4HI4A

Crystal structure of the 5-coordinate ferric heme-binding pas domain of aer2 from p. aeruginosa
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
GSHMARIASALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDAGRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANARLGSAVQWTDRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aerotaxis transducer Aer2
publication title Architecture of the soluble receptor Aer2 indicates an in-line mechanism for PAS and HAMP domain signaling.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 36
structure length 119
sequence length 119
chains with identical sequence B, D, G
ec nomenclature
pdb deposition date 2012-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hi4A00
4F3LB 2I9VA 5DJTA 4HOIA 2W0NA 1OTDA 3LIEA 3UMDA 2PR6A 4DJ2A 5AVFA 2V9AA 2BASA 2PYRA 1TS7A 1S1ZA 4EQ1A 1XFQA 2V1BA 5HDDA 4LRXC 4R38A 4PKYA 4JGQA 4I3AA 3LIFA 4KUKA 5IS1A 1LSXA 1GSWA 1N9LA 5I5LA 4HP4A 1JNUA 1OJ5A 3HJKA 4XT2B 2Z6DA 5HDSA 3UB6A 3A0RA 2WKQA 2B02A 3E4QA 2VLGA 3UB8A 1UWPX 1OT6A 4HY8A 5G4YA 2H28A 3H82A 2M1CA 4GHIA 4EESA 3LIDA 3P7NA 3F1NB 3LYXA 5HWWA 1UWNX 4NXGA 3F1PA 4I38A 3KX0X 2V1AA 2OWHA 5G4ZA 4NXEA 1XJ2A 3ZQ5A 4M4XA 1UGUA 2QJ7A 4GCZA 2KDKA 3NHQA 2KX6A 4HQAA 2GJ3A 2HV1A 2PD8A 3A0VA 1TS0A 4GS9A 4NXFA 1OJGA 3E4OA 1DRMA 4HHDA 2JHEA 3EEHA 3FG8A 4B9OA 4HP9A 2R78A 2QWSA 3T50A 1T18A 5TBMA 2VV8A 1S1YA 3HJIA 1XJ6A 3IBRA 1DP6A 4MN5A 3H82B 3UB7A 4GHIB 1TS6A 2OOLA 2A24A 2W27A 1OTAA 3NOTC 1S67L 1GSVA 1XFNA 4L9FA 5HD5A 3MR0A 3LI8A 3F1PB 5A8BA 3NJAA 1ODVA 4HNBA 3FC7A 3BY8A 3LUQA 3RTYA 2EA9A 4LLOB 5HDCA 2YKHA 3ULFA 4NXBA 1T1CA 1LSWA 1P0ZA 4GS9B 1LT0A 4L9EA 5F69A 3B33A 1VB6A 2PD7A 2D02A 1NWZA 4I3JA 4E04A 3GDIA 2PHYA 2K7SA 4WLAA 5EFWA 3CLOA 4HJ6A 5TBMB 3D72A 3LI9A 4WUJA 4LRZE 1X0OA 1N9OA 2VV7A 2A24B 2J80A 3C8CA 3UMEA 3OLOA 3BY9A 3K3DA 2VV6A 3IS2A 2L0WA 3C2WA 1DP8A 4LRYC 1OTEA 2QHKA 1S66L 4EXOA 1TS8A 1T19A 3F1OA 1LSVA 3VOLA 2Z6CA 2L4RA 1D7EA 1S4SA 2CMNA 5HZHA 2QJ5A 4HI4A 5HD3A 4EW7A 3H7WA 2YKFA 1Y28A 1G28A 3UE6A 4WL9A 1V9ZA 5HWTA 3LIAA 1T1BA 4EEUA 4MN6A 1P97A 4PKYG 3E4PA 4HIAA 4EERA 3K3CA 4EETB 3VE3A 5F5YA 4WN5A 2V0WA 3CWFA 1DP9A 4EEPA 5J3WA 4HH2A 4BBVA 1OTBA 4HH3A 3IS2B 1N9NA 3NOUC 1GSXA 3ICYA 4KUOA 3PHYA 5J4EA 1LL8A 1OTIA 2JN7A 4HJ4A 2PDRA 3F1OB 4RQ9A 5F68A 2P7JA 5IU1A 3BWLA 2WKPA 1T1AA 3MXQA 2QKPA 4GW9A 2D01A 5AVEA 3NOPC 4YWZA 1OT9A 4WF0A 4I39A 4JGOA 4LPZA 3H7WB 5DKKA 4H6JA 4BBUA 4F3LA 4R6LA 3VE4A 1S4RA 1WA9A 2INWA 1V9YA 4JGRA 2L1MA 5KIZA 3G6OA 3MFXA 5HSQA 2ZOIA 3RH8B 3MJQA 2WKRA 4L9GA 1XJ3A 5HWVA 4DJ3A 4HJ3A 4K08A 3CAXA 1XJ4A 3PYPA 2PR5A 5DKLA 2V0UA 3A0SA 1MZUA 1F9IA 2ZOHA 4XT2A 4I3IA 3SW1A 3GECA 3EWKA 5J7EA 1D06A 4I5SA 2ZBBA 4BBTA 1F98A 3LIBA 4JGPA 1EW0A 5DJUA 4KQDA 3H9WA 2OWJA 1KOUA 2VEAA 3MQQA 2PYPA 3UB9A 1BYWA 4R70A 3LICA 5F6AA 3MQOA 4R3AA 3F1NA 4H6JB
chains in the Genus database with same CATH superfamily
1F2KA 2I9VA 4O0PA 4EU0A 1ERMA 2W0NA 1K25A 1IYPA 5AVFA 5M1AA 3HLCA 4ETXA 4EQ1A 4EUVA 5E2EA 4KG2A 4Y5FA 1I5QA 3UE3A 3HLDA 1XFQA 1CQAA 1LL9A 1VETB 2V1BA 4I3AA 2XFSA 5EUAA 2O99A 1XKZA 3AGEA 1N9LA 1YLZA 3O3VA 3OCLA 3CUEC 4AFIA 1JNUA 5DTTA 1K57A 1KDWA 4C75A 3LO7A 2Z2MB 3C4PA 4QD4A 2OLVA 2Z6DA 3UB6A 3E0YA 5FAPA 1KGFA 3UB8A 3E2LA 5JYOA 4BD1A 5HAIA 2VZWA 3E98A 3MKFA 3JYIA 3BFFA 4CLCA 4MDZA 4EESA 5HAQA 2B95A 4OVDA 3F1NB 2FH5A 1UWNX 1VHMA 1D1JA 2JKRM 4NK3A 3PBQA 3UE1A 2PT7A 4M4XA 3V39A 2FZ0A 5HPIA 2XA7S 4R1GA 3A3DA 1TVFA 4OOLA 5A93A 5CHJA 3VP4A 2X02A 2I72A 2GJ3A 4JXWA 4BMWA 1H8MA 3A3JA 1TS0A 4GS9A 4NXFA 2V2FF 3VP2A 1ESUA 3Q07A 3BQ8A 3Q7VA 1DRMA 3EEAA 2JHEA 3BFCA 4N1XA 1K0KA 2XEPA 2Y59A 2R78A 3LGOA 1E3UA 4OQGA 1M40A 2XR0A 1HLUP 3LEZA 4MN5A 3UDFA 4UQIS 3BFEA 4GHIB 1VEUA 2Y2QA 4R4RA 2A49A 5FQIA 3F1PB 4MLLA 3MQ0A 3DTKA 4KZ9A 4DRTA 2IA2A 3FC7A 3BY8A 1TF1A 2J8YA 1BLPA 2EA9A 3HLBA 4LLOB 2V8FA 3IXBA 3P98A 3ZG8B 2LB9A 3ZNTA 2ZQ7A 4OOMA 2J3WA 2YKHA 2DRWA 4PAUA 2GDNA 2VJWA 4P6BA 1YLYA 4MMNA 3PBOA 3VMAA 1LSWA 4E3NA 3LCEA 2WZZA 3N7WA 4Y2FA 5F69A 1P9WA 3IWOA 2XGNA 5IT5A 1NYYA 3LR3A 2PD7A 3OBFA 2X01A 4I3JA 3KYEA 5FQ9A 3IF6A 2PHYA 2J3TD 4CJNA 2BG1A 3HLEA 1YMXA 1LI9A 3UN7A 3RXWA 3T4KA 4HJ6A 4EUZA 2HGVA 2W3EA 3D72A 1JTDA 4LRZE 5E2HA 1YAXA 1PRQA 2A24B 1Y54A 1CEGA 2J9OA 1EI5A 5AJGA 5EOEA 4H8RA 5TFQA 3Q82A 4ZTKA 5E2GA 3G32A 1NLYA 3IQAA 3BLMA 2ZC5B 1NY0A 3IS2A 2NUPC 3SOIA 3FYZA 5M18A 3VP0A 5FEGA 4QPRA 1T19A 1LL5A 4DDSA 2EWVA 1K4EA 3QP2A 3N8RA 3KSIA 3UPOA 2Z6CA 1BLCA 2ZJ9A 1S4SA 2CMNA 5CHMA 4X53A 4HI4A 5EVIA 1TDGA 5HD3A 1H5XA 3DWKA 4OP5A 4DMZA 2YKFA 3OPHA 3OPRA 3T4LA 4Y17A 3S1YA 4ARZA 1W8QA 1FOFA 1P97A 4DE3A 1K54A 3HLFA 3HLWA 3W4QA 3IBJA 4EETB 2XROA 4WN5A 1ZKJA 3T4TA 4OQIA 3KSFA 4C3QA 1DP9A 1CF0A 2GNXA 1OTBA 4KZAA 1O7EA 3AGFA 5EPHA 5TR7A 1ERQA 1GSXA 3ZVTA 1W63M 2K2NA 5FQJA 3IX4A 1LL8A 2JN7A 1GHIA 3NIAA 5FSRA 4RQ9A 4MCWA 5DTSA 3ZNYA 2OV5A 2WKPA 3MXQA 2QKPA 4E3MA 4GD8A 3NOPC 4ETZA 4H6JA 1NRFA 4GJ4A 4R6LA 4BQMA 4OQ0A 3FWLA 2ZC7A 3PR6A 2XD5A 5MC7A 1WA9A 2INWA 2HP9A 2BTFP 5KIZA 1K56A 1NYMA 3NI9A 4RYEA 5IHVA 3NY4A 4FD8A 4DJ3A 1VETA 1STZA 2HP6A 3CPTB 2LB5A 2Y2LA 3VOZA 5AQ7A 3MBZA 4HJ3A 2EXBA 4K08A 3CITA 4XXRA 4ME4A 3JVVA 5GLDA 4IBXA 4EBPA 2Y2GA 3NC8A 1IYQA 1ZG4A 2ZOHA 4I3IA 4HEFA 3GVBA 1W63Q 3EQVA 5FL3A 3TSGA 4KZ5A 4WZ5C 5K5BA 1F98A 4QHCA 3LIBA 3PXPA 3KSHA 4O8GA 5CGXA 4PM6A 2QYBA 4WELA 4S2LA 1G68A 5TJJA 5DF8A 2VEAA 4X55A 3L9KA 3QP8A 4Y0UA 3ITBA 4PM7A 3BW6A 3F1NA 3OC2A 1W7FA 5DJTA 3T1SA 2X71A 5AQAA 4HOIA 4X25A 1LI0A 3UE0A 4DJ2A 4HBTA 2EX2A 4IHQA 3G4PA 1JWVA 1TS7A 4KENB 5CX7A 2FFYA 5G18A 4OP8A 5HDDA 4LRXC 3KYQA 4PKYA 3IXGA 2RL3A 4KZBA 2J7VA 3LIFA 3WS2A 3Q81A 1PWGA 1HVBA 1K38A 4XT2B 1ZG6A 5HDSA 1FR1A 2XDMA 3IXDA 5FQMA 3W2ZA 4PMAA 3MXSA 5KZHA 2O9AA 4B4ZA 2W1RA 4N9KA 5CERA 4S2NC 3LR0A 5AQ9A 1IYOA 3TG9A 1K55C 1MXOA 4JF6A 2H28A 3IF5A 4RX2A 4WM9A 1G6OA 4OH0A 2H10A 4GHIA 1ES2A 3FV7A 3LYXA 3ZG5A 5KMWA 1FILA 3JPUA 2PAVP 4NXGA 3F1PA 5DFYA 1YLTA 1F5MA 2G2UA 4U3TA 5G4ZA 3TRCA 1ES5A 2EX9A 1Q2QA 4GCZA 1I2WA 2Y91A 1XGIA 5GLBA 4D60A 3NHQA 2KX6A 2A3UA 5FAOA 2HJ9C 5GLCA 5C5KA 2ZQDA 3P01A 3ZHHA 3UB5P 2JKTI 3T4OA 3N8LA 1VQQA 1HZOA 2WK0A 5EM0A 3DTEA 1H8ZA 3QP5A 4HHDA 3EEHA 2GZAA 1OMEA 1LLBA 3HUNA 2P04A 3W4PA 4EV4A 3BYDA 2VV8A 5FASA 1ACFA 3HJIA 3TJZC 5FI6A 4A5RA 1DP6A 2GX5A 3H82B 3UB7A 3TE8A 2OOLA 2A24A 3NOTC 4K91A 1S67L 1JTGA 2WGVA 3LI8A 5EOOA 3UO9A 1KDSA 5A8BA 3EGXC 3C7VA 1ODVA 1FQGA 3DTMA 3TW8A 3MF0A 5E2FA 3RTYA 3CZDA 3HUMA 2XSSA 2ZLYA 4Y13A 3D9YA 1O07A 1RGZA 4UA9A 1WYCA 3WS4A 4ESPA 4NXBA 4GKUA 1P0ZA 2B5RA 3LY3A 3PBRA 3B33A 3NCKA 1M6KA 1VB6A 4OPQA 2D02A 4E04A 2K7SA 1HD8A 1NRJA 1XP4A 1YLPA 4O7DA 4Y15A 2DNSA 1YLWA 4Z1WA 1N9OA 2EX6A 2VV7A 4IUKA 4R4SA 3UPPA 3BLSA 2J80A 5LBRA 3D4FA 4MBFA 5A91A 2WUQA 2JKFA 2Y2MA 5GHYA 3OLOA 3T1RA 5FQQA 1PIOA 1ALQA 2W1TB 3GTCA 3LR4A 4DXCA 2VV6A 3VSKA 4OKPA 2JKRI 4JXGA 2L0WA 3C2WA 2WKHA 1DP8A 3IX3A 3PBTA 2O9BA 2QHKA 1TS8A 4ZAMA 2VGLS 3P09A 4QB8A 3RJUA 1KVMA 3VOLA 3G2ZA 4MEZA 1D7EA 3A3FA 2EX8A 4EW7A 4P6ZS 2XQZA 4OPYA 4XUZA 2R9WA 1Y28A 5L10A 4Q0IA 3UE6A 3ZYTA 3LIAA 4WMCD 4HBUA 2V20A 3S7NA 5FDSA 2PU4A 1DJCA 3N6IA 4RVAA 4HIAA 3CPTA 3VE3A 4OQHA 4WBGA 1BZAA 1KE3A 4X56A 5EVEA 2V0WA 2WZXA 5FA7A 2J3TC 5CRFA 5J3WA 4HH2A 5FDHA 4LCLA 5CTNA 1GA9A 4BLMA 4NG2A 2VGJA 2HF6A 4HESA 2A2LA 1KGGA 5F1GA 1PI4A 4KQOA 4IEDA 1LHYA 4II7A 1JVJA 3MKEA 4KUOA 1YM1A 1AXBA 1L3LA 4IBRA 4HJ4A 1E25A 1NJ4A 1FSYA 3ZDJA 2K31A 1T1AA 1XXMA 5FI2A 3VP1A 4WF0A 4JGOA 4LPZA 4PM8A 5DKKA 3DBAA 3IXHA 2MJ6A 4BD0A 4RX3A 1S4RA 4K0XA 3GV9A 1ES4A 4JGRA 2QMIA 2H0TA 3ITAA 1SCWA 3D3OA 3ZG0A 1XJ3A 2B18A 5HAPA 1SHVA 3A3EA 2Y2OA 1GHPA 2WKEA 3EOIA 3O87A 5CECA 2UV0E 4X1LA 1XJ4A 5DKLA 1MY8A 3VFHA 2W3DA 3A0SA 1KE4A 4U0XA 5DF7A 4XT2A 4YNRA 3FPWA 3SW1A 3EWKA 2RCXA 3HVFA 4N1HA 4ZRRA 2HZ5A 4LFUA 3A3IA 4I5SA 5DJUA 2PBDP 3GRJA 2OWJA 2VX8A 3U2AA 1H8YA 2W3HA 3MZFA 1GA0A 1PYYA 4Q0JA 4YFMA 1YSQA 4FUWA 1BTLA 3LICA 1ZHHB 5EE8A 3MQOA 4F3LB 3WRTA 3QP4A 4P87A 1OTDA 3MS6A 4Y3IA 1XX2A 1K57C 3UMDA 2PR6A 3SH9A 2ZC6B 4XUXA 3V67A 1J3WA 2OLUA 3DW0A 4JGQA 1ONHA 1PWDA 2WGWB 3SS4A 4KUKA 5IS1A 3T4SA 3OCNA 1LSXA 1GSWA 3OPLA 4EQIA 2W3GA 5I5LA 2EWWA 4HP4A 4CLCC 2ZMFA 3WRZA 3HJKA 3SS3A 1GCEA 1TEMA 3WS1A 3G2YA 3R4KA 3A0RA 2WKQA 2H5SA 4S2KA 3PTEA 4EBNA 3E4QA 5M19A 1ZTUA 2P08A 2VLGA 4MN7A 1CEFA 4CLCD 5D3OA 4EBLA 4GNUA 3M6HA 2P9VB 1W8YA 3IH8A 5G4YA 3CUEA 5DFXA 1I2SA 3H82A 2M1CA 3NDEA 5HL6A 3S4XA 3T4QA 1SDNA 3N8SA 3QP6A 5EM1A 3C30A 3HL9A 1XPBA 4QU3A 4S2JA 4WEKA 4I38A 3CMZA 2KOIA 4LENA 3KX0X 4ZJ1A 2V1AA 3S22A 2NUTC 2WAFA 3V3RA 4NXEA 1VEUB 1XJ2A 3ZQ5A 4IUHA 1OPXA 2QJ7A 3PAGA 2ZL1B 2DCFA 3QNBA 1FCMA 2KDKA 4HQAA 2ZMVA 4GLQA 1BT5A 2HV1A 3GSGA 3CHWP 4WYYA 3CG5A 2PD8A 1N4OA 1Z6FA 4E3LA 3A0VA 1EROA 1S6RA 5CTMA 2V1ZA 1J9MA 1PW1A 3E4OA 1JWZA 3IWQA 2ZM8A 3IX8A 3V50A 2PBYA 3PBSA 4E3IA 4X69A 1E3UD 4D2OA 4DE0A 5J8XA 1CI8A 3T50A 3OZHA 1T18A 3IF6B 3WS0A 2Y2IA 4BENA 3T1QB 3IBRA 4DXBA 1RP5A 1C3BA 4B93A 3BFDA 3HUOA 3HCYA 4S2IA 4S2PA 1XFNA 4UHUA 5HD5A 1AWIA 4JF5A 5HL1A 5DTKA 4HNBA 3DAVA 2Y2NA 5JYPA 4KZ7A 2W1TA 5E43A 4PPRA 3VOYA 2VGKA 3IF6C 2IWDA 2HP5A 4WEJA 2XFTA 4CPKA 1L0FA 3O5YA 3ULFA 1T1CA 2V8CA 4DF6A 4WZ4A 1MBLA 2G7UA 1MC0A 2WAEA 1JWPA 2XA7M 4UAAA 3KYZA 4G3KA 3S7QA 2PRFA 4M3KA 5TBMB 3LI9A 1BLSA 3UPNA 4NKPA 5EVLA 4GB7A 3NDGA 3BECA 2ZD8A 4U0TA 2QZ6A 3K2NA 3O86A 2VGLM 2EXAA 2Q9MA 4S2MA 3RXXA 5FEFA 4PHTA 5EVIC 4IJGA 4ZBEA 4UQIM 2ZQAA 3BJNA 2H0YA 4JLFA 4OPZA 1K6RA 4BL3A 2M7VA 1BLHA 1K54C 1LSVA 5EVID 3L7HA 1HTZA 5HW3A 2CC1A 2L4RA 1MKIA 4KZ3A 5HZHA 2QJ5A 4P0MA 2XF3A 2WYXA 1PWCA 3M6BA 3OPPA 2WGIA 2ZM0A 1G28A 3N4IA 2HDRA 4WL9A 1V9ZA 3HREA 5HWTA 4DDYA 2HDQA 1T1BA 2E8IA 2ACGA 4EEUA 1WE4A 4MN6A 4C6YA 1MPLA 1G5UA 3E4PA 4ZJ3A 3K3CA 3GMWA 3T4JA 2Y8HA 5EV0A 3LR5A 2UWXA 1MWRA 1PW8A 3BQAA 3B47A 4R3BA 1YSPA 3M2JA 3SH7A 3ZCZA 4HH3A 3O88A 1N9NA 4KQRA 4BL2A 4RA7A 1KVLA 3QHYA 5A92A 3SS5A 4GOGA 3ICYA 3LEQA 3PHYA 5J4EA 2PDRA 3F1OB 5F68A 1XA7A 2P7JA 5IU1A 5CXWA 3IWIA 3G31A 1FCOA 1SKOB 4YWZA 2R9XA 1OT9A 5BOHA 4JF4A 3H7WB 1PZPA 2JE5A 4F3LA 3VP3A 3G30A 5CEBA 1XGJA 4X68A 1Z09A 4R23A 4GZBA 1K56D 2OAP1 2VK3A 1V9YA 4KG5A 4R3JA 2L1MA 5GHZA 5HSQA 2ZOIA 5DF9A 3RH8B 1E4DA 2C6WB 2WGWA 4B4XA 2VKSA 4KQQA 4Q8IA 3CAXA 1IKGA 2Y2HA 1MZUA 3C38A 2QPNA 4ID4A 3GECA 1D06A 2ZBBA 5HX9A 4BBTA 4JGPA 1EW0A 5CHUA 3ZGAB 4KQDA 3FPVA 4GD6A 4CQHA 2ZQ9A 3R7WB 1PZOA 3UDXA 2ZM2A 3RFBA 5HARA 3MQQA 4JXVA 1SKFA 2P9VA 5L8MA 3UB9A 1BYWA 5CEDA 2Y2JA 1MKMA 2M7UA 1KGEA 1MWUA 1YKDA 1YLJA 5F6AA 3QP1A 4R0QA 2J9PA 4R3AA 2O0YA 2HDSA 1TDLA 3W8KA 1G6AA 4WZ5A 4ZDXA 5L09A 3LIEA 4KZ8A 1QMEA 4QJGA 2V9AA 2BASA 2PYRA 1Q2PA 1FIKA 5KSHA 1S1ZA 2ZL1A 3BFGA 1L0EA 1S0WA 3CI6A 4L0LA 4R38A 4UEYA 3FKWA 4P85A 1RGYA 2O9CA 3MZDA 1FR6A 5TGFA 3LY4A 3VV4A 3C4OA 1H0MA 1OJ5A 5F83A 1WYBA 3C7UA 5HFOA 2OSUA 2B02A 1FCNA 4LV3A 1UWPX 1RCJA 4YOFA 4UA7A 1OT6A 2ZQ8A 1CK3A 4HY8A 3AGDA 3BEBA 3BM6A 3W4OA 2AVXA 2Q0OA 4Y0TA 2Z2LB 1P9RA 2JC7A 4FH2A 3LIDA 3UNWA 3P7NA 4Y0OA 5HWWA 3M2KA 5FQKA 3MSHA 1SDEA 2OWHA 3B3XA 4NEED 3QNCA 4S2NA 4EWFA 4JPMA 1UGUA 1K55A 2FFFB 1QMFA 2HPBA 3EQUA 4Y7PA 1IYSA 4Q0HA 1IELA 4E3KA 1YQSA 1SZVA 4KZ6A 1BSGA 5DVAA 1OJGA 4DE2A 4FSFA 4G3VA 3IHBA 3FG8A 3G35A 4BJPA 4B9OA 3VFFA 5I94A 4HP9A 2QWSA 5TBMA 1S1YA 4Z9QA 4E3JA 1XJ6A 1PFLA 1W5DA 3ZVWA 4CLCB 4QY5A 3MFDA 1TS6A 2W27A 1OTAA 1GSVA 4L9FA 3MR0A 4OLDA 4OOYA 4DN0A 1NLZA 1NZUA 1L0GA 2EFXA 3PAEA 3NJAA 2JBFA 3KO6A 2G2WA 3LUQA 5KSCA 4LV2A 5FAQA 2Y2KA 1ESIA 3ISGA 3NULA 4MBKA 5HDCA 1MWSA 3S7PA 3CJMA 2ZC3B 2PU2A 4QWOA 3I7JA 1ES3A 4BWIA 4IVIA 2Y55A 3V3SA 4NETA 4GS9B 1LT0A 3FKVA 4L9EA 2XRNA 4JBFA 2Q9NA 2EFUA 3Q7VB 3MZEA 3HBRA 1NWZA 4PM9A 2P74A 2C5WB 2XK1A 3GDIA 3PBNA 1ONGA 4WLAA 5EFWA 3ZG7B 3CLOA 4WUJA 1KE0A 1X0OA 2Y4AA 4FCFA 3Q7ZA 5EECA 3GQZA 4X6TA 4DE1A 4FOFA 4KG6A 4LV1A 2XLNA 5CGWA 3ZG9B 4PM5A 3T12B 3WWXA 3C8CA 3UMEA 4LV0A 1NXYA 1BUEA 3BY9A 3C5AA 2OAQ1 5AQBA 3LFVA 3K3DA 1ZC2A 5CGSA 1H3QA 1NZOA 3T1XA 2DMWA 5L2FA 4LGWA 1CI9A 1DJAA 3UDIA 4GDBA 4LRYC 3ZFZA 2JKGA 2HDUA 1OTEA 3NBLA 1L0DA 1S66L 4EXOA 1EWZA 5F1FA 3F1OA 3VSLA 4MBHA 1GHMA 4ZJ2A 3V5MA 2HJEA 4B88A 5A90A 3G34A 4N92A 2WADA 4LCMA 1YT4A 1SKOA 1K6SA 3KSGA 1TD5A 3H7WA 4G3WA 1U60A 1IEMA 3UY6A 4E6XA 4DKIA 4UA6A 1W79A 4K0WA 5FI7A 3EGDC 1Y4OA 4S2OA 5GLAA 1DJBA 4PKYG 4WMCA 5L07A 5HPFA 4EERA 3OOVA 1PI5A 4IVKA 5F5YA 1DY6A 3CWFA 4EEPA 4E6WA 1FSWA 2ZQCA 3JVUA 4F94A 2XH9A 4BBVA 5U47A 3IS2B 3NOUC 1IOUA 4YINA 4GDNA 3MXRA 3IHAA 3GR2A 4FH4A 3DWZA 3E2KA 5GHXA 1XA1A 1OTIA 3Q1FA 4GN2A 4JXSA 3R7WA 3TOIA 1MWTA 3BWLA 4OONA 2IWCA 4GW9A 2D01A 5EVIB 5AVEA 1YPRA 3FZCA 4I39A 1L2SA 5F82A 3WS5A 4BBUA 1YMSA 2IWBA 4OPRA 3VE4A 3MMHA 2JKTM 4ARZB 2WKIA 4MNRA 3IT9A 4O01A 3G6OA 4QY6A 3MFXA 3MJQA 2WKRA 4L9GA 2VA0A 5HWVA 1N9BA 4E3OA 3SH8A 1CJFA 5FATA 3NECA 4P6ZM 3DTIA 3PYPA 2PR5A 2ZMAA 3B42A 2V0UA 2BLSA 3BRMA 5GL9A 1VM1A 2KLIA 1F9IA 2Y79A 5J7EA 1K4FA 4N9LA 3SZTA 3U4LP 1IFQA 2E8JA 3H9WA 3IH9A 3S7OA 1A0KA 2XD1A 3HLGA 4KZ4A 4OLGA 2ZC4B 1KOUA 2W3FA 2JCHA 2PYPA 2Y2PA 4R70A 4CLCE 4JKTA 1BULA 1IKIA 4FTXA 4X1MA 1PNEA 4H6JB
chains in the Genus database with same CATH topology
4F3LB 2I9VA 5DJTA 4O0PA 4HOIA 4EU0A 2W0NA 1OTDA 3LIEA 4Y3IA 3UMDA 2PR6A 4DJ2A 5AVFA 2V9AA 2BASA 2PYRA 4IHQA 1TS7A 5KSHA 1S1ZA 5CX7A 4EQ1A 4ETXA 4EUVA 4Y5FA 3V67A 3UE3A 1XFQA 2V1BA 5HDDA 4LRXC 3KYQA 3CI6A 4L0LA 4R38A 4UEYA 4PKYA 4JGQA 4I3AA 3LIFA 4KUKA 5IS1A 2O99A 3T4SA 2O9CA 3OCNA 1LSXA 1GSWA 1N9LA 2W3GA 5I5LA 3OCLA 2EWWA 3CUEC 3VV4A 4HP4A 4AFIA 4CLCC 1JNUA 2ZMFA 1OJ5A 3HJKA 4XT2B 2Z6DA 3R4KA 5HDSA 3UB6A 3A0RA 2WKQA 2B02A 3E0YA 3E4QA 3W2ZA 1ZTUA 2P08A 2O9AA 2VLGA 4MN7A 1UWPX 3UB8A 2W1RA 4YOFA 3LR0A 1OT6A 2VZWA 4CLCD 3E98A 4HY8A 5G4YA 2H28A 3CUEA 4CLCA 1G6OA 5DFXA 4MDZA 3H82A 2M1CA 4GHIA 5HL6A 4EESA 1P9RA 3T4QA 3LIDA 3P7NA 3C30A 3F1NB 3LYXA 2FH5A 5HWWA 1UWNX 1VHMA 4NXGA 3F1PA 4WEKA 2JKRM 4I38A 5DFYA 2KOIA 3PBQA 1F5MA 2PT7A 3KX0X 2V1AA 2NUTC 2OWHA 5G4ZA 3TRCA 4NXEA 4NEED 1XJ2A 3ZQ5A 4IUHA 4M4XA 2FZ0A 5HPIA 1OPXA 1UGUA 2QJ7A 2XA7S 4GCZA 4OOLA 2KDKA 3EQUA 3NHQA 2KX6A 4HQAA 2ZMVA 4GLQA 2HJ9C 2GJ3A 2HV1A 4Q0HA 5C5KA 3P01A 2JKTI 2PD8A 4BMWA 1H8MA 3T4OA 3A0VA 1TS0A 4GS9A 4NXFA 1OJGA 3E4OA 3BQ8A 4FSFA 1DRMA 4HHDA 3EEAA 2JHEA 3EEHA 3PBSA 2GZAA 4G3VA 3FG8A 2P04A 4BJPA 4B9OA 4HP9A 2R78A 2QWSA 3T50A 1T18A 5TBMA 2VV8A 1S1YA 3HJIA 1XJ6A 3TJZC 3IBRA 4CLCB 1DP6A 2GX5A 4MN5A 4UQIS 3H82B 3UB7A 4GHIB 3TE8A 1TS6A 2OOLA 4B93A 2A24A 2W27A 1OTAA 3HCYA 3NOTC 1S67L 1GSVA 1XFNA 4L9FA 5HD5A 3MR0A 4DN0A 3LI8A 1NLZA 3F1PB 5A8BA 3MQ0A 3NJAA 3EGXC 1ODVA 4HNBA 2IA2A 3KO6A 3FC7A 3BY8A 3LUQA 1TF1A 3TW8A 3MF0A 2W1TA 3RTYA 2EA9A 2XSSA 4LLOB 5HDCA 4WEJA 3S7PA 2LB9A 4OOMA 2J3WA 2YKHA 4PAUA 2VJWA 4BWIA 3O5YA 3ULFA 4MMNA 3PBOA 4NXBA 1T1CA 1LSWA 1P0ZA 4GS9B 1LT0A 4L9EA 3PBRA 2XRNA 4Y2FA 5F69A 1P9WA 3B33A 5IT5A 1VB6A 2G7UA 1MC0A 3LR3A 2PD7A 2D02A 3OBFA 1NWZA 4I3JA 2XA7M 4E04A 3KYZA 4G3KA 3GDIA 2PHYA 3PBNA 2J3TD 2K7SA 4WLAA 3S7QA 5EFWA 3CLOA 4HJ6A 1NRJA 3T4KA 2HGVA 2W3EA 5TBMB 3D72A 3LI9A 4WUJA 4LRZE 1YAXA 1X0OA 4NKPA 4Z1WA 1N9OA 4FOFA 2VV7A 4IUKA 2A24B 5AJGA 2J80A 5LBRA 3C8CA 3UMEA 3OLOA 3K2NA 3BY9A 2VGLM 2OAQ1 2W1TB 3LFVA 1NLYA 3K3DA 1H3QA 3LR4A 2VV6A 2DMWA 4PHTA 4IJGA 4UQIM 3IS2A 2JKRI 2NUPC 2L0WA 3BJNA 3C2WA 1DP8A 4LRYC 1OTEA 3PBTA 2O9BA 4QPRA 2QHKA 1S66L 4EXOA 1TS8A 1T19A 2M7VA 3F1OA 2VGLS 2EWVA 1LSVA 3VOLA 3KSIA 2HJEA 2Z6CA 2L4RA 1D7EA 1S4SA 2CMNA 5HZHA 2QJ5A 4HI4A 5HD3A 4EW7A 3KSGA 4P6ZS 1TD5A 3H7WA 4G3WA 4DMZA 2YKFA 1Y28A 1G28A 4Q0IA 3UE6A 4WL9A 1V9ZA 5HWTA 3ZYTA 3LIAA 3T4LA 1T1BA 4ARZA 4EEUA 4MN6A 3S7NA 3EGDC 1P97A 4PKYG 5HPFA 3E4PA 4HIAA 4EERA 3K3CA 3OOVA 3IBJA 3T4JA 4EETB 3VE3A 5F5YA 2Y8HA 2XROA 3LR5A 4WN5A 3T4TA 2V0WA 3KSFA 3CWFA 3BQAA 2J3TC 1DP9A 4EEPA 3B47A 5J3WA 2GNXA 1YSPA 4HH2A 3JVUA 4BBVA 1OTBA 4HH3A 3IS2B 1N9NA 2HF6A 3NOUC 1IOUA 2A2LA 1GSXA 1W63M 2K2NA 4KQOA 3ICYA 4II7A 4KUOA 3PHYA 5J4EA 1LL8A 1OTIA 2JN7A 4HJ4A 2PDRA 3F1OB 4RQ9A 5F68A 3R7WA 4MCWA 2P7JA 5IU1A 3BWLA 2WKPA 2K31A 1T1AA 3MXQA 2QKPA 4GW9A 2D01A 5AVEA 3NOPC 4YWZA 1OT9A 4WF0A 4I39A 4JGOA 4LPZA 3H7WB 4ETZA 5DKKA 3DBAA 4H6JA 4BBUA 4F3LA 2MJ6A 4GJ4A 4R6LA 3PR6A 3VE4A 3MMHA 5MC7A 1S4RA 2JKTM 1WA9A 2INWA 2OAP1 4ARZB 1V9YA 4JGRA 4O01A 2L1MA 5KIZA 3G6OA 3MFXA 5HSQA 2ZOIA 5DF9A 3RH8B 3MJQA 3D3OA 2WKRA 4L9GA 2VA0A 1XJ3A 5HWVA 4DJ3A 1STZA 2B18A 2LB5A 4HJ3A 4K08A 2VKSA 4P6ZM 3EOIA 3CITA 3CAXA 4ME4A 1XJ4A 3JVVA 2PR5A 3PYPA 5DKLA 3B42A 2V0UA 2W3DA 3A0SA 1MZUA 3C38A 2KLIA 1F9IA 2Y79A 2ZOHA 4I3IA 4XT2A 3FPWA 4YNRA 3SW1A 3GECA 3EWKA 4ZRRA 5J7EA 1D06A 1W63Q 3EQVA 4I5SA 2ZBBA 5FL3A 4BBTA 5K5BA 1F98A 1IFQA 3LIBA 4JGPA 1EW0A 3PXPA 5DJUA 3KSHA 4O8GA 4KQDA 3FPVA 2QYBA 3H9WA 2OWJA 4WELA 4CQHA 2VX8A 3S7OA 3U2AA 2W3HA 1KOUA 3R7WB 5TJJA 3RFBA 2W3FA 4Q0JA 2VEAA 3MQQA 1YSQA 2PYPA 5L8MA 3UB9A 1BYWA 4R70A 4CLCE 1MKMA 3LICA 2M7UA 1YKDA 1ZHHB 5F6AA 3BW6A 3MQOA 4R3AA 2O0YA 3F1NA 4H6JB 3OC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F3L B;  2I9V A;  5DJT A;  4HOI A;  2W0N A;  1OTD A;  3LIE A;  3UMD A;  2PR6 A;  4DJ2 A;  5AVF A;  2V9A A;  2BAS A;  2PYR A;  1TS7 A;  1S1Z A;  4EQ1 A;  1XFQ A;  2V1B A;  5HDD A;  4LRX C;  4R38 A;  4PKY A;  4JGQ A;  4I3A A;  3LIF A;  4KUK A;  5IS1 A;  1LSX A;  1GSW A;  1N9L A;  5I5L A;  4HP4 A;  1JNU A;  1OJ5 A;  3HJK A;  4XT2 B;  2Z6D A;  5HDS A;  3UB6 A;  3A0R A;  2WKQ A;  2B02 A;  3E4Q A;  2VLG A;  3UB8 A;  1UWP X;  1OT6 A;  4HY8 A;  5G4Y A;  2H28 A;  3H82 A;  2M1C A;  4GHI A;  4EES A;  3LID A;  3P7N A;  3F1N B;  3LYX A;  5HWW A;  1UWN X;  4NXG A;  3F1P A;  4I38 A;  3KX0 X;  2V1A A;  2OWH A;  5G4Z A;  4NXE A;  1XJ2 A;  3ZQ5 A;  4M4X A;  1UGU A;  2QJ7 A;  4GCZ A;  2KDK A;  3NHQ A;  2KX6 A;  4HQA A;  2GJ3 A;  2HV1 A;  2PD8 A;  3A0V A;  1TS0 A;  4GS9 A;  4NXF A;  1OJG A;  3E4O A;  1DRM A;  4HHD A;  2JHE A;  3EEH A;  3FG8 A;  4B9O A;  4HP9 A;  2R78 A;  2QWS A;  3T50 A;  1T18 A;  5TBM A;  2VV8 A;  1S1Y A;  3HJI A;  1XJ6 A;  3IBR A;  1DP6 A;  4MN5 A;  3H82 B;  3UB7 A;  4GHI B;  1TS6 A;  2OOL A;  2A24 A;  2W27 A;  1OTA A;  3NOT C;  1S67 L;  1GSV A;  1XFN A;  4L9F A;  5HD5 A;  3MR0 A;  3LI8 A;  3F1P B;  5A8B A;  3NJA A;  1ODV A;  4HNB A;  3FC7 A;  3BY8 A;  3LUQ A;  3RTY A;  2EA9 A;  4LLO B;  5HDC A;  2YKH A;  3ULF A;  4NXB A;  1T1C A;  1LSW A;  1P0Z A;  4GS9 B;  1LT0 A;  4L9E A;  5F69 A;  3B33 A;  1VB6 A;  2PD7 A;  2D02 A;  1NWZ A;  4I3J A;  4E04 A;  3GDI A;  2PHY A;  2K7S A;  4WLA A;  5EFW A;  3CLO A;  4HJ6 A;  5TBM B;  3D72 A;  3LI9 A;  4WUJ A;  4LRZ E;  1X0O A;  1N9O A;  2VV7 A;  2A24 B;  2J80 A;  3C8C A;  3UME A;  3OLO A;  3BY9 A;  3K3D A;  2VV6 A;  3IS2 A;  2L0W A;  3C2W A;  1DP8 A;  4LRY C;  1OTE A;  2QHK A;  1S66 L;  4EXO A;  1TS8 A;  1T19 A;  3F1O A;  1LSV A;  3VOL A;  2Z6C A;  2L4R A;  1D7E A;  1S4S A;  2CMN A;  5HZH A;  2QJ5 A;  4HI4 A;  5HD3 A;  4EW7 A;  3H7W A;  2YKF A;  1Y28 A;  1G28 A;  3UE6 A;  4WL9 A;  1V9Z A;  5HWT A;  3LIA A;  1T1B A;  4EEU A;  4MN6 A;  1P97 A;  4PKY G;  3E4P A;  4HIA A;  4EER A;  3K3C A;  4EET B;  3VE3 A;  5F5Y A;  4WN5 A;  2V0W A;  3CWF A;  1DP9 A;  4EEP A;  5J3W A;  4HH2 A;  4BBV A;  1OTB A;  4HH3 A;  3IS2 B;  1N9N A;  3NOU C;  1GSX A;  3ICY A;  4KUO A;  3PHY A;  5J4E A;  1LL8 A;  1OTI A;  2JN7 A;  4HJ4 A;  2PDR A;  3F1O B;  4RQ9 A;  5F68 A;  2P7J A;  5IU1 A;  3BWL A;  2WKP A;  1T1A A;  3MXQ A;  2QKP A;  4GW9 A;  2D01 A;  5AVE A;  3NOP C;  4YWZ A;  1OT9 A;  4WF0 A;  4I39 A;  4JGO A;  4LPZ A;  3H7W B;  5DKK A;  4H6J A;  4BBU A;  4F3L A;  4R6L A;  3VE4 A;  1S4R A;  1WA9 A;  2INW A;  1V9Y A;  4JGR A;  2L1M A;  5KIZ A;  3G6O A;  3MFX A;  5HSQ A;  2ZOI A;  3RH8 B;  3MJQ A;  2WKR A;  4L9G A;  1XJ3 A;  5HWV A;  4DJ3 A;  4HJ3 A;  4K08 A;  3CAX A;  1XJ4 A;  3PYP A;  2PR5 A;  5DKL A;  2V0U A;  3A0S A;  1MZU A;  1F9I A;  2ZOH A;  4XT2 A;  4I3I A;  3SW1 A;  3GEC A;  3EWK A;  5J7E A;  1D06 A;  4I5S A;  2ZBB A;  4BBT A;  1F98 A;  3LIB A;  4JGP A;  1EW0 A;  5DJU A;  4KQD A;  3H9W A;  2OWJ A;  1KOU A;  2VEA A;  3MQQ A;  2PYP A;  3UB9 A;  1BYW A;  4R70 A;  3LIC A;  5F6A A;  3MQO A;  4R3A A;  3F1N A;  4H6J B; 
#chains in the Genus database with same CATH topology
 1F2K A;  2I9V A;  4O0P A;  4EU0 A;  1ERM A;  2W0N A;  1K25 A;  1IYP A;  5AVF A;  5M1A A;  3HLC A;  4ETX A;  4EQ1 A;  4EUV A;  5E2E A;  4KG2 A;  4Y5F A;  1I5Q A;  3UE3 A;  3HLD A;  1XFQ A;  1CQA A;  1LL9 A;  1VET B;  2V1B A;  4I3A A;  2XFS A;  5EUA A;  2O99 A;  1XKZ A;  3AGE A;  1N9L A;  1YLZ A;  3O3V A;  3OCL A;  3CUE C;  4AFI A;  1JNU A;  5DTT A;  1K57 A;  1KDW A;  4C75 A;  3LO7 A;  2Z2M B;  3C4P A;  4QD4 A;  2OLV A;  2Z6D A;  3UB6 A;  3E0Y A;  5FAP A;  1KGF A;  3UB8 A;  3E2L A;  5JYO A;  4BD1 A;  5HAI A;  2VZW A;  3E98 A;  3MKF A;  3JYI A;  3BFF A;  4CLC A;  4MDZ A;  4EES A;  5HAQ A;  2B95 A;  4OVD A;  3F1N B;  2FH5 A;  1UWN X;  1VHM A;  1D1J A;  2JKR M;  4NK3 A;  3PBQ A;  3UE1 A;  2PT7 A;  4M4X A;  3V39 A;  2FZ0 A;  5HPI A;  2XA7 S;  4R1G A;  3A3D A;  1TVF A;  4OOL A;  5A93 A;  5CHJ A;  3VP4 A;  2X02 A;  2I72 A;  2GJ3 A;  4JXW A;  4BMW A;  1H8M A;  3A3J A;  1TS0 A;  4GS9 A;  4NXF A;  2V2F F;  3VP2 A;  1ESU A;  3Q07 A;  3BQ8 A;  3Q7V A;  1DRM A;  3EEA A;  2JHE A;  3BFC A;  4N1X A;  1K0K A;  2XEP A;  2Y59 A;  2R78 A;  3LGO A;  1E3U A;  4OQG A;  1M40 A;  2XR0 A;  1HLU P;  3LEZ A;  4MN5 A;  3UDF A;  4UQI S;  3BFE A;  4GHI B;  1VEU A;  2Y2Q A;  4R4R A;  2A49 A;  5FQI A;  3F1P B;  4MLL A;  3MQ0 A;  3DTK A;  4KZ9 A;  4DRT A;  2IA2 A;  3FC7 A;  3BY8 A;  1TF1 A;  2J8Y A;  1BLP A;  2EA9 A;  3HLB A;  4LLO B;  2V8F A;  3IXB A;  3P98 A;  3ZG8 B;  2LB9 A;  3ZNT A;  2ZQ7 A;  4OOM A;  2J3W A;  2YKH A;  2DRW A;  4PAU A;  2GDN A;  2VJW A;  4P6B A;  1YLY A;  4MMN A;  3PBO A;  3VMA A;  1LSW A;  4E3N A;  3LCE A;  2WZZ A;  3N7W A;  4Y2F A;  5F69 A;  1P9W A;  3IWO A;  2XGN A;  5IT5 A;  1NYY A;  3LR3 A;  2PD7 A;  3OBF A;  2X01 A;  4I3J A;  3KYE A;  5FQ9 A;  3IF6 A;  2PHY A;  2J3T D;  4CJN A;  2BG1 A;  3HLE A;  1YMX A;  1LI9 A;  3UN7 A;  3RXW A;  3T4K A;  4HJ6 A;  4EUZ A;  2HGV A;  2W3E A;  3D72 A;  1JTD A;  4LRZ E;  5E2H A;  1YAX A;  1PRQ A;  2A24 B;  1Y54 A;  1CEG A;  2J9O A;  1EI5 A;  5AJG A;  5EOE A;  4H8R A;  5TFQ A;  3Q82 A;  4ZTK A;  5E2G A;  3G32 A;  1NLY A;  3IQA A;  3BLM A;  2ZC5 B;  1NY0 A;  3IS2 A;  2NUP C;  3SOI A;  3FYZ A;  5M18 A;  3VP0 A;  5FEG A;  4QPR A;  1T19 A;  1LL5 A;  4DDS A;  2EWV A;  1K4E A;  3QP2 A;  3N8R A;  3KSI A;  3UPO A;  2Z6C A;  1BLC A;  2ZJ9 A;  1S4S A;  2CMN A;  5CHM A;  4X53 A;  4HI4 A;  5EVI A;  1TDG A;  5HD3 A;  1H5X A;  3DWK A;  4OP5 A;  4DMZ A;  2YKF A;  3OPH A;  3OPR A;  3T4L A;  4Y17 A;  3S1Y A;  4ARZ A;  1W8Q A;  1FOF A;  1P97 A;  4DE3 A;  1K54 A;  3HLF A;  3HLW A;  3W4Q A;  3IBJ A;  4EET B;  2XRO A;  4WN5 A;  1ZKJ A;  3T4T A;  4OQI A;  3KSF A;  4C3Q A;  1DP9 A;  1CF0 A;  2GNX A;  1OTB A;  4KZA A;  1O7E A;  3AGF A;  5EPH A;  5TR7 A;  1ERQ A;  1GSX A;  3ZVT A;  1W63 M;  2K2N A;  5FQJ A;  3IX4 A;  1LL8 A;  2JN7 A;  1GHI A;  3NIA A;  5FSR A;  4RQ9 A;  4MCW A;  5DTS A;  3ZNY A;  2OV5 A;  2WKP A;  3MXQ A;  2QKP A;  4E3M A;  4GD8 A;  3NOP C;  4ETZ A;  4H6J A;  1NRF A;  4GJ4 A;  4R6L A;  4BQM A;  4OQ0 A;  3FWL A;  2ZC7 A;  3PR6 A;  2XD5 A;  5MC7 A;  1WA9 A;  2INW A;  2HP9 A;  2BTF P;  5KIZ A;  1K56 A;  1NYM A;  3NI9 A;  4RYE A;  5IHV A;  3NY4 A;  4FD8 A;  4DJ3 A;  1VET A;  1STZ A;  2HP6 A;  3CPT B;  2LB5 A;  2Y2L A;  3VOZ A;  5AQ7 A;  3MBZ A;  4HJ3 A;  2EXB A;  4K08 A;  3CIT A;  4XXR A;  4ME4 A;  3JVV A;  5GLD A;  4IBX A;  4EBP A;  2Y2G A;  3NC8 A;  1IYQ A;  1ZG4 A;  2ZOH A;  4I3I A;  4HEF A;  3GVB A;  1W63 Q;  3EQV A;  5FL3 A;  3TSG A;  4KZ5 A;  4WZ5 C;  5K5B A;  1F98 A;  4QHC A;  3LIB A;  3PXP A;  3KSH A;  4O8G A;  5CGX A;  4PM6 A;  2QYB A;  4WEL A;  4S2L A;  1G68 A;  5TJJ A;  5DF8 A;  2VEA A;  4X55 A;  3L9K A;  3QP8 A;  4Y0U A;  3ITB A;  4PM7 A;  3BW6 A;  3F1N A;  3OC2 A;  1W7F A;  5DJT A;  3T1S A;  2X71 A;  5AQA A;  4HOI A;  4X25 A;  1LI0 A;  3UE0 A;  4DJ2 A;  4HBT A;  2EX2 A;  4IHQ A;  3G4P A;  1JWV A;  1TS7 A;  4KEN B;  5CX7 A;  2FFY A;  5G18 A;  4OP8 A;  5HDD A;  4LRX C;  3KYQ A;  4PKY A;  3IXG A;  2RL3 A;  4KZB A;  2J7V A;  3LIF A;  3WS2 A;  3Q81 A;  1PWG A;  1HVB A;  1K38 A;  4XT2 B;  1ZG6 A;  5HDS A;  1FR1 A;  2XDM A;  3IXD A;  5FQM A;  3W2Z A;  4PMA A;  3MXS A;  5KZH A;  2O9A A;  4B4Z A;  2W1R A;  4N9K A;  5CER A;  4S2N C;  3LR0 A;  5AQ9 A;  1IYO A;  3TG9 A;  1K55 C;  1MXO A;  4JF6 A;  2H28 A;  3IF5 A;  4RX2 A;  4WM9 A;  1G6O A;  4OH0 A;  2H10 A;  4GHI A;  1ES2 A;  3FV7 A;  3LYX A;  3ZG5 A;  5KMW A;  1FIL A;  3JPU A;  2PAV P;  4NXG A;  3F1P A;  5DFY A;  1YLT A;  1F5M A;  2G2U A;  4U3T A;  5G4Z A;  3TRC A;  1ES5 A;  2EX9 A;  1Q2Q A;  4GCZ A;  1I2W A;  2Y91 A;  1XGI A;  5GLB A;  4D60 A;  3NHQ A;  2KX6 A;  2A3U A;  5FAO A;  2HJ9 C;  5GLC A;  5C5K A;  2ZQD A;  3P01 A;  3ZHH A;  3UB5 P;  2JKT I;  3T4O A;  3N8L A;  1VQQ A;  1HZO A;  2WK0 A;  5EM0 A;  3DTE A;  1H8Z A;  3QP5 A;  4HHD A;  3EEH A;  2GZA A;  1OME A;  1LLB A;  3HUN A;  2P04 A;  3W4P A;  4EV4 A;  3BYD A;  2VV8 A;  5FAS A;  1ACF A;  3HJI A;  3TJZ C;  5FI6 A;  4A5R A;  1DP6 A;  2GX5 A;  3H82 B;  3UB7 A;  3TE8 A;  2OOL A;  2A24 A;  3NOT C;  4K91 A;  1S67 L;  1JTG A;  2WGV A;  3LI8 A;  5EOO A;  3UO9 A;  1KDS A;  5A8B A;  3EGX C;  3C7V A;  1ODV A;  1FQG A;  3DTM A;  3TW8 A;  3MF0 A;  5E2F A;  3RTY A;  3CZD A;  3HUM A;  2XSS A;  2ZLY A;  4Y13 A;  3D9Y A;  1O07 A;  1RGZ A;  4UA9 A;  1WYC A;  3WS4 A;  4ESP A;  4NXB A;  4GKU A;  1P0Z A;  2B5R A;  3LY3 A;  3PBR A;  3B33 A;  3NCK A;  1M6K A;  1VB6 A;  4OPQ A;  2D02 A;  4E04 A;  2K7S A;  1HD8 A;  1NRJ A;  1XP4 A;  1YLP A;  4O7D A;  4Y15 A;  2DNS A;  1YLW A;  4Z1W A;  1N9O A;  2EX6 A;  2VV7 A;  4IUK A;  4R4S A;  3UPP A;  3BLS A;  2J80 A;  5LBR A;  3D4F A;  4MBF A;  5A91 A;  2WUQ A;  2JKF A;  2Y2M A;  5GHY A;  3OLO A;  3T1R A;  5FQQ A;  1PIO A;  1ALQ A;  2W1T B;  3GTC A;  3LR4 A;  4DXC A;  2VV6 A;  3VSK A;  4OKP A;  2JKR I;  4JXG A;  2L0W A;  3C2W A;  2WKH A;  1DP8 A;  3IX3 A;  3PBT A;  2O9B A;  2QHK A;  1TS8 A;  4ZAM A;  2VGL S;  3P09 A;  4QB8 A;  3RJU A;  1KVM A;  3VOL A;  3G2Z A;  4MEZ A;  1D7E A;  3A3F A;  2EX8 A;  4EW7 A;  4P6Z S;  2XQZ A;  4OPY A;  4XUZ A;  2R9W A;  1Y28 A;  5L10 A;  4Q0I A;  3UE6 A;  3ZYT A;  3LIA A;  4WMC D;  4HBU A;  2V20 A;  3S7N A;  5FDS A;  2PU4 A;  1DJC A;  3N6I A;  4RVA A;  4HIA A;  3CPT A;  3VE3 A;  4OQH A;  4WBG A;  1BZA A;  1KE3 A;  4X56 A;  5EVE A;  2V0W A;  2WZX A;  5FA7 A;  2J3T C;  5CRF A;  5J3W A;  4HH2 A;  5FDH A;  4LCL A;  5CTN A;  1GA9 A;  4BLM A;  4NG2 A;  2VGJ A;  2HF6 A;  4HES A;  2A2L A;  1KGG A;  5F1G A;  1PI4 A;  4KQO A;  4IED A;  1LHY A;  4II7 A;  1JVJ A;  3MKE A;  4KUO A;  1YM1 A;  1AXB A;  1L3L A;  4IBR A;  4HJ4 A;  1E25 A;  1NJ4 A;  1FSY A;  3ZDJ A;  2K31 A;  1T1A A;  1XXM A;  5FI2 A;  3VP1 A;  4WF0 A;  4JGO A;  4LPZ A;  4PM8 A;  5DKK A;  3DBA A;  3IXH A;  2MJ6 A;  4BD0 A;  4RX3 A;  1S4R A;  4K0X A;  3GV9 A;  1ES4 A;  4JGR A;  2QMI A;  2H0T A;  3ITA A;  1SCW A;  3D3O A;  3ZG0 A;  1XJ3 A;  2B18 A;  5HAP A;  1SHV A;  3A3E A;  2Y2O A;  1GHP A;  2WKE A;  3EOI A;  3O87 A;  5CEC A;  2UV0 E;  4X1L A;  1XJ4 A;  5DKL A;  1MY8 A;  3VFH A;  2W3D A;  3A0S A;  1KE4 A;  4U0X A;  5DF7 A;  4XT2 A;  4YNR A;  3FPW A;  3SW1 A;  3EWK A;  2RCX A;  3HVF A;  4N1H A;  4ZRR A;  2HZ5 A;  4LFU A;  3A3I A;  4I5S A;  5DJU A;  2PBD P;  3GRJ A;  2OWJ A;  2VX8 A;  3U2A A;  1H8Y A;  2W3H A;  3MZF A;  1GA0 A;  1PYY A;  4Q0J A;  4YFM A;  1YSQ A;  4FUW A;  1BTL A;  3LIC A;  1ZHH B;  5EE8 A;  3MQO A;  4F3L B;  3WRT A;  3QP4 A;  4P87 A;  1OTD A;  3MS6 A;  4Y3I A;  1XX2 A;  1K57 C;  3UMD A;  2PR6 A;  3SH9 A;  2ZC6 B;  4XUX A;  3V67 A;  1J3W A;  2OLU A;  3DW0 A;  4JGQ A;  1ONH A;  1PWD A;  2WGW B;  3SS4 A;  4KUK A;  5IS1 A;  3T4S A;  3OCN A;  1LSX A;  1GSW A;  3OPL A;  4EQI A;  2W3G A;  5I5L A;  2EWW A;  4HP4 A;  4CLC C;  2ZMF A;  3WRZ A;  3HJK A;  3SS3 A;  1GCE A;  1TEM A;  3WS1 A;  3G2Y A;  3R4K A;  3A0R A;  2WKQ A;  2H5S A;  4S2K A;  3PTE A;  4EBN A;  3E4Q A;  5M19 A;  1ZTU A;  2P08 A;  2VLG A;  4MN7 A;  1CEF A;  4CLC D;  5D3O A;  4EBL A;  4GNU A;  3M6H A;  2P9V B;  1W8Y A;  3IH8 A;  5G4Y A;  3CUE A;  5DFX A;  1I2S A;  3H82 A;  2M1C A;  3NDE A;  5HL6 A;  3S4X A;  3T4Q A;  1SDN A;  3N8S A;  3QP6 A;  5EM1 A;  3C30 A;  3HL9 A;  1XPB A;  4QU3 A;  4S2J A;  4WEK A;  4I38 A;  3CMZ A;  2KOI A;  4LEN A;  3KX0 X;  4ZJ1 A;  2V1A A;  3S22 A;  2NUT C;  2WAF A;  3V3R A;  4NXE A;  1VEU B;  1XJ2 A;  3ZQ5 A;  4IUH A;  1OPX A;  2QJ7 A;  3PAG A;  2ZL1 B;  2DCF A;  3QNB A;  1FCM A;  2KDK A;  4HQA A;  2ZMV A;  4GLQ A;  1BT5 A;  2HV1 A;  3GSG A;  3CHW P;  4WYY A;  3CG5 A;  2PD8 A;  1N4O A;  1Z6F A;  4E3L A;  3A0V A;  1ERO A;  1S6R A;  5CTM A;  2V1Z A;  1J9M A;  1PW1 A;  3E4O A;  1JWZ A;  3IWQ A;  2ZM8 A;  3IX8 A;  3V50 A;  2PBY A;  3PBS A;  4E3I A;  4X69 A;  1E3U D;  4D2O A;  4DE0 A;  5J8X A;  1CI8 A;  3T50 A;  3OZH A;  1T18 A;  3IF6 B;  3WS0 A;  2Y2I A;  4BEN A;  3T1Q B;  3IBR A;  4DXB A;  1RP5 A;  1C3B A;  4B93 A;  3BFD A;  3HUO A;  3HCY A;  4S2I A;  4S2P A;  1XFN A;  4UHU A;  5HD5 A;  1AWI A;  4JF5 A;  5HL1 A;  5DTK A;  4HNB A;  3DAV A;  2Y2N A;  5JYP A;  4KZ7 A;  2W1T A;  5E43 A;  4PPR A;  3VOY A;  2VGK A;  3IF6 C;  2IWD A;  2HP5 A;  4WEJ A;  2XFT A;  4CPK A;  1L0F A;  3O5Y A;  3ULF A;  1T1C A;  2V8C A;  4DF6 A;  4WZ4 A;  1MBL A;  2G7U A;  1MC0 A;  2WAE A;  1JWP A;  2XA7 M;  4UAA A;  3KYZ A;  4G3K A;  3S7Q A;  2PRF A;  4M3K A;  5TBM B;  3LI9 A;  1BLS A;  3UPN A;  4NKP A;  5EVL A;  4GB7 A;  3NDG A;  3BEC A;  2ZD8 A;  4U0T A;  2QZ6 A;  3K2N A;  3O86 A;  2VGL M;  2EXA A;  2Q9M A;  4S2M A;  3RXX A;  5FEF A;  4PHT A;  5EVI C;  4IJG A;  4ZBE A;  4UQI M;  2ZQA A;  3BJN A;  2H0Y A;  4JLF A;  4OPZ A;  1K6R A;  4BL3 A;  2M7V A;  1BLH A;  1K54 C;  1LSV A;  5EVI D;  3L7H A;  1HTZ A;  5HW3 A;  2CC1 A;  2L4R A;  1MKI A;  4KZ3 A;  5HZH A;  2QJ5 A;  4P0M A;  2XF3 A;  2WYX A;  1PWC A;  3M6B A;  3OPP A;  2WGI A;  2ZM0 A;  1G28 A;  3N4I A;  2HDR A;  4WL9 A;  1V9Z A;  3HRE A;  5HWT A;  4DDY A;  2HDQ A;  1T1B A;  2E8I A;  2ACG A;  4EEU A;  1WE4 A;  4MN6 A;  4C6Y A;  1MPL A;  1G5U A;  3E4P A;  4ZJ3 A;  3K3C A;  3GMW A;  3T4J A;  2Y8H A;  5EV0 A;  3LR5 A;  2UWX A;  1MWR A;  1PW8 A;  3BQA A;  3B47 A;  4R3B A;  1YSP A;  3M2J A;  3SH7 A;  3ZCZ A;  4HH3 A;  3O88 A;  1N9N A;  4KQR A;  4BL2 A;  4RA7 A;  1KVL A;  3QHY A;  5A92 A;  3SS5 A;  4GOG A;  3ICY A;  3LEQ A;  3PHY A;  5J4E A;  2PDR A;  3F1O B;  5F68 A;  1XA7 A;  2P7J A;  5IU1 A;  5CXW A;  3IWI A;  3G31 A;  1FCO A;  1SKO B;  4YWZ A;  2R9X A;  1OT9 A;  5BOH A;  4JF4 A;  3H7W B;  1PZP A;  2JE5 A;  4F3L A;  3VP3 A;  3G30 A;  5CEB A;  1XGJ A;  4X68 A;  1Z09 A;  4R23 A;  4GZB A;  1K56 D;  2OAP 1;  2VK3 A;  1V9Y A;  4KG5 A;  4R3J A;  2L1M A;  5GHZ A;  5HSQ A;  2ZOI A;  5DF9 A;  3RH8 B;  1E4D A;  2C6W B;  2WGW A;  4B4X A;  2VKS A;  4KQQ A;  4Q8I A;  3CAX A;  1IKG A;  2Y2H A;  1MZU A;  3C38 A;  2QPN A;  4ID4 A;  3GEC A;  1D06 A;  2ZBB A;  5HX9 A;  4BBT A;  4JGP A;  1EW0 A;  5CHU A;  3ZGA B;  4KQD A;  3FPV A;  4GD6 A;  4CQH A;  2ZQ9 A;  3R7W B;  1PZO A;  3UDX A;  2ZM2 A;  3RFB A;  5HAR A;  3MQQ A;  4JXV A;  1SKF A;  2P9V A;  5L8M A;  3UB9 A;  1BYW A;  5CED A;  2Y2J A;  1MKM A;  2M7U A;  1KGE A;  1MWU A;  1YKD A;  1YLJ A;  5F6A A;  3QP1 A;  4R0Q A;  2J9P A;  4R3A A;  2O0Y A;  2HDS A;  1TDL A;  3W8K A;  1G6A A;  4WZ5 A;  4ZDX A;  5L09 A;  3LIE A;  4KZ8 A;  1QME A;  4QJG A;  2V9A A;  2BAS A;  2PYR A;  1Q2P A;  1FIK A;  5KSH A;  1S1Z A;  2ZL1 A;  3BFG A;  1L0E A;  1S0W A;  3CI6 A;  4L0L A;  4R38 A;  4UEY A;  3FKW A;  4P85 A;  1RGY A;  2O9C A;  3MZD A;  1FR6 A;  5TGF A;  3LY4 A;  3VV4 A;  3C4O A;  1H0M A;  1OJ5 A;  5F83 A;  1WYB A;  3C7U A;  5HFO A;  2OSU A;  2B02 A;  1FCN A;  4LV3 A;  1UWP X;  1RCJ A;  4YOF A;  4UA7 A;  1OT6 A;  2ZQ8 A;  1CK3 A;  4HY8 A;  3AGD A;  3BEB A;  3BM6 A;  3W4O A;  2AVX A;  2Q0O A;  4Y0T A;  2Z2L B;  1P9R A;  2JC7 A;  4FH2 A;  3LID A;  3UNW A;  3P7N A;  4Y0O A;  5HWW A;  3M2K A;  5FQK A;  3MSH A;  1SDE A;  2OWH A;  3B3X A;  4NEE D;  3QNC A;  4S2N A;  4EWF A;  4JPM A;  1UGU A;  1K55 A;  2FFF B;  1QMF A;  2HPB A;  3EQU A;  4Y7P A;  1IYS A;  4Q0H A;  1IEL A;  4E3K A;  1YQS A;  1SZV A;  4KZ6 A;  1BSG A;  5DVA A;  1OJG A;  4DE2 A;  4FSF A;  4G3V A;  3IHB A;  3FG8 A;  3G35 A;  4BJP A;  4B9O A;  3VFF A;  5I94 A;  4HP9 A;  2QWS A;  5TBM A;  1S1Y A;  4Z9Q A;  4E3J A;  1XJ6 A;  1PFL A;  1W5D A;  3ZVW A;  4CLC B;  4QY5 A;  3MFD A;  1TS6 A;  2W27 A;  1OTA A;  1GSV A;  4L9F A;  3MR0 A;  4OLD A;  4OOY A;  4DN0 A;  1NLZ A;  1NZU A;  1L0G A;  2EFX A;  3PAE A;  3NJA A;  2JBF A;  3KO6 A;  2G2W A;  3LUQ A;  5KSC A;  4LV2 A;  5FAQ A;  2Y2K A;  1ESI A;  3ISG A;  3NUL A;  4MBK A;  5HDC A;  1MWS A;  3S7P A;  3CJM A;  2ZC3 B;  2PU2 A;  4QWO A;  3I7J A;  1ES3 A;  4BWI A;  4IVI A;  2Y55 A;  3V3S A;  4NET A;  4GS9 B;  1LT0 A;  3FKV A;  4L9E A;  2XRN A;  4JBF A;  2Q9N A;  2EFU A;  3Q7V B;  3MZE A;  3HBR A;  1NWZ A;  4PM9 A;  2P74 A;  2C5W B;  2XK1 A;  3GDI A;  3PBN A;  1ONG A;  4WLA A;  5EFW A;  3ZG7 B;  3CLO A;  4WUJ A;  1KE0 A;  1X0O A;  2Y4A A;  4FCF A;  3Q7Z A;  5EEC A;  3GQZ A;  4X6T A;  4DE1 A;  4FOF A;  4KG6 A;  4LV1 A;  2XLN A;  5CGW A;  3ZG9 B;  4PM5 A;  3T12 B;  3WWX A;  3C8C A;  3UME A;  4LV0 A;  1NXY A;  1BUE A;  3BY9 A;  3C5A A;  2OAQ 1;  5AQB A;  3LFV A;  3K3D A;  1ZC2 A;  5CGS A;  1H3Q A;  1NZO A;  3T1X A;  2DMW A;  5L2F A;  4LGW A;  1CI9 A;  1DJA A;  3UDI A;  4GDB A;  4LRY C;  3ZFZ A;  2JKG A;  2HDU A;  1OTE A;  3NBL A;  1L0D A;  1S66 L;  4EXO A;  1EWZ A;  5F1F A;  3F1O A;  3VSL A;  4MBH A;  1GHM A;  4ZJ2 A;  3V5M A;  2HJE A;  4B88 A;  5A90 A;  3G34 A;  4N92 A;  2WAD A;  4LCM A;  1YT4 A;  1SKO A;  1K6S A;  3KSG A;  1TD5 A;  3H7W A;  4G3W A;  1U60 A;  1IEM A;  3UY6 A;  4E6X A;  4DKI A;  4UA6 A;  1W79 A;  4K0W A;  5FI7 A;  3EGD C;  1Y4O A;  4S2O A;  5GLA A;  1DJB A;  4PKY G;  4WMC A;  5L07 A;  5HPF A;  4EER A;  3OOV A;  1PI5 A;  4IVK A;  5F5Y A;  1DY6 A;  3CWF A;  4EEP A;  4E6W A;  1FSW A;  2ZQC A;  3JVU A;  4F94 A;  2XH9 A;  4BBV A;  5U47 A;  3IS2 B;  3NOU C;  1IOU A;  4YIN A;  4GDN A;  3MXR A;  3IHA A;  3GR2 A;  4FH4 A;  3DWZ A;  3E2K A;  5GHX A;  1XA1 A;  1OTI A;  3Q1F A;  4GN2 A;  4JXS A;  3R7W A;  3TOI A;  1MWT A;  3BWL A;  4OON A;  2IWC A;  4GW9 A;  2D01 A;  5EVI B;  5AVE A;  1YPR A;  3FZC A;  4I39 A;  1L2S A;  5F82 A;  3WS5 A;  4BBU A;  1YMS A;  2IWB A;  4OPR A;  3VE4 A;  3MMH A;  2JKT M;  4ARZ B;  2WKI A;  4MNR A;  3IT9 A;  4O01 A;  3G6O A;  4QY6 A;  3MFX A;  3MJQ A;  2WKR A;  4L9G A;  2VA0 A;  5HWV A;  1N9B A;  4E3O A;  3SH8 A;  1CJF A;  5FAT A;  3NEC A;  4P6Z M;  3DTI A;  3PYP A;  2PR5 A;  2ZMA A;  3B42 A;  2V0U A;  2BLS A;  3BRM A;  5GL9 A;  1VM1 A;  2KLI A;  1F9I A;  2Y79 A;  5J7E A;  1K4F A;  4N9L A;  3SZT A;  3U4L P;  1IFQ A;  2E8J A;  3H9W A;  3IH9 A;  3S7O A;  1A0K A;  2XD1 A;  3HLG A;  4KZ4 A;  4OLG A;  2ZC4 B;  1KOU A;  2W3F A;  2JCH A;  2PYP A;  2Y2P A;  4R70 A;  4CLC E;  4JKT A;  1BUL A;  1IKI A;  4FTX A;  4X1M A;  1PNE A;  4H6J B; 
#chains in the Genus database with same CATH homology
 4F3L B;  2I9V A;  5DJT A;  4O0P A;  4HOI A;  4EU0 A;  2W0N A;  1OTD A;  3LIE A;  4Y3I A;  3UMD A;  2PR6 A;  4DJ2 A;  5AVF A;  2V9A A;  2BAS A;  2PYR A;  4IHQ A;  1TS7 A;  5KSH A;  1S1Z A;  5CX7 A;  4EQ1 A;  4ETX A;  4EUV A;  4Y5F A;  3V67 A;  3UE3 A;  1XFQ A;  2V1B A;  5HDD A;  4LRX C;  3KYQ A;  3CI6 A;  4L0L A;  4R38 A;  4UEY A;  4PKY A;  4JGQ A;  4I3A A;  3LIF A;  4KUK A;  5IS1 A;  2O99 A;  3T4S A;  2O9C A;  3OCN A;  1LSX A;  1GSW A;  1N9L A;  2W3G A;  5I5L A;  3OCL A;  2EWW A;  3CUE C;  3VV4 A;  4HP4 A;  4AFI A;  4CLC C;  1JNU A;  2ZMF A;  1OJ5 A;  3HJK A;  4XT2 B;  2Z6D A;  3R4K A;  5HDS A;  3UB6 A;  3A0R A;  2WKQ A;  2B02 A;  3E0Y A;  3E4Q A;  3W2Z A;  1ZTU A;  2P08 A;  2O9A A;  2VLG A;  4MN7 A;  1UWP X;  3UB8 A;  2W1R A;  4YOF A;  3LR0 A;  1OT6 A;  2VZW A;  4CLC D;  3E98 A;  4HY8 A;  5G4Y A;  2H28 A;  3CUE A;  4CLC A;  1G6O A;  5DFX A;  4MDZ A;  3H82 A;  2M1C A;  4GHI A;  5HL6 A;  4EES A;  1P9R A;  3T4Q A;  3LID A;  3P7N A;  3C30 A;  3F1N B;  3LYX A;  2FH5 A;  5HWW A;  1UWN X;  1VHM A;  4NXG A;  3F1P A;  4WEK A;  2JKR M;  4I38 A;  5DFY A;  2KOI A;  3PBQ A;  1F5M A;  2PT7 A;  3KX0 X;  2V1A A;  2NUT C;  2OWH A;  5G4Z A;  3TRC A;  4NXE A;  4NEE D;  1XJ2 A;  3ZQ5 A;  4IUH A;  4M4X A;  2FZ0 A;  5HPI A;  1OPX A;  1UGU A;  2QJ7 A;  2XA7 S;  4GCZ A;  4OOL A;  2KDK A;  3EQU A;  3NHQ A;  2KX6 A;  4HQA A;  2ZMV A;  4GLQ A;  2HJ9 C;  2GJ3 A;  2HV1 A;  4Q0H A;  5C5K A;  3P01 A;  2JKT I;  2PD8 A;  4BMW A;  1H8M A;  3T4O A;  3A0V A;  1TS0 A;  4GS9 A;  4NXF A;  1OJG A;  3E4O A;  3BQ8 A;  4FSF A;  1DRM A;  4HHD A;  3EEA A;  2JHE A;  3EEH A;  3PBS A;  2GZA A;  4G3V A;  3FG8 A;  2P04 A;  4BJP A;  4B9O A;  4HP9 A;  2R78 A;  2QWS A;  3T50 A;  1T18 A;  5TBM A;  2VV8 A;  1S1Y A;  3HJI A;  1XJ6 A;  3TJZ C;  3IBR A;  4CLC B;  1DP6 A;  2GX5 A;  4MN5 A;  4UQI S;  3H82 B;  3UB7 A;  4GHI B;  3TE8 A;  1TS6 A;  2OOL A;  4B93 A;  2A24 A;  2W27 A;  1OTA A;  3HCY A;  3NOT C;  1S67 L;  1GSV A;  1XFN A;  4L9F A;  5HD5 A;  3MR0 A;  4DN0 A;  3LI8 A;  1NLZ A;  3F1P B;  5A8B A;  3MQ0 A;  3NJA A;  3EGX C;  1ODV A;  4HNB A;  2IA2 A;  3KO6 A;  3FC7 A;  3BY8 A;  3LUQ A;  1TF1 A;  3TW8 A;  3MF0 A;  2W1T A;  3RTY A;  2EA9 A;  2XSS A;  4LLO B;  5HDC A;  4WEJ A;  3S7P A;  2LB9 A;  4OOM A;  2J3W A;  2YKH A;  4PAU A;  2VJW A;  4BWI A;  3O5Y A;  3ULF A;  4MMN A;  3PBO A;  4NXB A;  1T1C A;  1LSW A;  1P0Z A;  4GS9 B;  1LT0 A;  4L9E A;  3PBR A;  2XRN A;  4Y2F A;  5F69 A;  1P9W A;  3B33 A;  5IT5 A;  1VB6 A;  2G7U A;  1MC0 A;  3LR3 A;  2PD7 A;  2D02 A;  3OBF A;  1NWZ A;  4I3J A;  2XA7 M;  4E04 A;  3KYZ A;  4G3K A;  3GDI A;  2PHY A;  3PBN A;  2J3T D;  2K7S A;  4WLA A;  3S7Q A;  5EFW A;  3CLO A;  4HJ6 A;  1NRJ A;  3T4K A;  2HGV A;  2W3E A;  5TBM B;  3D72 A;  3LI9 A;  4WUJ A;  4LRZ E;  1YAX A;  1X0O A;  4NKP A;  4Z1W A;  1N9O A;  4FOF A;  2VV7 A;  4IUK A;  2A24 B;  5AJG A;  2J80 A;  5LBR A;  3C8C A;  3UME A;  3OLO A;  3K2N A;  3BY9 A;  2VGL M;  2OAQ 1;  2W1T B;  3LFV A;  1NLY A;  3K3D A;  1H3Q A;  3LR4 A;  2VV6 A;  2DMW A;  4PHT A;  4IJG A;  4UQI M;  3IS2 A;  2JKR I;  2NUP C;  2L0W A;  3BJN A;  3C2W A;  1DP8 A;  4LRY C;  1OTE A;  3PBT A;  2O9B A;  4QPR A;  2QHK A;  1S66 L;  4EXO A;  1TS8 A;  1T19 A;  2M7V A;  3F1O A;  2VGL S;  2EWV A;  1LSV A;  3VOL A;  3KSI A;  2HJE A;  2Z6C A;  2L4R A;  1D7E A;  1S4S A;  2CMN A;  5HZH A;  2QJ5 A;  4HI4 A;  5HD3 A;  4EW7 A;  3KSG A;  4P6Z S;  1TD5 A;  3H7W A;  4G3W A;  4DMZ A;  2YKF A;  1Y28 A;  1G28 A;  4Q0I A;  3UE6 A;  4WL9 A;  1V9Z A;  5HWT A;  3ZYT A;  3LIA A;  3T4L A;  1T1B A;  4ARZ A;  4EEU A;  4MN6 A;  3S7N A;  3EGD C;  1P97 A;  4PKY G;  5HPF A;  3E4P A;  4HIA A;  4EER A;  3K3C A;  3OOV A;  3IBJ A;  3T4J A;  4EET B;  3VE3 A;  5F5Y A;  2Y8H A;  2XRO A;  3LR5 A;  4WN5 A;  3T4T A;  2V0W A;  3KSF A;  3CWF A;  3BQA A;  2J3T C;  1DP9 A;  4EEP A;  3B47 A;  5J3W A;  2GNX A;  1YSP A;  4HH2 A;  3JVU A;  4BBV A;  1OTB A;  4HH3 A;  3IS2 B;  1N9N A;  2HF6 A;  3NOU C;  1IOU A;  2A2L A;  1GSX A;  1W63 M;  2K2N A;  4KQO A;  3ICY A;  4II7 A;  4KUO A;  3PHY A;  5J4E A;  1LL8 A;  1OTI A;  2JN7 A;  4HJ4 A;  2PDR A;  3F1O B;  4RQ9 A;  5F68 A;  3R7W A;  4MCW A;  2P7J A;  5IU1 A;  3BWL A;  2WKP A;  2K31 A;  1T1A A;  3MXQ A;  2QKP A;  4GW9 A;  2D01 A;  5AVE A;  3NOP C;  4YWZ A;  1OT9 A;  4WF0 A;  4I39 A;  4JGO A;  4LPZ A;  3H7W B;  4ETZ A;  5DKK A;  3DBA A;  4H6J A;  4BBU A;  4F3L A;  2MJ6 A;  4GJ4 A;  4R6L A;  3PR6 A;  3VE4 A;  3MMH A;  5MC7 A;  1S4R A;  2JKT M;  1WA9 A;  2INW A;  2OAP 1;  4ARZ B;  1V9Y A;  4JGR A;  4O01 A;  2L1M A;  5KIZ A;  3G6O A;  3MFX A;  5HSQ A;  2ZOI A;  5DF9 A;  3RH8 B;  3MJQ A;  3D3O A;  2WKR A;  4L9G A;  2VA0 A;  1XJ3 A;  5HWV A;  4DJ3 A;  1STZ A;  2B18 A;  2LB5 A;  4HJ3 A;  4K08 A;  2VKS A;  4P6Z M;  3EOI A;  3CIT A;  3CAX A;  4ME4 A;  1XJ4 A;  3JVV A;  2PR5 A;  3PYP A;  5DKL A;  3B42 A;  2V0U A;  2W3D A;  3A0S A;  1MZU A;  3C38 A;  2KLI A;  1F9I A;  2Y79 A;  2ZOH A;  4I3I A;  4XT2 A;  3FPW A;  4YNR A;  3SW1 A;  3GEC A;  3EWK A;  4ZRR A;  5J7E A;  1D06 A;  1W63 Q;  3EQV A;  4I5S A;  2ZBB A;  5FL3 A;  4BBT A;  5K5B A;  1F98 A;  1IFQ A;  3LIB A;  4JGP A;  1EW0 A;  3PXP A;  5DJU A;  3KSH A;  4O8G A;  4KQD A;  3FPV A;  2QYB A;  3H9W A;  2OWJ A;  4WEL A;  4CQH A;  2VX8 A;  3S7O A;  3U2A A;  2W3H A;  1KOU A;  3R7W B;  5TJJ A;  3RFB A;  2W3F A;  4Q0J A;  2VEA A;  3MQQ A;  1YSQ A;  2PYP A;  5L8M A;  3UB9 A;  1BYW A;  4R70 A;  4CLC E;  1MKM A;  3LIC A;  2M7U A;  1YKD A;  1ZHH B;  5F6A A;  3BW6 A;  3MQO A;  4R3A A;  2O0Y A;  3F1N A;  4H6J B;  3OC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...