4HI4A

Crystal structure of the 5-coordinate ferric heme-binding pas domain of aer2 from p. aeruginosa
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
GSHMARIASALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDAGRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANARLGSAVQWTDRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Architecture of the soluble receptor Aer2 indicates an in-line mechanism for PAS and HAMP domain signaling.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
molecule keywords Aerotaxis transducer Aer2
total genus 36
structure length 119
sequence length 119
chains with identical sequence B, D, G
ec nomenclature
pdb deposition date 2012-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hi4A00
2BASA 1LSXA 3F1PB 3LI9A 5AVFA 1Y28A 1X0OA 2PD8A 4HP9A 2OWHA 4GHIA 3FC7A 4BBUA 4DJ3A 3LIDA 2YKFA 4HJ6A 3MJQA 4LPZA 3NOTC 2I9VA 3IBRA 1OTAA 1KOUA 1T19A 1S66L 1S67L 3C2WA 3H9WA 4R6LA 1UWNX 3MR0A 3CLOA 3E4PA 4EEPA 1XFNA 5F5YA 4WLAA 1N9LA 2V1BA 4I5SA 2QHKA 4EW7A 2QKPA 4PKYA 4YWZA 5HDCA 2PYPA 1MZUA 3D72A 3F1OA 3GDIA 4HIAA 4M4XA 5IU1A 1WA9A 4DJ2A 3UB8A 2K7SA 2W27A 4XT2A 1LT0A 3RH8B 5F6AA 2Z6DA 2VV7A 3UB6A 2Z6CA 2PHYA 4HJ3A 1XFQA 1V9ZA 4HY8A 2A24A 1F9IA 3MXQA 4EESA 1N9OA 2VEAA 3F1OB 3ZQ5A 2A24B 4L9EA 5HDSA 3UE6A 4HNBA 3H7WB 2PR5A 1UWPX 5J4EA 3H82B 1G28A 4HHDA 1LSWA 3RTYA 2OWJA 3NOPC 3PHYA 1GSXA 3OLOA 3LIBA 3HJIA 3IS2B 4HJ4A 5A8BA 5IS1A 2JHEA 4HH3A 5F69A 3KX0X 4EERA 4EQ1A 3BY9A 4WL9A 1DP9A 2V9AA 4KQDA 1T18A 2OOLA 1OTEA 1TS7A 1OTDA 3CWFA 3UMEA 3T50A 1N9NA 1OT6A 2YKHA 4HI4A 4HH2A 3UMDA 4XT2B 5KIZA 3SW1A 1P0ZA 3P7NA 2VV8A 4R70A 5HZHA 4H6JA 2CMNA 5DJUA 4EETB 5HWTA 5G4YA 2QWSA 1S1ZA 4LRZE 5HWVA 1F98A 2QJ5A 3BY8A 3IS2A 2HV1A 4GCZA 4GS9A 2PR6A 4JGPA 4BBVA 3BWLA 3H82A 1DP6A 3LYXA 4GS9B 4HQAA 3MQQA 2P7JA 4PKYG 5G4ZA 3MQOA 1TS0A 4L9GA 3E4OA 2R78A 2ZOHA 3VE4A 4HOIA 1S1YA 1BYWA 1XJ2A 3MFXA 2PYRA 3B33A 3NJAA 4EXOA 3A0SA 4B9OA 1T1CA 3NOUC 1D06A 1TS6A 2VV6A 3H7WA 4R38A 4I3IA 1S4SA 4KUKA 1D7EA 4I38A 4LRXC 1TS8A 3UB7A 4E04A 5HD3A 1JNUA 5EFWA 1VB6A 1LL8A 2WKQA 1XJ6A 4JGOA 1EW0A 4JGRA 4NXBA 3F1NB 2M1CA 1DP8A 4GHIB 2PD7A 1LSVA 4L9FA 5I5LA 4I39A 4LRYC 3G6OA 3K3CA 2EA9A 2B02A 2L0WA 2VLGA 2WKRA 3VOLA 4I3AA 3F1NA 4R3AA 3HJKA 4KUOA 4HP4A 4MN6A 3GECA 2ZOIA 4GW9A 1OTIA 4K08A 2W0NA 3LUQA 4NXGA 4WN5A 2D01A 4MN5A 2PDRA 3ULFA 1DRMA 5HDDA 4F3LB 2ZBBA 5DJTA 2V0WA 3C8CA 3VE3A 2H28A 5DKKA 1XJ4A 3FG8A 3NHQA 3A0VA 1GSVA 1NWZA 3PYPA 4BBTA 2V1AA 3LI8A 4EEUA 1T1AA 1S4RA 3CAXA 2INWA 1UGUA 2KDKA 1ODVA 2JN7A 2KX6A 2WKPA 5F68A 3ICYA 5TBMB 1T1BA 4NXEA 1GSWA 4H6JB 2QJ7A 3UB9A 3K3DA 2L1MA 1OT9A 2D02A 1OJGA 4I3JA 5DKLA 3EWKA 3LICA 5HSQA 4JGQA 3LIAA 4WUJA 4RQ9A 5TBMA 2L4RA 4F3LA 4WF0A 5AVEA 3LIFA 4LLOB 5J3WA 5HWWA 1OTBA 1P97A 1XJ3A 2GJ3A 3E4QA 3A0RA 5J7EA 3LIEA 4NXFA 1OJ5A 2J80A 3EEHA 3F1PA 2V0UA 1V9YA 5HD5A
chains in the Genus database with same CATH superfamily
4P6BA 2ZLYA 3MKFA 4IUHA 3MJQA 3TJZC 3CHWP 4BENA 3VP1A 3NI9A 2QZ6A 3FWLA 1ESUA 4PKYA 4HBTA 2J9OA 1MZUA 5KSCA 1FR1A 4RA7A 4DJ2A 2XRNA 4G3KA 1MWUA 1O7EA 1ERQA 4X6TA 2XF3A 1N9BA 1Q2PA 4DXBA 4E3KA 1UWPX 4OPRA 2A2LA 3KYZA 1PRQA 3OPLA 1OTDA 4L0LA 3IH8A 2JKTI 4X1LA 3SW1A 1LLBA 4R70A 1SKOA 5HWVA 3S22A 2Z2MB 4RX2A 3BWLA 1DP6A 3MQQA 1K56A 1H8ZA 2ZOHA 4FOFA 4HOIA 1MWSA 2Y2LA 3NOUC 2G2WA 3EQVA 2JKRI 4I38A 3G2ZA 5EFWA 2HPBA 4LV3A 4JXVA 3K3CA 4PPRA 2WYXA 2WUQA 1HZOA 3F1NA 5DF8A 4MN6A 2MJ6A 3ULFA 2Y2JA 5A92A 5FAQA 4FSFA 3OPPA 3PYPA 4DKIA 1GCEA 1UGUA 3HCYA 3V39A 3Q82A 1LL5A 1O07A 3PBQA 5DKLA 2IA2A 2J8YA 5FQ9A 1NLYA 1RCJA 2DRWA 5F82A 4EUVA 3A3FA 2Y55A 3ZG7B 1S66L 3T4KA 3IXDA 3DWZA 3VP2A 2O9AA 1BSGA 2PBDP 4ZJ1A 3UPOA 3GDIA 5BOHA 2K7SA 5FATA 2ZC5B 1D1JA 2HP5A 2K31A 3Q7VB 5CGWA 3FV7A 4BL3A 2W3HA 5J4EA 1MWRA 1XA1A 4K0WA 4WEJA 5JYOA 2EFXA 4WL9A 5DFXA 5LBRA 3VMAA 5EE8A 3KSFA 2WKEA 4P6ZS 1EWZA 4H6JA 4S2NC 3IX8A 1ACFA 2Y2QA 4E6XA 3MQOA 4Q0IA 3E4OA 1SKOB 4CLCD 2PYRA 3MSHA 4EXOA 4B9OA 1WYCA 3R4KA 5F1FA 1PWDA 1PZOA 4EUZA 3IH9A 1JWZA 4L9FA 1E4DA 2L0WA 3A3EA 3T4LA 4YINA 3P09A 1YMSA 4OPYA 3HJKA 4QU3A 3BEBA 5J8XA 2Q9NA 3A0VA 2WK0A 4KQOA 3T50A 2HDQA 1T1BA 4NXEA 4WMCA 1J3WA 5CGXA 2J7VA 3CZDA 2L4RA 5J3WA 1DJAA 2GJ3A 5FDSA 2EXAA 1W8QA 4PM6A 1QMEA 3IWQA 2OV5A 4OP8A 4MDZA 2ZM2A 3VOYA 3WRZA 4Y2FA 2Y2MA 2HDRA 1ONGA 5EM1A 3BRMA 4HIAA 5HL6A 4GKUA 1JWPA 4MN7A 5D3OA 4JF5A 1N9OA 4KENB 3UE6A 3RTYA 4JBFA 2Y2NA 4C3QA 4BLMA 4IHQA 2FFYA 5CX7A 1OTEA 4HI4A 4KZ7A 1P0ZA 3MQ0A 5CTNA 3DTKA 3VSKA 4ZDXA 3H82A 1ZG4A 4YWZA 4CQHA 4KQQA 4B4ZA 1XJ2A 5FAOA 2ZQAA 5DVAA 3I7JA 4WZ4A 4MBFA 1S4SA 3V5MA 2ZQDA 1LL9A 1YLYA 3WS5A 4GDNA 3L7HA 2WKRA 4KUOA 2ZBBA 1PWGA 4KG5A 1BUEA 4OOMA 1W79A 2XQZA 3GRJA 1L2SA 2J3TD 3F1PA 4U0XA 1IYSA 4UHUA 1NRJA 1W7FA 4JPMA 3DTMA 4HJ6A 5HD5A 1TD5A 2UWXA 4FCFA 4E3JA 4E3NA 4DMZA 5EVLA 4PM5A 2O9BA 1PW8A 1K55C 4Y0UA 1CF0A 3LEZA 2OAQ1 3MMHA 1XFQA 3ZYTA 3ZQ5A 1CEFA 5IT5A 1GA9A 4UA7A 4LV0A 3FKVA 4Q0JA 4EWFA 1TF1A 1K25A 3JVVA 4PM7A 4E3IA 4P6ZM 1MC0A 4II7A 2CMNA 4EETB 3PTEA 3UO9A 3FKWA 4GS9A 1FCMA 3LFVA 3VE4A 4K91A 4X1MA 3DTIA 2WAEA 3UNWA 3DWKA 1T1CA 3IF6B 4GLQA 1YMXA 5EVIA 4JKTA 3IF6C 1BLPA 4WMCD 4JGRA 3QHYA 3ZVWA 1IYQA 3QP2A 4ZJ2A 5GHXA 1YQSA 2VLGA 2H0YA 1Q2QA 4GW9A 1OTIA 4EU0A 4ARZA 4Q8IA 2RCXA 1YSQA 1XPBA 5TBMB 3VP0A 1CI9A 3GR2A 5E2GA 5GHYA 5CHJA 2ZQ8A 3W2ZA 1SHVA 3BW6A 4E3LA 1MKMA 3LIFA 4MBHA 2LB5A 1OJ5A 3IXGA 4S2NA 4NG2A 5GLCA 3LIDA 3IBRA 1KOUA 1S67L 3MR0A 3CLOA 1Z6FA 2JC7A 3ZGAB 3SS5A 2QHKA 3SS3A 1CEGA 5IU1A 4XUXA 2W3FA 4DXCA 4ESPA 1OPXA 2JKFA 2Z6DA 3WS0A 1V9ZA 3HLFA 2XDMA 4ZAMA 2PR5A 3DW0A 3OLOA 3IS2B 4QPRA 3V3SA 2IWCA 3W4PA 3UDFA 4R4RA 1TS7A 3UMEA 2CC1A 5FL3A 1IFQA 4GJ4A 4RVAA 4E3OA 4QWOA 2PR6A 3DTEA 4X25A 2P7JA 5G4ZA 4OKPA 5TFQA 1MXOA 1BYWA 1YM1A 2Y2GA 3PBNA 4DF6A 2NUPC 5M19A 1LL8A 5CECA 2W1RA 3NY4A 2E8JA 2XROA 2Y2PA 1FCOA 3RXXA 3OBFA 2PDRA 4JLFA 4OLGA 2EFUA 5DKKA 2JE5A 3V50A 4KZ8A 3EOIA 3ICYA 3HLEA 4NK3A 4M3KA 4EQIA 3DBAA 3IWOA 5L09A 3NBLA 5CHMA 1P9RA 4KZAA 3OCLA 4BD1A 5MC7A 1XA7A 1XGJA 1PIOA 3ISGA 4KQRA 1OTAA 3UDIA 4WLAA 3BLSA 3BECA 4PMAA 3F1OA 3L9KA 1AWIA 4XUZA 1TVFA 3HLGA 1BLSA 1F9IA 2XFSA 4QB8A 2XA7S 2LB9A 2GNXA 3H82B 3T1XA 1E3UD 2OWJA 5L2FA 5E2EA 2J3TC 3IWIA 4PHTA 5FASA 1G68A 2H0TA 2WZZA 4PM8A 3MFDA 4DDSA 2BTFP 3FPWA 4KG6A 2V8FA 4C6YA 2QJ5A 2VJWA 1ZKJA 3S4XA 4L9GA 1NYYA 3AGEA 2P04A 3LGOA 2E8IA 3M6HA 1VETA 2QPNA 4BD0A 1JNUA 3Q07A 3QP5A 3HLWA 5FQJA 4R3BA 4WELA 4KZ3A 5CXWA 4R23A 2Y59A 2M7UA 4D60A 1YSPA 1OMEA 1KGGA 4Y13A 1VETB 4DE0A 3NDGA 4N9KA 2KX6A 3MBZA 5AQBA 4H6JB 3CITA 3BM6A 1OTBA 3E4QA 5FQIA 1CQAA 4BBUA 3N8SA 3FC7A 2PT7A 3E98A 3MKEA 1ZHHB 1UWNX 5EVIC 1XFNA 5U47A 3GMWA 4X55A 2BLSA 4LV2A 1ALQA 2QKPA 2EX2A 4OQGA 2PYPA 1WA9A 1JTGA 5F6AA 2PHYA 1W8YA 1YAXA 4MNRA 3MXQA 3F1OB 4CLCC 3WS1A 1L0GA 1K54A 4E3MA 4FTXA 1TDLA 5HAQA 2OAP1 4HEFA 1L0FA 3HLCA 4S2MA 4JF6A 1S1ZA 3E2LA 4O8GA 1KGEA 2VKSA 4JGPA 3Q7VA 5KSHA 3WS2A 2R78A 1NLZA 3CPTA 3OPRA 3B33A 4Y0TA 4WZ5A 1KE0A 2JBFA 2Q0OA 4OPQA 5HD3A 4WM9A 2G7UA 3OCNA 2ZMFA 4LRYC 3NULA 2ZQCA 1K4EA 1H8MA 4K08A 1L0DA 3LUQA 4MN5A 4LENA 3P01A 2V0WA 3ITAA 3VE3A 3T1RA 3UE1A 4S2KA 4OQIA 3C38A 4N1XA 2UV0E 2R9WA 2Y91A 1GSWA 3K3DA 3VV4A 4I3JA 3LICA 2W1TA 5TBMA 1P97A 3O87A 4U0TA 5HDCA 1I2SA 1IOUA 1YLJA 1LSXA 3ZFZA 4GHIA 3D4FA 1GHIA 2Y2IA 5KMWA 5DFYA 4CPKA 2I9VA 1FILA 1Z09A 2VA0A 1MY8A 5GLDA 3PXPA 3ZHHA 3UB8A 3G4PA 4Z9QA 2Z6CA 2Y2OA 2VEAA 3ZNYA 3EGDC 3H7WB 5EM0A 3ZCZA 4HHDA 3S7NA 3HUNA 2ZC7A 5F69A 3BY9A 1S0WA 2V20A 3HUOA 4O7DA 2VV8A 3HREA 5DJUA 1CJFA 1HVBA 4HQAA 4IVKA 1HD8A 1MBLA 1TS0A 4WYYA 5HARA 3CI6A 1D06A 1D7EA 1TS8A 2ZMAA 2PD7A 5FI6A 4LCLA 4IBXA 2EX8A 4GNUA 3KYEA 4IVIA 4I3AA 5CEDA 3RFBA 1U60A 2O9CA 3TG9A 1IKGA 4EEUA 1T1AA 1GHMA 2INWA 2KDKA 2WKPA 4IJGA 4ME4A 3ZVTA 1OJGA 2X71A 4NEED 4LLOB 5M18A 2XFTA 4DE2A 3A0RA 2JKGA 2V8CA 2ZL1A 4ARZB 4NETA 2BASA 3Q7ZA 3U2AA 1S6RA 4AFIA 3NOTC 3G2YA 5HX9A 4E04A 3D3OA 2Y8HA 1ES5A 1KDSA 3BFFA 3D72A 4ETZA 2PU2A 3ZG5A 2VV7A 2ACGA 3C5AA 3HUMA 4H8RA 2PAVP 3E2KA 1PWCA 2WZXA 5F1GA 5A90A 2RL3A 1LSWA 4HJ4A 1GSXA 1K0KA 1VHMA 3LCEA 4X68A 1DP9A 1T18A 1YKDA 1C3BA 5AQ7A 1OT6A 2YKHA 1ES2A 5KIZA 3P7NA 3SOIA 2NUTC 5FI7A 2JKRM 5G4YA 2PU4A 3V67A 4LCMA 1F98A 4BBVA 4Z1WA 5EV0A 5FI2A 1K38A 3B3XA 3NJAA 1EROA 1PI5A 1H8YA 4FH4A 4NKPA 2B5RA 2VGKA 1VB6A 2WKQA 3LR0A 2JCHA 4Y3IA 4GHIB 4I39A 2DNSA 4JXGA 2EWWA 3GTCA 4BJPA 4A5RA 5I94A 2XA7M 3JPUA 1YLPA 2H28A 3FG8A 4BBTA 3R7WB 3FYZA 3KSIA 2C5WB 2IWBA 3S1YA 2EX9A 2EX6A 2QJ7A 1K6SA 4CJNA 4P87A 3TOIA 4CLCB 4YNRA 4F3LA 5HFOA 2W3EA 3LIEA 3VP4A 2J80A 3UB6A 4E6WA 4C75A 4R6LA 1M40A 2Z2LB 3IF6A 4CLCE 1KGFA 3CPTB 1MPLA 1EI5A 2ZC6B 4RX3A 3PAGA 2AVXA 3M2KA 3QP8A 1BULA 4HH3A 4S2LA 4EERA 5F83A 1FIKA 3BLMA 4OQ0A 5FEGA 1PZPA 2HZ5A 3B42A 4XT2B 2ZC4B 2P9VA 4DE1A 3ITBA 2EXBA 2XH9A 3O3VA 2QYBA 3UB5P 4K0XA 2Y79A 1JWVA 1S1YA 3GSGA 4UAAA 3NECA 2ZL1B 4UQIM 1K55A 1VM1A 1LSVA 3C7UA 1XXMA 4N1HA 4QY6A 1G5UA 2GX5A 4EBLA 2ZOIA 1KE3A 3CUEA 4OOLA 4NXGA 1A0KA 3C8CA 2Q9MA 3NHQA 4JXWA 2VZWA 3EQUA 3LI8A 4IEDA 1S4RA 2FFFB 3GQZA 1YLZA 5FA7A 5DTSA 5HSQA 5HWWA 4UEYA 1NZOA 2WADA 3ZG0A 1V9YA 3G31A 1Y28A 3N7WA 3FZCA 3MF0A 4O0PA 2YKFA 3G35A 4LPZA 4JF4A 2WGWA 2Y2HA 4WEKA 1TEMA 3NDEA 3KYQA 1LT0A 4BMWA 2M7VA 4HJ3A 2HGVA 3PAEA 2A24A 3C4OA 5HDSA 2A49A 4HNBA 1G28A 3PHYA 3HJIA 3BYDA 3TRCA 3N8LA 4KZ6A 3TW8A 3K2NA 1FR6A 4KZ9A 4GB7A 1WYBA 1LI9A 5L10A 3VOZA 2J3WA 2WGWB 3IS2A 4GCZA 2P08A 3UY6A 3LYXA 1JVJA 3QP1A 2KOIA 5L07A 3IHBA 3A0SA 4ZJ3A 1TS6A 4R38A 5GL9A 3UB7A 4R3JA 2K2NA 4NXBA 1Y54A 2FH5A 4GD6A 3DAVA 4MCWA 4MLLA 4X69A 5GLBA 1K57C 4WN5A 2W0NA 4CLCA 2D01A 1IYPA 1DRMA 5HDDA 3IHAA 5DJTA 1FCNA 1STZA 4MBKA 4FH2A 1MWTA 2W3GA 4JXSA 5DF9A 2V1AA 3LR3A 1KE4A 2G2UA 2JN7A 2WKHA 2ZD8A 1SDEA 4DN0A 3UE3A 4S2OA 1XJ3A 3IBJA 2VX8A 4EV4A 3OPHA 2PD8A 4HP9A 1K6RA 3W8KA 5EVEA 2KLIA 3T12B 1P9WA 1ES3A 1Y4OA 3EGXC 2QMIA 5A91A 5G18A 3KO6A 3GVBA 2ZQ7A 5TR7A 2HP6A 4M4XA 3T4JA 2W27A 1FQGA 1ZC2A 3RH8B 1MKIA 2GZAA 2W3DA 4OPZA 3CUEC 3ZDJA 3T4QA 5CRFA 4O01A 1BZAA 3M6BA 5K5BA 4EQ1A 4S2IA 3LY3A 5E43A 5E2HA 5CHUA 2WKIA 3UMDA 4GDBA 1XKZA 5HWTA 2ZM0A 5EECA 4WBGA 3IX4A 1E3UA 1PFLA 3T4OA 1NY0A 4UA9A 3PBOA 5HL1A 4OH0A 1PNEA 3BQ8A 1CI8A 3BJNA 4KZ4A 2PRFA 3OZHA 1L0EA 2OSUA 1XJ6A 4R3AA 2M1CA 5CEBA 5I5LA 3SH9A 5C5KA 1DJCA 4HP4A 3EEAA 4Y15A 5HAPA 3BFEA 1H5XA 2VK3A 2Y4AA 4DE3A 1YLTA 1K54C 3IF5A 4U3TA 4KZBA 4OLDA 5EOOA 3SS4A 3ZNTA 1BLCA 3QP6A 5CTMA 5TJJA 4WF0A 3G32A 2W1TB 1PYYA 4R4SA 3NOPC 3LEQA 3LR5A 3IXHA 1W63M 2OWHA 3S7QA 3QP4A 3UN7A 3E4PA 4EEPA 2B18A 4RYEA 2OLUA 1N9LA 2V1BA 3BFGA 3UPNA 4ZTKA 4Y0OA 4XT2A 4IBRA 1PW1A 3T4TA 4ZBEA 4EBPA 3UDXA 4D2OA 3PBTA 3UE0A 1K57A 4FD8A 2A24B 4UQIS 5FQMA 3MS6A 4G3VA 1K56D 2GDNA 2DCFA 4OP5A 5IS1A 3AGDA 3OC2A 3KX0X 1NYMA 5FSRA 1YT4A 3LO7A 4BWIA 2H10A 2OOLA 3T4SA 1N9NA 5AQAA 1VEUA 3CG5A 3VFHA 1ERMA 2QWSA 3BQAA 2HV1A 3PBRA 3A3JA 1G6AA 4KG2A 2XR0A 4PKYG 3MZEA 4BQMA 1XX2A 4IUKA 5FAPA 1IKIA 3O5YA 4QY5A 4Q0HA 4XXRA 4KUKA 2V1ZA 4LRXC 1BLHA 3NC8A 4B88A 1W63Q 4Y17A 1ZG6A 4F3LB 1EW0A 1DP8A 4MEZA 4FUWA 3T1QB 3G6OA 2B02A 2HF6A 3GECA 4ID4A 4YFMA 1NWZA 1DY6A 3C30A 3LR4A 3LY4A 3E0YA 3IXBA 2L1MA 1OT9A 5FQKA 2D02A 5FQQA 3MZFA 4QHCA 3V3RA 2V0UA 3LI9A 4EBNA 2V2FF 2ZM8A 3N6IA 3RXWA 4S2JA 1T19A 3H9WA 3C2WA 4ZRRA 3HBRA 3KSHA 5F5YA 1IYOA 2PBYA 2WGVA 5HAIA 3FPVA 1HLUP 4GN2A 3VFFA 3JYIA 4R1GA 4OQHA 3O88A 4LGWA 4HESA 5GHZA 1QMFA 3VSLA 2XLNA 1YPRA 5FEFA 4QD4A 2C6WB 4UA6A 2ZMVA 1XP4A 3HLDA 1WE4A 2V9AA 4KQDA 5DTTA 3U4LP 1I2WA 3IQAA 4X56A 4DDYA 1BT5A 2Y2KA 3TE8A 4LRZE 2ZJ9A 1SKFA 4LFUA 2ZC3B 3A3IA 4GS9B 4KZ5A 4X53A 1LI0A 3MFXA 2VV6A 2HP9A 4BL2A 1GHPA 3SZTA 3ZG8B 1GA0A 2XD1A 3HL9A 5GLAA 2XEPA 4JGOA 3F1NB 4LV1A 4N9LA 5FDHA 3C7VA 3VOLA 4P85A 4OVDA 3N4IA 2JKTM 1XGIA 2XGNA 3AGFA 4HBUA 1GSVA 3PBSA 1L3LA 1ONHA 3JVUA 4GOGA 2P9VB 1TDGA 5HPIA 4JGQA 4WUJA 3PR6A 4RQ9A 4B4XA 5J7EA 1SDNA 2XK1A 5AVFA 1X0OA 2J9PA 5A93A 5TGFA 5E2FA 4ETXA 1KVMA 3T1SA 4DJ3A 1ZTUA 4OONA 3SH8A 3SH7A 1E25A 3IT9A 3NIAA 3P98A 5EUAA 4F94A 1SCWA 3HLBA 4YOFA 4HY8A 1KVLA 5CGSA 2I72A 5DTKA 3Q1FA 3LIBA 5A8BA 1NJ4A 5AQ9A 4S2PA 1NZUA 5L8MA 3G30A 3CWFA 5CERA 4HH2A 5IHVA 3WRTA 5HZHA 3BFCA 1NXYA 1PI4A 5HPFA 4P0MA 3NCKA 1W5DA 4Y5FA 4OOYA 5DF7A 5AJGA 3Q81A 1J9MA 3S7OA 4QJGA 2HJEA 1F5MA 4I3IA 2H5SA 1AXBA 1DJBA 3D9YA 5JYPA 1G6OA 5EOEA 2X01A 3CJMA 2EA9A 3WWXA 1ESIA 1K4FA 2DMWA 4DRTA 1LHYA 3WS4A 3HVFA 1HTZA 4Y7PA 3QNCA 1ODVA 3A3DA 3GV9A 1YLWA 3G34A 5EVID 1RGZA 2VGJA 3LIAA 2O99A 2VGLS 4PM9A 5HW3A 1FSYA 3F1PB 3TSGA 2XSSA 2WGIA 3ZG9B 4PAUA 1BTLA 2XD5A 3BFDA 2P74A 5EPHA 1I5QA 1NRFA 4I5SA 4EW7A 4WZ5C 3MZDA 2R9XA 2HDSA 3MXRA 3UPPA 3W4QA 1IEMA 1FOFA 4EESA 2EWVA 3M2JA 4L9EA 3C4PA 5EVIB 3OOVA 2IWDA 2JHEA 3W4OA 1VEUB 1H3QA 3O86A 1SZVA 1RP5A 1KDWA 3S7PA 3RJUA 2WAFA 3BY8A 1M6KA 3QNBA 4R0QA 1ES4A 3N8RA 3IX3A 2A3UA 2HDUA 3H7WA 3VP3A 4N92A 2HJ9C 1H0MA 3KSGA 5KZHA 1F2KA 1JTDA 3B47A 2VGLM 2OLVA 3MXSA 1FSWA 3R7WA 2O0YA 4MMNA 4GZBA 2FZ0A 1VQQA 4GD8A 2BG1A 1XJ4A 2ZQ9A 4G3WA 2X02A 4B93A 2B95A 3CAXA 5M1AA 5F68A 3UB9A 3EWKA 1RGYA 1N4OA 3CMZA 4NXFA 1CK3A 3EEHA 5AVEA 1IELA
chains in the Genus database with same CATH topology
2BASA 3LR5A 1W63M 2OWHA 3S7QA 3U2AA 3LIDA 4AFIA 4IUHA 3MJQA 3TJZC 3NOTC 3IBRA 4E04A 1KOUA 1S67L 3D3OA 3MR0A 3CLOA 3E4PA 4EEPA 2Y8HA 2B18A 1N9LA 2V1BA 2QHKA 4PKYA 1MZUA 3D72A 5IU1A 4ETZA 4DJ2A 2W3FA 2XRNA 4XT2A 4G3KA 1OPXA 3T4TA 2Z6DA 2VV7A 1V9ZA 3PBTA 2A24B 4UQIS 4G3VA 2PR5A 1UWPX 1LSWA 4HJ4A 1GSXA 3OLOA 2A2LA 3IS2B 5IS1A 1VHMA 3KYZA 4QPRA 3OC2A 3KX0X 1DP9A 4BWIA 1T18A 1YKDA 2OOLA 1TS7A 1OTDA 3UMEA 3T4SA 4L0LA 1N9NA 1OT6A 2JKTI 2YKHA 5FL3A 5KIZA 1IFQA 3SW1A 3P7NA 4GJ4A 4R70A 2NUTC 2JKRM 5G4YA 2QWSA 3BQAA 3V67A 5HWVA 1F98A 2HV1A 3PBRA 2PR6A 4BBVA 4Z1WA 3BWLA 1DP6A 4PKYG 3MQQA 2P7JA 5G4ZA 2ZOHA 4FOFA 4HOIA 4IUKA 1BYWA 3NJAA 3O5YA 3PBNA 3NOUC 4Q0HA 3EQVA 4KUKA 2NUPC 4NKPA 2JKRI 4I38A 4LRXC 5EFWA 1VB6A 1W63Q 1LL8A 2WKQA 3LR0A 4Y3IA 2W1RA 1EW0A 4F3LB 1DP8A 4GHIB 2XROA 4I39A 3G6OA 3K3CA 2EWWA 2B02A 4BJPA 3F1NA 4MN6A 3OBFA 2HF6A 3GECA 2MJ6A 2XA7M 3ULFA 2PDRA 4FSFA 2H28A 5DKKA 3FG8A 1NWZA 3PYPA 4BBTA 3R7WB 1UGUA 3C30A 3KSIA 3LR4A 3EOIA 3ICYA 3E0YA 3HCYA 2QJ7A 2L1MA 1OT9A 2D02A 3DBAA 3PBQA 5DKLA 2IA2A 4CLCB 1NLYA 4YNRA 4F3LA 2W3EA 3LIEA 2J80A 3UB6A 2V0UA 1P9RA 3OCLA 4EUVA 5MC7A 3LI9A 4R6LA 1OTAA 1T19A 3H9WA 1S66L 3C2WA 3T4KA 4ZRRA 3KSHA 2O9AA 5F5YA 4WLAA 4CLCE 3FPVA 3F1OA 3GDIA 2K7SA 1F9IA 2XA7S 2LB9A 2GNXA 2K31A 2W3HA 3H82B 5J4EA 2OWJA 2J3TC 2ZMVA 4HH3A 4PHTA 4WEJA 4EERA 4WL9A 5DFXA 5LBRA 2V9AA 4KQDA 3KSFA 3B42A 4XT2B 4P6ZS 4H6JA 3FPWA 3TE8A 4LRZE 2QJ5A 2VJWA 2QYBA 4GS9B 3MQOA 4Q0IA 4L9GA 3E4OA 2Y79A 1S1YA 4CLCD 3MFXA 2P04A 2PYRA 4EXOA 4B9OA 3R4KA 2VV6A 1JNUA 4UQIM 4JGOA 3F1NB 1LSVA 4L9FA 4WELA 2L0WA 3T4LA 3VOLA 2GX5A 3HJKA 2ZOIA 2M7UA 1YSPA 3CUEA 4NXGA 4OOLA 2JKTM 3C8CA 3NHQA 2VZWA 3A0VA 3EQUA 1GSVA 3PBSA 3LI8A 4KQOA 1S4RA 3T50A 2KX6A 1T1BA 3JVUA 4NXEA 4H6JB 3CITA 5HPIA 5HSQA 4JGQA 4WUJA 3EEHA 3PR6A 4RQ9A 2L4RA 5HWWA 5J3WA 1OTBA 2GJ3A 4UEYA 3E4QA 5J7EA 1V9YA 5AVFA 1Y28A 1X0OA 4BBUA 4ETXA 3FC7A 4DJ3A 3MF0A 1ZTUA 4O0PA 2PT7A 3E98A 2YKFA 4LPZA 1ZHHB 4MDZA 1UWNX 1XFNA 4Y2FA 2QKPA 4WEKA 2PYPA 4HIAA 5HL6A 1WA9A 3KYQA 1LT0A 5F6AA 4BMWA 2M7VA 2PHYA 4MN7A 4HJ3A 1YAXA 4YOFA 4HY8A 2HGVA 2A24A 3MXQA 1N9OA 3F1OB 4CLCC 5HDSA 3UE6A 4HNBA 3RTYA 1G28A 3PHYA 3LIBA 3HJIA 5A8BA 3TRCA 3TW8A 4IHQA 2OAP1 5CX7A 5L8MA 1OTEA 3K2NA 3CWFA 4HI4A 4HH2A 1P0ZA 3MQ0A 5HZHA 2J3WA 1S1ZA 4O8GA 4GCZA 3IS2A 2P08A 2VKSA 4JGPA 5HPFA 3H82A 3LYXA 4YWZA 4CQHA 5KSHA 2R78A 1NLZA 4Y5FA 1XJ2A 5AJGA 2KOIA 3B33A 3S7OA 3A0SA 1TS6A 4R38A 2HJEA 1F5MA 4I3IA 1S4SA 3UB7A 5HD3A 1G6OA 2K2NA 3OCNA 2G7UA 4NXBA 2FH5A 2ZMFA 4LRYC 2EA9A 2DMWA 2WKRA 4MCWA 1H8MA 4KUOA 4K08A 4WN5A 2W0NA 3LUQA 4CLCA 2D01A 4MN5A 1DRMA 5HDDA 3P01A 2ZBBA 5DJTA 2V0WA 3VE3A 1STZA 2W3GA 3C38A 2V1AA 5DF9A 3LR3A 1ODVA 2JN7A 4OOMA 1GSWA 3K3DA 3VV4A 4I3JA 3LICA 2W1TA 3LIAA 4DN0A 5TBMA 2O99A 2VGLS 3UE3A 1XJ3A 3IBJA 1P97A 2VX8A 2J3TD 5HDCA 3F1PA 1IOUA 1NRJA 1LSXA 3F1PB 2PD8A 2XSSA 4HP9A 4PAUA 4GHIA 2KLIA 1P9WA 4HJ6A 5DFYA 3EGXC 2I9VA 5HD5A 1TD5A 3KO6A 2VA0A 4DMZA 4I5SA 4EW7A 2O9BA 4M4XA 3PXPA 3T4JA 3UB8A 2W27A 2OAQ1 3RH8B 3MMHA 2GZAA 2Z6CA 2W3DA 1XFQA 3ZYTA 4EESA 3ZQ5A 2VEAA 2EWVA 3CUEC 4L9EA 3EGDC 3T4QA 3H7WB 5IT5A 4HHDA 3OOVA 4O01A 3S7NA 2JHEA 5F69A 5K5BA 4Q0JA 4EQ1A 3BY9A 1H3QA 1TF1A 3S7PA 3UMDA 3JVVA 2VV8A 4P6ZM 1MC0A 4II7A 2CMNA 5DJUA 4EETB 5HWTA 3BY8A 4GS9A 4HQAA 3LFVA 1TS0A 3T4OA 3VE4A 3PBOA 3CI6A 1T1CA 3BQ8A 3BJNA 4GLQA 1D06A 3H7WA 1D7EA 1TS8A 1XJ6A 2HJ9C 4R3AA 4JGRA 2M1CA 3KSGA 2PD7A 5I5LA 3B47A 2VGLM 5C5KA 2VLGA 4I3AA 4HP4A 3EEAA 3R7WA 4GW9A 1OTIA 2O0YA 4EU0A 3RFBA 4MMNA 2O9CA 2FZ0A 4ARZA 1XJ4A 4G3WA 1YSQA 4B93A 4EEUA 1T1AA 3CAXA 2INWA 2KDKA 5TBMB 5F68A 2WKPA 4IJGA 4ME4A 3UB9A 1OJGA 3W2ZA 3BW6A 3EWKA 4NEED 5TJJA 4WF0A 1MKMA 3LIFA 4LLOB 3A0RA 2LB5A 2W1TB 4NXFA 1OJ5A 3NOPC 5AVEA 4ARZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BAS A;  1LSX A;  3F1P B;  3LI9 A;  5AVF A;  1Y28 A;  1X0O A;  2PD8 A;  4HP9 A;  2OWH A;  4GHI A;  3FC7 A;  4BBU A;  4DJ3 A;  3LID A;  2YKF A;  4HJ6 A;  3MJQ A;  4LPZ A;  3NOT C;  2I9V A;  3IBR A;  1OTA A;  1KOU A;  1T19 A;  1S66 L;  1S67 L;  3C2W A;  3H9W A;  4R6L A;  1UWN X;  3MR0 A;  3CLO A;  3E4P A;  4EEP A;  1XFN A;  5F5Y A;  4WLA A;  1N9L A;  2V1B A;  4I5S A;  2QHK A;  4EW7 A;  2QKP A;  4PKY A;  4YWZ A;  5HDC A;  2PYP A;  1MZU A;  3D72 A;  3F1O A;  3GDI A;  4HIA A;  4M4X A;  5IU1 A;  1WA9 A;  4DJ2 A;  3UB8 A;  2K7S A;  2W27 A;  4XT2 A;  1LT0 A;  3RH8 B;  5F6A A;  2Z6D A;  2VV7 A;  3UB6 A;  2Z6C A;  2PHY A;  4HJ3 A;  1XFQ A;  1V9Z A;  4HY8 A;  2A24 A;  1F9I A;  3MXQ A;  4EES A;  1N9O A;  2VEA A;  3F1O B;  3ZQ5 A;  2A24 B;  4L9E A;  5HDS A;  3UE6 A;  4HNB A;  3H7W B;  2PR5 A;  1UWP X;  5J4E A;  3H82 B;  1G28 A;  4HHD A;  1LSW A;  3RTY A;  2OWJ A;  3NOP C;  3PHY A;  1GSX A;  3OLO A;  3LIB A;  3HJI A;  3IS2 B;  4HJ4 A;  5A8B A;  5IS1 A;  2JHE A;  4HH3 A;  5F69 A;  3KX0 X;  4EER A;  4EQ1 A;  3BY9 A;  4WL9 A;  1DP9 A;  2V9A A;  4KQD A;  1T18 A;  2OOL A;  1OTE A;  1TS7 A;  1OTD A;  3CWF A;  3UME A;  3T50 A;  1N9N A;  1OT6 A;  2YKH A;  4HI4 A;  4HH2 A;  3UMD A;  4XT2 B;  5KIZ A;  3SW1 A;  1P0Z A;  3P7N A;  2VV8 A;  4R70 A;  5HZH A;  4H6J A;  2CMN A;  5DJU A;  4EET B;  5HWT A;  5G4Y A;  2QWS A;  1S1Z A;  4LRZ E;  5HWV A;  1F98 A;  2QJ5 A;  3BY8 A;  3IS2 A;  2HV1 A;  4GCZ A;  4GS9 A;  2PR6 A;  4JGP A;  4BBV A;  3BWL A;  3H82 A;  1DP6 A;  3LYX A;  4GS9 B;  4HQA A;  3MQQ A;  2P7J A;  4PKY G;  5G4Z A;  3MQO A;  1TS0 A;  4L9G A;  3E4O A;  2R78 A;  2ZOH A;  3VE4 A;  4HOI A;  1S1Y A;  1BYW A;  1XJ2 A;  3MFX A;  2PYR A;  3B33 A;  3NJA A;  4EXO A;  3A0S A;  4B9O A;  1T1C A;  3NOU C;  1D06 A;  1TS6 A;  2VV6 A;  3H7W A;  4R38 A;  4I3I A;  1S4S A;  4KUK A;  1D7E A;  4I38 A;  4LRX C;  1TS8 A;  3UB7 A;  4E04 A;  5HD3 A;  1JNU A;  5EFW A;  1VB6 A;  1LL8 A;  2WKQ A;  1XJ6 A;  4JGO A;  1EW0 A;  4JGR A;  4NXB A;  3F1N B;  2M1C A;  1DP8 A;  4GHI B;  2PD7 A;  1LSV A;  4L9F A;  5I5L A;  4I39 A;  4LRY C;  3G6O A;  3K3C A;  2EA9 A;  2B02 A;  2L0W A;  2VLG A;  2WKR A;  3VOL A;  4I3A A;  3F1N A;  4R3A A;  3HJK A;  4KUO A;  4HP4 A;  4MN6 A;  3GEC A;  2ZOI A;  4GW9 A;  1OTI A;  4K08 A;  2W0N A;  3LUQ A;  4NXG A;  4WN5 A;  2D01 A;  4MN5 A;  2PDR A;  3ULF A;  1DRM A;  5HDD A;  4F3L B;  2ZBB A;  5DJT A;  2V0W A;  3C8C A;  3VE3 A;  2H28 A;  5DKK A;  1XJ4 A;  3FG8 A;  3NHQ A;  3A0V A;  1GSV A;  1NWZ A;  3PYP A;  4BBT A;  2V1A A;  3LI8 A;  4EEU A;  1T1A A;  1S4R A;  3CAX A;  2INW A;  1UGU A;  2KDK A;  1ODV A;  2JN7 A;  2KX6 A;  2WKP A;  5F68 A;  3ICY A;  5TBM B;  1T1B A;  4NXE A;  1GSW A;  4H6J B;  2QJ7 A;  3UB9 A;  3K3D A;  2L1M A;  1OT9 A;  2D02 A;  1OJG A;  4I3J A;  5DKL A;  3EWK A;  3LIC A;  5HSQ A;  4JGQ A;  3LIA A;  4WUJ A;  4RQ9 A;  5TBM A;  2L4R A;  4F3L A;  4WF0 A;  5AVE A;  3LIF A;  4LLO B;  5J3W A;  5HWW A;  1OTB A;  1P97 A;  1XJ3 A;  2GJ3 A;  3E4Q A;  3A0R A;  5J7E A;  3LIE A;  4NXF A;  1OJ5 A;  2J80 A;  3EEH A;  3F1P A;  2V0U A;  1V9Y A;  5HD5 A; 
#chains in the Genus database with same CATH topology
 4P6B A;  2ZLY A;  3MKF A;  4IUH A;  3MJQ A;  3TJZ C;  3CHW P;  4BEN A;  3VP1 A;  3NI9 A;  2QZ6 A;  3FWL A;  1ESU A;  4PKY A;  4HBT A;  2J9O A;  1MZU A;  5KSC A;  1FR1 A;  4RA7 A;  4DJ2 A;  2XRN A;  4G3K A;  1MWU A;  1O7E A;  1ERQ A;  4X6T A;  2XF3 A;  1N9B A;  1Q2P A;  4DXB A;  4E3K A;  1UWP X;  4OPR A;  2A2L A;  3KYZ A;  1PRQ A;  3OPL A;  1OTD A;  4L0L A;  3IH8 A;  2JKT I;  4X1L A;  3SW1 A;  1LLB A;  4R70 A;  1SKO A;  5HWV A;  3S22 A;  2Z2M B;  4RX2 A;  3BWL A;  1DP6 A;  3MQQ A;  1K56 A;  1H8Z A;  2ZOH A;  4FOF A;  4HOI A;  1MWS A;  2Y2L A;  3NOU C;  2G2W A;  3EQV A;  2JKR I;  4I38 A;  3G2Z A;  5EFW A;  2HPB A;  4LV3 A;  4JXV A;  3K3C A;  4PPR A;  2WYX A;  2WUQ A;  1HZO A;  3F1N A;  5DF8 A;  4MN6 A;  2MJ6 A;  3ULF A;  2Y2J A;  5A92 A;  5FAQ A;  4FSF A;  3OPP A;  3PYP A;  4DKI A;  1GCE A;  1UGU A;  3HCY A;  3V39 A;  3Q82 A;  1LL5 A;  1O07 A;  3PBQ A;  5DKL A;  2IA2 A;  2J8Y A;  5FQ9 A;  1NLY A;  1RCJ A;  2DRW A;  5F82 A;  4EUV A;  3A3F A;  2Y55 A;  3ZG7 B;  1S66 L;  3T4K A;  3IXD A;  3DWZ A;  3VP2 A;  2O9A A;  1BSG A;  2PBD P;  4ZJ1 A;  3UPO A;  3GDI A;  5BOH A;  2K7S A;  5FAT A;  2ZC5 B;  1D1J A;  2HP5 A;  2K31 A;  3Q7V B;  5CGW A;  3FV7 A;  4BL3 A;  2W3H A;  5J4E A;  1MWR A;  1XA1 A;  4K0W A;  4WEJ A;  5JYO A;  2EFX A;  4WL9 A;  5DFX A;  5LBR A;  3VMA A;  5EE8 A;  3KSF A;  2WKE A;  4P6Z S;  1EWZ A;  4H6J A;  4S2N C;  3IX8 A;  1ACF A;  2Y2Q A;  4E6X A;  3MQO A;  4Q0I A;  3E4O A;  1SKO B;  4CLC D;  2PYR A;  3MSH A;  4EXO A;  4B9O A;  1WYC A;  3R4K A;  5F1F A;  1PWD A;  1PZO A;  4EUZ A;  3IH9 A;  1JWZ A;  4L9F A;  1E4D A;  2L0W A;  3A3E A;  3T4L A;  4YIN A;  3P09 A;  1YMS A;  4OPY A;  3HJK A;  4QU3 A;  3BEB A;  5J8X A;  2Q9N A;  3A0V A;  2WK0 A;  4KQO A;  3T50 A;  2HDQ A;  1T1B A;  4NXE A;  4WMC A;  1J3W A;  5CGX A;  2J7V A;  3CZD A;  2L4R A;  5J3W A;  1DJA A;  2GJ3 A;  5FDS A;  2EXA A;  1W8Q A;  4PM6 A;  1QME A;  3IWQ A;  2OV5 A;  4OP8 A;  4MDZ A;  2ZM2 A;  3VOY A;  3WRZ A;  4Y2F A;  2Y2M A;  2HDR A;  1ONG A;  5EM1 A;  3BRM A;  4HIA A;  5HL6 A;  4GKU A;  1JWP A;  4MN7 A;  5D3O A;  4JF5 A;  1N9O A;  4KEN B;  3UE6 A;  3RTY A;  4JBF A;  2Y2N A;  4C3Q A;  4BLM A;  4IHQ A;  2FFY A;  5CX7 A;  1OTE A;  4HI4 A;  4KZ7 A;  1P0Z A;  3MQ0 A;  5CTN A;  3DTK A;  3VSK A;  4ZDX A;  3H82 A;  1ZG4 A;  4YWZ A;  4CQH A;  4KQQ A;  4B4Z A;  1XJ2 A;  5FAO A;  2ZQA A;  5DVA A;  3I7J A;  4WZ4 A;  4MBF A;  1S4S A;  3V5M A;  2ZQD A;  1LL9 A;  1YLY A;  3WS5 A;  4GDN A;  3L7H A;  2WKR A;  4KUO A;  2ZBB A;  1PWG A;  4KG5 A;  1BUE A;  4OOM A;  1W79 A;  2XQZ A;  3GRJ A;  1L2S A;  2J3T D;  3F1P A;  4U0X A;  1IYS A;  4UHU A;  1NRJ A;  1W7F A;  4JPM A;  3DTM A;  4HJ6 A;  5HD5 A;  1TD5 A;  2UWX A;  4FCF A;  4E3J A;  4E3N A;  4DMZ A;  5EVL A;  4PM5 A;  2O9B A;  1PW8 A;  1K55 C;  4Y0U A;  1CF0 A;  3LEZ A;  2OAQ 1;  3MMH A;  1XFQ A;  3ZYT A;  3ZQ5 A;  1CEF A;  5IT5 A;  1GA9 A;  4UA7 A;  4LV0 A;  3FKV A;  4Q0J A;  4EWF A;  1TF1 A;  1K25 A;  3JVV A;  4PM7 A;  4E3I A;  4P6Z M;  1MC0 A;  4II7 A;  2CMN A;  4EET B;  3PTE A;  3UO9 A;  3FKW A;  4GS9 A;  1FCM A;  3LFV A;  3VE4 A;  4K91 A;  4X1M A;  3DTI A;  2WAE A;  3UNW A;  3DWK A;  1T1C A;  3IF6 B;  4GLQ A;  1YMX A;  5EVI A;  4JKT A;  3IF6 C;  1BLP A;  4WMC D;  4JGR A;  3QHY A;  3ZVW A;  1IYQ A;  3QP2 A;  4ZJ2 A;  5GHX A;  1YQS A;  2VLG A;  2H0Y A;  1Q2Q A;  4GW9 A;  1OTI A;  4EU0 A;  4ARZ A;  4Q8I A;  2RCX A;  1YSQ A;  1XPB A;  5TBM B;  3VP0 A;  1CI9 A;  3GR2 A;  5E2G A;  5GHY A;  5CHJ A;  2ZQ8 A;  3W2Z A;  1SHV A;  3BW6 A;  4E3L A;  1MKM A;  3LIF A;  4MBH A;  2LB5 A;  1OJ5 A;  3IXG A;  4S2N A;  4NG2 A;  5GLC A;  3LID A;  3IBR A;  1KOU A;  1S67 L;  3MR0 A;  3CLO A;  1Z6F A;  2JC7 A;  3ZGA B;  3SS5 A;  2QHK A;  3SS3 A;  1CEG A;  5IU1 A;  4XUX A;  2W3F A;  4DXC A;  4ESP A;  1OPX A;  2JKF A;  2Z6D A;  3WS0 A;  1V9Z A;  3HLF A;  2XDM A;  4ZAM A;  2PR5 A;  3DW0 A;  3OLO A;  3IS2 B;  4QPR A;  3V3S A;  2IWC A;  3W4P A;  3UDF A;  4R4R A;  1TS7 A;  3UME A;  2CC1 A;  5FL3 A;  1IFQ A;  4GJ4 A;  4RVA A;  4E3O A;  4QWO A;  2PR6 A;  3DTE A;  4X25 A;  2P7J A;  5G4Z A;  4OKP A;  5TFQ A;  1MXO A;  1BYW A;  1YM1 A;  2Y2G A;  3PBN A;  4DF6 A;  2NUP C;  5M19 A;  1LL8 A;  5CEC A;  2W1R A;  3NY4 A;  2E8J A;  2XRO A;  2Y2P A;  1FCO A;  3RXX A;  3OBF A;  2PDR A;  4JLF A;  4OLG A;  2EFU A;  5DKK A;  2JE5 A;  3V50 A;  4KZ8 A;  3EOI A;  3ICY A;  3HLE A;  4NK3 A;  4M3K A;  4EQI A;  3DBA A;  3IWO A;  5L09 A;  3NBL A;  5CHM A;  1P9R A;  4KZA A;  3OCL A;  4BD1 A;  5MC7 A;  1XA7 A;  1XGJ A;  1PIO A;  3ISG A;  4KQR A;  1OTA A;  3UDI A;  4WLA A;  3BLS A;  3BEC A;  4PMA A;  3F1O A;  3L9K A;  1AWI A;  4XUZ A;  1TVF A;  3HLG A;  1BLS A;  1F9I A;  2XFS A;  4QB8 A;  2XA7 S;  2LB9 A;  2GNX A;  3H82 B;  3T1X A;  1E3U D;  2OWJ A;  5L2F A;  5E2E A;  2J3T C;  3IWI A;  4PHT A;  5FAS A;  1G68 A;  2H0T A;  2WZZ A;  4PM8 A;  3MFD A;  4DDS A;  2BTF P;  3FPW A;  4KG6 A;  2V8F A;  4C6Y A;  2QJ5 A;  2VJW A;  1ZKJ A;  3S4X A;  4L9G A;  1NYY A;  3AGE A;  2P04 A;  3LGO A;  2E8I A;  3M6H A;  1VET A;  2QPN A;  4BD0 A;  1JNU A;  3Q07 A;  3QP5 A;  3HLW A;  5FQJ A;  4R3B A;  4WEL A;  4KZ3 A;  5CXW A;  4R23 A;  2Y59 A;  2M7U A;  4D60 A;  1YSP A;  1OME A;  1KGG A;  4Y13 A;  1VET B;  4DE0 A;  3NDG A;  4N9K A;  2KX6 A;  3MBZ A;  5AQB A;  4H6J B;  3CIT A;  3BM6 A;  1OTB A;  3E4Q A;  5FQI A;  1CQA A;  4BBU A;  3N8S A;  3FC7 A;  2PT7 A;  3E98 A;  3MKE A;  1ZHH B;  1UWN X;  5EVI C;  1XFN A;  5U47 A;  3GMW A;  4X55 A;  2BLS A;  4LV2 A;  1ALQ A;  2QKP A;  2EX2 A;  4OQG A;  2PYP A;  1WA9 A;  1JTG A;  5F6A A;  2PHY A;  1W8Y A;  1YAX A;  4MNR A;  3MXQ A;  3F1O B;  4CLC C;  3WS1 A;  1L0G A;  1K54 A;  4E3M A;  4FTX A;  1TDL A;  5HAQ A;  2OAP 1;  4HEF A;  1L0F A;  3HLC A;  4S2M A;  4JF6 A;  1S1Z A;  3E2L A;  4O8G A;  1KGE A;  2VKS A;  4JGP A;  3Q7V A;  5KSH A;  3WS2 A;  2R78 A;  1NLZ A;  3CPT A;  3OPR A;  3B33 A;  4Y0T A;  4WZ5 A;  1KE0 A;  2JBF A;  2Q0O A;  4OPQ A;  5HD3 A;  4WM9 A;  2G7U A;  3OCN A;  2ZMF A;  4LRY C;  3NUL A;  2ZQC A;  1K4E A;  1H8M A;  4K08 A;  1L0D A;  3LUQ A;  4MN5 A;  4LEN A;  3P01 A;  2V0W A;  3ITA A;  3VE3 A;  3T1R A;  3UE1 A;  4S2K A;  4OQI A;  3C38 A;  4N1X A;  2UV0 E;  2R9W A;  2Y91 A;  1GSW A;  3K3D A;  3VV4 A;  4I3J A;  3LIC A;  2W1T A;  5TBM A;  1P97 A;  3O87 A;  4U0T A;  5HDC A;  1I2S A;  1IOU A;  1YLJ A;  1LSX A;  3ZFZ A;  4GHI A;  3D4F A;  1GHI A;  2Y2I A;  5KMW A;  5DFY A;  4CPK A;  2I9V A;  1FIL A;  1Z09 A;  2VA0 A;  1MY8 A;  5GLD A;  3PXP A;  3ZHH A;  3UB8 A;  3G4P A;  4Z9Q A;  2Z6C A;  2Y2O A;  2VEA A;  3ZNY A;  3EGD C;  3H7W B;  5EM0 A;  3ZCZ A;  4HHD A;  3S7N A;  3HUN A;  2ZC7 A;  5F69 A;  3BY9 A;  1S0W A;  2V20 A;  3HUO A;  4O7D A;  2VV8 A;  3HRE A;  5DJU A;  1CJF A;  1HVB A;  4HQA A;  4IVK A;  1HD8 A;  1MBL A;  1TS0 A;  4WYY A;  5HAR A;  3CI6 A;  1D06 A;  1D7E A;  1TS8 A;  2ZMA A;  2PD7 A;  5FI6 A;  4LCL A;  4IBX A;  2EX8 A;  4GNU A;  3KYE A;  4IVI A;  4I3A A;  5CED A;  3RFB A;  1U60 A;  2O9C A;  3TG9 A;  1IKG A;  4EEU A;  1T1A A;  1GHM A;  2INW A;  2KDK A;  2WKP A;  4IJG A;  4ME4 A;  3ZVT A;  1OJG A;  2X71 A;  4NEE D;  4LLO B;  5M18 A;  2XFT A;  4DE2 A;  3A0R A;  2JKG A;  2V8C A;  2ZL1 A;  4ARZ B;  4NET A;  2BAS A;  3Q7Z A;  3U2A A;  1S6R A;  4AFI A;  3NOT C;  3G2Y A;  5HX9 A;  4E04 A;  3D3O A;  2Y8H A;  1ES5 A;  1KDS A;  3BFF A;  3D72 A;  4ETZ A;  2PU2 A;  3ZG5 A;  2VV7 A;  2ACG A;  3C5A A;  3HUM A;  4H8R A;  2PAV P;  3E2K A;  1PWC A;  2WZX A;  5F1G A;  5A90 A;  2RL3 A;  1LSW A;  4HJ4 A;  1GSX A;  1K0K A;  1VHM A;  3LCE A;  4X68 A;  1DP9 A;  1T18 A;  1YKD A;  1C3B A;  5AQ7 A;  1OT6 A;  2YKH A;  1ES2 A;  5KIZ A;  3P7N A;  3SOI A;  2NUT C;  5FI7 A;  2JKR M;  5G4Y A;  2PU4 A;  3V67 A;  4LCM A;  1F98 A;  4BBV A;  4Z1W A;  5EV0 A;  5FI2 A;  1K38 A;  3B3X A;  3NJA A;  1ERO A;  1PI5 A;  1H8Y A;  4FH4 A;  4NKP A;  2B5R A;  2VGK A;  1VB6 A;  2WKQ A;  3LR0 A;  2JCH A;  4Y3I A;  4GHI B;  4I39 A;  2DNS A;  4JXG A;  2EWW A;  3GTC A;  4BJP A;  4A5R A;  5I94 A;  2XA7 M;  3JPU A;  1YLP A;  2H28 A;  3FG8 A;  4BBT A;  3R7W B;  3FYZ A;  3KSI A;  2C5W B;  2IWB A;  3S1Y A;  2EX9 A;  2EX6 A;  2QJ7 A;  1K6S A;  4CJN A;  4P87 A;  3TOI A;  4CLC B;  4YNR A;  4F3L A;  5HFO A;  2W3E A;  3LIE A;  3VP4 A;  2J80 A;  3UB6 A;  4E6W A;  4C75 A;  4R6L A;  1M40 A;  2Z2L B;  3IF6 A;  4CLC E;  1KGF A;  3CPT B;  1MPL A;  1EI5 A;  2ZC6 B;  4RX3 A;  3PAG A;  2AVX A;  3M2K A;  3QP8 A;  1BUL A;  4HH3 A;  4S2L A;  4EER A;  5F83 A;  1FIK A;  3BLM A;  4OQ0 A;  5FEG A;  1PZP A;  2HZ5 A;  3B42 A;  4XT2 B;  2ZC4 B;  2P9V A;  4DE1 A;  3ITB A;  2EXB A;  2XH9 A;  3O3V A;  2QYB A;  3UB5 P;  4K0X A;  2Y79 A;  1JWV A;  1S1Y A;  3GSG A;  4UAA A;  3NEC A;  2ZL1 B;  4UQI M;  1K55 A;  1VM1 A;  1LSV A;  3C7U A;  1XXM A;  4N1H A;  4QY6 A;  1G5U A;  2GX5 A;  4EBL A;  2ZOI A;  1KE3 A;  3CUE A;  4OOL A;  4NXG A;  1A0K A;  3C8C A;  2Q9M A;  3NHQ A;  4JXW A;  2VZW A;  3EQU A;  3LI8 A;  4IED A;  1S4R A;  2FFF B;  3GQZ A;  1YLZ A;  5FA7 A;  5DTS A;  5HSQ A;  5HWW A;  4UEY A;  1NZO A;  2WAD A;  3ZG0 A;  1V9Y A;  3G31 A;  1Y28 A;  3N7W A;  3FZC A;  3MF0 A;  4O0P A;  2YKF A;  3G35 A;  4LPZ A;  4JF4 A;  2WGW A;  2Y2H A;  4WEK A;  1TEM A;  3NDE A;  3KYQ A;  1LT0 A;  4BMW A;  2M7V A;  4HJ3 A;  2HGV A;  3PAE A;  2A24 A;  3C4O A;  5HDS A;  2A49 A;  4HNB A;  1G28 A;  3PHY A;  3HJI A;  3BYD A;  3TRC A;  3N8L A;  4KZ6 A;  3TW8 A;  3K2N A;  1FR6 A;  4KZ9 A;  4GB7 A;  1WYB A;  1LI9 A;  5L10 A;  3VOZ A;  2J3W A;  2WGW B;  3IS2 A;  4GCZ A;  2P08 A;  3UY6 A;  3LYX A;  1JVJ A;  3QP1 A;  2KOI A;  5L07 A;  3IHB A;  3A0S A;  4ZJ3 A;  1TS6 A;  4R38 A;  5GL9 A;  3UB7 A;  4R3J A;  2K2N A;  4NXB A;  1Y54 A;  2FH5 A;  4GD6 A;  3DAV A;  4MCW A;  4MLL A;  4X69 A;  5GLB A;  1K57 C;  4WN5 A;  2W0N A;  4CLC A;  2D01 A;  1IYP A;  1DRM A;  5HDD A;  3IHA A;  5DJT A;  1FCN A;  1STZ A;  4MBK A;  4FH2 A;  1MWT A;  2W3G A;  4JXS A;  5DF9 A;  2V1A A;  3LR3 A;  1KE4 A;  2G2U A;  2JN7 A;  2WKH A;  2ZD8 A;  1SDE A;  4DN0 A;  3UE3 A;  4S2O A;  1XJ3 A;  3IBJ A;  2VX8 A;  4EV4 A;  3OPH A;  2PD8 A;  4HP9 A;  1K6R A;  3W8K A;  5EVE A;  2KLI A;  3T12 B;  1P9W A;  1ES3 A;  1Y4O A;  3EGX C;  2QMI A;  5A91 A;  5G18 A;  3KO6 A;  3GVB A;  2ZQ7 A;  5TR7 A;  2HP6 A;  4M4X A;  3T4J A;  2W27 A;  1FQG A;  1ZC2 A;  3RH8 B;  1MKI A;  2GZA A;  2W3D A;  4OPZ A;  3CUE C;  3ZDJ A;  3T4Q A;  5CRF A;  4O01 A;  1BZA A;  3M6B A;  5K5B A;  4EQ1 A;  4S2I A;  3LY3 A;  5E43 A;  5E2H A;  5CHU A;  2WKI A;  3UMD A;  4GDB A;  1XKZ A;  5HWT A;  2ZM0 A;  5EEC A;  4WBG A;  3IX4 A;  1E3U A;  1PFL A;  3T4O A;  1NY0 A;  4UA9 A;  3PBO A;  5HL1 A;  4OH0 A;  1PNE A;  3BQ8 A;  1CI8 A;  3BJN A;  4KZ4 A;  2PRF A;  3OZH A;  1L0E A;  2OSU A;  1XJ6 A;  4R3A A;  2M1C A;  5CEB A;  5I5L A;  3SH9 A;  5C5K A;  1DJC A;  4HP4 A;  3EEA A;  4Y15 A;  5HAP A;  3BFE A;  1H5X A;  2VK3 A;  2Y4A A;  4DE3 A;  1YLT A;  1K54 C;  3IF5 A;  4U3T A;  4KZB A;  4OLD A;  5EOO A;  3SS4 A;  3ZNT A;  1BLC A;  3QP6 A;  5CTM A;  5TJJ A;  4WF0 A;  3G32 A;  2W1T B;  1PYY A;  4R4S A;  3NOP C;  3LEQ A;  3LR5 A;  3IXH A;  1W63 M;  2OWH A;  3S7Q A;  3QP4 A;  3UN7 A;  3E4P A;  4EEP A;  2B18 A;  4RYE A;  2OLU A;  1N9L A;  2V1B A;  3BFG A;  3UPN A;  4ZTK A;  4Y0O A;  4XT2 A;  4IBR A;  1PW1 A;  3T4T A;  4ZBE A;  4EBP A;  3UDX A;  4D2O A;  3PBT A;  3UE0 A;  1K57 A;  4FD8 A;  2A24 B;  4UQI S;  5FQM A;  3MS6 A;  4G3V A;  1K56 D;  2GDN A;  2DCF A;  4OP5 A;  5IS1 A;  3AGD A;  3OC2 A;  3KX0 X;  1NYM A;  5FSR A;  1YT4 A;  3LO7 A;  4BWI A;  2H10 A;  2OOL A;  3T4S A;  1N9N A;  5AQA A;  1VEU A;  3CG5 A;  3VFH A;  1ERM A;  2QWS A;  3BQA A;  2HV1 A;  3PBR A;  3A3J A;  1G6A A;  4KG2 A;  2XR0 A;  4PKY G;  3MZE A;  4BQM A;  1XX2 A;  4IUK A;  5FAP A;  1IKI A;  3O5Y A;  4QY5 A;  4Q0H A;  4XXR A;  4KUK A;  2V1Z A;  4LRX C;  1BLH A;  3NC8 A;  4B88 A;  1W63 Q;  4Y17 A;  1ZG6 A;  4F3L B;  1EW0 A;  1DP8 A;  4MEZ A;  4FUW A;  3T1Q B;  3G6O A;  2B02 A;  2HF6 A;  3GEC A;  4ID4 A;  4YFM A;  1NWZ A;  1DY6 A;  3C30 A;  3LR4 A;  3LY4 A;  3E0Y A;  3IXB A;  2L1M A;  1OT9 A;  5FQK A;  2D02 A;  5FQQ A;  3MZF A;  4QHC A;  3V3R A;  2V0U A;  3LI9 A;  4EBN A;  2V2F F;  2ZM8 A;  3N6I A;  3RXW A;  4S2J A;  1T19 A;  3H9W A;  3C2W A;  4ZRR A;  3HBR A;  3KSH A;  5F5Y A;  1IYO A;  2PBY A;  2WGV A;  5HAI A;  3FPV A;  1HLU P;  4GN2 A;  3VFF A;  3JYI A;  4R1G A;  4OQH A;  3O88 A;  4LGW A;  4HES A;  5GHZ A;  1QMF A;  3VSL A;  2XLN A;  1YPR A;  5FEF A;  4QD4 A;  2C6W B;  4UA6 A;  2ZMV A;  1XP4 A;  3HLD A;  1WE4 A;  2V9A A;  4KQD A;  5DTT A;  3U4L P;  1I2W A;  3IQA A;  4X56 A;  4DDY A;  1BT5 A;  2Y2K A;  3TE8 A;  4LRZ E;  2ZJ9 A;  1SKF A;  4LFU A;  2ZC3 B;  3A3I A;  4GS9 B;  4KZ5 A;  4X53 A;  1LI0 A;  3MFX A;  2VV6 A;  2HP9 A;  4BL2 A;  1GHP A;  3SZT A;  3ZG8 B;  1GA0 A;  2XD1 A;  3HL9 A;  5GLA A;  2XEP A;  4JGO A;  3F1N B;  4LV1 A;  4N9L A;  5FDH A;  3C7V A;  3VOL A;  4P85 A;  4OVD A;  3N4I A;  2JKT M;  1XGI A;  2XGN A;  3AGF A;  4HBU A;  1GSV A;  3PBS A;  1L3L A;  1ONH A;  3JVU A;  4GOG A;  2P9V B;  1TDG A;  5HPI A;  4JGQ A;  4WUJ A;  3PR6 A;  4RQ9 A;  4B4X A;  5J7E A;  1SDN A;  2XK1 A;  5AVF A;  1X0O A;  2J9P A;  5A93 A;  5TGF A;  5E2F A;  4ETX A;  1KVM A;  3T1S A;  4DJ3 A;  1ZTU A;  4OON A;  3SH8 A;  3SH7 A;  1E25 A;  3IT9 A;  3NIA A;  3P98 A;  5EUA A;  4F94 A;  1SCW A;  3HLB A;  4YOF A;  4HY8 A;  1KVL A;  5CGS A;  2I72 A;  5DTK A;  3Q1F A;  3LIB A;  5A8B A;  1NJ4 A;  5AQ9 A;  4S2P A;  1NZU A;  5L8M A;  3G30 A;  3CWF A;  5CER A;  4HH2 A;  5IHV A;  3WRT A;  5HZH A;  3BFC A;  1NXY A;  1PI4 A;  5HPF A;  4P0M A;  3NCK A;  1W5D A;  4Y5F A;  4OOY A;  5DF7 A;  5AJG A;  3Q81 A;  1J9M A;  3S7O A;  4QJG A;  2HJE A;  1F5M A;  4I3I A;  2H5S A;  1AXB A;  1DJB A;  3D9Y A;  5JYP A;  1G6O A;  5EOE A;  2X01 A;  3CJM A;  2EA9 A;  3WWX A;  1ESI A;  1K4F A;  2DMW A;  4DRT A;  1LHY A;  3WS4 A;  3HVF A;  1HTZ A;  4Y7P A;  3QNC A;  1ODV A;  3A3D A;  3GV9 A;  1YLW A;  3G34 A;  5EVI D;  1RGZ A;  2VGJ A;  3LIA A;  2O99 A;  2VGL S;  4PM9 A;  5HW3 A;  1FSY A;  3F1P B;  3TSG A;  2XSS A;  2WGI A;  3ZG9 B;  4PAU A;  1BTL A;  2XD5 A;  3BFD A;  2P74 A;  5EPH A;  1I5Q A;  1NRF A;  4I5S A;  4EW7 A;  4WZ5 C;  3MZD A;  2R9X A;  2HDS A;  3MXR A;  3UPP A;  3W4Q A;  1IEM A;  1FOF A;  4EES A;  2EWV A;  3M2J A;  4L9E A;  3C4P A;  5EVI B;  3OOV A;  2IWD A;  2JHE A;  3W4O A;  1VEU B;  1H3Q A;  3O86 A;  1SZV A;  1RP5 A;  1KDW A;  3S7P A;  3RJU A;  2WAF A;  3BY8 A;  1M6K A;  3QNB A;  4R0Q A;  1ES4 A;  3N8R A;  3IX3 A;  2A3U A;  2HDU A;  3H7W A;  3VP3 A;  4N92 A;  2HJ9 C;  1H0M A;  3KSG A;  5KZH A;  1F2K A;  1JTD A;  3B47 A;  2VGL M;  2OLV A;  3MXS A;  1FSW A;  3R7W A;  2O0Y A;  4MMN A;  4GZB A;  2FZ0 A;  1VQQ A;  4GD8 A;  2BG1 A;  1XJ4 A;  2ZQ9 A;  4G3W A;  2X02 A;  4B93 A;  2B95 A;  3CAX A;  5M1A A;  5F68 A;  3UB9 A;  3EWK A;  1RGY A;  1N4O A;  3CMZ A;  4NXF A;  1CK3 A;  3EEH A;  5AVE A;  1IEL A; 
#chains in the Genus database with same CATH homology
 2BAS A;  3LR5 A;  1W63 M;  2OWH A;  3S7Q A;  3U2A A;  3LID A;  4AFI A;  4IUH A;  3MJQ A;  3TJZ C;  3NOT C;  3IBR A;  4E04 A;  1KOU A;  1S67 L;  3D3O A;  3MR0 A;  3CLO A;  3E4P A;  4EEP A;  2Y8H A;  2B18 A;  1N9L A;  2V1B A;  2QHK A;  4PKY A;  1MZU A;  3D72 A;  5IU1 A;  4ETZ A;  4DJ2 A;  2W3F A;  2XRN A;  4XT2 A;  4G3K A;  1OPX A;  3T4T A;  2Z6D A;  2VV7 A;  1V9Z A;  3PBT A;  2A24 B;  4UQI S;  4G3V A;  2PR5 A;  1UWP X;  1LSW A;  4HJ4 A;  1GSX A;  3OLO A;  2A2L A;  3IS2 B;  5IS1 A;  1VHM A;  3KYZ A;  4QPR A;  3OC2 A;  3KX0 X;  1DP9 A;  4BWI A;  1T18 A;  1YKD A;  2OOL A;  1TS7 A;  1OTD A;  3UME A;  3T4S A;  4L0L A;  1N9N A;  1OT6 A;  2JKT I;  2YKH A;  5FL3 A;  5KIZ A;  1IFQ A;  3SW1 A;  3P7N A;  4GJ4 A;  4R70 A;  2NUT C;  2JKR M;  5G4Y A;  2QWS A;  3BQA A;  3V67 A;  5HWV A;  1F98 A;  2HV1 A;  3PBR A;  2PR6 A;  4BBV A;  4Z1W A;  3BWL A;  1DP6 A;  4PKY G;  3MQQ A;  2P7J A;  5G4Z A;  2ZOH A;  4FOF A;  4HOI A;  4IUK A;  1BYW A;  3NJA A;  3O5Y A;  3PBN A;  3NOU C;  4Q0H A;  3EQV A;  4KUK A;  2NUP C;  4NKP A;  2JKR I;  4I38 A;  4LRX C;  5EFW A;  1VB6 A;  1W63 Q;  1LL8 A;  2WKQ A;  3LR0 A;  4Y3I A;  2W1R A;  1EW0 A;  4F3L B;  1DP8 A;  4GHI B;  2XRO A;  4I39 A;  3G6O A;  3K3C A;  2EWW A;  2B02 A;  4BJP A;  3F1N A;  4MN6 A;  3OBF A;  2HF6 A;  3GEC A;  2MJ6 A;  2XA7 M;  3ULF A;  2PDR A;  4FSF A;  2H28 A;  5DKK A;  3FG8 A;  1NWZ A;  3PYP A;  4BBT A;  3R7W B;  1UGU A;  3C30 A;  3KSI A;  3LR4 A;  3EOI A;  3ICY A;  3E0Y A;  3HCY A;  2QJ7 A;  2L1M A;  1OT9 A;  2D02 A;  3DBA A;  3PBQ A;  5DKL A;  2IA2 A;  4CLC B;  1NLY A;  4YNR A;  4F3L A;  2W3E A;  3LIE A;  2J80 A;  3UB6 A;  2V0U A;  1P9R A;  3OCL A;  4EUV A;  5MC7 A;  3LI9 A;  4R6L A;  1OTA A;  1T19 A;  3H9W A;  1S66 L;  3C2W A;  3T4K A;  4ZRR A;  3KSH A;  2O9A A;  5F5Y A;  4WLA A;  4CLC E;  3FPV A;  3F1O A;  3GDI A;  2K7S A;  1F9I A;  2XA7 S;  2LB9 A;  2GNX A;  2K31 A;  2W3H A;  3H82 B;  5J4E A;  2OWJ A;  2J3T C;  2ZMV A;  4HH3 A;  4PHT A;  4WEJ A;  4EER A;  4WL9 A;  5DFX A;  5LBR A;  2V9A A;  4KQD A;  3KSF A;  3B42 A;  4XT2 B;  4P6Z S;  4H6J A;  3FPW A;  3TE8 A;  4LRZ E;  2QJ5 A;  2VJW A;  2QYB A;  4GS9 B;  3MQO A;  4Q0I A;  4L9G A;  3E4O A;  2Y79 A;  1S1Y A;  4CLC D;  3MFX A;  2P04 A;  2PYR A;  4EXO A;  4B9O A;  3R4K A;  2VV6 A;  1JNU A;  4UQI M;  4JGO A;  3F1N B;  1LSV A;  4L9F A;  4WEL A;  2L0W A;  3T4L A;  3VOL A;  2GX5 A;  3HJK A;  2ZOI A;  2M7U A;  1YSP A;  3CUE A;  4NXG A;  4OOL A;  2JKT M;  3C8C A;  3NHQ A;  2VZW A;  3A0V A;  3EQU A;  1GSV A;  3PBS A;  3LI8 A;  4KQO A;  1S4R A;  3T50 A;  2KX6 A;  1T1B A;  3JVU A;  4NXE A;  4H6J B;  3CIT A;  5HPI A;  5HSQ A;  4JGQ A;  4WUJ A;  3EEH A;  3PR6 A;  4RQ9 A;  2L4R A;  5HWW A;  5J3W A;  1OTB A;  2GJ3 A;  4UEY A;  3E4Q A;  5J7E A;  1V9Y A;  5AVF A;  1Y28 A;  1X0O A;  4BBU A;  4ETX A;  3FC7 A;  4DJ3 A;  3MF0 A;  1ZTU A;  4O0P A;  2PT7 A;  3E98 A;  2YKF A;  4LPZ A;  1ZHH B;  4MDZ A;  1UWN X;  1XFN A;  4Y2F A;  2QKP A;  4WEK A;  2PYP A;  4HIA A;  5HL6 A;  1WA9 A;  3KYQ A;  1LT0 A;  5F6A A;  4BMW A;  2M7V A;  2PHY A;  4MN7 A;  4HJ3 A;  1YAX A;  4YOF A;  4HY8 A;  2HGV A;  2A24 A;  3MXQ A;  1N9O A;  3F1O B;  4CLC C;  5HDS A;  3UE6 A;  4HNB A;  3RTY A;  1G28 A;  3PHY A;  3LIB A;  3HJI A;  5A8B A;  3TRC A;  3TW8 A;  4IHQ A;  2OAP 1;  5CX7 A;  5L8M A;  1OTE A;  3K2N A;  3CWF A;  4HI4 A;  4HH2 A;  1P0Z A;  3MQ0 A;  5HZH A;  2J3W A;  1S1Z A;  4O8G A;  4GCZ A;  3IS2 A;  2P08 A;  2VKS A;  4JGP A;  5HPF A;  3H82 A;  3LYX A;  4YWZ A;  4CQH A;  5KSH A;  2R78 A;  1NLZ A;  4Y5F A;  1XJ2 A;  5AJG A;  2KOI A;  3B33 A;  3S7O A;  3A0S A;  1TS6 A;  4R38 A;  2HJE A;  1F5M A;  4I3I A;  1S4S A;  3UB7 A;  5HD3 A;  1G6O A;  2K2N A;  3OCN A;  2G7U A;  4NXB A;  2FH5 A;  2ZMF A;  4LRY C;  2EA9 A;  2DMW A;  2WKR A;  4MCW A;  1H8M A;  4KUO A;  4K08 A;  4WN5 A;  2W0N A;  3LUQ A;  4CLC A;  2D01 A;  4MN5 A;  1DRM A;  5HDD A;  3P01 A;  2ZBB A;  5DJT A;  2V0W A;  3VE3 A;  1STZ A;  2W3G A;  3C38 A;  2V1A A;  5DF9 A;  3LR3 A;  1ODV A;  2JN7 A;  4OOM A;  1GSW A;  3K3D A;  3VV4 A;  4I3J A;  3LIC A;  2W1T A;  3LIA A;  4DN0 A;  5TBM A;  2O99 A;  2VGL S;  3UE3 A;  1XJ3 A;  3IBJ A;  1P97 A;  2VX8 A;  2J3T D;  5HDC A;  3F1P A;  1IOU A;  1NRJ A;  1LSX A;  3F1P B;  2PD8 A;  2XSS A;  4HP9 A;  4PAU A;  4GHI A;  2KLI A;  1P9W A;  4HJ6 A;  5DFY A;  3EGX C;  2I9V A;  5HD5 A;  1TD5 A;  3KO6 A;  2VA0 A;  4DMZ A;  4I5S A;  4EW7 A;  2O9B A;  4M4X A;  3PXP A;  3T4J A;  3UB8 A;  2W27 A;  2OAQ 1;  3RH8 B;  3MMH A;  2GZA A;  2Z6C A;  2W3D A;  1XFQ A;  3ZYT A;  4EES A;  3ZQ5 A;  2VEA A;  2EWV A;  3CUE C;  4L9E A;  3EGD C;  3T4Q A;  3H7W B;  5IT5 A;  4HHD A;  3OOV A;  4O01 A;  3S7N A;  2JHE A;  5F69 A;  5K5B A;  4Q0J A;  4EQ1 A;  3BY9 A;  1H3Q A;  1TF1 A;  3S7P A;  3UMD A;  3JVV A;  2VV8 A;  4P6Z M;  1MC0 A;  4II7 A;  2CMN A;  5DJU A;  4EET B;  5HWT A;  3BY8 A;  4GS9 A;  4HQA A;  3LFV A;  1TS0 A;  3T4O A;  3VE4 A;  3PBO A;  3CI6 A;  1T1C A;  3BQ8 A;  3BJN A;  4GLQ A;  1D06 A;  3H7W A;  1D7E A;  1TS8 A;  1XJ6 A;  2HJ9 C;  4R3A A;  4JGR A;  2M1C A;  3KSG A;  2PD7 A;  5I5L A;  3B47 A;  2VGL M;  5C5K A;  2VLG A;  4I3A A;  4HP4 A;  3EEA A;  3R7W A;  4GW9 A;  1OTI A;  2O0Y A;  4EU0 A;  3RFB A;  4MMN A;  2O9C A;  2FZ0 A;  4ARZ A;  1XJ4 A;  4G3W A;  1YSQ A;  4B93 A;  4EEU A;  1T1A A;  3CAX A;  2INW A;  2KDK A;  5TBM B;  5F68 A;  2WKP A;  4IJG A;  4ME4 A;  3UB9 A;  1OJG A;  3W2Z A;  3BW6 A;  3EWK A;  4NEE D;  5TJJ A;  4WF0 A;  1MKM A;  3LIF A;  4LLO B;  3A0R A;  2LB5 A;  2W1T B;  4NXF A;  1OJ5 A;  3NOP C;  5AVE A;  4ARZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...