1OTEA

E46q mutant of photoactive yellow protein, p65 at 110k
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords photoactive yellow protein, PYP
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 33
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1oteA00
3VE3A 1OTIA 1LSWA 5A8BA 1GSWA 2A24A 2W0NA 1TS8A 3F1OA 1TS6A 4NXEA 1S66L 4NXBA 2ZOHA 5HDSA 3C2WA 5HDCA 2PR5A 4PKYA 1S1ZA 2JHEA 4EXOA 4EW7A 2V9AA 3IS2B 4LPZA 1N9OA 1TS7A 3A0VA 3MQQA 2H28A 1OJGA 4BBVA 4XT2A 3F1NB 1T1AA 4DJ2A 4GHIA 4LRXC 2PD7A 4EEUA 3CAXA 1UWPX 3EWKA 1XJ2A 2VEAA 4HQAA 1D06A 4I3JA 3VE4A 1S67L 2VV8A 4HY8A 2BASA 4HOIA 3LIAA 4LRZE 2M1CA 5I5LA 3LIBA 2PYRA 3K3CA 4LLOB 2QJ7A 3A0RA 3F1NA 5KIZA 4EQ1A 3UB6A 2B02A 1KOUA 4EESA 3LIEA 1V9ZA 3PHYA 2QHKA 4WN5A 2WKQA 5HD5A 5IU1A 4BBTA 5IS1A 5J4EA 4HJ4A 4BBUA 1OT9A 4F3LB 5DJTA 4HHDA 3NOTC 3FC7A 3VOLA 4DJ3A 4HH2A 2OWHA 3IBRA 3OLOA 4WLAA 4LRYC 1T1BA 3LI9A 1N9LA 4L9FA 1LL8A 3MJQA 1DRMA 4GCZA 3P7NA 3H82B 3BWLA 3LIFA 3D72A 3UB9A 3F1PB 4HJ3A 2D02A 2CMNA 1WA9A 4WL9A 4L9GA 4GW9A 4F3LA 4R70A 1BYWA 1XJ6A 5G4YA 3FG8A 4EETB 1DP8A 4WUJA 1LSVA 5AVEA 4I38A 3B33A 4I3IA 5HDDA 4H6JA 5DKLA 4R6LA 4KQDA 3ULFA 3H82A 1TS0A 2PR6A 4NXGA 3E4QA 2VV6A 3F1PA 3E4OA 3LIDA 2I9VA 3C8CA 1GSVA 4GS9B 2VLGA 1OTAA 2GJ3A 1MZUA 2QJ5A 4NXFA 3BY9A 1DP6A 1S4SA 3UB7A 1UGUA 4HP9A 5HWVA 1OTBA 3BY8A 2PD8A 4KUOA 2L1MA 3ZQ5A 3IS2A 5F68A 3LI8A 3UMEA 2KX6A 4I5SA 2P7JA 4GS9A 1XJ4A 5DKKA 1T18A 4JGQA 5TBMB 1F9IA 2J80A 1G28A 2YKFA 4HI4A 2WKPA 4JGRA 3MR0A 1ODVA 4WF0A 3T50A 3GECA 5HSQA 3H7WB 1D7EA 1OTEA 3RTYA 1S4RA 2PDRA 4YWZA 4HNBA 1P97A 2L4RA 3HJKA 4JGPA 1DP9A 3UMDA 4MN6A 1NWZA 3EEHA 5J7EA 5TBMA 4B9OA 4K08A 2V1AA 2Z6DA 1F98A 3A0SA 2A24B 1XFNA 1LT0A 3ICYA 2ZBBA 5F5YA 2K7SA 3MXQA 4HJ6A 4KUKA 4R3AA 1V9YA 2HV1A 2WKRA 1XFQA 1N9NA 5HZHA 1OT6A 4GHIB 5G4ZA 2ZOIA 3RH8B 2V0UA 1OTDA 5J3WA 2QKPA 5HWWA 4HH3A 3K3DA 1Y28A 1JNUA 4PKYG 4JGOA 4M4XA 1UWNX 1X0OA 3LICA 4R38A 2W27A 1VB6A 2JN7A 2Z6CA 1EW0A 4HP4A 1XJ3A 2OWJA 2V1BA 5F6AA 3KX0X 2YKHA 2OOLA 2VV7A 3G6OA 4RQ9A 2EA9A 4E04A 5HD3A 5DJUA 4I39A 2PYPA 4EERA 4MN5A 3E4PA 5AVFA 1LSXA 4I3AA 1S1YA 3MFXA 2R78A 4L9EA 3PYPA 3NOUC 2L0WA 2D01A 3GDIA 5HWTA 3CWFA 3SW1A 1GSXA 3HJIA 5EFWA 3NJAA 2QWSA 3F1OB 2PHYA 4EEPA 4H6JB 1P0ZA 3H7WA 1OJ5A 1T19A 2V0WA 3H9WA 3LUQA 3NHQA 1T1CA 3CLOA 2INWA 3MQOA 3LYXA 2KDKA 5F69A 3NOPC 3UB8A 3UE6A 4XT2B 4HIAA
chains in the Genus database with same CATH superfamily
1K4FA 3VE3A 1OTIA 1NYYA 1GHIA 3IT9A 1S66L 4NXBA 2ZOHA 4WMCA 2XA7S 4KZ8A 1S1ZA 2JHEA 4FCFA 4BLMA 4EW7A 3W4OA 3D3OA 1NLYA 3VSLA 1CEFA 3T1XA 4QY5A 1H3QA 3VFFA 4QD4A 1OJGA 4XT2A 3GR2A 4GHIA 5A90A 1M40A 1UWPX 4GB7A 3CMZA 5GL9A 3QHYA 3HCYA 4I3JA 2VV8A 2BASA 3P98A 2HGVA 3JVVA 3ZNTA 2R9WA 2PYRA 4Y13A 3K3CA 1YKDA 1PWDA 3BQ8A 5L2FA 3A0RA 5HAPA 3LR5A 2W3FA 2ZQAA 1FR1A 2B02A 1KOUA 2Y2HA 1AXBA 4S2OA 4UAAA 1HVBA 4Z1WA 5J8XA 3V3SA 4BBTA 5IS1A 5KMWA 3HLGA 5CGWA 2VJWA 1NRFA 1PW1A 4HJ4A 4ZJ2A 5DJTA 2LB9A 2WZXA 4DJ3A 2I72A 3CUEC 3OLOA 3TE8A 3FWLA 5IT5A 2J8YA 4X1MA 4L9FA 3T12B 1IFQA 2ZC3B 4YFMA 1LL8A 4D60A 3MJQA 3C5AA 1IKGA 3KSIA 4LFUA 3LIFA 5FQMA 4OVDA 4S2PA 4HJ3A 2EX2A 2CMNA 3TG9A 2BG1A 2VA0A 4G3KA 4GW9A 2QZ6A 4WZ4A 4UEYA 5GLAA 4F3LA 5GLDA 1RP5A 3UB5P 4R70A 1Y4OA 1BYWA 3IQAA 3FG8A 4WUJA 4BL3A 4E3LA 4I38A 5M19A 2PRFA 2Y2PA 4ETZA 3LY3A 3Q7VB 5HDDA 3LY4A 2E8IA 4XUZA 4OPQA 5DKLA 4R6LA 2WAEA 4IVIA 2WAFA 2Y2OA 2H5SA 3CJMA 3H82A 2PR6A 2Y79A 2VV6A 4IEDA 1W7FA 2A49A 3C8CA 4S2KA 1ES5A 2P9VB 2GJ3A 3HREA 1ACFA 3BY9A 4QHCA 2OSUA 4MBFA 1DJCA 1ONHA 4Z9QA 4MCWA 4UHUA 3SH9A 2ZC4B 2J3WA 3VP0A 1KE4A 1H8ZA 1GCEA 4KUOA 3ZQ5A 3IS2A 3T4TA 3HUOA 3ITAA 2KX6A 1YAXA 4I5SA 1OPXA 1BLCA 3N6IA 3OPRA 1T18A 1CJFA 2Q9MA 1G28A 3QP6A 4NETA 4Y7PA 2ZL1A 4HI4A 3G35A 5LBRA 3M6HA 1ODVA 4WF0A 5HW3A 3PXPA 3E2KA 1W8QA 5DTSA 1Y54A 3EQUA 1OTEA 2H0TA 3T4LA 1VM1A 1SKOA 3AGEA 1SZVA 5EM0A 3C4PA 3DW0A 3UMDA 1JWPA 3OPHA 3VV4A 2JC7A 4JF5A 4IBXA 3EEHA 5TBMA 3EGDC 4KG6A 4K91A 5CGXA 4N1HA 2XDMA 1BSGA 3A0SA 1W63Q 1XFNA 1LT0A 1MBLA 4ZBEA 2GDNA 1TDLA 3PR6A 1JTDA 1SDNA 4WBGA 1YMSA 4LCMA 4F94A 3IF6A 4KZ4A 3W4QA 2W1TB 4DMZA 1OT6A 4MDZA 4GDBA 2X02A 2HDQA 5CRFA 2ZOIA 5F82A 1MWSA 3LO7A 1XA7A 5E2HA 3WS4A 4DE1A 5J3WA 1OTDA 1MC0A 2QKPA 4N92A 3N8SA 4HESA 2MJ6A 4HH3A 1LL9A 2EXBA 1VEUA 1CI9A 1ZG4A 4EBPA 5FEGA 2WGWA 3G2ZA 1L0EA 2W27A 2JN7A 3C7VA 5EOOA 3G32A 3VP3A 1N9BA 3EOIA 2XD5A 1RCJA 2XGNA 1BULA 4LV3A 4GDNA 1W8YA 2YKHA 1XGIA 4GN2A 3M2JA 4OQGA 4RX2A 1K6RA 1PIOA 2Y55A 5HD3A 5DJUA 1K4EA 4Q0HA 1JVJA 1KGGA 5L07A 2VZWA 5E43A 1W79A 2VX8A 4R23A 3E4PA 5F83A 1FCNA 2B5RA 3TJZC 1S1YA 4JF4A 3MFXA 4N9KA 3WRTA 2DMWA 1VETB 3JPUA 3AGDA 1DJAA 4P0MA 2XK1A 3LEZA 1TF1A 2IA2A 3M6BA 4KZ7A 4WZ5A 1XPBA 3GDIA 1IYSA 5HWTA 3CWFA 1TD5A 3DTEA 3SW1A 4JKTA 1PI4A 2B18A 4CLCD 4KZ3A 2VK3A 3UDXA 1PZPA 3HJIA 1EI5A 3PBRA 5HAIA 1FSYA 4NG2A 3PAGA 4WM9A 5EFWA 3C7UA 3F1OB 4GNUA 4NEED 2HDRA 5JYPA 1XGJA 4H6JB 1YSQA 3H7WA 4KZBA 3CLOA 2INWA 2HP5A 3SH8A 3KYEA 3ZNYA 2PBDP 2FZ0A 4DDYA 2P04A 1GSWA 3LR3A 5JYOA 1DY6A 3DBAA 1VQQA 1ALQA 1K57C 1MKMA 2IWCA 2QPNA 1G6AA 1BTLA 4ZTKA 4LPZA 2HJEA 1YLZA 3IXHA 1TS7A 3MQQA 4LENA 4U0TA 3BFCA 3F1NB 3HLFA 4GD6A 4YOFA 5CHUA 3Q1FA 1IKIA 3ZHHA 4EEUA 1NZOA 2Y91A 1S0WA 2Y2MA 4Y5FA 3U2AA 4OQ0A 5HL6A 3VE4A 3VP2A 1ES4A 1HLUP 5F1GA 2OV5A 4E3MA 2A3UA 2M1CA 5I5LA 2PBYA 1K55A 4C75A 4ZJ1A 3G30A 5G18A 2QJ7A 3VOZA 3SH7A 2HF6A 4P6BA 4BD1A 4R1GA 1XKZA 1M6KA 4P6ZM 1KE3A 3T4SA 3S4XA 1PZOA 3DWKA 5CERA 3UB6A 3VMAA 1MWRA 4EESA 2ZQCA 2EFUA 1ZTUA 3PHYA 1K54A 2WKQA 3LGOA 4ME4A 2XRNA 3QP2A 5K5BA 5TFQA 5HX9A 4HHDA 3VOLA 2O99A 4WLAA 2DNSA 4LRYC 3OPLA 4X53A 1T1BA 3WS5A 2IWBA 3EEAA 3MKEA 4EUVA 5L8MA 1ZHHB 3CHWP 4B4XA 3P7NA 3BWLA 3D72A 4ARZA 3UB9A 2D02A 4IBRA 1WA9A 4L9GA 3ZVTA 1L0FA 3S7OA 4EETB 2WYXA 4QU3A 1DP8A 3S22A 1LSVA 1PFLA 2OLVA 2RL3A 5FI2A 3BW6A 3B33A 1MKIA 3HUMA 2ZQ9A 4DKIA 4I3IA 4OLGA 2O9BA 4KQDA 2J3TC 4R0QA 2NUTC 1STZA 4NXGA 4S2NC 1Z6FA 3E4QA 4OKPA 4KQRA 3E4OA 2I9VA 2VLGA 3ZG0A 4MEZA 3TSGA 3VP1A 1WYCA 3KSFA 1DP6A 1S4SA 2M7VA 1UGUA 4HP9A 3T4OA 3BFDA 5A92A 3A3DA 3R7WB 3BY8A 1PWGA 4IUKA 5GHXA 1PI5A 2EX8A 2NUPC 2PU2A 3C38A 1XX2A 1GA0A 5EOEA 5D3OA 3UMEA 5HL1A 4OOLA 1EROA 2P9VA 4JXVA 4E3OA 4LGWA 2KOIA 4OOYA 4O0PA 1IEMA 3TOIA 3NC8A 1RGZA 2J80A 4NKPA 1CI8A 3UDFA 3E98A 1KDWA 1P9WA 4B4ZA 2WKPA 4JGRA 3MR0A 4QPRA 3CPTA 4OPRA 4K0XA 3T50A 4ZDXA 2XH9A 4PM5A 5HSQA 1S4RA 4CJNA 4OP5A 4YWZA 5FDSA 1QMEA 3V67A 1P97A 3GRJA 3HJKA 4JGPA 5GLCA 3QP5A 3W4PA 3HL9A 2Y2JA 4CLCA 1ESUA 1NWZA 4IHQA 5J7EA 3BLSA 3HLWA 5FAPA 4MBKA 1CEGA 4E3JA 5F5YA 3QP8A 2Y2QA 3V5MA 4HJ6A 4D2OA 3KSGA 3B3XA 3MFDA 3DTKA 1NLZA 4R3AA 1H0MA 3BRMA 3HBRA 1XP4A 1N9NA 2XSSA 4GHIB 5G4ZA 4G3VA 2HJ9C 2JKTM 2ZM8A 3RH8B 3IF5A 2HPBA 1W63M 3WRZA 4PPRA 4M3KA 4JXSA 3T4KA 4E3KA 5KZHA 4FUWA 4S2JA 5FA7A 1NY0A 5U47A 1TDGA 1YPRA 4M4XA 1UWNX 2VGLM 3GSGA 1X0OA 1BUEA 4KENB 4II7A 3Q82A 1LI0A 2G2WA 4KQOA 3OZHA 3NULA 4HP4A 1ONGA 1XJ3A 4BENA 2OWJA 1BT5A 4ZAMA 2VV7A 2DRWA 3PBOA 3SS4A 2G7UA 5M1AA 5FAQA 1WYBA 2Y2LA 4EERA 3UE1A 4E6XA 2Y2NA 3MZEA 4R3BA 2WKIA 3BECA 4I3AA 4P85A 2EFXA 2Y4AA 3GQZA 1G6OA 3VSKA 5FQIA 4C6YA 2D01A 5DTKA 2ZM0A 1H8YA 3FPWA 3LFVA 4IVKA 1GSXA 3O3VA 4GZBA 1IYQA 2V1ZA 2WUQA 2HZ5A 3CG5A 4JLFA 3W8KA 1YLYA 5GHZA 1MPLA 5FDHA 3IXBA 2ZQ8A 1YLTA 2PHYA 5C5KA 3IHAA 1LHYA 4EEPA 3HUNA 2V20A 1ES2A 3OCNA 4GKUA 1OJ5A 4E6WA 2ZC6B 2ZQDA 2VGKA 3QNCA 4NK3A 1E3UD 3BLMA 3NHQA 4GJ4A 1T1CA 4QB8A 3MQOA 2P08A 5CXWA 3IX4A 2H0YA 2V8FA 3M2KA 3UE6A 4KZ6A 3S1YA 3G4PA 3BEBA 4R3JA 5BOHA 1BZAA 2A24A 3UE3A 3F1OA 1RGYA 4NXEA 4OH0A 5HDCA 4PKYA 1IYOA 2PU4A 3B47A 5FASA 2K2NA 4N9LA 3IS2B 5EVIC 3WWXA 4X1LA 3CUEA 2H28A 1ESIA 1T1AA 3JVUA 2E8JA 2PAVP 4LRXC 5DVAA 2PD7A 3CAXA 5A91A 5CTMA 2ZL1B 3IHBA 4BWIA 3VFHA 3OPPA 4HY8A 4HOIA 3LIAA 4LRZE 4OLDA 2G2UA 3LIBA 1U60A 4LLOB 2VKSA 1SKOB 3KYZA 2ZMVA 5DF9A 2O9AA 3MZFA 3F1NA 1C3BA 2XFSA 5KIZA 3SZTA 4EQ1A 4UQIS 3W2ZA 2JKGA 3LIEA 2QHKA 4WN5A 1TEMA 5IU1A 3MZDA 2V2FF 1YLJA 4BBUA 1OT9A 3HLBA 4PAUA 4JXWA 4KZAA 3NY4A 4PM9A 3FC7A 4KZ9A 2FFYA 4CPKA 4HH2A 2JBFA 4OP8A 2XA7M 4WEKA 4IJGA 3LI9A 2JKTI 1YLWA 1N9LA 5CEBA 3ZG5A 3BJNA 2WADA 5FQJA 1J3WA 5AQBA 4E3IA 4X6TA 2JKFA 5FQKA 3GMWA 1KGFA 3MXSA 3F1PB 4UA6A 5HARA 2WGIA 3RXWA 2W1RA 1XJ6A 2OLUA 2W3GA 5AVEA 2WGWB 4PM7A 2XR0A 1PNEA 1G68A 4ESPA 3PAEA 1BLHA 4YINA 1K0KA 2X01A 2K31A 3OC2A 3ZG9B 3N4IA 3DWZA 1G5UA 3ULFA 1L0DA 1TS0A 2B95A 1FSWA 3U4LP 4GS9B 1Q2PA 1VETA 4LV1A 4PM8A 4Q0JA 5E2FA 3G31A 3IWOA 2WKHA 1Z09A 3HLEA 3NECA 2ZD8A 3CZDA 4PMAA 5HWVA 4LCLA 4X55A 4KG5A 3SOIA 5DTTA 5L09A 2PD8A 3V3RA 3R4KA 3FV7A 2W3EA 5EVEA 3MXRA 5F68A 3PBNA 1SHVA 1QMFA 3FKWA 1N4OA 2O9CA 3LR0A 3LI8A 3N8LA 1KDSA 2P7JA 5DKKA 4JGQA 2EX6A 2W3DA 5EM1A 4HBTA 2J3TD 4EV4A 3ZFZA 1BLPA 5AJGA 3ZYTA 1YM1A 1ZG6A 3WS1A 1F2KA 3A3JA 2WZZA 1HZOA 3LCEA 3ISGA 3IXDA 2KLIA 3GECA 1GHMA 3H7WB 1GHPA 2PDRA 2OAP1 3O87A 4B88A 4HNBA 5DFXA 4BQMA 5I94A 2L4RA 5FAOA 2IWDA 3KSHA 4DE3A 1L3LA 4MN6A 3QP1A 1CK3A 4Y3IA 3VP4A 4B9OA 4K08A 2Z6DA 1W5DA 1O7EA 2M7UA 3S7QA 2EXAA 5DF7A 4GOGA 4Q0IA 3MXQA 5E2GA 4KUKA 1E3UA 5EPHA 3KO6A 3FPVA 1V9YA 3D9YA 4PM6A 4OQIA 3AGFA 5CHMA 3BFEA 1XFQA 4UA7A 1CQAA 2ACGA 3MMHA 3A3IA 3T1SA 3K2NA 5E2EA 4KQQA 1YQSA 4C3QA 5FQQA 3T1RA 3IXGA 2CC1A 5TR7A 5HWWA 3FZCA 4WYYA 4EUZA 3K3DA 4JGOA 5HFOA 4RVAA 4DDSA 5TGFA 3IBJA 3LICA 3PTEA 1FCOA 4R38A 1SKFA 3Q7VA 5AQAA 2Z6CA 1EW0A 3JYIA 3I7JA 2QYBA 2O0YA 3SS5A 3DTMA 1YSPA 2WK0A 3KX0X 4LV2A 3MQ0A 4RQ9A 2EA9A 5EVIB 4E04A 1ZKJA 1FILA 4X25A 3L9KA 2Z2LB 1HTZA 3LR4A 2WGVA 3DAVA 3IF6C 1FQGA 1LI9A 1PW8A 4MN5A 1YMXA 2XROA 4S2LA 4HBUA 1K56D 2R78A 4KZ5A 4L9EA 3PYPA 5GLBA 2ZJ9A 2ZMFA 1K57A 3E0YA 3G2YA 4FOFA 5EV0A 1L2SA 2H10A 1I2WA 4O7DA 4EWFA 3GVBA 2GNXA 4ARZB 4EQIA 3B42A 2GZAA 4MN7A 3NCKA 3CI6A 5EUAA 1IOUA 2X71A 1S6RA 3FKVA 1FR6A 3MBZA 3BYDA 3NJAA 4BMWA 1H5XA 4X56A 5MC7A 5A93A 3IWIA 2ZC7A 4O01A 2PT7A 1P0ZA 1Q2QA 4RA7A 1T19A 2V0WA 4B93A 2JCHA 4PHTA 2OAQ1 4P6ZS 3IH8A 3LUQA 3QNBA 4Q8IA 2KDKA 5F69A 3NOPC 5KSCA 1FOFA 3UB8A 4XT2B 4HIAA 3UO9A 4U3TA 3ZDJA 3HLCA 3GV9A 3QP4A 5FI6A 4OOMA 1LSWA 2EWWA 5A8BA 4QWOA 3BM6A 2W0NA 1TS8A 1TS6A 1L0GA 2Q0OA 2ZC5B 4BL2A 5HDSA 3C2WA 4S2IA 2PR5A 5FL3A 2HDSA 3C4OA 3MSHA 4EXOA 4WZ5C 1NZUA 2V9AA 4FH4A 1N9OA 3A0VA 1MY8A 2W1TA 4BBVA 4UQIM 1FCMA 4DJ2A 3UPOA 3SS3A 4DE2A 3O88A 2ZQ7A 5DFYA 3EWKA 1XJ2A 2HP6A 2VEAA 4Y17A 2Z2MB 4HQAA 1D06A 4E3NA 3LEQA 3MF0A 3CPTB 1AWIA 1S67L 3EGXC 3NDEA 1SCWA 4DRTA 3CITA 2BTFP 4ZRRA 2RCXA 1MWTA 2A2LA 4G3WA 4DN0A 5AQ9A 1OMEA 4MLLA 3IH9A 1MWUA 4CLCB 1YT4A 4HEFA 2XEPA 2Y59A 1V9ZA 2Q9NA 4AFIA 3MS6A 1IYPA 1I2SA 2P74A 5HD5A 5EVID 3RXXA 4S2NA 2Y8HA 1ERMA 2Y2IA 5J4EA 4F3LB 4H8RA 3ZCZA 3BQAA 2BLSA 3RJUA 3ZVWA 3NOTC 3WS0A 2OWHA 4CLCE 3NI9A 3IBRA 2FH5A 4FD8A 5AQ7A 2C6WB 5CHJA 3RFBA 1DRMA 3UE0A 3Q07A 1NJ4A 4GCZA 3N8RA 2LB5A 3H82B 5FQ9A 5KSHA 4DF6A 2V8CA 4WL9A 4K0WA 1K55C 5IHVA 3EQVA 3T1QB 3ZG7B 4DE0A 5G4YA 1PRQA 1LLBA 1ERQA 3P01A 4QY6A 2JKRM 2XFTA 4YNRA 3C30A 3TRCA 3BFFA 1YLPA 3UPPA 4H6JA 4WMCD 4FH2A 1K25A 5FSRA 2GX5A 4Y0UA 4DXBA 1K54C 1LL5A 2J7VA 1NYMA 1XXMA 3F1PA 5CEDA 3LIDA 1GSVA 4RYEA 2J9OA 1OTAA 4P87A 4Y0OA 4S2MA 1IELA 1MZUA 1MXOA 4BD0A 3UY6A 1CF0A 2QJ5A 3A3FA 4NXFA 1J9MA 1XA1A 3UB7A 1KE0A 1KGEA 5FI7A 2HDUA 1OTBA 1VHMA 2FFFB 1P9RA 4MBHA 3S7NA 2L1MA 3FYZA 3T4QA 2Y2GA 1BLSA 5DF8A 5EVLA 3Q7ZA 4GS9A 1XJ4A 3ZGAB 4X68A 3PBTA 5TBMB 1F9IA 4Y15A 4ETXA 1H8MA 2YKFA 4JBFA 5L10A 2VGLS 1FIKA 4L0LA 2XLNA 2QMIA 1K56A 3PBQA 4FTXA 2W3HA 3UPNA 1D7EA 4ZJ3A 3RTYA 1WE4A 3HLDA 4EBNA 2XF3A 4N1XA 3IF6B 1DP9A 1K38A 1E4DA 2UV0E 3V39A 2VGJA 4ID4A 5CECA 1NXYA 1PWCA 2JE5A 1JWVA 3VOYA 4BJPA 2V1AA 4CQHA 1NRJA 3PBSA 1ZC2A 1F98A 2AVXA 1HD8A 3KYQA 2A24B 2ZMAA 1JWZA 3ICYA 2ZBBA 4IUHA 2K7SA 1VEUB 3IX3A 4KG2A 5EE8A 3NDGA 2XQZA 3D4FA 3NBLA 4UA9A 3S7PA 5CX7A 4OONA 1DJBA 1EWZA 2HV1A 2WKRA 1F5MA 5HZHA 5CTNA 3ZG8B 3O5YA 5FATA 1I5QA 5CGSA 3V50A 1A0KA 4GLQA 3OBFA 2V0UA 1KVMA 4MMNA 2XD1A 1Y28A 1JNUA 4PKYG 1TVFA 3OCLA 4GD8A 3E2LA 4WEJA 2UWXA 3OOVA 4RX3A 3L7HA 1VB6A 2J9PA 1KVLA 3UNWA 5FEFA 4CLCC 5HPIA 3G34A 4XUXA 3HVFA 1E25A 1JTGA 2ZLYA 3BFGA 3P09A 4QJGA 2V1BA 5F6AA 2WKEA 2OOLA 3G6OA 2DCFA 4OPZA 4R4RA 4R4SA 1PYYA 5HPFA 4FSFA 4I39A 3IX8A 3IWQA 3UN7A 2PYPA 5M18A 3TW8A 5HAQA 3WS2A 5AVFA 4WELA 3R7WA 4Y0TA 3MKFA 1LSXA 4JXGA 4JPMA 5EECA 4XXRA 3NOUC 2L0WA 4JF6A 4MNRA 2HP9A 2Y2KA 4EBLA 3ITBA 5EVIA 5TJJA 4DXCA 4LV0A 3DTIA 4O8GA 2R9XA 2C5WB 2JKRI 3O86A 5F1FA 5GHYA 2QWSA 2ZM2A 4OQHA 4OPYA 1D1JA 3N7WA 1K6SA 3Q81A 1O07A 2EX9A 1GA9A 3NIAA 3GTCA 3A3EA 3H9WA 3T4JA 3LYXA 3UDIA 4Y2FA 4EU0A 4U0XA 4A5RA 4X69A 1ES3A 2EWVA 1SDEA
chains in the Genus database with same CATH topology
3VE3A 1OTIA 2FZ0A 4OOMA 1LSWA 2EWWA 2P04A 1GSWA 5A8BA 2A24A 3LR3A 3UE3A 2W0NA 1TS8A 3DBAA 3F1OA 1TS6A 4NXEA 1S66L 4NXBA 2ZOHA 5HDSA 3C2WA 5HDCA 2PR5A 4PKYA 1MKMA 3B47A 5FL3A 2XA7S 1S1ZA 2JHEA 4EXOA 4EW7A 2K2NA 2V9AA 3IS2B 3D3OA 4LPZA 1NLYA 1N9OA 2HJEA 1TS7A 3A0VA 1H3QA 3MQQA 2W1TA 3CUEA 2H28A 1OJGA 4BBVA 4XT2A 3F1NB 1T1AA 4UQIM 4YOFA 4DJ2A 3JVUA 4GHIA 4LRXC 5DFYA 2PD7A 4EEUA 3CAXA 1UWPX 3EWKA 1XJ2A 2VEAA 4HQAA 1D06A 3HCYA 4Y5FA 3U2AA 4I3JA 5HL6A 3VE4A 3MF0A 4BWIA 1S67L 3EGXC 2VV8A 4HY8A 2BASA 4HOIA 3LIAA 4LRZE 2M1CA 2HGVA 3JVVA 5I5LA 3CITA 4ZRRA 3LIBA 2PYRA 2A2LA 3K3CA 4LLOB 2VKSA 1YKDA 2QJ7A 4G3WA 4DN0A 3BQ8A 3A0RA 2HF6A 2ZMVA 3KYZA 5DF9A 2O9AA 3F1NA 4P6ZM 5KIZA 3LR5A 3T4SA 4CLCB 4EQ1A 2W3FA 3UB6A 2B02A 1KOUA 4UQIS 4EESA 3W2ZA 3LIEA 1ZTUA 1V9ZA 4AFIA 3PHYA 2QHKA 4WN5A 2WKQA 4Z1WA 5HD5A 5IU1A 4ME4A 4BBTA 5IS1A 2Y8HA 5J4EA 2VJWA 4HJ4A 2XRNA 4BBUA 1OT9A 4F3LB 4PAUA 5K5BA 3BQAA 5DJTA 4HHDA 3NOTC 3FC7A 3VOLA 2LB9A 2O99A 4DJ3A 4HH2A 2OWHA 4CLCE 3CUEC 3IBRA 2FH5A 3OLOA 3TE8A 4WLAA 2XA7M 4LRYC 4WEKA 1T1BA 4IJGA 3LI9A 2JKTI 1N9LA 5IT5A 3EEAA 4L9FA 4EUVA 3BJNA 1IFQA 1LL8A 3RFBA 3MJQA 1DRMA 5L8MA 1ZHHB 3KSIA 4GCZA 2LB5A 3P7NA 3H82B 3BWLA 3LIFA 3D72A 4ARZA 3UB9A 3F1PB 4HJ3A 2D02A 2CMNA 5KSHA 1WA9A 4WL9A 4L9GA 2VA0A 4G3KA 4GW9A 3S7OA 4UEYA 3EQVA 4F3LA 2W1RA 4R70A 1BYWA 1XJ6A 5G4YA 3FG8A 4EETB 1DP8A 4WUJA 1LSVA 2W3GA 5AVEA 4I38A 3P01A 2JKRM 3BW6A 3B33A 4YNRA 3C30A 4ETZA 3TRCA 4I3IA 5HDDA 4H6JA 2K31A 5DKLA 2GX5A 2O9BA 4R6LA 4KQDA 2J3TC 3OC2A 2NUTC 3ULFA 3H82A 1TS0A 2PR6A 1STZA 2Y79A 4NXGA 3E4QA 2VV6A 3F1PA 3E4OA 3LIDA 2I9VA 3C8CA 1GSVA 4GS9B 2VLGA 1OTAA 2GJ3A 4Q0JA 1MZUA 2QJ5A 4NXFA 3KSFA 3BY9A 1DP6A 1S4SA 3UB7A 2M7VA 1UGUA 4HP9A 3T4OA 5HWVA 1OTBA 3R7WB 1VHMA 1P9RA 4MCWA 3BY8A 4IUKA 3S7NA 2J3WA 2PD8A 3R4KA 2NUPC 4KUOA 2L1MA 2W3EA 3IS2A 3C38A 3ZQ5A 5F68A 3PBNA 3T4TA 3T4QA 2O9CA 3LR0A 3LI8A 3UMEA 4OOLA 2KX6A 1YAXA 4I5SA 1OPXA 2P7JA 4GS9A 1XJ4A 5DKKA 1T18A 2KOIA 4JGQA 4O0PA 2W3DA 3PBTA 5TBMB 1F9IA 2J80A 4NKPA 1G28A 4ETXA 1H8MA 2J3TD 2YKFA 3E98A 4HI4A 5LBRA 1P9WA 2WKPA 4JGRA 5AJGA 3ZYTA 2VGLS 3MR0A 1ODVA 4QPRA 4WF0A 4L0LA 3PXPA 3T50A 3PBQA 2W3HA 3EQUA 2KLIA 3GECA 5HSQA 3H7WB 1D7EA 1OTEA 3RTYA 1S4RA 2PDRA 3T4LA 4YWZA 2OAP1 3V67A 4HNBA 5DFXA 1P97A 2L4RA 3HJKA 4JGPA 1DP9A 3UMDA 3KSHA 3VV4A 4CLCA 4MN6A 1NWZA 3EEHA 4IHQA 5J7EA 4Y3IA 5TBMA 3EGDC 4B9OA 4K08A 2V1AA 2Z6DA 4BJPA 4CQHA 1NRJA 3PBSA 1F98A 3A0SA 3KYQA 2A24B 1W63Q 1XFNA 1LT0A 3ICYA 2ZBBA 4IUHA 5F5YA 2M7UA 2K7SA 3S7QA 4Q0IA 3PR6A 3MXQA 4HJ6A 3KSGA 4KUKA 1NLZA 3S7PA 4R3AA 3KO6A 3FPVA 5CX7A 1V9YA 2HV1A 2WKRA 1F5MA 2W1TB 4DMZA 1XFQA 1N9NA 5HZHA 1OT6A 2XSSA 4MDZA 4GHIB 3O5YA 3MMHA 4G3VA 5G4ZA 2HJ9C 2JKTM 2ZOIA 3K2NA 3RH8B 1W63M 4GLQA 3T4KA 3OBFA 2V0UA 1OTDA 5J3WA 1MC0A 2QKPA 4MMNA 5HWWA 2MJ6A 4HH3A 3K3DA 1Y28A 1JNUA 4PKYG 4JGOA 3OCLA 4M4XA 1UWNX 2VGLM 1X0OA 3IBJA 4WEJA 3LICA 4II7A 3OOVA 4R38A 2W27A 1VB6A 4KQOA 4CLCC 5HPIA 2JN7A 2Z6CA 1EW0A 4HP4A 1XJ3A 2QYBA 3EOIA 2OWJA 2O0YA 2V1BA 5F6AA 1YSPA 3KX0X 3MQ0A 2YKHA 2OOLA 2VV7A 3G6OA 4RQ9A 2EA9A 3PBOA 4E04A 5HD3A 5DJUA 2G7UA 5HPFA 4Q0HA 4FSFA 4I39A 2VZWA 2PYPA 3LR4A 4HIAA 3TW8A 2VX8A 4EERA 4MN5A 3E4PA 5AVFA 4WELA 3R7WA 2XROA 1LSXA 3TJZC 4I3AA 1S1YA 3MFXA 2DMWA 2R78A 4L9EA 1G6OA 3PYPA 2ZMFA 3E0YA 3NOUC 2L0WA 4FOFA 1TF1A 2IA2A 2D01A 3GDIA 3FPWA 3LFVA 5HWTA 3CWFA 1TD5A 2GNXA 3SW1A 4ARZB 1GSXA 5TJJA 3B42A 2GZAA 4MN7A 3CI6A 2B18A 4O8GA 4CLCD 1IOUA 3HJIA 2JKRI 3PBRA 5EFWA 3NJAA 4BMWA 2QWSA 3F1OB 2PHYA 5C5KA 4NEED 4EEPA 5MC7A 4H6JB 1YSQA 2PT7A 4O01A 3OCNA 1P0ZA 3H7WA 1OJ5A 1T19A 2V0WA 3H9WA 4B93A 4PHTA 2OAQ1 4P6ZS 3LUQA 3NHQA 4GJ4A 1T1CA 3CLOA 3T4JA 2INWA 3MQOA 3LYXA 2P08A 2KDKA 4Y2FA 5F69A 4EU0A 3NOPC 3UB8A 3UE6A 4XT2B 2EWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VE3 A;  1OTI A;  1LSW A;  5A8B A;  1GSW A;  2A24 A;  2W0N A;  1TS8 A;  3F1O A;  1TS6 A;  4NXE A;  1S66 L;  4NXB A;  2ZOH A;  5HDS A;  3C2W A;  5HDC A;  2PR5 A;  4PKY A;  1S1Z A;  2JHE A;  4EXO A;  4EW7 A;  2V9A A;  3IS2 B;  4LPZ A;  1N9O A;  1TS7 A;  3A0V A;  3MQQ A;  2H28 A;  1OJG A;  4BBV A;  4XT2 A;  3F1N B;  1T1A A;  4DJ2 A;  4GHI A;  4LRX C;  2PD7 A;  4EEU A;  3CAX A;  1UWP X;  3EWK A;  1XJ2 A;  2VEA A;  4HQA A;  1D06 A;  4I3J A;  3VE4 A;  1S67 L;  2VV8 A;  4HY8 A;  2BAS A;  4HOI A;  3LIA A;  4LRZ E;  2M1C A;  5I5L A;  3LIB A;  2PYR A;  3K3C A;  4LLO B;  2QJ7 A;  3A0R A;  3F1N A;  5KIZ A;  4EQ1 A;  3UB6 A;  2B02 A;  1KOU A;  4EES A;  3LIE A;  1V9Z A;  3PHY A;  2QHK A;  4WN5 A;  2WKQ A;  5HD5 A;  5IU1 A;  4BBT A;  5IS1 A;  5J4E A;  4HJ4 A;  4BBU A;  1OT9 A;  4F3L B;  5DJT A;  4HHD A;  3NOT C;  3FC7 A;  3VOL A;  4DJ3 A;  4HH2 A;  2OWH A;  3IBR A;  3OLO A;  4WLA A;  4LRY C;  1T1B A;  3LI9 A;  1N9L A;  4L9F A;  1LL8 A;  3MJQ A;  1DRM A;  4GCZ A;  3P7N A;  3H82 B;  3BWL A;  3LIF A;  3D72 A;  3UB9 A;  3F1P B;  4HJ3 A;  2D02 A;  2CMN A;  1WA9 A;  4WL9 A;  4L9G A;  4GW9 A;  4F3L A;  4R70 A;  1BYW A;  1XJ6 A;  5G4Y A;  3FG8 A;  4EET B;  1DP8 A;  4WUJ A;  1LSV A;  5AVE A;  4I38 A;  3B33 A;  4I3I A;  5HDD A;  4H6J A;  5DKL A;  4R6L A;  4KQD A;  3ULF A;  3H82 A;  1TS0 A;  2PR6 A;  4NXG A;  3E4Q A;  2VV6 A;  3F1P A;  3E4O A;  3LID A;  2I9V A;  3C8C A;  1GSV A;  4GS9 B;  2VLG A;  1OTA A;  2GJ3 A;  1MZU A;  2QJ5 A;  4NXF A;  3BY9 A;  1DP6 A;  1S4S A;  3UB7 A;  1UGU A;  4HP9 A;  5HWV A;  1OTB A;  3BY8 A;  2PD8 A;  4KUO A;  2L1M A;  3ZQ5 A;  3IS2 A;  5F68 A;  3LI8 A;  3UME A;  2KX6 A;  4I5S A;  2P7J A;  4GS9 A;  1XJ4 A;  5DKK A;  1T18 A;  4JGQ A;  5TBM B;  1F9I A;  2J80 A;  1G28 A;  2YKF A;  4HI4 A;  2WKP A;  4JGR A;  3MR0 A;  1ODV A;  4WF0 A;  3T50 A;  3GEC A;  5HSQ A;  3H7W B;  1D7E A;  1OTE A;  3RTY A;  1S4R A;  2PDR A;  4YWZ A;  4HNB A;  1P97 A;  2L4R A;  3HJK A;  4JGP A;  1DP9 A;  3UMD A;  4MN6 A;  1NWZ A;  3EEH A;  5J7E A;  5TBM A;  4B9O A;  4K08 A;  2V1A A;  2Z6D A;  1F98 A;  3A0S A;  2A24 B;  1XFN A;  1LT0 A;  3ICY A;  2ZBB A;  5F5Y A;  2K7S A;  3MXQ A;  4HJ6 A;  4KUK A;  4R3A A;  1V9Y A;  2HV1 A;  2WKR A;  1XFQ A;  1N9N A;  5HZH A;  1OT6 A;  4GHI B;  5G4Z A;  2ZOI A;  3RH8 B;  2V0U A;  1OTD A;  5J3W A;  2QKP A;  5HWW A;  4HH3 A;  3K3D A;  1Y28 A;  1JNU A;  4PKY G;  4JGO A;  4M4X A;  1UWN X;  1X0O A;  3LIC A;  4R38 A;  2W27 A;  1VB6 A;  2JN7 A;  2Z6C A;  1EW0 A;  4HP4 A;  1XJ3 A;  2OWJ A;  2V1B A;  5F6A A;  3KX0 X;  2YKH A;  2OOL A;  2VV7 A;  3G6O A;  4RQ9 A;  2EA9 A;  4E04 A;  5HD3 A;  5DJU A;  4I39 A;  2PYP A;  4EER A;  4MN5 A;  3E4P A;  5AVF A;  1LSX A;  4I3A A;  1S1Y A;  3MFX A;  2R78 A;  4L9E A;  3PYP A;  3NOU C;  2L0W A;  2D01 A;  3GDI A;  5HWT A;  3CWF A;  3SW1 A;  1GSX A;  3HJI A;  5EFW A;  3NJA A;  2QWS A;  3F1O B;  2PHY A;  4EEP A;  4H6J B;  1P0Z A;  3H7W A;  1OJ5 A;  1T19 A;  2V0W A;  3H9W A;  3LUQ A;  3NHQ A;  1T1C A;  3CLO A;  2INW A;  3MQO A;  3LYX A;  2KDK A;  5F69 A;  3NOP C;  3UB8 A;  3UE6 A;  4XT2 B;  4HIA A; 
#chains in the Genus database with same CATH topology
 1K4F A;  3VE3 A;  1OTI A;  1NYY A;  1GHI A;  3IT9 A;  1S66 L;  4NXB A;  2ZOH A;  4WMC A;  2XA7 S;  4KZ8 A;  1S1Z A;  2JHE A;  4FCF A;  4BLM A;  4EW7 A;  3W4O A;  3D3O A;  1NLY A;  3VSL A;  1CEF A;  3T1X A;  4QY5 A;  1H3Q A;  3VFF A;  4QD4 A;  1OJG A;  4XT2 A;  3GR2 A;  4GHI A;  5A90 A;  1M40 A;  1UWP X;  4GB7 A;  3CMZ A;  5GL9 A;  3QHY A;  3HCY A;  4I3J A;  2VV8 A;  2BAS A;  3P98 A;  2HGV A;  3JVV A;  3ZNT A;  2R9W A;  2PYR A;  4Y13 A;  3K3C A;  1YKD A;  1PWD A;  3BQ8 A;  5L2F A;  3A0R A;  5HAP A;  3LR5 A;  2W3F A;  2ZQA A;  1FR1 A;  2B02 A;  1KOU A;  2Y2H A;  1AXB A;  4S2O A;  4UAA A;  1HVB A;  4Z1W A;  5J8X A;  3V3S A;  4BBT A;  5IS1 A;  5KMW A;  3HLG A;  5CGW A;  2VJW A;  1NRF A;  1PW1 A;  4HJ4 A;  4ZJ2 A;  5DJT A;  2LB9 A;  2WZX A;  4DJ3 A;  2I72 A;  3CUE C;  3OLO A;  3TE8 A;  3FWL A;  5IT5 A;  2J8Y A;  4X1M A;  4L9F A;  3T12 B;  1IFQ A;  2ZC3 B;  4YFM A;  1LL8 A;  4D60 A;  3MJQ A;  3C5A A;  1IKG A;  3KSI A;  4LFU A;  3LIF A;  5FQM A;  4OVD A;  4S2P A;  4HJ3 A;  2EX2 A;  2CMN A;  3TG9 A;  2BG1 A;  2VA0 A;  4G3K A;  4GW9 A;  2QZ6 A;  4WZ4 A;  4UEY A;  5GLA A;  4F3L A;  5GLD A;  1RP5 A;  3UB5 P;  4R70 A;  1Y4O A;  1BYW A;  3IQA A;  3FG8 A;  4WUJ A;  4BL3 A;  4E3L A;  4I38 A;  5M19 A;  2PRF A;  2Y2P A;  4ETZ A;  3LY3 A;  3Q7V B;  5HDD A;  3LY4 A;  2E8I A;  4XUZ A;  4OPQ A;  5DKL A;  4R6L A;  2WAE A;  4IVI A;  2WAF A;  2Y2O A;  2H5S A;  3CJM A;  3H82 A;  2PR6 A;  2Y79 A;  2VV6 A;  4IED A;  1W7F A;  2A49 A;  3C8C A;  4S2K A;  1ES5 A;  2P9V B;  2GJ3 A;  3HRE A;  1ACF A;  3BY9 A;  4QHC A;  2OSU A;  4MBF A;  1DJC A;  1ONH A;  4Z9Q A;  4MCW A;  4UHU A;  3SH9 A;  2ZC4 B;  2J3W A;  3VP0 A;  1KE4 A;  1H8Z A;  1GCE A;  4KUO A;  3ZQ5 A;  3IS2 A;  3T4T A;  3HUO A;  3ITA A;  2KX6 A;  1YAX A;  4I5S A;  1OPX A;  1BLC A;  3N6I A;  3OPR A;  1T18 A;  1CJF A;  2Q9M A;  1G28 A;  3QP6 A;  4NET A;  4Y7P A;  2ZL1 A;  4HI4 A;  3G35 A;  5LBR A;  3M6H A;  1ODV A;  4WF0 A;  5HW3 A;  3PXP A;  3E2K A;  1W8Q A;  5DTS A;  1Y54 A;  3EQU A;  1OTE A;  2H0T A;  3T4L A;  1VM1 A;  1SKO A;  3AGE A;  1SZV A;  5EM0 A;  3C4P A;  3DW0 A;  3UMD A;  1JWP A;  3OPH A;  3VV4 A;  2JC7 A;  4JF5 A;  4IBX A;  3EEH A;  5TBM A;  3EGD C;  4KG6 A;  4K91 A;  5CGX A;  4N1H A;  2XDM A;  1BSG A;  3A0S A;  1W63 Q;  1XFN A;  1LT0 A;  1MBL A;  4ZBE A;  2GDN A;  1TDL A;  3PR6 A;  1JTD A;  1SDN A;  4WBG A;  1YMS A;  4LCM A;  4F94 A;  3IF6 A;  4KZ4 A;  3W4Q A;  2W1T B;  4DMZ A;  1OT6 A;  4MDZ A;  4GDB A;  2X02 A;  2HDQ A;  5CRF A;  2ZOI A;  5F82 A;  1MWS A;  3LO7 A;  1XA7 A;  5E2H A;  3WS4 A;  4DE1 A;  5J3W A;  1OTD A;  1MC0 A;  2QKP A;  4N92 A;  3N8S A;  4HES A;  2MJ6 A;  4HH3 A;  1LL9 A;  2EXB A;  1VEU A;  1CI9 A;  1ZG4 A;  4EBP A;  5FEG A;  2WGW A;  3G2Z A;  1L0E A;  2W27 A;  2JN7 A;  3C7V A;  5EOO A;  3G32 A;  3VP3 A;  1N9B A;  3EOI A;  2XD5 A;  1RCJ A;  2XGN A;  1BUL A;  4LV3 A;  4GDN A;  1W8Y A;  2YKH A;  1XGI A;  4GN2 A;  3M2J A;  4OQG A;  4RX2 A;  1K6R A;  1PIO A;  2Y55 A;  5HD3 A;  5DJU A;  1K4E A;  4Q0H A;  1JVJ A;  1KGG A;  5L07 A;  2VZW A;  5E43 A;  1W79 A;  2VX8 A;  4R23 A;  3E4P A;  5F83 A;  1FCN A;  2B5R A;  3TJZ C;  1S1Y A;  4JF4 A;  3MFX A;  4N9K A;  3WRT A;  2DMW A;  1VET B;  3JPU A;  3AGD A;  1DJA A;  4P0M A;  2XK1 A;  3LEZ A;  1TF1 A;  2IA2 A;  3M6B A;  4KZ7 A;  4WZ5 A;  1XPB A;  3GDI A;  1IYS A;  5HWT A;  3CWF A;  1TD5 A;  3DTE A;  3SW1 A;  4JKT A;  1PI4 A;  2B18 A;  4CLC D;  4KZ3 A;  2VK3 A;  3UDX A;  1PZP A;  3HJI A;  1EI5 A;  3PBR A;  5HAI A;  1FSY A;  4NG2 A;  3PAG A;  4WM9 A;  5EFW A;  3C7U A;  3F1O B;  4GNU A;  4NEE D;  2HDR A;  5JYP A;  1XGJ A;  4H6J B;  1YSQ A;  3H7W A;  4KZB A;  3CLO A;  2INW A;  2HP5 A;  3SH8 A;  3KYE A;  3ZNY A;  2PBD P;  2FZ0 A;  4DDY A;  2P04 A;  1GSW A;  3LR3 A;  5JYO A;  1DY6 A;  3DBA A;  1VQQ A;  1ALQ A;  1K57 C;  1MKM A;  2IWC A;  2QPN A;  1G6A A;  1BTL A;  4ZTK A;  4LPZ A;  2HJE A;  1YLZ A;  3IXH A;  1TS7 A;  3MQQ A;  4LEN A;  4U0T A;  3BFC A;  3F1N B;  3HLF A;  4GD6 A;  4YOF A;  5CHU A;  3Q1F A;  1IKI A;  3ZHH A;  4EEU A;  1NZO A;  2Y91 A;  1S0W A;  2Y2M A;  4Y5F A;  3U2A A;  4OQ0 A;  5HL6 A;  3VE4 A;  3VP2 A;  1ES4 A;  1HLU P;  5F1G A;  2OV5 A;  4E3M A;  2A3U A;  2M1C A;  5I5L A;  2PBY A;  1K55 A;  4C75 A;  4ZJ1 A;  3G30 A;  5G18 A;  2QJ7 A;  3VOZ A;  3SH7 A;  2HF6 A;  4P6B A;  4BD1 A;  4R1G A;  1XKZ A;  1M6K A;  4P6Z M;  1KE3 A;  3T4S A;  3S4X A;  1PZO A;  3DWK A;  5CER A;  3UB6 A;  3VMA A;  1MWR A;  4EES A;  2ZQC A;  2EFU A;  1ZTU A;  3PHY A;  1K54 A;  2WKQ A;  3LGO A;  4ME4 A;  2XRN A;  3QP2 A;  5K5B A;  5TFQ A;  5HX9 A;  4HHD A;  3VOL A;  2O99 A;  4WLA A;  2DNS A;  4LRY C;  3OPL A;  4X53 A;  1T1B A;  3WS5 A;  2IWB A;  3EEA A;  3MKE A;  4EUV A;  5L8M A;  1ZHH B;  3CHW P;  4B4X A;  3P7N A;  3BWL A;  3D72 A;  4ARZ A;  3UB9 A;  2D02 A;  4IBR A;  1WA9 A;  4L9G A;  3ZVT A;  1L0F A;  3S7O A;  4EET B;  2WYX A;  4QU3 A;  1DP8 A;  3S22 A;  1LSV A;  1PFL A;  2OLV A;  2RL3 A;  5FI2 A;  3BW6 A;  3B33 A;  1MKI A;  3HUM A;  2ZQ9 A;  4DKI A;  4I3I A;  4OLG A;  2O9B A;  4KQD A;  2J3T C;  4R0Q A;  2NUT C;  1STZ A;  4NXG A;  4S2N C;  1Z6F A;  3E4Q A;  4OKP A;  4KQR A;  3E4O A;  2I9V A;  2VLG A;  3ZG0 A;  4MEZ A;  3TSG A;  3VP1 A;  1WYC A;  3KSF A;  1DP6 A;  1S4S A;  2M7V A;  1UGU A;  4HP9 A;  3T4O A;  3BFD A;  5A92 A;  3A3D A;  3R7W B;  3BY8 A;  1PWG A;  4IUK A;  5GHX A;  1PI5 A;  2EX8 A;  2NUP C;  2PU2 A;  3C38 A;  1XX2 A;  1GA0 A;  5EOE A;  5D3O A;  3UME A;  5HL1 A;  4OOL A;  1ERO A;  2P9V A;  4JXV A;  4E3O A;  4LGW A;  2KOI A;  4OOY A;  4O0P A;  1IEM A;  3TOI A;  3NC8 A;  1RGZ A;  2J80 A;  4NKP A;  1CI8 A;  3UDF A;  3E98 A;  1KDW A;  1P9W A;  4B4Z A;  2WKP A;  4JGR A;  3MR0 A;  4QPR A;  3CPT A;  4OPR A;  4K0X A;  3T50 A;  4ZDX A;  2XH9 A;  4PM5 A;  5HSQ A;  1S4R A;  4CJN A;  4OP5 A;  4YWZ A;  5FDS A;  1QME A;  3V67 A;  1P97 A;  3GRJ A;  3HJK A;  4JGP A;  5GLC A;  3QP5 A;  3W4P A;  3HL9 A;  2Y2J A;  4CLC A;  1ESU A;  1NWZ A;  4IHQ A;  5J7E A;  3BLS A;  3HLW A;  5FAP A;  4MBK A;  1CEG A;  4E3J A;  5F5Y A;  3QP8 A;  2Y2Q A;  3V5M A;  4HJ6 A;  4D2O A;  3KSG A;  3B3X A;  3MFD A;  3DTK A;  1NLZ A;  4R3A A;  1H0M A;  3BRM A;  3HBR A;  1XP4 A;  1N9N A;  2XSS A;  4GHI B;  5G4Z A;  4G3V A;  2HJ9 C;  2JKT M;  2ZM8 A;  3RH8 B;  3IF5 A;  2HPB A;  1W63 M;  3WRZ A;  4PPR A;  4M3K A;  4JXS A;  3T4K A;  4E3K A;  5KZH A;  4FUW A;  4S2J A;  5FA7 A;  1NY0 A;  5U47 A;  1TDG A;  1YPR A;  4M4X A;  1UWN X;  2VGL M;  3GSG A;  1X0O A;  1BUE A;  4KEN B;  4II7 A;  3Q82 A;  1LI0 A;  2G2W A;  4KQO A;  3OZH A;  3NUL A;  4HP4 A;  1ONG A;  1XJ3 A;  4BEN A;  2OWJ A;  1BT5 A;  4ZAM A;  2VV7 A;  2DRW A;  3PBO A;  3SS4 A;  2G7U A;  5M1A A;  5FAQ A;  1WYB A;  2Y2L A;  4EER A;  3UE1 A;  4E6X A;  2Y2N A;  3MZE A;  4R3B A;  2WKI A;  3BEC A;  4I3A A;  4P85 A;  2EFX A;  2Y4A A;  3GQZ A;  1G6O A;  3VSK A;  5FQI A;  4C6Y A;  2D01 A;  5DTK A;  2ZM0 A;  1H8Y A;  3FPW A;  3LFV A;  4IVK A;  1GSX A;  3O3V A;  4GZB A;  1IYQ A;  2V1Z A;  2WUQ A;  2HZ5 A;  3CG5 A;  4JLF A;  3W8K A;  1YLY A;  5GHZ A;  1MPL A;  5FDH A;  3IXB A;  2ZQ8 A;  1YLT A;  2PHY A;  5C5K A;  3IHA A;  1LHY A;  4EEP A;  3HUN A;  2V20 A;  1ES2 A;  3OCN A;  4GKU A;  1OJ5 A;  4E6W A;  2ZC6 B;  2ZQD A;  2VGK A;  3QNC A;  4NK3 A;  1E3U D;  3BLM A;  3NHQ A;  4GJ4 A;  1T1C A;  4QB8 A;  3MQO A;  2P08 A;  5CXW A;  3IX4 A;  2H0Y A;  2V8F A;  3M2K A;  3UE6 A;  4KZ6 A;  3S1Y A;  3G4P A;  3BEB A;  4R3J A;  5BOH A;  1BZA A;  2A24 A;  3UE3 A;  3F1O A;  1RGY A;  4NXE A;  4OH0 A;  5HDC A;  4PKY A;  1IYO A;  2PU4 A;  3B47 A;  5FAS A;  2K2N A;  4N9L A;  3IS2 B;  5EVI C;  3WWX A;  4X1L A;  3CUE A;  2H28 A;  1ESI A;  1T1A A;  3JVU A;  2E8J A;  2PAV P;  4LRX C;  5DVA A;  2PD7 A;  3CAX A;  5A91 A;  5CTM A;  2ZL1 B;  3IHB A;  4BWI A;  3VFH A;  3OPP A;  4HY8 A;  4HOI A;  3LIA A;  4LRZ E;  4OLD A;  2G2U A;  3LIB A;  1U60 A;  4LLO B;  2VKS A;  1SKO B;  3KYZ A;  2ZMV A;  5DF9 A;  2O9A A;  3MZF A;  3F1N A;  1C3B A;  2XFS A;  5KIZ A;  3SZT A;  4EQ1 A;  4UQI S;  3W2Z A;  2JKG A;  3LIE A;  2QHK A;  4WN5 A;  1TEM A;  5IU1 A;  3MZD A;  2V2F F;  1YLJ A;  4BBU A;  1OT9 A;  3HLB A;  4PAU A;  4JXW A;  4KZA A;  3NY4 A;  4PM9 A;  3FC7 A;  4KZ9 A;  2FFY A;  4CPK A;  4HH2 A;  2JBF A;  4OP8 A;  2XA7 M;  4WEK A;  4IJG A;  3LI9 A;  2JKT I;  1YLW A;  1N9L A;  5CEB A;  3ZG5 A;  3BJN A;  2WAD A;  5FQJ A;  1J3W A;  5AQB A;  4E3I A;  4X6T A;  2JKF A;  5FQK A;  3GMW A;  1KGF A;  3MXS A;  3F1P B;  4UA6 A;  5HAR A;  2WGI A;  3RXW A;  2W1R A;  1XJ6 A;  2OLU A;  2W3G A;  5AVE A;  2WGW B;  4PM7 A;  2XR0 A;  1PNE A;  1G68 A;  4ESP A;  3PAE A;  1BLH A;  4YIN A;  1K0K A;  2X01 A;  2K31 A;  3OC2 A;  3ZG9 B;  3N4I A;  3DWZ A;  1G5U A;  3ULF A;  1L0D A;  1TS0 A;  2B95 A;  1FSW A;  3U4L P;  4GS9 B;  1Q2P A;  1VET A;  4LV1 A;  4PM8 A;  4Q0J A;  5E2F A;  3G31 A;  3IWO A;  2WKH A;  1Z09 A;  3HLE A;  3NEC A;  2ZD8 A;  3CZD A;  4PMA A;  5HWV A;  4LCL A;  4X55 A;  4KG5 A;  3SOI A;  5DTT A;  5L09 A;  2PD8 A;  3V3R A;  3R4K A;  3FV7 A;  2W3E A;  5EVE A;  3MXR A;  5F68 A;  3PBN A;  1SHV A;  1QMF A;  3FKW A;  1N4O A;  2O9C A;  3LR0 A;  3LI8 A;  3N8L A;  1KDS A;  2P7J A;  5DKK A;  4JGQ A;  2EX6 A;  2W3D A;  5EM1 A;  4HBT A;  2J3T D;  4EV4 A;  3ZFZ A;  1BLP A;  5AJG A;  3ZYT A;  1YM1 A;  1ZG6 A;  3WS1 A;  1F2K A;  3A3J A;  2WZZ A;  1HZO A;  3LCE A;  3ISG A;  3IXD A;  2KLI A;  3GEC A;  1GHM A;  3H7W B;  1GHP A;  2PDR A;  2OAP 1;  3O87 A;  4B88 A;  4HNB A;  5DFX A;  4BQM A;  5I94 A;  2L4R A;  5FAO A;  2IWD A;  3KSH A;  4DE3 A;  1L3L A;  4MN6 A;  3QP1 A;  1CK3 A;  4Y3I A;  3VP4 A;  4B9O A;  4K08 A;  2Z6D A;  1W5D A;  1O7E A;  2M7U A;  3S7Q A;  2EXA A;  5DF7 A;  4GOG A;  4Q0I A;  3MXQ A;  5E2G A;  4KUK A;  1E3U A;  5EPH A;  3KO6 A;  3FPV A;  1V9Y A;  3D9Y A;  4PM6 A;  4OQI A;  3AGF A;  5CHM A;  3BFE A;  1XFQ A;  4UA7 A;  1CQA A;  2ACG A;  3MMH A;  3A3I A;  3T1S A;  3K2N A;  5E2E A;  4KQQ A;  1YQS A;  4C3Q A;  5FQQ A;  3T1R A;  3IXG A;  2CC1 A;  5TR7 A;  5HWW A;  3FZC A;  4WYY A;  4EUZ A;  3K3D A;  4JGO A;  5HFO A;  4RVA A;  4DDS A;  5TGF A;  3IBJ A;  3LIC A;  3PTE A;  1FCO A;  4R38 A;  1SKF A;  3Q7V A;  5AQA A;  2Z6C A;  1EW0 A;  3JYI A;  3I7J A;  2QYB A;  2O0Y A;  3SS5 A;  3DTM A;  1YSP A;  2WK0 A;  3KX0 X;  4LV2 A;  3MQ0 A;  4RQ9 A;  2EA9 A;  5EVI B;  4E04 A;  1ZKJ A;  1FIL A;  4X25 A;  3L9K A;  2Z2L B;  1HTZ A;  3LR4 A;  2WGV A;  3DAV A;  3IF6 C;  1FQG A;  1LI9 A;  1PW8 A;  4MN5 A;  1YMX A;  2XRO A;  4S2L A;  4HBU A;  1K56 D;  2R78 A;  4KZ5 A;  4L9E A;  3PYP A;  5GLB A;  2ZJ9 A;  2ZMF A;  1K57 A;  3E0Y A;  3G2Y A;  4FOF A;  5EV0 A;  1L2S A;  2H10 A;  1I2W A;  4O7D A;  4EWF A;  3GVB A;  2GNX A;  4ARZ B;  4EQI A;  3B42 A;  2GZA A;  4MN7 A;  3NCK A;  3CI6 A;  5EUA A;  1IOU A;  2X71 A;  1S6R A;  3FKV A;  1FR6 A;  3MBZ A;  3BYD A;  3NJA A;  4BMW A;  1H5X A;  4X56 A;  5MC7 A;  5A93 A;  3IWI A;  2ZC7 A;  4O01 A;  2PT7 A;  1P0Z A;  1Q2Q A;  4RA7 A;  1T19 A;  2V0W A;  4B93 A;  2JCH A;  4PHT A;  2OAQ 1;  4P6Z S;  3IH8 A;  3LUQ A;  3QNB A;  4Q8I A;  2KDK A;  5F69 A;  3NOP C;  5KSC A;  1FOF A;  3UB8 A;  4XT2 B;  4HIA A;  3UO9 A;  4U3T A;  3ZDJ A;  3HLC A;  3GV9 A;  3QP4 A;  5FI6 A;  4OOM A;  1LSW A;  2EWW A;  5A8B A;  4QWO A;  3BM6 A;  2W0N A;  1TS8 A;  1TS6 A;  1L0G A;  2Q0O A;  2ZC5 B;  4BL2 A;  5HDS A;  3C2W A;  4S2I A;  2PR5 A;  5FL3 A;  2HDS A;  3C4O A;  3MSH A;  4EXO A;  4WZ5 C;  1NZU A;  2V9A A;  4FH4 A;  1N9O A;  3A0V A;  1MY8 A;  2W1T A;  4BBV A;  4UQI M;  1FCM A;  4DJ2 A;  3UPO A;  3SS3 A;  4DE2 A;  3O88 A;  2ZQ7 A;  5DFY A;  3EWK A;  1XJ2 A;  2HP6 A;  2VEA A;  4Y17 A;  2Z2M B;  4HQA A;  1D06 A;  4E3N A;  3LEQ A;  3MF0 A;  3CPT B;  1AWI A;  1S67 L;  3EGX C;  3NDE A;  1SCW A;  4DRT A;  3CIT A;  2BTF P;  4ZRR A;  2RCX A;  1MWT A;  2A2L A;  4G3W A;  4DN0 A;  5AQ9 A;  1OME A;  4MLL A;  3IH9 A;  1MWU A;  4CLC B;  1YT4 A;  4HEF A;  2XEP A;  2Y59 A;  1V9Z A;  2Q9N A;  4AFI A;  3MS6 A;  1IYP A;  1I2S A;  2P74 A;  5HD5 A;  5EVI D;  3RXX A;  4S2N A;  2Y8H A;  1ERM A;  2Y2I A;  5J4E A;  4F3L B;  4H8R A;  3ZCZ A;  3BQA A;  2BLS A;  3RJU A;  3ZVW A;  3NOT C;  3WS0 A;  2OWH A;  4CLC E;  3NI9 A;  3IBR A;  2FH5 A;  4FD8 A;  5AQ7 A;  2C6W B;  5CHJ A;  3RFB A;  1DRM A;  3UE0 A;  3Q07 A;  1NJ4 A;  4GCZ A;  3N8R A;  2LB5 A;  3H82 B;  5FQ9 A;  5KSH A;  4DF6 A;  2V8C A;  4WL9 A;  4K0W A;  1K55 C;  5IHV A;  3EQV A;  3T1Q B;  3ZG7 B;  4DE0 A;  5G4Y A;  1PRQ A;  1LLB A;  1ERQ A;  3P01 A;  4QY6 A;  2JKR M;  2XFT A;  4YNR A;  3C30 A;  3TRC A;  3BFF A;  1YLP A;  3UPP A;  4H6J A;  4WMC D;  4FH2 A;  1K25 A;  5FSR A;  2GX5 A;  4Y0U A;  4DXB A;  1K54 C;  1LL5 A;  2J7V A;  1NYM A;  1XXM A;  3F1P A;  5CED A;  3LID A;  1GSV A;  4RYE A;  2J9O A;  1OTA A;  4P87 A;  4Y0O A;  4S2M A;  1IEL A;  1MZU A;  1MXO A;  4BD0 A;  3UY6 A;  1CF0 A;  2QJ5 A;  3A3F A;  4NXF A;  1J9M A;  1XA1 A;  3UB7 A;  1KE0 A;  1KGE A;  5FI7 A;  2HDU A;  1OTB A;  1VHM A;  2FFF B;  1P9R A;  4MBH A;  3S7N A;  2L1M A;  3FYZ A;  3T4Q A;  2Y2G A;  1BLS A;  5DF8 A;  5EVL A;  3Q7Z A;  4GS9 A;  1XJ4 A;  3ZGA B;  4X68 A;  3PBT A;  5TBM B;  1F9I A;  4Y15 A;  4ETX A;  1H8M A;  2YKF A;  4JBF A;  5L10 A;  2VGL S;  1FIK A;  4L0L A;  2XLN A;  2QMI A;  1K56 A;  3PBQ A;  4FTX A;  2W3H A;  3UPN A;  1D7E A;  4ZJ3 A;  3RTY A;  1WE4 A;  3HLD A;  4EBN A;  2XF3 A;  4N1X A;  3IF6 B;  1DP9 A;  1K38 A;  1E4D A;  2UV0 E;  3V39 A;  2VGJ A;  4ID4 A;  5CEC A;  1NXY A;  1PWC A;  2JE5 A;  1JWV A;  3VOY A;  4BJP A;  2V1A A;  4CQH A;  1NRJ A;  3PBS A;  1ZC2 A;  1F98 A;  2AVX A;  1HD8 A;  3KYQ A;  2A24 B;  2ZMA A;  1JWZ A;  3ICY A;  2ZBB A;  4IUH A;  2K7S A;  1VEU B;  3IX3 A;  4KG2 A;  5EE8 A;  3NDG A;  2XQZ A;  3D4F A;  3NBL A;  4UA9 A;  3S7P A;  5CX7 A;  4OON A;  1DJB A;  1EWZ A;  2HV1 A;  2WKR A;  1F5M A;  5HZH A;  5CTN A;  3ZG8 B;  3O5Y A;  5FAT A;  1I5Q A;  5CGS A;  3V50 A;  1A0K A;  4GLQ A;  3OBF A;  2V0U A;  1KVM A;  4MMN A;  2XD1 A;  1Y28 A;  1JNU A;  4PKY G;  1TVF A;  3OCL A;  4GD8 A;  3E2L A;  4WEJ A;  2UWX A;  3OOV A;  4RX3 A;  3L7H A;  1VB6 A;  2J9P A;  1KVL A;  3UNW A;  5FEF A;  4CLC C;  5HPI A;  3G34 A;  4XUX A;  3HVF A;  1E25 A;  1JTG A;  2ZLY A;  3BFG A;  3P09 A;  4QJG A;  2V1B A;  5F6A A;  2WKE A;  2OOL A;  3G6O A;  2DCF A;  4OPZ A;  4R4R A;  4R4S A;  1PYY A;  5HPF A;  4FSF A;  4I39 A;  3IX8 A;  3IWQ A;  3UN7 A;  2PYP A;  5M18 A;  3TW8 A;  5HAQ A;  3WS2 A;  5AVF A;  4WEL A;  3R7W A;  4Y0T A;  3MKF A;  1LSX A;  4JXG A;  4JPM A;  5EEC A;  4XXR A;  3NOU C;  2L0W A;  4JF6 A;  4MNR A;  2HP9 A;  2Y2K A;  4EBL A;  3ITB A;  5EVI A;  5TJJ A;  4DXC A;  4LV0 A;  3DTI A;  4O8G A;  2R9X A;  2C5W B;  2JKR I;  3O86 A;  5F1F A;  5GHY A;  2QWS A;  2ZM2 A;  4OQH A;  4OPY A;  1D1J A;  3N7W A;  1K6S A;  3Q81 A;  1O07 A;  2EX9 A;  1GA9 A;  3NIA A;  3GTC A;  3A3E A;  3H9W A;  3T4J A;  3LYX A;  3UDI A;  4Y2F A;  4EU0 A;  4U0X A;  4A5R A;  4X69 A;  1ES3 A;  2EWV A;  1SDE A; 
#chains in the Genus database with same CATH homology
 3VE3 A;  1OTI A;  2FZ0 A;  4OOM A;  1LSW A;  2EWW A;  2P04 A;  1GSW A;  5A8B A;  2A24 A;  3LR3 A;  3UE3 A;  2W0N A;  1TS8 A;  3DBA A;  3F1O A;  1TS6 A;  4NXE A;  1S66 L;  4NXB A;  2ZOH A;  5HDS A;  3C2W A;  5HDC A;  2PR5 A;  4PKY A;  1MKM A;  3B47 A;  5FL3 A;  2XA7 S;  1S1Z A;  2JHE A;  4EXO A;  4EW7 A;  2K2N A;  2V9A A;  3IS2 B;  3D3O A;  4LPZ A;  1NLY A;  1N9O A;  2HJE A;  1TS7 A;  3A0V A;  1H3Q A;  3MQQ A;  2W1T A;  3CUE A;  2H28 A;  1OJG A;  4BBV A;  4XT2 A;  3F1N B;  1T1A A;  4UQI M;  4YOF A;  4DJ2 A;  3JVU A;  4GHI A;  4LRX C;  5DFY A;  2PD7 A;  4EEU A;  3CAX A;  1UWP X;  3EWK A;  1XJ2 A;  2VEA A;  4HQA A;  1D06 A;  3HCY A;  4Y5F A;  3U2A A;  4I3J A;  5HL6 A;  3VE4 A;  3MF0 A;  4BWI A;  1S67 L;  3EGX C;  2VV8 A;  4HY8 A;  2BAS A;  4HOI A;  3LIA A;  4LRZ E;  2M1C A;  2HGV A;  3JVV A;  5I5L A;  3CIT A;  4ZRR A;  3LIB A;  2PYR A;  2A2L A;  3K3C A;  4LLO B;  2VKS A;  1YKD A;  2QJ7 A;  4G3W A;  4DN0 A;  3BQ8 A;  3A0R A;  2HF6 A;  2ZMV A;  3KYZ A;  5DF9 A;  2O9A A;  3F1N A;  4P6Z M;  5KIZ A;  3LR5 A;  3T4S A;  4CLC B;  4EQ1 A;  2W3F A;  3UB6 A;  2B02 A;  1KOU A;  4UQI S;  4EES A;  3W2Z A;  3LIE A;  1ZTU A;  1V9Z A;  4AFI A;  3PHY A;  2QHK A;  4WN5 A;  2WKQ A;  4Z1W A;  5HD5 A;  5IU1 A;  4ME4 A;  4BBT A;  5IS1 A;  2Y8H A;  5J4E A;  2VJW A;  4HJ4 A;  2XRN A;  4BBU A;  1OT9 A;  4F3L B;  4PAU A;  5K5B A;  3BQA A;  5DJT A;  4HHD A;  3NOT C;  3FC7 A;  3VOL A;  2LB9 A;  2O99 A;  4DJ3 A;  4HH2 A;  2OWH A;  4CLC E;  3CUE C;  3IBR A;  2FH5 A;  3OLO A;  3TE8 A;  4WLA A;  2XA7 M;  4LRY C;  4WEK A;  1T1B A;  4IJG A;  3LI9 A;  2JKT I;  1N9L A;  5IT5 A;  3EEA A;  4L9F A;  4EUV A;  3BJN A;  1IFQ A;  1LL8 A;  3RFB A;  3MJQ A;  1DRM A;  5L8M A;  1ZHH B;  3KSI A;  4GCZ A;  2LB5 A;  3P7N A;  3H82 B;  3BWL A;  3LIF A;  3D72 A;  4ARZ A;  3UB9 A;  3F1P B;  4HJ3 A;  2D02 A;  2CMN A;  5KSH A;  1WA9 A;  4WL9 A;  4L9G A;  2VA0 A;  4G3K A;  4GW9 A;  3S7O A;  4UEY A;  3EQV A;  4F3L A;  2W1R A;  4R70 A;  1BYW A;  1XJ6 A;  5G4Y A;  3FG8 A;  4EET B;  1DP8 A;  4WUJ A;  1LSV A;  2W3G A;  5AVE A;  4I38 A;  3P01 A;  2JKR M;  3BW6 A;  3B33 A;  4YNR A;  3C30 A;  4ETZ A;  3TRC A;  4I3I A;  5HDD A;  4H6J A;  2K31 A;  5DKL A;  2GX5 A;  2O9B A;  4R6L A;  4KQD A;  2J3T C;  3OC2 A;  2NUT C;  3ULF A;  3H82 A;  1TS0 A;  2PR6 A;  1STZ A;  2Y79 A;  4NXG A;  3E4Q A;  2VV6 A;  3F1P A;  3E4O A;  3LID A;  2I9V A;  3C8C A;  1GSV A;  4GS9 B;  2VLG A;  1OTA A;  2GJ3 A;  4Q0J A;  1MZU A;  2QJ5 A;  4NXF A;  3KSF A;  3BY9 A;  1DP6 A;  1S4S A;  3UB7 A;  2M7V A;  1UGU A;  4HP9 A;  3T4O A;  5HWV A;  1OTB A;  3R7W B;  1VHM A;  1P9R A;  4MCW A;  3BY8 A;  4IUK A;  3S7N A;  2J3W A;  2PD8 A;  3R4K A;  2NUP C;  4KUO A;  2L1M A;  2W3E A;  3IS2 A;  3C38 A;  3ZQ5 A;  5F68 A;  3PBN A;  3T4T A;  3T4Q A;  2O9C A;  3LR0 A;  3LI8 A;  3UME A;  4OOL A;  2KX6 A;  1YAX A;  4I5S A;  1OPX A;  2P7J A;  4GS9 A;  1XJ4 A;  5DKK A;  1T18 A;  2KOI A;  4JGQ A;  4O0P A;  2W3D A;  3PBT A;  5TBM B;  1F9I A;  2J80 A;  4NKP A;  1G28 A;  4ETX A;  1H8M A;  2J3T D;  2YKF A;  3E98 A;  4HI4 A;  5LBR A;  1P9W A;  2WKP A;  4JGR A;  5AJG A;  3ZYT A;  2VGL S;  3MR0 A;  1ODV A;  4QPR A;  4WF0 A;  4L0L A;  3PXP A;  3T50 A;  3PBQ A;  2W3H A;  3EQU A;  2KLI A;  3GEC A;  5HSQ A;  3H7W B;  1D7E A;  1OTE A;  3RTY A;  1S4R A;  2PDR A;  3T4L A;  4YWZ A;  2OAP 1;  3V67 A;  4HNB A;  5DFX A;  1P97 A;  2L4R A;  3HJK A;  4JGP A;  1DP9 A;  3UMD A;  3KSH A;  3VV4 A;  4CLC A;  4MN6 A;  1NWZ A;  3EEH A;  4IHQ A;  5J7E A;  4Y3I A;  5TBM A;  3EGD C;  4B9O A;  4K08 A;  2V1A A;  2Z6D A;  4BJP A;  4CQH A;  1NRJ A;  3PBS A;  1F98 A;  3A0S A;  3KYQ A;  2A24 B;  1W63 Q;  1XFN A;  1LT0 A;  3ICY A;  2ZBB A;  4IUH A;  5F5Y A;  2M7U A;  2K7S A;  3S7Q A;  4Q0I A;  3PR6 A;  3MXQ A;  4HJ6 A;  3KSG A;  4KUK A;  1NLZ A;  3S7P A;  4R3A A;  3KO6 A;  3FPV A;  5CX7 A;  1V9Y A;  2HV1 A;  2WKR A;  1F5M A;  2W1T B;  4DMZ A;  1XFQ A;  1N9N A;  5HZH A;  1OT6 A;  2XSS A;  4MDZ A;  4GHI B;  3O5Y A;  3MMH A;  4G3V A;  5G4Z A;  2HJ9 C;  2JKT M;  2ZOI A;  3K2N A;  3RH8 B;  1W63 M;  4GLQ A;  3T4K A;  3OBF A;  2V0U A;  1OTD A;  5J3W A;  1MC0 A;  2QKP A;  4MMN A;  5HWW A;  2MJ6 A;  4HH3 A;  3K3D A;  1Y28 A;  1JNU A;  4PKY G;  4JGO A;  3OCL A;  4M4X A;  1UWN X;  2VGL M;  1X0O A;  3IBJ A;  4WEJ A;  3LIC A;  4II7 A;  3OOV A;  4R38 A;  2W27 A;  1VB6 A;  4KQO A;  4CLC C;  5HPI A;  2JN7 A;  2Z6C A;  1EW0 A;  4HP4 A;  1XJ3 A;  2QYB A;  3EOI A;  2OWJ A;  2O0Y A;  2V1B A;  5F6A A;  1YSP A;  3KX0 X;  3MQ0 A;  2YKH A;  2OOL A;  2VV7 A;  3G6O A;  4RQ9 A;  2EA9 A;  3PBO A;  4E04 A;  5HD3 A;  5DJU A;  2G7U A;  5HPF A;  4Q0H A;  4FSF A;  4I39 A;  2VZW A;  2PYP A;  3LR4 A;  4HIA A;  3TW8 A;  2VX8 A;  4EER A;  4MN5 A;  3E4P A;  5AVF A;  4WEL A;  3R7W A;  2XRO A;  1LSX A;  3TJZ C;  4I3A A;  1S1Y A;  3MFX A;  2DMW A;  2R78 A;  4L9E A;  1G6O A;  3PYP A;  2ZMF A;  3E0Y A;  3NOU C;  2L0W A;  4FOF A;  1TF1 A;  2IA2 A;  2D01 A;  3GDI A;  3FPW A;  3LFV A;  5HWT A;  3CWF A;  1TD5 A;  2GNX A;  3SW1 A;  4ARZ B;  1GSX A;  5TJJ A;  3B42 A;  2GZA A;  4MN7 A;  3CI6 A;  2B18 A;  4O8G A;  4CLC D;  1IOU A;  3HJI A;  2JKR I;  3PBR A;  5EFW A;  3NJA A;  4BMW A;  2QWS A;  3F1O B;  2PHY A;  5C5K A;  4NEE D;  4EEP A;  5MC7 A;  4H6J B;  1YSQ A;  2PT7 A;  4O01 A;  3OCN A;  1P0Z A;  3H7W A;  1OJ5 A;  1T19 A;  2V0W A;  3H9W A;  4B93 A;  4PHT A;  2OAQ 1;  4P6Z S;  3LUQ A;  3NHQ A;  4GJ4 A;  1T1C A;  3CLO A;  3T4J A;  2INW A;  3MQO A;  3LYX A;  2P08 A;  2KDK A;  4Y2F A;  5F69 A;  4EU0 A;  3NOP C;  3UB8 A;  3UE6 A;  4XT2 B;  2EWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...