5F69A

Drosophila melanogaster cycle w398a pas-b with bound glycerol
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
MFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPATSEIDYIIAKNSVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Circadian clock protein
molecule keywords Protein cycle
publication title Drosophila Melanogaster Cycle PAS-B with Bound Glycerol
rcsb
source organism Drosophila melanogaster
total genus 31
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5f69A00
2INWA 3UB8A 4B9OA 4JGRA 4GW9A 2D01A 3PHYA 3MQOA 3BWLA 2J80A 1N9OA 3UB9A 2V9AA 2VV6A 2L1MA 4MN5A 2CMNA 1LL8A 4M4XA 3E4QA 3LICA 4XT2A 1GSWA 2W27A 3C2WA 1KOUA 1T19A 3FC7A 5IS1A 4BBTA 1UGUA 3MXQA 5A8BA 3CLOA 2PR5A 3LIFA 2PYPA 4HY8A 2YKFA 2PHYA 3NOPC 1DP8A 5HWTA 1LT0A 4WLAA 2Z6CA 4DJ3A 1TS8A 1S1ZA 5G4ZA 2ZOIA 3K3CA 3MJQA 1NWZA 5HWWA 3P7NA 1GSVA 3F1PB 3H82B 3PYPA 4WF0A 1DRMA 2D02A 4NXEA 1N9LA 1XJ6A 4F3LA 5HDCA 3NOTC 1LSWA 2PYRA 2PD8A 2OOLA 1S67L 3A0SA 3BY9A 3G6OA 4EEUA 2M1CA 1TS7A 2HV1A 2YKHA 4HP9A 2KX6A 1OTAA 2WKQA 3C8CA 5F69A 5HWVA 2A24A 2QJ7A 3CAXA 4WN5A 4WUJA 3F1PA 4EEPA 1S4RA 4GHIA 3H7WB 1S4SA 2Z6DA 2V0WA 4HNBA 2VLGA 3MFXA 3UE6A 1V9ZA 4H6JB 1EW0A 2OWHA 2VV7A 3LI8A 5HD5A 3RTYA 4HHDA 3T50A 1T1BA 3NJAA 4EETB 3IS2B 1OT6A 1XJ2A 2WKPA 4JGQA 4I38A 5EFWA 4HIAA 4GS9A 4EW7A 5HSQA 3NOUC 1F98A 4HQAA 5AVEA 1LSXA 4HH2A 1TS6A 3F1OB 5DJUA 3ULFA 4EQ1A 5TBMB 4K08A 3H9WA 5J3WA 3MQQA 3UB7A 4GCZA 3E4PA 1OTDA 3A0RA 1UWPX 1N9NA 3RH8B 3VOLA 2K7SA 1V9YA 2V0UA 4LPZA 4R6LA 3F1NB 4LRYC 1XFQA 1S1YA 1Y28A 1UWNX 3LIAA 3OLOA 1T1CA 2W0NA 3CWFA 1OTIA 4PKYA 5HD3A 1XFNA 4BBVA 2GJ3A 5J4EA 2V1BA 4NXBA 4KUKA 1MZUA 5AVFA 2PDRA 3MR0A 4MN6A 3HJKA 5KIZA 4R38A 3UMDA 5DJTA 2JN7A 3UB6A 3FG8A 4L9EA 5G4YA 3KX0X 2WKRA 3H82A 1XJ4A 3LIEA 3LUQA 1OJ5A 4KUOA 3LIDA 4RQ9A 1WA9A 3HJIA 4XT2B 4JGOA 1D7EA 4LRXC 3SW1A 1TS0A 3EWKA 5F5YA 1OT9A 3NHQA 3LYXA 2QKPA 3VE4A 3LIBA 4DJ2A 4L9GA 4I3JA 2PR6A 1XJ3A 4EXOA 2ZBBA 1JNUA 2QWSA 3EEHA 1F9IA 1OJGA 3GECA 1BYWA 2R78A 2KDKA 1D06A 5HZHA 4LRZE 3H7WA 4I5SA 3GDIA 4EERA 3A0VA 4NXFA 4EESA 3ZQ5A 2L4RA 4F3LB 5IU1A 5F68A 4H6JA 1ODVA 5HDDA 4R70A 4HI4A 1OTEA 2PD7A 2P7JA 3IS2A 4NXGA 5J7EA 1P0ZA 1G28A 1GSXA 1T18A 4L9FA 1X0OA 4HP4A 4LLOB 2OWJA 3IBRA 1OTBA 3K3DA 2A24B 3F1OA 2EA9A 4I3IA 2BASA 5TBMA 4BBUA 4YWZA 4KQDA 4GHIB 5F6AA 3BY8A 4HOIA 4HJ4A 4E04A 4HJ6A 2H28A 2ZOHA 1VB6A 1T1AA 2L0WA 1LSVA 1DP9A 3F1NA 2VEAA 2QJ5A 3VE3A 4PKYG 3UMEA 2VV8A 3B33A 3D72A 4HH3A 4GS9B 1DP6A 5DKLA 3ICYA 3E4OA 2V1AA 1S66L 4R3AA 1P97A 5HDSA 4JGPA 4I39A 2QHKA 4I3AA 3LI9A 4WL9A 2JHEA 2I9VA 4HJ3A 2B02A 5DKKA 5I5LA
chains in the Genus database with same CATH superfamily
3UB8A 3NC8A 5HL1A 4XUZA 4GW9A 1M6KA 4OPYA 2ZQ9A 3BWLA 3C30A 1N9OA 2EX6A 3ZG0A 5CEDA 2H10A 2VV6A 3AGFA 4II7A 1LL8A 3GV9A 4M4XA 2NUPC 1S6RA 4E6WA 1SKOA 4XT2A 1GSWA 1FSWA 5HPIA 3DWKA 5DF8A 2Q9NA 1KDSA 3WRTA 3CLOA 2EX8A 3G32A 4JXGA 2HJEA 4RA7A 3LIFA 1K57C 1FCNA 1YSPA 3BLSA 2PHYA 2EXBA 4LV1A 4MCWA 1ERQA 4WLAA 2J8YA 3S22A 1FR1A 3DBAA 4DJ3A 5L2FA 3LCEA 4IHQA 5HWWA 1MWTA 1GSVA 1NZOA 3F1PB 1XA7A 2XSSA 3H82B 3T1XA 2ZM0A 3SZTA 3WS2A 3TJZC 2XQZA 3CUEA 4F3LA 3WS0A 4ESPA 2K31A 1LSWA 2PYRA 3T1RA 4E3IA 2XF3A 1JTDA 4OLGA 4Z1WA 3G6OA 4EEUA 3G31A 3TRCA 2HV1A 2XEPA 2ZQ7A 4Q8IA 1K38A 2WYXA 4JPMA 4K0XA 4QU3A 5EVID 5F69A 3FWLA 4KZ6A 3DTIA 3IXGA 2HP6A 4OQGA 3P98A 4WUJA 2XD1A 1PNEA 3JVVA 1S4RA 4GHIA 3H7WB 2HP5A 1TD5A 3TSGA 1S4SA 2Z6DA 3BJNA 5CX7A 5CERA 4HNBA 2EX2A 2HDRA 4LCLA 5HD5A 4P6ZS 3U2AA 2ZC3B 3B47A 3NJAA 4PM7A 4EETB 5CGXA 1OT6A 4IVIA 5CGWA 3NCKA 3MBZA 3CPTB 4MMNA 1GA0A 4Y13A 4OP8A 3DTMA 2ZM8A 3KYQA 3G4PA 4LV2A 2ZC6B 4HQAA 5AVEA 2ZLYA 4LFUA 4HH2A 1TS6A 3UDXA 4EQ1A 1JVJA 2DNSA 2XFTA 5TBMB 4K08A 3H9WA 4UHUA 5J3WA 3MQQA 4CQHA 4PAUA 2WGIA 4R3BA 5EVIB 4EWFA 2DMWA 1XPBA 4WMCD 3PBQA 2A2LA 2P74A 4R6LA 4KENB 5AQBA 5DF9A 1K57A 3ZDJA 4OQIA 1Y28A 2J3WA 3OLOA 4QD4A 1J9MA 1NLYA 4IBRA 3HBRA 3GQZA 3T1SA 5CHJA 4OVDA 4JXSA 1YQSA 1MWSA 3MF0A 3WS4A 5EVEA 1JWPA 3OZHA 5AVFA 5CECA 3MR0A 4MN6A 3UE3A 1G5UA 3QP6A 4LCMA 2XFSA 3G34A 3QNCA 4R4SA 4QB8A 5EM1A 4R38A 3EQVA 4RYEA 3RJUA 5CRFA 2JN7A 3HLGA 4ZJ1A 3V67A 3IT9A 3FG8A 1MWRA 3SS4A 3Q7VB 3H82A 3LIEA 3LUQA 4NETA 1MBLA 1OJ5A 3NIAA 4KUOA 3M2KA 3HVFA 4GDNA 3LR3A 4DXCA 3HJIA 3SW1A 4CJNA 1ES2A 4UA6A 3LYXA 1K56D 3VE4A 1P9RA 3LIBA 4KQQA 2G2WA 3MS6A 2ZBBA 1JNUA 1G68A 1M40A 2P04A 4KQOA 3QP1A 4XUXA 4G3VA 2DRWA 4WYYA 2R78A 3KSIA 3VFFA 5DFYA 1BLCA 4U0XA 4BWIA 2W3EA 2IWCA 1TDLA 3H7WA 3HLWA 1L0DA 2QMIA 3GSGA 4U3TA 3UE0A 4Y17A 5IU1A 5J8XA 2V1ZA 5TFQA 2G7UA 3VV4A 5AQ7A 1LHYA 2FH5A 3FYZA 3UN7A 1ZG4A 3Q07A 3T4SA 4OKPA 3HLBA 5J7EA 3G2YA 1MPLA 1T18A 3K2NA 2A3UA 3CPTA 3W4OA 1YLPA 3IBRA 5GLBA 2A24B 3B42A 3MZDA 2BASA 2KLIA 5TBMA 1C3BA 1YPRA 5JYPA 5F6AA 5CTMA 1ES3A 2ZQDA 4HOIA 4S2PA 3MZFA 4CPKA 5EVIA 2HDQA 4K91A 3R7WB 4EUZA 5LBRA 3NDEA 4YOFA 4HBUA 1FILA 1LSVA 3A3DA 4NK3A 2VEAA 2QJ5A 2FFYA 3VE3A 4O7DA 1ES5A 3MKEA 4O0PA 4HH3A 1IKGA 5FA7A 1K6SA 4KG2A 3C4PA 1K54C 3E4OA 2E8IA 4R3AA 3EGXC 4ID4A 4UQIS 4X56A 1YLWA 2O9BA 4X1LA 2JHEA 5E2EA 5A92A 1KE4A 1L0GA 5CHUA 4BL2A 3FPVA 3SH8A 3DW0A 5JYOA 2INWA 4B9OA 4BMWA 5E43A 3TG9A 4N9LA 3MQOA 1ZTUA 4OPZA 4M3KA 3OPRA 4GD8A 3UB9A 3Q7VA 1N9BA 2L1MA 4WMCA 2CMNA 4OP5A 1TF1A 3UY6A 1Y4OA 3LICA 4WZ4A 2W27A 1VHMA 4S2KA 3IWIA 4RVAA 1H5XA 2HJ9C 3KYZA 1UGUA 5A8BA 4ARZB 1G6OA 2BTFP 3AGEA 1ERMA 4EBPA 2ZD8A 1KGGA 5CXWA 1DP8A 5HWTA 2VX8A 1YM1A 2Z6CA 4PM6A 4BD0A 2EWWA 2Y2MA 1IEMA 4QPRA 1TS8A 1K55A 3KYEA 3IQAA 5CGSA 2RL3A 1XKZA 3PYPA 1DRMA 1PZPA 4IUHA 2D02A 4FH4A 3QP5A 5E2HA 4P6BA 1N9LA 1XJ6A 3FKVA 3NOTC 3HLEA 5FL3A 2W3GA 3QP8A 5FDSA 4Y0TA 3QP2A 5AQ9A 3BFFA 3KSHA 3N7WA 2M1CA 2Y4AA 1ACFA 1JWZA 2W1RA 3MQ0A 4IUKA 2YKHA 4HP9A 1FCOA 1PW8A 2WZZA 3ITAA 2V8CA 1HD8A 3IF6B 1K56A 2A24A 1O07A 1Y54A 4A5RA 2QJ7A 1IELA 4Y7PA 2VK3A 4MN7A 4EEPA 3JPUA 4PM5A 2VKSA 3LEQA 2JE5A 2WKHA 1K54A 3O88A 5FQKA 1VQQA 1XXMA 3QP4A 2JC7A 1K0KA 1MKIA 3Q82A 1EW0A 4BD1A 3G2ZA 3VOZA 2OLUA 3WRZA 1IYSA 3T50A 4LENA 2UWXA 2HF6A 3IF6C 1XJ2A 2HDUA 4ZJ2A 4JGQA 4I38A 1KGEA 1YAXA 5HL6A 4IBXA 4Y15A 4Z9QA 1GHIA 5AJGA 1F98A 1LSXA 4R1GA 1PWGA 4C3QA 3FPWA 4Q0HA 3ZYTA 4GCZA 3BECA 5U47A 2PBYA 3E4PA 5FAPA 2JKRI 1OTDA 4UAAA 3BYDA 1YMXA 1L2SA 2K7SA 2WADA 3C38A 4LPZA 2M7VA 4EUVA 4WEKA 3F1NB 4LRYC 1EI5A 1L0FA 3M2JA 2Y2LA 1J3WA 1IFQA 1G6AA 1T1CA 1DJBA 3VSLA 2NUTC 2ZMAA 3UDIA 1FSYA 1NYYA 1XFNA 4BBVA 4D2OA 5FAOA 2RCXA 2Y2IA 3DTEA 2R9WA 2WGVA 4E3MA 5F82A 5L07A 4KUKA 1BULA 1XGIA 3T4LA 2PDRA 4ARZA 1PW1A 1W8YA 3GTCA 3HLDA 3IX3A 3LEZA 1Z09A 3S4XA 4PMAA 4S2IA 5E2FA 5A93A 2HPBA 1ZC2A 5GL9A 1ALQA 3CI6A 3VP3A 3GMWA 2WK0A 2WAEA 1K4FA 3KX0X 3O86A 2WKRA 1KGFA 1XGJA 4N92A 2ZC4B 4GOGA 4G3WA 4ZAMA 3LIDA 1D7EA 3VSKA 5FEFA 3LR0A 4WBGA 1CK3A 4OQHA 1OT9A 2W3HA 4FUWA 4JF6A 2QKPA 5HFOA 1CJFA 3HCYA 4GB7A 3NI9A 4ZRRA 4L9GA 1NRFA 4YFMA 1XJ3A 2JKTM 4P6ZM 1F9IA 3S7NA 3GECA 3IF6A 5DTKA 1F2KA 3DWZA 5M19A 4UA9A 2PBDP 5FI2A 1MWUA 3BFEA 5GHZA 2GDNA 2QZ6A 2VGJA 1D06A 1GHMA 3T12B 1WYCA 3GDIA 3A0VA 1LI0A 3GRJA 3LY4A 3S7QA 4JBFA 3UNWA 4IVKA 2JBFA 3VMAA 1YKDA 4R70A 3PTEA 1NY0A 2GX5A 2H0YA 3RXXA 1BSGA 3CG5A 4KQRA 1G28A 2WGWB 1GSXA 2ACGA 1S0WA 3V39A 1X0OA 5TJJA 3HUNA 4LLOB 2OWJA 5FQMA 1H8MA 1N4OA 1EWZA 4KZAA 3C7VA 3E2KA 1FQGA 1NYMA 3BFCA 5HARA 5EE8A 3W2ZA 1LI9A 5L10A 5TGFA 4E04A 4PPRA 1SKFA 4LV0A 3NDGA 5M18A 3BEBA 5L8MA 3VP0A 4FOFA 1E3UD 1W79A 4BLMA 1T1AA 4YINA 3O5YA 1DP9A 5HAIA 3F1NA 3SH7A 3ZG8B 2ZMVA 2Y91A 2ZC5B 3S1YA 1D1JA 4PKYG 2XRNA 4E3JA 1RCJA 2EXAA 3NECA 1QMFA 4GS9B 2J7VA 4KZ8A 3PBNA 5DKLA 3V5MA 1S66L 4E3KA 1P97A 4PHTA 3C4OA 3V3RA 5TR7A 2H5SA 5I94A 4WL9A 1MC0A 1HLUP 2Y2NA 1RGYA 2I9VA 4HJ3A 2HGVA 2KOIA 1BLSA 3VP4A 4E3NA 5DKKA 5EVLA 5GLDA 5I5LA 5EOOA 1U60A 3IF5A 4JGRA 4X69A 2D01A 2ZL1B 3ZVWA 4X25A 3PR6A 3LY3A 2V9AA 1O7EA 4G3KA 3E4QA 2OAQ1 4WZ5C 3MXSA 3BFGA 3PAGA 3UB5P 2ZQAA 3C2WA 1KOUA 1T19A 5CTNA 3MXQA 2XR0A 2WKIA 1SZVA 3M6BA 3T4QA 1BLPA 2PR5A 1HTZA 2YKFA 4KZ7A 1SDNA 2WKEA 2V2FF 2O0YA 1YLTA 4B93A 2P08A 3G35A 1LL5A 2ZOIA 3K3CA 3WS1A 2J9PA 3AGDA 2R9XA 1FOFA 1GCEA 3OPHA 5EECA 4KZ4A 4WF0A 2Q0OA 4NXEA 5HDCA 4ZTKA 2VGKA 4S2MA 3W8KA 3T4TA 3T4OA 4X6TA 1VM1A 1BUEA 5CEBA 2PD8A 2EFUA 3T1QB 3CMZA 2C6WB 2PAVP 3BY9A 2V8FA 4Y0UA 2BG1A 4WEJA 4JLFA 1TS7A 2WGWA 1MKMA 2Y2KA 3BQ8A 3ZNYA 2PU4A 5FSRA 2KX6A 1DJCA 4S2JA 3FV7A 3C8CA 4RX3A 1K6RA 3OC2A 4HBTA 4WN5A 1L3LA 4EQIA 2XLNA 5EPHA 3IXHA 3IWQA 3MFXA 3UE6A 1ES4A 1V9ZA 1JTGA 4UQIM 3N6IA 3I7JA 3E98A 2OWHA 2VV7A 3LI8A 3RTYA 3L7HA 4HHDA 1T1BA 1STZA 2ZQ8A 3IS2B 4GZBA 2ZC7A 4IEDA 1OMEA 1BTLA 1W63Q 2Y55A 1H0MA 3R4KA 4GS9A 4KZ3A 5HSQA 2Q9MA 3A3FA 5E2GA 1IKIA 5IT5A 5DJUA 3IX4A 3C5AA 2A49A 3BFDA 3DAVA 3IHAA 4EBNA 3Q1FA 4WZ5A 4QHCA 3UB7A 2B5RA 5HAPA 2MJ6A 2XDMA 5L09A 2DCFA 5FDHA 3RH8B 3VOLA 2ZL1A 1SDEA 2I72A 3OPLA 2O9CA 2XGNA 4N1HA 1XFQA 1UWNX 2GNXA 3LIAA 4ZDXA 4BQMA 4R23A 4KZBA 1A0KA 3PAEA 3IXDA 2XA7S 1E3UA 3CWFA 4MBKA 4PKYA 5KMWA 3W4PA 2B95A 3ZVTA 5HD3A 4P87A 2M7UA 5DVAA 4H8RA 5J4EA 1FCMA 3E2LA 2V1BA 4X68A 3N8SA 4NXBA 4C75A 1MZUA 4KG5A 4JXWA 2GZAA 2JKGA 4XXRA 5K5BA 4OOYA 3HJKA 3T4JA 5EM0A 5KIZA 3W4QA 4BJPA 2Y2OA 4DE3A 5G18A 3V50A 1E4DA 1ONGA 3ZG5A 4DF6A 1ZG6A 3LFVA 2WZXA 3UPOA 5G4YA 4JXVA 1XJ4A 5FATA 3JVUA 4B4XA 1FR6A 4MNRA 4EV4A 1YLJA 1ESIA 1RGZA 3CJMA 1IOUA 3DTKA 3PXPA 1EROA 3GVBA 4JGOA 1TS0A 3EWKA 3OOVA 2W3DA 3P01A 4C6YA 4MBFA 3BLMA 5F83A 2XH9A 3PBSA 4I3JA 5FI7A 2PR6A 3JYIA 1L0EA 4EBLA 4EXOA 2WAFA 3EEHA 1DJAA 4GNUA 1OJGA 3CHWP 3NY4A 5GLCA 5M1AA 4ZJ3A 4MBHA 2Y2GA 5GLAA 2KDKA 3B3XA 2ZQCA 5CHMA 3LO7A 4UA7A 3EGDC 2FZ0A 4P0MA 4DXBA 3EOIA 4EERA 1F5MA 3OPPA 4NXFA 1YMSA 3ZQ5A 2OLVA 2EX9A 1FIKA 4R0QA 3RXWA 5F68A 4DRTA 1BZAA 1ODVA 3KSFA 3HLCA 2JKFA 1W7FA 5BOHA 3IS2A 4NXGA 4U0TA 3IWOA 2QYBA 3V3SA 3P09A 1NXYA 4O01A 3UPNA 4HP4A 4WELA 3BQAA 5FEGA 3ZG9B 1OTBA 3K3DA 2EA9A 4I3IA 5F1FA 4BBUA 5FQQA 1KVMA 1GHPA 4WM9A 2Y2JA 1YT4A 2XROA 1NRJA 4NKPA 3PBOA 4HJ6A 1ZKJA 2H28A 4RX2A 3S7OA 1H8ZA 3VP1A 2LB9A 2P9VB 3Q81A 1VETB 1MXOA 4E3OA 3UMEA 2VV8A 1TDGA 4FSFA 3ISGA 2Y2PA 4S2LA 3ICYA 2Z2LB 3MZEA 5HX9A 2V1AA 5EUAA 3FKWA 4OQ0A 5HDSA 4JGPA 2QHKA 4Y3IA 4OOMA 1RP5A 4OOLA 3LI9A 1ONHA 4HESA 1MY8A 4DMZA 1SHVA 3S7PA 1H3QA 1NLZA 2XD5A 3PHYA 3LR5A 3GR2A 1NJ4A 1PYYA 4UEYA 2J80A 3KO6A 3N4IA 4Y0OA 3SOIA 2PRFA 4BENA 4S2NC 1I2WA 1IYQA 4DKIA 2IA2A 4MN5A 1I2SA 3C7UA 3IH8A 1PZOA 5DTTA 4DE2A 4L0LA 5IHVA 1IYPA 3M6HA 4NEED 5EOEA 1WYBA 4DDYA 3FC7A 3HREA 3UO9A 5DFXA 4BBTA 5IS1A 2J3TD 2HDSA 2X01A 3QNBA 2ZM2A 2HP9A 5DF7A 4DE0A 3HL9A 2PYPA 4HY8A 3U4LP 1NZUA 1IYOA 3NOPC 3ZG7B 4B88A 2Y79A 2Y59A 4OLDA 1LT0A 2PT7A 2VJWA 3ZFZA 3IXBA 2X71A 3SS5A 1KDWA 1S1ZA 1CEGA 3ZHHA 5G4ZA 3MJQA 1NWZA 4N9KA 4OPQA 3P7NA 1TVFA 1PIOA 5EV0A 3O87A 4MLLA 3A3IA 4JF4A 1KE3A 3A3EA 5MC7A 5EVIC 4Y5FA 3G30A 3VOYA 2VA0A 2OOLA 1S67L 1Z6FA 3A0SA 1XA1A 4QY6A 2FFFB 1I5QA 4R3JA 5A91A 1OTAA 5GHXA 2WKQA 1KVLA 2OV5A 4OH0A 5HWVA 1PI4A 5C5KA 1PRQA 4DN0A 3CAXA 2O9AA 3F1PA 3TW8A 5HPFA 3D9YA 2UV0E 2W1TB 2WUQA 2JKTI 2V0WA 3KSGA 2VLGA 3TOIA 1GA9A 5DTSA 5FQJA 5AQAA 4H6JB 4FH2A 2Y2HA 2P9VA 1BLHA 2X02A 4JF5A 5FI6A 1VETA 1W5DA 2WKPA 2XK1A 2J3TC 3EEAA 5EFWA 3TE8A 1TEMA 4HIAA 3PBRA 2O99A 4EW7A 4IJGA 1WE4A 4PM9A 5A90A 4S2NA 3NOUC 3EQUA 4P85A 4CLCD 1AWIA 5HAQA 4F94A 3ULFA 3F1OB 5FAQA 4LGWA 2C5WB 4GJ4A 3MXRA 1PWCA 1H8YA 3MSHA 3Q7ZA 1PFLA 4X1MA 1W63M 2B18A 4JKTA 3A0RA 1UWPX 1N9NA 1V9YA 2V0UA 3HLFA 4KG6A 2HZ5A 2Z2MB 4LV3A 3BM6A 5D3OA 4Q0IA 2LB5A 1S1YA 3UPPA 3UDFA 3MKFA 4HEFA 2W0NA 4Y2FA 1K55C 1OTIA 4GN2A 3VFHA 3OBFA 3NBLA 3CZDA 1OPXA 2GJ3A 2V20A 4ME4A 1LL9A 4X55A 3LGOA 4MEZA 2OSUA 1K4EA 2JCHA 4MDZA 3MMHA 2W3FA 5F1GA 4CLCE 2VGLS 3BW6A 1YLZA 3IX8A 4CLCB 4OONA 3UMDA 5DJTA 1VEUB 5FQIA 3E0YA 4O8GA 1XP4A 3UB6A 2PU2A 1CI9A 1PI5A 2K2NA 4L9EA 2VGLM 3WWXA 1SCWA 4EU0A 3RFBA 4S2OA 4KZ5A 2BLSA 4FD8A 4ETXA 3WS5A 4QWOA 4D60A 4RQ9A 3N8RA 1WA9A 4NG2A 1SKOB 4XT2B 4R4RA 4LRXC 4DE1A 5F5YA 1LLBA 3HUOA 3NHQA 4N1XA 5FQ9A 1ESUA 4CLCC 5HW3A 3CITA 3OCLA 4DJ2A 2E8JA 2AVXA 4QJGA 1CEFA 1Q2PA 3BRMA 1K25A 2QWSA 1JWVA 3L9KA 1P9WA 3LR4A 4GLQA 3A3JA 1BYWA 3VP2A 1DY6A 5GHYA 4GD6A 4YNRA 5HZHA 4LRZE 2CC1A 1HZOA 4I5SA 2W1TA 2QPNA 4Q0JA 1ZHHB 4EESA 3O3VA 2L4RA 4F3LB 1AXBA 2ZJ9A 4H6JA 3N8LA 5HDDA 4K0WA 4HI4A 1W8QA 1OTEA 4AFIA 2PD7A 4E3LA 2P7JA 2IWBA 2G2UA 4FTXA 3SS3A 2J9OA 3ZNTA 1P0ZA 1CF0A 4GDBA 1KE0A 1HVBA 4L9FA 1BT5A 5FASA 2JKRM 5KSCA 1PWDA 4DDSA 1Q2QA 3PBTA 4E6XA 3FZCA 4PM8A 3F1OA 4ETZA 3CUEC 2XA7M 4YWZA 4KQDA 4GHIB 4KZ9A 3BY8A 4HJ4A 2Y8HA 3D3OA 4X53A 2IWDA 3QHYA 1E25A 3NULA 2ZOHA 1VB6A 3ITBA 3HUMA 2L0WA 3IBJA 4GKUA 4B4ZA 5KZHA 4ZBEA 3OCNA 1CI8A 3SH9A 2ZMFA 3D4FA 1QMEA 3B33A 2VZWA 3D72A 4OPRA 2EFXA 1DP6A 1YLYA 3ZCZA 3IHBA 1XX2A 2EWVA 1YSQA 3T4KA 4BL3A 3UE1A 4I39A 3IH9A 4I3AA 3MFDA 3ZGAB 2OAP1 5KSHA 3R7WA 1CQAA 2B02A 2H0TA 4CLCA 4FCFA 4QY5A 1VEUA 2Y2QA
chains in the Genus database with same CATH topology
1NLZA 2INWA 3UB8A 4B9OA 4BMWA 4JGRA 4GW9A 2D01A 3PHYA 3LR5A 3MQOA 1ZTUA 3BWLA 3C30A 3PR6A 4UEYA 2J80A 3KO6A 1N9OA 3UB9A 2V9AA 2VV6A 2L1MA 2IA2A 4MN5A 4G3KA 4II7A 2CMNA 1LL8A 1TF1A 4M4XA 2NUPC 4L0LA 3E4QA 2OAQ1 4NEED 3LICA 4XT2A 1GSWA 2W27A 1VHMA 3C2WA 5HPIA 2HJ9C 1KOUA 1T19A 3FC7A 3KYZA 5DFXA 4BBTA 5IS1A 2J3TD 1UGUA 3MXQA 5A8BA 3CLOA 4ARZB 1G6OA 3T4QA 2PR5A 2HJEA 3LIFA 2PYPA 4HY8A 2YKFA 1YSPA 2PHYA 3NOPC 2Y79A 1DP8A 4MCWA 5HWTA 1LT0A 2VX8A 2PT7A 2VJWA 4WLAA 2Z6CA 2O0YA 2EWWA 3DBAA 4B93A 4DJ3A 2P08A 4QPRA 1TS8A 1S1ZA 5G4ZA 2ZOIA 3K3CA 3MJQA 4IHQA 1NWZA 5HWWA 3P7NA 1GSVA 3F1PB 2XSSA 3H82B 3PYPA 4WF0A 1DRMA 3TJZC 4IUHA 2D02A 4NXEA 3CUEA 1N9LA 1XJ6A 4F3LA 5HDCA 3NOTC 5FL3A 2K31A 1LSWA 5MC7A 3T4TA 3T4OA 2W3GA 4Y5FA 2PYRA 2VA0A 2PD8A 2OOLA 1S67L 3KSHA 4Z1WA 3A0SA 3BY9A 3G6OA 4EEUA 3TRCA 2M1CA 4WEJA 1TS7A 2HV1A 2W1RA 1MKMA 3MQ0A 3BQ8A 4IUKA 2YKHA 4HP9A 2KX6A 1OTAA 2WKQA 3C8CA 5F69A 5HWVA 4DN0A 5C5KA 2A24A 3OC2A 2QJ7A 3CAXA 2O9AA 4MN7A 4WN5A 4WUJA 3F1PA 4EEPA 3JVVA 2VKSA 3TW8A 5HPFA 1S4RA 4GHIA 3H7WB 1TD5A 2W1TB 1S4SA 2Z6DA 2JKTI 2V0WA 3BJNA 3KSGA 5CX7A 4HNBA 2VLGA 3MFXA 3UE6A 1V9ZA 4UQIM 3E98A 4H6JB 1EW0A 2OWHA 2VV7A 3LI8A 5HD5A 3RTYA 4P6ZS 3U2AA 4HHDA 3T50A 3B47A 1T1BA 3NJAA 1STZA 4EETB 2HF6A 3IS2B 1OT6A 1XJ2A 2WKPA 1W63Q 4JGQA 2J3TC 3EEAA 4I38A 5EFWA 3TE8A 3R4KA 1YAXA 5HL6A 4HIAA 3PBRA 2O99A 4GS9A 4EW7A 4IJGA 5HSQA 4MMNA 3NOUC 3EQUA 3KYQA 5AJGA 4CLCD 1F98A 5IT5A 4HQAA 5AVEA 1LSXA 4HH2A 1TS6A 3F1OB 5DJUA 3ULFA 4EQ1A 5TBMB 4K08A 3H9WA 3FPWA 5J3WA 4Q0HA 3ZYTA 4GJ4A 3MQQA 3UB7A 4CQHA 4PAUA 4GCZA 2MJ6A 3E4PA 2DMWA 2JKRI 1OTDA 1W63M 2B18A 3A0RA 1UWPX 1N9NA 3PBQA 3RH8B 2K7SA 3VOLA 1V9YA 2A2LA 2V0UA 3C38A 4LPZA 4R6LA 2M7VA 4EUVA 2O9CA 4WEKA 5DF9A 3F1NB 4LRYC 4Q0IA 2LB5A 1XFQA 1S1YA 1Y28A 1UWNX 1IFQA 2J3WA 2GNXA 3LIAA 3OLOA 1NLYA 1T1CA 2W0NA 2NUTC 4Y2FA 2XA7S 3CWFA 1OTIA 4PKYA 3OBFA 1OPXA 5HD3A 1XFNA 4BBVA 2GJ3A 2M7UA 4ME4A 5J4EA 3MF0A 2V1BA 4NXBA 4KUKA 1MZUA 5AVFA 3T4LA 2PDRA 2GZAA 3MR0A 4MN6A 4ARZA 3UE3A 5K5BA 3HJKA 4MDZA 3T4JA 3MMHA 5KIZA 2W3FA 4CLCE 4BJPA 2VGLS 3BW6A 4R38A 4CLCB 3UMDA 3EQVA 5DJTA 3E0YA 4O8GA 2JN7A 3UB6A 3V67A 2K2NA 3CI6A 3FG8A 4L9EA 2VGLM 3LFVA 4EU0A 3RFBA 5G4YA 3KX0X 2WKRA 3H82A 4ETXA 1XJ4A 3LIEA 3LUQA 3JVUA 1OJ5A 4KUOA 4G3WA 1IOUA 3LR3A 3LIDA 3PXPA 4RQ9A 1WA9A 3HJIA 4XT2B 4JGOA 1D7EA 4LRXC 3SW1A 1TS0A 3EWKA 3LR0A 3OOVA 2W3DA 5F5YA 3P01A 1OT9A 3NHQA 2W3HA 4CLCC 3LYXA 3CITA 2QKPA 3OCLA 3VE4A 1P9RA 3LIBA 4DJ2A 3HCYA 3PBSA 4ZRRA 4L9GA 4I3JA 2PR6A 1XJ3A 2JKTM 2ZBBA 4EXOA 1JNUA 2QWSA 3EEHA 4P6ZM 1F9IA 1P9WA 2P04A 4KQOA 3LR4A 3S7NA 4GLQA 1OJGA 3GECA 1BYWA 4G3VA 2R78A 3KSIA 5DFYA 4YNRA 2KDKA 1D06A 4BWIA 5HZHA 2W3EA 4LRZE 3EGDC 2FZ0A 3H7WA 4I5SA 3GDIA 3EOIA 4EERA 1F5MA 3A0VA 2W1TA 4NXFA 4Q0JA 3S7QA 1ZHHB 4EESA 3ZQ5A 2L4RA 4F3LB 5IU1A 5F68A 4H6JA 1ODVA 5HDDA 1YKDA 2G7UA 3KSFA 4R70A 3VV4A 4HI4A 2FH5A 1OTEA 4AFIA 2PD7A 2GX5A 3T4SA 2P7JA 3IS2A 4NXGA 5J7EA 1P0ZA 1G28A 2QYBA 1GSXA 1T18A 3K2NA 4L9FA 4O01A 2JKRM 1X0OA 4HP4A 4WELA 5TJJA 3BQAA 4LLOB 2OWJA 3IBRA 3PBTA 1H8MA 1OTBA 3K3DA 2A24B 3F1OA 2EA9A 3B42A 4ETZA 4I3IA 3CUEC 2BASA 2KLIA 5TBMA 2XA7M 4BBUA 4YWZA 4KQDA 4GHIB 5F6AA 3BY8A 3W2ZA 4HOIA 4HJ4A 2Y8HA 3D3OA 4E04A 3R7WB 2XROA 1NRJA 5L8MA 4NKPA 3PBOA 4FOFA 4HJ6A 2H28A 5LBRA 2ZOHA 1VB6A 4YOFA 3S7OA 1T1AA 2L0WA 3IBJA 1LSVA 3O5YA 2LB9A 1DP9A 3F1NA 2VEAA 2ZMVA 2QJ5A 3OCNA 3VE3A 4PKYG 2XRNA 2ZMFA 3UMEA 2VV8A 3B33A 4O0PA 4FSFA 2VZWA 3D72A 4HH3A 4GS9B 1DP6A 3PBNA 5DKLA 3ICYA 3E4OA 2V1AA 1S66L 2EWVA 1YSQA 3T4KA 4R3AA 1P97A 5HDSA 4PHTA 3EGXC 4JGPA 4I39A 4UQIS 2QHKA 4I3AA 4Y3IA 4OOMA 2O9BA 4OOLA 3LI9A 2OAP1 4WL9A 2JHEA 1MC0A 5KSHA 4DMZA 2I9VA 4HJ3A 3R7WA 2HGVA 2KOIA 2B02A 3S7PA 5DKKA 4CLCA 1H3QA 3FPVA 5I5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2INW A;  3UB8 A;  4B9O A;  4JGR A;  4GW9 A;  2D01 A;  3PHY A;  3MQO A;  3BWL A;  2J80 A;  1N9O A;  3UB9 A;  2V9A A;  2VV6 A;  2L1M A;  4MN5 A;  2CMN A;  1LL8 A;  4M4X A;  3E4Q A;  3LIC A;  4XT2 A;  1GSW A;  2W27 A;  3C2W A;  1KOU A;  1T19 A;  3FC7 A;  5IS1 A;  4BBT A;  1UGU A;  3MXQ A;  5A8B A;  3CLO A;  2PR5 A;  3LIF A;  2PYP A;  4HY8 A;  2YKF A;  2PHY A;  3NOP C;  1DP8 A;  5HWT A;  1LT0 A;  4WLA A;  2Z6C A;  4DJ3 A;  1TS8 A;  1S1Z A;  5G4Z A;  2ZOI A;  3K3C A;  3MJQ A;  1NWZ A;  5HWW A;  3P7N A;  1GSV A;  3F1P B;  3H82 B;  3PYP A;  4WF0 A;  1DRM A;  2D02 A;  4NXE A;  1N9L A;  1XJ6 A;  4F3L A;  5HDC A;  3NOT C;  1LSW A;  2PYR A;  2PD8 A;  2OOL A;  1S67 L;  3A0S A;  3BY9 A;  3G6O A;  4EEU A;  2M1C A;  1TS7 A;  2HV1 A;  2YKH A;  4HP9 A;  2KX6 A;  1OTA A;  2WKQ A;  3C8C A;  5F69 A;  5HWV A;  2A24 A;  2QJ7 A;  3CAX A;  4WN5 A;  4WUJ A;  3F1P A;  4EEP A;  1S4R A;  4GHI A;  3H7W B;  1S4S A;  2Z6D A;  2V0W A;  4HNB A;  2VLG A;  3MFX A;  3UE6 A;  1V9Z A;  4H6J B;  1EW0 A;  2OWH A;  2VV7 A;  3LI8 A;  5HD5 A;  3RTY A;  4HHD A;  3T50 A;  1T1B A;  3NJA A;  4EET B;  3IS2 B;  1OT6 A;  1XJ2 A;  2WKP A;  4JGQ A;  4I38 A;  5EFW A;  4HIA A;  4GS9 A;  4EW7 A;  5HSQ A;  3NOU C;  1F98 A;  4HQA A;  5AVE A;  1LSX A;  4HH2 A;  1TS6 A;  3F1O B;  5DJU A;  3ULF A;  4EQ1 A;  5TBM B;  4K08 A;  3H9W A;  5J3W A;  3MQQ A;  3UB7 A;  4GCZ A;  3E4P A;  1OTD A;  3A0R A;  1UWP X;  1N9N A;  3RH8 B;  3VOL A;  2K7S A;  1V9Y A;  2V0U A;  4LPZ A;  4R6L A;  3F1N B;  4LRY C;  1XFQ A;  1S1Y A;  1Y28 A;  1UWN X;  3LIA A;  3OLO A;  1T1C A;  2W0N A;  3CWF A;  1OTI A;  4PKY A;  5HD3 A;  1XFN A;  4BBV A;  2GJ3 A;  5J4E A;  2V1B A;  4NXB A;  4KUK A;  1MZU A;  5AVF A;  2PDR A;  3MR0 A;  4MN6 A;  3HJK A;  5KIZ A;  4R38 A;  3UMD A;  5DJT A;  2JN7 A;  3UB6 A;  3FG8 A;  4L9E A;  5G4Y A;  3KX0 X;  2WKR A;  3H82 A;  1XJ4 A;  3LIE A;  3LUQ A;  1OJ5 A;  4KUO A;  3LID A;  4RQ9 A;  1WA9 A;  3HJI A;  4XT2 B;  4JGO A;  1D7E A;  4LRX C;  3SW1 A;  1TS0 A;  3EWK A;  5F5Y A;  1OT9 A;  3NHQ A;  3LYX A;  2QKP A;  3VE4 A;  3LIB A;  4DJ2 A;  4L9G A;  4I3J A;  2PR6 A;  1XJ3 A;  4EXO A;  2ZBB A;  1JNU A;  2QWS A;  3EEH A;  1F9I A;  1OJG A;  3GEC A;  1BYW A;  2R78 A;  2KDK A;  1D06 A;  5HZH A;  4LRZ E;  3H7W A;  4I5S A;  3GDI A;  4EER A;  3A0V A;  4NXF A;  4EES A;  3ZQ5 A;  2L4R A;  4F3L B;  5IU1 A;  5F68 A;  4H6J A;  1ODV A;  5HDD A;  4R70 A;  4HI4 A;  1OTE A;  2PD7 A;  2P7J A;  3IS2 A;  4NXG A;  5J7E A;  1P0Z A;  1G28 A;  1GSX A;  1T18 A;  4L9F A;  1X0O A;  4HP4 A;  4LLO B;  2OWJ A;  3IBR A;  1OTB A;  3K3D A;  2A24 B;  3F1O A;  2EA9 A;  4I3I A;  2BAS A;  5TBM A;  4BBU A;  4YWZ A;  4KQD A;  4GHI B;  5F6A A;  3BY8 A;  4HOI A;  4HJ4 A;  4E04 A;  4HJ6 A;  2H28 A;  2ZOH A;  1VB6 A;  1T1A A;  2L0W A;  1LSV A;  1DP9 A;  3F1N A;  2VEA A;  2QJ5 A;  3VE3 A;  4PKY G;  3UME A;  2VV8 A;  3B33 A;  3D72 A;  4HH3 A;  4GS9 B;  1DP6 A;  5DKL A;  3ICY A;  3E4O A;  2V1A A;  1S66 L;  4R3A A;  1P97 A;  5HDS A;  4JGP A;  4I39 A;  2QHK A;  4I3A A;  3LI9 A;  4WL9 A;  2JHE A;  2I9V A;  4HJ3 A;  2B02 A;  5DKK A;  5I5L A; 
#chains in the Genus database with same CATH topology
 3UB8 A;  3NC8 A;  5HL1 A;  4XUZ A;  4GW9 A;  1M6K A;  4OPY A;  2ZQ9 A;  3BWL A;  3C30 A;  1N9O A;  2EX6 A;  3ZG0 A;  5CED A;  2H10 A;  2VV6 A;  3AGF A;  4II7 A;  1LL8 A;  3GV9 A;  4M4X A;  2NUP C;  1S6R A;  4E6W A;  1SKO A;  4XT2 A;  1GSW A;  1FSW A;  5HPI A;  3DWK A;  5DF8 A;  2Q9N A;  1KDS A;  3WRT A;  3CLO A;  2EX8 A;  3G32 A;  4JXG A;  2HJE A;  4RA7 A;  3LIF A;  1K57 C;  1FCN A;  1YSP A;  3BLS A;  2PHY A;  2EXB A;  4LV1 A;  4MCW A;  1ERQ A;  4WLA A;  2J8Y A;  3S22 A;  1FR1 A;  3DBA A;  4DJ3 A;  5L2F A;  3LCE A;  4IHQ A;  5HWW A;  1MWT A;  1GSV A;  1NZO A;  3F1P B;  1XA7 A;  2XSS A;  3H82 B;  3T1X A;  2ZM0 A;  3SZT A;  3WS2 A;  3TJZ C;  2XQZ A;  3CUE A;  4F3L A;  3WS0 A;  4ESP A;  2K31 A;  1LSW A;  2PYR A;  3T1R A;  4E3I A;  2XF3 A;  1JTD A;  4OLG A;  4Z1W A;  3G6O A;  4EEU A;  3G31 A;  3TRC A;  2HV1 A;  2XEP A;  2ZQ7 A;  4Q8I A;  1K38 A;  2WYX A;  4JPM A;  4K0X A;  4QU3 A;  5EVI D;  5F69 A;  3FWL A;  4KZ6 A;  3DTI A;  3IXG A;  2HP6 A;  4OQG A;  3P98 A;  4WUJ A;  2XD1 A;  1PNE A;  3JVV A;  1S4R A;  4GHI A;  3H7W B;  2HP5 A;  1TD5 A;  3TSG A;  1S4S A;  2Z6D A;  3BJN A;  5CX7 A;  5CER A;  4HNB A;  2EX2 A;  2HDR A;  4LCL A;  5HD5 A;  4P6Z S;  3U2A A;  2ZC3 B;  3B47 A;  3NJA A;  4PM7 A;  4EET B;  5CGX A;  1OT6 A;  4IVI A;  5CGW A;  3NCK A;  3MBZ A;  3CPT B;  4MMN A;  1GA0 A;  4Y13 A;  4OP8 A;  3DTM A;  2ZM8 A;  3KYQ A;  3G4P A;  4LV2 A;  2ZC6 B;  4HQA A;  5AVE A;  2ZLY A;  4LFU A;  4HH2 A;  1TS6 A;  3UDX A;  4EQ1 A;  1JVJ A;  2DNS A;  2XFT A;  5TBM B;  4K08 A;  3H9W A;  4UHU A;  5J3W A;  3MQQ A;  4CQH A;  4PAU A;  2WGI A;  4R3B A;  5EVI B;  4EWF A;  2DMW A;  1XPB A;  4WMC D;  3PBQ A;  2A2L A;  2P74 A;  4R6L A;  4KEN B;  5AQB A;  5DF9 A;  1K57 A;  3ZDJ A;  4OQI A;  1Y28 A;  2J3W A;  3OLO A;  4QD4 A;  1J9M A;  1NLY A;  4IBR A;  3HBR A;  3GQZ A;  3T1S A;  5CHJ A;  4OVD A;  4JXS A;  1YQS A;  1MWS A;  3MF0 A;  3WS4 A;  5EVE A;  1JWP A;  3OZH A;  5AVF A;  5CEC A;  3MR0 A;  4MN6 A;  3UE3 A;  1G5U A;  3QP6 A;  4LCM A;  2XFS A;  3G34 A;  3QNC A;  4R4S A;  4QB8 A;  5EM1 A;  4R38 A;  3EQV A;  4RYE A;  3RJU A;  5CRF A;  2JN7 A;  3HLG A;  4ZJ1 A;  3V67 A;  3IT9 A;  3FG8 A;  1MWR A;  3SS4 A;  3Q7V B;  3H82 A;  3LIE A;  3LUQ A;  4NET A;  1MBL A;  1OJ5 A;  3NIA A;  4KUO A;  3M2K A;  3HVF A;  4GDN A;  3LR3 A;  4DXC A;  3HJI A;  3SW1 A;  4CJN A;  1ES2 A;  4UA6 A;  3LYX A;  1K56 D;  3VE4 A;  1P9R A;  3LIB A;  4KQQ A;  2G2W A;  3MS6 A;  2ZBB A;  1JNU A;  1G68 A;  1M40 A;  2P04 A;  4KQO A;  3QP1 A;  4XUX A;  4G3V A;  2DRW A;  4WYY A;  2R78 A;  3KSI A;  3VFF A;  5DFY A;  1BLC A;  4U0X A;  4BWI A;  2W3E A;  2IWC A;  1TDL A;  3H7W A;  3HLW A;  1L0D A;  2QMI A;  3GSG A;  4U3T A;  3UE0 A;  4Y17 A;  5IU1 A;  5J8X A;  2V1Z A;  5TFQ A;  2G7U A;  3VV4 A;  5AQ7 A;  1LHY A;  2FH5 A;  3FYZ A;  3UN7 A;  1ZG4 A;  3Q07 A;  3T4S A;  4OKP A;  3HLB A;  5J7E A;  3G2Y A;  1MPL A;  1T18 A;  3K2N A;  2A3U A;  3CPT A;  3W4O A;  1YLP A;  3IBR A;  5GLB A;  2A24 B;  3B42 A;  3MZD A;  2BAS A;  2KLI A;  5TBM A;  1C3B A;  1YPR A;  5JYP A;  5F6A A;  5CTM A;  1ES3 A;  2ZQD A;  4HOI A;  4S2P A;  3MZF A;  4CPK A;  5EVI A;  2HDQ A;  4K91 A;  3R7W B;  4EUZ A;  5LBR A;  3NDE A;  4YOF A;  4HBU A;  1FIL A;  1LSV A;  3A3D A;  4NK3 A;  2VEA A;  2QJ5 A;  2FFY A;  3VE3 A;  4O7D A;  1ES5 A;  3MKE A;  4O0P A;  4HH3 A;  1IKG A;  5FA7 A;  1K6S A;  4KG2 A;  3C4P A;  1K54 C;  3E4O A;  2E8I A;  4R3A A;  3EGX C;  4ID4 A;  4UQI S;  4X56 A;  1YLW A;  2O9B A;  4X1L A;  2JHE A;  5E2E A;  5A92 A;  1KE4 A;  1L0G A;  5CHU A;  4BL2 A;  3FPV A;  3SH8 A;  3DW0 A;  5JYO A;  2INW A;  4B9O A;  4BMW A;  5E43 A;  3TG9 A;  4N9L A;  3MQO A;  1ZTU A;  4OPZ A;  4M3K A;  3OPR A;  4GD8 A;  3UB9 A;  3Q7V A;  1N9B A;  2L1M A;  4WMC A;  2CMN A;  4OP5 A;  1TF1 A;  3UY6 A;  1Y4O A;  3LIC A;  4WZ4 A;  2W27 A;  1VHM A;  4S2K A;  3IWI A;  4RVA A;  1H5X A;  2HJ9 C;  3KYZ A;  1UGU A;  5A8B A;  4ARZ B;  1G6O A;  2BTF P;  3AGE A;  1ERM A;  4EBP A;  2ZD8 A;  1KGG A;  5CXW A;  1DP8 A;  5HWT A;  2VX8 A;  1YM1 A;  2Z6C A;  4PM6 A;  4BD0 A;  2EWW A;  2Y2M A;  1IEM A;  4QPR A;  1TS8 A;  1K55 A;  3KYE A;  3IQA A;  5CGS A;  2RL3 A;  1XKZ A;  3PYP A;  1DRM A;  1PZP A;  4IUH A;  2D02 A;  4FH4 A;  3QP5 A;  5E2H A;  4P6B A;  1N9L A;  1XJ6 A;  3FKV A;  3NOT C;  3HLE A;  5FL3 A;  2W3G A;  3QP8 A;  5FDS A;  4Y0T A;  3QP2 A;  5AQ9 A;  3BFF A;  3KSH A;  3N7W A;  2M1C A;  2Y4A A;  1ACF A;  1JWZ A;  2W1R A;  3MQ0 A;  4IUK A;  2YKH A;  4HP9 A;  1FCO A;  1PW8 A;  2WZZ A;  3ITA A;  2V8C A;  1HD8 A;  3IF6 B;  1K56 A;  2A24 A;  1O07 A;  1Y54 A;  4A5R A;  2QJ7 A;  1IEL A;  4Y7P A;  2VK3 A;  4MN7 A;  4EEP A;  3JPU A;  4PM5 A;  2VKS A;  3LEQ A;  2JE5 A;  2WKH A;  1K54 A;  3O88 A;  5FQK A;  1VQQ A;  1XXM A;  3QP4 A;  2JC7 A;  1K0K A;  1MKI A;  3Q82 A;  1EW0 A;  4BD1 A;  3G2Z A;  3VOZ A;  2OLU A;  3WRZ A;  1IYS A;  3T50 A;  4LEN A;  2UWX A;  2HF6 A;  3IF6 C;  1XJ2 A;  2HDU A;  4ZJ2 A;  4JGQ A;  4I38 A;  1KGE A;  1YAX A;  5HL6 A;  4IBX A;  4Y15 A;  4Z9Q A;  1GHI A;  5AJG A;  1F98 A;  1LSX A;  4R1G A;  1PWG A;  4C3Q A;  3FPW A;  4Q0H A;  3ZYT A;  4GCZ A;  3BEC A;  5U47 A;  2PBY A;  3E4P A;  5FAP A;  2JKR I;  1OTD A;  4UAA A;  3BYD A;  1YMX A;  1L2S A;  2K7S A;  2WAD A;  3C38 A;  4LPZ A;  2M7V A;  4EUV A;  4WEK A;  3F1N B;  4LRY C;  1EI5 A;  1L0F A;  3M2J A;  2Y2L A;  1J3W A;  1IFQ A;  1G6A A;  1T1C A;  1DJB A;  3VSL A;  2NUT C;  2ZMA A;  3UDI A;  1FSY A;  1NYY A;  1XFN A;  4BBV A;  4D2O A;  5FAO A;  2RCX A;  2Y2I A;  3DTE A;  2R9W A;  2WGV A;  4E3M A;  5F82 A;  5L07 A;  4KUK A;  1BUL A;  1XGI A;  3T4L A;  2PDR A;  4ARZ A;  1PW1 A;  1W8Y A;  3GTC A;  3HLD A;  3IX3 A;  3LEZ A;  1Z09 A;  3S4X A;  4PMA A;  4S2I A;  5E2F A;  5A93 A;  2HPB A;  1ZC2 A;  5GL9 A;  1ALQ A;  3CI6 A;  3VP3 A;  3GMW A;  2WK0 A;  2WAE A;  1K4F A;  3KX0 X;  3O86 A;  2WKR A;  1KGF A;  1XGJ A;  4N92 A;  2ZC4 B;  4GOG A;  4G3W A;  4ZAM A;  3LID A;  1D7E A;  3VSK A;  5FEF A;  3LR0 A;  4WBG A;  1CK3 A;  4OQH A;  1OT9 A;  2W3H A;  4FUW A;  4JF6 A;  2QKP A;  5HFO A;  1CJF A;  3HCY A;  4GB7 A;  3NI9 A;  4ZRR A;  4L9G A;  1NRF A;  4YFM A;  1XJ3 A;  2JKT M;  4P6Z M;  1F9I A;  3S7N A;  3GEC A;  3IF6 A;  5DTK A;  1F2K A;  3DWZ A;  5M19 A;  4UA9 A;  2PBD P;  5FI2 A;  1MWU A;  3BFE A;  5GHZ A;  2GDN A;  2QZ6 A;  2VGJ A;  1D06 A;  1GHM A;  3T12 B;  1WYC A;  3GDI A;  3A0V A;  1LI0 A;  3GRJ A;  3LY4 A;  3S7Q A;  4JBF A;  3UNW A;  4IVK A;  2JBF A;  3VMA A;  1YKD A;  4R70 A;  3PTE A;  1NY0 A;  2GX5 A;  2H0Y A;  3RXX A;  1BSG A;  3CG5 A;  4KQR A;  1G28 A;  2WGW B;  1GSX A;  2ACG A;  1S0W A;  3V39 A;  1X0O A;  5TJJ A;  3HUN A;  4LLO B;  2OWJ A;  5FQM A;  1H8M A;  1N4O A;  1EWZ A;  4KZA A;  3C7V A;  3E2K A;  1FQG A;  1NYM A;  3BFC A;  5HAR A;  5EE8 A;  3W2Z A;  1LI9 A;  5L10 A;  5TGF A;  4E04 A;  4PPR A;  1SKF A;  4LV0 A;  3NDG A;  5M18 A;  3BEB A;  5L8M A;  3VP0 A;  4FOF A;  1E3U D;  1W79 A;  4BLM A;  1T1A A;  4YIN A;  3O5Y A;  1DP9 A;  5HAI A;  3F1N A;  3SH7 A;  3ZG8 B;  2ZMV A;  2Y91 A;  2ZC5 B;  3S1Y A;  1D1J A;  4PKY G;  2XRN A;  4E3J A;  1RCJ A;  2EXA A;  3NEC A;  1QMF A;  4GS9 B;  2J7V A;  4KZ8 A;  3PBN A;  5DKL A;  3V5M A;  1S66 L;  4E3K A;  1P97 A;  4PHT A;  3C4O A;  3V3R A;  5TR7 A;  2H5S A;  5I94 A;  4WL9 A;  1MC0 A;  1HLU P;  2Y2N A;  1RGY A;  2I9V A;  4HJ3 A;  2HGV A;  2KOI A;  1BLS A;  3VP4 A;  4E3N A;  5DKK A;  5EVL A;  5GLD A;  5I5L A;  5EOO A;  1U60 A;  3IF5 A;  4JGR A;  4X69 A;  2D01 A;  2ZL1 B;  3ZVW A;  4X25 A;  3PR6 A;  3LY3 A;  2V9A A;  1O7E A;  4G3K A;  3E4Q A;  2OAQ 1;  4WZ5 C;  3MXS A;  3BFG A;  3PAG A;  3UB5 P;  2ZQA A;  3C2W A;  1KOU A;  1T19 A;  5CTN A;  3MXQ A;  2XR0 A;  2WKI A;  1SZV A;  3M6B A;  3T4Q A;  1BLP A;  2PR5 A;  1HTZ A;  2YKF A;  4KZ7 A;  1SDN A;  2WKE A;  2V2F F;  2O0Y A;  1YLT A;  4B93 A;  2P08 A;  3G35 A;  1LL5 A;  2ZOI A;  3K3C A;  3WS1 A;  2J9P A;  3AGD A;  2R9X A;  1FOF A;  1GCE A;  3OPH A;  5EEC A;  4KZ4 A;  4WF0 A;  2Q0O A;  4NXE A;  5HDC A;  4ZTK A;  2VGK A;  4S2M A;  3W8K A;  3T4T A;  3T4O A;  4X6T A;  1VM1 A;  1BUE A;  5CEB A;  2PD8 A;  2EFU A;  3T1Q B;  3CMZ A;  2C6W B;  2PAV P;  3BY9 A;  2V8F A;  4Y0U A;  2BG1 A;  4WEJ A;  4JLF A;  1TS7 A;  2WGW A;  1MKM A;  2Y2K A;  3BQ8 A;  3ZNY A;  2PU4 A;  5FSR A;  2KX6 A;  1DJC A;  4S2J A;  3FV7 A;  3C8C A;  4RX3 A;  1K6R A;  3OC2 A;  4HBT A;  4WN5 A;  1L3L A;  4EQI A;  2XLN A;  5EPH A;  3IXH A;  3IWQ A;  3MFX A;  3UE6 A;  1ES4 A;  1V9Z A;  1JTG A;  4UQI M;  3N6I A;  3I7J A;  3E98 A;  2OWH A;  2VV7 A;  3LI8 A;  3RTY A;  3L7H A;  4HHD A;  1T1B A;  1STZ A;  2ZQ8 A;  3IS2 B;  4GZB A;  2ZC7 A;  4IED A;  1OME A;  1BTL A;  1W63 Q;  2Y55 A;  1H0M A;  3R4K A;  4GS9 A;  4KZ3 A;  5HSQ A;  2Q9M A;  3A3F A;  5E2G A;  1IKI A;  5IT5 A;  5DJU A;  3IX4 A;  3C5A A;  2A49 A;  3BFD A;  3DAV A;  3IHA A;  4EBN A;  3Q1F A;  4WZ5 A;  4QHC A;  3UB7 A;  2B5R A;  5HAP A;  2MJ6 A;  2XDM A;  5L09 A;  2DCF A;  5FDH A;  3RH8 B;  3VOL A;  2ZL1 A;  1SDE A;  2I72 A;  3OPL A;  2O9C A;  2XGN A;  4N1H A;  1XFQ A;  1UWN X;  2GNX A;  3LIA A;  4ZDX A;  4BQM A;  4R23 A;  4KZB A;  1A0K A;  3PAE A;  3IXD A;  2XA7 S;  1E3U A;  3CWF A;  4MBK A;  4PKY A;  5KMW A;  3W4P A;  2B95 A;  3ZVT A;  5HD3 A;  4P87 A;  2M7U A;  5DVA A;  4H8R A;  5J4E A;  1FCM A;  3E2L A;  2V1B A;  4X68 A;  3N8S A;  4NXB A;  4C75 A;  1MZU A;  4KG5 A;  4JXW A;  2GZA A;  2JKG A;  4XXR A;  5K5B A;  4OOY A;  3HJK A;  3T4J A;  5EM0 A;  5KIZ A;  3W4Q A;  4BJP A;  2Y2O A;  4DE3 A;  5G18 A;  3V50 A;  1E4D A;  1ONG A;  3ZG5 A;  4DF6 A;  1ZG6 A;  3LFV A;  2WZX A;  3UPO A;  5G4Y A;  4JXV A;  1XJ4 A;  5FAT A;  3JVU A;  4B4X A;  1FR6 A;  4MNR A;  4EV4 A;  1YLJ A;  1ESI A;  1RGZ A;  3CJM A;  1IOU A;  3DTK A;  3PXP A;  1ERO A;  3GVB A;  4JGO A;  1TS0 A;  3EWK A;  3OOV A;  2W3D A;  3P01 A;  4C6Y A;  4MBF A;  3BLM A;  5F83 A;  2XH9 A;  3PBS A;  4I3J A;  5FI7 A;  2PR6 A;  3JYI A;  1L0E A;  4EBL A;  4EXO A;  2WAF A;  3EEH A;  1DJA A;  4GNU A;  1OJG A;  3CHW P;  3NY4 A;  5GLC A;  5M1A A;  4ZJ3 A;  4MBH A;  2Y2G A;  5GLA A;  2KDK A;  3B3X A;  2ZQC A;  5CHM A;  3LO7 A;  4UA7 A;  3EGD C;  2FZ0 A;  4P0M A;  4DXB A;  3EOI A;  4EER A;  1F5M A;  3OPP A;  4NXF A;  1YMS A;  3ZQ5 A;  2OLV A;  2EX9 A;  1FIK A;  4R0Q A;  3RXW A;  5F68 A;  4DRT A;  1BZA A;  1ODV A;  3KSF A;  3HLC A;  2JKF A;  1W7F A;  5BOH A;  3IS2 A;  4NXG A;  4U0T A;  3IWO A;  2QYB A;  3V3S A;  3P09 A;  1NXY A;  4O01 A;  3UPN A;  4HP4 A;  4WEL A;  3BQA A;  5FEG A;  3ZG9 B;  1OTB A;  3K3D A;  2EA9 A;  4I3I A;  5F1F A;  4BBU A;  5FQQ A;  1KVM A;  1GHP A;  4WM9 A;  2Y2J A;  1YT4 A;  2XRO A;  1NRJ A;  4NKP A;  3PBO A;  4HJ6 A;  1ZKJ A;  2H28 A;  4RX2 A;  3S7O A;  1H8Z A;  3VP1 A;  2LB9 A;  2P9V B;  3Q81 A;  1VET B;  1MXO A;  4E3O A;  3UME A;  2VV8 A;  1TDG A;  4FSF A;  3ISG A;  2Y2P A;  4S2L A;  3ICY A;  2Z2L B;  3MZE A;  5HX9 A;  2V1A A;  5EUA A;  3FKW A;  4OQ0 A;  5HDS A;  4JGP A;  2QHK A;  4Y3I A;  4OOM A;  1RP5 A;  4OOL A;  3LI9 A;  1ONH A;  4HES A;  1MY8 A;  4DMZ A;  1SHV A;  3S7P A;  1H3Q A;  1NLZ A;  2XD5 A;  3PHY A;  3LR5 A;  3GR2 A;  1NJ4 A;  1PYY A;  4UEY A;  2J80 A;  3KO6 A;  3N4I A;  4Y0O A;  3SOI A;  2PRF A;  4BEN A;  4S2N C;  1I2W A;  1IYQ A;  4DKI A;  2IA2 A;  4MN5 A;  1I2S A;  3C7U A;  3IH8 A;  1PZO A;  5DTT A;  4DE2 A;  4L0L A;  5IHV A;  1IYP A;  3M6H A;  4NEE D;  5EOE A;  1WYB A;  4DDY A;  3FC7 A;  3HRE A;  3UO9 A;  5DFX A;  4BBT A;  5IS1 A;  2J3T D;  2HDS A;  2X01 A;  3QNB A;  2ZM2 A;  2HP9 A;  5DF7 A;  4DE0 A;  3HL9 A;  2PYP A;  4HY8 A;  3U4L P;  1NZU A;  1IYO A;  3NOP C;  3ZG7 B;  4B88 A;  2Y79 A;  2Y59 A;  4OLD A;  1LT0 A;  2PT7 A;  2VJW A;  3ZFZ A;  3IXB A;  2X71 A;  3SS5 A;  1KDW A;  1S1Z A;  1CEG A;  3ZHH A;  5G4Z A;  3MJQ A;  1NWZ A;  4N9K A;  4OPQ A;  3P7N A;  1TVF A;  1PIO A;  5EV0 A;  3O87 A;  4MLL A;  3A3I A;  4JF4 A;  1KE3 A;  3A3E A;  5MC7 A;  5EVI C;  4Y5F A;  3G30 A;  3VOY A;  2VA0 A;  2OOL A;  1S67 L;  1Z6F A;  3A0S A;  1XA1 A;  4QY6 A;  2FFF B;  1I5Q A;  4R3J A;  5A91 A;  1OTA A;  5GHX A;  2WKQ A;  1KVL A;  2OV5 A;  4OH0 A;  5HWV A;  1PI4 A;  5C5K A;  1PRQ A;  4DN0 A;  3CAX A;  2O9A A;  3F1P A;  3TW8 A;  5HPF A;  3D9Y A;  2UV0 E;  2W1T B;  2WUQ A;  2JKT I;  2V0W A;  3KSG A;  2VLG A;  3TOI A;  1GA9 A;  5DTS A;  5FQJ A;  5AQA A;  4H6J B;  4FH2 A;  2Y2H A;  2P9V A;  1BLH A;  2X02 A;  4JF5 A;  5FI6 A;  1VET A;  1W5D A;  2WKP A;  2XK1 A;  2J3T C;  3EEA A;  5EFW A;  3TE8 A;  1TEM A;  4HIA A;  3PBR A;  2O99 A;  4EW7 A;  4IJG A;  1WE4 A;  4PM9 A;  5A90 A;  4S2N A;  3NOU C;  3EQU A;  4P85 A;  4CLC D;  1AWI A;  5HAQ A;  4F94 A;  3ULF A;  3F1O B;  5FAQ A;  4LGW A;  2C5W B;  4GJ4 A;  3MXR A;  1PWC A;  1H8Y A;  3MSH A;  3Q7Z A;  1PFL A;  4X1M A;  1W63 M;  2B18 A;  4JKT A;  3A0R A;  1UWP X;  1N9N A;  1V9Y A;  2V0U A;  3HLF A;  4KG6 A;  2HZ5 A;  2Z2M B;  4LV3 A;  3BM6 A;  5D3O A;  4Q0I A;  2LB5 A;  1S1Y A;  3UPP A;  3UDF A;  3MKF A;  4HEF A;  2W0N A;  4Y2F A;  1K55 C;  1OTI A;  4GN2 A;  3VFH A;  3OBF A;  3NBL A;  3CZD A;  1OPX A;  2GJ3 A;  2V20 A;  4ME4 A;  1LL9 A;  4X55 A;  3LGO A;  4MEZ A;  2OSU A;  1K4E A;  2JCH A;  4MDZ A;  3MMH A;  2W3F A;  5F1G A;  4CLC E;  2VGL S;  3BW6 A;  1YLZ A;  3IX8 A;  4CLC B;  4OON A;  3UMD A;  5DJT A;  1VEU B;  5FQI A;  3E0Y A;  4O8G A;  1XP4 A;  3UB6 A;  2PU2 A;  1CI9 A;  1PI5 A;  2K2N A;  4L9E A;  2VGL M;  3WWX A;  1SCW A;  4EU0 A;  3RFB A;  4S2O A;  4KZ5 A;  2BLS A;  4FD8 A;  4ETX A;  3WS5 A;  4QWO A;  4D60 A;  4RQ9 A;  3N8R A;  1WA9 A;  4NG2 A;  1SKO B;  4XT2 B;  4R4R A;  4LRX C;  4DE1 A;  5F5Y A;  1LLB A;  3HUO A;  3NHQ A;  4N1X A;  5FQ9 A;  1ESU A;  4CLC C;  5HW3 A;  3CIT A;  3OCL A;  4DJ2 A;  2E8J A;  2AVX A;  4QJG A;  1CEF A;  1Q2P A;  3BRM A;  1K25 A;  2QWS A;  1JWV A;  3L9K A;  1P9W A;  3LR4 A;  4GLQ A;  3A3J A;  1BYW A;  3VP2 A;  1DY6 A;  5GHY A;  4GD6 A;  4YNR A;  5HZH A;  4LRZ E;  2CC1 A;  1HZO A;  4I5S A;  2W1T A;  2QPN A;  4Q0J A;  1ZHH B;  4EES A;  3O3V A;  2L4R A;  4F3L B;  1AXB A;  2ZJ9 A;  4H6J A;  3N8L A;  5HDD A;  4K0W A;  4HI4 A;  1W8Q A;  1OTE A;  4AFI A;  2PD7 A;  4E3L A;  2P7J A;  2IWB A;  2G2U A;  4FTX A;  3SS3 A;  2J9O A;  3ZNT A;  1P0Z A;  1CF0 A;  4GDB A;  1KE0 A;  1HVB A;  4L9F A;  1BT5 A;  5FAS A;  2JKR M;  5KSC A;  1PWD A;  4DDS A;  1Q2Q A;  3PBT A;  4E6X A;  3FZC A;  4PM8 A;  3F1O A;  4ETZ A;  3CUE C;  2XA7 M;  4YWZ A;  4KQD A;  4GHI B;  4KZ9 A;  3BY8 A;  4HJ4 A;  2Y8H A;  3D3O A;  4X53 A;  2IWD A;  3QHY A;  1E25 A;  3NUL A;  2ZOH A;  1VB6 A;  3ITB A;  3HUM A;  2L0W A;  3IBJ A;  4GKU A;  4B4Z A;  5KZH A;  4ZBE A;  3OCN A;  1CI8 A;  3SH9 A;  2ZMF A;  3D4F A;  1QME A;  3B33 A;  2VZW A;  3D72 A;  4OPR A;  2EFX A;  1DP6 A;  1YLY A;  3ZCZ A;  3IHB A;  1XX2 A;  2EWV A;  1YSQ A;  3T4K A;  4BL3 A;  3UE1 A;  4I39 A;  3IH9 A;  4I3A A;  3MFD A;  3ZGA B;  2OAP 1;  5KSH A;  3R7W A;  1CQA A;  2B02 A;  2H0T A;  4CLC A;  4FCF A;  4QY5 A;  1VEU A;  2Y2Q A; 
#chains in the Genus database with same CATH homology
 1NLZ A;  2INW A;  3UB8 A;  4B9O A;  4BMW A;  4JGR A;  4GW9 A;  2D01 A;  3PHY A;  3LR5 A;  3MQO A;  1ZTU A;  3BWL A;  3C30 A;  3PR6 A;  4UEY A;  2J80 A;  3KO6 A;  1N9O A;  3UB9 A;  2V9A A;  2VV6 A;  2L1M A;  2IA2 A;  4MN5 A;  4G3K A;  4II7 A;  2CMN A;  1LL8 A;  1TF1 A;  4M4X A;  2NUP C;  4L0L A;  3E4Q A;  2OAQ 1;  4NEE D;  3LIC A;  4XT2 A;  1GSW A;  2W27 A;  1VHM A;  3C2W A;  5HPI A;  2HJ9 C;  1KOU A;  1T19 A;  3FC7 A;  3KYZ A;  5DFX A;  4BBT A;  5IS1 A;  2J3T D;  1UGU A;  3MXQ A;  5A8B A;  3CLO A;  4ARZ B;  1G6O A;  3T4Q A;  2PR5 A;  2HJE A;  3LIF A;  2PYP A;  4HY8 A;  2YKF A;  1YSP A;  2PHY A;  3NOP C;  2Y79 A;  1DP8 A;  4MCW A;  5HWT A;  1LT0 A;  2VX8 A;  2PT7 A;  2VJW A;  4WLA A;  2Z6C A;  2O0Y A;  2EWW A;  3DBA A;  4B93 A;  4DJ3 A;  2P08 A;  4QPR A;  1TS8 A;  1S1Z A;  5G4Z A;  2ZOI A;  3K3C A;  3MJQ A;  4IHQ A;  1NWZ A;  5HWW A;  3P7N A;  1GSV A;  3F1P B;  2XSS A;  3H82 B;  3PYP A;  4WF0 A;  1DRM A;  3TJZ C;  4IUH A;  2D02 A;  4NXE A;  3CUE A;  1N9L A;  1XJ6 A;  4F3L A;  5HDC A;  3NOT C;  5FL3 A;  2K31 A;  1LSW A;  5MC7 A;  3T4T A;  3T4O A;  2W3G A;  4Y5F A;  2PYR A;  2VA0 A;  2PD8 A;  2OOL A;  1S67 L;  3KSH A;  4Z1W A;  3A0S A;  3BY9 A;  3G6O A;  4EEU A;  3TRC A;  2M1C A;  4WEJ A;  1TS7 A;  2HV1 A;  2W1R A;  1MKM A;  3MQ0 A;  3BQ8 A;  4IUK A;  2YKH A;  4HP9 A;  2KX6 A;  1OTA A;  2WKQ A;  3C8C A;  5F69 A;  5HWV A;  4DN0 A;  5C5K A;  2A24 A;  3OC2 A;  2QJ7 A;  3CAX A;  2O9A A;  4MN7 A;  4WN5 A;  4WUJ A;  3F1P A;  4EEP A;  3JVV A;  2VKS A;  3TW8 A;  5HPF A;  1S4R A;  4GHI A;  3H7W B;  1TD5 A;  2W1T B;  1S4S A;  2Z6D A;  2JKT I;  2V0W A;  3BJN A;  3KSG A;  5CX7 A;  4HNB A;  2VLG A;  3MFX A;  3UE6 A;  1V9Z A;  4UQI M;  3E98 A;  4H6J B;  1EW0 A;  2OWH A;  2VV7 A;  3LI8 A;  5HD5 A;  3RTY A;  4P6Z S;  3U2A A;  4HHD A;  3T50 A;  3B47 A;  1T1B A;  3NJA A;  1STZ A;  4EET B;  2HF6 A;  3IS2 B;  1OT6 A;  1XJ2 A;  2WKP A;  1W63 Q;  4JGQ A;  2J3T C;  3EEA A;  4I38 A;  5EFW A;  3TE8 A;  3R4K A;  1YAX A;  5HL6 A;  4HIA A;  3PBR A;  2O99 A;  4GS9 A;  4EW7 A;  4IJG A;  5HSQ A;  4MMN A;  3NOU C;  3EQU A;  3KYQ A;  5AJG A;  4CLC D;  1F98 A;  5IT5 A;  4HQA A;  5AVE A;  1LSX A;  4HH2 A;  1TS6 A;  3F1O B;  5DJU A;  3ULF A;  4EQ1 A;  5TBM B;  4K08 A;  3H9W A;  3FPW A;  5J3W A;  4Q0H A;  3ZYT A;  4GJ4 A;  3MQQ A;  3UB7 A;  4CQH A;  4PAU A;  4GCZ A;  2MJ6 A;  3E4P A;  2DMW A;  2JKR I;  1OTD A;  1W63 M;  2B18 A;  3A0R A;  1UWP X;  1N9N A;  3PBQ A;  3RH8 B;  2K7S A;  3VOL A;  1V9Y A;  2A2L A;  2V0U A;  3C38 A;  4LPZ A;  4R6L A;  2M7V A;  4EUV A;  2O9C A;  4WEK A;  5DF9 A;  3F1N B;  4LRY C;  4Q0I A;  2LB5 A;  1XFQ A;  1S1Y A;  1Y28 A;  1UWN X;  1IFQ A;  2J3W A;  2GNX A;  3LIA A;  3OLO A;  1NLY A;  1T1C A;  2W0N A;  2NUT C;  4Y2F A;  2XA7 S;  3CWF A;  1OTI A;  4PKY A;  3OBF A;  1OPX A;  5HD3 A;  1XFN A;  4BBV A;  2GJ3 A;  2M7U A;  4ME4 A;  5J4E A;  3MF0 A;  2V1B A;  4NXB A;  4KUK A;  1MZU A;  5AVF A;  3T4L A;  2PDR A;  2GZA A;  3MR0 A;  4MN6 A;  4ARZ A;  3UE3 A;  5K5B A;  3HJK A;  4MDZ A;  3T4J A;  3MMH A;  5KIZ A;  2W3F A;  4CLC E;  4BJP A;  2VGL S;  3BW6 A;  4R38 A;  4CLC B;  3UMD A;  3EQV A;  5DJT A;  3E0Y A;  4O8G A;  2JN7 A;  3UB6 A;  3V67 A;  2K2N A;  3CI6 A;  3FG8 A;  4L9E A;  2VGL M;  3LFV A;  4EU0 A;  3RFB A;  5G4Y A;  3KX0 X;  2WKR A;  3H82 A;  4ETX A;  1XJ4 A;  3LIE A;  3LUQ A;  3JVU A;  1OJ5 A;  4KUO A;  4G3W A;  1IOU A;  3LR3 A;  3LID A;  3PXP A;  4RQ9 A;  1WA9 A;  3HJI A;  4XT2 B;  4JGO A;  1D7E A;  4LRX C;  3SW1 A;  1TS0 A;  3EWK A;  3LR0 A;  3OOV A;  2W3D A;  5F5Y A;  3P01 A;  1OT9 A;  3NHQ A;  2W3H A;  4CLC C;  3LYX A;  3CIT A;  2QKP A;  3OCL A;  3VE4 A;  1P9R A;  3LIB A;  4DJ2 A;  3HCY A;  3PBS A;  4ZRR A;  4L9G A;  4I3J A;  2PR6 A;  1XJ3 A;  2JKT M;  2ZBB A;  4EXO A;  1JNU A;  2QWS A;  3EEH A;  4P6Z M;  1F9I A;  1P9W A;  2P04 A;  4KQO A;  3LR4 A;  3S7N A;  4GLQ A;  1OJG A;  3GEC A;  1BYW A;  4G3V A;  2R78 A;  3KSI A;  5DFY A;  4YNR A;  2KDK A;  1D06 A;  4BWI A;  5HZH A;  2W3E A;  4LRZ E;  3EGD C;  2FZ0 A;  3H7W A;  4I5S A;  3GDI A;  3EOI A;  4EER A;  1F5M A;  3A0V A;  2W1T A;  4NXF A;  4Q0J A;  3S7Q A;  1ZHH B;  4EES A;  3ZQ5 A;  2L4R A;  4F3L B;  5IU1 A;  5F68 A;  4H6J A;  1ODV A;  5HDD A;  1YKD A;  2G7U A;  3KSF A;  4R70 A;  3VV4 A;  4HI4 A;  2FH5 A;  1OTE A;  4AFI A;  2PD7 A;  2GX5 A;  3T4S A;  2P7J A;  3IS2 A;  4NXG A;  5J7E A;  1P0Z A;  1G28 A;  2QYB A;  1GSX A;  1T18 A;  3K2N A;  4L9F A;  4O01 A;  2JKR M;  1X0O A;  4HP4 A;  4WEL A;  5TJJ A;  3BQA A;  4LLO B;  2OWJ A;  3IBR A;  3PBT A;  1H8M A;  1OTB A;  3K3D A;  2A24 B;  3F1O A;  2EA9 A;  3B42 A;  4ETZ A;  4I3I A;  3CUE C;  2BAS A;  2KLI A;  5TBM A;  2XA7 M;  4BBU A;  4YWZ A;  4KQD A;  4GHI B;  5F6A A;  3BY8 A;  3W2Z A;  4HOI A;  4HJ4 A;  2Y8H A;  3D3O A;  4E04 A;  3R7W B;  2XRO A;  1NRJ A;  5L8M A;  4NKP A;  3PBO A;  4FOF A;  4HJ6 A;  2H28 A;  5LBR A;  2ZOH A;  1VB6 A;  4YOF A;  3S7O A;  1T1A A;  2L0W A;  3IBJ A;  1LSV A;  3O5Y A;  2LB9 A;  1DP9 A;  3F1N A;  2VEA A;  2ZMV A;  2QJ5 A;  3OCN A;  3VE3 A;  4PKY G;  2XRN A;  2ZMF A;  3UME A;  2VV8 A;  3B33 A;  4O0P A;  4FSF A;  2VZW A;  3D72 A;  4HH3 A;  4GS9 B;  1DP6 A;  3PBN A;  5DKL A;  3ICY A;  3E4O A;  2V1A A;  1S66 L;  2EWV A;  1YSQ A;  3T4K A;  4R3A A;  1P97 A;  5HDS A;  4PHT A;  3EGX C;  4JGP A;  4I39 A;  4UQI S;  2QHK A;  4I3A A;  4Y3I A;  4OOM A;  2O9B A;  4OOL A;  3LI9 A;  2OAP 1;  4WL9 A;  2JHE A;  1MC0 A;  5KSH A;  4DMZ A;  2I9V A;  4HJ3 A;  3R7W A;  2HGV A;  2KOI A;  2B02 A;  3S7P A;  5DKK A;  4CLC A;  1H3Q A;  3FPV A;  5I5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...