4HI4A

Crystal structure of the 5-coordinate ferric heme-binding pas domain of aer2 from p. aeruginosa
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
b'GSHMARIASALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDAGRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANARLGSAVQWTDRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aerotaxis transducer Aer2
molecule tags Signaling protein
source organism Pseudomonas aeruginosa
publication title Architecture of the soluble receptor Aer2 indicates an in-line mechanism for PAS and HAMP domain signaling.
pubmed doi rcsb
total genus 36
structure length 119
sequence length 119
chains with identical sequence B, D, G
ec nomenclature
pdb deposition date 2012-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hi4A00
2PD8A 4LLOB 4I39A 3ULFA 4HP4A 3VOLA 3UE6A 1VB6A 1OT9A 3B33A 1TS8A 4EESA 5KIZA 1LL8A 1N9LA 5J3WA 3F1OA 5HDDA 5F68A 4EW7A 1JNUA 1XJ4A 2H28A 1S66L 3A0VA 1S4RA 1OT6A 3E4PA 3P7NA 4HH2A 4JGRA 4JGQA 4R38A 3NJAA 2ZOIA 5HDCA 2BASA 3MR0A 1OTEA 2WKRA 2Z6DA 3K3CA 4NXFA 2VEAA 5AVFA 1P0ZA 2B02A 1LT0A 4WF0A 1T1BA 4GHIB 2M1CA 4HH3A 2YKHA 3UB8A 4L9EA 2PD7A 3LYXA 1DP8A 2PR5A 1F9IA 2ZOHA 3ZQ5A 3F1NA 4I5SA 2WKQA 4GCZA 4LRXC 3IS2A 3VE4A 4WUJA 4I3AA 2P7JA 3E4OA 2PHYA 2OOLA 2R78A 3G6OA 4DJ3A 4F3LA 1N9OA 4WN5A 1LSVA 1OTDA 3EEHA 3F1PB 5HWTA 1KOUA 1DRMA 2A24B 5AVEA 1T1AA 1TS7A 4HQAA 2QWSA 4EERA 3EWKA 1EW0A 4HIAA 4BBTA 4I3IA 4WLAA 1UGUA 1GSVA 4NXGA 2KX6A 3MQQA 5F6AA 1T19A 3LI9A 3MFXA 4HP9A 1OTIA 3CLOA 4K08A 5F69A 5TBMA 2D01A 1UWPX 3K3DA 4MN6A 2PR6A 5HZHA 3UB9A 1OTBA 1BYWA 4R3AA 2VLGA 3A0RA 4H6JB 2HV1A 5DJUA 2ZBBA 4H6JA 3UB7A 1S67L 3LI8A 3PYPA 1XJ2A 1DP6A 1GSWA 3BY9A 3NOUC 3NOPC 1T1CA 4MN5A 3LUQA 2V1AA 3H82A 3MXQA 4RQ9A 3H7WA 4GHIA 3FC7A 1XFNA 3GDIA 2PDRA 1LSWA 3FG8A 3LIEA 3HJKA 4KUOA 4NXBA 5EFWA 4KUKA 4YWZA 2V0WA 3IBRA 4HNBA 1S1ZA 3GECA 4KQDA 4PKYA 5I5LA 3UMDA 1S4SA 1WA9A 2QJ5A 4EXOA 1N9NA 2V1BA 2V9AA 3C2WA 3LICA 3UB6A 2QHKA 3A0SA 4I38A 5HWWA 1D7EA 3F1OB 3CAXA 3MQOA 1DP9A 4GS9A 2KDKA 5HD5A 3OLOA 1ODVA 3H9WA 2EA9A 1S1YA 5A8BA 3LIFA 1T18A 2K7SA 3T50A 3D72A 1OJGA 2I9VA 1X0OA 4R6LA 1LSXA 2Z6CA 3BWLA 3RH8B 4EETB 3MJQA 4NXEA 4EEUA 4F3LB 3C8CA 3SW1A 2D02A 2V0UA 4B9OA 4EEPA 4GS9B 2J80A 1XFQA 2VV7A 4L9GA 4BBVA 3NHQA 4BBUA 1G28A 5IS1A 1D06A 2A24A 4JGOA 4LPZA 5G4ZA 2CMNA 2YKFA 1OTAA 4JGPA 5J7EA 2L0WA 4PKYG 1F98A 4HJ4A 4L9FA 4WL9A 5HSQA 4I3JA 1OJ5A 2PYRA 2QKPA 2VV8A 3H7WB 4HI4A 1NWZA 4DJ2A 1P97A 5F5YA 4EQ1A 5J4EA 3LIDA 3BY8A 1XJ3A 3F1PA 4LRYC 2W27A 4XT2A 5HDSA 2L4RA 2QJ7A 3VE3A 2PYPA 3IS2B 3LIAA 3F1NB 5IU1A 5DKLA 4E04A 1TS6A 2L1MA 3HJIA 3H82B 3KX0X 4LRZE 3E4QA 3NOTC 5HWVA 2WKPA 2INWA 4HY8A 2GJ3A 3PHYA 1Y28A 3ICYA 4HJ3A 1GSXA 5DJTA 4XT2B 4M4XA 2OWJA 3UMEA 2JN7A 4GW9A 2OWHA 2VV6A 1XJ6A 1V9ZA 4HOIA 4R70A 5DKKA 4HHDA 2W0NA 3LIBA 5HD3A 1MZUA 5TBMB 3RTYA 5G4YA 4HJ6A 1TS0A 2JHEA 1V9YA 3CWFA 1UWNX
chains in the Genus database with same CATH superfamily
3M6HA 4X68A 3VV4A 3S7OA 3LR3A 2ZQAA 3Q82A 1OTEA 2Y2JA 3SH7A 1DP8A 3WRZA 3E4OA 3OPPA 4HBUA 4ETZA 4EV4A 4R3BA 4WN5A 1K38A 4GD8A 2OAQ1 2A24B 1T1AA 1MWRA 3NIAA 5EE8A 4RVAA 5F1FA 3K3DA 3OOVA 4Y7PA 4S2NA 1LLBA 3H82A 1PW8A 1XGJA 1YSPA 1EWZA 3IF6C 4ZJ1A 4MMNA 2OV5A 4EUZA 3F1OB 2EXAA 1ODVA 3PBNA 5HL6A 3T50A 3BWLA 3SH8A 2G2UA 2J80A 1ALQA 1PYYA 3BFCA 3W4PA 3QP6A 1FSYA 1QMFA 4Y13A 1CK3A 3OPRA 3C4OA 2GJ3A 3ICYA 1YQSA 3VMAA 1LI0A 2JN7A 4S2IA 3HBRA 4FSFA 3FYZA 5G4YA 4RX3A 3T4KA 3CWFA 5M19A 4YFMA 4O01A 1NY0A 4EWFA 1Q2QA 2A49A 5F68A 4PHTA 5HDCA 2XRNA 4LFUA 4HEFA 5AVFA 1P0ZA 3HREA 1PWGA 1RP5A 2V8FA 1YLYA 4LRXC 5HAIA 1SHVA 3NBLA 1ERQA 1UGUA 1ESIA 4NXGA 2B95A 5F6AA 5DFYA 4HP9A 1LL9A 4AFIA 5HZHA 1SKOA 1BULA 3ZG8B 4R4SA 3MZEA 1S67L 3BY9A 3D3OA 4WZ4A 4DDSA 4CLCD 5DTSA 5AJGA 5EFWA 3IBRA 4UA7A 4S2KA 3N7WA 3A0SA 3E2KA 1L0GA 1KGEA 4B93A 3OLOA 2Y2OA 4X55A 4IEDA 1BSGA 2I9VA 1X0OA 3MJQA 2X71A 1K57A 2XDMA 4KZ6A 3G30A 3G4PA 1NLZA 4JGOA 1BT5A 5J7EA 5FI2A 3T4OA 5FQ9A 3SS3A 4PAUA 2O9BA 3F1PA 4XT2A 1P9WA 4WBGA 3BFEA 2C5WB 3IS2B 4E04A 1TS6A 3H82B 2XA7M 3B42A 3PHYA 5EPHA 1ES5A 4FCFA 2WK0A 3IHAA 3PBSA 3UO9A 2VA0A 4KQQA 2E8JA 5I5LA 3QNCA 4HP4A 3UDIA 4H8RA 1MWTA 3B33A 1TS8A 4EESA 2B5RA 1JWZA 1N9LA 3OCNA 1ONGA 4NKPA 1HVBA 1YMSA 4ME4A 1XXMA 2B02A 5F83A 2M1CA 3M6BA 2YKHA 2ZC7A 3MF0A 4MBFA 5HW3A 4X53A 3QP2A 1PWDA 3BRMA 2Y2NA 3ZG7B 2O0YA 4UEYA 2QWSA 3EWKA 2Y91A 4PM5A 2FH5A 2G2WA 3LI9A 4GDNA 5FAQA 2QZ6A 5JYPA 2HDRA 4JF5A 4R3AA 2KOIA 2HV1A 1XJ2A 5FA7A 1T1CA 3FC7A 3S1YA 5FL3A 4OQIA 2XFSA 3UE0A 4EUVA 2ZQ8A 1QMEA 5FDSA 1IYQA 5A8BA 2ZL1A 1DY6A 3D9YA 2A2LA 3CHWP 3SS4A 1XKZA 4GS9B 2A24A 1D06A 1KVLA 1YAXA 3ISGA 3IX3A 1F98A 4HJ4A 4L9FA 1K4FA 5CEBA 3OC2A 2VV8A 3R7WB 2QJ7A 3A3DA 3ZFZA 5L2FA 2Y2IA 3FWLA 1Y28A 3DTKA 3IH8A 4BL2A 3GR2A 4JXSA 2OWHA 2VV6A 3IH9A 3JVVA 1K54C 1IELA 4KZAA 1IKIA 2WKEA 1KDWA 2WGWB 2BLSA 3A3IA 4X1MA 4QU3A 1ZC2A 3R4KA 4O8GA 4DMZA 3LR4A 3PAEA 1FQGA 3PBOA 3TOIA 5IT5A 2X02A 3ZGAB 1F9IA 1FILA 4X6TA 1M6KA 5KZHA 4OH0A 3G6OA 5BOHA 1N9OA 1K55C 2XGNA 1TDLA 2IWCA 4WLAA 3DBAA 1DJCA 5TBMA 3UB5P 1FR1A 2D01A 4FH2A 4X69A 1LI9A 4RQ9A 5HL1A 4MLLA 4NXBA 1ERMA 3C30A 4LCMA 2QJ5A 3GTCA 1D7EA 1DP9A 2KDKA 3QP5A 2JKFA 2WGWA 4F3LA 3A3FA 2Z6CA 3V3SA 4IJGA 4JF4A 3T1RA 3NHQA 4KG2A 2YKFA 4GJ4A 3WWXA 2JCHA 2WYXA 1CEGA 4DDYA 3BY8A 4LRYC 4M3KA 1KE4A 5HDSA 2V2FF 2PYPA 2R9XA 5DKLA 2IWBA 1PI5A 2XLNA 4OONA 2JKTI 4PM7A 5E2HA 4NETA 1ZKJA 4OLGA 4DN0A 3CJMA 1MZUA 2JHEA 3AGEA 2OLVA 1E4DA 4LENA 1IYPA 1JWVA 2ZL1B 5L07A 4EBNA 5DVAA 1XJ4A 3U2AA 3QP1A 1JTDA 2VKSA 2PRFA 3CG5A 4D60A 1ES3A 2FFYA 2HDSA 5CGWA 4L9EA 1L2SA 2PD7A 1BLHA 1G5UA 2PR5A 2WAEA 2ZQ7A 1XGIA 3TE8A 1W63M 5KSHA 2ZC6B 3RXWA 3G35A 2G7UA 3MFXA 3CLOA 2DRWA 1AXBA 4WZ5C 4O0PA 4X56A 3W4QA 4GN2A 1Y54A 5DJUA 4H6JB 5A90A 4OPYA 3IXHA 1YLWA 3LUQA 3KSIA 3LY4A 3GDIA 4ETXA 1Q2PA 4HNBA 4E3OA 2VGKA 1ES2A 1K54A 3BJNA 3L9KA 2K7SA 4R6LA 1O07A 2Z2LB 2CC1A 4E3MA 3CUEA 1BZAA 4LV2A 3LR0A 4Y2FA 1OJ5A 3H7WB 5J4EA 4GD6A 3P98A 1NYMA 3VSLA 3GSGA 1FCNA 2XD1A 4EQIA 3T4TA 1V9ZA 5DKKA 3ZVWA 2V1ZA 3DTMA 3KSHA 3UY6A 1UWNX 4I39A 5TFQA 3VP1A 3KSGA 4WEJA 3BYDA 3T1XA 5EM0A 1DJAA 5F82A 1KGFA 4R0QA 4NXFA 3UNWA 5EUAA 3E2LA 4C75A 2PBDP 3MS6A 2P04A 3F1NA 4I3AA 5L10A 4OKPA 3HLBA 4CPKA 3Q81A 1JTGA 2HGVA 1O7EA 4EERA 4BBTA 1Y4OA 5CX7A 3MQQA 4F94A 1JWPA 1JVJA 1FSWA 4MN6A 2PR6A 4P6ZM 5CEDA 1FR6A 3PAGA 1W79A 4BD0A 1FCOA 1TD5A 3BM6A 3C2WA 3MKEA 4KZ9A 4BQMA 1ZHHB 2V8CA 2ACGA 3D72A 4EETB 3ITAA 2PU4A 4BBVA 2WZZA 1WYCA 1BUEA 1ZG4A 2W1TB 1TVFA 5FAOA 2PU2A 1LHYA 2JKGA 4HI4A 3A3EA 3DWZA 4DJ2A 3VE3A 1EROA 2QYBA 2RL3A 3LIAA 3F1NB 2A3UA 2WKPA 2KLIA 1YSQA 4DRTA 3E0YA 3VFFA 2W0NA 1PRQA 3RTYA 1TS0A 2V20A 1K25A 2PD8A 3QNBA 4XXRA 1YMXA 1YLTA 3ZNTA 1TF1A 2IWDA 3T4LA 2PAVP 3F1OA 4EW7A 3BQ8A 1GHPA 1YLZA 4JLFA 3NDEA 1NZUA 4G3KA 4IBRA 2Z6DA 1K55A 2DNSA 4ZAMA 5L09A 4CQHA 3HLEA 1MBLA 5AQBA 3VP3A 3SH9A 4KG5A 5FQQA 4DJ3A 5CTNA 2NUTC 2HJEA 2ZMAA 1E3UD 2VJWA 4HQAA 4EBPA 4KZ7A 3OPLA 3PR6A 2Q0OA 3HLFA 4UAAA 1IOUA 1UWPX 5G18A 3UB9A 4B88A 5E43A 3V50A 2C6WB 2LB5A 3V39A 1FIKA 2ZMVA 4PKYA 2AVXA 4GDBA 3UB6A 2O9CA 1DJBA 4DE0A 1S1YA 3NC8A 3AGFA 2VGLM 1YPRA 3UN7A 4F3LB 4NXEA 3UPNA 4PMAA 4L9GA 1BLCA 3Q1FA 3WRTA 1K57C 3HLGA 2HPBA 4U3TA 1MWUA 5F5YA 1XJ3A 1PWCA 1M40A 2L4RA 1P9RA 5A91A 1ACFA 4LRZE 4NG2A 4GKUA 2HJ9C 1GCEA 2VX8A 5CHJA 3UPOA 1V9YA 3MMHA 1K4EA 4NEED 4WELA 2W3DA 3M2KA 4FTXA 5KIZA 1XP4A 2H28A 4IHQA 2MJ6A 3A0VA 5U47A 1E25A 2BTFP 1NJ4A 4U0TA 2Y59A 4HH3A 3UB8A 3QHYA 4KZBA 2R78A 5I94A 3VP2A 3F1PB 2J3TC 2J8YA 3S7NA 3HLCA 3PTEA 2KX6A 1N4OA 1T19A 4Z1WA 4ARZB 1NXYA 1OTBA 2VLGA 5HX9A 3GMWA 1KE3A 4DF6A 4R3JA 2DMWA 3LFVA 1LL5A 3H7WA 1XFNA 3G32A 1HZOA 2M7UA 1H0MA 2W3GA 4KUKA 3LY3A 2V0WA 4YWZA 3T1QB 3UMDA 4K0XA 2QHKA 1K56D 4GS9A 1BLSA 1T18A 1L0FA 2EX2A 5EVIB 4YOFA 3T1SA 4B9OA 2H0YA 4CLCA 4S2JA 3IHBA 2WKHA 1KE0A 4WL9A 4QHCA 1L0DA 2ZMFA 2JE5A 3RFBA 2PYRA 1NWZA 2EWWA 5EV0A 4E3NA 2E8IA 5CECA 3IXGA 2QPNA 3HJIA 3KX0X 1SZVA 4Y0OA 3ZG0A 1PIOA 1W7FA 2ZLYA 1K0KA 1XJ6A 5DTTA 4GLQA 4OPZA 4FD8A 2HF6A 5G4ZA 3B47A 1CI9A 5CHMA 3VOLA 4OQHA 3S22A 5CGXA 2Y2KA 3CPTB 2GDNA 1S66L 4CLCC 1S4RA 4DE1A 2ZOIA 4Y0UA 1CF0A 1MC0A 2J3WA 5GHYA 4K0WA 1YM1A 2ZC4B 4WEKA 3IX8A 3KYEA 2BG1A 2X01A 2PHYA 3EEAA 5DF9A 3K2NA 5CRFA 5EVID 2JKRI 2W1RA 2WGVA 3T4SA 1OTIA 4RX2A 3S7QA 3HUOA 1E3UA 2OLUA 4BENA 4ARZA 4X25A 1ZG6A 2RCXA 2H10A 4QPRA 4X1LA 1W8QA 5F1GA 4Y5FA 5HWWA 1YT4A 3RH8B 1LSXA 3V67A 3BLSA 2D02A 2V0UA 4E3KA 5IS1A 2PT7A 4UHUA 5L8MA 4IVKA 5HSQA 4JXVA 2ZQCA 2QKPA 3Q07A 4ZTKA 4YINA 3HVFA 3O88A 3MBZA 3NCKA 5A92A 4ZBEA 2WUQA 2Y2HA 3NOTC 3HCYA 1IKGA 1GSXA 5FEFA 2OWJA 3UMEA 4HOIA 1MXOA 3ZG5A 4UA9A 3KYQA 1K56A 4HJ6A 3G31A 2LB9A 5FAPA 3ZDJA 3HLWA 3FPVA 3MKFA 1I2SA 2BASA 4RYEA 1MKIA 1K6RA 1S6RA 5HPIA 3GVBA 4KZ3A 1T1BA 2XSSA 4JKTA 4WM9A 4CJNA 1G6OA 1K6SA 3QP4A 3EOIA 3IS2A 1MWSA 1G68A 1LSVA 3T4JA 1SKFA 4E6WA 1VM1A 4OP8A 5CGSA 3N8RA 4LV3A 4DKIA 4DE2A 3ZVTA 3DTEA 3NOUC 1GSWA 1YKDA 2UV0E 4P6ZS 1CQAA 1PNEA 1GA9A 3IF6A 2GNXA 1N9NA 2P9VA 4CLCE 2XEPA 2Q9NA 2O99A 3H9WA 2EA9A 1OMEA 2XK1A 4QB8A 4WMCD 2Y4AA 4FH4A 3CI6A 5EVEA 3WS2A 4EBLA 3D4FA 4N1XA 4GZBA 2CMNA 3HUMA 4HBTA 2WKIA 2GX5A 1EI5A 1J3WA 4EQ1A 1RGYA 3S7PA 3ZYTA 2FFFB 2O9AA 3NI9A 4S2OA 3SOIA 5KSCA 3G2YA 2Y2QA 4GW9A 4R70A 3PBTA 1XA1A 1IFQA 2ZQDA 2VGJA 1FCMA 1ONHA 4K91A 3VOYA 3ULFA 1OT9A 2OAP1 5LBRA 3DTIA 3VFHA 5D3OA 5DF7A 1D1JA 3RXXA 2J9PA 2VEAA 4MBHA 1PFLA 3IXDA 5TGFA 3OCLA 4GHIB 2XD5A 3NDGA 4N92A 4DXBA 2EX9A 3MXRA 2WKQA 3VE4A 3LGOA 2P7JA 2J9OA 3EEHA 1KOUA 3VP4A 1KGGA 4UQIM 5FSRA 3ZHHA 3LO7A 2ZBBA 3PYPA 5HAPA 1DP6A 3IWQA 3FKVA 4OOYA 2I72A 1U60A 2PBYA 3HJKA 3FKWA 4Y15A 3N4IA 3LICA 2V1BA 4WYYA 1VEUB 4OLDA 4G3VA 4CLCB 2ZC3B 1AWIA 1STZA 3OZHA 2JKRM 1IYSA 2Q9MA 5EVIA 4QY6A 3VP0A 4P85A 4EEPA 1G28A 5HFOA 4P0MA 4DXCA 4JGPA 4S2PA 4MDZA 4Q0IA 1G6AA 4PKYG 2NUPC 2IA2A 4OVDA 3MXSA 2W27A 3BFDA 2WAFA 1A0KA 1L3LA 1H8MA 3VSKA 1YLPA 3E4QA 5FQMA 4HY8A 4Q0JA 2HDQA 5C5KA 4XT2B 3GV9A 2ZM2A 1ZTUA 2P08A 4R23A 4HHDA 2HP5A 2EX6A 1RCJA 3EGDC 4B4ZA 1W8YA 4FOFA 3C4PA 3UDFA 3TRCA 1NRJA 1JNUA 2HP9A 4UA6A 1OT6A 2Y2PA 2ZM8A 4JGRA 3TG9A 3MR0A 2WKRA 1GA0A 4XUZA 4BWIA 3PXPA 4Y17A 5CXWA 4ZJ3A 3LYXA 3HUNA 3MSHA 4GB7A 3BFFA 4GCZA 1I2WA 4EU0A 3B3XA 5EOOA 5HAQA 1OTDA 5AVEA 3UE3A 3EQUA 1IYOA 3IF5A 4OP5A 4S2MA 4MCWA 5GHXA 3JYIA 3IXBA 2JKTM 4II7A 4B4XA 4BLMA 1XPBA 3C7UA 3LEZA 5GLCA 1HLUP 2V9AA 4N1HA 3Q7ZA 4PPRA 3CAXA 5FDHA 5CHUA 1OJGA 3SW1A 4LCLA 1XFQA 3O5YA 1ESUA 3IT9A 3ZG9B 4I3JA 3V5MA 5FQJA 2QMIA 5FQIA 3MZDA 3ZNYA 3T12B 2WZXA 4NK3A 2XROA 4ZJ2A 3NY4A 3R7WA 4QY5A 4JBFA 4MBKA 4BMWA 1H8YA 4JXGA 5CERA 4MNRA 4ZRRA 4E6XA 5J3WA 4MN7A 1SDEA 1VQQA 3FZCA 4O7DA 4UQIS 5TJJA 4Q8IA 2JBFA 3U4LP 1XX2A 5GHZA 4C6YA 5EM1A 2GZAA 4GOGA 2OOLA 3P09A 4Y3IA 3C38A 1TS7A 1PI4A 4I3IA 3BEBA 1GSVA 4YNRA 5FQKA 2VK3A 3MQ0A 1I5QA 1NLYA 3IF6B 3G34A 4MN5A 4GHIA 3FG8A 1LSWA 3TSGA 4KUOA 3WS5A 1S1ZA 3O3VA 1S4SA 1WA9A 2W3EA 4I38A 5HARA 3OBFA 3MQOA 4KQRA 3KYZA 5GL9A 4LV1A 3LIFA 5AQAA 2EXBA 3C8CA 3JVUA 3UDXA 4RA7A 2L0WA 1BLPA 3SZTA 2ZM0A 1P97A 3BW6A 3LIDA 4HESA 3PBRA 3W2ZA 3NULA 4Q0HA 4HJ3A 3UPPA 3JPUA 1CI8A 5EVLA 3IWOA 2B18A 2P74A 4G3WA 1N9BA 2XA7S 1ES4A 1H5XA 1MPLA 3KO6A 4WMCA 5HDDA 3P7NA 2EFXA 3VOZA 2ZD8A 1CEFA 3TW8A 5AQ7A 1LT0A 4FUWA 3MZFA 5FI7A 4QWOA 3KSFA 3IX4A 3L7HA 4I5SA 2Y8HA 2WADA 1VETB 3EQVA 3V3RA 1SCWA 1SKOB 2W1TA 1MY8A 4OPQA 1RGZA 2Z2MB 1EW0A 4DE3A 3I7JA 3FPWA 1XA7A 2HDUA 1HD8A 5F69A 3M2JA 3GQZA 4OPRA 1Z09A 1BYWA 3ITBA 4WZ5A 4LGWA 3A0RA 3LCEA 4H6JA 1GHIA 5EECA 3LI8A 3OPHA 1NRFA 3MXQA 3DW0A 3LEQA 4BL3A 3E98A 2PDRA 4IBXA 2ZC5B 2EFUA 3WS4A 4R4RA 4EXOA 3C5AA 1NZOA 4E3JA 4Z9QA 2HP6A 4XUXA 1YLJA 3T4QA 4PM9A 5K5BA 5A93A 4N9KA 4OOMA 1H8ZA 2VV7A 4BBUA 1WYBA 2W3HA 5IHVA 4QD4A 1OPXA 1NYYA 5FATA 4KENB 4PM6A 1PZOA 3PBQA 3O87A 1J9MA 1H3QA 1HTZA 3N8SA 4C3QA 5IU1A 2XR0A 5GLAA 4A5RA 5HWVA 2INWA 4M4XA 2FZ0A 5MC7A 5HD3A 4OOLA 4ID4A 4D2OA 3BECA 4BJPA 3UE6A 2K31A 2Y2MA 1VEUA 4HH2A 4JPMA 3CUEC 3NJAA 4GNUA 3EGXC 3W8KA 3K3CA 3IBJA 2VZWA 3HL9A 4WUJA 3P01A 1F5MA 2J7VA 1GHMA 3SS5A 4E3LA 4HIAA 2OSUA 1FOFA 4K08A 4ESPA 4E3IA 5E2GA 3FV7A 1CJFA 3NOPC 2V1AA 5M18A 1IEMA 3DWKA 1C3BA 1PW1A 3S4XA 5HPFA 2Y55A 5EOEA 5AQ9A 4LV0A 3DAVA 3CPTA 5KMWA 1L0EA 3N6IA 2H0TA 5E2FA 2Y79A 4MEZA 5DF8A 4IVIA 3TJZC 5M1AA 4QJGA 1OTAA 3LR5A 1KDSA 4Y0TA 3A3JA 3NECA 5J8XA 1W5DA 3RJUA 3ZCZA 2UWXA 2ZQ9A 2HZ5A 1PZPA 4BD1A 2L1MA 4KZ5A 4P6BA 4KG6A 5DJTA 3CITA 3CZDA 3HLDA 2M7VA 3LIBA 5TBMB 2H5SA 1BTLA 4LLOB 1VB6A 5E2EA 5GLBA 3N8LA 1LL8A 2P9VB 5JYOA 4KZ8A 3MFDA 3E4PA 3W4OA 4R38A 4JGQA 3Q7VB 4S2NC 3BQAA 2Y2LA 2XFTA 4WF0A 1VHMA 3WS1A 4KQOA 4N9LA 2ZOHA 3ZQ5A 3UE1A 5DTKA 4IUHA 2Y2GA 2XF3A 3BFGA 5HWTA 1DRMA 2EX8A 2DCFA 5FEGA 4R1GA 3C7VA 2JC7A 1MKMA 3QP8A 5FI6A 3CMZA 2XH9A 2R9WA 5DFXA 3UB7A 5FASA 2XQZA 1VETA 3G2ZA 5GLDA 2J3TD 3LIEA 4U0XA 4OQ0A 4JF6A 3IWIA 3GECA 4KQDA 1KVMA 1F2KA 1WE4A 2WGIA 5TR7A 1TEMA 3Q7VA 5HD5A 4EEUA 1Z6FA 2K2NA 4JXWA 2ZJ9A 4S2LA 4ZDXA 5CTMA 3WS0A 4LPZA 1TDGA 4L0LA 3GRJA 5EVIC 4KZ4A 4IUKA 3AGDA 2EWVA 2VGLS 2W3FA 3O86A 4P87A 1SDNA 4PM8A 3BLMA 3IQAA 1S0WA 4OQGA 1W63Q
chains in the Genus database with same CATH topology
3B47A 3VOLA 3VV4A 3S7OA 3LR3A 4ZRRA 5J3WA 1XJ4A 1S66L 3U2AA 1S4RA 4MN7A 4CLCC 2ZOIA 1MC0A 1OTEA 2J3WA 4UQIS 2VKSA 5TJJA 4L9EA 2PD7A 4WEKA 1DP8A 2PR5A 2GZAA 3E4OA 2PHYA 2OOLA 3TE8A 3EEAA 5DF9A 4ETZA 4Y3IA 3K2NA 4WN5A 1W63M 2OAQ1 2A24B 3C38A 5KSHA 1T1AA 1TS7A 2JKRI 4I3IA 2G7UA 2W1RA 1GSVA 4YNRA 3T4SA 3MFXA 1OTIA 3CLOA 3K3DA 3MQ0A 4O0PA 3OOVA 3S7QA 1NLYA 5DJUA 4H6JB 4MN5A 3LUQA 3H82A 3KSIA 4GHIA 4ARZA 3GDIA 3FG8A 1LSWA 1YSPA 4KUOA 4ETXA 4HNBA 4QPRA 1S1ZA 1S4SA 1WA9A 4MMNA 2W3EA 4I38A 4Y5FA 5HWWA 3F1OB 3OBFA 3MQOA 1ODVA 3PBNA 3KYZA 5HL6A 3BJNA 3LIFA 2K7SA 3T50A 3RH8B 4R6LA 1LSXA 3V67A 3BWLA 3C8CA 3JVUA 2D02A 2V0UA 3CUEA 2J80A 5IS1A 2PT7A 3LR0A 5L8MA 2L0WA 5HSQA 4Y2FA 1OJ5A 2QKPA 3H7WB 1P97A 5J4EA 3BW6A 3LIDA 3PBRA 3NOTC 3W2ZA 4Q0HA 2GJ3A 4HJ3A 3ICYA 3HCYA 1GSXA 3T4TA 2OWJA 3UMEA 2JN7A 4HOIA 1V9ZA 5DKKA 4FSFA 3KYQA 2B18A 5G4YA 3KSHA 4G3WA 4HJ6A 3T4KA 3CWFA 1UWNX 2XA7S 2LB9A 4I39A 3KSGA 4O01A 3KO6A 3FPVA 4WEJA 5HDDA 5F68A 4PHTA 3P7NA 2XRNA 5HDCA 2BASA 4NXFA 5AVFA 1P0ZA 3TW8A 5HPIA 1LT0A 1T1BA 3KSFA 2XSSA 1G6OA 2P04A 3F1NA 4I5SA 3EOIA 4LRXC 2Y8HA 3IS2A 4I3AA 3EQVA 1LSVA 2HGVA 2W1TA 3T4JA 4EERA 1EW0A 4BBTA 1UGUA 4NXGA 5CX7A 3FPWA 3MQQA 5F6AA 5DFYA 4HP9A 5F69A 4AFIA 4MN6A 2PR6A 5HZHA 1BYWA 4P6ZM 3A0RA 4H6JA 1S67L 3LI8A 3NOUC 1GSWA 1YKDA 3BY9A 4P6ZS 3D3OA 3MXQA 4CLCD 3E98A 2PDRA 5AJGA 5EFWA 3IBRA 2GNXA 4EXOA 1N9NA 3C2WA 1TD5A 4CLCE 3A0SA 2O99A 4B93A 3OLOA 3H9WA 2EA9A 1ZHHB 3D72A 2I9VA 1X0OA 3T4QA 4EETB 3MJQA 5K5BA 4OOMA 4BBVA 2VV7A 3CI6A 1NLZA 4BBUA 2W3HA 2W1TB 4JGOA 1OPXA 2CMNA 5J7EA 3T4OA 2GX5A 4PAUA 4HI4A 4DJ2A 4EQ1A 2O9BA 3PBQA 3F1PA 4XT2A 1P9WA 3S7PA 3VE3A 2QYBA 1H3QA 3IS2B 3LIAA 3ZYTA 3F1NB 5IU1A 2O9AA 4E04A 1TS6A 3H82B 5HWVA 2XA7M 3B42A 2WKPA 2INWA 2KLIA 3PHYA 1YSQA 4M4XA 2FZ0A 3E0YA 4GW9A 4R70A 5MC7A 3PBTA 3PBSA 2W0NA 5HD3A 1IFQA 3RTYA 4OOLA 2VA0A 1TS0A 5I5LA 2PD8A 3ULFA 4HP4A 4BJPA 3UE6A 2K31A 1TF1A 1OT9A 3B33A 1TS8A 4EESA 2OAP1 5LBRA 1N9LA 3OCNA 3T4LA 3F1OA 4EW7A 4NKPA 3BQ8A 4HH2A 4ME4A 3CUEC 3NJAA 3EGXC 4G3KA 3K3CA 2Z6DA 3IBJA 2VEAA 2B02A 2VZWA 3OCLA 4GHIB 2M1CA 2YKHA 4CQHA 3MF0A 2WKQA 3VE4A 4WUJA 3P01A 2P7JA 4DJ3A 2NUTC 3EEHA 1F5MA 1KOUA 2HJEA 4BMWA 2O0YA 4UEYA 2VJWA 4HQAA 2QWSA 3EWKA 4HIAA 4UQIM 3PR6A 2FH5A 3LI9A 4K08A 1IOUA 1UWPX 3UB9A 4R3AA 2KOIA 2HV1A 2ZBBA 3PYPA 1XJ2A 1DP6A 3NOPC 1T1CA 2LB5A 2V1AA 3FC7A 3HJKA 2ZMVA 5FL3A 5HPFA 4PKYA 3LICA 2V1BA 2O9CA 3UB6A 4EUVA 1S1YA 4G3VA 5A8BA 4CLCB 2A2LA 2VGLM 4F3LB 1STZA 4NXEA 2JKRM 2Y79A 4EEPA 4GS9B 4L9GA 3TJZC 1G28A 1D06A 2A24A 1YAXA 4JGPA 1OTAA 4MDZA 4Q0IA 3LR5A 4PKYG 1F98A 4HJ4A 4L9FA 2NUPC 2IA2A 3OC2A 2VV8A 5F5YA 3R7WB 1XJ3A 2W27A 2L4RA 2QJ7A 1P9RA 2L1MA 1H8MA 4LRZE 3E4QA 4HY8A 4Q0JA 1Y28A 2HJ9C 5DJTA 5C5KA 4XT2B 3CITA 1ZTUA 2OWHA 2VV6A 2P08A 3JVVA 2VX8A 4HHDA 2M7VA 3LIBA 5TBMB 1V9YA 3EGDC 4LLOB 3MMHA 1VB6A 4NEED 2W3DA 4WELA 5KIZA 4FOFA 1LL8A 3TRCA 1NRJA 1JNUA 2H28A 3A0VA 2MJ6A 4IHQA 1OT6A 3E4PA 4R38A 4JGRA 3R4KA 4JGQA 4O8GA 4DMZA 3MR0A 2WKRA 3BQAA 3LR4A 4WF0A 1VHMA 3PBOA 4BWIA 4HH3A 3PXPA 3UB8A 3LYXA 5IT5A 4KQOA 1F9IA 2ZOHA 3ZQ5A 4GCZA 4EU0A 4IUHA 2R78A 3G6OA 1N9OA 5HWTA 1OTDA 3F1PB 2J3TC 1DRMA 3S7NA 5AVEA 4WLAA 2KX6A 3DBAA 1T19A 5TBMA 3UE3A 1MKMA 4Z1WA 3EQUA 2D01A 4ARZB 1OTBA 2VLGA 5DFXA 3UB7A 4MCWA 2DMWA 3LFVA 4RQ9A 3H7WA 2JKTM 1XFNA 2J3TD 3LIEA 4II7A 2M7UA 4NXBA 2W3GA 4KUKA 4YWZA 2V0WA 3C30A 3GECA 4KQDA 3UMDA 2QJ5A 2V9AA 2QHKA 1D7EA 3CAXA 4GS9A 1DP9A 2KDKA 5HD5A 1T18A 4F3LA 1OJGA 4EEUA 2Z6CA 3SW1A 4IJGA 4YOFA 2K2NA 4B9OA 1XFQA 3O5YA 3NHQA 4CLCA 4LPZA 4L0LA 2YKFA 4GJ4A 4WL9A 2ZMFA 4I3JA 3RFBA 2PYRA 1NWZA 2EWWA 3BY8A 4LRYC 5HDSA 4IUKA 2PYPA 2EWVA 2VGLS 5DKLA 2W3FA 3HJIA 3KX0X 2XROA 2JKTI 3R7WA 1XJ6A 4DN0A 4GLQA 1MZUA 1W63Q 2JHEA 2HF6A 5G4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PD8 A;  4LLO B;  4I39 A;  3ULF A;  4HP4 A;  3VOL A;  3UE6 A;  1VB6 A;  1OT9 A;  3B33 A;  1TS8 A;  4EES A;  5KIZ A;  1LL8 A;  1N9L A;  5J3W A;  3F1O A;  5HDD A;  5F68 A;  4EW7 A;  1JNU A;  1XJ4 A;  2H28 A;  1S66 L;  3A0V A;  1S4R A;  1OT6 A;  3E4P A;  3P7N A;  4HH2 A;  4JGR A;  4JGQ A;  4R38 A;  3NJA A;  2ZOI A;  5HDC A;  2BAS A;  3MR0 A;  1OTE A;  2WKR A;  2Z6D A;  3K3C A;  4NXF A;  2VEA A;  5AVF A;  1P0Z A;  2B02 A;  1LT0 A;  4WF0 A;  1T1B A;  4GHI B;  2M1C A;  4HH3 A;  2YKH A;  3UB8 A;  4L9E A;  2PD7 A;  3LYX A;  1DP8 A;  2PR5 A;  1F9I A;  2ZOH A;  3ZQ5 A;  3F1N A;  4I5S A;  2WKQ A;  4GCZ A;  4LRX C;  3IS2 A;  3VE4 A;  4WUJ A;  4I3A A;  2P7J A;  3E4O A;  2PHY A;  2OOL A;  2R78 A;  3G6O A;  4DJ3 A;  4F3L A;  1N9O A;  4WN5 A;  1LSV A;  1OTD A;  3EEH A;  3F1P B;  5HWT A;  1KOU A;  1DRM A;  2A24 B;  5AVE A;  1T1A A;  1TS7 A;  4HQA A;  2QWS A;  4EER A;  3EWK A;  1EW0 A;  4HIA A;  4BBT A;  4I3I A;  4WLA A;  1UGU A;  1GSV A;  4NXG A;  2KX6 A;  3MQQ A;  5F6A A;  1T19 A;  3LI9 A;  3MFX A;  4HP9 A;  1OTI A;  3CLO A;  4K08 A;  5F69 A;  5TBM A;  2D01 A;  1UWP X;  3K3D A;  4MN6 A;  2PR6 A;  5HZH A;  3UB9 A;  1OTB A;  1BYW A;  4R3A A;  2VLG A;  3A0R A;  4H6J B;  2HV1 A;  5DJU A;  2ZBB A;  4H6J A;  3UB7 A;  1S67 L;  3LI8 A;  3PYP A;  1XJ2 A;  1DP6 A;  1GSW A;  3BY9 A;  3NOU C;  3NOP C;  1T1C A;  4MN5 A;  3LUQ A;  2V1A A;  3H82 A;  3MXQ A;  4RQ9 A;  3H7W A;  4GHI A;  3FC7 A;  1XFN A;  3GDI A;  2PDR A;  1LSW A;  3FG8 A;  3LIE A;  3HJK A;  4KUO A;  4NXB A;  5EFW A;  4KUK A;  4YWZ A;  2V0W A;  3IBR A;  4HNB A;  1S1Z A;  3GEC A;  4KQD A;  4PKY A;  5I5L A;  3UMD A;  1S4S A;  1WA9 A;  2QJ5 A;  4EXO A;  1N9N A;  2V1B A;  2V9A A;  3C2W A;  3LIC A;  3UB6 A;  2QHK A;  3A0S A;  4I38 A;  5HWW A;  1D7E A;  3F1O B;  3CAX A;  3MQO A;  1DP9 A;  4GS9 A;  2KDK A;  5HD5 A;  3OLO A;  1ODV A;  3H9W A;  2EA9 A;  1S1Y A;  5A8B A;  3LIF A;  1T18 A;  2K7S A;  3T50 A;  3D72 A;  1OJG A;  2I9V A;  1X0O A;  4R6L A;  1LSX A;  2Z6C A;  3BWL A;  3RH8 B;  4EET B;  3MJQ A;  4NXE A;  4EEU A;  4F3L B;  3C8C A;  3SW1 A;  2D02 A;  2V0U A;  4B9O A;  4EEP A;  4GS9 B;  2J80 A;  1XFQ A;  2VV7 A;  4L9G A;  4BBV A;  3NHQ A;  4BBU A;  1G28 A;  5IS1 A;  1D06 A;  2A24 A;  4JGO A;  4LPZ A;  5G4Z A;  2CMN A;  2YKF A;  1OTA A;  4JGP A;  5J7E A;  2L0W A;  4PKY G;  1F98 A;  4HJ4 A;  4L9F A;  4WL9 A;  5HSQ A;  4I3J A;  1OJ5 A;  2PYR A;  2QKP A;  2VV8 A;  3H7W B;  4HI4 A;  1NWZ A;  4DJ2 A;  1P97 A;  5F5Y A;  4EQ1 A;  5J4E A;  3LID A;  3BY8 A;  1XJ3 A;  3F1P A;  4LRY C;  2W27 A;  4XT2 A;  5HDS A;  2L4R A;  2QJ7 A;  3VE3 A;  2PYP A;  3IS2 B;  3LIA A;  3F1N B;  5IU1 A;  5DKL A;  4E04 A;  1TS6 A;  2L1M A;  3HJI A;  3H82 B;  3KX0 X;  4LRZ E;  3E4Q A;  3NOT C;  5HWV A;  2WKP A;  2INW A;  4HY8 A;  2GJ3 A;  3PHY A;  1Y28 A;  3ICY A;  4HJ3 A;  1GSX A;  5DJT A;  4XT2 B;  4M4X A;  2OWJ A;  3UME A;  2JN7 A;  4GW9 A;  2OWH A;  2VV6 A;  1XJ6 A;  1V9Z A;  4HOI A;  4R70 A;  5DKK A;  4HHD A;  2W0N A;  3LIB A;  5HD3 A;  1MZU A;  5TBM B;  3RTY A;  5G4Y A;  4HJ6 A;  1TS0 A;  2JHE A;  1V9Y A;  3CWF A;  1UWN X; 
#chains in the Genus database with same CATH topology
 3M6H A;  4X68 A;  3VV4 A;  3S7O A;  3LR3 A;  2ZQA A;  3Q82 A;  1OTE A;  2Y2J A;  3SH7 A;  1DP8 A;  3WRZ A;  3E4O A;  3OPP A;  4HBU A;  4ETZ A;  4EV4 A;  4R3B A;  4WN5 A;  1K38 A;  4GD8 A;  2OAQ 1;  2A24 B;  1T1A A;  1MWR A;  3NIA A;  5EE8 A;  4RVA A;  5F1F A;  3K3D A;  3OOV A;  4Y7P A;  4S2N A;  1LLB A;  3H82 A;  1PW8 A;  1XGJ A;  1YSP A;  1EWZ A;  3IF6 C;  4ZJ1 A;  4MMN A;  2OV5 A;  4EUZ A;  3F1O B;  2EXA A;  1ODV A;  3PBN A;  5HL6 A;  3T50 A;  3BWL A;  3SH8 A;  2G2U A;  2J80 A;  1ALQ A;  1PYY A;  3BFC A;  3W4P A;  3QP6 A;  1FSY A;  1QMF A;  4Y13 A;  1CK3 A;  3OPR A;  3C4O A;  2GJ3 A;  3ICY A;  1YQS A;  3VMA A;  1LI0 A;  2JN7 A;  4S2I A;  3HBR A;  4FSF A;  3FYZ A;  5G4Y A;  4RX3 A;  3T4K A;  3CWF A;  5M19 A;  4YFM A;  4O01 A;  1NY0 A;  4EWF A;  1Q2Q A;  2A49 A;  5F68 A;  4PHT A;  5HDC A;  2XRN A;  4LFU A;  4HEF A;  5AVF A;  1P0Z A;  3HRE A;  1PWG A;  1RP5 A;  2V8F A;  1YLY A;  4LRX C;  5HAI A;  1SHV A;  3NBL A;  1ERQ A;  1UGU A;  1ESI A;  4NXG A;  2B95 A;  5F6A A;  5DFY A;  4HP9 A;  1LL9 A;  4AFI A;  5HZH A;  1SKO A;  1BUL A;  3ZG8 B;  4R4S A;  3MZE A;  1S67 L;  3BY9 A;  3D3O A;  4WZ4 A;  4DDS A;  4CLC D;  5DTS A;  5AJG A;  5EFW A;  3IBR A;  4UA7 A;  4S2K A;  3N7W A;  3A0S A;  3E2K A;  1L0G A;  1KGE A;  4B93 A;  3OLO A;  2Y2O A;  4X55 A;  4IED A;  1BSG A;  2I9V A;  1X0O A;  3MJQ A;  2X71 A;  1K57 A;  2XDM A;  4KZ6 A;  3G30 A;  3G4P A;  1NLZ A;  4JGO A;  1BT5 A;  5J7E A;  5FI2 A;  3T4O A;  5FQ9 A;  3SS3 A;  4PAU A;  2O9B A;  3F1P A;  4XT2 A;  1P9W A;  4WBG A;  3BFE A;  2C5W B;  3IS2 B;  4E04 A;  1TS6 A;  3H82 B;  2XA7 M;  3B42 A;  3PHY A;  5EPH A;  1ES5 A;  4FCF A;  2WK0 A;  3IHA A;  3PBS A;  3UO9 A;  2VA0 A;  4KQQ A;  2E8J A;  5I5L A;  3QNC A;  4HP4 A;  3UDI A;  4H8R A;  1MWT A;  3B33 A;  1TS8 A;  4EES A;  2B5R A;  1JWZ A;  1N9L A;  3OCN A;  1ONG A;  4NKP A;  1HVB A;  1YMS A;  4ME4 A;  1XXM A;  2B02 A;  5F83 A;  2M1C A;  3M6B A;  2YKH A;  2ZC7 A;  3MF0 A;  4MBF A;  5HW3 A;  4X53 A;  3QP2 A;  1PWD A;  3BRM A;  2Y2N A;  3ZG7 B;  2O0Y A;  4UEY A;  2QWS A;  3EWK A;  2Y91 A;  4PM5 A;  2FH5 A;  2G2W A;  3LI9 A;  4GDN A;  5FAQ A;  2QZ6 A;  5JYP A;  2HDR A;  4JF5 A;  4R3A A;  2KOI A;  2HV1 A;  1XJ2 A;  5FA7 A;  1T1C A;  3FC7 A;  3S1Y A;  5FL3 A;  4OQI A;  2XFS A;  3UE0 A;  4EUV A;  2ZQ8 A;  1QME A;  5FDS A;  1IYQ A;  5A8B A;  2ZL1 A;  1DY6 A;  3D9Y A;  2A2L A;  3CHW P;  3SS4 A;  1XKZ A;  4GS9 B;  2A24 A;  1D06 A;  1KVL A;  1YAX A;  3ISG A;  3IX3 A;  1F98 A;  4HJ4 A;  4L9F A;  1K4F A;  5CEB A;  3OC2 A;  2VV8 A;  3R7W B;  2QJ7 A;  3A3D A;  3ZFZ A;  5L2F A;  2Y2I A;  3FWL A;  1Y28 A;  3DTK A;  3IH8 A;  4BL2 A;  3GR2 A;  4JXS A;  2OWH A;  2VV6 A;  3IH9 A;  3JVV A;  1K54 C;  1IEL A;  4KZA A;  1IKI A;  2WKE A;  1KDW A;  2WGW B;  2BLS A;  3A3I A;  4X1M A;  4QU3 A;  1ZC2 A;  3R4K A;  4O8G A;  4DMZ A;  3LR4 A;  3PAE A;  1FQG A;  3PBO A;  3TOI A;  5IT5 A;  2X02 A;  3ZGA B;  1F9I A;  1FIL A;  4X6T A;  1M6K A;  5KZH A;  4OH0 A;  3G6O A;  5BOH A;  1N9O A;  1K55 C;  2XGN A;  1TDL A;  2IWC A;  4WLA A;  3DBA A;  1DJC A;  5TBM A;  3UB5 P;  1FR1 A;  2D01 A;  4FH2 A;  4X69 A;  1LI9 A;  4RQ9 A;  5HL1 A;  4MLL A;  4NXB A;  1ERM A;  3C30 A;  4LCM A;  2QJ5 A;  3GTC A;  1D7E A;  1DP9 A;  2KDK A;  3QP5 A;  2JKF A;  2WGW A;  4F3L A;  3A3F A;  2Z6C A;  3V3S A;  4IJG A;  4JF4 A;  3T1R A;  3NHQ A;  4KG2 A;  2YKF A;  4GJ4 A;  3WWX A;  2JCH A;  2WYX A;  1CEG A;  4DDY A;  3BY8 A;  4LRY C;  4M3K A;  1KE4 A;  5HDS A;  2V2F F;  2PYP A;  2R9X A;  5DKL A;  2IWB A;  1PI5 A;  2XLN A;  4OON A;  2JKT I;  4PM7 A;  5E2H A;  4NET A;  1ZKJ A;  4OLG A;  4DN0 A;  3CJM A;  1MZU A;  2JHE A;  3AGE A;  2OLV A;  1E4D A;  4LEN A;  1IYP A;  1JWV A;  2ZL1 B;  5L07 A;  4EBN A;  5DVA A;  1XJ4 A;  3U2A A;  3QP1 A;  1JTD A;  2VKS A;  2PRF A;  3CG5 A;  4D60 A;  1ES3 A;  2FFY A;  2HDS A;  5CGW A;  4L9E A;  1L2S A;  2PD7 A;  1BLH A;  1G5U A;  2PR5 A;  2WAE A;  2ZQ7 A;  1XGI A;  3TE8 A;  1W63 M;  5KSH A;  2ZC6 B;  3RXW A;  3G35 A;  2G7U A;  3MFX A;  3CLO A;  2DRW A;  1AXB A;  4WZ5 C;  4O0P A;  4X56 A;  3W4Q A;  4GN2 A;  1Y54 A;  5DJU A;  4H6J B;  5A90 A;  4OPY A;  3IXH A;  1YLW A;  3LUQ A;  3KSI A;  3LY4 A;  3GDI A;  4ETX A;  1Q2P A;  4HNB A;  4E3O A;  2VGK A;  1ES2 A;  1K54 A;  3BJN A;  3L9K A;  2K7S A;  4R6L A;  1O07 A;  2Z2L B;  2CC1 A;  4E3M A;  3CUE A;  1BZA A;  4LV2 A;  3LR0 A;  4Y2F A;  1OJ5 A;  3H7W B;  5J4E A;  4GD6 A;  3P98 A;  1NYM A;  3VSL A;  3GSG A;  1FCN A;  2XD1 A;  4EQI A;  3T4T A;  1V9Z A;  5DKK A;  3ZVW A;  2V1Z A;  3DTM A;  3KSH A;  3UY6 A;  1UWN X;  4I39 A;  5TFQ A;  3VP1 A;  3KSG A;  4WEJ A;  3BYD A;  3T1X A;  5EM0 A;  1DJA A;  5F82 A;  1KGF A;  4R0Q A;  4NXF A;  3UNW A;  5EUA A;  3E2L A;  4C75 A;  2PBD P;  3MS6 A;  2P04 A;  3F1N A;  4I3A A;  5L10 A;  4OKP A;  3HLB A;  4CPK A;  3Q81 A;  1JTG A;  2HGV A;  1O7E A;  4EER A;  4BBT A;  1Y4O A;  5CX7 A;  3MQQ A;  4F94 A;  1JWP A;  1JVJ A;  1FSW A;  4MN6 A;  2PR6 A;  4P6Z M;  5CED A;  1FR6 A;  3PAG A;  1W79 A;  4BD0 A;  1FCO A;  1TD5 A;  3BM6 A;  3C2W A;  3MKE A;  4KZ9 A;  4BQM A;  1ZHH B;  2V8C A;  2ACG A;  3D72 A;  4EET B;  3ITA A;  2PU4 A;  4BBV A;  2WZZ A;  1WYC A;  1BUE A;  1ZG4 A;  2W1T B;  1TVF A;  5FAO A;  2PU2 A;  1LHY A;  2JKG A;  4HI4 A;  3A3E A;  3DWZ A;  4DJ2 A;  3VE3 A;  1ERO A;  2QYB A;  2RL3 A;  3LIA A;  3F1N B;  2A3U A;  2WKP A;  2KLI A;  1YSQ A;  4DRT A;  3E0Y A;  3VFF A;  2W0N A;  1PRQ A;  3RTY A;  1TS0 A;  2V20 A;  1K25 A;  2PD8 A;  3QNB A;  4XXR A;  1YMX A;  1YLT A;  3ZNT A;  1TF1 A;  2IWD A;  3T4L A;  2PAV P;  3F1O A;  4EW7 A;  3BQ8 A;  1GHP A;  1YLZ A;  4JLF A;  3NDE A;  1NZU A;  4G3K A;  4IBR A;  2Z6D A;  1K55 A;  2DNS A;  4ZAM A;  5L09 A;  4CQH A;  3HLE A;  1MBL A;  5AQB A;  3VP3 A;  3SH9 A;  4KG5 A;  5FQQ A;  4DJ3 A;  5CTN A;  2NUT C;  2HJE A;  2ZMA A;  1E3U D;  2VJW A;  4HQA A;  4EBP A;  4KZ7 A;  3OPL A;  3PR6 A;  2Q0O A;  3HLF A;  4UAA A;  1IOU A;  1UWP X;  5G18 A;  3UB9 A;  4B88 A;  5E43 A;  3V50 A;  2C6W B;  2LB5 A;  3V39 A;  1FIK A;  2ZMV A;  4PKY A;  2AVX A;  4GDB A;  3UB6 A;  2O9C A;  1DJB A;  4DE0 A;  1S1Y A;  3NC8 A;  3AGF A;  2VGL M;  1YPR A;  3UN7 A;  4F3L B;  4NXE A;  3UPN A;  4PMA A;  4L9G A;  1BLC A;  3Q1F A;  3WRT A;  1K57 C;  3HLG A;  2HPB A;  4U3T A;  1MWU A;  5F5Y A;  1XJ3 A;  1PWC A;  1M40 A;  2L4R A;  1P9R A;  5A91 A;  1ACF A;  4LRZ E;  4NG2 A;  4GKU A;  2HJ9 C;  1GCE A;  2VX8 A;  5CHJ A;  3UPO A;  1V9Y A;  3MMH A;  1K4E A;  4NEE D;  4WEL A;  2W3D A;  3M2K A;  4FTX A;  5KIZ A;  1XP4 A;  2H28 A;  4IHQ A;  2MJ6 A;  3A0V A;  5U47 A;  1E25 A;  2BTF P;  1NJ4 A;  4U0T A;  2Y59 A;  4HH3 A;  3UB8 A;  3QHY A;  4KZB A;  2R78 A;  5I94 A;  3VP2 A;  3F1P B;  2J3T C;  2J8Y A;  3S7N A;  3HLC A;  3PTE A;  2KX6 A;  1N4O A;  1T19 A;  4Z1W A;  4ARZ B;  1NXY A;  1OTB A;  2VLG A;  5HX9 A;  3GMW A;  1KE3 A;  4DF6 A;  4R3J A;  2DMW A;  3LFV A;  1LL5 A;  3H7W A;  1XFN A;  3G32 A;  1HZO A;  2M7U A;  1H0M A;  2W3G A;  4KUK A;  3LY3 A;  2V0W A;  4YWZ A;  3T1Q B;  3UMD A;  4K0X A;  2QHK A;  1K56 D;  4GS9 A;  1BLS A;  1T18 A;  1L0F A;  2EX2 A;  5EVI B;  4YOF A;  3T1S A;  4B9O A;  2H0Y A;  4CLC A;  4S2J A;  3IHB A;  2WKH A;  1KE0 A;  4WL9 A;  4QHC A;  1L0D A;  2ZMF A;  2JE5 A;  3RFB A;  2PYR A;  1NWZ A;  2EWW A;  5EV0 A;  4E3N A;  2E8I A;  5CEC A;  3IXG A;  2QPN A;  3HJI A;  3KX0 X;  1SZV A;  4Y0O A;  3ZG0 A;  1PIO A;  1W7F A;  2ZLY A;  1K0K A;  1XJ6 A;  5DTT A;  4GLQ A;  4OPZ A;  4FD8 A;  2HF6 A;  5G4Z A;  3B47 A;  1CI9 A;  5CHM A;  3VOL A;  4OQH A;  3S22 A;  5CGX A;  2Y2K A;  3CPT B;  2GDN A;  1S66 L;  4CLC C;  1S4R A;  4DE1 A;  2ZOI A;  4Y0U A;  1CF0 A;  1MC0 A;  2J3W A;  5GHY A;  4K0W A;  1YM1 A;  2ZC4 B;  4WEK A;  3IX8 A;  3KYE A;  2BG1 A;  2X01 A;  2PHY A;  3EEA A;  5DF9 A;  3K2N A;  5CRF A;  5EVI D;  2JKR I;  2W1R A;  2WGV A;  3T4S A;  1OTI A;  4RX2 A;  3S7Q A;  3HUO A;  1E3U A;  2OLU A;  4BEN A;  4ARZ A;  4X25 A;  1ZG6 A;  2RCX A;  2H10 A;  4QPR A;  4X1L A;  1W8Q A;  5F1G A;  4Y5F A;  5HWW A;  1YT4 A;  3RH8 B;  1LSX A;  3V67 A;  3BLS A;  2D02 A;  2V0U A;  4E3K A;  5IS1 A;  2PT7 A;  4UHU A;  5L8M A;  4IVK A;  5HSQ A;  4JXV A;  2ZQC A;  2QKP A;  3Q07 A;  4ZTK A;  4YIN A;  3HVF A;  3O88 A;  3MBZ A;  3NCK A;  5A92 A;  4ZBE A;  2WUQ A;  2Y2H A;  3NOT C;  3HCY A;  1IKG A;  1GSX A;  5FEF A;  2OWJ A;  3UME A;  4HOI A;  1MXO A;  3ZG5 A;  4UA9 A;  3KYQ A;  1K56 A;  4HJ6 A;  3G31 A;  2LB9 A;  5FAP A;  3ZDJ A;  3HLW A;  3FPV A;  3MKF A;  1I2S A;  2BAS A;  4RYE A;  1MKI A;  1K6R A;  1S6R A;  5HPI A;  3GVB A;  4KZ3 A;  1T1B A;  2XSS A;  4JKT A;  4WM9 A;  4CJN A;  1G6O A;  1K6S A;  3QP4 A;  3EOI A;  3IS2 A;  1MWS A;  1G68 A;  1LSV A;  3T4J A;  1SKF A;  4E6W A;  1VM1 A;  4OP8 A;  5CGS A;  3N8R A;  4LV3 A;  4DKI A;  4DE2 A;  3ZVT A;  3DTE A;  3NOU C;  1GSW A;  1YKD A;  2UV0 E;  4P6Z S;  1CQA A;  1PNE A;  1GA9 A;  3IF6 A;  2GNX A;  1N9N A;  2P9V A;  4CLC E;  2XEP A;  2Q9N A;  2O99 A;  3H9W A;  2EA9 A;  1OME A;  2XK1 A;  4QB8 A;  4WMC D;  2Y4A A;  4FH4 A;  3CI6 A;  5EVE A;  3WS2 A;  4EBL A;  3D4F A;  4N1X A;  4GZB A;  2CMN A;  3HUM A;  4HBT A;  2WKI A;  2GX5 A;  1EI5 A;  1J3W A;  4EQ1 A;  1RGY A;  3S7P A;  3ZYT A;  2FFF B;  2O9A A;  3NI9 A;  4S2O A;  3SOI A;  5KSC A;  3G2Y A;  2Y2Q A;  4GW9 A;  4R70 A;  3PBT A;  1XA1 A;  1IFQ A;  2ZQD A;  2VGJ A;  1FCM A;  1ONH A;  4K91 A;  3VOY A;  3ULF A;  1OT9 A;  2OAP 1;  5LBR A;  3DTI A;  3VFH A;  5D3O A;  5DF7 A;  1D1J A;  3RXX A;  2J9P A;  2VEA A;  4MBH A;  1PFL A;  3IXD A;  5TGF A;  3OCL A;  4GHI B;  2XD5 A;  3NDG A;  4N92 A;  4DXB A;  2EX9 A;  3MXR A;  2WKQ A;  3VE4 A;  3LGO A;  2P7J A;  2J9O A;  3EEH A;  1KOU A;  3VP4 A;  1KGG A;  4UQI M;  5FSR A;  3ZHH A;  3LO7 A;  2ZBB A;  3PYP A;  5HAP A;  1DP6 A;  3IWQ A;  3FKV A;  4OOY A;  2I72 A;  1U60 A;  2PBY A;  3HJK A;  3FKW A;  4Y15 A;  3N4I A;  3LIC A;  2V1B A;  4WYY A;  1VEU B;  4OLD A;  4G3V A;  4CLC B;  2ZC3 B;  1AWI A;  1STZ A;  3OZH A;  2JKR M;  1IYS A;  2Q9M A;  5EVI A;  4QY6 A;  3VP0 A;  4P85 A;  4EEP A;  1G28 A;  5HFO A;  4P0M A;  4DXC A;  4JGP A;  4S2P A;  4MDZ A;  4Q0I A;  1G6A A;  4PKY G;  2NUP C;  2IA2 A;  4OVD A;  3MXS A;  2W27 A;  3BFD A;  2WAF A;  1A0K A;  1L3L A;  1H8M A;  3VSK A;  1YLP A;  3E4Q A;  5FQM A;  4HY8 A;  4Q0J A;  2HDQ A;  5C5K A;  4XT2 B;  3GV9 A;  2ZM2 A;  1ZTU A;  2P08 A;  4R23 A;  4HHD A;  2HP5 A;  2EX6 A;  1RCJ A;  3EGD C;  4B4Z A;  1W8Y A;  4FOF A;  3C4P A;  3UDF A;  3TRC A;  1NRJ A;  1JNU A;  2HP9 A;  4UA6 A;  1OT6 A;  2Y2P A;  2ZM8 A;  4JGR A;  3TG9 A;  3MR0 A;  2WKR A;  1GA0 A;  4XUZ A;  4BWI A;  3PXP A;  4Y17 A;  5CXW A;  4ZJ3 A;  3LYX A;  3HUN A;  3MSH A;  4GB7 A;  3BFF A;  4GCZ A;  1I2W A;  4EU0 A;  3B3X A;  5EOO A;  5HAQ A;  1OTD A;  5AVE A;  3UE3 A;  3EQU A;  1IYO A;  3IF5 A;  4OP5 A;  4S2M A;  4MCW A;  5GHX A;  3JYI A;  3IXB A;  2JKT M;  4II7 A;  4B4X A;  4BLM A;  1XPB A;  3C7U A;  3LEZ A;  5GLC A;  1HLU P;  2V9A A;  4N1H A;  3Q7Z A;  4PPR A;  3CAX A;  5FDH A;  5CHU A;  1OJG A;  3SW1 A;  4LCL A;  1XFQ A;  3O5Y A;  1ESU A;  3IT9 A;  3ZG9 B;  4I3J A;  3V5M A;  5FQJ A;  2QMI A;  5FQI A;  3MZD A;  3ZNY A;  3T12 B;  2WZX A;  4NK3 A;  2XRO A;  4ZJ2 A;  3NY4 A;  3R7W A;  4QY5 A;  4JBF A;  4MBK A;  4BMW A;  1H8Y A;  4JXG A;  5CER A;  4MNR A;  4ZRR A;  4E6X A;  5J3W A;  4MN7 A;  1SDE A;  1VQQ A;  3FZC A;  4O7D A;  4UQI S;  5TJJ A;  4Q8I A;  2JBF A;  3U4L P;  1XX2 A;  5GHZ A;  4C6Y A;  5EM1 A;  2GZA A;  4GOG A;  2OOL A;  3P09 A;  4Y3I A;  3C38 A;  1TS7 A;  1PI4 A;  4I3I A;  3BEB A;  1GSV A;  4YNR A;  5FQK A;  2VK3 A;  3MQ0 A;  1I5Q A;  1NLY A;  3IF6 B;  3G34 A;  4MN5 A;  4GHI A;  3FG8 A;  1LSW A;  3TSG A;  4KUO A;  3WS5 A;  1S1Z A;  3O3V A;  1S4S A;  1WA9 A;  2W3E A;  4I38 A;  5HAR A;  3OBF A;  3MQO A;  4KQR A;  3KYZ A;  5GL9 A;  4LV1 A;  3LIF A;  5AQA A;  2EXB A;  3C8C A;  3JVU A;  3UDX A;  4RA7 A;  2L0W A;  1BLP A;  3SZT A;  2ZM0 A;  1P97 A;  3BW6 A;  3LID A;  4HES A;  3PBR A;  3W2Z A;  3NUL A;  4Q0H A;  4HJ3 A;  3UPP A;  3JPU A;  1CI8 A;  5EVL A;  3IWO A;  2B18 A;  2P74 A;  4G3W A;  1N9B A;  2XA7 S;  1ES4 A;  1H5X A;  1MPL A;  3KO6 A;  4WMC A;  5HDD A;  3P7N A;  2EFX A;  3VOZ A;  2ZD8 A;  1CEF A;  3TW8 A;  5AQ7 A;  1LT0 A;  4FUW A;  3MZF A;  5FI7 A;  4QWO A;  3KSF A;  3IX4 A;  3L7H A;  4I5S A;  2Y8H A;  2WAD A;  1VET B;  3EQV A;  3V3R A;  1SCW A;  1SKO B;  2W1T A;  1MY8 A;  4OPQ A;  1RGZ A;  2Z2M B;  1EW0 A;  4DE3 A;  3I7J A;  3FPW A;  1XA7 A;  2HDU A;  1HD8 A;  5F69 A;  3M2J A;  3GQZ A;  4OPR A;  1Z09 A;  1BYW A;  3ITB A;  4WZ5 A;  4LGW A;  3A0R A;  3LCE A;  4H6J A;  1GHI A;  5EEC A;  3LI8 A;  3OPH A;  1NRF A;  3MXQ A;  3DW0 A;  3LEQ A;  4BL3 A;  3E98 A;  2PDR A;  4IBX A;  2ZC5 B;  2EFU A;  3WS4 A;  4R4R A;  4EXO A;  3C5A A;  1NZO A;  4E3J A;  4Z9Q A;  2HP6 A;  4XUX A;  1YLJ A;  3T4Q A;  4PM9 A;  5K5B A;  5A93 A;  4N9K A;  4OOM A;  1H8Z A;  2VV7 A;  4BBU A;  1WYB A;  2W3H A;  5IHV A;  4QD4 A;  1OPX A;  1NYY A;  5FAT A;  4KEN B;  4PM6 A;  1PZO A;  3PBQ A;  3O87 A;  1J9M A;  1H3Q A;  1HTZ A;  3N8S A;  4C3Q A;  5IU1 A;  2XR0 A;  5GLA A;  4A5R A;  5HWV A;  2INW A;  4M4X A;  2FZ0 A;  5MC7 A;  5HD3 A;  4OOL A;  4ID4 A;  4D2O A;  3BEC A;  4BJP A;  3UE6 A;  2K31 A;  2Y2M A;  1VEU A;  4HH2 A;  4JPM A;  3CUE C;  3NJA A;  4GNU A;  3EGX C;  3W8K A;  3K3C A;  3IBJ A;  2VZW A;  3HL9 A;  4WUJ A;  3P01 A;  1F5M A;  2J7V A;  1GHM A;  3SS5 A;  4E3L A;  4HIA A;  2OSU A;  1FOF A;  4K08 A;  4ESP A;  4E3I A;  5E2G A;  3FV7 A;  1CJF A;  3NOP C;  2V1A A;  5M18 A;  1IEM A;  3DWK A;  1C3B A;  1PW1 A;  3S4X A;  5HPF A;  2Y55 A;  5EOE A;  5AQ9 A;  4LV0 A;  3DAV A;  3CPT A;  5KMW A;  1L0E A;  3N6I A;  2H0T A;  5E2F A;  2Y79 A;  4MEZ A;  5DF8 A;  4IVI A;  3TJZ C;  5M1A A;  4QJG A;  1OTA A;  3LR5 A;  1KDS A;  4Y0T A;  3A3J A;  3NEC A;  5J8X A;  1W5D A;  3RJU A;  3ZCZ A;  2UWX A;  2ZQ9 A;  2HZ5 A;  1PZP A;  4BD1 A;  2L1M A;  4KZ5 A;  4P6B A;  4KG6 A;  5DJT A;  3CIT A;  3CZD A;  3HLD A;  2M7V A;  3LIB A;  5TBM B;  2H5S A;  1BTL A;  4LLO B;  1VB6 A;  5E2E A;  5GLB A;  3N8L A;  1LL8 A;  2P9V B;  5JYO A;  4KZ8 A;  3MFD A;  3E4P A;  3W4O A;  4R38 A;  4JGQ A;  3Q7V B;  4S2N C;  3BQA A;  2Y2L A;  2XFT A;  4WF0 A;  1VHM A;  3WS1 A;  4KQO A;  4N9L A;  2ZOH A;  3ZQ5 A;  3UE1 A;  5DTK A;  4IUH A;  2Y2G A;  2XF3 A;  3BFG A;  5HWT A;  1DRM A;  2EX8 A;  2DCF A;  5FEG A;  4R1G A;  3C7V A;  2JC7 A;  1MKM A;  3QP8 A;  5FI6 A;  3CMZ A;  2XH9 A;  2R9W A;  5DFX A;  3UB7 A;  5FAS A;  2XQZ A;  1VET A;  3G2Z A;  5GLD A;  2J3T D;  3LIE A;  4U0X A;  4OQ0 A;  4JF6 A;  3IWI A;  3GEC A;  4KQD A;  1KVM A;  1F2K A;  1WE4 A;  2WGI A;  5TR7 A;  1TEM A;  3Q7V A;  5HD5 A;  4EEU A;  1Z6F A;  2K2N A;  4JXW A;  2ZJ9 A;  4S2L A;  4ZDX A;  5CTM A;  3WS0 A;  4LPZ A;  1TDG A;  4L0L A;  3GRJ A;  5EVI C;  4KZ4 A;  4IUK A;  3AGD A;  2EWV A;  2VGL S;  2W3F A;  3O86 A;  4P87 A;  1SDN A;  4PM8 A;  3BLM A;  3IQA A;  1S0W A;  4OQG A;  1W63 Q; 
#chains in the Genus database with same CATH homology
 3B47 A;  3VOL A;  3VV4 A;  3S7O A;  3LR3 A;  4ZRR A;  5J3W A;  1XJ4 A;  1S66 L;  3U2A A;  1S4R A;  4MN7 A;  4CLC C;  2ZOI A;  1MC0 A;  1OTE A;  2J3W A;  4UQI S;  2VKS A;  5TJJ A;  4L9E A;  2PD7 A;  4WEK A;  1DP8 A;  2PR5 A;  2GZA A;  3E4O A;  2PHY A;  2OOL A;  3TE8 A;  3EEA A;  5DF9 A;  4ETZ A;  4Y3I A;  3K2N A;  4WN5 A;  1W63 M;  2OAQ 1;  2A24 B;  3C38 A;  5KSH A;  1T1A A;  1TS7 A;  2JKR I;  4I3I A;  2G7U A;  2W1R A;  1GSV A;  4YNR A;  3T4S A;  3MFX A;  1OTI A;  3CLO A;  3K3D A;  3MQ0 A;  4O0P A;  3OOV A;  3S7Q A;  1NLY A;  5DJU A;  4H6J B;  4MN5 A;  3LUQ A;  3H82 A;  3KSI A;  4GHI A;  4ARZ A;  3GDI A;  3FG8 A;  1LSW A;  1YSP A;  4KUO A;  4ETX A;  4HNB A;  4QPR A;  1S1Z A;  1S4S A;  1WA9 A;  4MMN A;  2W3E A;  4I38 A;  4Y5F A;  5HWW A;  3F1O B;  3OBF A;  3MQO A;  1ODV A;  3PBN A;  3KYZ A;  5HL6 A;  3BJN A;  3LIF A;  2K7S A;  3T50 A;  3RH8 B;  4R6L A;  1LSX A;  3V67 A;  3BWL A;  3C8C A;  3JVU A;  2D02 A;  2V0U A;  3CUE A;  2J80 A;  5IS1 A;  2PT7 A;  3LR0 A;  5L8M A;  2L0W A;  5HSQ A;  4Y2F A;  1OJ5 A;  2QKP A;  3H7W B;  1P97 A;  5J4E A;  3BW6 A;  3LID A;  3PBR A;  3NOT C;  3W2Z A;  4Q0H A;  2GJ3 A;  4HJ3 A;  3ICY A;  3HCY A;  1GSX A;  3T4T A;  2OWJ A;  3UME A;  2JN7 A;  4HOI A;  1V9Z A;  5DKK A;  4FSF A;  3KYQ A;  2B18 A;  5G4Y A;  3KSH A;  4G3W A;  4HJ6 A;  3T4K A;  3CWF A;  1UWN X;  2XA7 S;  2LB9 A;  4I39 A;  3KSG A;  4O01 A;  3KO6 A;  3FPV A;  4WEJ A;  5HDD A;  5F68 A;  4PHT A;  3P7N A;  2XRN A;  5HDC A;  2BAS A;  4NXF A;  5AVF A;  1P0Z A;  3TW8 A;  5HPI A;  1LT0 A;  1T1B A;  3KSF A;  2XSS A;  1G6O A;  2P04 A;  3F1N A;  4I5S A;  3EOI A;  4LRX C;  2Y8H A;  3IS2 A;  4I3A A;  3EQV A;  1LSV A;  2HGV A;  2W1T A;  3T4J A;  4EER A;  1EW0 A;  4BBT A;  1UGU A;  4NXG A;  5CX7 A;  3FPW A;  3MQQ A;  5F6A A;  5DFY A;  4HP9 A;  5F69 A;  4AFI A;  4MN6 A;  2PR6 A;  5HZH A;  1BYW A;  4P6Z M;  3A0R A;  4H6J A;  1S67 L;  3LI8 A;  3NOU C;  1GSW A;  1YKD A;  3BY9 A;  4P6Z S;  3D3O A;  3MXQ A;  4CLC D;  3E98 A;  2PDR A;  5AJG A;  5EFW A;  3IBR A;  2GNX A;  4EXO A;  1N9N A;  3C2W A;  1TD5 A;  4CLC E;  3A0S A;  2O99 A;  4B93 A;  3OLO A;  3H9W A;  2EA9 A;  1ZHH B;  3D72 A;  2I9V A;  1X0O A;  3T4Q A;  4EET B;  3MJQ A;  5K5B A;  4OOM A;  4BBV A;  2VV7 A;  3CI6 A;  1NLZ A;  4BBU A;  2W3H A;  2W1T B;  4JGO A;  1OPX A;  2CMN A;  5J7E A;  3T4O A;  2GX5 A;  4PAU A;  4HI4 A;  4DJ2 A;  4EQ1 A;  2O9B A;  3PBQ A;  3F1P A;  4XT2 A;  1P9W A;  3S7P A;  3VE3 A;  2QYB A;  1H3Q A;  3IS2 B;  3LIA A;  3ZYT A;  3F1N B;  5IU1 A;  2O9A A;  4E04 A;  1TS6 A;  3H82 B;  5HWV A;  2XA7 M;  3B42 A;  2WKP A;  2INW A;  2KLI A;  3PHY A;  1YSQ A;  4M4X A;  2FZ0 A;  3E0Y A;  4GW9 A;  4R70 A;  5MC7 A;  3PBT A;  3PBS A;  2W0N A;  5HD3 A;  1IFQ A;  3RTY A;  4OOL A;  2VA0 A;  1TS0 A;  5I5L A;  2PD8 A;  3ULF A;  4HP4 A;  4BJP A;  3UE6 A;  2K31 A;  1TF1 A;  1OT9 A;  3B33 A;  1TS8 A;  4EES A;  2OAP 1;  5LBR A;  1N9L A;  3OCN A;  3T4L A;  3F1O A;  4EW7 A;  4NKP A;  3BQ8 A;  4HH2 A;  4ME4 A;  3CUE C;  3NJA A;  3EGX C;  4G3K A;  3K3C A;  2Z6D A;  3IBJ A;  2VEA A;  2B02 A;  2VZW A;  3OCL A;  4GHI B;  2M1C A;  2YKH A;  4CQH A;  3MF0 A;  2WKQ A;  3VE4 A;  4WUJ A;  3P01 A;  2P7J A;  4DJ3 A;  2NUT C;  3EEH A;  1F5M A;  1KOU A;  2HJE A;  4BMW A;  2O0Y A;  4UEY A;  2VJW A;  4HQA A;  2QWS A;  3EWK A;  4HIA A;  4UQI M;  3PR6 A;  2FH5 A;  3LI9 A;  4K08 A;  1IOU A;  1UWP X;  3UB9 A;  4R3A A;  2KOI A;  2HV1 A;  2ZBB A;  3PYP A;  1XJ2 A;  1DP6 A;  3NOP C;  1T1C A;  2LB5 A;  2V1A A;  3FC7 A;  3HJK A;  2ZMV A;  5FL3 A;  5HPF A;  4PKY A;  3LIC A;  2V1B A;  2O9C A;  3UB6 A;  4EUV A;  1S1Y A;  4G3V A;  5A8B A;  4CLC B;  2A2L A;  2VGL M;  4F3L B;  1STZ A;  4NXE A;  2JKR M;  2Y79 A;  4EEP A;  4GS9 B;  4L9G A;  3TJZ C;  1G28 A;  1D06 A;  2A24 A;  1YAX A;  4JGP A;  1OTA A;  4MDZ A;  4Q0I A;  3LR5 A;  4PKY G;  1F98 A;  4HJ4 A;  4L9F A;  2NUP C;  2IA2 A;  3OC2 A;  2VV8 A;  5F5Y A;  3R7W B;  1XJ3 A;  2W27 A;  2L4R A;  2QJ7 A;  1P9R A;  2L1M A;  1H8M A;  4LRZ E;  3E4Q A;  4HY8 A;  4Q0J A;  1Y28 A;  2HJ9 C;  5DJT A;  5C5K A;  4XT2 B;  3CIT A;  1ZTU A;  2OWH A;  2VV6 A;  2P08 A;  3JVV A;  2VX8 A;  4HHD A;  2M7V A;  3LIB A;  5TBM B;  1V9Y A;  3EGD C;  4LLO B;  3MMH A;  1VB6 A;  4NEE D;  2W3D A;  4WEL A;  5KIZ A;  4FOF A;  1LL8 A;  3TRC A;  1NRJ A;  1JNU A;  2H28 A;  3A0V A;  2MJ6 A;  4IHQ A;  1OT6 A;  3E4P A;  4R38 A;  4JGR A;  3R4K A;  4JGQ A;  4O8G A;  4DMZ A;  3MR0 A;  2WKR A;  3BQA A;  3LR4 A;  4WF0 A;  1VHM A;  3PBO A;  4BWI A;  4HH3 A;  3PXP A;  3UB8 A;  3LYX A;  5IT5 A;  4KQO A;  1F9I A;  2ZOH A;  3ZQ5 A;  4GCZ A;  4EU0 A;  4IUH A;  2R78 A;  3G6O A;  1N9O A;  5HWT A;  1OTD A;  3F1P B;  2J3T C;  1DRM A;  3S7N A;  5AVE A;  4WLA A;  2KX6 A;  3DBA A;  1T19 A;  5TBM A;  3UE3 A;  1MKM A;  4Z1W A;  3EQU A;  2D01 A;  4ARZ B;  1OTB A;  2VLG A;  5DFX A;  3UB7 A;  4MCW A;  2DMW A;  3LFV A;  4RQ9 A;  3H7W A;  2JKT M;  1XFN A;  2J3T D;  3LIE A;  4II7 A;  2M7U A;  4NXB A;  2W3G A;  4KUK A;  4YWZ A;  2V0W A;  3C30 A;  3GEC A;  4KQD A;  3UMD A;  2QJ5 A;  2V9A A;  2QHK A;  1D7E A;  3CAX A;  4GS9 A;  1DP9 A;  2KDK A;  5HD5 A;  1T18 A;  4F3L A;  1OJG A;  4EEU A;  2Z6C A;  3SW1 A;  4IJG A;  4YOF A;  2K2N A;  4B9O A;  1XFQ A;  3O5Y A;  3NHQ A;  4CLC A;  4LPZ A;  4L0L A;  2YKF A;  4GJ4 A;  4WL9 A;  2ZMF A;  4I3J A;  3RFB A;  2PYR A;  1NWZ A;  2EWW A;  3BY8 A;  4LRY C;  5HDS A;  4IUK A;  2PYP A;  2EWV A;  2VGL S;  5DKL A;  2W3F A;  3HJI A;  3KX0 X;  2XRO A;  2JKT I;  3R7W A;  1XJ6 A;  4DN0 A;  4GLQ A;  1MZU A;  1W63 Q;  2JHE A;  2HF6 A;  5G4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...