5F69A

Drosophila melanogaster cycle w398a pas-b with bound glycerol
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
b'MFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPATSEIDYIIAKNSVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein cycle
publication title Drosophila Melanogaster Cycle PAS-B with Bound Glycerol
rcsb
source organism Drosophila melanogaster
molecule tags Circadian clock protein
total genus 31
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5f69A00
2A24A 1GSXA 3PYPA 4HI4A 3UB9A 2VV7A 3A0VA 1UWNX 2Z6DA 3BY9A 1VB6A 1P0ZA 3K3DA 1XFNA 4HH2A 2H28A 3BY8A 2EA9A 1OTDA 2L4RA 3LIAA 2OWHA 4HHDA 5A8BA 4HNBA 4GS9B 4L9GA 4M4XA 4H6JA 2PD8A 4WLAA 4XT2B 5HDCA 2CMNA 4R3AA 5HSQA 3EWKA 5G4ZA 3F1OA 2L1MA 4F3LA 4GHIA 4HP9A 1OTIA 3LYXA 4HJ6A 4GCZA 3LIFA 1KOUA 3T50A 4JGOA 4LLOB 4LPZA 2VV8A 3E4QA 4DJ2A 2WKQA 4EXOA 3F1NA 4HP4A 2J80A 1S4SA 5I5LA 2WKRA 3LICA 1TS8A 1N9OA 3C2WA 3CWFA 1XFQA 3PHYA 3OLOA 1XJ4A 1TS0A 1WA9A 3LI8A 1P97A 5DJUA 2R78A 1UGUA 1OT6A 4BBVA 3H7WA 3ZQ5A 1DP9A 5DKKA 3H82A 3VOLA 2GJ3A 2M1CA 2YKHA 3HJKA 4HOIA 3UB6A 4I3JA 5HWVA 1DRMA 3FG8A 3BWLA 2D02A 5TBMB 2W27A 1D06A 2PYRA 5AVEA 4E04A 3NHQA 4YWZA 1LSWA 4KUOA 2PR5A 3LIEA 1BYWA 1JNUA 4GS9A 3A0SA 4I5SA 2Z6CA 4HQAA 2P7JA 3LIBA 2OOLA 3NOUC 4PKYG 3UE6A 4EESA 5HDSA 4MN6A 4R38A 2W0NA 5HD3A 3LIDA 1S66L 3GECA 1N9NA 4EEPA 3D72A 4BBTA 1V9YA 1Y28A 4EERA 1F9IA 2BASA 2D01A 4LRXC 3RH8B 1T19A 3MFXA 3UMEA 4H6JB 3NOPC 1S67L 2INWA 1T18A 5G4YA 3RTYA 2HV1A 3FC7A 2ZOHA 2PDRA 2PD7A 4F3LB 2PYPA 4GHIB 3SW1A 4JGRA 1LSVA 3E4OA 3IS2B 2OWJA 3H9WA 1S4RA 3E4PA 4JGPA 5DKLA 1T1AA 1OTAA 5HWWA 2V0WA 3G6OA 5HWTA 3F1PA 5J4EA 1MZUA 3B33A 2QJ5A 4HIAA 4I3IA 5TBMA 3MQQA 3ICYA 3F1NB 4HY8A 4EW7A 2B02A 1X0OA 5IU1A 2JHEA 3GDIA 2QHKA 1XJ6A 4K08A 2JN7A 3UB7A 2PR6A 1TS6A 3HJIA 4NXBA 4B9OA 3H7WB 3MQOA 1GSWA 5F68A 3H82B 4XT2A 5DJTA 5EFWA 1GSVA 1S1ZA 1T1CA 3VE4A 2VEAA 2V9AA 2VV6A 2QKPA 4L9FA 2PHYA 4KQDA 4WN5A 2ZBBA 4EQ1A 2A24B 3IBRA 4GW9A 1DP6A 4HH3A 4PKYA 4HJ3A 4LRYC 4I3AA 2KX6A 4NXEA 1V9ZA 2QWSA 3MJQA 1G28A 1LT0A 3A0RA 2V1BA 1F98A 4JGQA 5HDDA 2ZOIA 4RQ9A 5HZHA 1XJ3A 1LSXA 3P7NA 1OTBA 4WF0A 5F6AA 2V1AA 2V0UA 1UWPX 5J3WA 3UMDA 1D7EA 2K7SA 3IS2A 4I38A 1DP8A 2QJ7A 3VE3A 1OTEA 1ODVA 3EEHA 3KX0X 1OJGA 3F1OB 4LRZE 2I9VA 3UB8A 3LI9A 1OJ5A 1TS7A 5F69A 3K3CA 4EEUA 1S1YA 4MN5A 4BBUA 4R6LA 4WUJA 5F5YA 4DJ3A 1N9LA 1T1BA 3NOTC 4EETB 1EW0A 5AVFA 4NXGA 3MXQA 2YKFA 5IS1A 1NWZA 3C8CA 4L9EA 3CLOA 3LUQA 4R70A 1OT9A 5HD5A 2WKPA 1LL8A 4HJ4A 2VLGA 4KUKA 4WL9A 3ULFA 2L0WA 3MR0A 2KDKA 3CAXA 3NJAA 4NXFA 1XJ2A 5KIZA 5J7EA 3F1PB 4I39A
chains in the Genus database with same CATH superfamily
2A24A 3IWOA 1O7EA 2IA2A 5FAPA 1M6KA 1GSXA 4HI4A 3CI6A 1Q2PA 1A0KA 3BY9A 4LCMA 4E6WA 1P0ZA 3K3DA 3OZHA 4HH2A 1PIOA 2H28A 3UE1A 2EA9A 4MDZA 1F5MA 1PZOA 2L4RA 4OOLA 5TFQA 2OLUA 2ZMFA 1GHPA 2OWHA 4HHDA 4KQRA 1XGJA 3EQUA 2W1TB 3HBRA 4O8GA 4OOMA 4H6JA 1JWVA 5IHVA 3BFEA 3C38A 2CMNA 5HPIA 3EWKA 1BTLA 3MFDA 2W1RA 1E3UD 3EOIA 3F1OA 3Q7ZA 4GHIA 2O99A 1K56A 1CJFA 1N4OA 3IBJA 1KOUA 1KE3A 3CHWP 4LV1A 3NDEA 4E3OA 1HZOA 1K6RA 2VV8A 4Y0UA 3HLGA 3FKVA 1PWDA 2H0YA 2OLVA 2GZAA 1GA9A 1XP4A 5I5LA 1P9WA 4R0QA 5DF8A 4S2LA 5GL9A 3JPUA 3K2NA 1L0GA 5GLBA 1MWUA 3C2WA 1TDLA 1WYBA 2EX2A 2Y4AA 3PHYA 3ISGA 1TS0A 5GHXA 1WA9A 1P97A 3BYDA 1NXYA 2XQZA 5EVIA 3KSGA 3KSIA 2Y2GA 4P6BA 4BBVA 1DP9A 2J3TC 4JKTA 4ZDXA 3BFDA 3V3SA 4LV3A 1MWRA 3G31A 1YQSA 2JKGA 1VEUB 1K56D 5EECA 4HEFA 3S22A 2M1CA 4GKUA 1H3QA 2YKHA 2Y91A 3EEAA 1H5XA 1DRMA 3B3XA 3QP8A 3FZCA 4X53A 2W27A 1D06A 1SDEA 4R4RA 1IYSA 4ZRRA 4YWZA 3T12B 1LSWA 3LR4A 4FCFA 4KUOA 2C6WB 1TD5A 1YLZA 3TJZC 3PBRA 1BYWA 1XA1A 2X71A 5CGWA 3LIBA 1J9MA 2G2WA 1ES5A 3NOUC 4MLLA 1K0KA 3BFCA 2XH9A 5EVID 3PBNA 4EESA 4N9KA 5HDSA 1BT5A 4RYEA 3B42A 1ONGA 3DBAA 3HLWA 4BENA 5DFYA 4R38A 5GLCA 1S66L 3GECA 1N9BA 3VFHA 1WYCA 4DF6A 3V3RA 3O86A 1KGEA 1F9IA 2WGIA 3ZHHA 1E4DA 3ZG5A 2WZXA 3ZYTA 5GLAA 1TVFA 2KLIA 2ZD8A 4O01A 2W3GA 2XEPA 1QMEA 4FD8A 2XGNA 5F1GA 4IUKA 4G3WA 1Z6FA 3OCNA 5EOOA 3PAEA 3UMEA 4H6JB 3NOPC 1S0WA 2XFTA 4GD8A 2INWA 1T18A 2NUTC 2E8IA 2JKTM 2Q9NA 5HFOA 4S2MA 3FC7A 2ZOHA 4CLCE 4BQMA 4ETZA 4GHIB 3D9YA 3SW1A 4CLCA 4R3BA 3IS2B 1IYPA 4EBPA 2V8FA 2Y59A 3ZNTA 4LGWA 3CJMA 4JGPA 2QPNA 4X25A 2XA7S 4QHCA 5HWWA 2V0WA 3G6OA 2EWWA 3UB5P 3NIAA 4HIAA 2QJ5A 4I3IA 5TBMA 3VOZA 2OAQ1 3HUOA 4HY8A 4Q0JA 1DJCA 4B88A 1XJ6A 1RGZA 2JN7A 5EVIC 3UB7A 3S7NA 2HJ9C 1G68A 3HLEA 1DY6A 3TG9A 3NULA 3MQOA 1TF1A 4QY5A 2G2UA 4UQIS 1STZA 4R23A 2OAP1 4XT2A 4CLCD 5DJTA 5EFWA 3GVBA 4OPQA 5AJGA 1U60A 2HP6A 3IX8A 1T1CA 3VE4A 2O9BA 1SDNA 3SS3A 5U47A 4PM6A 1FSYA 2ZMVA 4E6XA 4WBGA 1PI4A 4WEKA 1VM1A 1ONHA 3WS0A 1ZKJA 1JTGA 3RXWA 3IXDA 2LB9A 2JCHA 4RX3A 3ITBA 2J8YA 4LRYC 5A92A 4I3AA 2FFFB 2EXBA 3SS5A 4BD0A 2HGVA 2V8CA 2VX8A 4P6ZS 2PRFA 3IF6A 5FI6A 5L2FA 1I5QA 4ME4A 4MBFA 1OTBA 2Z2LB 4E3MA 3BECA 2PBYA 3ZG9B 2FZ0A 2ZLYA 2UV0E 5J3WA 3E2LA 3S1YA 1DP8A 3CMZA 1W63Q 4DE3A 1ODVA 1H8YA 1NYMA 3EEHA 2Y79A 1OJGA 4BD1A 3SS4A 3V39A 4LRZE 3HUNA 3SOIA 2E8JA 3T1QB 1OJ5A 5F69A 3MZFA 4GN2A 4EEUA 1MY8A 4DKIA 1DJAA 3VP4A 3E0YA 1FR1A 4PAUA 1N9LA 1T1BA 1EW0A 2P9VA 3CZDA 5FAOA 4KZ6A 3CLOA 3ZFZA 3NY4A 4JBFA 3LR0A 3LUQA 1K4EA 2WKPA 3LEZA 3BJNA 1LL8A 4CLCB 2VLGA 1K38A 2W3DA 4R1GA 4GOGA 3ULFA 2L0WA 3NBLA 3Q07A 2EXAA 4IHQA 1XJ2A 5KIZA 1Q2QA 5LBRA 5CEDA 4DE1A 2HDUA 3PYPA 3UB9A 4Z1WA 4MBKA 1IYOA 1JVJA 2Z6DA 4K91A 2QYBA 4KZ9A 4BJPA 1XFNA 5CX7A 3W4PA 2HF6A 2VGJA 3ZG0A 5CHUA 4UEYA 3ZVWA 4IJGA 1OTDA 2VA0A 4E3LA 2V2FF 1HTZA 4OH0A 1HD8A 5E43A 3FWLA 4HNBA 5TR7A 2ZM2A 3D3OA 3W4OA 4GS9B 3MSHA 4WLAA 3E98A 4KZ5A 4XT2B 1ESIA 1ZTUA 3I7JA 3UDIA 4X55A 5HDCA 2ZQ7A 1S6RA 5HSQA 5TJJA 3W8KA 4MCWA 2WAEA 4S2IA 1M40A 1H0MA 3VOYA 4KG2A 1AWIA 4HP9A 4JXWA 3CUEA 3LYXA 2HP5A 3T50A 4O0PA 3MKFA 3N7WA 5CHJA 2HJEA 3RXXA 4DJ2A 2WKQA 4JLFA 4YOFA 2XDMA 4HP4A 2J80A 4FOFA 4OVDA 1PNEA 3RJUA 3LICA 2BLSA 3DTIA 2H0TA 2XR0A 4Y2FA 2K31A 4OOYA 3CITA 3OLOA 3WRTA 1J3WA 4X56A 5EM1A 5DJUA 4PM7A 4H8RA 4P0MA 3MXRA 1OT6A 3C7UA 3UN7A 4S2NC 4YNRA 4GB7A 4NK3A 3EQVA 1XXMA 3VOLA 1F2KA 2HPBA 4HOIA 4CQHA 2XFSA 3IHBA 1MBLA 1CEFA 1WE4A 1BULA 3N4IA 5HPFA 4ZBEA 1VETA 2OSUA 3BWLA 3Q7VA 1KGGA 2LB5A 5FI2A 3DWZA 3Q81A 2P9VB 4AFIA 4EBNA 4WEJA 3BLSA 2J3TD 1BZAA 4ZJ3A 5KMWA 1YSPA 4X69A 2PR5A 4WMCA 3VP2A 1JNUA 3IX4A 3A0SA 1EROA 2Z6CA 2P7JA 2WUQA 5AQAA 3T4JA 4E3KA 5BOHA 4DDYA 2WZZA 4XXRA 4MN6A 2B18A 2W0NA 3L9KA 4IVIA 1N9NA 4EEPA 1K25A 3WWXA 2JC7A 4BBTA 5MC7A 2UWXA 1BUEA 4XUXA 2RL3A 3C4OA 3DWKA 1MPLA 2D01A 4DXCA 4OP8A 4LRXC 5FDHA 3OPPA 1PFLA 2BTFP 1T19A 3BRMA 1XKZA 5EVEA 1FR6A 4WMCD 4OPYA 1S67L 4ID4A 3D4FA 4II7A 3BFGA 4EV4A 5GHZA 1PYYA 1KVLA 1L2SA 2P74A 2Y2IA 3CUEC 3N8SA 2GNXA 2VGLM 3P09A 5FI7A 3HL9A 5EV0A 2PD7A 2PYPA 3B47A 4N1XA 3E4OA 3M6BA 4HESA 3PR6A 2ZC3B 5HAPA 3E4PA 3ZNYA 5HWTA 3O3VA 3F1PA 3S7QA 1MZUA 3B33A 4DRTA 4Z9QA 4NETA 3VSKA 2B02A 3T4TA 2QHKA 4WZ5C 2XD1A 1TS6A 2Y2KA 2FFYA 5CGSA 3DW0A 4NXBA 2J9OA 1GSWA 1ZHHB 4QB8A 5DF9A 1SKOA 1W8QA 3KSFA 3EGXC 4P85A 4NEED 1W5DA 5HAIA 4S2OA 1NRJA 3AGEA 3G2YA 1MKMA 2QKPA 4L9FA 4MN7A 2PHYA 3Q7VB 4KQDA 5FSRA 2A24B 4GW9A 4YFMA 5AQ7A 4Q0IA 1FILA 3HLDA 1ES2A 4HJ3A 4UA6A 3HLBA 2KX6A 4R3JA 5D3OA 1NYYA 1G28A 5DTTA 1VHMA 3AGFA 1SKFA 3A0RA 1F98A 5HDDA 1YPRA 2WADA 4E3JA 2HP9A 4DN0A 1XJ3A 4PMAA 5E2FA 2J3WA 2FH5A 5F6AA 1PW8A 5CERA 3SZTA 4R4SA 1UWPX 3UMDA 3QP2A 1K55C 4ESPA 4Q0HA 2JKTI 2X02A 3VE3A 3OCLA 2OV5A 3KX0X 4FTXA 4GZBA 3JVUA 3IXBA 3F1OB 2XD5A 4M3KA 5AQBA 2A3UA 4OKPA 2ZC5B 3FV7A 2WK0A 3T4KA 4WUJA 3QP5A 1TEMA 1GHIA 3C4PA 2Y8HA 1IELA 4ARZA 4EETB 3AGDA 4NXGA 1Z09A 2J7VA 5L07A 4L9EA 5CXWA 1MC0A 3OPLA 5HD5A 2KOIA 2P04A 2DMWA 2ZM8A 5EUAA 4KUKA 4JXGA 2ZC6B 4WL9A 4ZJ2A 3TRCA 3W4QA 3A3FA 3BW6A 3MR0A 4IVKA 5EVIB 4C6YA 1ERQA 4FSFA 3NJAA 3N6IA 3IQAA 3MS6A 3F1PB 2W3HA 4RVAA 2ZM0A 3WRZA 4C3QA 5CHMA 3C30A 2PBDP 1KVMA 4K0XA 5IT5A 1I2SA 4Q8IA 4N9LA 5E2GA 1VB6A 5DTSA 2W3EA 3UPPA 3BY8A 5CEBA 3O87A 3DTKA 1CI9A 3R7WA 5A8BA 4OPZA 4UQIM 4L9GA 4M4XA 1IFQA 2PD8A 5KSHA 2VGKA 5FQQA 1K6SA 4KZAA 2W3FA 1FSWA 4N1HA 4F3LA 2Y2OA 4GLQA 3BQAA 1OTIA 3LIFA 3IHAA 2V1ZA 4NKPA 2A49A 1FCNA 3VP0A 5A93A 2Y2JA 3VV4A 3LY3A 1IEMA 3GMWA 4KQOA 3FPVA 4EUZA 5FQ9A 4Y0OA 1SZVA 2EFXA 3ITAA 4OLDA 4S2NA 4U0TA 2B5RA 3P98A 3F1NA 4DE0A 2ZQ9A 1S4SA 4DE2A 1TDGA 4EBLA 1D1JA 2ZMAA 2VJWA 5E2HA 1JWZA 1TS8A 1N9OA 3G2ZA 3QP4A 3HVFA 4KZ4A 3PXPA 3QNBA 3FPWA 3MKEA 1RP5A 3HLCA 3LI8A 2JKRM 5EE8A 1UGUA 3H7WA 3ZQ5A 4QD4A 5DKKA 4ZAMA 3IXHA 4Y13A 4UA7A 3UDFA 1KDSA 1Y4OA 3LGOA 1NLYA 1FQGA 3HJKA 3HUMA 1K4FA 3UB6A 3M2KA 4Y0TA 5FDSA 4ARZB 3FG8A 3IXGA 4XUZA 2D02A 5TBMB 4S2PA 1XA7A 1KGFA 4WM9A 4E04A 1G6OA 1MWTA 4BWIA 5DF7A 1XGIA 3LIEA 1OMEA 2W1TA 4I5SA 5DFXA 5HW3A 4HQAA 2H5SA 1VQQA 2OOLA 3U2AA 3WS2A 4GDNA 4Y5FA 1KE0A 2Y2HA 5GLDA 3Q1FA 3V50A 3MZDA 1ZC2A 4MBHA 5CECA 3UPNA 5HD3A 3LIDA 4D60A 3D72A 3T1XA 1BLPA 3LY4A 2C5WB 1FIKA 1V9YA 1Y28A 2EX9A 4OONA 5FASA 4EERA 1YM1A 4WZ4A 4JPMA 2BASA 3G34A 3Q82A 2HDQA 3RH8B 3R7WB 2PT7A 4OQIA 5FEGA 5FAQA 3MFXA 3OBFA 2AVXA 2ZQDA 2PU4A 2PU2A 2XROA 1W63M 4B93A 3PAGA 3IH8A 4KQQA 3T4LA 2O9AA 3IF6B 5G4YA 4JF5A 1JWPA 2RCXA 4Y15A 2HV1A 3A3IA 4B4XA 3GTCA 4U0XA 1IYQA 4F3LB 2ZC4B 1LSVA 1VEUA 2PAVP 2OWJA 3TE8A 2NUPC 1ACFA 4WZ5A 1ALQA 4PM8A 4IEDA 1OTAA 1XX2A 3OOVA 3LO7A 5HL6A 4MMNA 2HZ5A 5K5BA 3SH8A 4HBTA 5J4EA 2XLNA 1YMXA 4MEZA 5FATA 4EQIA 1PZPA 3F1NB 3ICYA 5IU1A 5J8XA 1EWZA 2WAFA 2JHEA 3HLFA 5L10A 3IWQA 3E2KA 4K08A 2XRNA 4WYYA 5HARA 3UNWA 5KZHA 2M7UA 5EVLA 3BFFA 4NG2A 3G35A 1ZG6A 5CTNA 4BL2A 3T4SA 3H7WB 1I2WA 5F68A 1LL5A 3MXSA 3UDXA 2M7VA 1XPBA 4QY6A 2ZL1A 1GSVA 4OP5A 2VEAA 3MZEA 2QMIA 2V9AA 4FH4A 1HLUP 3GRJA 5L09A 2VK3A 4EQ1A 2JE5A 3IBRA 1DP6A 5FQKA 4WELA 4PKYA 3VP3A 2HDRA 3VP1A 1K55A 1V9ZA 2IWDA 3HREA 1GHMA 3LFVA 4MNRA 5F1FA 5C5KA 1W79A 4JGQA 2O0YA 4JXSA 3UY6A 4RQ9A 3QP6A 1K57C 2BG1A 3NECA 5HZHA 3IX3A 2VGLS 2IWCA 3P7NA 3C5AA 1EI5A 1BLHA 5FQMA 2WYXA 2V1AA 2V0UA 3W2ZA 4GD6A 1GA0A 3IS2A 2K7SA 4I38A 4OPRA 2WKHA 1CI8A 1PRQA 1ZG4A 5AQ9A 3IT9A 3FKWA 4G3VA 4D2OA 3N8RA 4U3TA 4OQGA 3ZGAB 3UB8A 4N92A 4OQHA 4X68A 1IKGA 1TS7A 5FQIA 3MMHA 5DVAA 3ZCZA 4EWFA 1S1YA 3GSGA 4S2JA 4R6LA 1YMSA 2GX5A 2MJ6A 4YINA 1PW1A 1YLPA 3OC2A 3NOTC 1LI9A 1BLCA 2VZWA 3MXQA 1LHYA 4UHUA 1KE4A 2ZQCA 3C8CA 3M6HA 3T4OA 3S7PA 3SH9A 5JYOA 2CC1A 2P08A 4R70A 1G5UA 2JKFA 2V20A 2WKIA 3CPTA 4DXBA 5KSCA 3NI9A 4KG5A 2O9CA 1W7FA 1FCMA 2KDKA 3CAXA 3FYZA 3ZG7B 4PHTA 4UAAA 3SH7A 5M18A 2JBFA 5J7EA 1NLZA 4I39A 5JYPA 3DTMA 1MKIA 4OLGA 2VV7A 3A0VA 3G4PA 3GR2A 3O5YA 4LFUA 1UWNX 3V67A 1VETB 3WS1A 1H8MA 4ETXA 5E2EA 2ZJ9A 4X1LA 4KZ3A 1YLYA 1K54C 3LIAA 3V5MA 1YAXA 4GDBA 2I72A 3PTEA 3VSLA 3PBSA 3S7OA 3GQZA 2HDSA 4EUVA 2ZL1B 1L3LA 4BL3A 2Q9MA 4R3AA 3NCKA 4IUHA 2XF3A 5G4ZA 4G3KA 1L0EA 4KENB 2L1MA 1O07A 3G32A 4HJ6A 4GCZA 4P87A 5FQJA 4KZBA 4JGOA 4RA7A 4LLOB 3T1SA 3P01A 4LPZA 3LEQA 1FCOA 3IH9A 3E4QA 5HAQA 4EXOA 1NJ4A 4KG6A 4DMZA 1MWSA 2WKRA 1CK3A 4BLMA 3N8LA 2B95A 3ZVTA 3CWFA 1YLWA 2XK1A 4UA9A 4BMWA 1XFQA 4QJGA 3NC8A 5FL3A 1XJ4A 1QMFA 3C7VA 2A2LA 3S4XA 2R78A 4IBRA 4O7DA 3LCEA 4RX2A 4L0LA 4A5RA 1IOUA 2WKEA 3H82A 1LL9A 2GJ3A 4CPKA 1IKIA 4E3NA 3RFBA 4LCLA 4I3JA 3U4LP 5CGXA 5HWVA 2ZQAA 4S2KA 5HL1A 2XA7M 1GCEA 4QU3A 3DTEA 2WGWA 2PYRA 5GHYA 5AVEA 4LV2A 5CTMA 4QWOA 1JTDA 4HBUA 2EFUA 4KZ7A 3NHQA 3KO6A 4GS9A 3DAVA 1CQAA 2R9WA 2ZC7A 3CPTB 4IBXA 1NY0A 4FUWA 1PI5A 4ZJ1A 4CJNA 2Y2LA 4PKYG 3IWIA 4JF6A 2G7UA 3A3JA 3UE6A 3PBTA 5M1AA 1SKOB 3NDGA 5A90A 3O88A 5DTKA 4LENA 3KYEA 4QPRA 3TSGA 1HVBA 1E25A 1C3BA 1G6AA 4F94A 4GJ4A 1BLSA 4EU0A 3QHYA 4B4ZA 3OPRA 5EOEA 1FOFA 2DCFA 3IF5A 4K0WA 2R9XA 3LR3A 4P6ZM 5I94A 3UO9A 5EPHA 3RTYA 3CG5A 3UE0A 4GNUA 1DJBA 1ES4A 2PDRA 4JGRA 3PBQA 1RCJA 5A91A 3G30A 1P9RA 2VKSA 2JKRI 3H9WA 2Y2NA 3HCYA 1S4RA 3TOIA 5DKLA 1T1AA 4JF4A 2DRWA 5G18A 4FH2A 3BQ8A 3MQQA 1CF0A 4KZ8A 4EW7A 1X0OA 1H8ZA 4CLCC 4JXVA 2Y2QA 3GDIA 3R4KA 1SHVA 1YKDA 2PR6A 2ACGA 3HJIA 3ZDJA 1NZOA 5F83A 1L0DA 1PWCA 4B9OA 3KYQA 3VFFA 2WGVA 5EM0A 3BLMA 3T4QA 3H82B 1SCWA 1W8YA 3EGDC 4C75A 3KYZA 2Y2MA 1S1ZA 4ZTKA 2VV6A 3JYIA 3TW8A 5M19A 4WN5A 2ZBBA 2Y2PA 2WGWB 4HH3A 5TGFA 1K57A 1ES3A 3GV9A 3KSHA 5HX9A 4PM9A 4NXEA 2QWSA 2EX6A 3UE3A 3MJQA 1LLBA 1NRFA 1LT0A 2XSSA 2K2NA 2V1BA 1RGYA 2ZOIA 1YSQA 1LI0A 5CRFA 1PWGA 1LSXA 2GDNA 2Y55A 4WF0A 1ESUA 1BSGA 4Y3IA 1NZUA 1D7EA 4PPRA 1AXBA 3OPHA 2QJ7A 4E3IA 3WS5A 1OTEA 3A3EA 3M2JA 2I9VA 4X6TA 3UPOA 3IF6C 1L0FA 1YLTA 4OQ0A 3LI9A 3BM6A 2EX8A 3QNCA 5L8MA 3K3CA 4MN5A 3BEBA 4BBUA 5FEFA 5F5YA 1Y54A 5F82A 1CEGA 4DJ3A 3T1RA 3MBZA 3JVVA 2IWBA 3WS4A 5AVFA 2ZQ8A 2EWVA 2DNSA 5IS1A 1YT4A 2YKFA 1KDWA 3PBOA 1MXOA 1YLJA 1NWZA 2H10A 4PM5A 2Q0OA 3LR5A 1OT9A 3L7HA 3QP1A 1OPXA 3ZG8B 3VMAA 4HJ4A 1ERMA 3MQ0A 4Y17A 4X1MA 4LV0A 5FA7A 4DDSA 4NXFA 2Z2MB 2QZ6A 3A3DA 1E3UA 4Y7PA 1K54A 2X01A 3MF0A 2J9PA
chains in the Genus database with same CATH topology
2A24A 2IA2A 1GSXA 3PYPA 4HI4A 3C30A 3UB9A 5IT5A 3CI6A 4Z1WA 2VV7A 3A0VA 3O5YA 1UWNX 2Z6DA 3BY9A 3V67A 1VB6A 2QYBA 1P0ZA 4BJPA 3K3DA 1XFNA 5CX7A 4HH2A 2W3EA 1H8MA 4ETXA 2H28A 2HF6A 3BY8A 2EA9A 4UEYA 4MDZA 4IJGA 1F5MA 1OTDA 2VA0A 2L4RA 4OOLA 3LIAA 2ZMFA 2OWHA 1YAXA 4HHDA 3R7WA 5A8BA 4HNBA 4UQIM 3D3OA 2W1TB 3EQUA 4GS9B 4L9GA 4M4XA 4O8GA 4H6JA 3PBSA 4OOMA 1IFQA 2PD8A 5KSHA 4WLAA 3E98A 3S7OA 4XT2B 1ZTUA 3C38A 5HDCA 4EUVA 2CMNA 4R3AA 5HSQA 5TJJA 2W3FA 5HPIA 4MCWA 4IUHA 3EWKA 5G4ZA 2W1RA 3EOIA 3F1OA 4G3KA 2L1MA 4F3LA 4GHIA 4GLQA 4HP9A 2O99A 3BQAA 1OTIA 3CUEA 3LYXA 4HJ6A 4GCZA 3LIFA 3IBJA 1KOUA 3T50A 4NKPA 4O0PA 4JGOA 3VV4A 4LLOB 3P01A 4LPZA 4KQOA 2VV8A 3FPVA 2HJEA 3E4QA 4DJ2A 2WKQA 4EXOA 4YOFA 2GZAA 3F1NA 4DMZA 4HP4A 2J80A 1S4SA 4FOFA 5I5LA 2WKRA 1P9WA 3LICA 2VJWA 3K2NA 1TS8A 1N9OA 4Y2FA 3C2WA 3CWFA 2K31A 3PXPA 4BMWA 1XFQA 3CITA 3PHYA 3OLOA 5FL3A 1XJ4A 3FPWA 1TS0A 1WA9A 3LI8A 1P97A 2A2LA 5DJUA 2JKRM 2R78A 3KSGA 3KSIA 1UGUA 1OT6A 4BBVA 3H7WA 3ZQ5A 1DP9A 2J3TC 5DKKA 4L0LA 4YNRA 1IOUA 3H82A 3EQVA 3VOLA 1NLYA 2GJ3A 2M1CA 1H3QA 2YKHA 3HJKA 3RFBA 4CQHA 4HOIA 3UB6A 4I3JA 5HWVA 2XA7M 3EEAA 1DRMA 5HPFA 4ARZB 3FG8A 3BWLA 2D02A 2LB5A 5TBMB 2W27A 1D06A 2PYRA 5AVEA 4AFIA 4WEJA 2J3TD 4E04A 1G6OA 4ZRRA 3NHQA 4YWZA 4BWIA 1LSWA 3LR4A 1YSPA 4KUOA 2PR5A 1TD5A 3KO6A 3LIEA 3TJZC 3PBRA 1BYWA 1JNUA 2W1TA 4GS9A 3A0SA 4I5SA 5DFXA 2Z6CA 4HQAA 2P7JA 3LIBA 2OOLA 3NOUC 3T4JA 4PKYG 3U2AA 4Y5FA 2G7UA 3PBNA 3UE6A 4EESA 5HDSA 3PBTA 3B42A 3DBAA 4MN6A 5DFYA 4R38A 2B18A 2W0NA 5HD3A 3LIDA 1S66L 3GECA 1N9NA 4EEPA 3D72A 4BBTA 5MC7A 4QPRA 1V9YA 1Y28A 4EERA 1F9IA 2BASA 2D01A 3ZYTA 4GJ4A 4LRXC 2KLIA 4O01A 2W3GA 4EU0A 3RH8B 1T19A 4IUKA 3R7WB 2PT7A 4G3WA 3MFXA 3OBFA 3OCNA 3UMEA 4H6JB 3NOPC 2XROA 1W63M 1S67L 3LR3A 4P6ZM 4B93A 4II7A 3T4LA 2INWA 1T18A 2O9AA 5G4YA 3RTYA 2NUTC 2JKTM 3CUEC 2GNXA 2VGLM 2HV1A 3FC7A 2ZOHA 2PDRA 4CLCE 2PD7A 4F3LB 4ETZA 2PYPA 4GHIB 3B47A 3SW1A 4JGRA 4CLCA 1LSVA 3PBQA 3E4OA 3IS2B 3PR6A 1P9RA 2VKSA 2OWJA 3TE8A 2JKRI 3H9WA 2NUPC 3HCYA 1S4RA 3E4PA 4JGPA 5DKLA 1T1AA 1OTAA 2XA7S 5HWWA 3OOVA 2V0WA 5HL6A 3G6OA 4MMNA 5HWTA 5K5BA 2EWWA 3F1PA 3S7QA 3BQ8A 5J4EA 1MZUA 3B33A 2QJ5A 4HIAA 4I3IA 5TBMA 3MQQA 2OAQ1 3ICYA 3F1NB 4HY8A 4EW7A 2B02A 1X0OA 5IU1A 4CLCC 3T4TA 2JHEA 4Q0JA 3GDIA 3R4KA 2QHKA 1XJ6A 4K08A 2JN7A 2XRNA 1YKDA 3UB7A 2PR6A 1TS6A 3S7NA 3HJIA 2M7UA 4NXBA 2HJ9C 4B9OA 3KYQA 3T4SA 3H7WB 3MQOA 1TF1A 1GSWA 5F68A 1ZHHB 5DF9A 3T4QA 3H82B 4UQIS 2M7VA 1STZA 2OAP1 3EGDC 4XT2A 4CLCD 5DJTA 5EFWA 3KSFA 5AJGA 3EGXC 3KYZA 4NEED 1GSVA 1S1ZA 1T1CA 3VE4A 2O9BA 2VEAA 1NRJA 2V9AA 2VV6A 1MKMA 2QKPA 4L9FA 4MN7A 2ZMVA 3TW8A 2PHYA 4KQDA 4WN5A 2ZBBA 4WEKA 2A24B 4EQ1A 3IBRA 4GW9A 1DP6A 4HH3A 4WELA 4PKYA 4Q0IA 4HJ3A 2LB9A 3KSHA 4LRYC 4I3AA 2KX6A 4NXEA 1V9ZA 2QWSA 3UE3A 3MJQA 1G28A 3LFVA 1VHMA 2HGVA 1LT0A 5C5KA 3A0RA 2XSSA 2VX8A 4P6ZS 2K2NA 2V1BA 1F98A 4JGQA 5HDDA 2O0YA 2ZOIA 1YSQA 4RQ9A 4DN0A 5HZHA 1XJ3A 4ME4A 2VGLS 1LSXA 3P7NA 1OTBA 2J3WA 2FH5A 2FZ0A 4WF0A 5F6AA 2V1AA 2V0UA 1UWPX 4Y3IA 5J3WA 3UMDA 1D7EA 2K7SA 3IS2A 4I38A 3W2ZA 4Q0HA 1DP8A 2JKTI 2QJ7A 3VE3A 3OCLA 1W63Q 1OTEA 1ODVA 3EEHA 3KX0X 4G3VA 2Y79A 3JVUA 1OJGA 3F1OB 4LRZE 2I9VA 3UB8A 3LI9A 1OJ5A 1TS7A 5F69A 3MMHA 5L8MA 3K3CA 4EEUA 1S1YA 4MN5A 4BBUA 3T4KA 4R6LA 4WUJA 3E0YA 4PAUA 5F5YA 2GX5A 2MJ6A 4DJ3A 2Y8HA 1N9LA 3OC2A 1T1BA 3JVVA 4ARZA 3NOTC 4EETB 1EW0A 5AVFA 2EWVA 4NXGA 2VZWA 2YKFA 3MXQA 5IS1A 3PBOA 1NWZA 3C8CA 4L9EA 3CLOA 3T4OA 1MC0A 3S7PA 3LR0A 3LR5A 2P08A 3LUQA 4R70A 1OT9A 5HD5A 2KOIA 2WKPA 1OPXA 2P04A 1LL8A 2DMWA 3BJNA 4HJ4A 4CLCB 2VLGA 4KUKA 2W3DA 3TRCA 3MQ0A 4WL9A 3ULFA 2L0WA 2O9CA 3BW6A 3MR0A 2KDKA 3CAXA 4FSFA 3NJAA 4NXFA 4IHQA 4PHTA 1XJ2A 5KIZA 5J7EA 1NLZA 3F1PB 5LBRA 2W3HA 4I39A 3MF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A24 A;  1GSX A;  3PYP A;  4HI4 A;  3UB9 A;  2VV7 A;  3A0V A;  1UWN X;  2Z6D A;  3BY9 A;  1VB6 A;  1P0Z A;  3K3D A;  1XFN A;  4HH2 A;  2H28 A;  3BY8 A;  2EA9 A;  1OTD A;  2L4R A;  3LIA A;  2OWH A;  4HHD A;  5A8B A;  4HNB A;  4GS9 B;  4L9G A;  4M4X A;  4H6J A;  2PD8 A;  4WLA A;  4XT2 B;  5HDC A;  2CMN A;  4R3A A;  5HSQ A;  3EWK A;  5G4Z A;  3F1O A;  2L1M A;  4F3L A;  4GHI A;  4HP9 A;  1OTI A;  3LYX A;  4HJ6 A;  4GCZ A;  3LIF A;  1KOU A;  3T50 A;  4JGO A;  4LLO B;  4LPZ A;  2VV8 A;  3E4Q A;  4DJ2 A;  2WKQ A;  4EXO A;  3F1N A;  4HP4 A;  2J80 A;  1S4S A;  5I5L A;  2WKR A;  3LIC A;  1TS8 A;  1N9O A;  3C2W A;  3CWF A;  1XFQ A;  3PHY A;  3OLO A;  1XJ4 A;  1TS0 A;  1WA9 A;  3LI8 A;  1P97 A;  5DJU A;  2R78 A;  1UGU A;  1OT6 A;  4BBV A;  3H7W A;  3ZQ5 A;  1DP9 A;  5DKK A;  3H82 A;  3VOL A;  2GJ3 A;  2M1C A;  2YKH A;  3HJK A;  4HOI A;  3UB6 A;  4I3J A;  5HWV A;  1DRM A;  3FG8 A;  3BWL A;  2D02 A;  5TBM B;  2W27 A;  1D06 A;  2PYR A;  5AVE A;  4E04 A;  3NHQ A;  4YWZ A;  1LSW A;  4KUO A;  2PR5 A;  3LIE A;  1BYW A;  1JNU A;  4GS9 A;  3A0S A;  4I5S A;  2Z6C A;  4HQA A;  2P7J A;  3LIB A;  2OOL A;  3NOU C;  4PKY G;  3UE6 A;  4EES A;  5HDS A;  4MN6 A;  4R38 A;  2W0N A;  5HD3 A;  3LID A;  1S66 L;  3GEC A;  1N9N A;  4EEP A;  3D72 A;  4BBT A;  1V9Y A;  1Y28 A;  4EER A;  1F9I A;  2BAS A;  2D01 A;  4LRX C;  3RH8 B;  1T19 A;  3MFX A;  3UME A;  4H6J B;  3NOP C;  1S67 L;  2INW A;  1T18 A;  5G4Y A;  3RTY A;  2HV1 A;  3FC7 A;  2ZOH A;  2PDR A;  2PD7 A;  4F3L B;  2PYP A;  4GHI B;  3SW1 A;  4JGR A;  1LSV A;  3E4O A;  3IS2 B;  2OWJ A;  3H9W A;  1S4R A;  3E4P A;  4JGP A;  5DKL A;  1T1A A;  1OTA A;  5HWW A;  2V0W A;  3G6O A;  5HWT A;  3F1P A;  5J4E A;  1MZU A;  3B33 A;  2QJ5 A;  4HIA A;  4I3I A;  5TBM A;  3MQQ A;  3ICY A;  3F1N B;  4HY8 A;  4EW7 A;  2B02 A;  1X0O A;  5IU1 A;  2JHE A;  3GDI A;  2QHK A;  1XJ6 A;  4K08 A;  2JN7 A;  3UB7 A;  2PR6 A;  1TS6 A;  3HJI A;  4NXB A;  4B9O A;  3H7W B;  3MQO A;  1GSW A;  5F68 A;  3H82 B;  4XT2 A;  5DJT A;  5EFW A;  1GSV A;  1S1Z A;  1T1C A;  3VE4 A;  2VEA A;  2V9A A;  2VV6 A;  2QKP A;  4L9F A;  2PHY A;  4KQD A;  4WN5 A;  2ZBB A;  4EQ1 A;  2A24 B;  3IBR A;  4GW9 A;  1DP6 A;  4HH3 A;  4PKY A;  4HJ3 A;  4LRY C;  4I3A A;  2KX6 A;  4NXE A;  1V9Z A;  2QWS A;  3MJQ A;  1G28 A;  1LT0 A;  3A0R A;  2V1B A;  1F98 A;  4JGQ A;  5HDD A;  2ZOI A;  4RQ9 A;  5HZH A;  1XJ3 A;  1LSX A;  3P7N A;  1OTB A;  4WF0 A;  5F6A A;  2V1A A;  2V0U A;  1UWP X;  5J3W A;  3UMD A;  1D7E A;  2K7S A;  3IS2 A;  4I38 A;  1DP8 A;  2QJ7 A;  3VE3 A;  1OTE A;  1ODV A;  3EEH A;  3KX0 X;  1OJG A;  3F1O B;  4LRZ E;  2I9V A;  3UB8 A;  3LI9 A;  1OJ5 A;  1TS7 A;  5F69 A;  3K3C A;  4EEU A;  1S1Y A;  4MN5 A;  4BBU A;  4R6L A;  4WUJ A;  5F5Y A;  4DJ3 A;  1N9L A;  1T1B A;  3NOT C;  4EET B;  1EW0 A;  5AVF A;  4NXG A;  3MXQ A;  2YKF A;  5IS1 A;  1NWZ A;  3C8C A;  4L9E A;  3CLO A;  3LUQ A;  4R70 A;  1OT9 A;  5HD5 A;  2WKP A;  1LL8 A;  4HJ4 A;  2VLG A;  4KUK A;  4WL9 A;  3ULF A;  2L0W A;  3MR0 A;  2KDK A;  3CAX A;  3NJA A;  4NXF A;  1XJ2 A;  5KIZ A;  5J7E A;  3F1P B;  4I39 A; 
#chains in the Genus database with same CATH topology
 2A24 A;  3IWO A;  1O7E A;  2IA2 A;  5FAP A;  1M6K A;  1GSX A;  4HI4 A;  3CI6 A;  1Q2P A;  1A0K A;  3BY9 A;  4LCM A;  4E6W A;  1P0Z A;  3K3D A;  3OZH A;  4HH2 A;  1PIO A;  2H28 A;  3UE1 A;  2EA9 A;  4MDZ A;  1F5M A;  1PZO A;  2L4R A;  4OOL A;  5TFQ A;  2OLU A;  2ZMF A;  1GHP A;  2OWH A;  4HHD A;  4KQR A;  1XGJ A;  3EQU A;  2W1T B;  3HBR A;  4O8G A;  4OOM A;  4H6J A;  1JWV A;  5IHV A;  3BFE A;  3C38 A;  2CMN A;  5HPI A;  3EWK A;  1BTL A;  3MFD A;  2W1R A;  1E3U D;  3EOI A;  3F1O A;  3Q7Z A;  4GHI A;  2O99 A;  1K56 A;  1CJF A;  1N4O A;  3IBJ A;  1KOU A;  1KE3 A;  3CHW P;  4LV1 A;  3NDE A;  4E3O A;  1HZO A;  1K6R A;  2VV8 A;  4Y0U A;  3HLG A;  3FKV A;  1PWD A;  2H0Y A;  2OLV A;  2GZA A;  1GA9 A;  1XP4 A;  5I5L A;  1P9W A;  4R0Q A;  5DF8 A;  4S2L A;  5GL9 A;  3JPU A;  3K2N A;  1L0G A;  5GLB A;  1MWU A;  3C2W A;  1TDL A;  1WYB A;  2EX2 A;  2Y4A A;  3PHY A;  3ISG A;  1TS0 A;  5GHX A;  1WA9 A;  1P97 A;  3BYD A;  1NXY A;  2XQZ A;  5EVI A;  3KSG A;  3KSI A;  2Y2G A;  4P6B A;  4BBV A;  1DP9 A;  2J3T C;  4JKT A;  4ZDX A;  3BFD A;  3V3S A;  4LV3 A;  1MWR A;  3G31 A;  1YQS A;  2JKG A;  1VEU B;  1K56 D;  5EEC A;  4HEF A;  3S22 A;  2M1C A;  4GKU A;  1H3Q A;  2YKH A;  2Y91 A;  3EEA A;  1H5X A;  1DRM A;  3B3X A;  3QP8 A;  3FZC A;  4X53 A;  2W27 A;  1D06 A;  1SDE A;  4R4R A;  1IYS A;  4ZRR A;  4YWZ A;  3T12 B;  1LSW A;  3LR4 A;  4FCF A;  4KUO A;  2C6W B;  1TD5 A;  1YLZ A;  3TJZ C;  3PBR A;  1BYW A;  1XA1 A;  2X71 A;  5CGW A;  3LIB A;  1J9M A;  2G2W A;  1ES5 A;  3NOU C;  4MLL A;  1K0K A;  3BFC A;  2XH9 A;  5EVI D;  3PBN A;  4EES A;  4N9K A;  5HDS A;  1BT5 A;  4RYE A;  3B42 A;  1ONG A;  3DBA A;  3HLW A;  4BEN A;  5DFY A;  4R38 A;  5GLC A;  1S66 L;  3GEC A;  1N9B A;  3VFH A;  1WYC A;  4DF6 A;  3V3R A;  3O86 A;  1KGE A;  1F9I A;  2WGI A;  3ZHH A;  1E4D A;  3ZG5 A;  2WZX A;  3ZYT A;  5GLA A;  1TVF A;  2KLI A;  2ZD8 A;  4O01 A;  2W3G A;  2XEP A;  1QME A;  4FD8 A;  2XGN A;  5F1G A;  4IUK A;  4G3W A;  1Z6F A;  3OCN A;  5EOO A;  3PAE A;  3UME A;  4H6J B;  3NOP C;  1S0W A;  2XFT A;  4GD8 A;  2INW A;  1T18 A;  2NUT C;  2E8I A;  2JKT M;  2Q9N A;  5HFO A;  4S2M A;  3FC7 A;  2ZOH A;  4CLC E;  4BQM A;  4ETZ A;  4GHI B;  3D9Y A;  3SW1 A;  4CLC A;  4R3B A;  3IS2 B;  1IYP A;  4EBP A;  2V8F A;  2Y59 A;  3ZNT A;  4LGW A;  3CJM A;  4JGP A;  2QPN A;  4X25 A;  2XA7 S;  4QHC A;  5HWW A;  2V0W A;  3G6O A;  2EWW A;  3UB5 P;  3NIA A;  4HIA A;  2QJ5 A;  4I3I A;  5TBM A;  3VOZ A;  2OAQ 1;  3HUO A;  4HY8 A;  4Q0J A;  1DJC A;  4B88 A;  1XJ6 A;  1RGZ A;  2JN7 A;  5EVI C;  3UB7 A;  3S7N A;  2HJ9 C;  1G68 A;  3HLE A;  1DY6 A;  3TG9 A;  3NUL A;  3MQO A;  1TF1 A;  4QY5 A;  2G2U A;  4UQI S;  1STZ A;  4R23 A;  2OAP 1;  4XT2 A;  4CLC D;  5DJT A;  5EFW A;  3GVB A;  4OPQ A;  5AJG A;  1U60 A;  2HP6 A;  3IX8 A;  1T1C A;  3VE4 A;  2O9B A;  1SDN A;  3SS3 A;  5U47 A;  4PM6 A;  1FSY A;  2ZMV A;  4E6X A;  4WBG A;  1PI4 A;  4WEK A;  1VM1 A;  1ONH A;  3WS0 A;  1ZKJ A;  1JTG A;  3RXW A;  3IXD A;  2LB9 A;  2JCH A;  4RX3 A;  3ITB A;  2J8Y A;  4LRY C;  5A92 A;  4I3A A;  2FFF B;  2EXB A;  3SS5 A;  4BD0 A;  2HGV A;  2V8C A;  2VX8 A;  4P6Z S;  2PRF A;  3IF6 A;  5FI6 A;  5L2F A;  1I5Q A;  4ME4 A;  4MBF A;  1OTB A;  2Z2L B;  4E3M A;  3BEC A;  2PBY A;  3ZG9 B;  2FZ0 A;  2ZLY A;  2UV0 E;  5J3W A;  3E2L A;  3S1Y A;  1DP8 A;  3CMZ A;  1W63 Q;  4DE3 A;  1ODV A;  1H8Y A;  1NYM A;  3EEH A;  2Y79 A;  1OJG A;  4BD1 A;  3SS4 A;  3V39 A;  4LRZ E;  3HUN A;  3SOI A;  2E8J A;  3T1Q B;  1OJ5 A;  5F69 A;  3MZF A;  4GN2 A;  4EEU A;  1MY8 A;  4DKI A;  1DJA A;  3VP4 A;  3E0Y A;  1FR1 A;  4PAU A;  1N9L A;  1T1B A;  1EW0 A;  2P9V A;  3CZD A;  5FAO A;  4KZ6 A;  3CLO A;  3ZFZ A;  3NY4 A;  4JBF A;  3LR0 A;  3LUQ A;  1K4E A;  2WKP A;  3LEZ A;  3BJN A;  1LL8 A;  4CLC B;  2VLG A;  1K38 A;  2W3D A;  4R1G A;  4GOG A;  3ULF A;  2L0W A;  3NBL A;  3Q07 A;  2EXA A;  4IHQ A;  1XJ2 A;  5KIZ A;  1Q2Q A;  5LBR A;  5CED A;  4DE1 A;  2HDU A;  3PYP A;  3UB9 A;  4Z1W A;  4MBK A;  1IYO A;  1JVJ A;  2Z6D A;  4K91 A;  2QYB A;  4KZ9 A;  4BJP A;  1XFN A;  5CX7 A;  3W4P A;  2HF6 A;  2VGJ A;  3ZG0 A;  5CHU A;  4UEY A;  3ZVW A;  4IJG A;  1OTD A;  2VA0 A;  4E3L A;  2V2F F;  1HTZ A;  4OH0 A;  1HD8 A;  5E43 A;  3FWL A;  4HNB A;  5TR7 A;  2ZM2 A;  3D3O A;  3W4O A;  4GS9 B;  3MSH A;  4WLA A;  3E98 A;  4KZ5 A;  4XT2 B;  1ESI A;  1ZTU A;  3I7J A;  3UDI A;  4X55 A;  5HDC A;  2ZQ7 A;  1S6R A;  5HSQ A;  5TJJ A;  3W8K A;  4MCW A;  2WAE A;  4S2I A;  1M40 A;  1H0M A;  3VOY A;  4KG2 A;  1AWI A;  4HP9 A;  4JXW A;  3CUE A;  3LYX A;  2HP5 A;  3T50 A;  4O0P A;  3MKF A;  3N7W A;  5CHJ A;  2HJE A;  3RXX A;  4DJ2 A;  2WKQ A;  4JLF A;  4YOF A;  2XDM A;  4HP4 A;  2J80 A;  4FOF A;  4OVD A;  1PNE A;  3RJU A;  3LIC A;  2BLS A;  3DTI A;  2H0T A;  2XR0 A;  4Y2F A;  2K31 A;  4OOY A;  3CIT A;  3OLO A;  3WRT A;  1J3W A;  4X56 A;  5EM1 A;  5DJU A;  4PM7 A;  4H8R A;  4P0M A;  3MXR A;  1OT6 A;  3C7U A;  3UN7 A;  4S2N C;  4YNR A;  4GB7 A;  4NK3 A;  3EQV A;  1XXM A;  3VOL A;  1F2K A;  2HPB A;  4HOI A;  4CQH A;  2XFS A;  3IHB A;  1MBL A;  1CEF A;  1WE4 A;  1BUL A;  3N4I A;  5HPF A;  4ZBE A;  1VET A;  2OSU A;  3BWL A;  3Q7V A;  1KGG A;  2LB5 A;  5FI2 A;  3DWZ A;  3Q81 A;  2P9V B;  4AFI A;  4EBN A;  4WEJ A;  3BLS A;  2J3T D;  1BZA A;  4ZJ3 A;  5KMW A;  1YSP A;  4X69 A;  2PR5 A;  4WMC A;  3VP2 A;  1JNU A;  3IX4 A;  3A0S A;  1ERO A;  2Z6C A;  2P7J A;  2WUQ A;  5AQA A;  3T4J A;  4E3K A;  5BOH A;  4DDY A;  2WZZ A;  4XXR A;  4MN6 A;  2B18 A;  2W0N A;  3L9K A;  4IVI A;  1N9N A;  4EEP A;  1K25 A;  3WWX A;  2JC7 A;  4BBT A;  5MC7 A;  2UWX A;  1BUE A;  4XUX A;  2RL3 A;  3C4O A;  3DWK A;  1MPL A;  2D01 A;  4DXC A;  4OP8 A;  4LRX C;  5FDH A;  3OPP A;  1PFL A;  2BTF P;  1T19 A;  3BRM A;  1XKZ A;  5EVE A;  1FR6 A;  4WMC D;  4OPY A;  1S67 L;  4ID4 A;  3D4F A;  4II7 A;  3BFG A;  4EV4 A;  5GHZ A;  1PYY A;  1KVL A;  1L2S A;  2P74 A;  2Y2I A;  3CUE C;  3N8S A;  2GNX A;  2VGL M;  3P09 A;  5FI7 A;  3HL9 A;  5EV0 A;  2PD7 A;  2PYP A;  3B47 A;  4N1X A;  3E4O A;  3M6B A;  4HES A;  3PR6 A;  2ZC3 B;  5HAP A;  3E4P A;  3ZNY A;  5HWT A;  3O3V A;  3F1P A;  3S7Q A;  1MZU A;  3B33 A;  4DRT A;  4Z9Q A;  4NET A;  3VSK A;  2B02 A;  3T4T A;  2QHK A;  4WZ5 C;  2XD1 A;  1TS6 A;  2Y2K A;  2FFY A;  5CGS A;  3DW0 A;  4NXB A;  2J9O A;  1GSW A;  1ZHH B;  4QB8 A;  5DF9 A;  1SKO A;  1W8Q A;  3KSF A;  3EGX C;  4P85 A;  4NEE D;  1W5D A;  5HAI A;  4S2O A;  1NRJ A;  3AGE A;  3G2Y A;  1MKM A;  2QKP A;  4L9F A;  4MN7 A;  2PHY A;  3Q7V B;  4KQD A;  5FSR A;  2A24 B;  4GW9 A;  4YFM A;  5AQ7 A;  4Q0I A;  1FIL A;  3HLD A;  1ES2 A;  4HJ3 A;  4UA6 A;  3HLB A;  2KX6 A;  4R3J A;  5D3O A;  1NYY A;  1G28 A;  5DTT A;  1VHM A;  3AGF A;  1SKF A;  3A0R A;  1F98 A;  5HDD A;  1YPR A;  2WAD A;  4E3J A;  2HP9 A;  4DN0 A;  1XJ3 A;  4PMA A;  5E2F A;  2J3W A;  2FH5 A;  5F6A A;  1PW8 A;  5CER A;  3SZT A;  4R4S A;  1UWP X;  3UMD A;  3QP2 A;  1K55 C;  4ESP A;  4Q0H A;  2JKT I;  2X02 A;  3VE3 A;  3OCL A;  2OV5 A;  3KX0 X;  4FTX A;  4GZB A;  3JVU A;  3IXB A;  3F1O B;  2XD5 A;  4M3K A;  5AQB A;  2A3U A;  4OKP A;  2ZC5 B;  3FV7 A;  2WK0 A;  3T4K A;  4WUJ A;  3QP5 A;  1TEM A;  1GHI A;  3C4P A;  2Y8H A;  1IEL A;  4ARZ A;  4EET B;  3AGD A;  4NXG A;  1Z09 A;  2J7V A;  5L07 A;  4L9E A;  5CXW A;  1MC0 A;  3OPL A;  5HD5 A;  2KOI A;  2P04 A;  2DMW A;  2ZM8 A;  5EUA A;  4KUK A;  4JXG A;  2ZC6 B;  4WL9 A;  4ZJ2 A;  3TRC A;  3W4Q A;  3A3F A;  3BW6 A;  3MR0 A;  4IVK A;  5EVI B;  4C6Y A;  1ERQ A;  4FSF A;  3NJA A;  3N6I A;  3IQA A;  3MS6 A;  3F1P B;  2W3H A;  4RVA A;  2ZM0 A;  3WRZ A;  4C3Q A;  5CHM A;  3C30 A;  2PBD P;  1KVM A;  4K0X A;  5IT5 A;  1I2S A;  4Q8I A;  4N9L A;  5E2G A;  1VB6 A;  5DTS A;  2W3E A;  3UPP A;  3BY8 A;  5CEB A;  3O87 A;  3DTK A;  1CI9 A;  3R7W A;  5A8B A;  4OPZ A;  4UQI M;  4L9G A;  4M4X A;  1IFQ A;  2PD8 A;  5KSH A;  2VGK A;  5FQQ A;  1K6S A;  4KZA A;  2W3F A;  1FSW A;  4N1H A;  4F3L A;  2Y2O A;  4GLQ A;  3BQA A;  1OTI A;  3LIF A;  3IHA A;  2V1Z A;  4NKP A;  2A49 A;  1FCN A;  3VP0 A;  5A93 A;  2Y2J A;  3VV4 A;  3LY3 A;  1IEM A;  3GMW A;  4KQO A;  3FPV A;  4EUZ A;  5FQ9 A;  4Y0O A;  1SZV A;  2EFX A;  3ITA A;  4OLD A;  4S2N A;  4U0T A;  2B5R A;  3P98 A;  3F1N A;  4DE0 A;  2ZQ9 A;  1S4S A;  4DE2 A;  1TDG A;  4EBL A;  1D1J A;  2ZMA A;  2VJW A;  5E2H A;  1JWZ A;  1TS8 A;  1N9O A;  3G2Z A;  3QP4 A;  3HVF A;  4KZ4 A;  3PXP A;  3QNB A;  3FPW A;  3MKE A;  1RP5 A;  3HLC A;  3LI8 A;  2JKR M;  5EE8 A;  1UGU A;  3H7W A;  3ZQ5 A;  4QD4 A;  5DKK A;  4ZAM A;  3IXH A;  4Y13 A;  4UA7 A;  3UDF A;  1KDS A;  1Y4O A;  3LGO A;  1NLY A;  1FQG A;  3HJK A;  3HUM A;  1K4F A;  3UB6 A;  3M2K A;  4Y0T A;  5FDS A;  4ARZ B;  3FG8 A;  3IXG A;  4XUZ A;  2D02 A;  5TBM B;  4S2P A;  1XA7 A;  1KGF A;  4WM9 A;  4E04 A;  1G6O A;  1MWT A;  4BWI A;  5DF7 A;  1XGI A;  3LIE A;  1OME A;  2W1T A;  4I5S A;  5DFX A;  5HW3 A;  4HQA A;  2H5S A;  1VQQ A;  2OOL A;  3U2A A;  3WS2 A;  4GDN A;  4Y5F A;  1KE0 A;  2Y2H A;  5GLD A;  3Q1F A;  3V50 A;  3MZD A;  1ZC2 A;  4MBH A;  5CEC A;  3UPN A;  5HD3 A;  3LID A;  4D60 A;  3D72 A;  3T1X A;  1BLP A;  3LY4 A;  2C5W B;  1FIK A;  1V9Y A;  1Y28 A;  2EX9 A;  4OON A;  5FAS A;  4EER A;  1YM1 A;  4WZ4 A;  4JPM A;  2BAS A;  3G34 A;  3Q82 A;  2HDQ A;  3RH8 B;  3R7W B;  2PT7 A;  4OQI A;  5FEG A;  5FAQ A;  3MFX A;  3OBF A;  2AVX A;  2ZQD A;  2PU4 A;  2PU2 A;  2XRO A;  1W63 M;  4B93 A;  3PAG A;  3IH8 A;  4KQQ A;  3T4L A;  2O9A A;  3IF6 B;  5G4Y A;  4JF5 A;  1JWP A;  2RCX A;  4Y15 A;  2HV1 A;  3A3I A;  4B4X A;  3GTC A;  4U0X A;  1IYQ A;  4F3L B;  2ZC4 B;  1LSV A;  1VEU A;  2PAV P;  2OWJ A;  3TE8 A;  2NUP C;  1ACF A;  4WZ5 A;  1ALQ A;  4PM8 A;  4IED A;  1OTA A;  1XX2 A;  3OOV A;  3LO7 A;  5HL6 A;  4MMN A;  2HZ5 A;  5K5B A;  3SH8 A;  4HBT A;  5J4E A;  2XLN A;  1YMX A;  4MEZ A;  5FAT A;  4EQI A;  1PZP A;  3F1N B;  3ICY A;  5IU1 A;  5J8X A;  1EWZ A;  2WAF A;  2JHE A;  3HLF A;  5L10 A;  3IWQ A;  3E2K A;  4K08 A;  2XRN A;  4WYY A;  5HAR A;  3UNW A;  5KZH A;  2M7U A;  5EVL A;  3BFF A;  4NG2 A;  3G35 A;  1ZG6 A;  5CTN A;  4BL2 A;  3T4S A;  3H7W B;  1I2W A;  5F68 A;  1LL5 A;  3MXS A;  3UDX A;  2M7V A;  1XPB A;  4QY6 A;  2ZL1 A;  1GSV A;  4OP5 A;  2VEA A;  3MZE A;  2QMI A;  2V9A A;  4FH4 A;  1HLU P;  3GRJ A;  5L09 A;  2VK3 A;  4EQ1 A;  2JE5 A;  3IBR A;  1DP6 A;  5FQK A;  4WEL A;  4PKY A;  3VP3 A;  2HDR A;  3VP1 A;  1K55 A;  1V9Z A;  2IWD A;  3HRE A;  1GHM A;  3LFV A;  4MNR A;  5F1F A;  5C5K A;  1W79 A;  4JGQ A;  2O0Y A;  4JXS A;  3UY6 A;  4RQ9 A;  3QP6 A;  1K57 C;  2BG1 A;  3NEC A;  5HZH A;  3IX3 A;  2VGL S;  2IWC A;  3P7N A;  3C5A A;  1EI5 A;  1BLH A;  5FQM A;  2WYX A;  2V1A A;  2V0U A;  3W2Z A;  4GD6 A;  1GA0 A;  3IS2 A;  2K7S A;  4I38 A;  4OPR A;  2WKH A;  1CI8 A;  1PRQ A;  1ZG4 A;  5AQ9 A;  3IT9 A;  3FKW A;  4G3V A;  4D2O A;  3N8R A;  4U3T A;  4OQG A;  3ZGA B;  3UB8 A;  4N92 A;  4OQH A;  4X68 A;  1IKG A;  1TS7 A;  5FQI A;  3MMH A;  5DVA A;  3ZCZ A;  4EWF A;  1S1Y A;  3GSG A;  4S2J A;  4R6L A;  1YMS A;  2GX5 A;  2MJ6 A;  4YIN A;  1PW1 A;  1YLP A;  3OC2 A;  3NOT C;  1LI9 A;  1BLC A;  2VZW A;  3MXQ A;  1LHY A;  4UHU A;  1KE4 A;  2ZQC A;  3C8C A;  3M6H A;  3T4O A;  3S7P A;  3SH9 A;  5JYO A;  2CC1 A;  2P08 A;  4R70 A;  1G5U A;  2JKF A;  2V20 A;  2WKI A;  3CPT A;  4DXB A;  5KSC A;  3NI9 A;  4KG5 A;  2O9C A;  1W7F A;  1FCM A;  2KDK A;  3CAX A;  3FYZ A;  3ZG7 B;  4PHT A;  4UAA A;  3SH7 A;  5M18 A;  2JBF A;  5J7E A;  1NLZ A;  4I39 A;  5JYP A;  3DTM A;  1MKI A;  4OLG A;  2VV7 A;  3A0V A;  3G4P A;  3GR2 A;  3O5Y A;  4LFU A;  1UWN X;  3V67 A;  1VET B;  3WS1 A;  1H8M A;  4ETX A;  5E2E A;  2ZJ9 A;  4X1L A;  4KZ3 A;  1YLY A;  1K54 C;  3LIA A;  3V5M A;  1YAX A;  4GDB A;  2I72 A;  3PTE A;  3VSL A;  3PBS A;  3S7O A;  3GQZ A;  2HDS A;  4EUV A;  2ZL1 B;  1L3L A;  4BL3 A;  2Q9M A;  4R3A A;  3NCK A;  4IUH A;  2XF3 A;  5G4Z A;  4G3K A;  1L0E A;  4KEN B;  2L1M A;  1O07 A;  3G32 A;  4HJ6 A;  4GCZ A;  4P87 A;  5FQJ A;  4KZB A;  4JGO A;  4RA7 A;  4LLO B;  3T1S A;  3P01 A;  4LPZ A;  3LEQ A;  1FCO A;  3IH9 A;  3E4Q A;  5HAQ A;  4EXO A;  1NJ4 A;  4KG6 A;  4DMZ A;  1MWS A;  2WKR A;  1CK3 A;  4BLM A;  3N8L A;  2B95 A;  3ZVT A;  3CWF A;  1YLW A;  2XK1 A;  4UA9 A;  4BMW A;  1XFQ A;  4QJG A;  3NC8 A;  5FL3 A;  1XJ4 A;  1QMF A;  3C7V A;  2A2L A;  3S4X A;  2R78 A;  4IBR A;  4O7D A;  3LCE A;  4RX2 A;  4L0L A;  4A5R A;  1IOU A;  2WKE A;  3H82 A;  1LL9 A;  2GJ3 A;  4CPK A;  1IKI A;  4E3N A;  3RFB A;  4LCL A;  4I3J A;  3U4L P;  5CGX A;  5HWV A;  2ZQA A;  4S2K A;  5HL1 A;  2XA7 M;  1GCE A;  4QU3 A;  3DTE A;  2WGW A;  2PYR A;  5GHY A;  5AVE A;  4LV2 A;  5CTM A;  4QWO A;  1JTD A;  4HBU A;  2EFU A;  4KZ7 A;  3NHQ A;  3KO6 A;  4GS9 A;  3DAV A;  1CQA A;  2R9W A;  2ZC7 A;  3CPT B;  4IBX A;  1NY0 A;  4FUW A;  1PI5 A;  4ZJ1 A;  4CJN A;  2Y2L A;  4PKY G;  3IWI A;  4JF6 A;  2G7U A;  3A3J A;  3UE6 A;  3PBT A;  5M1A A;  1SKO B;  3NDG A;  5A90 A;  3O88 A;  5DTK A;  4LEN A;  3KYE A;  4QPR A;  3TSG A;  1HVB A;  1E25 A;  1C3B A;  1G6A A;  4F94 A;  4GJ4 A;  1BLS A;  4EU0 A;  3QHY A;  4B4Z A;  3OPR A;  5EOE A;  1FOF A;  2DCF A;  3IF5 A;  4K0W A;  2R9X A;  3LR3 A;  4P6Z M;  5I94 A;  3UO9 A;  5EPH A;  3RTY A;  3CG5 A;  3UE0 A;  4GNU A;  1DJB A;  1ES4 A;  2PDR A;  4JGR A;  3PBQ A;  1RCJ A;  5A91 A;  3G30 A;  1P9R A;  2VKS A;  2JKR I;  3H9W A;  2Y2N A;  3HCY A;  1S4R A;  3TOI A;  5DKL A;  1T1A A;  4JF4 A;  2DRW A;  5G18 A;  4FH2 A;  3BQ8 A;  3MQQ A;  1CF0 A;  4KZ8 A;  4EW7 A;  1X0O A;  1H8Z A;  4CLC C;  4JXV A;  2Y2Q A;  3GDI A;  3R4K A;  1SHV A;  1YKD A;  2PR6 A;  2ACG A;  3HJI A;  3ZDJ A;  1NZO A;  5F83 A;  1L0D A;  1PWC A;  4B9O A;  3KYQ A;  3VFF A;  2WGV A;  5EM0 A;  3BLM A;  3T4Q A;  3H82 B;  1SCW A;  1W8Y A;  3EGD C;  4C75 A;  3KYZ A;  2Y2M A;  1S1Z A;  4ZTK A;  2VV6 A;  3JYI A;  3TW8 A;  5M19 A;  4WN5 A;  2ZBB A;  2Y2P A;  2WGW B;  4HH3 A;  5TGF A;  1K57 A;  1ES3 A;  3GV9 A;  3KSH A;  5HX9 A;  4PM9 A;  4NXE A;  2QWS A;  2EX6 A;  3UE3 A;  3MJQ A;  1LLB A;  1NRF A;  1LT0 A;  2XSS A;  2K2N A;  2V1B A;  1RGY A;  2ZOI A;  1YSQ A;  1LI0 A;  5CRF A;  1PWG A;  1LSX A;  2GDN A;  2Y55 A;  4WF0 A;  1ESU A;  1BSG A;  4Y3I A;  1NZU A;  1D7E A;  4PPR A;  1AXB A;  3OPH A;  2QJ7 A;  4E3I A;  3WS5 A;  1OTE A;  3A3E A;  3M2J A;  2I9V A;  4X6T A;  3UPO A;  3IF6 C;  1L0F A;  1YLT A;  4OQ0 A;  3LI9 A;  3BM6 A;  2EX8 A;  3QNC A;  5L8M A;  3K3C A;  4MN5 A;  3BEB A;  4BBU A;  5FEF A;  5F5Y A;  1Y54 A;  5F82 A;  1CEG A;  4DJ3 A;  3T1R A;  3MBZ A;  3JVV A;  2IWB A;  3WS4 A;  5AVF A;  2ZQ8 A;  2EWV A;  2DNS A;  5IS1 A;  1YT4 A;  2YKF A;  1KDW A;  3PBO A;  1MXO A;  1YLJ A;  1NWZ A;  2H10 A;  4PM5 A;  2Q0O A;  3LR5 A;  1OT9 A;  3L7H A;  3QP1 A;  1OPX A;  3ZG8 B;  3VMA A;  4HJ4 A;  1ERM A;  3MQ0 A;  4Y17 A;  4X1M A;  4LV0 A;  5FA7 A;  4DDS A;  4NXF A;  2Z2M B;  2QZ6 A;  3A3D A;  1E3U A;  4Y7P A;  1K54 A;  2X01 A;  3MF0 A;  2J9P A; 
#chains in the Genus database with same CATH homology
 2A24 A;  2IA2 A;  1GSX A;  3PYP A;  4HI4 A;  3C30 A;  3UB9 A;  5IT5 A;  3CI6 A;  4Z1W A;  2VV7 A;  3A0V A;  3O5Y A;  1UWN X;  2Z6D A;  3BY9 A;  3V67 A;  1VB6 A;  2QYB A;  1P0Z A;  4BJP A;  3K3D A;  1XFN A;  5CX7 A;  4HH2 A;  2W3E A;  1H8M A;  4ETX A;  2H28 A;  2HF6 A;  3BY8 A;  2EA9 A;  4UEY A;  4MDZ A;  4IJG A;  1F5M A;  1OTD A;  2VA0 A;  2L4R A;  4OOL A;  3LIA A;  2ZMF A;  2OWH A;  1YAX A;  4HHD A;  3R7W A;  5A8B A;  4HNB A;  4UQI M;  3D3O A;  2W1T B;  3EQU A;  4GS9 B;  4L9G A;  4M4X A;  4O8G A;  4H6J A;  3PBS A;  4OOM A;  1IFQ A;  2PD8 A;  5KSH A;  4WLA A;  3E98 A;  3S7O A;  4XT2 B;  1ZTU A;  3C38 A;  5HDC A;  4EUV A;  2CMN A;  4R3A A;  5HSQ A;  5TJJ A;  2W3F A;  5HPI A;  4MCW A;  4IUH A;  3EWK A;  5G4Z A;  2W1R A;  3EOI A;  3F1O A;  4G3K A;  2L1M A;  4F3L A;  4GHI A;  4GLQ A;  4HP9 A;  2O99 A;  3BQA A;  1OTI A;  3CUE A;  3LYX A;  4HJ6 A;  4GCZ A;  3LIF A;  3IBJ A;  1KOU A;  3T50 A;  4NKP A;  4O0P A;  4JGO A;  3VV4 A;  4LLO B;  3P01 A;  4LPZ A;  4KQO A;  2VV8 A;  3FPV A;  2HJE A;  3E4Q A;  4DJ2 A;  2WKQ A;  4EXO A;  4YOF A;  2GZA A;  3F1N A;  4DMZ A;  4HP4 A;  2J80 A;  1S4S A;  4FOF A;  5I5L A;  2WKR A;  1P9W A;  3LIC A;  2VJW A;  3K2N A;  1TS8 A;  1N9O A;  4Y2F A;  3C2W A;  3CWF A;  2K31 A;  3PXP A;  4BMW A;  1XFQ A;  3CIT A;  3PHY A;  3OLO A;  5FL3 A;  1XJ4 A;  3FPW A;  1TS0 A;  1WA9 A;  3LI8 A;  1P97 A;  2A2L A;  5DJU A;  2JKR M;  2R78 A;  3KSG A;  3KSI A;  1UGU A;  1OT6 A;  4BBV A;  3H7W A;  3ZQ5 A;  1DP9 A;  2J3T C;  5DKK A;  4L0L A;  4YNR A;  1IOU A;  3H82 A;  3EQV A;  3VOL A;  1NLY A;  2GJ3 A;  2M1C A;  1H3Q A;  2YKH A;  3HJK A;  3RFB A;  4CQH A;  4HOI A;  3UB6 A;  4I3J A;  5HWV A;  2XA7 M;  3EEA A;  1DRM A;  5HPF A;  4ARZ B;  3FG8 A;  3BWL A;  2D02 A;  2LB5 A;  5TBM B;  2W27 A;  1D06 A;  2PYR A;  5AVE A;  4AFI A;  4WEJ A;  2J3T D;  4E04 A;  1G6O A;  4ZRR A;  3NHQ A;  4YWZ A;  4BWI A;  1LSW A;  3LR4 A;  1YSP A;  4KUO A;  2PR5 A;  1TD5 A;  3KO6 A;  3LIE A;  3TJZ C;  3PBR A;  1BYW A;  1JNU A;  2W1T A;  4GS9 A;  3A0S A;  4I5S A;  5DFX A;  2Z6C A;  4HQA A;  2P7J A;  3LIB A;  2OOL A;  3NOU C;  3T4J A;  4PKY G;  3U2A A;  4Y5F A;  2G7U A;  3PBN A;  3UE6 A;  4EES A;  5HDS A;  3PBT A;  3B42 A;  3DBA A;  4MN6 A;  5DFY A;  4R38 A;  2B18 A;  2W0N A;  5HD3 A;  3LID A;  1S66 L;  3GEC A;  1N9N A;  4EEP A;  3D72 A;  4BBT A;  5MC7 A;  4QPR A;  1V9Y A;  1Y28 A;  4EER A;  1F9I A;  2BAS A;  2D01 A;  3ZYT A;  4GJ4 A;  4LRX C;  2KLI A;  4O01 A;  2W3G A;  4EU0 A;  3RH8 B;  1T19 A;  4IUK A;  3R7W B;  2PT7 A;  4G3W A;  3MFX A;  3OBF A;  3OCN A;  3UME A;  4H6J B;  3NOP C;  2XRO A;  1W63 M;  1S67 L;  3LR3 A;  4P6Z M;  4B93 A;  4II7 A;  3T4L A;  2INW A;  1T18 A;  2O9A A;  5G4Y A;  3RTY A;  2NUT C;  2JKT M;  3CUE C;  2GNX A;  2VGL M;  2HV1 A;  3FC7 A;  2ZOH A;  2PDR A;  4CLC E;  2PD7 A;  4F3L B;  4ETZ A;  2PYP A;  4GHI B;  3B47 A;  3SW1 A;  4JGR A;  4CLC A;  1LSV A;  3PBQ A;  3E4O A;  3IS2 B;  3PR6 A;  1P9R A;  2VKS A;  2OWJ A;  3TE8 A;  2JKR I;  3H9W A;  2NUP C;  3HCY A;  1S4R A;  3E4P A;  4JGP A;  5DKL A;  1T1A A;  1OTA A;  2XA7 S;  5HWW A;  3OOV A;  2V0W A;  5HL6 A;  3G6O A;  4MMN A;  5HWT A;  5K5B A;  2EWW A;  3F1P A;  3S7Q A;  3BQ8 A;  5J4E A;  1MZU A;  3B33 A;  2QJ5 A;  4HIA A;  4I3I A;  5TBM A;  3MQQ A;  2OAQ 1;  3ICY A;  3F1N B;  4HY8 A;  4EW7 A;  2B02 A;  1X0O A;  5IU1 A;  4CLC C;  3T4T A;  2JHE A;  4Q0J A;  3GDI A;  3R4K A;  2QHK A;  1XJ6 A;  4K08 A;  2JN7 A;  2XRN A;  1YKD A;  3UB7 A;  2PR6 A;  1TS6 A;  3S7N A;  3HJI A;  2M7U A;  4NXB A;  2HJ9 C;  4B9O A;  3KYQ A;  3T4S A;  3H7W B;  3MQO A;  1TF1 A;  1GSW A;  5F68 A;  1ZHH B;  5DF9 A;  3T4Q A;  3H82 B;  4UQI S;  2M7V A;  1STZ A;  2OAP 1;  3EGD C;  4XT2 A;  4CLC D;  5DJT A;  5EFW A;  3KSF A;  5AJG A;  3EGX C;  3KYZ A;  4NEE D;  1GSV A;  1S1Z A;  1T1C A;  3VE4 A;  2O9B A;  2VEA A;  1NRJ A;  2V9A A;  2VV6 A;  1MKM A;  2QKP A;  4L9F A;  4MN7 A;  2ZMV A;  3TW8 A;  2PHY A;  4KQD A;  4WN5 A;  2ZBB A;  4WEK A;  2A24 B;  4EQ1 A;  3IBR A;  4GW9 A;  1DP6 A;  4HH3 A;  4WEL A;  4PKY A;  4Q0I A;  4HJ3 A;  2LB9 A;  3KSH A;  4LRY C;  4I3A A;  2KX6 A;  4NXE A;  1V9Z A;  2QWS A;  3UE3 A;  3MJQ A;  1G28 A;  3LFV A;  1VHM A;  2HGV A;  1LT0 A;  5C5K A;  3A0R A;  2XSS A;  2VX8 A;  4P6Z S;  2K2N A;  2V1B A;  1F98 A;  4JGQ A;  5HDD A;  2O0Y A;  2ZOI A;  1YSQ A;  4RQ9 A;  4DN0 A;  5HZH A;  1XJ3 A;  4ME4 A;  2VGL S;  1LSX A;  3P7N A;  1OTB A;  2J3W A;  2FH5 A;  2FZ0 A;  4WF0 A;  5F6A A;  2V1A A;  2V0U A;  1UWP X;  4Y3I A;  5J3W A;  3UMD A;  1D7E A;  2K7S A;  3IS2 A;  4I38 A;  3W2Z A;  4Q0H A;  1DP8 A;  2JKT I;  2QJ7 A;  3VE3 A;  3OCL A;  1W63 Q;  1OTE A;  1ODV A;  3EEH A;  3KX0 X;  4G3V A;  2Y79 A;  3JVU A;  1OJG A;  3F1O B;  4LRZ E;  2I9V A;  3UB8 A;  3LI9 A;  1OJ5 A;  1TS7 A;  5F69 A;  3MMH A;  5L8M A;  3K3C A;  4EEU A;  1S1Y A;  4MN5 A;  4BBU A;  3T4K A;  4R6L A;  4WUJ A;  3E0Y A;  4PAU A;  5F5Y A;  2GX5 A;  2MJ6 A;  4DJ3 A;  2Y8H A;  1N9L A;  3OC2 A;  1T1B A;  3JVV A;  4ARZ A;  3NOT C;  4EET B;  1EW0 A;  5AVF A;  2EWV A;  4NXG A;  2VZW A;  2YKF A;  3MXQ A;  5IS1 A;  3PBO A;  1NWZ A;  3C8C A;  4L9E A;  3CLO A;  3T4O A;  1MC0 A;  3S7P A;  3LR0 A;  3LR5 A;  2P08 A;  3LUQ A;  4R70 A;  1OT9 A;  5HD5 A;  2KOI A;  2WKP A;  1OPX A;  2P04 A;  1LL8 A;  2DMW A;  3BJN A;  4HJ4 A;  4CLC B;  2VLG A;  4KUK A;  2W3D A;  3TRC A;  3MQ0 A;  4WL9 A;  3ULF A;  2L0W A;  2O9C A;  3BW6 A;  3MR0 A;  2KDK A;  3CAX A;  4FSF A;  3NJA A;  4NXF A;  4IHQ A;  4PHT A;  1XJ2 A;  5KIZ A;  5J7E A;  1NLZ A;  3F1P B;  5LBR A;  2W3H A;  4I39 A;  3MF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...