4HI4A

Crystal structure of the 5-coordinate ferric heme-binding pas domain of aer2 from p. aeruginosa
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
GSHMARIASALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDAGRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANARLGSAVQWTDRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aerotaxis transducer Aer2
publication title Architecture of the soluble receptor Aer2 indicates an in-line mechanism for PAS and HAMP domain signaling.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 36
structure length 119
sequence length 119
chains with identical sequence B, D, G
ec nomenclature
pdb deposition date 2012-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hi4A00
4HJ6A 1TS7A 4BBTA 2OWHA 2QWSA 2V0UA 4JGQA 4EW7A 3IS2B 2W0NA 2OWJA 1OTDA 1T18A 4DJ3A 1BYWA 4I39A 3VE4A 4KUOA 4GHIA 4HNBA 2GJ3A 3PYPA 4BBUA 2QJ5A 3OLOA 3MXQA 3IBRA 2VV8A 2WKQA 4EXOA 4HHDA 5A8BA 3CWFA 5I5LA 4XT2A 1S1ZA 1UGUA 4HY8A 4I3AA 1GSXA 1XFQA 3D72A 4WF0A 2PR6A 4NXFA 2VV6A 1DP8A 3GDIA 4LRYC 5G4YA 5F5YA 1KOUA 1LSWA 4HP4A 2WKRA 3NOTC 3H9WA 2VLGA 1OTIA 3RTYA 4WLAA 3GECA 3VE3A 1P97A 3LIFA 2VV7A 5HZHA 5TBMB 4F3LB 1DRMA 3EEHA 1G28A 1T1AA 3UB6A 1F98A 2ZOIA 2V0WA 4R38A 1Y28A 1V9YA 4MN5A 3B33A 3CLOA 4NXBA 2BASA 2JHEA 1XJ2A 4EEUA 3H7WB 2L0WA 2ZOHA 3F1NB 1N9OA 2YKFA 3LIEA 1WA9A 2Z6CA 3NHQA 3KX0X 1D7EA 2VEAA 1S4SA 1D06A 4GS9A 3PHYA 2P7JA 2H28A 4EERA 1UWNX 4HH2A 3MFXA 2W27A 3IS2A 2PYPA 4HP9A 3K3DA 4LLOB 1ODVA 1XFNA 2YKHA 3UE6A 3MQQA 1TS0A 1V9ZA 4HH3A 4GHIB 2KDKA 3HJKA 5HDDA 3H82A 5F6AA 2KX6A 1JNUA 4LRZE 2R78A 2PD8A 4I38A 1N9LA 5G4ZA 3FC7A 4L9EA 3LIAA 3F1OB 4H6JA 1OJGA 5HDCA 4BBVA 1UWPX 4HJ4A 3G6OA 3LI8A 4PKYA 5F69A 2QJ7A 3ULFA 3UB9A 4L9GA 4HQAA 1OTAA 1GSVA 1LT0A 3T50A 1S67L 4DJ2A 1OT6A 1X0OA 4B9OA 5DJTA 2L1MA 4R6LA 4EETB 1EW0A 2A24A 4KUKA 1GSWA 3F1PB 3NOPC 3SW1A 5TBMA 4GCZA 1LSXA 2L4RA 3LIBA 4JGOA 5HD3A 3A0SA 2J80A 1DP6A 4KQDA 1OJ5A 5HDSA 3LUQA 2HV1A 1XJ3A 4YWZA 3NJAA 1OTEA 2WKPA 4RQ9A 1P0ZA 3LI9A 3H7WA 4MN6A 5HWVA 5HWTA 3UB7A 3NOUC 4EEPA 2I9VA 4R70A 5KIZA 2PYRA 4I3JA 3BY9A 3ZQ5A 3RH8B 3A0RA 1T1CA 1LSVA 2EA9A 5HWWA 1LL8A 3K3CA 4R3AA 4I5SA 3P7NA 3UB8A 1S1YA 4I3IA 4LRXC 4NXGA 3MR0A 4LPZA 3VOLA 2PHYA 5J4EA 1S66L 4EESA 1T19A 4M4XA 4WUJA 4PKYG 2V1BA 1T1BA 3H82B 4XT2B 3E4PA 3LICA 1XJ6A 2PR5A 1N9NA 5DJUA 3UMDA 2QHKA 3F1OA 4H6JB 1DP9A 5AVFA 2K7SA 3EWKA 1TS6A 1OTBA 3C2WA 4HJ3A 5HD5A 3E4OA 2V9AA 2PD7A 5F68A 2OOLA 2Z6DA 3E4QA 5J7EA 3BWLA 5IS1A 2D01A 1XJ4A 3C8CA 3CAXA 4WL9A 4HIAA 3MQOA 4L9FA 3UMEA 1S4RA 4JGRA 4HI4A 1NWZA 4F3LA 4HOIA 5J3WA 3BY8A 1F9IA 2QKPA 1OT9A 2A24B 3F1PA 4WN5A 4EQ1A 2JN7A 5AVEA 4K08A 3HJIA 2CMNA 3FG8A 5HSQA 3LIDA 3A0VA 1MZUA 2M1CA 3LYXA 2PDRA 2ZBBA 5EFWA 1TS8A 4JGPA 5DKKA 3F1NA 1VB6A 2INWA 5IU1A 2B02A 4E04A 5DKLA 4GW9A 2V1AA 4NXEA 3ICYA 4GS9B 2D02A 3MJQA
chains in the Genus database with same CATH superfamily
4HJ6A 5GHXA 3MFDA 1BT5A 4EW7A 4X1MA 1YAXA 3UO9A 1I5QA 1N9BA 5U47A 4E3KA 2J3TD 3HLEA 1KGEA 3LCEA 1OTDA 5KMWA 3LFVA 4DJ3A 1BYWA 3BYDA 2WYXA 3PXPA 1FQGA 1YLZA 4R4SA 4HNBA 3AGEA 4JPMA 4EUVA 1TF1A 2ZJ9A 5E2FA 4Y13A 2NUPC 3W2ZA 5IT5A 4N9LA 5EOEA 3UE1A 2ZQCA 4WBGA 3CUEA 4UA7A 3HLWA 4Q8IA 3N6IA 1MPLA 5A8BA 5EE8A 4P6BA 4OPQA 3O3VA 4X25A 4C75A 3E2KA 1XFQA 4WF0A 1XA1A 3OPHA 1KE3A 2Y79A 2Q9NA 2VV6A 2GNXA 2K31A 2Y2KA 4XUXA 2QZ6A 4HP4A 2RCXA 3VSKA 4IBRA 3UY6A 1OTIA 3JPUA 4L0LA 3RTYA 2XR0A 4PM7A 1P97A 2J8YA 5TR7A 5FI7A 4JXWA 4F3LB 1DRMA 3EEHA 3TW8A 3OPRA 3KYZA 2ZOIA 3N8SA 2MJ6A 5L8MA 1PWDA 4DE1A 3SS3A 2LB5A 3IHAA 1KE0A 3T4TA 2Y4AA 4S2NA 2ZC6B 3TJZC 4MN5A 1LI9A 5HAIA 4DXCA 1NY0A 5EM0A 1HD8A 5GLAA 2IWBA 5HAQA 2ZOHA 4B88A 3LY4A 1FIKA 2ZLYA 2Z6CA 4KG2A 1IEMA 3BFFA 2HP5A 3HLCA 1D7EA 3HCYA 3GQZA 1CI9A 1MWRA 1D06A 3RFBA 1MKIA 1CI8A 3NIAA 4E3OA 2GDNA 2OLVA 4Y0TA 1Q2PA 3P09A 3IF5A 4HP9A 5L10A 2EWVA 4CLCC 4OP5A 1ODVA 1Y4OA 4GB7A 3EQUA 1ES5A 3MQQA 1TS0A 1L3LA 4DN0A 1W63Q 4RX3A 4GLQA 4MDZA 1CK3A 5CHMA 1ONGA 3H82A 5EVIB 1K57A 1IKGA 2PD8A 1N9LA 2Y2HA 4GZBA 1OJGA 5HDCA 1ONHA 4UAAA 1ALQA 4S2MA 2Y2QA 3IHBA 3SH9A 3LO7A 4PM9A 5F69A 2Y91A 3A3IA 1BLPA 1XGJA 2WADA 5HX9A 4EV4A 2VA0A 4ZDXA 3KYEA 5FSRA 3FPWA 1LT0A 2B5RA 1X0OA 2W1RA 3SS4A 2VZWA 1K56D 5CECA 4B9OA 4E3NA 2L1MA 4R6LA 4U0XA 4EETB 1EW0A 5FATA 3BJNA 3DWZA 3S7PA 1GSWA 1H5XA 5CX7A 4MBKA 3G34A 3LIBA 1Q2QA 4BLMA 4JGOA 4UA6A 4FSFA 5CGXA 3OZHA 1DP6A 1RGZA 3ZVTA 1OJ5A 1MWSA 4YWZA 5FAPA 4OQGA 5TFQA 1IYQA 2WKPA 3CZDA 4MBFA 3WS0A 2XF3A 4X53A 4LCMA 1BSGA 4R3JA 3G2ZA 5EOOA 5HWVA 5HWTA 2J9PA 3NOUC 4FOFA 3LR3A 4GN2A 3IWIA 3EQVA 1NJ4A 2PYRA 1TD5A 4IUKA 4O01A 3L7HA 1HZOA 3DW0A 5C5KA 5EVID 4QHCA 1S6RA 3K3CA 1YKDA 4R3AA 4I5SA 3UDFA 4KZ5A 1H3QA 4JXSA 3V39A 4LRXC 4NXGA 5FQMA 3C7VA 2VGKA 3VV4A 1EROA 2P74A 3CPTA 1K57C 2PHYA 3IX4A 4EESA 1MY8A 3RXWA 3O87A 4GDNA 4GNUA 3T4LA 3SZTA 4KZ9A 4Y3IA 1T1BA 3H82B 3E4PA 5EM1A 2WK0A 4LFUA 3VOZA 1XJ6A 2PR5A 5DFXA 3MZEA 1ESIA 1PZOA 2QHKA 2Y2LA 4NETA 2O9CA 2XROA 1KVMA 5GLCA 3EWKA 1TS6A 5FL3A 4DE2A 4KQRA 5HD5A 2HDRA 1L0DA 2ZC7A 2O0YA 1U60A 3BLSA 4IBXA 2QPNA 3N8RA 5IS1A 1MWTA 1TVFA 3P98A 3DTKA 3T1SA 4H8RA 2V1ZA 4HEFA 1S4RA 1XP4A 1SDNA 4HI4A 3CMZA 1NWZA 1SZVA 3HUMA 4KG6A 4RVAA 5J3WA 3BY8A 1F9IA 1YMSA 2QKPA 1KDWA 2J3WA 3ZNTA 3ZFZA 4B4ZA 2VGLM 4K08A 3ZG8B 1IYPA 2CMNA 5HSQA 2PBDP 5M1AA 1SHVA 1MZUA 3O5YA 4Q0JA 4P0MA 2M1CA 2XFTA 2PDRA 3LYXA 3VP3A 1MWUA 1FCNA 2Z2MB 2ZBBA 4GJ4A 3HLGA 1JTDA 3FZCA 1H8ZA 2ZQ7A 5EFWA 1QMEA 5E2GA 4KG5A 1BLSA 5DKKA 2WKHA 2R9XA 1VB6A 4ARZA 3QNCA 5AQBA 4LV2A 3T4QA 1H0MA 1W5DA 3MKFA 3ICYA 4UQIM 2O9AA 2D02A 5CHJA 1VEUA 3IXDA 4JKTA 3U4LP 4EU0A 2OWHA 4C6YA 5I94A 3FPVA 4R1GA 3TOIA 4BD1A 4BENA 3V50A 5FI6A 1T18A 4OVDA 5A91A 5CGWA 4KUOA 4NKPA 2ZD8A 4GHIA 1SKOB 2IWCA 3M2JA 1GHIA 2HJ9C 3UPNA 2WKQA 3OOVA 4X1LA 3T4SA 2ZL1A 1XPBA 4HHDA 5CXWA 1EWZA 3VP1A 3WS1A 5AQ9A 3UE0A 1W8QA 1GSXA 2PBYA 3OPLA 3D72A 2A49A 4R0QA 1FCMA 3A3FA 2PR6A 4NXFA 2HZ5A 1DP8A 4IJGA 5KSHA 3NI9A 3IBJA 3MQ0A 2P9VB 3T1RA 1KOUA 4KZ8A 5GHYA 2P08A 3H9WA 2VLGA 2W3GA 1BTLA 1W8YA 4DRTA 3GECA 3C5AA 4GD8A 3VE3A 4HBUA 4IVKA 3LIFA 1IYOA 4ZJ3A 1FSWA 2W1TA 3CHWP 5TBMB 2H0TA 1YLPA 1T1AA 4D2OA 4E6XA 2XD5A 4E6WA 3PBRA 4R3BA 1Y28A 2C5WB 4QB8A 1NLYA 3C7UA 3B33A 3ZGAB 2V8CA 4NXBA 2W3DA 2BASA 2XQZA 4EEUA 3GTCA 3H7WB 4UHUA 4WEKA 2WKIA 3FKVA 3KSGA 4ARZB 3NDEA 3NDGA 1WA9A 1PWCA 3NHQA 2HDSA 4ZTKA 5A93A 2BTFP 4FH2A 2WKEA 1L0GA 4Y5FA 1QMFA 3LR0A 3PR6A 4GS9A 4DDYA 2P7JA 1JWPA 4Y2FA 1UWNX 3M6BA 4EUZA 3ZG7B 2HPBA 3IX8A 3IS2A 1YSPA 4OONA 2PYPA 4K0WA 4ZJ1A 3N4IA 2EX9A 4LLOB 1NRFA 4NK3A 4CLCA 1XFNA 3UE6A 4YFMA 4GHIB 3ISGA 2DCFA 1ESUA 4MNRA 1VHMA 4OQ0A 5E43A 1K38A 4LRZE 4I38A 3Q7VA 1DJBA 1WE4A 4S2JA 4Y15A 5DTTA 2XEPA 2EX8A 4U3TA 3F1OB 1UWPX 5K5BA 3LI8A 5M18A 1DJAA 1WYBA 3FYZA 3UE3A 4FUWA 4DMZA 4EBPA 3QP4A 4OP8A 3JYIA 3ZYTA 3ITBA 3VP4A 4HQAA 3OCLA 3EGDC 1GSVA 2OSUA 3VFHA 3SH8A 3VMAA 4KENB 4CLCE 3LEQA 1OPXA 5CEBA 2VJWA 4WZ5C 2W1TB 2K2NA 3F1PB 3SW1A 5FQQA 2DRWA 4GCZA 1Z09A 5EPHA 5HD3A 3A0SA 4LV3A 3TG9A 4CPKA 4E3IA 4KQDA 3LUQA 4KZ4A 3ZHHA 4FTXA 1GA9A 1PW8A 1EI5A 5FA7A 4ZBEA 2XFSA 1BLHA 1P0ZA 4BQMA 1P9WA 3DBAA 1PI4A 3UB7A 2GZAA 5L2FA 3MMHA 1FSYA 3G30A 5KIZA 4BD0A 5FQJA 1H8MA 1YMXA 3RH8B 1YLYA 5FI2A 3QP6A 4Y0OA 4G3VA 3P7NA 3VP0A 2JKGA 4WELA 3BRMA 3PBQA 2XLNA 1IELA 4LPZA 1ES2A 1NXYA 2XRNA 4XUZA 4OQIA 3ITAA 1ZTUA 2ZC5B 1PNEA 3IXHA 4FCFA 4PKYG 2A3UA 2V1BA 4MEZA 2ZQ8A 1TDGA 5EVIC 1ZHHB 4MN7A 4D60A 1NYYA 3Q7VB 4G3WA 5AQAA 2QMIA 1K25A 5DJUA 3UMDA 5HL1A 1DP9A 4HJ3A 4NG2A 4S2PA 1GHMA 5F68A 4ESPA 4QJGA 2Z6DA 3E4QA 1SKFA 4IUHA 3C8CA 3CAXA 4JXVA 2ZC3B 1LI0A 4S2LA 4L9FA 4GDBA 3UMEA 2Y2JA 2J9OA 3CG5A 4E3LA 3B3XA 3BEBA 3A3DA 3W4OA 1BULA 4N1XA 2Q0OA 1NZUA 3HLDA 3I7JA 4R4RA 1HTZA 3HJIA 4AFIA 3VP2A 1W7FA 3LIDA 3QNBA 3HBRA 4QY5A 3TSGA 1ERMA 1CF0A 1TS8A 1KDSA 3KSFA 3F1NA 2ACGA 5IU1A 3IF6C 5HW3A 2BLSA 2B02A 3V3SA 2W3EA 4JLFA 4XXRA 4NXEA 4OH0A 2FZ0A 3LEZA 1JTGA 2R9WA 4KZ6A 3N8LA 4BBTA 4ZRRA 2V0UA 4JF4A 2JKTM 4WEJA 3N7WA 1I2SA 4OLGA 2W0NA 2VGLS 2VGJA 4O8GA 4S2OA 3RXXA 1MC0A 4OPRA 4ZAMA 5L07A 2IA2A 3BFCA 3P01A 1O07A 4Y17A 1NYMA 3OLOA 3PAEA 3O88A 2VV8A 2I72A 5DF8A 4CJNA 4XT2A 4Q0IA 5DTKA 3HUOA 4KQQA 3PBTA 4UQIS 5CTMA 4DE0A 3IWQA 4YINA 4PM5A 3IT9A 3SS5A 4MCWA 3GDIA 4LRYC 1M40A 4BJPA 1CEFA 3IX3A 1LSWA 3PBNA 3NOTC 1LLBA 4EBNA 5GL9A 2WGIA 1XA7A 5HZHA 4B4XA 3WRTA 5FDSA 1ZG4A 1G28A 3UB6A 1F98A 5A92A 3D3OA 3D4FA 4R38A 1GCEA 1PWGA 4O7DA 1ZG6A 1FOFA 2X01A 2V8FA 3CLOA 1G6OA 2WAFA 1XGIA 1L0EA 2WUQA 2VX8A 3F1NB 1N9OA 3LIEA 3QP2A 1PRQA 1ACFA 3KSHA 1JWZA 3KX0X 2W3HA 3T12B 5L09A 2VEAA 3LR4A 2KLIA 1K6SA 4EERA 3DTEA 4MLLA 3TE8A 1ZC2A 2E8IA 3BQAA 3MFXA 1RGYA 3E0YA 1F2KA 3S7NA 3MKEA 3K3DA 3A3JA 3E2LA 4OOYA 3CPTB 3V67A 1V9ZA 3TRCA 2KDKA 3B42A 3HJKA 1O7EA 3WS5A 1K55C 3OCNA 2J3TC 3ZNYA 1JNUA 1K4FA 1LL9A 1E3UA 5G4ZA 3FC7A 4L9EA 4H6JA 3G2YA 4BBVA 3BLMA 3L9KA 5EUAA 4P6ZM 1P9RA 2FFYA 1RP5A 4PKYA 3K2NA 2QJ7A 3GVBA 3NY4A 4X68A 5E2EA 3C4OA 4BL3A 3UB9A 2G7UA 4L9GA 5HAPA 1NLZA 2O99A 2Y59A 3T50A 1S67L 2Y2GA 3U2AA 3Q81A 3B47A 2HDQA 3NCKA 4Z9QA 3GMWA 4KUKA 4WZ5A 1CEGA 4U0TA 2ZQAA 3T4OA 1LSXA 2L4RA 5EVLA 4X55A 3OPPA 2J80A 4KZAA 3PBSA 5HDSA 1XJ3A 1OTEA 1GA0A 1ES3A 5HARA 1K56A 2HJEA 2J7VA 5GLBA 4RQ9A 4GD6A 1PYYA 4BWIA 5MC7A 3HLBA 4MN6A 2DNSA 3PAGA 2I9VA 1I2WA 4WZ4A 4DXBA 2EX2A 1G68A 1VEUB 3ZQ5A 3S1YA 4ID4A 2W3FA 1TDLA 3GSGA 1LSVA 3LR5A 2EA9A 5DF7A 5GHZA 2M7UA 3AGFA 1OMEA 1DY6A 4I3IA 2JKRM 1BZAA 2OV5A 5J4EA 2ZMFA 5JYOA 5AQ7A 2A2LA 2ZL1B 3G35A 4WUJA 2WAEA 2FFFB 4QPRA 5EVIA 5J8XA 1N9NA 4R23A 5G18A 2DMWA 4G3KA 3WS4A 3UPPA 4DE3A 5F1GA 1K4EA 4H6JB 5F82A 2K7SA 4OOMA 3GRJA 2PT7A 1OTBA 4LENA 2WGVA 2XGNA 3C2WA 5KZHA 2X02A 3E4OA 4LV0A 4WMCA 4OOLA 3DTIA 2V9AA 5BOHA 4MBHA 1FR6A 5DTSA 3MSHA 5J7EA 1AXBA 2C6WB 3BWLA 4Z1WA 2D01A 1XJ4A 2EWWA 2Y2PA 3VFFA 2B18A 3SOIA 3WWXA 2O9BA 4HIAA 2ZQDA 5M19A 3BFEA 1PFLA 4JGRA 4OPYA 3W4QA 4M3KA 1IOUA 1E25A 1CQAA 3NULA 2CC1A 2Y2NA 3R4KA 4HOIA 3HREA 5F1FA 1OT9A 3S7OA 2EXAA 5TJJA 4WN5A 4EQ1A 2JN7A 5AVEA 1SDEA 5FQIA 2G2WA 1C3BA 4O0PA 3A0VA 1VETA 3RJUA 3E98A 3UB5P 2EFXA 1NRJA 5JYPA 4N1HA 3S4XA 4JGPA 2UV0E 4QU3A 3C4PA 1M6KA 2WZZA 3FKWA 4QD4A 4E04A 3IF6A 4GW9A 3Q1FA 1K54C 2V1AA 3W8KA 5E2HA 4ZJ2A 2RL3A 5CERA 4X6TA 4GS9B 3Q07A 4P87A 3MJQA 3BW6A 1TS7A 4P85A 3CI6A 1XX2A 2JKTI 2QWSA 3FWLA 1LL5A 4JGQA 3S22A 3IS2B 5FDHA 1FCOA 2ZMAA 4DKIA 2OWJA 1KGGA 3EGXC 4CLCB 1E3UD 1J9MA 1H8YA 4II7A 4I39A 2ZM8A 2PU4A 3VE4A 1AWIA 2GJ3A 3GR2A 2V2FF 3PYPA 5FQ9A 4BBUA 1D1JA 2QJ5A 3MXQA 3IBRA 5EV0A 4BMWA 4ME4A 3CUEC 4OLDA 4EXOA 4YOFA 5CRFA 4UEYA 1TEMA 3BFDA 3CWFA 3Q7ZA 5I5LA 5CEDA 1S1ZA 2PRFA 4F94A 1JWVA 1UGUA 4HY8A 4I3AA 3BFGA 4E3JA 2LB9A 3MS6A 1DJCA 5HPIA 5IHVA 1FR1A 1PW1A 5G4YA 1K6RA 5F5YA 3BECA 4E3MA 1Y54A 2WKRA 4PHTA 3S7QA 1ES4A 4WLAA 1YM1A 4IEDA 2V20A 5EECA 2VKSA 1BLCA 2VV7A 4X56A 5LBRA 3DWKA 3BM6A 1Z6FA 1XKZA 3UDXA 5FEGA 4JF6A 5CTNA 2V0WA 3NBLA 4S2NC 2PU2A 4PMAA 5HPFA 1YQSA 1V9YA 2OLUA 3HVFA 1VETB 3C38A 4N9KA 1HVBA 2ZMVA 3ZG5A 5CHUA 2JE5A 3QP5A 3QP1A 2JHEA 1XJ2A 2H5SA 2M7VA 2UWXA 3CJMA 2L0WA 4KZ3A 2Y8HA 4QY6A 2FH5A 4DDSA 2Y2OA 2YKFA 5GLDA 4RX2A 1PI5A 3V3RA 4CLCD 3IF6B 3IQAA 4FH4A 1ZKJA 3LGOA 1GHPA 4KQOA 1S4SA 3HLFA 1IYSA 2OAP1 3PHYA 2H28A 4N92A 4BL2A 4A5RA 4HESA 4HH2A 3O86A 2W27A 4ETXA 2OAQ1 4LV1A 1XXMA 1YLWA 5EVEA 5HL6A 2HGVA 3R7WA 3ZVWA 4JXGA 1S0WA 2YKHA 3D9YA 1PZPA 3QP8A 1MKMA 4HH3A 3G31A 4Y0UA 3MF0A 1E4DA 1SKOA 2XDMA 3PTEA 2EXBA 4UA9A 2HP6A 2XK1A 3HL9A 5HDDA 4CQHA 2X71A 3HUNA 5HFOA 3T4KA 5F6AA 1CJFA 4OKPA 2KX6A 4WMCD 1K55A 3G4PA 1F5MA 2R78A 2JCHA 2WGWA 3MZDA 3LIAA 4Q0HA 4EBLA 2GX5A 3QHYA 2XH9A 1W79A 2E8JA 2XA7S 3MXSA 1YLJA 4HJ4A 3G6OA 5D3OA 4JBFA 1VM1A 2ZC4B 5CGSA 1HLUP 4WM9A 1YSQA 1PIOA 2P9VA 2VK3A 3KYQA 5FQKA 1VQQA 3ULFA 4OQHA 2Y2IA 5DVAA 3JVUA 4S2KA 4GOGA 3MZFA 1OTAA 3T1QB 3OC2A 4DJ2A 3KO6A 1OT6A 3WRZA 2IWDA 4LCLA 3MBZA 4EQIA 5DJTA 4PM6A 2HP9A 5FEFA 4X69A 2A24A 5FAOA 3PBOA 3ZG9B 3FV7A 4IHQA 2BG1A 3NOPC 5TBMA 2JC7A 1J3WA 3C30A 2KOIA 3JVVA 2ZM2A 2HV1A 3DTMA 3NJAA 4P6ZS 5A90A 3SH7A 2NUTC 3UNWA 4ETZA 1RCJA 3MXRA 1SCWA 4KZBA 3VOYA 2H10A 4GKUA 2HF6A 3IWOA 3LI9A 3H7WA 4C3QA 5F83A 5FASA 4EEPA 4JF5A 2XA7M 4R70A 3NC8A 3BY9A 4I3JA 2P04A 5FAQA 2Q9MA 3A0RA 1T1CA 1LHYA 2EFUA 3VSLA 5HWWA 1LL8A 3UB8A 2Y2MA 4PM8A 4K91A 4PPRA 2JKRI 1S1YA 2WZXA 1IKIA 2B95A 4PAUA 3G32A 5DFYA 3R7WB 3ZG0A 3MR0A 1YLTA 3Q82A 3VOLA 2XSSA 3M2KA 3A3EA 1S66L 2XD1A 1T19A 4M4XA 2JBFA 1NZOA 1BUEA 1WYCA 1G5UA 1ERQA 4XT2B 3AGDA 4KZ7A 3LICA 3OBFA 2WGWB 4DF6A 1FILA 1N4OA 4K0XA 4HBTA 3F1OA 3DAVA 1A0KA 5AVFA 3IH9A 4QWOA 5KSCA 5DF9A 4OPZA 4FD8A 3LY3A 3V5MA 3WS2A 2ZM0A 2AVXA 2PD7A 2OOLA 3UPOA 2JKFA 3M6HA 3CITA 3EOIA 4MMNA 1L2SA 4WL9A 1JVJA 3MQOA 3ZCZA 5AJGA 3BQ8A 1YPRA 4RYEA 4Y7PA 4F3LA 5TGFA 2A24B 4YNRA 2G2UA 4NEED 3F1PA 3IH8A 3ZDJA 1L0FA 2ZQ9A 4LGWA 2Y55A 3EEAA 3FG8A 2Z2LB 2QYBA 4IVIA 3T4JA 4EWFA 1STZA 3UN7A 1KVLA 2H0YA 2PAVP 2HDUA 2EX6A 3UDIA 3IXGA 3NECA 1K0KA 4S2IA 4WYYA 1W63M 2INWA 1MBLA 3W4PA 1MXOA 3KSIA 5DKLA 4B93A 1IFQA 3IXBA 4RA7A 1YT4A 3T1XA 1K54A 1G6AA 3GV9A 1KE4A 1KGFA
chains in the Genus database with same CATH topology
4HJ6A 1TS7A 4BBTA 3CI6A 4ZRRA 4EU0A 2JKTI 2OWHA 2QWSA 2V0UA 2JKTM 3FPVA 4JGQA 4WEJA 4EW7A 3IS2B 2W0NA 2VGLS 1YAXA 2OWJA 2J3TD 4O8GA 3EGXC 1OTDA 4CLCB 3LFVA 1T18A 4DJ3A 1BYWA 4II7A 4I39A 3PXPA 3VE4A 4KUOA 4NKPA 1MC0A 4GHIA 4HNBA 2GJ3A 2IA2A 4EUVA 3P01A 3PYPA 1TF1A 4BBUA 2HJ9C 2QJ5A 3OLOA 2NUPC 3MXQA 3IBRA 4BMWA 2VV8A 3W2ZA 2WKQA 5IT5A 3OOVA 3CUEC 4ME4A 4EXOA 3T4SA 4HHDA 3CUEA 4YOFA 5A8BA 4UEYA 3CWFA 5I5LA 4XT2A 1S1ZA 4Q0IA 1UGUA 4HY8A 4I3AA 1GSXA 3PBTA 4UQIS 2LB9A 1XFQA 3D72A 4WF0A 2PR6A 4NXFA 5HPIA 2Y79A 4MCWA 2VV6A 1DP8A 2GNXA 4IJGA 3GDIA 5KSHA 4LRYC 3IBJA 3MQ0A 4BJPA 5G4YA 2K31A 5F5YA 1KOUA 1LSWA 2P08A 4HP4A 3PBNA 2WKRA 4PHTA 3NOTC 3H9WA 2VLGA 2W3GA 3S7QA 1OTIA 4L0LA 3RTYA 4WLAA 3GECA 1P97A 3VE3A 3LIFA 2VKSA 2W1TA 2VV7A 5LBRA 5HZHA 5TBMB 4F3LB 1DRMA 3EEHA 3TW8A 1G28A 1T1AA 3UB6A 1F98A 3KYZA 2ZOIA 2MJ6A 5L8MA 3D3OA 3PBRA 2V0WA 4R38A 1Y28A 2LB5A 5HPFA 3T4TA 1V9YA 3TJZC 4MN5A 1NLYA 3C38A 3B33A 2ZMVA 3CLOA 4NXBA 1G6OA 2W3DA 2BASA 2JHEA 1XJ2A 2M7VA 4EEUA 3H7WB 2VX8A 2L0WA 2Y8HA 2ZOHA 3F1NB 4WEKA 1N9OA 2FH5A 3KSGA 2YKFA 3LIEA 4ARZB 4CLCD 1WA9A 3KSHA 2Z6CA 3NHQA 3KX0X 2W3HA 1D7EA 4Y5FA 4KQOA 2VEAA 1S4SA 3HCYA 3LR4A 3LR0A 1D06A 3PR6A 3RFBA 4GS9A 2OAP1 3PHYA 2KLIA 2P7JA 2H28A 4EERA 4Y2FA 3TE8A 1UWNX 4HH2A 3BQAA 3MFXA 2W27A 4ETXA 3E0YA 2OAQ1 3IS2A 1YSPA 2PYPA 3S7NA 4HP9A 2EWVA 4CLCC 3K3DA 4LLOB 5HL6A 2HGVA 3R7WA 1ODVA 4CLCA 1XFNA 2YKHA 3UE6A 3EQUA 3MQQA 1MKMA 1TS0A 1V9ZA 4HH3A 3V67A 3MF0A 4GHIB 4DN0A 1W63Q 3TRCA 2KDKA 4GLQA 3B42A 3HJKA 4MDZA 5HDDA 4CQHA 1VHMA 3T4KA 3H82A 5F6AA 3OCNA 2J3TC 2KX6A 1JNUA 4LRZE 1F5MA 2R78A 2PD8A 4I38A 1N9LA 5G4ZA 3FC7A 4L9EA 3LIAA 4Q0HA 2GX5A 3F1OB 4H6JA 1OJGA 5HDCA 4BBVA 1UWPX 2XA7S 5K5BA 4HJ4A 4P6ZM 3G6OA 1P9RA 3LI8A 4PKYA 3UE3A 4DMZA 5F69A 1YSQA 3K2NA 2QJ7A 3KYQA 3ULFA 3UB9A 3JVUA 3ZYTA 2G7UA 4L9GA 4HQAA 1NLZA 2O99A 3OCLA 1OTAA 2VA0A 3EGDC 1GSVA 3FPWA 3OC2A 1LT0A 3T50A 1S67L 3U2AA 4DJ2A 3KO6A 1OT6A 1X0OA 2W1RA 2VZWA 4CLCE 3B47A 4B9OA 1OPXA 5DJTA 2L1MA 4R6LA 4EETB 2VJWA 1EW0A 2A24A 3PBOA 4KUKA 3BJNA 4IHQA 2W1TB 2K2NA 1GSWA 3F1PB 3NOPC 5CX7A 3S7PA 3SW1A 5TBMA 3T4OA 4GCZA 1LSXA 2L4RA 3LIBA 4JGOA 5HD3A 3A0SA 4FSFA 3C30A 2KOIA 2J80A 3JVVA 1DP6A 4KQDA 3PBSA 1OJ5A 5HDSA 3LUQA 2HV1A 1XJ3A 4YWZA 3NJAA 1OTEA 4P6ZS 2WKPA 2NUTC 4ETZA 2HJEA 4RQ9A 1P0ZA 1P9WA 3DBAA 2HF6A 4BWIA 5MC7A 3LI9A 3H7WA 4MN6A 5HWVA 5HWTA 3UB7A 2GZAA 3NOUC 4EEPA 2I9VA 4FOFA 3LR3A 2XA7M 3MMHA 4R70A 3EQVA 5KIZA 2PYRA 4I3JA 3BY9A 1TD5A 2P04A 3ZQ5A 1H8MA 3RH8B 4IUKA 2W3FA 3A0RA 4O01A 1T1CA 1LSVA 3LR5A 2EA9A 5C5KA 5HWWA 1LL8A 2M7UA 3K3CA 1YKDA 4R3AA 4G3VA 4I5SA 3P7NA 3UB8A 1H3QA 4WELA 2JKRI 1S1YA 4I3IA 4PAUA 2JKRM 3PBQA 4LRXC 5DFYA 4NXGA 3R7WB 3MR0A 4LPZA 3VOLA 3VV4A 2PHYA 2XRNA 2XSSA 5J4EA 2ZMFA 1S66L 4EESA 1ZTUA 2A2LA 1T19A 4M4XA 4WUJA 4PKYG 3T4LA 2V1BA 4Y3IA 1ZHHB 4MN7A 1T1BA 3H82B 4QPRA 3E4PA 4XT2B 3LICA 3OBFA 1XJ6A 2PR5A 5DFXA 4G3WA 1N9NA 2DMWA 4G3KA 5DJUA 3UMDA 2QHKA 3F1OA 4H6JB 1DP9A 2O9CA 2XROA 5AVFA 2K7SA 3EWKA 4OOMA 1TS6A 2PT7A 1OTBA 5DF9A 5FL3A 3C2WA 4HJ3A 5HD5A 3E4OA 4OOLA 2V9AA 2PD7A 5F68A 2O0YA 2OOLA 2Z6DA 3E4QA 5J7EA 3BWLA 4Z1WA 5IS1A 3CITA 3EOIA 4IUHA 4MMNA 2D01A 1XJ4A 3C8CA 2EWWA 3CAXA 2B18A 4WL9A 2O9BA 4HIAA 3MQOA 4L9FA 3UMEA 5AJGA 1S4RA 4JGRA 3BQ8A 4HI4A 1IOUA 1NWZA 4F3LA 3R4KA 4HOIA 5J3WA 3BY8A 1F9IA 2QKPA 1OT9A 2A24B 2J3WA 3S7OA 4YNRA 4NEED 5TJJA 3F1PA 4WN5A 4EQ1A 2JN7A 2VGLM 5AVEA 4K08A 3HJIA 4AFIA 2CMNA 3EEAA 3FG8A 2QYBA 4O0PA 5HSQA 3LIDA 3A0VA 3T4JA 1MZUA 3O5YA 4Q0JA 2M1CA 3E98A 1STZA 3LYXA 2PDRA 2ZBBA 4GJ4A 1NRJA 5EFWA 1TS8A 4JGPA 3KSFA 5DKKA 3F1NA 1VB6A 1W63M 2INWA 5IU1A 3KSIA 2B02A 4ARZA 4E04A 5DKLA 4B93A 1IFQA 4GW9A 2V1AA 2W3EA 3T4QA 4NXEA 2FZ0A 3ICYA 4GS9B 2O9AA 4UQIM 2D02A 3MJQA 3BW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJ6 A;  1TS7 A;  4BBT A;  2OWH A;  2QWS A;  2V0U A;  4JGQ A;  4EW7 A;  3IS2 B;  2W0N A;  2OWJ A;  1OTD A;  1T18 A;  4DJ3 A;  1BYW A;  4I39 A;  3VE4 A;  4KUO A;  4GHI A;  4HNB A;  2GJ3 A;  3PYP A;  4BBU A;  2QJ5 A;  3OLO A;  3MXQ A;  3IBR A;  2VV8 A;  2WKQ A;  4EXO A;  4HHD A;  5A8B A;  3CWF A;  5I5L A;  4XT2 A;  1S1Z A;  1UGU A;  4HY8 A;  4I3A A;  1GSX A;  1XFQ A;  3D72 A;  4WF0 A;  2PR6 A;  4NXF A;  2VV6 A;  1DP8 A;  3GDI A;  4LRY C;  5G4Y A;  5F5Y A;  1KOU A;  1LSW A;  4HP4 A;  2WKR A;  3NOT C;  3H9W A;  2VLG A;  1OTI A;  3RTY A;  4WLA A;  3GEC A;  3VE3 A;  1P97 A;  3LIF A;  2VV7 A;  5HZH A;  5TBM B;  4F3L B;  1DRM A;  3EEH A;  1G28 A;  1T1A A;  3UB6 A;  1F98 A;  2ZOI A;  2V0W A;  4R38 A;  1Y28 A;  1V9Y A;  4MN5 A;  3B33 A;  3CLO A;  4NXB A;  2BAS A;  2JHE A;  1XJ2 A;  4EEU A;  3H7W B;  2L0W A;  2ZOH A;  3F1N B;  1N9O A;  2YKF A;  3LIE A;  1WA9 A;  2Z6C A;  3NHQ A;  3KX0 X;  1D7E A;  2VEA A;  1S4S A;  1D06 A;  4GS9 A;  3PHY A;  2P7J A;  2H28 A;  4EER A;  1UWN X;  4HH2 A;  3MFX A;  2W27 A;  3IS2 A;  2PYP A;  4HP9 A;  3K3D A;  4LLO B;  1ODV A;  1XFN A;  2YKH A;  3UE6 A;  3MQQ A;  1TS0 A;  1V9Z A;  4HH3 A;  4GHI B;  2KDK A;  3HJK A;  5HDD A;  3H82 A;  5F6A A;  2KX6 A;  1JNU A;  4LRZ E;  2R78 A;  2PD8 A;  4I38 A;  1N9L A;  5G4Z A;  3FC7 A;  4L9E A;  3LIA A;  3F1O B;  4H6J A;  1OJG A;  5HDC A;  4BBV A;  1UWP X;  4HJ4 A;  3G6O A;  3LI8 A;  4PKY A;  5F69 A;  2QJ7 A;  3ULF A;  3UB9 A;  4L9G A;  4HQA A;  1OTA A;  1GSV A;  1LT0 A;  3T50 A;  1S67 L;  4DJ2 A;  1OT6 A;  1X0O A;  4B9O A;  5DJT A;  2L1M A;  4R6L A;  4EET B;  1EW0 A;  2A24 A;  4KUK A;  1GSW A;  3F1P B;  3NOP C;  3SW1 A;  5TBM A;  4GCZ A;  1LSX A;  2L4R A;  3LIB A;  4JGO A;  5HD3 A;  3A0S A;  2J80 A;  1DP6 A;  4KQD A;  1OJ5 A;  5HDS A;  3LUQ A;  2HV1 A;  1XJ3 A;  4YWZ A;  3NJA A;  1OTE A;  2WKP A;  4RQ9 A;  1P0Z A;  3LI9 A;  3H7W A;  4MN6 A;  5HWV A;  5HWT A;  3UB7 A;  3NOU C;  4EEP A;  2I9V A;  4R70 A;  5KIZ A;  2PYR A;  4I3J A;  3BY9 A;  3ZQ5 A;  3RH8 B;  3A0R A;  1T1C A;  1LSV A;  2EA9 A;  5HWW A;  1LL8 A;  3K3C A;  4R3A A;  4I5S A;  3P7N A;  3UB8 A;  1S1Y A;  4I3I A;  4LRX C;  4NXG A;  3MR0 A;  4LPZ A;  3VOL A;  2PHY A;  5J4E A;  1S66 L;  4EES A;  1T19 A;  4M4X A;  4WUJ A;  4PKY G;  2V1B A;  1T1B A;  3H82 B;  4XT2 B;  3E4P A;  3LIC A;  1XJ6 A;  2PR5 A;  1N9N A;  5DJU A;  3UMD A;  2QHK A;  3F1O A;  4H6J B;  1DP9 A;  5AVF A;  2K7S A;  3EWK A;  1TS6 A;  1OTB A;  3C2W A;  4HJ3 A;  5HD5 A;  3E4O A;  2V9A A;  2PD7 A;  5F68 A;  2OOL A;  2Z6D A;  3E4Q A;  5J7E A;  3BWL A;  5IS1 A;  2D01 A;  1XJ4 A;  3C8C A;  3CAX A;  4WL9 A;  4HIA A;  3MQO A;  4L9F A;  3UME A;  1S4R A;  4JGR A;  4HI4 A;  1NWZ A;  4F3L A;  4HOI A;  5J3W A;  3BY8 A;  1F9I A;  2QKP A;  1OT9 A;  2A24 B;  3F1P A;  4WN5 A;  4EQ1 A;  2JN7 A;  5AVE A;  4K08 A;  3HJI A;  2CMN A;  3FG8 A;  5HSQ A;  3LID A;  3A0V A;  1MZU A;  2M1C A;  3LYX A;  2PDR A;  2ZBB A;  5EFW A;  1TS8 A;  4JGP A;  5DKK A;  3F1N A;  1VB6 A;  2INW A;  5IU1 A;  2B02 A;  4E04 A;  5DKL A;  4GW9 A;  2V1A A;  4NXE A;  3ICY A;  4GS9 B;  2D02 A;  3MJQ A; 
#chains in the Genus database with same CATH topology
 4HJ6 A;  5GHX A;  3MFD A;  1BT5 A;  4EW7 A;  4X1M A;  1YAX A;  3UO9 A;  1I5Q A;  1N9B A;  5U47 A;  4E3K A;  2J3T D;  3HLE A;  1KGE A;  3LCE A;  1OTD A;  5KMW A;  3LFV A;  4DJ3 A;  1BYW A;  3BYD A;  2WYX A;  3PXP A;  1FQG A;  1YLZ A;  4R4S A;  4HNB A;  3AGE A;  4JPM A;  4EUV A;  1TF1 A;  2ZJ9 A;  5E2F A;  4Y13 A;  2NUP C;  3W2Z A;  5IT5 A;  4N9L A;  5EOE A;  3UE1 A;  2ZQC A;  4WBG A;  3CUE A;  4UA7 A;  3HLW A;  4Q8I A;  3N6I A;  1MPL A;  5A8B A;  5EE8 A;  4P6B A;  4OPQ A;  3O3V A;  4X25 A;  4C75 A;  3E2K A;  1XFQ A;  4WF0 A;  1XA1 A;  3OPH A;  1KE3 A;  2Y79 A;  2Q9N A;  2VV6 A;  2GNX A;  2K31 A;  2Y2K A;  4XUX A;  2QZ6 A;  4HP4 A;  2RCX A;  3VSK A;  4IBR A;  3UY6 A;  1OTI A;  3JPU A;  4L0L A;  3RTY A;  2XR0 A;  4PM7 A;  1P97 A;  2J8Y A;  5TR7 A;  5FI7 A;  4JXW A;  4F3L B;  1DRM A;  3EEH A;  3TW8 A;  3OPR A;  3KYZ A;  2ZOI A;  3N8S A;  2MJ6 A;  5L8M A;  1PWD A;  4DE1 A;  3SS3 A;  2LB5 A;  3IHA A;  1KE0 A;  3T4T A;  2Y4A A;  4S2N A;  2ZC6 B;  3TJZ C;  4MN5 A;  1LI9 A;  5HAI A;  4DXC A;  1NY0 A;  5EM0 A;  1HD8 A;  5GLA A;  2IWB A;  5HAQ A;  2ZOH A;  4B88 A;  3LY4 A;  1FIK A;  2ZLY A;  2Z6C A;  4KG2 A;  1IEM A;  3BFF A;  2HP5 A;  3HLC A;  1D7E A;  3HCY A;  3GQZ A;  1CI9 A;  1MWR A;  1D06 A;  3RFB A;  1MKI A;  1CI8 A;  3NIA A;  4E3O A;  2GDN A;  2OLV A;  4Y0T A;  1Q2P A;  3P09 A;  3IF5 A;  4HP9 A;  5L10 A;  2EWV A;  4CLC C;  4OP5 A;  1ODV A;  1Y4O A;  4GB7 A;  3EQU A;  1ES5 A;  3MQQ A;  1TS0 A;  1L3L A;  4DN0 A;  1W63 Q;  4RX3 A;  4GLQ A;  4MDZ A;  1CK3 A;  5CHM A;  1ONG A;  3H82 A;  5EVI B;  1K57 A;  1IKG A;  2PD8 A;  1N9L A;  2Y2H A;  4GZB A;  1OJG A;  5HDC A;  1ONH A;  4UAA A;  1ALQ A;  4S2M A;  2Y2Q A;  3IHB A;  3SH9 A;  3LO7 A;  4PM9 A;  5F69 A;  2Y91 A;  3A3I A;  1BLP A;  1XGJ A;  2WAD A;  5HX9 A;  4EV4 A;  2VA0 A;  4ZDX A;  3KYE A;  5FSR A;  3FPW A;  1LT0 A;  2B5R A;  1X0O A;  2W1R A;  3SS4 A;  2VZW A;  1K56 D;  5CEC A;  4B9O A;  4E3N A;  2L1M A;  4R6L A;  4U0X A;  4EET B;  1EW0 A;  5FAT A;  3BJN A;  3DWZ A;  3S7P A;  1GSW A;  1H5X A;  5CX7 A;  4MBK A;  3G34 A;  3LIB A;  1Q2Q A;  4BLM A;  4JGO A;  4UA6 A;  4FSF A;  5CGX A;  3OZH A;  1DP6 A;  1RGZ A;  3ZVT A;  1OJ5 A;  1MWS A;  4YWZ A;  5FAP A;  4OQG A;  5TFQ A;  1IYQ A;  2WKP A;  3CZD A;  4MBF A;  3WS0 A;  2XF3 A;  4X53 A;  4LCM A;  1BSG A;  4R3J A;  3G2Z A;  5EOO A;  5HWV A;  5HWT A;  2J9P A;  3NOU C;  4FOF A;  3LR3 A;  4GN2 A;  3IWI A;  3EQV A;  1NJ4 A;  2PYR A;  1TD5 A;  4IUK A;  4O01 A;  3L7H A;  1HZO A;  3DW0 A;  5C5K A;  5EVI D;  4QHC A;  1S6R A;  3K3C A;  1YKD A;  4R3A A;  4I5S A;  3UDF A;  4KZ5 A;  1H3Q A;  4JXS A;  3V39 A;  4LRX C;  4NXG A;  5FQM A;  3C7V A;  2VGK A;  3VV4 A;  1ERO A;  2P74 A;  3CPT A;  1K57 C;  2PHY A;  3IX4 A;  4EES A;  1MY8 A;  3RXW A;  3O87 A;  4GDN A;  4GNU A;  3T4L A;  3SZT A;  4KZ9 A;  4Y3I A;  1T1B A;  3H82 B;  3E4P A;  5EM1 A;  2WK0 A;  4LFU A;  3VOZ A;  1XJ6 A;  2PR5 A;  5DFX A;  3MZE A;  1ESI A;  1PZO A;  2QHK A;  2Y2L A;  4NET A;  2O9C A;  2XRO A;  1KVM A;  5GLC A;  3EWK A;  1TS6 A;  5FL3 A;  4DE2 A;  4KQR A;  5HD5 A;  2HDR A;  1L0D A;  2ZC7 A;  2O0Y A;  1U60 A;  3BLS A;  4IBX A;  2QPN A;  3N8R A;  5IS1 A;  1MWT A;  1TVF A;  3P98 A;  3DTK A;  3T1S A;  4H8R A;  2V1Z A;  4HEF A;  1S4R A;  1XP4 A;  1SDN A;  4HI4 A;  3CMZ A;  1NWZ A;  1SZV A;  3HUM A;  4KG6 A;  4RVA A;  5J3W A;  3BY8 A;  1F9I A;  1YMS A;  2QKP A;  1KDW A;  2J3W A;  3ZNT A;  3ZFZ A;  4B4Z A;  2VGL M;  4K08 A;  3ZG8 B;  1IYP A;  2CMN A;  5HSQ A;  2PBD P;  5M1A A;  1SHV A;  1MZU A;  3O5Y A;  4Q0J A;  4P0M A;  2M1C A;  2XFT A;  2PDR A;  3LYX A;  3VP3 A;  1MWU A;  1FCN A;  2Z2M B;  2ZBB A;  4GJ4 A;  3HLG A;  1JTD A;  3FZC A;  1H8Z A;  2ZQ7 A;  5EFW A;  1QME A;  5E2G A;  4KG5 A;  1BLS A;  5DKK A;  2WKH A;  2R9X A;  1VB6 A;  4ARZ A;  3QNC A;  5AQB A;  4LV2 A;  3T4Q A;  1H0M A;  1W5D A;  3MKF A;  3ICY A;  4UQI M;  2O9A A;  2D02 A;  5CHJ A;  1VEU A;  3IXD A;  4JKT A;  3U4L P;  4EU0 A;  2OWH A;  4C6Y A;  5I94 A;  3FPV A;  4R1G A;  3TOI A;  4BD1 A;  4BEN A;  3V50 A;  5FI6 A;  1T18 A;  4OVD A;  5A91 A;  5CGW A;  4KUO A;  4NKP A;  2ZD8 A;  4GHI A;  1SKO B;  2IWC A;  3M2J A;  1GHI A;  2HJ9 C;  3UPN A;  2WKQ A;  3OOV A;  4X1L A;  3T4S A;  2ZL1 A;  1XPB A;  4HHD A;  5CXW A;  1EWZ A;  3VP1 A;  3WS1 A;  5AQ9 A;  3UE0 A;  1W8Q A;  1GSX A;  2PBY A;  3OPL A;  3D72 A;  2A49 A;  4R0Q A;  1FCM A;  3A3F A;  2PR6 A;  4NXF A;  2HZ5 A;  1DP8 A;  4IJG A;  5KSH A;  3NI9 A;  3IBJ A;  3MQ0 A;  2P9V B;  3T1R A;  1KOU A;  4KZ8 A;  5GHY A;  2P08 A;  3H9W A;  2VLG A;  2W3G A;  1BTL A;  1W8Y A;  4DRT A;  3GEC A;  3C5A A;  4GD8 A;  3VE3 A;  4HBU A;  4IVK A;  3LIF A;  1IYO A;  4ZJ3 A;  1FSW A;  2W1T A;  3CHW P;  5TBM B;  2H0T A;  1YLP A;  1T1A A;  4D2O A;  4E6X A;  2XD5 A;  4E6W A;  3PBR A;  4R3B A;  1Y28 A;  2C5W B;  4QB8 A;  1NLY A;  3C7U A;  3B33 A;  3ZGA B;  2V8C A;  4NXB A;  2W3D A;  2BAS A;  2XQZ A;  4EEU A;  3GTC A;  3H7W B;  4UHU A;  4WEK A;  2WKI A;  3FKV A;  3KSG A;  4ARZ B;  3NDE A;  3NDG A;  1WA9 A;  1PWC A;  3NHQ A;  2HDS A;  4ZTK A;  5A93 A;  2BTF P;  4FH2 A;  2WKE A;  1L0G A;  4Y5F A;  1QMF A;  3LR0 A;  3PR6 A;  4GS9 A;  4DDY A;  2P7J A;  1JWP A;  4Y2F A;  1UWN X;  3M6B A;  4EUZ A;  3ZG7 B;  2HPB A;  3IX8 A;  3IS2 A;  1YSP A;  4OON A;  2PYP A;  4K0W A;  4ZJ1 A;  3N4I A;  2EX9 A;  4LLO B;  1NRF A;  4NK3 A;  4CLC A;  1XFN A;  3UE6 A;  4YFM A;  4GHI B;  3ISG A;  2DCF A;  1ESU A;  4MNR A;  1VHM A;  4OQ0 A;  5E43 A;  1K38 A;  4LRZ E;  4I38 A;  3Q7V A;  1DJB A;  1WE4 A;  4S2J A;  4Y15 A;  5DTT A;  2XEP A;  2EX8 A;  4U3T A;  3F1O B;  1UWP X;  5K5B A;  3LI8 A;  5M18 A;  1DJA A;  1WYB A;  3FYZ A;  3UE3 A;  4FUW A;  4DMZ A;  4EBP A;  3QP4 A;  4OP8 A;  3JYI A;  3ZYT A;  3ITB A;  3VP4 A;  4HQA A;  3OCL A;  3EGD C;  1GSV A;  2OSU A;  3VFH A;  3SH8 A;  3VMA A;  4KEN B;  4CLC E;  3LEQ A;  1OPX A;  5CEB A;  2VJW A;  4WZ5 C;  2W1T B;  2K2N A;  3F1P B;  3SW1 A;  5FQQ A;  2DRW A;  4GCZ A;  1Z09 A;  5EPH A;  5HD3 A;  3A0S A;  4LV3 A;  3TG9 A;  4CPK A;  4E3I A;  4KQD A;  3LUQ A;  4KZ4 A;  3ZHH A;  4FTX A;  1GA9 A;  1PW8 A;  1EI5 A;  5FA7 A;  4ZBE A;  2XFS A;  1BLH A;  1P0Z A;  4BQM A;  1P9W A;  3DBA A;  1PI4 A;  3UB7 A;  2GZA A;  5L2F A;  3MMH A;  1FSY A;  3G30 A;  5KIZ A;  4BD0 A;  5FQJ A;  1H8M A;  1YMX A;  3RH8 B;  1YLY A;  5FI2 A;  3QP6 A;  4Y0O A;  4G3V A;  3P7N A;  3VP0 A;  2JKG A;  4WEL A;  3BRM A;  3PBQ A;  2XLN A;  1IEL A;  4LPZ A;  1ES2 A;  1NXY A;  2XRN A;  4XUZ A;  4OQI A;  3ITA A;  1ZTU A;  2ZC5 B;  1PNE A;  3IXH A;  4FCF A;  4PKY G;  2A3U A;  2V1B A;  4MEZ A;  2ZQ8 A;  1TDG A;  5EVI C;  1ZHH B;  4MN7 A;  4D60 A;  1NYY A;  3Q7V B;  4G3W A;  5AQA A;  2QMI A;  1K25 A;  5DJU A;  3UMD A;  5HL1 A;  1DP9 A;  4HJ3 A;  4NG2 A;  4S2P A;  1GHM A;  5F68 A;  4ESP A;  4QJG A;  2Z6D A;  3E4Q A;  1SKF A;  4IUH A;  3C8C A;  3CAX A;  4JXV A;  2ZC3 B;  1LI0 A;  4S2L A;  4L9F A;  4GDB A;  3UME A;  2Y2J A;  2J9O A;  3CG5 A;  4E3L A;  3B3X A;  3BEB A;  3A3D A;  3W4O A;  1BUL A;  4N1X A;  2Q0O A;  1NZU A;  3HLD A;  3I7J A;  4R4R A;  1HTZ A;  3HJI A;  4AFI A;  3VP2 A;  1W7F A;  3LID A;  3QNB A;  3HBR A;  4QY5 A;  3TSG A;  1ERM A;  1CF0 A;  1TS8 A;  1KDS A;  3KSF A;  3F1N A;  2ACG A;  5IU1 A;  3IF6 C;  5HW3 A;  2BLS A;  2B02 A;  3V3S A;  2W3E A;  4JLF A;  4XXR A;  4NXE A;  4OH0 A;  2FZ0 A;  3LEZ A;  1JTG A;  2R9W A;  4KZ6 A;  3N8L A;  4BBT A;  4ZRR A;  2V0U A;  4JF4 A;  2JKT M;  4WEJ A;  3N7W A;  1I2S A;  4OLG A;  2W0N A;  2VGL S;  2VGJ A;  4O8G A;  4S2O A;  3RXX A;  1MC0 A;  4OPR A;  4ZAM A;  5L07 A;  2IA2 A;  3BFC A;  3P01 A;  1O07 A;  4Y17 A;  1NYM A;  3OLO A;  3PAE A;  3O88 A;  2VV8 A;  2I72 A;  5DF8 A;  4CJN A;  4XT2 A;  4Q0I A;  5DTK A;  3HUO A;  4KQQ A;  3PBT A;  4UQI S;  5CTM A;  4DE0 A;  3IWQ A;  4YIN A;  4PM5 A;  3IT9 A;  3SS5 A;  4MCW A;  3GDI A;  4LRY C;  1M40 A;  4BJP A;  1CEF A;  3IX3 A;  1LSW A;  3PBN A;  3NOT C;  1LLB A;  4EBN A;  5GL9 A;  2WGI A;  1XA7 A;  5HZH A;  4B4X A;  3WRT A;  5FDS A;  1ZG4 A;  1G28 A;  3UB6 A;  1F98 A;  5A92 A;  3D3O A;  3D4F A;  4R38 A;  1GCE A;  1PWG A;  4O7D A;  1ZG6 A;  1FOF A;  2X01 A;  2V8F A;  3CLO A;  1G6O A;  2WAF A;  1XGI A;  1L0E A;  2WUQ A;  2VX8 A;  3F1N B;  1N9O A;  3LIE A;  3QP2 A;  1PRQ A;  1ACF A;  3KSH A;  1JWZ A;  3KX0 X;  2W3H A;  3T12 B;  5L09 A;  2VEA A;  3LR4 A;  2KLI A;  1K6S A;  4EER A;  3DTE A;  4MLL A;  3TE8 A;  1ZC2 A;  2E8I A;  3BQA A;  3MFX A;  1RGY A;  3E0Y A;  1F2K A;  3S7N A;  3MKE A;  3K3D A;  3A3J A;  3E2L A;  4OOY A;  3CPT B;  3V67 A;  1V9Z A;  3TRC A;  2KDK A;  3B42 A;  3HJK A;  1O7E A;  3WS5 A;  1K55 C;  3OCN A;  2J3T C;  3ZNY A;  1JNU A;  1K4F A;  1LL9 A;  1E3U A;  5G4Z A;  3FC7 A;  4L9E A;  4H6J A;  3G2Y A;  4BBV A;  3BLM A;  3L9K A;  5EUA A;  4P6Z M;  1P9R A;  2FFY A;  1RP5 A;  4PKY A;  3K2N A;  2QJ7 A;  3GVB A;  3NY4 A;  4X68 A;  5E2E A;  3C4O A;  4BL3 A;  3UB9 A;  2G7U A;  4L9G A;  5HAP A;  1NLZ A;  2O99 A;  2Y59 A;  3T50 A;  1S67 L;  2Y2G A;  3U2A A;  3Q81 A;  3B47 A;  2HDQ A;  3NCK A;  4Z9Q A;  3GMW A;  4KUK A;  4WZ5 A;  1CEG A;  4U0T A;  2ZQA A;  3T4O A;  1LSX A;  2L4R A;  5EVL A;  4X55 A;  3OPP A;  2J80 A;  4KZA A;  3PBS A;  5HDS A;  1XJ3 A;  1OTE A;  1GA0 A;  1ES3 A;  5HAR A;  1K56 A;  2HJE A;  2J7V A;  5GLB A;  4RQ9 A;  4GD6 A;  1PYY A;  4BWI A;  5MC7 A;  3HLB A;  4MN6 A;  2DNS A;  3PAG A;  2I9V A;  1I2W A;  4WZ4 A;  4DXB A;  2EX2 A;  1G68 A;  1VEU B;  3ZQ5 A;  3S1Y A;  4ID4 A;  2W3F A;  1TDL A;  3GSG A;  1LSV A;  3LR5 A;  2EA9 A;  5DF7 A;  5GHZ A;  2M7U A;  3AGF A;  1OME A;  1DY6 A;  4I3I A;  2JKR M;  1BZA A;  2OV5 A;  5J4E A;  2ZMF A;  5JYO A;  5AQ7 A;  2A2L A;  2ZL1 B;  3G35 A;  4WUJ A;  2WAE A;  2FFF B;  4QPR A;  5EVI A;  5J8X A;  1N9N A;  4R23 A;  5G18 A;  2DMW A;  4G3K A;  3WS4 A;  3UPP A;  4DE3 A;  5F1G A;  1K4E A;  4H6J B;  5F82 A;  2K7S A;  4OOM A;  3GRJ A;  2PT7 A;  1OTB A;  4LEN A;  2WGV A;  2XGN A;  3C2W A;  5KZH A;  2X02 A;  3E4O A;  4LV0 A;  4WMC A;  4OOL A;  3DTI A;  2V9A A;  5BOH A;  4MBH A;  1FR6 A;  5DTS A;  3MSH A;  5J7E A;  1AXB A;  2C6W B;  3BWL A;  4Z1W A;  2D01 A;  1XJ4 A;  2EWW A;  2Y2P A;  3VFF A;  2B18 A;  3SOI A;  3WWX A;  2O9B A;  4HIA A;  2ZQD A;  5M19 A;  3BFE A;  1PFL A;  4JGR A;  4OPY A;  3W4Q A;  4M3K A;  1IOU A;  1E25 A;  1CQA A;  3NUL A;  2CC1 A;  2Y2N A;  3R4K A;  4HOI A;  3HRE A;  5F1F A;  1OT9 A;  3S7O A;  2EXA A;  5TJJ A;  4WN5 A;  4EQ1 A;  2JN7 A;  5AVE A;  1SDE A;  5FQI A;  2G2W A;  1C3B A;  4O0P A;  3A0V A;  1VET A;  3RJU A;  3E98 A;  3UB5 P;  2EFX A;  1NRJ A;  5JYP A;  4N1H A;  3S4X A;  4JGP A;  2UV0 E;  4QU3 A;  3C4P A;  1M6K A;  2WZZ A;  3FKW A;  4QD4 A;  4E04 A;  3IF6 A;  4GW9 A;  3Q1F A;  1K54 C;  2V1A A;  3W8K A;  5E2H A;  4ZJ2 A;  2RL3 A;  5CER A;  4X6T A;  4GS9 B;  3Q07 A;  4P87 A;  3MJQ A;  3BW6 A;  1TS7 A;  4P85 A;  3CI6 A;  1XX2 A;  2JKT I;  2QWS A;  3FWL A;  1LL5 A;  4JGQ A;  3S22 A;  3IS2 B;  5FDH A;  1FCO A;  2ZMA A;  4DKI A;  2OWJ A;  1KGG A;  3EGX C;  4CLC B;  1E3U D;  1J9M A;  1H8Y A;  4II7 A;  4I39 A;  2ZM8 A;  2PU4 A;  3VE4 A;  1AWI A;  2GJ3 A;  3GR2 A;  2V2F F;  3PYP A;  5FQ9 A;  4BBU A;  1D1J A;  2QJ5 A;  3MXQ A;  3IBR A;  5EV0 A;  4BMW A;  4ME4 A;  3CUE C;  4OLD A;  4EXO A;  4YOF A;  5CRF A;  4UEY A;  1TEM A;  3BFD A;  3CWF A;  3Q7Z A;  5I5L A;  5CED A;  1S1Z A;  2PRF A;  4F94 A;  1JWV A;  1UGU A;  4HY8 A;  4I3A A;  3BFG A;  4E3J A;  2LB9 A;  3MS6 A;  1DJC A;  5HPI A;  5IHV A;  1FR1 A;  1PW1 A;  5G4Y A;  1K6R A;  5F5Y A;  3BEC A;  4E3M A;  1Y54 A;  2WKR A;  4PHT A;  3S7Q A;  1ES4 A;  4WLA A;  1YM1 A;  4IED A;  2V20 A;  5EEC A;  2VKS A;  1BLC A;  2VV7 A;  4X56 A;  5LBR A;  3DWK A;  3BM6 A;  1Z6F A;  1XKZ A;  3UDX A;  5FEG A;  4JF6 A;  5CTN A;  2V0W A;  3NBL A;  4S2N C;  2PU2 A;  4PMA A;  5HPF A;  1YQS A;  1V9Y A;  2OLU A;  3HVF A;  1VET B;  3C38 A;  4N9K A;  1HVB A;  2ZMV A;  3ZG5 A;  5CHU A;  2JE5 A;  3QP5 A;  3QP1 A;  2JHE A;  1XJ2 A;  2H5S A;  2M7V A;  2UWX A;  3CJM A;  2L0W A;  4KZ3 A;  2Y8H A;  4QY6 A;  2FH5 A;  4DDS A;  2Y2O A;  2YKF A;  5GLD A;  4RX2 A;  1PI5 A;  3V3R A;  4CLC D;  3IF6 B;  3IQA A;  4FH4 A;  1ZKJ A;  3LGO A;  1GHP A;  4KQO A;  1S4S A;  3HLF A;  1IYS A;  2OAP 1;  3PHY A;  2H28 A;  4N92 A;  4BL2 A;  4A5R A;  4HES A;  4HH2 A;  3O86 A;  2W27 A;  4ETX A;  2OAQ 1;  4LV1 A;  1XXM A;  1YLW A;  5EVE A;  5HL6 A;  2HGV A;  3R7W A;  3ZVW A;  4JXG A;  1S0W A;  2YKH A;  3D9Y A;  1PZP A;  3QP8 A;  1MKM A;  4HH3 A;  3G31 A;  4Y0U A;  3MF0 A;  1E4D A;  1SKO A;  2XDM A;  3PTE A;  2EXB A;  4UA9 A;  2HP6 A;  2XK1 A;  3HL9 A;  5HDD A;  4CQH A;  2X71 A;  3HUN A;  5HFO A;  3T4K A;  5F6A A;  1CJF A;  4OKP A;  2KX6 A;  4WMC D;  1K55 A;  3G4P A;  1F5M A;  2R78 A;  2JCH A;  2WGW A;  3MZD A;  3LIA A;  4Q0H A;  4EBL A;  2GX5 A;  3QHY A;  2XH9 A;  1W79 A;  2E8J A;  2XA7 S;  3MXS A;  1YLJ A;  4HJ4 A;  3G6O A;  5D3O A;  4JBF A;  1VM1 A;  2ZC4 B;  5CGS A;  1HLU P;  4WM9 A;  1YSQ A;  1PIO A;  2P9V A;  2VK3 A;  3KYQ A;  5FQK A;  1VQQ A;  3ULF A;  4OQH A;  2Y2I A;  5DVA A;  3JVU A;  4S2K A;  4GOG A;  3MZF A;  1OTA A;  3T1Q B;  3OC2 A;  4DJ2 A;  3KO6 A;  1OT6 A;  3WRZ A;  2IWD A;  4LCL A;  3MBZ A;  4EQI A;  5DJT A;  4PM6 A;  2HP9 A;  5FEF A;  4X69 A;  2A24 A;  5FAO A;  3PBO A;  3ZG9 B;  3FV7 A;  4IHQ A;  2BG1 A;  3NOP C;  5TBM A;  2JC7 A;  1J3W A;  3C30 A;  2KOI A;  3JVV A;  2ZM2 A;  2HV1 A;  3DTM A;  3NJA A;  4P6Z S;  5A90 A;  3SH7 A;  2NUT C;  3UNW A;  4ETZ A;  1RCJ A;  3MXR A;  1SCW A;  4KZB A;  3VOY A;  2H10 A;  4GKU A;  2HF6 A;  3IWO A;  3LI9 A;  3H7W A;  4C3Q A;  5F83 A;  5FAS A;  4EEP A;  4JF5 A;  2XA7 M;  4R70 A;  3NC8 A;  3BY9 A;  4I3J A;  2P04 A;  5FAQ A;  2Q9M A;  3A0R A;  1T1C A;  1LHY A;  2EFU A;  3VSL A;  5HWW A;  1LL8 A;  3UB8 A;  2Y2M A;  4PM8 A;  4K91 A;  4PPR A;  2JKR I;  1S1Y A;  2WZX A;  1IKI A;  2B95 A;  4PAU A;  3G32 A;  5DFY A;  3R7W B;  3ZG0 A;  3MR0 A;  1YLT A;  3Q82 A;  3VOL A;  2XSS A;  3M2K A;  3A3E A;  1S66 L;  2XD1 A;  1T19 A;  4M4X A;  2JBF A;  1NZO A;  1BUE A;  1WYC A;  1G5U A;  1ERQ A;  4XT2 B;  3AGD A;  4KZ7 A;  3LIC A;  3OBF A;  2WGW B;  4DF6 A;  1FIL A;  1N4O A;  4K0X A;  4HBT A;  3F1O A;  3DAV A;  1A0K A;  5AVF A;  3IH9 A;  4QWO A;  5KSC A;  5DF9 A;  4OPZ A;  4FD8 A;  3LY3 A;  3V5M A;  3WS2 A;  2ZM0 A;  2AVX A;  2PD7 A;  2OOL A;  3UPO A;  2JKF A;  3M6H A;  3CIT A;  3EOI A;  4MMN A;  1L2S A;  4WL9 A;  1JVJ A;  3MQO A;  3ZCZ A;  5AJG A;  3BQ8 A;  1YPR A;  4RYE A;  4Y7P A;  4F3L A;  5TGF A;  2A24 B;  4YNR A;  2G2U A;  4NEE D;  3F1P A;  3IH8 A;  3ZDJ A;  1L0F A;  2ZQ9 A;  4LGW A;  2Y55 A;  3EEA A;  3FG8 A;  2Z2L B;  2QYB A;  4IVI A;  3T4J A;  4EWF A;  1STZ A;  3UN7 A;  1KVL A;  2H0Y A;  2PAV P;  2HDU A;  2EX6 A;  3UDI A;  3IXG A;  3NEC A;  1K0K A;  4S2I A;  4WYY A;  1W63 M;  2INW A;  1MBL A;  3W4P A;  1MXO A;  3KSI A;  5DKL A;  4B93 A;  1IFQ A;  3IXB A;  4RA7 A;  1YT4 A;  3T1X A;  1K54 A;  1G6A A;  3GV9 A;  1KE4 A;  1KGF A; 
#chains in the Genus database with same CATH homology
 4HJ6 A;  1TS7 A;  4BBT A;  3CI6 A;  4ZRR A;  4EU0 A;  2JKT I;  2OWH A;  2QWS A;  2V0U A;  2JKT M;  3FPV A;  4JGQ A;  4WEJ A;  4EW7 A;  3IS2 B;  2W0N A;  2VGL S;  1YAX A;  2OWJ A;  2J3T D;  4O8G A;  3EGX C;  1OTD A;  4CLC B;  3LFV A;  1T18 A;  4DJ3 A;  1BYW A;  4II7 A;  4I39 A;  3PXP A;  3VE4 A;  4KUO A;  4NKP A;  1MC0 A;  4GHI A;  4HNB A;  2GJ3 A;  2IA2 A;  4EUV A;  3P01 A;  3PYP A;  1TF1 A;  4BBU A;  2HJ9 C;  2QJ5 A;  3OLO A;  2NUP C;  3MXQ A;  3IBR A;  4BMW A;  2VV8 A;  3W2Z A;  2WKQ A;  5IT5 A;  3OOV A;  3CUE C;  4ME4 A;  4EXO A;  3T4S A;  4HHD A;  3CUE A;  4YOF A;  5A8B A;  4UEY A;  3CWF A;  5I5L A;  4XT2 A;  1S1Z A;  4Q0I A;  1UGU A;  4HY8 A;  4I3A A;  1GSX A;  3PBT A;  4UQI S;  2LB9 A;  1XFQ A;  3D72 A;  4WF0 A;  2PR6 A;  4NXF A;  5HPI A;  2Y79 A;  4MCW A;  2VV6 A;  1DP8 A;  2GNX A;  4IJG A;  3GDI A;  5KSH A;  4LRY C;  3IBJ A;  3MQ0 A;  4BJP A;  5G4Y A;  2K31 A;  5F5Y A;  1KOU A;  1LSW A;  2P08 A;  4HP4 A;  3PBN A;  2WKR A;  4PHT A;  3NOT C;  3H9W A;  2VLG A;  2W3G A;  3S7Q A;  1OTI A;  4L0L A;  3RTY A;  4WLA A;  3GEC A;  1P97 A;  3VE3 A;  3LIF A;  2VKS A;  2W1T A;  2VV7 A;  5LBR A;  5HZH A;  5TBM B;  4F3L B;  1DRM A;  3EEH A;  3TW8 A;  1G28 A;  1T1A A;  3UB6 A;  1F98 A;  3KYZ A;  2ZOI A;  2MJ6 A;  5L8M A;  3D3O A;  3PBR A;  2V0W A;  4R38 A;  1Y28 A;  2LB5 A;  5HPF A;  3T4T A;  1V9Y A;  3TJZ C;  4MN5 A;  1NLY A;  3C38 A;  3B33 A;  2ZMV A;  3CLO A;  4NXB A;  1G6O A;  2W3D A;  2BAS A;  2JHE A;  1XJ2 A;  2M7V A;  4EEU A;  3H7W B;  2VX8 A;  2L0W A;  2Y8H A;  2ZOH A;  3F1N B;  4WEK A;  1N9O A;  2FH5 A;  3KSG A;  2YKF A;  3LIE A;  4ARZ B;  4CLC D;  1WA9 A;  3KSH A;  2Z6C A;  3NHQ A;  3KX0 X;  2W3H A;  1D7E A;  4Y5F A;  4KQO A;  2VEA A;  1S4S A;  3HCY A;  3LR4 A;  3LR0 A;  1D06 A;  3PR6 A;  3RFB A;  4GS9 A;  2OAP 1;  3PHY A;  2KLI A;  2P7J A;  2H28 A;  4EER A;  4Y2F A;  3TE8 A;  1UWN X;  4HH2 A;  3BQA A;  3MFX A;  2W27 A;  4ETX A;  3E0Y A;  2OAQ 1;  3IS2 A;  1YSP A;  2PYP A;  3S7N A;  4HP9 A;  2EWV A;  4CLC C;  3K3D A;  4LLO B;  5HL6 A;  2HGV A;  3R7W A;  1ODV A;  4CLC A;  1XFN A;  2YKH A;  3UE6 A;  3EQU A;  3MQQ A;  1MKM A;  1TS0 A;  1V9Z A;  4HH3 A;  3V67 A;  3MF0 A;  4GHI B;  4DN0 A;  1W63 Q;  3TRC A;  2KDK A;  4GLQ A;  3B42 A;  3HJK A;  4MDZ A;  5HDD A;  4CQH A;  1VHM A;  3T4K A;  3H82 A;  5F6A A;  3OCN A;  2J3T C;  2KX6 A;  1JNU A;  4LRZ E;  1F5M A;  2R78 A;  2PD8 A;  4I38 A;  1N9L A;  5G4Z A;  3FC7 A;  4L9E A;  3LIA A;  4Q0H A;  2GX5 A;  3F1O B;  4H6J A;  1OJG A;  5HDC A;  4BBV A;  1UWP X;  2XA7 S;  5K5B A;  4HJ4 A;  4P6Z M;  3G6O A;  1P9R A;  3LI8 A;  4PKY A;  3UE3 A;  4DMZ A;  5F69 A;  1YSQ A;  3K2N A;  2QJ7 A;  3KYQ A;  3ULF A;  3UB9 A;  3JVU A;  3ZYT A;  2G7U A;  4L9G A;  4HQA A;  1NLZ A;  2O99 A;  3OCL A;  1OTA A;  2VA0 A;  3EGD C;  1GSV A;  3FPW A;  3OC2 A;  1LT0 A;  3T50 A;  1S67 L;  3U2A A;  4DJ2 A;  3KO6 A;  1OT6 A;  1X0O A;  2W1R A;  2VZW A;  4CLC E;  3B47 A;  4B9O A;  1OPX A;  5DJT A;  2L1M A;  4R6L A;  4EET B;  2VJW A;  1EW0 A;  2A24 A;  3PBO A;  4KUK A;  3BJN A;  4IHQ A;  2W1T B;  2K2N A;  1GSW A;  3F1P B;  3NOP C;  5CX7 A;  3S7P A;  3SW1 A;  5TBM A;  3T4O A;  4GCZ A;  1LSX A;  2L4R A;  3LIB A;  4JGO A;  5HD3 A;  3A0S A;  4FSF A;  3C30 A;  2KOI A;  2J80 A;  3JVV A;  1DP6 A;  4KQD A;  3PBS A;  1OJ5 A;  5HDS A;  3LUQ A;  2HV1 A;  1XJ3 A;  4YWZ A;  3NJA A;  1OTE A;  4P6Z S;  2WKP A;  2NUT C;  4ETZ A;  2HJE A;  4RQ9 A;  1P0Z A;  1P9W A;  3DBA A;  2HF6 A;  4BWI A;  5MC7 A;  3LI9 A;  3H7W A;  4MN6 A;  5HWV A;  5HWT A;  3UB7 A;  2GZA A;  3NOU C;  4EEP A;  2I9V A;  4FOF A;  3LR3 A;  2XA7 M;  3MMH A;  4R70 A;  3EQV A;  5KIZ A;  2PYR A;  4I3J A;  3BY9 A;  1TD5 A;  2P04 A;  3ZQ5 A;  1H8M A;  3RH8 B;  4IUK A;  2W3F A;  3A0R A;  4O01 A;  1T1C A;  1LSV A;  3LR5 A;  2EA9 A;  5C5K A;  5HWW A;  1LL8 A;  2M7U A;  3K3C A;  1YKD A;  4R3A A;  4G3V A;  4I5S A;  3P7N A;  3UB8 A;  1H3Q A;  4WEL A;  2JKR I;  1S1Y A;  4I3I A;  4PAU A;  2JKR M;  3PBQ A;  4LRX C;  5DFY A;  4NXG A;  3R7W B;  3MR0 A;  4LPZ A;  3VOL A;  3VV4 A;  2PHY A;  2XRN A;  2XSS A;  5J4E A;  2ZMF A;  1S66 L;  4EES A;  1ZTU A;  2A2L A;  1T19 A;  4M4X A;  4WUJ A;  4PKY G;  3T4L A;  2V1B A;  4Y3I A;  1ZHH B;  4MN7 A;  1T1B A;  3H82 B;  4QPR A;  3E4P A;  4XT2 B;  3LIC A;  3OBF A;  1XJ6 A;  2PR5 A;  5DFX A;  4G3W A;  1N9N A;  2DMW A;  4G3K A;  5DJU A;  3UMD A;  2QHK A;  3F1O A;  4H6J B;  1DP9 A;  2O9C A;  2XRO A;  5AVF A;  2K7S A;  3EWK A;  4OOM A;  1TS6 A;  2PT7 A;  1OTB A;  5DF9 A;  5FL3 A;  3C2W A;  4HJ3 A;  5HD5 A;  3E4O A;  4OOL A;  2V9A A;  2PD7 A;  5F68 A;  2O0Y A;  2OOL A;  2Z6D A;  3E4Q A;  5J7E A;  3BWL A;  4Z1W A;  5IS1 A;  3CIT A;  3EOI A;  4IUH A;  4MMN A;  2D01 A;  1XJ4 A;  3C8C A;  2EWW A;  3CAX A;  2B18 A;  4WL9 A;  2O9B A;  4HIA A;  3MQO A;  4L9F A;  3UME A;  5AJG A;  1S4R A;  4JGR A;  3BQ8 A;  4HI4 A;  1IOU A;  1NWZ A;  4F3L A;  3R4K A;  4HOI A;  5J3W A;  3BY8 A;  1F9I A;  2QKP A;  1OT9 A;  2A24 B;  2J3W A;  3S7O A;  4YNR A;  4NEE D;  5TJJ A;  3F1P A;  4WN5 A;  4EQ1 A;  2JN7 A;  2VGL M;  5AVE A;  4K08 A;  3HJI A;  4AFI A;  2CMN A;  3EEA A;  3FG8 A;  2QYB A;  4O0P A;  5HSQ A;  3LID A;  3A0V A;  3T4J A;  1MZU A;  3O5Y A;  4Q0J A;  2M1C A;  3E98 A;  1STZ A;  3LYX A;  2PDR A;  2ZBB A;  4GJ4 A;  1NRJ A;  5EFW A;  1TS8 A;  4JGP A;  3KSF A;  5DKK A;  3F1N A;  1VB6 A;  1W63 M;  2INW A;  5IU1 A;  3KSI A;  2B02 A;  4ARZ A;  4E04 A;  5DKL A;  4B93 A;  1IFQ A;  4GW9 A;  2V1A A;  2W3E A;  3T4Q A;  4NXE A;  2FZ0 A;  3ICY A;  4GS9 B;  2O9A A;  4UQI M;  2D02 A;  3MJQ A;  3BW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...