4HI4A

Crystal structure of the 5-coordinate ferric heme-binding pas domain of aer2 from p. aeruginosa
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
GSHMARIASALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDAGRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANARLGSAVQWTDRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Aerotaxis transducer Aer2
publication title Architecture of the soluble receptor Aer2 indicates an in-line mechanism for PAS and HAMP domain signaling.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 36
structure length 119
sequence length 119
chains with identical sequence B, D, G
ec nomenclature
pdb deposition date 2012-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hi4A00
4I5SA 1G28A 1F98A 4GS9A 1XFNA 3B33A 2Z6DA 4KUKA 2QJ5A 1OJ5A 5G4ZA 2VV6A 1WA9A 1VB6A 2R78A 4MN6A 3BWLA 3P7NA 2M1CA 3E4OA 5DKKA 4HQAA 2ZBBA 4WF0A 2QJ7A 4GCZA 2YKHA 1MZUA 1T19A 1NWZA 1D06A 1XJ3A 4WLAA 1GSWA 2W0NA 2OWJA 3LICA 1TS8A 3PYPA 2PR5A 4YWZA 3UB6A 2KDKA 2JN7A 4LPZA 2QKPA 1S1ZA 1UGUA 3CWFA 3FG8A 1OTEA 2WKPA 5HSQA 1LL8A 1TS0A 4JGPA 5F68A 3F1OA 4KQDA 4EEUA 1LT0A 3H82A 3LIBA 5HD3A 3LIFA 2PYRA 5KIZA 3F1PA 5F69A 3VOLA 4HJ4A 4I3IA 4I3AA 3IS2A 3EEHA 4EXOA 2OOLA 3NOUC 3F1NA 4F3LB 3VE4A 4EERA 3UE6A 3UB9A 2BASA 4NXGA 2K7SA 4NXBA 4WL9A 4L9GA 5I5LA 1T1AA 4HJ3A 4MN5A 4EETB 3IBRA 1T1BA 2V1BA 1XJ4A 4R3AA 3LI8A 5J4EA 5IU1A 4EW7A 3NJAA 5HDCA 3MR0A 2VEAA 2ZOHA 5EFWA 5AVFA 5TBMA 1DP9A 3MQOA 3BY8A 3FC7A 2B02A 5AVEA 4PKYA 4E04A 2D02A 5IS1A 5DJUA 2EA9A 2PDRA 3LYXA 1N9NA 2PYPA 2P7JA 3HJKA 4XT2B 4HP4A 4EEPA 2VV7A 1V9ZA 4H6JA 2V9AA 4I3JA 4L9EA 1LSWA 3UB7A 4DJ3A 5J7EA 4PKYG 5HWVA 4GW9A 4BBVA 2D01A 4GHIB 3LIDA 3E4PA 5HDSA 1P97A 4HP9A 4DJ2A 3BY9A 2PD8A 2A24A 4LRZE 2ZOIA 3NOTC 2WKQA 1DRMA 1LSVA 4GS9B 4BBTA 1X0OA 4NXFA 1S66L 3SW1A 1EW0A 3RTYA 4L9FA 3H7WB 1OTAA 2PR6A 1V9YA 2PHYA 5A8BA 4HNBA 1N9OA 4JGQA 3NOPC 3T50A 5HWTA 2V0UA 5HDDA 1S1YA 3LI9A 1S4RA 5DJTA 1DP8A 3ICYA 2L0WA 4HH3A 4HJ6A 1LSXA 2GJ3A 2HV1A 3VE3A 1T18A 3C8CA 3HJIA 1Y28A 4XT2A 3F1OB 2YKFA 1DP6A 4HHDA 3ZQ5A 2VV8A 3H82B 4R38A 1D7EA 3A0RA 4K08A 5DKLA 1KOUA 1F9IA 2H28A 3F1PB 3H9WA 1S67L 1XJ2A 3IS2B 2JHEA 5J3WA 3CAXA 2L1MA 4EQ1A 3MFXA 3NHQA 2CMNA 2QWSA 2W27A 2KX6A 5HD5A 1GSXA 4JGOA 1OTBA 1UWPX 2J80A 1TS7A 4I38A 1T1CA 3ULFA 4HH2A 1P0ZA 4LRYC 3H7WA 3MXQA 3OLOA 4WUJA 1JNUA 4KUOA 5TBMB 4LLOB 4NXEA 2V0WA 4BBUA 4F3LA 3GDIA 2Z6CA 3RH8B 2OWHA 1OTIA 1GSVA 1OT9A 3C2WA 3MJQA 2WKRA 1ODVA 3A0VA 4H6JB 4HIAA 5HZHA 4M4XA 1OJGA 4WN5A 2QHKA 3A0SA 4RQ9A 1XFQA 3LIAA 5HWWA 1BYWA 5G4YA 3E4QA 1XJ6A 2L4RA 3UMDA 1TS6A 3MQQA 4EESA 2A24B 4HY8A 2PD7A 4HI4A 4R6LA 5F6AA 2I9VA 3GECA 3D72A 1OT6A 3K3CA 4JGRA 5F5YA 3LUQA 3KX0X 1S4SA 4HOIA 4I39A 3UB8A 4R70A 2INWA 3CLOA 1UWNX 3F1NB 4LRXC 3LIEA 3UMEA 3EWKA 3K3DA 4GHIA 2V1AA 4B9OA 3G6OA 1N9LA 2VLGA 1OTDA 3PHYA
chains in the Genus database with same CATH superfamily
3SOIA 2WGWB 3LR5A 2H0YA 2Y91A 4GS9A 1XFNA 3B33A 2Z6DA 3MQ0A 1OJ5A 2O9CA 5G4ZA 2VV6A 3UE0A 3UNWA 4CLCC 5LBRA 3R7WB 3UDIA 4MN6A 3P7NA 4GD8A 3ZDJA 2XD1A 3HCYA 3CHWP 4CLCE 3P09A 4WMCD 1N4OA 2JE5A 2EX9A 2Y2MA 3MSHA 3BFEA 4LCMA 3GRJA 1CJFA 2OAQ1 3PYPA 2PR5A 1K57C 1SKOA 1QMFA 3T1SA 1L0GA 2VGLS 2WKPA 1ONHA 2ZM8A 5HSQA 1GHPA 5FI2A 4CQHA 1WYBA 3MS6A 1LT0A 4LCLA 3LIBA 4QU3A 4ETZA 5KIZA 2HJEA 3PTEA 4ESPA 2ZMFA 3F1PA 1LI0A 2XD5A 1YT4A 1NXYA 4I3IA 3UE3A 2GZAA 2ZC4B 3CJMA 2RCXA 4JLFA 3RXXA 2XA7S 3NOUC 1K55A 3F1NA 5GLCA 4F3LB 4EERA 3TSGA 3UE6A 3V67A 1W79A 3FPWA 4NXGA 1YLYA 4IVIA 1JWZA 1BLHA 4L9GA 1T1AA 4JXVA 4MN5A 1PYYA 3KSHA 1PRQA 2XFSA 1GCEA 4WM9A 5GHYA 1EWZA 4GB7A 4EW7A 5DF7A 1DJAA 2VEAA 5IT5A 1I5QA 2ZOHA 3QNBA 1DP9A 1JTGA 3VSKA 4ETXA 3MQOA 3BY8A 3FC7A 2P04A 3PAGA 5F82A 4E04A 2VX8A 1PNEA 3S7QA 2EA9A 2HJ9C 1NJ4A 2V8FA 3UN7A 3O5YA 2IWDA 3BQAA 3LYXA 1N9NA 1U60A 2J9OA 4X25A 4II7A 4XT2B 1Y4OA 4G3WA 3FYZA 3GVBA 1ERQA 4UA7A 1CI9A 1TEMA 2O9AA 5HFOA 2ZL1A 4LENA 4L9EA 4KZBA 5CGSA 4KQOA 2IWBA 5J7EA 3CZDA 5CTMA 4WZ5C 1LHYA 4S2OA 4GW9A 4BBVA 1VEUB 5HDSA 1P97A 1NY0A 2HF6A 5A92A 4NKPA 4DXBA 1GA0A 4PAUA 3HLGA 1DRMA 1LSVA 4GS9B 4BBTA 4JF4A 1S66L 3SW1A 5EVIA 1H0MA 4R4RA 1S6RA 3NIAA 1CI8A 3H7WB 4Q0JA 4BD0A 4FD8A 3MZEA 4HNBA 4WYYA 2Y2OA 3R4KA 4MDZA 1L3LA 2WAEA 5DTTA 3T50A 3ZNYA 3IT9A 4Z1WA 3KSIA 1PWCA 3WS1A 5HAQA 4E3NA 1ZG4A 3JPUA 3ICYA 4A5RA 2L0WA 4HH3A 3T4KA 4DDYA 4P0MA 2XROA 1SKOB 4HEFA 3KYEA 4S2PA 1T18A 3HJIA 2VA0A 1CF0A 5HL6A 2VV8A 3ZQ5A 1D7EA 5DKLA 3SS4A 3F1PB 3N8LA 3WS0A 3H9WA 1GHMA 1S67L 1VQQA 1XJ2A 1ZKJA 2A49A 1NRJA 5CHUA 5FQIA 2H5SA 3HLFA 2B18A 1W63Q 5E2GA 4KZAA 2CMNA 2DCFA 4P87A 4S2JA 2KX6A 3U4LP 3GV9A 2IA2A 3PBOA 4JGOA 1AXBA 3IXGA 3ZHHA 1M6KA 4OKPA 3ULFA 5CEDA 4HH2A 2ZC7A 3DBAA 2E8IA 5A91A 1IYSA 5FL3A 3DWZA 3OC2A 2ZMVA 3LO7A 3OLOA 2O9BA 1L2SA 4R3BA 4WUJA 2HPBA 1PZPA 4OQGA 4JKTA 4NXEA 4UHUA 2JKGA 1ERMA 2R9WA 2Y2QA 3ZG9B 1NYMA 3RH8B 5U47A 4G3KA 4Y15A 4R3JA 2WKRA 3HLBA 3OPLA 4O01A 4LGWA 4P6BA 3ITBA 3JVUA 2ZL1B 2JC7A 2QHKA 3S7NA 1FIKA 2GDNA 4DN0A 3MZFA 1LL9A 3I7JA 3N6IA 3S1YA 1XGIA 4MMNA 1ES3A 1L0DA 4ID4A 2L4RA 1RCJA 2HP5A 4DXCA 1HD8A 4HBUA 4UQIM 3DW0A 5EVID 4DKIA 1G68A 3Q1FA 2WKIA 1BLCA 4R23A 3P98A 2VZWA 5EUAA 1ESUA 1CEGA 2I9VA 3PBRA 5EOEA 1DJCA 1IFQA 4IJGA 4JGRA 1W8YA 3Q81A 4OPZA 2NUPC 3WRTA 1C3BA 5A93A 3G35A 4R70A 3IH8A 1GHIA 4GZBA 2Y79A 5JYPA 2ZMAA 3G2ZA 4WMCA 4GHIA 4LV2A 3CPTA 3G34A 3MKFA 3C38A 4I5SA 5GLAA 1LL5A 1F98A 1XGJA 1K54A 3S7OA 3HBRA 4PHTA 2ZM0A 4KUKA 1IYOA 2WGIA 1VB6A 5C5KA 2XDMA 1RGZA 2XGNA 2M1CA 1FCOA 4HQAA 4YOFA 4QWOA 1KVLA 4PM8A 3T1XA 2OLVA 1K4EA 1HLUP 1XA7A 3MXSA 3T4SA 1MZUA 5AQAA 4QHCA 1CK3A 5CGWA 1GSWA 2W0NA 4X55A 1LLBA 1M40A 1TS8A 3HLEA 3C7VA 2G2UA 3T12B 2JN7A 4C75A 4LPZA 1S1ZA 1YSPA 3UE1A 1OTEA 1RP5A 1TS0A 4MNRA 5M1AA 3F1OA 4KQDA 1K6SA 3FWLA 5GHZA 4QY5A 1FSYA 5HD3A 4R4SA 3G4PA 3M2JA 3E98A 5HAPA 2IWCA 2WYXA 4WEKA 4MEZA 3NDGA 1YMXA 4JXGA 4I3AA 1YQSA 3BW6A 3IS2A 2J3TC 2O99A 1YM1A 3ZVWA 2OOLA 5FI7A 3FPVA 2W3FA 5EM1A 3VOZA 1VETA 2QPNA 3HLDA 2K7SA 3LY4A 3CI6A 2Y55A 2Q0OA 4EETB 4KENB 1IELA 3IBRA 3NC8A 4KG6A 2XK1A 5F1FA 3LI8A 1W8QA 4XUXA 2QYBA 1K55C 2XQZA 1YLJA 1AWIA 5EFWA 5AVFA 3A3EA 4UA6A 1ES2A 4AFIA 2QZ6A 1ZHHB 4OPRA 2ACGA 5FAQA 1I2WA 2D02A 4HESA 5IS1A 2PDRA 3C7UA 4Q0IA 5K5BA 4HP4A 3W2ZA 4EUVA 2VV7A 3ZG8B 5CECA 3NDEA 4UAAA 3A3FA 2QMIA 2V9AA 4I3JA 2JCHA 3OPRA 3CMZA 4N9LA 3T4JA 3UB7A 4DJ3A 3AGDA 2PBDP 3PBQA 4X1LA 3LFVA 3NI9A 2W3DA 4GHIB 3LIDA 3E4PA 5JYOA 1MKIA 4HP9A 3C4PA 3BY9A 3CPTB 3NY4A 5M18A 2PD8A 1PI4A 2A24A 3PBNA 3W4PA 2Y2JA 2ZQAA 4IUKA 3CUEA 2WKQA 5L07A 3KSGA 1NLYA 1ALQA 4NXFA 4BQMA 1TDGA 2JKTM 1D1JA 4MCWA 1MXOA 1E25A 4S2MA 2ZD8A 3OBFA 2PR6A 3VP3A 4FTXA 4DE0A 2Q9NA 5A8BA 4JGQA 3T4QA 2PAVP 1KE4A 3VV4A 4S2NA 5HWTA 4MBKA 3UDXA 1S1YA 2HDQA 1DP8A 4GJ4A 2PBYA 1A0KA 3D3OA 5L09A 4HJ6A 5E43A 4OOYA 1LSXA 3EGDC 3C8CA 2I72A 3EGXC 3F1OB 4HHDA 5HPIA 3T1QB 3A0RA 3A3JA 1YMSA 1KOUA 3KSFA 4GDNA 3QP5A 5E2FA 1KDWA 4X53A 3MF0A 3IS2B 3SZTA 3CAXA 4KZ5A 2PU2A 2WKEA 1H8YA 3IF6C 3DTKA 4JXWA 4N1HA 3MFXA 2Y8HA 1VETB 1L0EA 2H0TA 4IBRA 1H8ZA 5CERA 4U0XA 5HD5A 1GSXA 1ZG6A 2ZM2A 2Y2NA 4LV0A 1OTBA 5DFYA 4Y5FA 5FA7A 4MBHA 3OZHA 4I38A 2B5RA 4RX2A 3N8SA 1FCMA 2HGVA 1K57A 3DTEA 4LRYC 4QJGA 3IX4A 1YAXA 2P74A 3SS3A 3PXPA 4B88A 3CITA 4ZBEA 1JNUA 4OOMA 1G5UA 3PBTA 1FOFA 3FKWA 4ME4A 1H8MA 1SDNA 1YSQA 3ISGA 4PM7A 3IWIA 3HUOA 5A90A 2FFFB 4KG5A 3MKEA 3IHBA 3VFFA 2EXBA 1P9RA 2AVXA 4ZRRA 1F5MA 2Z6CA 3IXBA 3OCLA 4FCFA 2OWHA 3GTCA 1K56D 5AQBA 2X71A 3C2WA 4KZ6A 1JVJA 2P9VA 4NEED 5HL1A 5AQ9A 5M19A 1G6AA 4GN2A 3A0VA 3GQZA 5HZHA 1O07A 1ZC2A 1KGGA 3MXRA 1XKZA 2K2NA 4GNUA 3LIAA 2J8YA 3GSGA 3C30A 3EEAA 1W63M 4KZ7A 4OQHA 4DDSA 2HP9A 3E4QA 4KZ3A 4FOFA 2BG1A 2ZQCA 2FFYA 1XJ6A 2DNSA 3UMDA 3AGEA 1MBLA 1L0FA 1E3UD 4EBNA 5KSCA 2A24B 4HY8A 3BM6A 4PMAA 2PD7A 5FEFA 3ZGAB 4PM6A 5EE8A 4NK3A 3IBJA 4N9KA 4O8GA 3A3IA 1YLWA 2BTFP 1OT6A 1TDLA 3UPPA 3IWQA 3K3CA 5FQ9A 3Q07A 4C3QA 5CXWA 3N7WA 3UDFA 4P6ZM 2V8CA 2KLIA 4QB8A 3OCNA 3G30A 1UWNX 3F1NB 4K91A 1PW1A 3JVVA 5EOOA 5L8MA 4B9OA 2FH5A 2C5WB 3N4IA 4EU0A 3G6OA 2VKSA 1N9LA 3T4OA 2VLGA 1OTDA 3AGFA 4Y0OA 3LR4A 4CPKA 1YPRA 2VK3A 2LB5A 5L2FA 2R78A 3WS5A 3BWLA 2PT7A 4CLCD 2XH9A 1NRFA 5DKKA 2ZBBA 3Q7VA 3TRCA 2Y2PA 4EQIA 1ES5A 3ZG0A 4E3LA 2QJ7A 2EFUA 1CEFA 2JKRM 4DE3A 2Y2KA 4RYEA 2Y2HA 3K2NA 4EV4A 1T19A 1D06A 2HDRA 1K54C 1K25A 3LCEA 2OWJA 4OP8A 1XA1A 5FASA 4YWZA 4RA7A 2QKPA 1UGUA 2DMWA 3CWFA 1E4DA 1CQAA 1LL8A 3KYZA 4JGPA 5F68A 4EBPA 3T1RA 3H82A 3TG9A 2PYRA 4K0XA 3BJNA 1W7FA 3C5AA 5F69A 2FZ0A 4FH4A 2WGVA 4B4ZA 4DRTA 2XFTA 4E6XA 3HUNA 1Y54A 3UB9A 3E2KA 5EVIB 2BASA 4ZTKA 2XA7M 1BSGA 3IXDA 2VGJA 5GLBA 2P9VB 4ZDXA 3BFCA 2WGWA 2Y2LA 4MLLA 5I5LA 2Q9MA 3Q7ZA 1WE4A 1T1BA 2V1BA 5DF9A 2PRFA 1XJ4A 5CHJA 4NG2A 4MN7A 1KDSA 5IU1A 3NJAA 3R7WA 5KMWA 2ZQ9A 5CGXA 1H3QA 4OQIA 1SZVA 3BECA 1HZOA 3TE8A 4FUWA 1Z6FA 1SCWA 2B02A 4X6TA 3LR3A 4PKYA 3WS2A 2MJ6A 3V3SA 3ZG5A 2LB9A 3C4OA 3UY6A 3TJZC 2P7JA 1OPXA 3HJKA 1K38A 3HREA 4R1GA 3T4LA 3WS4A 4EEPA 1DY6A 2UWXA 4H6JA 1O7EA 4OLGA 4FSFA 2Y4AA 3ZNTA 2W3EA 1NZUA 3ITAA 4H8RA 3UO9A 1LSWA 1MWUA 2Z2LB 2OLUA 4PKYG 5HWVA 2ZLYA 2D01A 3PR6A 4DJ2A 4WELA 4BJPA 3HVFA 3HUMA 2ZOIA 4GKUA 4KZ8A 5GHXA 4YFMA 3DWKA 4ZJ3A 3IX3A 5F1GA 1X0OA 5HW3A 1TVFA 4R0QA 3RJUA 1ONGA 1BT5A 1MWSA 3RTYA 2UV0E 5EV0A 4WEJA 3HL9A 1XX2A 1OTAA 3O87A 5EPHA 3QP6A 1VM1A 3Q7VB 5EVLA 1N9OA 2W3GA 3OPPA 4X1MA 5TGFA 4QD4A 4BL3A 3FZCA 3B47A 4JBFA 3D9YA 2V0UA 4L0LA 1K6RA 5HDDA 5DTSA 1S4RA 1KGFA 3BYDA 5DJTA 2OAP1 3RXWA 2M7VA 3DAVA 3BLMA 4QY6A 4KZ4A 3SH7A 1PW8A 2C6WB 2EXAA 5TFQA 3DTMA 1K4FA 3D4FA 3TW8A 3ZG7B 3VE3A 4XT2A 1NYYA 2YKFA 1DP6A 5MC7A 4ARZA 4R38A 3H82B 4OH0A 3KO6A 4K08A 4U0TA 2OV5A 3QP8A 4P6ZS 1BTLA 4S2NC 4BWIA 2DRWA 3A3DA 2H28A 2JBFA 3S4XA 5E2EA 1JTDA 1BLPA 2P08A 4IEDA 3IXHA 3ZYTA 2L1MA 3NHQA 3U2AA 4OPYA 5EM0A 3BQ8A 2W27A 2ZQDA 1K56A 4KQQA 3IF5A 1JWVA 1TS7A 4OVDA 5HPFA 1G6OA 1P0ZA 1IOUA 2JKTI 4D60A 1GA9A 3H7WA 5FDSA 3L7HA 1PIOA 2ZQ8A 4X69A 3DTIA 5FDHA 1TD5A 4MBFA 4BBUA 2K31A 1E3UA 4Z9QA 3NECA 4GDBA 2XSSA 3G31A 1Q2PA 1OT9A 1NLZA 1S0WA 1ODVA 2J3WA 3RFBA 3IH9A 4H6JB 2WKHA 5GL9A 4P85A 2GX5A 2WZZA 3BFFA 5FQJA 4WN5A 4RQ9A 3BFDA 1XFQA 4PPRA 1FQGA 4BD1A 1K0KA 5G4YA 4UQIS 4IHQA 4N1XA 3MQQA 5EVIC 3EQUA 4EBLA 4QPRA 4LV1A 2WUQA 1KGEA 3BEBA 3UPNA 4DE2A 1F2KA 3SH9A 3W8KA 2CC1A 4HI4A 3OOVA 5CHMA 5F6AA 4DE1A 2EFXA 3GECA 3D72A 2WZXA 2NUTC 3QP2A 5F5YA 3KX0X 1S4SA 4CJNA 4HOIA 4I39A 1SHVA 5E2HA 2X02A 1QMEA 1BULA 4CLCA 3IX8A 3B3XA 5DTKA 4LV3A 3UB8A 5I94A 4LRXC 3LIEA 3UMEA 3EWKA 3K3DA 3V3RA 4E3KA 4OP5A 4D2OA 4GOGA 1J3WA 3V39A 2RL3A 1FR6A 2OSUA 3PHYA 4BMWA 1G28A 1FILA 3WRZA 3GMWA 1H5XA 1SDEA 4UEYA 4JXSA 4C6YA 2QJ5A 1WA9A 4ARZB 3QHYA 4LFUA 5AQ7A 3E4OA 3KYQA 4OPQA 5G18A 2W1TA 4JF5A 4WZ4A 4WF0A 3E2LA 5DFXA 4GCZA 4Y3IA 3IHAA 2YKHA 3UB5P 1ESIA 4B93A 2XRNA 2X01A 1LI9A 1DJBA 1NWZA 2VGKA 3LR0A 1XJ3A 4WLAA 3VP1A 1JWPA 4E3IA 3LICA 1XP4A 1YLTA 2KDKA 3UB6A 1HVBA 5FAPA 4Q0HA 3NULA 4BL2A 3O86A 3FG8A 1MWTA 3FV7A 3S22A 2M7UA 3LGOA 4O7DA 1TF1A 2XR0A 4EEUA 3M6HA 4E3OA 3LIFA 1BZAA 3QNCA 2ZQ7A 3B42A 3VOLA 4HJ4A 2B95A 3EEHA 4EXOA 4Y0TA 1IYQA 1VHMA 4IVKA 4XUZA 2J3TD 5TJJA 2G2WA 3VE4A 3EOIA 2A3UA 3V5MA 4DF6A 1PFLA 2ZC3B 4BENA 4O0PA 4NXBA 4HBTA 4WL9A 3BFGA 2JKFA 3W4QA 1ACFA 1IYPA 4HJ3A 2HP6A 3IF6A 3VP2A 1J9MA 1BLSA 3M6BA 3PBSA 4R3AA 5J4EA 4U3TA 5HAIA 2Y2IA 3MBZA 4Y2FA 3G32A 5HDCA 3L9KA 4ZJ2A 5EECA 3MR0A 2H10A 5TBMA 2XF3A 2EWWA 5FEGA 4K0WA 4ZAMA 2JKRI 1KVMA 4WZ5A 5AVEA 2EX2A 4GD6A 2HDSA 5DJUA 3VP0A 4YNRA 3ZFZA 2PYPA 4RX3A 1KE3A 1OMEA 5DF8A 3CG5A 5CTNA 5FATA 2V2FF 4PM9A 4E3JA 2E8JA 1V9ZA 1YLPA 1RGYA 1IKIA 4KZ9A 3IWOA 4CLCB 3OPHA 3O88A 4S2KA 5HARA 4E3MA 4S2LA 3FKVA 4Y13A 4RVAA 2EX6A 2ZC6B 3M2KA 3T4TA 4LRZE 4G3VA 3V50A 3NOTC 5J8XA 2V1ZA 1W5DA 4BLMA 4X56A 4YINA 3UPOA 3TOIA 5FQKA 1EW0A 1IEMA 5TR7A 1MC0A 1KE0A 1WYCA 2VJWA 4JPMA 2VGLM 1ZTUA 4L9FA 1PI5A 1V9YA 1FSWA 3PAEA 2PHYA 2J9PA 2W1TB 2GNXA 5FQQA 3P01A 3NOPC 1EROA 3VSLA 1MWRA 2G7UA 3W4OA 4EUZA 4Y17A 1PWDA 3VMAA 4IUHA 1IKGA 1PWGA 3LI9A 1FCNA 3G2YA 3VOYA 4Y0UA 1P9WA 5IHVA 2BLSA 4OOLA 1STZA 2GJ3A 2HV1A 5FQMA 1Y28A 5CRFA 2A2LA 4WBGA 5HX9A 2XLNA 5D3OA 3N8RA 4X68A 4B4XA 4S2IA 1F9IA 1EI5A 3BRMA 4KQRA 5GLDA 5EVEA 1Q2QA 2JHEA 1YKDA 5J3WA 4ZJ1A 4M3KA 4EQ1A 4DMZA 3QP1A 2V20A 4XXRA 1HTZA 2QWSA 3NBLA 3LEQA 1NZOA 1UWPX 3IF6B 2J80A 4NETA 1T1CA 2Z2MB 2Y59A 3ZCZA 5BOHA 1I2SA 3WWXA 4OLDA 5DVAA 3MXQA 5AJGA 5FSRA 3SS5A 3HLWA 3MZDA 4KUOA 5TBMB 4LLOB 4OQ0A 4OONA 3MFDA 2V0WA 5F83A 5CX7A 4F3LA 3GDIA 5KZHA 1PZOA 3GR2A 2PU4A 4KG2A 3VFHA 5FI6A 2EX8A 3JYIA 1OTIA 1GSVA 3Q82A 3O3VA 3MJQA 4JF6A 4HIAA 4M4XA 2R9XA 3VP4A 1OJGA 1XPBA 2HZ5A 2WADA 3A0SA 2WAFA 3LY3A 3CUEC 5CEBA 5HWWA 1BYWA 2EWVA 3LEZA 2Y2GA 4Y7PA 1TS6A 4F94A 4EESA 3EQVA 1MPLA 2KOIA 4GLQA 2J7VA 3BLSA 2XEPA 1ES4A 4R6LA 3S7PA 4UA9A 4IBXA 2W1RA 5FAOA 3ZVTA 5KSHA 1MY8A 3SH8A 1Z09A 1N9BA 1BUEA 3LUQA 4EWFA 3IQAA 3QP4A 2ZC5B 4PM5A 1MKMA 4E6WA 2O0YA 1XXMA 3NCKA 4N92A 3MMHA 2INWA 3CLOA 4FH2A 1SKFA 5L10A 2V1AA 1VEUA 3HLCA 2ZJ9A 2WK0A 1YLZA 3E0YA 2HDUA 1FR1A 4Q8IA 2W3HA
chains in the Genus database with same CATH topology
4BMWA 4I5SA 1G28A 3LR5A 1F98A 4GS9A 3S7OA 4UEYA 1XFNA 4PHTA 3B33A 2Z6DA 3LR4A 3MQ0A 4KUKA 2QJ5A 1OJ5A 2O9CA 5G4ZA 2VV6A 1WA9A 2LB5A 4CLCC 1VB6A 5C5KA 4ARZB 2R78A 5LBRA 3R7WB 4MN6A 3BWLA 3P7NA 2PT7A 4CLCD 2M1CA 3E4OA 5DKKA 3KYQA 4HQAA 4YOFA 2W1TA 2ZBBA 3HCYA 3TRCA 4WF0A 4CLCE 2QJ7A 2JKRM 5DFXA 4GCZA 4Y3IA 2YKHA 3K2NA 3T4SA 4B93A 2XRNA 1MZUA 1T19A 1NWZA 1D06A 3LR0A 1XJ3A 4WLAA 1GSWA 2W0NA 2OWJA 3LICA 1TS8A 2OAQ1 3PYPA 2PR5A 4YWZA 3UB6A 2KDKA 2JN7A 4LPZA 2QKPA 4Q0HA 1S1ZA 1UGUA 2DMWA 3CWFA 3FG8A 1YSPA 2VGLS 2M7UA 1OTEA 2WKPA 5HSQA 3KYZA 1LL8A 1TS0A 4JGPA 5F68A 3F1OA 4KQDA 1TF1A 4CQHA 4EEUA 1LT0A 3H82A 3LIBA 5HD3A 3LIFA 2PYRA 4ETZA 5KIZA 3BJNA 2HJEA 3E98A 2ZMFA 3F1PA 3B42A 5F69A 2FZ0A 3VOLA 4WEKA 4HJ4A 4I3IA 4I3AA 3BW6A 3UE3A 3IS2A 2J3TC 3EEHA 2O99A 2GZAA 4EXOA 1VHMA 2J3TD 2OOLA 2XA7S 3F1NA 3NOUC 5TJJA 4F3LB 3FPVA 3VE4A 3EOIA 2W3FA 4EERA 3UE6A 3V67A 3UB9A 2BASA 3FPWA 4NXGA 4O0PA 2K7SA 2XA7M 4NXBA 4WL9A 4L9GA 5I5LA 3CI6A 1T1AA 4HJ3A 4MN5A 4EETB 3IBRA 3KSHA 1T1BA 2V1BA 3PBSA 5DF9A 1XJ4A 4R3AA 3LI8A 4MN7A 5J4EA 4Y2FA 5IU1A 4EW7A 3NJAA 3R7WA 5HDCA 2QYBA 1H3QA 3MR0A 2VEAA 5IT5A 2ZOHA 5EFWA 5AVFA 5TBMA 1DP9A 2EWWA 4ETXA 4AFIA 3MQOA 3BY8A 3TE8A 1ZHHB 3FC7A 2P04A 2B02A 2JKRI 5AVEA 3LR3A 4PKYA 4E04A 2D02A 2VX8A 5IS1A 5DJUA 3S7QA 2EA9A 2HJ9C 2PDRA 2MJ6A 2LB9A 4Q0IA 4YNRA 5K5BA 3O5YA 3BQAA 3LYXA 1N9NA 2PYPA 3TJZC 2P7JA 1OPXA 3HJKA 4II7A 4XT2B 4HP4A 4G3WA 3T4LA 3W2ZA 4EUVA 4EEPA 2VV7A 1V9ZA 4H6JA 2V9AA 4FSFA 4I3JA 2O9AA 2W3EA 4L9EA 3T4JA 4CLCB 4KQOA 1LSWA 3UB7A 4DJ3A 5J7EA 3PBQA 4PKYG 5HWVA 4GW9A 3LFVA 4BBVA 2D01A 2W3DA 4GHIB 3LIDA 3E4PA 3PR6A 5HDSA 1P97A 4HP9A 4DJ2A 3BY9A 4WELA 3T4TA 2PD8A 2A24A 4LRZE 4G3VA 3PBNA 2HF6A 4BJPA 2ZOIA 3NOTC 4NKPA 4IUKA 3CUEA 2WKQA 4PAUA 3KSGA 1NLYA 1DRMA 1LSVA 4GS9B 4BBTA 1X0OA 4NXFA 1S66L 3SW1A 1EW0A 1MC0A 2JKTM 4MCWA 2VJWA 3RTYA 2VGLM 1ZTUA 4WEJA 4L9FA 3H7WB 3OBFA 1OTAA 2PR6A 1V9YA 4Q0JA 2PHYA 2W1TB 5A8BA 2GNXA 4HNBA 1N9OA 2W3GA 3P01A 4JGQA 3NOPC 3R4KA 4MDZA 3T4QA 2G7UA 3T50A 3B47A 3VV4A 5HWTA 2V0UA 4L0LA 5HDDA 4IUHA 4Z1WA 1S1YA 3LI9A 3KSIA 1S4RA 5DJTA 2OAP1 1DP8A 4GJ4A 2M7VA 3ICYA 1P9WA 2L0WA 4HH3A 3T4KA 3D3OA 2XROA 4OOLA 4HJ6A 1LSXA 1STZA 2GJ3A 2HV1A 3TW8A 3VE3A 3EGDC 1T18A 3C8CA 3HJIA 2VA0A 1Y28A 4XT2A 3EGXC 3F1OB 2YKFA 1DP6A 5MC7A 5HL6A 4HHDA 4ARZA 2A2LA 2VV8A 3H82B 4R38A 3ZQ5A 5HPIA 1D7EA 3A0RA 3KO6A 4K08A 4P6ZS 5DKLA 4BWIA 1KOUA 3KSFA 1F9IA 2H28A 3F1PB 3H9WA 1S67L 1XJ2A 3MF0A 3IS2B 2JHEA 1YKDA 5J3WA 2P08A 1NRJA 3CAXA 3ZYTA 2B18A 2L1MA 4EQ1A 4DMZA 1W63Q 3MFXA 3NHQA 2CMNA 3U2AA 2Y8HA 3BQ8A 2QWSA 2W27A 2KX6A 5HD5A 1GSXA 2IA2A 3PBOA 4JGOA 1OTBA 5DFYA 1UWPX 2J80A 4Y5FA 1TS7A 4I38A 1T1CA 3ULFA 5HPFA 1G6OA 1P0ZA 4HH2A 3DBAA 1IOUA 2HGVA 2JKTI 5FL3A 4LRYC 3OC2A 2ZMVA 3H7WA 3MXQA 5AJGA 1YAXA 3OLOA 3PXPA 2O9BA 4WUJA 3CITA 1JNUA 4OOMA 4KUOA 3PBTA 5TBMB 4LLOB 4ME4A 1H8MA 4NXEA 1YSQA 1TD5A 2V0WA 4BBUA 5CX7A 2K31A 4F3LA 1P9RA 3GDIA 4ZRRA 2XSSA 1F5MA 2Z6CA 3OCLA 3RH8B 2OWHA 1OTIA 1GSVA 4G3KA 1OT9A 3C2WA 1NLZA 3MJQA 4NEED 2WKRA 1ODVA 2J3WA 4O01A 3A0VA 3RFBA 4H6JB 4HIAA 5HZHA 4M4XA 1OJGA 3JVUA 2GX5A 4WN5A 3S7NA 2QHKA 3A0SA 4RQ9A 2K2NA 1XFQA 4DN0A 3LIAA 3CUEC 5HWWA 3C30A 3EEAA 1W63M 1BYWA 2EWVA 5G4YA 3E4QA 4UQIS 4FOFA 4MMNA 4IHQA 1XJ6A 2L4RA 3UMDA 1TS6A 3MQQA 4EESA 3EQVA 3EQUA 2KOIA 4GLQA 2A24B 4UQIM 4QPRA 4HY8A 2PD7A 4HI4A 3OOVA 2VZWA 3IBJA 4R6LA 3S7PA 4O8GA 2W1RA 5F6AA 2I9VA 5KSHA 3GECA 3PBRA 3D72A 2NUTC 1OT6A 1IFQA 4IJGA 3K3CA 4JGRA 5F5YA 2NUPC 3LUQA 3KX0X 1S4SA 4HOIA 1MKMA 4I39A 2O0YA 4P6ZM 4CLCA 3MMHA 3UB8A 4R70A 2KLIA 2INWA 3CLOA 3OCNA 2Y79A 1UWNX 3F1NB 4LRXC 3LIEA 3JVVA 3UMEA 3EWKA 3K3DA 4GHIA 2V1AA 5L8MA 4B9OA 2FH5A 4EU0A 3G6OA 3E0YA 2VKSA 1N9LA 3T4OA 2VLGA 1OTDA 2W3HA 3PHYA 3C38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5S A;  1G28 A;  1F98 A;  4GS9 A;  1XFN A;  3B33 A;  2Z6D A;  4KUK A;  2QJ5 A;  1OJ5 A;  5G4Z A;  2VV6 A;  1WA9 A;  1VB6 A;  2R78 A;  4MN6 A;  3BWL A;  3P7N A;  2M1C A;  3E4O A;  5DKK A;  4HQA A;  2ZBB A;  4WF0 A;  2QJ7 A;  4GCZ A;  2YKH A;  1MZU A;  1T19 A;  1NWZ A;  1D06 A;  1XJ3 A;  4WLA A;  1GSW A;  2W0N A;  2OWJ A;  3LIC A;  1TS8 A;  3PYP A;  2PR5 A;  4YWZ A;  3UB6 A;  2KDK A;  2JN7 A;  4LPZ A;  2QKP A;  1S1Z A;  1UGU A;  3CWF A;  3FG8 A;  1OTE A;  2WKP A;  5HSQ A;  1LL8 A;  1TS0 A;  4JGP A;  5F68 A;  3F1O A;  4KQD A;  4EEU A;  1LT0 A;  3H82 A;  3LIB A;  5HD3 A;  3LIF A;  2PYR A;  5KIZ A;  3F1P A;  5F69 A;  3VOL A;  4HJ4 A;  4I3I A;  4I3A A;  3IS2 A;  3EEH A;  4EXO A;  2OOL A;  3NOU C;  3F1N A;  4F3L B;  3VE4 A;  4EER A;  3UE6 A;  3UB9 A;  2BAS A;  4NXG A;  2K7S A;  4NXB A;  4WL9 A;  4L9G A;  5I5L A;  1T1A A;  4HJ3 A;  4MN5 A;  4EET B;  3IBR A;  1T1B A;  2V1B A;  1XJ4 A;  4R3A A;  3LI8 A;  5J4E A;  5IU1 A;  4EW7 A;  3NJA A;  5HDC A;  3MR0 A;  2VEA A;  2ZOH A;  5EFW A;  5AVF A;  5TBM A;  1DP9 A;  3MQO A;  3BY8 A;  3FC7 A;  2B02 A;  5AVE A;  4PKY A;  4E04 A;  2D02 A;  5IS1 A;  5DJU A;  2EA9 A;  2PDR A;  3LYX A;  1N9N A;  2PYP A;  2P7J A;  3HJK A;  4XT2 B;  4HP4 A;  4EEP A;  2VV7 A;  1V9Z A;  4H6J A;  2V9A A;  4I3J A;  4L9E A;  1LSW A;  3UB7 A;  4DJ3 A;  5J7E A;  4PKY G;  5HWV A;  4GW9 A;  4BBV A;  2D01 A;  4GHI B;  3LID A;  3E4P A;  5HDS A;  1P97 A;  4HP9 A;  4DJ2 A;  3BY9 A;  2PD8 A;  2A24 A;  4LRZ E;  2ZOI A;  3NOT C;  2WKQ A;  1DRM A;  1LSV A;  4GS9 B;  4BBT A;  1X0O A;  4NXF A;  1S66 L;  3SW1 A;  1EW0 A;  3RTY A;  4L9F A;  3H7W B;  1OTA A;  2PR6 A;  1V9Y A;  2PHY A;  5A8B A;  4HNB A;  1N9O A;  4JGQ A;  3NOP C;  3T50 A;  5HWT A;  2V0U A;  5HDD A;  1S1Y A;  3LI9 A;  1S4R A;  5DJT A;  1DP8 A;  3ICY A;  2L0W A;  4HH3 A;  4HJ6 A;  1LSX A;  2GJ3 A;  2HV1 A;  3VE3 A;  1T18 A;  3C8C A;  3HJI A;  1Y28 A;  4XT2 A;  3F1O B;  2YKF A;  1DP6 A;  4HHD A;  3ZQ5 A;  2VV8 A;  3H82 B;  4R38 A;  1D7E A;  3A0R A;  4K08 A;  5DKL A;  1KOU A;  1F9I A;  2H28 A;  3F1P B;  3H9W A;  1S67 L;  1XJ2 A;  3IS2 B;  2JHE A;  5J3W A;  3CAX A;  2L1M A;  4EQ1 A;  3MFX A;  3NHQ A;  2CMN A;  2QWS A;  2W27 A;  2KX6 A;  5HD5 A;  1GSX A;  4JGO A;  1OTB A;  1UWP X;  2J80 A;  1TS7 A;  4I38 A;  1T1C A;  3ULF A;  4HH2 A;  1P0Z A;  4LRY C;  3H7W A;  3MXQ A;  3OLO A;  4WUJ A;  1JNU A;  4KUO A;  5TBM B;  4LLO B;  4NXE A;  2V0W A;  4BBU A;  4F3L A;  3GDI A;  2Z6C A;  3RH8 B;  2OWH A;  1OTI A;  1GSV A;  1OT9 A;  3C2W A;  3MJQ A;  2WKR A;  1ODV A;  3A0V A;  4H6J B;  4HIA A;  5HZH A;  4M4X A;  1OJG A;  4WN5 A;  2QHK A;  3A0S A;  4RQ9 A;  1XFQ A;  3LIA A;  5HWW A;  1BYW A;  5G4Y A;  3E4Q A;  1XJ6 A;  2L4R A;  3UMD A;  1TS6 A;  3MQQ A;  4EES A;  2A24 B;  4HY8 A;  2PD7 A;  4HI4 A;  4R6L A;  5F6A A;  2I9V A;  3GEC A;  3D72 A;  1OT6 A;  3K3C A;  4JGR A;  5F5Y A;  3LUQ A;  3KX0 X;  1S4S A;  4HOI A;  4I39 A;  3UB8 A;  4R70 A;  2INW A;  3CLO A;  1UWN X;  3F1N B;  4LRX C;  3LIE A;  3UME A;  3EWK A;  3K3D A;  4GHI A;  2V1A A;  4B9O A;  3G6O A;  1N9L A;  2VLG A;  1OTD A;  3PHY A; 
#chains in the Genus database with same CATH topology
 3SOI A;  2WGW B;  3LR5 A;  2H0Y A;  2Y91 A;  4GS9 A;  1XFN A;  3B33 A;  2Z6D A;  3MQ0 A;  1OJ5 A;  2O9C A;  5G4Z A;  2VV6 A;  3UE0 A;  3UNW A;  4CLC C;  5LBR A;  3R7W B;  3UDI A;  4MN6 A;  3P7N A;  4GD8 A;  3ZDJ A;  2XD1 A;  3HCY A;  3CHW P;  4CLC E;  3P09 A;  4WMC D;  1N4O A;  2JE5 A;  2EX9 A;  2Y2M A;  3MSH A;  3BFE A;  4LCM A;  3GRJ A;  1CJF A;  2OAQ 1;  3PYP A;  2PR5 A;  1K57 C;  1SKO A;  1QMF A;  3T1S A;  1L0G A;  2VGL S;  2WKP A;  1ONH A;  2ZM8 A;  5HSQ A;  1GHP A;  5FI2 A;  4CQH A;  1WYB A;  3MS6 A;  1LT0 A;  4LCL A;  3LIB A;  4QU3 A;  4ETZ A;  5KIZ A;  2HJE A;  3PTE A;  4ESP A;  2ZMF A;  3F1P A;  1LI0 A;  2XD5 A;  1YT4 A;  1NXY A;  4I3I A;  3UE3 A;  2GZA A;  2ZC4 B;  3CJM A;  2RCX A;  4JLF A;  3RXX A;  2XA7 S;  3NOU C;  1K55 A;  3F1N A;  5GLC A;  4F3L B;  4EER A;  3TSG A;  3UE6 A;  3V67 A;  1W79 A;  3FPW A;  4NXG A;  1YLY A;  4IVI A;  1JWZ A;  1BLH A;  4L9G A;  1T1A A;  4JXV A;  4MN5 A;  1PYY A;  3KSH A;  1PRQ A;  2XFS A;  1GCE A;  4WM9 A;  5GHY A;  1EWZ A;  4GB7 A;  4EW7 A;  5DF7 A;  1DJA A;  2VEA A;  5IT5 A;  1I5Q A;  2ZOH A;  3QNB A;  1DP9 A;  1JTG A;  3VSK A;  4ETX A;  3MQO A;  3BY8 A;  3FC7 A;  2P04 A;  3PAG A;  5F82 A;  4E04 A;  2VX8 A;  1PNE A;  3S7Q A;  2EA9 A;  2HJ9 C;  1NJ4 A;  2V8F A;  3UN7 A;  3O5Y A;  2IWD A;  3BQA A;  3LYX A;  1N9N A;  1U60 A;  2J9O A;  4X25 A;  4II7 A;  4XT2 B;  1Y4O A;  4G3W A;  3FYZ A;  3GVB A;  1ERQ A;  4UA7 A;  1CI9 A;  1TEM A;  2O9A A;  5HFO A;  2ZL1 A;  4LEN A;  4L9E A;  4KZB A;  5CGS A;  4KQO A;  2IWB A;  5J7E A;  3CZD A;  5CTM A;  4WZ5 C;  1LHY A;  4S2O A;  4GW9 A;  4BBV A;  1VEU B;  5HDS A;  1P97 A;  1NY0 A;  2HF6 A;  5A92 A;  4NKP A;  4DXB A;  1GA0 A;  4PAU A;  3HLG A;  1DRM A;  1LSV A;  4GS9 B;  4BBT A;  4JF4 A;  1S66 L;  3SW1 A;  5EVI A;  1H0M A;  4R4R A;  1S6R A;  3NIA A;  1CI8 A;  3H7W B;  4Q0J A;  4BD0 A;  4FD8 A;  3MZE A;  4HNB A;  4WYY A;  2Y2O A;  3R4K A;  4MDZ A;  1L3L A;  2WAE A;  5DTT A;  3T50 A;  3ZNY A;  3IT9 A;  4Z1W A;  3KSI A;  1PWC A;  3WS1 A;  5HAQ A;  4E3N A;  1ZG4 A;  3JPU A;  3ICY A;  4A5R A;  2L0W A;  4HH3 A;  3T4K A;  4DDY A;  4P0M A;  2XRO A;  1SKO B;  4HEF A;  3KYE A;  4S2P A;  1T18 A;  3HJI A;  2VA0 A;  1CF0 A;  5HL6 A;  2VV8 A;  3ZQ5 A;  1D7E A;  5DKL A;  3SS4 A;  3F1P B;  3N8L A;  3WS0 A;  3H9W A;  1GHM A;  1S67 L;  1VQQ A;  1XJ2 A;  1ZKJ A;  2A49 A;  1NRJ A;  5CHU A;  5FQI A;  2H5S A;  3HLF A;  2B18 A;  1W63 Q;  5E2G A;  4KZA A;  2CMN A;  2DCF A;  4P87 A;  4S2J A;  2KX6 A;  3U4L P;  3GV9 A;  2IA2 A;  3PBO A;  4JGO A;  1AXB A;  3IXG A;  3ZHH A;  1M6K A;  4OKP A;  3ULF A;  5CED A;  4HH2 A;  2ZC7 A;  3DBA A;  2E8I A;  5A91 A;  1IYS A;  5FL3 A;  3DWZ A;  3OC2 A;  2ZMV A;  3LO7 A;  3OLO A;  2O9B A;  1L2S A;  4R3B A;  4WUJ A;  2HPB A;  1PZP A;  4OQG A;  4JKT A;  4NXE A;  4UHU A;  2JKG A;  1ERM A;  2R9W A;  2Y2Q A;  3ZG9 B;  1NYM A;  3RH8 B;  5U47 A;  4G3K A;  4Y15 A;  4R3J A;  2WKR A;  3HLB A;  3OPL A;  4O01 A;  4LGW A;  4P6B A;  3ITB A;  3JVU A;  2ZL1 B;  2JC7 A;  2QHK A;  3S7N A;  1FIK A;  2GDN A;  4DN0 A;  3MZF A;  1LL9 A;  3I7J A;  3N6I A;  3S1Y A;  1XGI A;  4MMN A;  1ES3 A;  1L0D A;  4ID4 A;  2L4R A;  1RCJ A;  2HP5 A;  4DXC A;  1HD8 A;  4HBU A;  4UQI M;  3DW0 A;  5EVI D;  4DKI A;  1G68 A;  3Q1F A;  2WKI A;  1BLC A;  4R23 A;  3P98 A;  2VZW A;  5EUA A;  1ESU A;  1CEG A;  2I9V A;  3PBR A;  5EOE A;  1DJC A;  1IFQ A;  4IJG A;  4JGR A;  1W8Y A;  3Q81 A;  4OPZ A;  2NUP C;  3WRT A;  1C3B A;  5A93 A;  3G35 A;  4R70 A;  3IH8 A;  1GHI A;  4GZB A;  2Y79 A;  5JYP A;  2ZMA A;  3G2Z A;  4WMC A;  4GHI A;  4LV2 A;  3CPT A;  3G34 A;  3MKF A;  3C38 A;  4I5S A;  5GLA A;  1LL5 A;  1F98 A;  1XGJ A;  1K54 A;  3S7O A;  3HBR A;  4PHT A;  2ZM0 A;  4KUK A;  1IYO A;  2WGI A;  1VB6 A;  5C5K A;  2XDM A;  1RGZ A;  2XGN A;  2M1C A;  1FCO A;  4HQA A;  4YOF A;  4QWO A;  1KVL A;  4PM8 A;  3T1X A;  2OLV A;  1K4E A;  1HLU P;  1XA7 A;  3MXS A;  3T4S A;  1MZU A;  5AQA A;  4QHC A;  1CK3 A;  5CGW A;  1GSW A;  2W0N A;  4X55 A;  1LLB A;  1M40 A;  1TS8 A;  3HLE A;  3C7V A;  2G2U A;  3T12 B;  2JN7 A;  4C75 A;  4LPZ A;  1S1Z A;  1YSP A;  3UE1 A;  1OTE A;  1RP5 A;  1TS0 A;  4MNR A;  5M1A A;  3F1O A;  4KQD A;  1K6S A;  3FWL A;  5GHZ A;  4QY5 A;  1FSY A;  5HD3 A;  4R4S A;  3G4P A;  3M2J A;  3E98 A;  5HAP A;  2IWC A;  2WYX A;  4WEK A;  4MEZ A;  3NDG A;  1YMX A;  4JXG A;  4I3A A;  1YQS A;  3BW6 A;  3IS2 A;  2J3T C;  2O99 A;  1YM1 A;  3ZVW A;  2OOL A;  5FI7 A;  3FPV A;  2W3F A;  5EM1 A;  3VOZ A;  1VET A;  2QPN A;  3HLD A;  2K7S A;  3LY4 A;  3CI6 A;  2Y55 A;  2Q0O A;  4EET B;  4KEN B;  1IEL A;  3IBR A;  3NC8 A;  4KG6 A;  2XK1 A;  5F1F A;  3LI8 A;  1W8Q A;  4XUX A;  2QYB A;  1K55 C;  2XQZ A;  1YLJ A;  1AWI A;  5EFW A;  5AVF A;  3A3E A;  4UA6 A;  1ES2 A;  4AFI A;  2QZ6 A;  1ZHH B;  4OPR A;  2ACG A;  5FAQ A;  1I2W A;  2D02 A;  4HES A;  5IS1 A;  2PDR A;  3C7U A;  4Q0I A;  5K5B A;  4HP4 A;  3W2Z A;  4EUV A;  2VV7 A;  3ZG8 B;  5CEC A;  3NDE A;  4UAA A;  3A3F A;  2QMI A;  2V9A A;  4I3J A;  2JCH A;  3OPR A;  3CMZ A;  4N9L A;  3T4J A;  3UB7 A;  4DJ3 A;  3AGD A;  2PBD P;  3PBQ A;  4X1L A;  3LFV A;  3NI9 A;  2W3D A;  4GHI B;  3LID A;  3E4P A;  5JYO A;  1MKI A;  4HP9 A;  3C4P A;  3BY9 A;  3CPT B;  3NY4 A;  5M18 A;  2PD8 A;  1PI4 A;  2A24 A;  3PBN A;  3W4P A;  2Y2J A;  2ZQA A;  4IUK A;  3CUE A;  2WKQ A;  5L07 A;  3KSG A;  1NLY A;  1ALQ A;  4NXF A;  4BQM A;  1TDG A;  2JKT M;  1D1J A;  4MCW A;  1MXO A;  1E25 A;  4S2M A;  2ZD8 A;  3OBF A;  2PR6 A;  3VP3 A;  4FTX A;  4DE0 A;  2Q9N A;  5A8B A;  4JGQ A;  3T4Q A;  2PAV P;  1KE4 A;  3VV4 A;  4S2N A;  5HWT A;  4MBK A;  3UDX A;  1S1Y A;  2HDQ A;  1DP8 A;  4GJ4 A;  2PBY A;  1A0K A;  3D3O A;  5L09 A;  4HJ6 A;  5E43 A;  4OOY A;  1LSX A;  3EGD C;  3C8C A;  2I72 A;  3EGX C;  3F1O B;  4HHD A;  5HPI A;  3T1Q B;  3A0R A;  3A3J A;  1YMS A;  1KOU A;  3KSF A;  4GDN A;  3QP5 A;  5E2F A;  1KDW A;  4X53 A;  3MF0 A;  3IS2 B;  3SZT A;  3CAX A;  4KZ5 A;  2PU2 A;  2WKE A;  1H8Y A;  3IF6 C;  3DTK A;  4JXW A;  4N1H A;  3MFX A;  2Y8H A;  1VET B;  1L0E A;  2H0T A;  4IBR A;  1H8Z A;  5CER A;  4U0X A;  5HD5 A;  1GSX A;  1ZG6 A;  2ZM2 A;  2Y2N A;  4LV0 A;  1OTB A;  5DFY A;  4Y5F A;  5FA7 A;  4MBH A;  3OZH A;  4I38 A;  2B5R A;  4RX2 A;  3N8S A;  1FCM A;  2HGV A;  1K57 A;  3DTE A;  4LRY C;  4QJG A;  3IX4 A;  1YAX A;  2P74 A;  3SS3 A;  3PXP A;  4B88 A;  3CIT A;  4ZBE A;  1JNU A;  4OOM A;  1G5U A;  3PBT A;  1FOF A;  3FKW A;  4ME4 A;  1H8M A;  1SDN A;  1YSQ A;  3ISG A;  4PM7 A;  3IWI A;  3HUO A;  5A90 A;  2FFF B;  4KG5 A;  3MKE A;  3IHB A;  3VFF A;  2EXB A;  1P9R A;  2AVX A;  4ZRR A;  1F5M A;  2Z6C A;  3IXB A;  3OCL A;  4FCF A;  2OWH A;  3GTC A;  1K56 D;  5AQB A;  2X71 A;  3C2W A;  4KZ6 A;  1JVJ A;  2P9V A;  4NEE D;  5HL1 A;  5AQ9 A;  5M19 A;  1G6A A;  4GN2 A;  3A0V A;  3GQZ A;  5HZH A;  1O07 A;  1ZC2 A;  1KGG A;  3MXR A;  1XKZ A;  2K2N A;  4GNU A;  3LIA A;  2J8Y A;  3GSG A;  3C30 A;  3EEA A;  1W63 M;  4KZ7 A;  4OQH A;  4DDS A;  2HP9 A;  3E4Q A;  4KZ3 A;  4FOF A;  2BG1 A;  2ZQC A;  2FFY A;  1XJ6 A;  2DNS A;  3UMD A;  3AGE A;  1MBL A;  1L0F A;  1E3U D;  4EBN A;  5KSC A;  2A24 B;  4HY8 A;  3BM6 A;  4PMA A;  2PD7 A;  5FEF A;  3ZGA B;  4PM6 A;  5EE8 A;  4NK3 A;  3IBJ A;  4N9K A;  4O8G A;  3A3I A;  1YLW A;  2BTF P;  1OT6 A;  1TDL A;  3UPP A;  3IWQ A;  3K3C A;  5FQ9 A;  3Q07 A;  4C3Q A;  5CXW A;  3N7W A;  3UDF A;  4P6Z M;  2V8C A;  2KLI A;  4QB8 A;  3OCN A;  3G30 A;  1UWN X;  3F1N B;  4K91 A;  1PW1 A;  3JVV A;  5EOO A;  5L8M A;  4B9O A;  2FH5 A;  2C5W B;  3N4I A;  4EU0 A;  3G6O A;  2VKS A;  1N9L A;  3T4O A;  2VLG A;  1OTD A;  3AGF A;  4Y0O A;  3LR4 A;  4CPK A;  1YPR A;  2VK3 A;  2LB5 A;  5L2F A;  2R78 A;  3WS5 A;  3BWL A;  2PT7 A;  4CLC D;  2XH9 A;  1NRF A;  5DKK A;  2ZBB A;  3Q7V A;  3TRC A;  2Y2P A;  4EQI A;  1ES5 A;  3ZG0 A;  4E3L A;  2QJ7 A;  2EFU A;  1CEF A;  2JKR M;  4DE3 A;  2Y2K A;  4RYE A;  2Y2H A;  3K2N A;  4EV4 A;  1T19 A;  1D06 A;  2HDR A;  1K54 C;  1K25 A;  3LCE A;  2OWJ A;  4OP8 A;  1XA1 A;  5FAS A;  4YWZ A;  4RA7 A;  2QKP A;  1UGU A;  2DMW A;  3CWF A;  1E4D A;  1CQA A;  1LL8 A;  3KYZ A;  4JGP A;  5F68 A;  4EBP A;  3T1R A;  3H82 A;  3TG9 A;  2PYR A;  4K0X A;  3BJN A;  1W7F A;  3C5A A;  5F69 A;  2FZ0 A;  4FH4 A;  2WGV A;  4B4Z A;  4DRT A;  2XFT A;  4E6X A;  3HUN A;  1Y54 A;  3UB9 A;  3E2K A;  5EVI B;  2BAS A;  4ZTK A;  2XA7 M;  1BSG A;  3IXD A;  2VGJ A;  5GLB A;  2P9V B;  4ZDX A;  3BFC A;  2WGW A;  2Y2L A;  4MLL A;  5I5L A;  2Q9M A;  3Q7Z A;  1WE4 A;  1T1B A;  2V1B A;  5DF9 A;  2PRF A;  1XJ4 A;  5CHJ A;  4NG2 A;  4MN7 A;  1KDS A;  5IU1 A;  3NJA A;  3R7W A;  5KMW A;  2ZQ9 A;  5CGX A;  1H3Q A;  4OQI A;  1SZV A;  3BEC A;  1HZO A;  3TE8 A;  4FUW A;  1Z6F A;  1SCW A;  2B02 A;  4X6T A;  3LR3 A;  4PKY A;  3WS2 A;  2MJ6 A;  3V3S A;  3ZG5 A;  2LB9 A;  3C4O A;  3UY6 A;  3TJZ C;  2P7J A;  1OPX A;  3HJK A;  1K38 A;  3HRE A;  4R1G A;  3T4L A;  3WS4 A;  4EEP A;  1DY6 A;  2UWX A;  4H6J A;  1O7E A;  4OLG A;  4FSF A;  2Y4A A;  3ZNT A;  2W3E A;  1NZU A;  3ITA A;  4H8R A;  3UO9 A;  1LSW A;  1MWU A;  2Z2L B;  2OLU A;  4PKY G;  5HWV A;  2ZLY A;  2D01 A;  3PR6 A;  4DJ2 A;  4WEL A;  4BJP A;  3HVF A;  3HUM A;  2ZOI A;  4GKU A;  4KZ8 A;  5GHX A;  4YFM A;  3DWK A;  4ZJ3 A;  3IX3 A;  5F1G A;  1X0O A;  5HW3 A;  1TVF A;  4R0Q A;  3RJU A;  1ONG A;  1BT5 A;  1MWS A;  3RTY A;  2UV0 E;  5EV0 A;  4WEJ A;  3HL9 A;  1XX2 A;  1OTA A;  3O87 A;  5EPH A;  3QP6 A;  1VM1 A;  3Q7V B;  5EVL A;  1N9O A;  2W3G A;  3OPP A;  4X1M A;  5TGF A;  4QD4 A;  4BL3 A;  3FZC A;  3B47 A;  4JBF A;  3D9Y A;  2V0U A;  4L0L A;  1K6R A;  5HDD A;  5DTS A;  1S4R A;  1KGF A;  3BYD A;  5DJT A;  2OAP 1;  3RXW A;  2M7V A;  3DAV A;  3BLM A;  4QY6 A;  4KZ4 A;  3SH7 A;  1PW8 A;  2C6W B;  2EXA A;  5TFQ A;  3DTM A;  1K4F A;  3D4F A;  3TW8 A;  3ZG7 B;  3VE3 A;  4XT2 A;  1NYY A;  2YKF A;  1DP6 A;  5MC7 A;  4ARZ A;  4R38 A;  3H82 B;  4OH0 A;  3KO6 A;  4K08 A;  4U0T A;  2OV5 A;  3QP8 A;  4P6Z S;  1BTL A;  4S2N C;  4BWI A;  2DRW A;  3A3D A;  2H28 A;  2JBF A;  3S4X A;  5E2E A;  1JTD A;  1BLP A;  2P08 A;  4IED A;  3IXH A;  3ZYT A;  2L1M A;  3NHQ A;  3U2A A;  4OPY A;  5EM0 A;  3BQ8 A;  2W27 A;  2ZQD A;  1K56 A;  4KQQ A;  3IF5 A;  1JWV A;  1TS7 A;  4OVD A;  5HPF A;  1G6O A;  1P0Z A;  1IOU A;  2JKT I;  4D60 A;  1GA9 A;  3H7W A;  5FDS A;  3L7H A;  1PIO A;  2ZQ8 A;  4X69 A;  3DTI A;  5FDH A;  1TD5 A;  4MBF A;  4BBU A;  2K31 A;  1E3U A;  4Z9Q A;  3NEC A;  4GDB A;  2XSS A;  3G31 A;  1Q2P A;  1OT9 A;  1NLZ A;  1S0W A;  1ODV A;  2J3W A;  3RFB A;  3IH9 A;  4H6J B;  2WKH A;  5GL9 A;  4P85 A;  2GX5 A;  2WZZ A;  3BFF A;  5FQJ A;  4WN5 A;  4RQ9 A;  3BFD A;  1XFQ A;  4PPR A;  1FQG A;  4BD1 A;  1K0K A;  5G4Y A;  4UQI S;  4IHQ A;  4N1X A;  3MQQ A;  5EVI C;  3EQU A;  4EBL A;  4QPR A;  4LV1 A;  2WUQ A;  1KGE A;  3BEB A;  3UPN A;  4DE2 A;  1F2K A;  3SH9 A;  3W8K A;  2CC1 A;  4HI4 A;  3OOV A;  5CHM A;  5F6A A;  4DE1 A;  2EFX A;  3GEC A;  3D72 A;  2WZX A;  2NUT C;  3QP2 A;  5F5Y A;  3KX0 X;  1S4S A;  4CJN A;  4HOI A;  4I39 A;  1SHV A;  5E2H A;  2X02 A;  1QME A;  1BUL A;  4CLC A;  3IX8 A;  3B3X A;  5DTK A;  4LV3 A;  3UB8 A;  5I94 A;  4LRX C;  3LIE A;  3UME A;  3EWK A;  3K3D A;  3V3R A;  4E3K A;  4OP5 A;  4D2O A;  4GOG A;  1J3W A;  3V39 A;  2RL3 A;  1FR6 A;  2OSU A;  3PHY A;  4BMW A;  1G28 A;  1FIL A;  3WRZ A;  3GMW A;  1H5X A;  1SDE A;  4UEY A;  4JXS A;  4C6Y A;  2QJ5 A;  1WA9 A;  4ARZ B;  3QHY A;  4LFU A;  5AQ7 A;  3E4O A;  3KYQ A;  4OPQ A;  5G18 A;  2W1T A;  4JF5 A;  4WZ4 A;  4WF0 A;  3E2L A;  5DFX A;  4GCZ A;  4Y3I A;  3IHA A;  2YKH A;  3UB5 P;  1ESI A;  4B93 A;  2XRN A;  2X01 A;  1LI9 A;  1DJB A;  1NWZ A;  2VGK A;  3LR0 A;  1XJ3 A;  4WLA A;  3VP1 A;  1JWP A;  4E3I A;  3LIC A;  1XP4 A;  1YLT A;  2KDK A;  3UB6 A;  1HVB A;  5FAP A;  4Q0H A;  3NUL A;  4BL2 A;  3O86 A;  3FG8 A;  1MWT A;  3FV7 A;  3S22 A;  2M7U A;  3LGO A;  4O7D A;  1TF1 A;  2XR0 A;  4EEU A;  3M6H A;  4E3O A;  3LIF A;  1BZA A;  3QNC A;  2ZQ7 A;  3B42 A;  3VOL A;  4HJ4 A;  2B95 A;  3EEH A;  4EXO A;  4Y0T A;  1IYQ A;  1VHM A;  4IVK A;  4XUZ A;  2J3T D;  5TJJ A;  2G2W A;  3VE4 A;  3EOI A;  2A3U A;  3V5M A;  4DF6 A;  1PFL A;  2ZC3 B;  4BEN A;  4O0P A;  4NXB A;  4HBT A;  4WL9 A;  3BFG A;  2JKF A;  3W4Q A;  1ACF A;  1IYP A;  4HJ3 A;  2HP6 A;  3IF6 A;  3VP2 A;  1J9M A;  1BLS A;  3M6B A;  3PBS A;  4R3A A;  5J4E A;  4U3T A;  5HAI A;  2Y2I A;  3MBZ A;  4Y2F A;  3G32 A;  5HDC A;  3L9K A;  4ZJ2 A;  5EEC A;  3MR0 A;  2H10 A;  5TBM A;  2XF3 A;  2EWW A;  5FEG A;  4K0W A;  4ZAM A;  2JKR I;  1KVM A;  4WZ5 A;  5AVE A;  2EX2 A;  4GD6 A;  2HDS A;  5DJU A;  3VP0 A;  4YNR A;  3ZFZ A;  2PYP A;  4RX3 A;  1KE3 A;  1OME A;  5DF8 A;  3CG5 A;  5CTN A;  5FAT A;  2V2F F;  4PM9 A;  4E3J A;  2E8J A;  1V9Z A;  1YLP A;  1RGY A;  1IKI A;  4KZ9 A;  3IWO A;  4CLC B;  3OPH A;  3O88 A;  4S2K A;  5HAR A;  4E3M A;  4S2L A;  3FKV A;  4Y13 A;  4RVA A;  2EX6 A;  2ZC6 B;  3M2K A;  3T4T A;  4LRZ E;  4G3V A;  3V50 A;  3NOT C;  5J8X A;  2V1Z A;  1W5D A;  4BLM A;  4X56 A;  4YIN A;  3UPO A;  3TOI A;  5FQK A;  1EW0 A;  1IEM A;  5TR7 A;  1MC0 A;  1KE0 A;  1WYC A;  2VJW A;  4JPM A;  2VGL M;  1ZTU A;  4L9F A;  1PI5 A;  1V9Y A;  1FSW A;  3PAE A;  2PHY A;  2J9P A;  2W1T B;  2GNX A;  5FQQ A;  3P01 A;  3NOP C;  1ERO A;  3VSL A;  1MWR A;  2G7U A;  3W4O A;  4EUZ A;  4Y17 A;  1PWD A;  3VMA A;  4IUH A;  1IKG A;  1PWG A;  3LI9 A;  1FCN A;  3G2Y A;  3VOY A;  4Y0U A;  1P9W A;  5IHV A;  2BLS A;  4OOL A;  1STZ A;  2GJ3 A;  2HV1 A;  5FQM A;  1Y28 A;  5CRF A;  2A2L A;  4WBG A;  5HX9 A;  2XLN A;  5D3O A;  3N8R A;  4X68 A;  4B4X A;  4S2I A;  1F9I A;  1EI5 A;  3BRM A;  4KQR A;  5GLD A;  5EVE A;  1Q2Q A;  2JHE A;  1YKD A;  5J3W A;  4ZJ1 A;  4M3K A;  4EQ1 A;  4DMZ A;  3QP1 A;  2V20 A;  4XXR A;  1HTZ A;  2QWS A;  3NBL A;  3LEQ A;  1NZO A;  1UWP X;  3IF6 B;  2J80 A;  4NET A;  1T1C A;  2Z2M B;  2Y59 A;  3ZCZ A;  5BOH A;  1I2S A;  3WWX A;  4OLD A;  5DVA A;  3MXQ A;  5AJG A;  5FSR A;  3SS5 A;  3HLW A;  3MZD A;  4KUO A;  5TBM B;  4LLO B;  4OQ0 A;  4OON A;  3MFD A;  2V0W A;  5F83 A;  5CX7 A;  4F3L A;  3GDI A;  5KZH A;  1PZO A;  3GR2 A;  2PU4 A;  4KG2 A;  3VFH A;  5FI6 A;  2EX8 A;  3JYI A;  1OTI A;  1GSV A;  3Q82 A;  3O3V A;  3MJQ A;  4JF6 A;  4HIA A;  4M4X A;  2R9X A;  3VP4 A;  1OJG A;  1XPB A;  2HZ5 A;  2WAD A;  3A0S A;  2WAF A;  3LY3 A;  3CUE C;  5CEB A;  5HWW A;  1BYW A;  2EWV A;  3LEZ A;  2Y2G A;  4Y7P A;  1TS6 A;  4F94 A;  4EES A;  3EQV A;  1MPL A;  2KOI A;  4GLQ A;  2J7V A;  3BLS A;  2XEP A;  1ES4 A;  4R6L A;  3S7P A;  4UA9 A;  4IBX A;  2W1R A;  5FAO A;  3ZVT A;  5KSH A;  1MY8 A;  3SH8 A;  1Z09 A;  1N9B A;  1BUE A;  3LUQ A;  4EWF A;  3IQA A;  3QP4 A;  2ZC5 B;  4PM5 A;  1MKM A;  4E6W A;  2O0Y A;  1XXM A;  3NCK A;  4N92 A;  3MMH A;  2INW A;  3CLO A;  4FH2 A;  1SKF A;  5L10 A;  2V1A A;  1VEU A;  3HLC A;  2ZJ9 A;  2WK0 A;  1YLZ A;  3E0Y A;  2HDU A;  1FR1 A;  4Q8I A;  2W3H A; 
#chains in the Genus database with same CATH homology
 4BMW A;  4I5S A;  1G28 A;  3LR5 A;  1F98 A;  4GS9 A;  3S7O A;  4UEY A;  1XFN A;  4PHT A;  3B33 A;  2Z6D A;  3LR4 A;  3MQ0 A;  4KUK A;  2QJ5 A;  1OJ5 A;  2O9C A;  5G4Z A;  2VV6 A;  1WA9 A;  2LB5 A;  4CLC C;  1VB6 A;  5C5K A;  4ARZ B;  2R78 A;  5LBR A;  3R7W B;  4MN6 A;  3BWL A;  3P7N A;  2PT7 A;  4CLC D;  2M1C A;  3E4O A;  5DKK A;  3KYQ A;  4HQA A;  4YOF A;  2W1T A;  2ZBB A;  3HCY A;  3TRC A;  4WF0 A;  4CLC E;  2QJ7 A;  2JKR M;  5DFX A;  4GCZ A;  4Y3I A;  2YKH A;  3K2N A;  3T4S A;  4B93 A;  2XRN A;  1MZU A;  1T19 A;  1NWZ A;  1D06 A;  3LR0 A;  1XJ3 A;  4WLA A;  1GSW A;  2W0N A;  2OWJ A;  3LIC A;  1TS8 A;  2OAQ 1;  3PYP A;  2PR5 A;  4YWZ A;  3UB6 A;  2KDK A;  2JN7 A;  4LPZ A;  2QKP A;  4Q0H A;  1S1Z A;  1UGU A;  2DMW A;  3CWF A;  3FG8 A;  1YSP A;  2VGL S;  2M7U A;  1OTE A;  2WKP A;  5HSQ A;  3KYZ A;  1LL8 A;  1TS0 A;  4JGP A;  5F68 A;  3F1O A;  4KQD A;  1TF1 A;  4CQH A;  4EEU A;  1LT0 A;  3H82 A;  3LIB A;  5HD3 A;  3LIF A;  2PYR A;  4ETZ A;  5KIZ A;  3BJN A;  2HJE A;  3E98 A;  2ZMF A;  3F1P A;  3B42 A;  5F69 A;  2FZ0 A;  3VOL A;  4WEK A;  4HJ4 A;  4I3I A;  4I3A A;  3BW6 A;  3UE3 A;  3IS2 A;  2J3T C;  3EEH A;  2O99 A;  2GZA A;  4EXO A;  1VHM A;  2J3T D;  2OOL A;  2XA7 S;  3F1N A;  3NOU C;  5TJJ A;  4F3L B;  3FPV A;  3VE4 A;  3EOI A;  2W3F A;  4EER A;  3UE6 A;  3V67 A;  3UB9 A;  2BAS A;  3FPW A;  4NXG A;  4O0P A;  2K7S A;  2XA7 M;  4NXB A;  4WL9 A;  4L9G A;  5I5L A;  3CI6 A;  1T1A A;  4HJ3 A;  4MN5 A;  4EET B;  3IBR A;  3KSH A;  1T1B A;  2V1B A;  3PBS A;  5DF9 A;  1XJ4 A;  4R3A A;  3LI8 A;  4MN7 A;  5J4E A;  4Y2F A;  5IU1 A;  4EW7 A;  3NJA A;  3R7W A;  5HDC A;  2QYB A;  1H3Q A;  3MR0 A;  2VEA A;  5IT5 A;  2ZOH A;  5EFW A;  5AVF A;  5TBM A;  1DP9 A;  2EWW A;  4ETX A;  4AFI A;  3MQO A;  3BY8 A;  3TE8 A;  1ZHH B;  3FC7 A;  2P04 A;  2B02 A;  2JKR I;  5AVE A;  3LR3 A;  4PKY A;  4E04 A;  2D02 A;  2VX8 A;  5IS1 A;  5DJU A;  3S7Q A;  2EA9 A;  2HJ9 C;  2PDR A;  2MJ6 A;  2LB9 A;  4Q0I A;  4YNR A;  5K5B A;  3O5Y A;  3BQA A;  3LYX A;  1N9N A;  2PYP A;  3TJZ C;  2P7J A;  1OPX A;  3HJK A;  4II7 A;  4XT2 B;  4HP4 A;  4G3W A;  3T4L A;  3W2Z A;  4EUV A;  4EEP A;  2VV7 A;  1V9Z A;  4H6J A;  2V9A A;  4FSF A;  4I3J A;  2O9A A;  2W3E A;  4L9E A;  3T4J A;  4CLC B;  4KQO A;  1LSW A;  3UB7 A;  4DJ3 A;  5J7E A;  3PBQ A;  4PKY G;  5HWV A;  4GW9 A;  3LFV A;  4BBV A;  2D01 A;  2W3D A;  4GHI B;  3LID A;  3E4P A;  3PR6 A;  5HDS A;  1P97 A;  4HP9 A;  4DJ2 A;  3BY9 A;  4WEL A;  3T4T A;  2PD8 A;  2A24 A;  4LRZ E;  4G3V A;  3PBN A;  2HF6 A;  4BJP A;  2ZOI A;  3NOT C;  4NKP A;  4IUK A;  3CUE A;  2WKQ A;  4PAU A;  3KSG A;  1NLY A;  1DRM A;  1LSV A;  4GS9 B;  4BBT A;  1X0O A;  4NXF A;  1S66 L;  3SW1 A;  1EW0 A;  1MC0 A;  2JKT M;  4MCW A;  2VJW A;  3RTY A;  2VGL M;  1ZTU A;  4WEJ A;  4L9F A;  3H7W B;  3OBF A;  1OTA A;  2PR6 A;  1V9Y A;  4Q0J A;  2PHY A;  2W1T B;  5A8B A;  2GNX A;  4HNB A;  1N9O A;  2W3G A;  3P01 A;  4JGQ A;  3NOP C;  3R4K A;  4MDZ A;  3T4Q A;  2G7U A;  3T50 A;  3B47 A;  3VV4 A;  5HWT A;  2V0U A;  4L0L A;  5HDD A;  4IUH A;  4Z1W A;  1S1Y A;  3LI9 A;  3KSI A;  1S4R A;  5DJT A;  2OAP 1;  1DP8 A;  4GJ4 A;  2M7V A;  3ICY A;  1P9W A;  2L0W A;  4HH3 A;  3T4K A;  3D3O A;  2XRO A;  4OOL A;  4HJ6 A;  1LSX A;  1STZ A;  2GJ3 A;  2HV1 A;  3TW8 A;  3VE3 A;  3EGD C;  1T18 A;  3C8C A;  3HJI A;  2VA0 A;  1Y28 A;  4XT2 A;  3EGX C;  3F1O B;  2YKF A;  1DP6 A;  5MC7 A;  5HL6 A;  4HHD A;  4ARZ A;  2A2L A;  2VV8 A;  3H82 B;  4R38 A;  3ZQ5 A;  5HPI A;  1D7E A;  3A0R A;  3KO6 A;  4K08 A;  4P6Z S;  5DKL A;  4BWI A;  1KOU A;  3KSF A;  1F9I A;  2H28 A;  3F1P B;  3H9W A;  1S67 L;  1XJ2 A;  3MF0 A;  3IS2 B;  2JHE A;  1YKD A;  5J3W A;  2P08 A;  1NRJ A;  3CAX A;  3ZYT A;  2B18 A;  2L1M A;  4EQ1 A;  4DMZ A;  1W63 Q;  3MFX A;  3NHQ A;  2CMN A;  3U2A A;  2Y8H A;  3BQ8 A;  2QWS A;  2W27 A;  2KX6 A;  5HD5 A;  1GSX A;  2IA2 A;  3PBO A;  4JGO A;  1OTB A;  5DFY A;  1UWP X;  2J80 A;  4Y5F A;  1TS7 A;  4I38 A;  1T1C A;  3ULF A;  5HPF A;  1G6O A;  1P0Z A;  4HH2 A;  3DBA A;  1IOU A;  2HGV A;  2JKT I;  5FL3 A;  4LRY C;  3OC2 A;  2ZMV A;  3H7W A;  3MXQ A;  5AJG A;  1YAX A;  3OLO A;  3PXP A;  2O9B A;  4WUJ A;  3CIT A;  1JNU A;  4OOM A;  4KUO A;  3PBT A;  5TBM B;  4LLO B;  4ME4 A;  1H8M A;  4NXE A;  1YSQ A;  1TD5 A;  2V0W A;  4BBU A;  5CX7 A;  2K31 A;  4F3L A;  1P9R A;  3GDI A;  4ZRR A;  2XSS A;  1F5M A;  2Z6C A;  3OCL A;  3RH8 B;  2OWH A;  1OTI A;  1GSV A;  4G3K A;  1OT9 A;  3C2W A;  1NLZ A;  3MJQ A;  4NEE D;  2WKR A;  1ODV A;  2J3W A;  4O01 A;  3A0V A;  3RFB A;  4H6J B;  4HIA A;  5HZH A;  4M4X A;  1OJG A;  3JVU A;  2GX5 A;  4WN5 A;  3S7N A;  2QHK A;  3A0S A;  4RQ9 A;  2K2N A;  1XFQ A;  4DN0 A;  3LIA A;  3CUE C;  5HWW A;  3C30 A;  3EEA A;  1W63 M;  1BYW A;  2EWV A;  5G4Y A;  3E4Q A;  4UQI S;  4FOF A;  4MMN A;  4IHQ A;  1XJ6 A;  2L4R A;  3UMD A;  1TS6 A;  3MQQ A;  4EES A;  3EQV A;  3EQU A;  2KOI A;  4GLQ A;  2A24 B;  4UQI M;  4QPR A;  4HY8 A;  2PD7 A;  4HI4 A;  3OOV A;  2VZW A;  3IBJ A;  4R6L A;  3S7P A;  4O8G A;  2W1R A;  5F6A A;  2I9V A;  5KSH A;  3GEC A;  3PBR A;  3D72 A;  2NUT C;  1OT6 A;  1IFQ A;  4IJG A;  3K3C A;  4JGR A;  5F5Y A;  2NUP C;  3LUQ A;  3KX0 X;  1S4S A;  4HOI A;  1MKM A;  4I39 A;  2O0Y A;  4P6Z M;  4CLC A;  3MMH A;  3UB8 A;  4R70 A;  2KLI A;  2INW A;  3CLO A;  3OCN A;  2Y79 A;  1UWN X;  3F1N B;  4LRX C;  3LIE A;  3JVV A;  3UME A;  3EWK A;  3K3D A;  4GHI A;  2V1A A;  5L8M A;  4B9O A;  2FH5 A;  4EU0 A;  3G6O A;  3E0Y A;  2VKS A;  1N9L A;  3T4O A;  2VLG A;  1OTD A;  2W3H A;  3PHY A;  3C38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...