;  3QP6 A;  1KVM A;  5J7E A;  3ZQ5 A;  4HI4 A;  4DN0 A;  2JN7 A;  2QJ7 A;  2Y2K A;  3UMD A;  3Q7V A;  3PBR A;  4BMW A;  5GLD A;  5HW3 A;  3G2Z A;  3MJQ A;  3VSL A;  1H5X A;  4RX2 A;  3UY6 A;  2OV5 A;  4JGO A;  4Y0T A;  3P98 A;  1ODV A;  5EM0 A;  4LV2 A;  3KSF A;  2H5S A;  4OPR A;  4KZ6 A;  3GRJ A;  4BEN A;  1VET A;  4LCL A;  1DRM A;  2KX6 A;  1V9Y A;  4ZAM A;  4QU3 A;  3VOL A;  1FQG A;  3F1P B;  4QD4 A;  4EU0 A;  2V0W A;  4IVK A;  2L4R A;  3WRZ A;  5JYP A;  1FCM A;  3N7W A;  2K7S A;  4OPQ A;  4U3T A;  1FSW A;  1I5Q A;  1L0F A;  1FR1 A;  4X69 A;  1NY0 A;  2JKT I;  3HLG A;  3E2L A;  5TBM B;  4R6L A;  3V3S A;  5HWV A;  3IQA A;  2ACG A;  2OLV A;  3SH9 A;  4L9E A;  3LR5 A;  1SKF A;  4JGR A;  4DDS A;  5GHX A;  4KZA A;  4OOL A;  3ZVT A;  5TGF A;  1KDS A;  4JPM A;  3KYE A;  4MN7 A;  5FQJ A;  2WAD A;  1H8M A;  4ZRR A;  1YM1 A;  3H82 A;  3LY4 A;  1ERM A;  1FCN A;  3T1X A;  1NRF A;  2GJ3 A;  2J3W A;  4MBF A;  5EVL A;  4Y0O A;  2B5R A;  2WYX A;  5M18 A;  4XUZ A;  2ZMA A;  4OP8 A;  2IWD A;  1PZP A;  3ZG5 A;  3UPN A;  4UAA A;  3PTE A;  5M1A A;  3OCL A;  5GHZ A;  3T4K A;  3VP1 A;  1PI5 A;  3UE0 A;  3QP8 A;  3FV7 A;  1CK3 A;  2GX5 A;  4CPK A;  2XF3 A;  1RGZ A;  2GZA A;  2HP5 A;  4ZJ3 A;  3O86 A;  1IYO A;  2V1Z A;  2ZM8 A;  1HZO A;  3RTY A;  3U2A A;  2XRN A;  4WUJ A;  2EXB A;  3MS6 A;  5DF9 A;  2Y59 A;  3SS4 A;  2EA9 A;  2Z6D A;  4K91 A;  3BY8 A;  2W3E A;  5AQA A;  1KDW A;  2ZQ7 A;  3UE6 A;  3MSH A;  1S4R A;  3VE4 A;  1ESU A;  1BLP A;  3HUN A;  3IXD A;  2ZOI A;  4DE2 A;  4PKY A;  2INW A;  1K54 C;  3EQV A;  5EV0 A;  3ICY A;  4OKP A;  1MY8 A;  1YMS A;  3V5M A;  4LPZ A;  4EUV A;  4XT2 A;  4BWI A;  3MMH A;  3VOY A;  5HAR A;  4UA9 A;  2ZL1 A;  2C6W B;  5FAS A;  4Y0U A;  5EVI B;  5J4E A;  1TS0 A;  5G18 A;  2FZ0 A;  4DMZ A;  4LLO B;  1N9O A;  1WE4 A;  1IKI A;  1Z09 A;  3CLO A;  3EOI A;  1AXB A;  1ERQ A;  3BEB A;  1M40 A;  4JF5 A;  3RXW A;  4KZ9 A;  3O88 A;  1H3Q A;  4R1G A;  3VFH A;  3G6O A;  2DRW A;  2O9B A;  1MWS A;  4EXO A;  1PZO A;  3AGD A;  3FWL A;  1NYY A;  4WBG A;  4ME4 A;  3LEZ A;  2I9V A;  4IBX A;  5CGX A;  1HVB A;  1P97 A;  3BLS A;  3CI6 A;  2Y2G A;  2HJ9 C;  1GCE A;  2VGL M;  3QP1 A;  2P7J A;  1GA0 A;  1GSX A;  2V8C A;  3UN7 A;  5A93 A;  4UQI S;  3LCE A;  4B93 A;  3SOI A;  2HDQ A;  5GLC A;  4Y13 A;  2Y2I A;  2XA7 S;  5DFY A;  2Y2N A;  4CLC D;  1N4O A;  3FKV A;  1GHI A;  1IOU A;  1RGY A;  1W63 M;  2O9C A;  2QPN A;  5HDD A;  1S1Z A;  1HTZ A;  4UHU A;  1K0K A;  1LSV A;  4GNU A;  3P09 A;  3HLD A;  2ZC5 B;  5L2F A;  2AVX A;  4P6B A;  4PM8 A;  3RH8 B;  1KGE A;  4IED A;  2QHK A;  3S7N A;  1ERO A;  4F3L A;  2C5W B;  4HES A;  3G30 A;  3CIT A;  3T4O A;  3FKW A;  1A0K A;  1X0O A;  5E2E A;  4B9O A;  2PDR A;  3BW6 A;  1CF0 A;  2G2W A;  3BWL A;  1G6O A;  3EEH A;  5CX7 A;  1F2K A;  3G35 A;  3P01 A;  5DF7 A;  2VK3 A;  1CI9 A;  5G4Y A;  2J3T D;  1W5D A;  5E43 A;  5A8B A;  4KG5 A;  2FFY A;  1MWR A;  3ZGA B;  1D7E A;  2OAP 1;  1NLY A;  1K55 C;  2YKH A;  4ZJ1 A;  2V1A A;  2Y4A A;  4MNR A;  5EOO A;  1XJ4 A;  1UGU A;  2Y2M A;  2GNX A;  4EER A;  2JC7 A;  1OJG A;  1YLY A;  1PWG A;  3IF5 A;  2BG1 A;  4GW9 A; 
#chains in the Genus database with same CATH homology
 2VEA A;  2XSS A;  4HJ3 A;  1MZU A;  3TE8 A;  4RQ9 A;  4BBV A;  4BJP A;  2VA0 A;  1OT9 A;  2CMN A;  5HDS A;  5KSH A;  2A24 A;  3KSG A;  2JHE A;  3OC2 A;  1LSW A;  1Y28 A;  2OWH A;  2DMW A;  3K2N A;  1N9L A;  2PR6 A;  5F6A A;  5AJG A;  4Q0J A;  3T4T A;  2D01 A;  5DKL A;  1P0Z A;  1F98 A;  2B02 A;  2VV8 A;  2J80 A;  3LR3 A;  1VB6 A;  1GSW A;  3BQ8 A;  1F9I A;  2W27 A;  4R38 A;  1YKD A;  3UE3 A;  3KO6 A;  2W3F A;  4L0L A;  2OOL A;  2JKR I;  2W3H A;  3E4O A;  4I3A A;  3GEC A;  3PXP A;  3MQQ A;  4II7 A;  1S66 L;  5HD5 A;  3IBJ A;  3S7P A;  2WKQ A;  3IS2 A;  1F5M A;  3LR4 A;  3T50 A;  3K3C A;  1G28 A;  3T4J A;  2KDK A;  5F69 A;  5AVE A;  4ETX A;  4EES A;  4EQ1 A;  4I3I A;  1DP9 A;  3KSI A;  1OTD A;  2QWS A;  4Q0I A;  2VX8 A;  3KSH A;  4OOM A;  2A2L A;  4O0P A;  4JGP A;  3MQ0 A;  1VHM A;  2PD7 A;  1D06 A;  3PR6 A;  2VZW A;  2PT7 A;  2W3D A;  2Y79 A;  5J7E A;  4HH2 A;  3ZQ5 A;  4HI4 A;  2P08 A;  3FPV A;  2JN7 A;  3MR0 A;  4DN0 A;  3UB7 A;  2QJ7 A;  4EEU A;  3UMD A;  3BQA A;  3R4K A;  1S4S A;  5L8M A;  1N9N A;  3OCN A;  3PBR A;  4BMW A;  5HZH A;  3LR0 A;  1NLZ A;  1TS8 A;  3MJQ A;  1T1A A;  4R70 A;  4GCZ A;  5DJT A;  2OWJ A;  1UWN X;  4JGO A;  3MXQ A;  3SW1 A;  3LFV A;  1ODV A;  1WA9 A;  4HY8 A;  3F1O B;  1DP8 A;  4FOF A;  3KSF A;  3FC7 A;  3MFX A;  3OOV A;  4Z1W A;  3CAX A;  1DP6 A;  2VV6 A;  5MC7 A;  3OLO A;  4KUK A;  1IFQ A;  3A0R A;  4G3W A;  4MCW A;  4HIA A;  3BJN A;  1DRM A;  1V9Z A;  2MJ6 A;  2KX6 A;  1V9Y A;  1OPX A;  3VOL A;  5IT5 A;  1YSQ A;  3F1P B;  5G4Z A;  4EU0 A;  1YAX A;  2V0W A;  4NKP A;  2EWW A;  2L4R A;  2O0Y A;  2HF6 A;  3F1O A;  4G3K A;  4O01 A;  1OTE A;  2K7S A;  3NJA A;  4HP4 A;  1XJ2 A;  2JKT I;  3E0Y A;  5TBM B;  3TW8 A;  5I5L A;  4R6L A;  3EEA A;  3KYZ A;  3LIA A;  5HWV A;  1XFN A;  2BAS A;  3H82 B;  4YOF A;  2ZMV A;  4L9E A;  3LR5 A;  4JGR A;  3E4P A;  4PKY G;  5KIZ A;  2PHY A;  4HNB A;  4OOL A;  4NXF A;  3V67 A;  4WN5 A;  2M7U A;  4NXE A;  5TBM A;  2G7U A;  3PBT A;  4GJ4 A;  3FG8 A;  4MN7 A;  2EWV A;  1H8M A;  3H7W B;  4HOI A;  4ZRR A;  2PD8 A;  3IS2 B;  3H82 A;  1TD5 A;  3CWF A;  2O9A A;  4H6J B;  4HH3 A;  3PYP A;  2FH5 A;  1T18 A;  1BYW A;  2PYP A;  2LB9 A;  2GJ3 A;  2J3W A;  2V1B A;  2OAQ 1;  4QPR A;  4HP9 A;  4LRZ E;  3JVV A;  4IUH A;  3H7W A;  1XJ3 A;  3D3O A;  2VKS A;  2M7V A;  4P6Z M;  4H6J A;  3C2W A;  4LRY C;  2QKP A;  2WKP A;  3GDI A;  4NEE D;  1T19 A;  4IHQ A;  3OCL A;  3T4K A;  3LUQ A;  5EFW A;  2H28 A;  4Y3I A;  1OTB A;  4IJG A;  2B18 A;  4WL9 A;  1GSV A;  2GX5 A;  1P9R A;  2JKT M;  4ARZ A;  5HPI A;  2GZA A;  1T1B A;  3UB9 A;  4HHD A;  5DJU A;  5IU1 A;  3PBS A;  3B47 A;  4KQO A;  3E98 A;  3A0V A;  4I38 A;  4DJ3 A;  4EET B;  3RTY A;  3U2A A;  2VGL S;  2PR5 A;  1P9W A;  2XRN A;  2VV7 A;  4WUJ A;  3UB6 A;  4GHI B;  1S1Y A;  4I3J A;  4P6Z S;  4UEY A;  1MC0 A;  1ZTU A;  5DF9 A;  4I5S A;  5TJJ A;  4PAU A;  3LIB A;  5C5K A;  4I39 A;  5HD3 A;  3CUE A;  2EA9 A;  2Z6D A;  3BY8 A;  4BBU A;  4XT2 B;  3EWK A;  2W3E A;  5HWT A;  4MN5 A;  3B33 A;  3UE6 A;  4CLC E;  3P7N A;  1S4R A;  3VE4 A;  2QJ5 A;  3HJI A;  2ZOI A;  4PKY A;  2INW A;  3C30 A;  3TRC A;  3EQV A;  4GHI A;  1UWP X;  3ICY A;  5FL3 A;  2Z6C A;  4O8G A;  5AVF A;  4PHT A;  4LPZ A;  4EUV A;  4XT2 A;  4BWI A;  3MMH A;  3C8C A;  2HGV A;  3S7O A;  3W2Z A;  3PBN A;  3T4Q A;  4FSF A;  1NWZ A;  5DKK A;  3ULF A;  1LL8 A;  1TF1 A;  3EGD C;  3R7W B;  4CLC B;  5J4E A;  1S67 L;  1TS0 A;  2HV1 A;  4WLA A;  2FZ0 A;  4WF0 A;  1ZHH B;  2W3G A;  4DMZ A;  4LLO B;  1N9O A;  3KX0 X;  3S7Q A;  3CLO A;  1XJ6 A;  3EOI A;  4GS9 B;  1OTA A;  3LID A;  3E4Q A;  1OT6 A;  3R7W A;  4CLC A;  4L9G A;  4KUO A;  3H9W A;  3FPW A;  3B42 A;  5F68 A;  4K08 A;  1EW0 A;  3ZYT A;  3F1N B;  3LIC A;  3VV4 A;  1H3Q A;  2L0W A;  3NOT C;  2WKR A;  1MKM A;  5F5Y A;  3G6O A;  1OTI A;  3NOP C;  4M4X A;  3NOU C;  4GS9 A;  2O9B A;  3K3D A;  4EXO A;  2ZBB A;  5LBR A;  2IA2 A;  2ZMF A;  2W0N A;  4HJ6 A;  4ME4 A;  2I9V A;  4MDZ A;  4WEJ A;  4Y5F A;  1P97 A;  2D02 A;  2P04 A;  3A0S A;  2VJW A;  3CI6 A;  3F1N A;  4CLC C;  2HJ9 C;  3OBF A;  1LSX A;  1TS7 A;  1KOU A;  3PHY A;  1OJ5 A;  2VGL M;  3DBA A;  2P7J A;  1GSX A;  1NRJ A;  2XRO A;  2YKF A;  4LRX C;  4UQI S;  1YSP A;  4B93 A;  3MF0 A;  4DJ2 A;  4ARZ B;  4AFI A;  5HWW A;  2XA7 S;  3EQU A;  5DFY A;  2NUT C;  3TJZ C;  2V0U A;  3JVU A;  4KQD A;  4CLC D;  3PBQ A;  4WEL A;  4YNR A;  1IOU A;  3NHQ A;  1W63 M;  2O9C A;  4MMN A;  4NXB A;  4EEP A;  5HDD A;  1S1Z A;  2V9A A;  2Y8H A;  2W1R A;  5HL6 A;  3C38 A;  4F3L B;  2HJE A;  4R3A A;  2ZOH A;  1LSV A;  4L9F A;  3O5Y A;  1W63 Q;  2KOI A;  3HJK A;  3UB8 A;  3LIF A;  5K5B A;  4HJ4 A;  2K2N A;  1LT0 A;  1TS6 A;  1XFQ A;  2LB5 A;  2M1C A;  5HDC A;  3RH8 B;  2KLI A;  2QHK A;  3LI8 A;  3S7N A;  3RFB A;  4F3L A;  3T4S A;  2K31 A;  3CIT A;  3T4O A;  2R78 A;  4NXG A;  2W1T B;  2J3T C;  5DFX A;  1X0O A;  1T1C A;  4MN6 A;  4HQA A;  2PDR A;  3BW6 A;  4B9O A;  5J3W A;  4GLQ A;  3BWL A;  1G6O A;  3EEH A;  4E04 A;  5CX7 A;  4EW7 A;  3LIE A;  3P01 A;  1JNU A;  5G4Y A;  3CUE C;  3LYX A;  4YWZ A;  2J3T D;  4BBT A;  2W1T A;  5IS1 A;  5A8B A;  4Y2F A;  3LI9 A;  4ETZ A;  4Q0H A;  3UME A;  1STZ A;  3VE3 A;  1D7E A;  2JKR M;  2OAP 1;  2PYR A;  1NLY A;  2YKH A;  5HPF A;  4IUK A;  2V1A A;  3EGX C;  5HSQ A;  1XJ4 A;  3D72 A;  1UGU A;  3PBO A;  2GNX A;  4EER A;  3IBR A;  4JGQ A;  2VLG A;  2L1M A;  4UQI M;  1OJG A;  3BY9 A;  2A24 B;  4WEK A;  2QYB A;  2NUP C;  2O99 A;  3HCY A;  3KYQ A;  4G3V A;  2XA7 M;  3MQO A;  3T4L A;  4CQH A;  3F1P A;  4GW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...