1OTEA

E46q mutant of photoactive yellow protein, p65 at 110k
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
b'VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords photoactive yellow protein, PYP
molecule tags Signaling protein
source organism Halorhodospira halophila
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
total genus 33
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1oteA00
4KUKA 5I5LA 2QWSA 1UWNX 1Y28A 3VE3A 1OTIA 5DJUA 3LIBA 5HDSA 5TBMA 2V0UA 3IBRA 3H82B 2VV8A 3BWLA 2QHKA 4EXOA 2WKQA 4WF0A 2L4RA 1OT6A 3CAXA 4PKYA 5F69A 4I38A 4GW9A 1OTEA 2OOLA 2H28A 1P97A 1XFNA 3EEHA 1V9ZA 1LL8A 3UMEA 2D02A 4I3IA 1TS6A 1ODVA 3H7WA 3MFXA 5TBMB 1G28A 3LI8A 3UB7A 4WUJA 2EA9A 3C8CA 4LLOB 1LT0A 4B9OA 3H7WB 2PR6A 4I3AA 4NXGA 5HWTA 4EEPA 4NXEA 3C2WA 1GSVA 2V1BA 2VLGA 3GECA 2VV6A 1T18A 4JGRA 4H6JB 1TS7A 4XT2B 1T1CA 3EWKA 3NOPC 3BY9A 2K7SA 4LPZA 1UWPX 2VV7A 4BBTA 5G4ZA 1F9IA 3E4OA 4DJ3A 4GHIB 1S4SA 1XJ3A 4R70A 4R3AA 1LSXA 5A8BA 3SW1A 2KDKA 3FC7A 4I5SA 3VOLA 3A0VA 4KQDA 1DP8A 3MQOA 2VEAA 4WN5A 5DKKA 3MJQA 3ZQ5A 4KUOA 5F68A 2Z6DA 3MXQA 3NHQA 3IS2A 4MN5A 4XT2A 2V0WA 1XJ4A 2L1MA 3NOUC 3RTYA 1P0ZA 2OWJA 4HP9A 5J7EA 4WLAA 1T1AA 3F1OA 4GHIA 4HJ4A 3F1NB 1S67L 5IS1A 4PKYG 1OJ5A 1UGUA 2PYRA 2V9AA 4WL9A 5J4EA 1VB6A 2JN7A 3IS2B 1X0OA 4HY8A 3LI9A 3F1PA 3UMDA 1S1ZA 1OJGA 1XJ2A 1XJ6A 3LUQA 1XFQA 4MN6A 3LICA 1OTDA 3KX0X 4L9FA 2W0NA 3MR0A 1DP6A 2ZBBA 4LRXC 5KIZA 4LRZE 2CMNA 2V1AA 2PYPA 3UB9A 3A0RA 5HZHA 1S4RA 2B02A 3NJAA 1DRMA 4R6LA 1T19A 3E4QA 3ULFA 3LIAA 3H82A 4GS9A 1GSWA 1MZUA 2WKPA 2ZOHA 5AVEA 1TS0A 4E04A 2YKFA 4EETB 5HDDA 3UB6A 2PD7A 2PR5A 1D7EA 2ZOIA 5HDCA 4HQAA 1KOUA 1V9YA 2P7JA 4EESA 3T50A 1JNUA 3A0SA 1OTBA 3D72A 3F1PB 3BY8A 1T1BA 4I39A 2JHEA 5IU1A 4GS9B 2INWA 1D06A 3CLOA 4HJ3A 3UB8A 2D01A 3H9WA 3LIFA 4BBUA 5HWWA 2KX6A 1DP9A 1WA9A 1OTAA 3F1NA 3LYXA 3P7NA 5DJTA 3F1OB 4YWZA 2GJ3A 1F98A 3LIEA 5HD5A 4F3LA 4HH2A 4BBVA 1S1YA 4EW7A 1TS8A 2PD8A 4K08A 3K3CA 4F3LB 2Z6CA 4NXBA 5DKLA 2PDRA 5F5YA 5HD3A 2W27A 4HIAA 3FG8A 3MQQA 3NOTC 4HH3A 3ICYA 1LSWA 2I9VA 1GSXA 3K3DA 1N9OA 3PHYA 2QJ7A 4I3JA 2A24B 2HV1A 4HOIA 4L9GA 5AVFA 2M1CA 3B33A 1N9NA 2L0WA 1N9LA 1S66L 3E4PA 4HI4A 4HNBA 4H6JA 3CWFA 2A24A 4EEUA 5EFWA 2OWHA 3LIDA 3UE6A 2WKRA 5F6AA 3G6OA 3VE4A 1BYWA 4JGPA 1OT9A 2YKHA 5J3WA 4GCZA 4HP4A 4L9EA 3RH8B 4NXFA 2QKPA 5HSQA 5G4YA 4R38A 4RQ9A 3OLOA 4DJ2A 2BASA 4EERA 3HJKA 4LRYC 1EW0A 5HWVA 4HHDA 4JGQA 4EQ1A 2QJ5A 3GDIA 4HJ6A 4JGOA 3PYPA 4M4XA 1LSVA 1NWZA 2J80A 2PHYA 2R78A 3HJIA
chains in the Genus database with same CATH superfamily
5DJUA 4LV2A 4OPZA 3IBRA 1PZPA 4G3WA 2XEPA 4GW9A 4BMWA 5DFYA 1K4FA 4IHQA 1G28A 3T1SA 1WYBA 2Y4AA 3A3EA 2EX8A 4NXGA 1YKDA 4KZ5A 4E3KA 2ZL1B 4U3TA 2XD1A 3EWKA 4GN2A 4MDZA 3HLEA 1KDWA 4HESA 2QMIA 1I2SA 4Y15A 5DKKA 3FPVA 3MZFA 3V50A 4GNUA 4PM6A 3SH9A 1XJ2A 4GKUA 1FSWA 1DP6A 3MKEA 1YLWA 3H82A 4JF4A 4DE2A 1EWZA 5CTNA 3PBTA 4MBKA 3UB8A 1ERMA 4E3OA 2J7VA 3T4SA 3MXRA 3VSKA 4EBNA 2QYBA 4UA7A 2HP9A 4XXRA 3B33A 3PTEA 5DTSA 3VP1A 3T4LA 4EEUA 5EFWA 1N4OA 4IVIA 2LB5A 1ONHA 3NI9A 4DE0A 3IXBA 4LV0A 3QNCA 4NG2A 1FILA 4DDSA 1SDNA 5DFXA 4JGOA 3V39A 3P09A 5E2FA 5TBMA 4ZRRA 2E8IA 4E6WA 1OTEA 2RL3A 1P9RA 3BRMA 3IWIA 2GX5A 2JBFA 2VGJA 4WMCA 2VLGA 1HD8A 4DXCA 3HUOA 1IYSA 1JWZA 2HDRA 4P87A 4R70A 1XJ3A 3SW1A 3VOLA 3A0VA 4WN5A 3IWQA 5L8MA 4DDYA 3WS2A 4UAAA 3ZVWA 3UDIA 3MXQA 4XT2A 4R4SA 4Y0OA 2GNXA 4WL9A 1K56D 3IS2B 2ZMVA 1K6SA 4MCWA 5FQMA 5CHMA 1H5XA 2V1AA 2PYPA 3A0RA 2XF3A 3SOIA 4GLQA 3LR4A 1WE4A 3MZDA 4E04A 4OPRA 5HDDA 1GHIA 4UQIM 3MS6A 3ZCZA 4B93A 1NY0A 3BY8A 1G68A 4NETA 2OSUA 1DP9A 5M19A 3P7NA 4MMNA 4F3LA 4OLDA 5DKLA 2V1ZA 2B95A 5F5YA 3MQQA 2HDUA 4QU3A 3R4KA 4MBFA 5K5BA 5U47A 2J9OA 4ZDXA 3CWFA 3N6IA 4S2LA 3RH8B 3OPPA 4OQHA 2P9VA 2QZ6A 3IF6C 1KE3A 3AGDA 2X01A 2VV8A 3T1RA 1NYMA 1CEGA 2C5WB 2KLIA 4ETZA 1SDEA 2EWVA 5FI7A 1Z6FA 5FSRA 4YNRA 4PHTA 3ZG9B 1FOFA 5DF8A 1P9WA 4O0PA 3RTYA 1J3WA 2GZAA 3OBFA 4OKPA 2HJ9C 4QPRA 2X02A 4O7DA 3LUQA 3MR0A 2ZQAA 1YPRA 2XFSA 3I7JA 4GOGA 4R6LA 4QWOA 4GS9A 4OONA 2XRNA 1CI8A 2K2NA 3IH9A 3E2KA 1V9YA 3LR3A 4WELA 3BQ8A 3M2KA 1L3LA 4QJGA 1LLBA 2H5SA 3JVUA 1L0DA 3C30A 2GJ3A 2JE5A 4JLFA 4BL3A 5HPIA 2JKRM 3DTIA 4ZAMA 3VP4A 1DY6A 4HH3A 1LSWA 5CECA 4G3KA 3UPPA 4GB7A 2HV1A 3M2JA 3IF5A 4OQIA 1E25A 4H6JA 4E3LA 2WKRA 5FAQA 3HVFA 4RX3A 3OLOA 2BASA 5HAIA 3Q1FA 5FASA 3BYDA 3LY4A 1AXBA 3CG5A 5I5LA 1UWNX 2J8YA 4WZ5A 3S7OA 3BWLA 1PW8A 5F69A 4MEZA 5CGSA 4Y3IA 3N7WA 1XFNA 4PPRA 1NXYA 4S2KA 4I3IA 3MFXA 5TBMB 1W63Q 4LGWA 3H7WB 2V8CA 1JWVA 2EFXA 3NY4A 5DVAA 2WGWB 4PM8A 5CHJA 4S2NA 4BBTA 1FCOA 3G4PA 1ESIA 1S0WA 3JPUA 4FUWA 4MN5A 3F1OA 3UE1A 3NECA 3D3OA 1X0OA 4YFMA 1K0KA 3CZDA 4MN6A 1OTDA 3IHAA 5GHXA 1LI9A 1VQQA 3ZNTA 1E4DA 3FYZA 1MZUA 1Z09A 1SKOA 2HGVA 3MSHA 4HQAA 2HDQA 3NCKA 5CX7A 4R23A 2INWA 3UE0A 4WEJA 1BLSA 1OTAA 4JXWA 3A3IA 2O9CA 2HJEA 3HCYA 2XQZA 4HIAA 2K31A 4GDNA 3GQZA 3WRZA 1PRQA 4I3JA 2VKSA 2VJWA 4JF5A 5FDSA 4X55A 4O01A 3UDXA 4O8GA 5J3WA 4L9EA 5HSQA 5G4YA 1TVFA 2ZC5B 4BD0A 4JGQA 1FCNA 4ID4A 4EBLA 4BQMA 2R9XA 2ZQ7A 1K4EA 1Y54A 3BJNA 5M1AA 2PBDP 4OP5A 2IWCA 1KGEA 3NDEA 4OLGA 2G2WA 1YMXA 5EOEA 2M7VA 1MWSA 3WS1A 2Q9NA 1W8QA 2ZQ9A 3LEQA 3VSLA 5CERA 1T1CA 1YLPA 2K7SA 3IXHA 2VV7A 2R9WA 1GA9A 3C38A 1XJ4A 2W3FA 1S67L 1FSYA 2V9AA 1CQAA 3HUNA 5EOOA 5HFOA 4S2IA 2ZBBA 4Y7PA 3TOIA 2CMNA 3UY6A 4BJPA 2WADA 1YMSA 3FZCA 1D7EA 2O99A 2FFYA 3A0SA 2Y2LA 3ZG8B 2W3DA 3KYEA 4Y2FA 5EVEA 4Y17A 5HWWA 4CLCA 4UEYA 4BBVA 2XGNA 2PD8A 3OC2A 2EX9A 2PDRA 3MF0A 2ZJ9A 3DWKA 3G2ZA 1E3UD 3LR0A 3PHYA 3B3XA 5GLAA 2A24B 4B4ZA 3LCEA 3NIAA 1PWCA 2X71A 5AJGA 4R38A 3R7WA 3G32A 2JKGA 5CEDA 3TE8A 2Y2NA 4OOMA 3G2YA 5JYPA 2FZ0A 4DMZA 1K55C 2ZC7A 3Q7VB 5TR7A 3KO6A 1L2SA 4CLCC 1GHPA 5A92A 4N9KA 1TS6A 2H0YA 4QHCA 1M40A 1VETB 3DTMA 4IUHA 2ZQ8A 4WMCD 5HW3A 2Y2OA 3V67A 4R3AA 3LY3A 1BLPA 2VEAA 4FSFA 4ZJ3A 4N1HA 5AQ9A 2L1MA 3A3JA 3NOUC 1TD5A 1O7EA 4KZ7A 4HY8A 4IVKA 3GV9A 3TG9A 4LRZE 1O07A 4PAUA 3T1XA 4DRTA 4ETXA 4OQ0A 4QB8A 3G35A 4L0LA 4G3VA 1SKOB 4UQIS 1XPBA 5HARA 3F1PB 3BW6A 5IU1A 3PBOA 4WBGA 3F1OB 1F98A 4HH2A 2ZC4B 2Y2IA 1GCEA 2PAVP 2GDNA 3S7NA 1KVLA 3NULA 3OOVA 2XA7M 4II7A 4IUKA 4S2NC 4HI4A 5A91A 2ZL1A 5F6AA 4PMAA 3CUEC 2ZMAA 4JF6A 1EW0A 1NLZA 5E2HA 3H7WA 2Y2PA 3D4FA 2C6WB 5HDSA 3WS0A 2L4RA 3T4TA 2Z2MB 2OV5A 1M6KA 4KQQA 1NZOA 4HEFA 3RFBA 4EBPA 5TFQA 3HLBA 4EUZA 4EUVA 4H6JB 3NOPC 2DCFA 1OMEA 2J9PA 3BLSA 1F9IA 1SZVA 3E98A 3PBRA 3FKWA 1CK3A 4LV1A 5J7EA 3F1NB 1OJ5A 4LENA 4OPYA 1IYPA 1VB6A 5JYOA 1KVMA 1G6OA 1OJGA 4X6TA 1LL9A 2DNSA 4WZ4A 2Y2KA 3BLMA 1KDSA 4PM7A 4RVAA 3IH8A 3CJMA 1EI5A 3IF6A 2M7UA 4OOYA 1BSGA 1YQSA 2P7JA 3T50A 1JNUA 5FI6A 1KE0A 1W7FA 3EQVA 1ALQA 1SKFA 4N9LA 3LIFA 1XA1A 4OVDA 3CUEA 1S1YA 3BFDA 4X69A 1TS8A 2JKTI 3E2LA 2Z6CA 1VEUA 1KE4A 2Y55A 3TSGA 4YOFA 4YINA 1N9LA 3ZVTA 1D1JA 1MWRA 5FATA 3O5YA 3O86A 1BUEA 2XFTA 3BM6A 3GDIA 4HJ6A 2PHYA 4IBRA 2PRFA 4X1LA 3HBRA 2WUQA 2QHKA 1TDLA 1K6RA 4LCMA 3SH7A 3Q7VA 2Y2GA 2D02A 1PYYA 1W5DA 3T4JA 1W8YA 1ONGA 1HTZA 1VHMA 2WZZA 5FQIA 1KGGA 3ISGA 2ZM8A 3WWXA 4FTXA 2WZXA 2O9BA 4DJ3A 4EWFA 4ARZB 2H10A 1GHMA 1IEMA 3GVBA 4P6ZS 1F5MA 2PBYA 1SHVA 1HZOA 4PKYG 1UGUA 1K25A 3KX0X 2EX2A 1RGYA 1DRMA 5KMWA 3E4QA 2AVXA 3Q7ZA 1K54A 3FKVA 1YM1A 3DW0A 3HL9A 2PU4A 1T1BA 4S2PA 1D06A 4K0XA 1EROA 1GA0A 5EVIA 3BQAA 3WS4A 5FI2A 3S7PA 4BLMA 1K57C 3Q07A 3NDGA 3LFVA 5GHYA 4FCFA 2OAQ1 2E8JA 5EVLA 3E4PA 4ESPA 2G7UA 3LIDA 4Y0TA 4RA7A 2W1RA 3DBAA 2O0YA 3ZGAB 5AQ7A 3MKFA 5FL3A 5F1FA 3T12B 2VK3A 2QWSA 2NUPC 1L0EA 3NBLA 5GLDA 1ZG4A 2H28A 5EE8A 2FFFB 1LL8A 3CHWP 3UMEA 4LV3A 1ODVA 3LI8A 2BLSA 4EEPA 4I3AA 3C2WA 1VM1A 1ES5A 3ZG7B 4JKTA 4JGRA 1MC0A 3MMHA 2A3UA 5E2GA 1RP5A 1PNEA 5EM1A 1ZTUA 4BENA 4Z9QA 1TF1A 5CRFA 4S2MA 4BD1A 4DE3A 3CMZA 3IQAA 1P0ZA 4WLAA 5F83A 5FDHA 2WK0A 3KSIA 3FWLA 3LI9A 3F1PA 3C7VA 3T4QA 2Y2MA 2HPBA 3LICA 2O9AA 1QMEA 5KIZA 3GR2A 4WM9A 3OCNA 2J3WA 2EXAA 3CPTB 3QP2A 1K38A 2ZOHA 2ACGA 1TS0A 3CPTA 3AGFA 3JYIA 5CTMA 3VP3A 2ZQCA 3L9KA 3CLOA 3BFFA 2BG1A 1XA7A 3P01A 5CGWA 2EXBA 3IHBA 4IBXA 2P9VB 3OPRA 1QMFA 3CITA 3EGDC 4NXBA 1TDGA 5DF9A 3GRJA 2W27A 1I5QA 5AQBA 3O87A 1LI0A 3K3DA 3BFEA 2M1CA 1S66L 5KSCA 1YLJA 4FH4A 2V8FA 3VE4A 4A5RA 4CPKA 4HP4A 4DKIA 3KSGA 4GZBA 1Y4OA 4F3LB 1Q2PA 1IKIA 1OTIA 2V0UA 3DTKA 2XH9A 4WYYA 3U2AA 4PKYA 1ES2A 4I38A 1V9ZA 4X53A 5CEBA 3T4KA 1K56A 4KZ6A 1XGIA 1ZC2A 5E2EA 3GSGA 3ITAA 4LLOB 1LT0A 4UA9A 2XROA 5TGFA 3M6BA 4CQHA 3E4OA 1ZHHB 3MFDA 1DP8A 3VOZA 4LFUA 3MJQA 3ZQ5A 2FH5A 3QHYA 4HP9A 1C3BA 1MWUA 5AQAA 4CLCB 3A3FA 4WZ5C 3DTEA 3ZNYA 2W0NA 4P6BA 3E0YA 2MJ6A 5HZHA 1H8YA 2XLNA 2ZM0A 2PD7A 4P85A 1JTDA 1MKIA 2JKTM 2NUTC 3FV7A 5EECA 2VGLS 4FD8A 3LIEA 4ZJ2A 5E43A 1DJBA 3FG8A 2QJ7A 4HOIA 3OCLA 2L0WA 3KSFA 4KENB 4C75A 1H0MA 4ME4A 2OWHA 1YSQA 3EOIA 2W1TA 4JXSA 3UPOA 3ZDJA 4NXFA 1RGZA 4DJ2A 5A90A 2DRWA 3KYQA 3PXPA 4KG2A 4ZTKA 4Q0HA 4PM9A 5EVID 3LGOA 1JVJA 3DWZA 1Y28A 1VEUB 1G6AA 2PU2A 4PM5A 3BEBA 3MBZA 5BOHA 3BECA 4R4RA 2A49A 1TS7A 3U4LP 3ZFZA 4GHIB 1PI5A 1F2KA 3VP2A 3TRCA 1WYCA 2Z6DA 3IX8A 5GHZA 3LR5A 3EEAA 4QY6A 2Y79A 3T4OA 4K91A 1XJ6A 2B5RA 1PIOA 3C5AA 2WGWA 3G31A 4HBUA 1S4RA 3VV4A 4GDBA 5L09A 2ZC6B 4B4XA 1PWDA 3A3DA 3S1YA 2LB9A 1XKZA 1OTBA 5FQ9A 3VFFA 1HVBA 4I39A 3SS5A 1W63M 1IOUA 2WKEA 4YWZA 1E3UA 4KQRA 5HD3A 3ICYA 2OAP1 4KQOA 4JBFA 3L7HA 4Y0UA 1ZKJA 4HNBA 2A24A 3JVVA 2WYXA 1BYWA 3ITBA 1OT9A 4KG5A 3GMWA 2QKPA 4R3BA 4EERA 2ZMFA 1IELA 3PR6A 1ZG6A 5GLBA 4RX2A 5EVIB 2J80A 4JXVA 3G30A 3OPLA 3LEZA 1MY8A 4U0XA 2W3HA 4X25A 1OT6A 3CAXA 2XA7S 2XSSA 1PFLA 4H8RA 2VGKA 3UB7A 3IX3A 4B9OA 5HWTA 4ZBEA 4NXEA 1NLYA 1KGFA 2V1BA 4XT2B 1MPLA 5KZHA 2UV0E 1L0FA 5A8BA 2KDKA 4I5SA 5HL1A 4KQDA 4M3KA 3NHQA 3SZTA 3BFCA 1YLZA 4MNRA 1YSPA 5TJJA 3HLGA 1YLYA 2ZC3B 2PT7A 1XFQA 3B47A 3T1QB 2OLVA 3ZG5A 3IXGA 1K55A 3CI6A 3IBJA 2B02A 5FQQA 3ULFA 5AVEA 2WKPA 4OQGA 3QP8A 1FR6A 3LO7A 2PR5A 1Q2QA 3P98A 1KOUA 3QNBA 2JHEA 1BZAA 4HJ3A 4BBUA 4MN7A 3UPNA 1WA9A 4S2OA 5HD5A 3UN7A 3GTCA 1IYOA 4K08A 4CJNA 2Y91A 5D3OA 3NOTC 2HP5A 2W1TB 4D60A 2KOIA 4E6XA 1N9NA 3RXWA 5EM0A 3C4OA 4GCZA 5CHUA 1G5UA 5CGXA 4RQ9A 4LRYC 4HBTA 1LSVA 1BULA 4KZ8A 4KUKA 3C4PA 3HLDA 3VE3A 3LIBA 2XR0A 3H82B 4WF0A 4OH0A 4D2OA 3IF6B 1FQGA 1XP4A 3PBSA 5HAPA 3UDFA 3C8CA 3ZHHA 1IKGA 1ES3A 1FIKA 3QP1A 4LPZA 2Z2LB 3C7UA 2Q0OA 4GJ4A 1MBLA 1LSXA 3ZG0A 3SS4A 1J9MA 1DJCA 1BT5A 2HP6A 2XDMA 5F68A 1ERQA 2Y59A 2VA0A 3IS2A 3N8LA 2OWJA 2OLUA 4U0TA 4NKPA 1YLTA 4HJ4A 2IWDA 1L0GA 4CLCD 5IS1A 5HX9A 3RXXA 1AWIA 3D9YA 4KZBA 4L9FA 3UB9A 4S2JA 5L07A 4RYEA 1N9BA 4EU0A 2YKFA 4DXBA 4LCLA 3UB6A 2VX8A 5GLCA 4EESA 1MWTA 3D72A 4KZ9A 5F1GA 3FPWA 1PW1A 4MBHA 3Q81A 5DJTA 2WAEA 4UA6A 3K2NA 4EW7A 3RJUA 3K3CA 3PAGA 3QP5A 2WGVA 2I9VA 5C5KA 1STZA 3VP0A 2JKRI 5A93A 1U60A 5MC7A 4C6YA 4JGPA 4K0WA 4EQ1A 2W3GA 3QP6A 5F82A 1K54C 3V5MA 1MKMA 2R78A 2ZD8A 5FA7A 3VFHA 1CF0A 5EPHA 4E3JA 3IX4A 3O3VA 3EGXC 5FAPA 4Q0JA 4AFIA 1TEMA 5EVIC 4WUJA 1NRFA 3V3RA 2PR6A 1GSVA 5I94A 1H8MA 1T18A 1LL5A 1UWPX 5FEFA 3WS5A 2HF6A 4ZJ1A 1PZOA 3FC7A 5IT5A 5EUAA 1I2WA 3MQOA 4GD6A 4MLLA 2EFUA 2JCHA 3KYZA 2RCXA 4E3MA 1JWPA 4GHIA 1A0KA 4KZ3A 4F94A 3O88A 1MXOA 4JPMA 5J4EA 4E3IA 2P04A 2ZQDA 1ESUA 4N1XA 4WEKA 3MZEA 4LRXC 1CEFA 1VETA 4KG6A 4Y13A 2WKHA 3NJAA 2DMWA 1GSWA 4EETB 1PI4A 4X56A 3W4PA 2Y8HA 4DF6A 2VGLM 5FAOA 1CI9A 2KX6A 3LYXA 3W4QA 3AGEA 3PAEA 1DJAA 1JTGA 3G34A 5L10A 2I72A 5DF7A 2Q9MA 2WAFA 2EX6A 3G6OA 4BWIA 5DTTA 3HLWA 4Y5FA 1BLCA 5HWVA 1XGJA 3W4OA 3W8KA 3S4XA 3PYPA 4R0QA 1NWZA 4N92A 4IEDA 5HAQA 3SS3A 1YT4A 2Y2HA 2XD5A 1BLHA 2Y2QA 1P97A 2Y2JA 4KZAA 1NRJA 4R1GA 2EA9A 3UE3A 4OPQA 1NJ4A 2VV6A 3IWOA 5HL6A 3BY9A 3PBNA 2J3TC 4FOFA 3B42A 3OZHA 4Z1WA 4KUOA 2JC7A 2EWWA 2V0WA 4XUXA 1T1AA 4EV4A 3S7QA 5FQJA 2IA2A 3UMDA 3EQUA 2WGIA 1BTLA 2ZM2A 2B18A 3UNWA 4FH2A 1T19A 2HDSA 4CLCE 3W2ZA 3SH8A 4Q8IA 2ZOIA 2G2UA 3OPHA 4DN0A 3N4IA 2HZ5A 4GS9B 2D01A 1S6RA 5HPFA 2V20A 5DTKA 4GD8A 4KZ4A 1FCMA 1XXMA 4ARZA 4BL2A 1GSXA 2VZWA 2BTFP 4X1MA 5CXWA 3VOYA 2JKFA 2V2FF 2A2LA 4Q0IA 5EV0A 1RCJA 3MQ0A 3VMAA 1K57A 4OOLA 3HREA 3HJKA 1NZUA 1XX2A 1H8ZA 1FR1A 3QP4A 4UHUA 3IXDA 1IYQA 1W79A 3BFGA 4EXOA 2UWXA 2WKQA 4QY5A 2P74A 4P6ZM 3IT9A 1HLUP 5L2FA 2OOLA 3HUMA 2H0TA 3EEHA 5M18A 2QPNA 5GL9A 3GECA 1SCWA 5IHVA 2WKIA 3R7WB 3TJZC 2XK1A 5G4ZA 4JXGA 4XUZA 1S4SA 2W3EA 1YAXA 3HLCA 3N8RA 3N8SA 4EQIA 5LBRA 3WRTA 5G18A 1ACFA 5KSHA 3Q82A 2PYRA 3KSHA 2JN7A 3S22A 3MXSA 3ZYTA 3DAVA 4NK3A 1CJFA 1S1ZA 4P0MA 1PWGA 1NYYA 3UO9A 4OP8A 2CC1A 1OPXA 3LIAA 3UB5P 4C3QA 4X68A 5HDCA 3PBQA 4E3NA 3H9WA 1IFQA 3F1NA 5FQKA 4R3JA 2J3TD 2ZLYA 1H3QA 4IJGA 3HLFA 5FEGA 1N9OA 4L9GA 4QD4A 5AVFA 4DE1A 3UE6A 2P08A 2YKHA 5J8XA 3TW8A 2IWBA 3M6HA 1ES4A 4HHDA 2QJ5A 3V3SA 4M4XA 4B88A 4NEED 1LHYA 3HJIA 3NC8A
chains in the Genus database with same CATH topology
4KUKA 2QWSA 2NUPC 3VE3A 5DJUA 3LIBA 3IBRA 3H82B 4WF0A 4G3WA 3BJNA 4GW9A 4BMWA 2H28A 5DFYA 1LL8A 3UMEA 3PBSA 1ODVA 4IHQA 1G28A 3LI8A 2M7VA 3C8CA 4NXGA 4I3AA 4EEPA 1YKDA 3C2WA 4JGRA 1MC0A 1T1CA 3EWKA 3MMHA 4MDZA 2K7SA 4LPZA 1ZTUA 2VV7A 4GJ4A 1LSXA 1TF1A 5DKKA 3C38A 5F68A 2VA0A 3IS2A 3FPVA 1XJ4A 2W3FA 1P0ZA 2OWJA 4NKPA 4WLAA 4HJ4A 4CLCD 1S67L 5IS1A 2V9AA 3KSIA 3LI9A 3F1PA 3T4QA 1XJ2A 3LICA 2O9AA 4L9FA 5KIZA 1DP6A 2ZBBA 2CMNA 3UB9A 4BJPA 3OCNA 2J3WA 4EU0A 3H82A 2ZOHA 1TS0A 2YKFA 3UB6A 1D7EA 2VX8A 2O99A 4EESA 3PBTA 3A0SA 3D72A 2W3DA 3FPWA 4Y2FA 3UB8A 3CLOA 5HWWA 4CLCA 4UEYA 3P01A 5DJTA 3T4SA 4BBVA 3K2NA 4EW7A 3CITA 2PD8A 3EGDC 3K3CA 3OC2A 4NXBA 2PDRA 3MF0A 5DF9A 2W27A 2QYBA 2I9VA 5C5KA 3K3DA 3LR0A 3PHYA 1STZA 2A24B 2M1CA 3B33A 1S66L 2JKRI 3T4LA 5MC7A 4EEUA 5EFWA 5AJGA 3VE4A 4JGPA 2LB5A 4HP4A 4R38A 3R7WA 4EQ1A 3KSGA 3TE8A 2W3GA 5DFXA 4JGOA 4OOMA 4F3LB 2R78A 1MKMA 1OTIA 5TBMA 4ZRRA 2V0UA 2FZ0A 4DMZA 3EGXC 3U2AA 3KO6A 4PKYA 4I38A 4Q0JA 4AFIA 1OTEA 4CLCC 1V9ZA 3T4KA 1P9RA 1TS6A 2GX5A 4WUJA 4LLOB 1LT0A 2PR6A 1GSVA 2VLGA 1H8MA 1T18A 2XROA 4IUHA 1UWPX 4CQHA 3E4OA 2HF6A 4R70A 1XJ3A 3V67A 4R3AA 3SW1A 1ZHHB 3FC7A 3VOLA 5IT5A 3A0VA 4WN5A 1DP8A 3MQOA 2VEAA 5L8MA 4FSFA 3MJQA 3ZQ5A 2FH5A 3MXQA 4XT2A 2L1MA 3NOUC 3KYZA 4HP9A 4GHIA 2GNXA 1TD5A 4CLCB 4WL9A 5J4EA 2P04A 3IS2B 2ZMVA 4HY8A 4MCWA 4WEKA 2W0NA 4LRXC 4LRZE 2V1AA 2MJ6A 2PYPA 3A0RA 3E0YA 4PAUA 5HZHA 3NJAA 4GLQA 3LR4A 4ETXA 2DMWA 1GSWA 4EETB 4E04A 5HDDA 4UQIM 2PD7A 4L0LA 4G3VA 2Y8HA 4UQIS 2JKTM 4B93A 2NUTC 2VGLM 3BY8A 3F1PB 3BW6A 5IU1A 2VGLS 3PBOA 2KX6A 1DP9A 3LYXA 3P7NA 4MMNA 3F1OB 1F98A 3LIEA 4F3LA 4HH2A 5DKLA 5F5YA 3FG8A 3MQQA 3S7NA 3OOVA 2QJ7A 2XA7M 4HOIA 4II7A 4IUKA 3R4KA 5K5BA 3OCLA 2L0WA 4HI4A 3KSFA 3CWFA 4ME4A 2OWHA 1YSQA 3EOIA 2W1TA 3G6OA 5F6AA 3CUEC 3RH8B 4NXFA 4BWIA 4DJ2A 4Y5FA 1EW0A 3KYQA 5HWVA 3PXPA 4Q0HA 1NLZA 3PYPA 1NWZA 3H7WA 1Y28A 5HDSA 2VV8A 2L4RA 3T4TA 2KLIA 4ETZA 1P97A 1NRJA 3RFBA 2EA9A 3UE3A 2EWVA 2VV6A 5HL6A 4H6JB 1TS7A 4EUVA 3NOPC 3BY9A 4YNRA 4PHTA 3PBNA 2J3TC 4FOFA 3B42A 1F9IA 4GHIB 4Z1WA 3TRCA 4KUOA 3E98A 3PBRA 2Z6DA 2EWWA 1P9WA 4O0PA 2V0WA 3RTYA 2GZAA 3OBFA 4QPRA 2HJ9C 5J7EA 1T1AA 3F1NB 3LR5A 3EEAA 3S7QA 1OJ5A 2Y79A 1VB6A 3T4OA 2IA2A 3UMDA 1XJ6A 1G6OA 1OJGA 3LUQA 3EQUA 3MR0A 1S4RA 2B18A 4R6LA 3VV4A 1T19A 4GS9A 2XRNA 4CLCE 2M7UA 3W2ZA 2K2NA 2ZOIA 4WELA 1V9YA 2P7JA 3LR3A 4DN0A 3T50A 1JNUA 2LB9A 1OTBA 3BQ8A 4I39A 3EQVA 1W63M 4GS9B 2D01A 3JVUA 3LIFA 1IOUA 3C30A 4YWZA 5HPFA 2GJ3A 3CUEA 1S1YA 5HPIA 1TS8A 2JKTI 2JKRM 2Z6CA 5HD3A 4HH3A 3ICYA 2OAP1 1LSWA 4ARZA 4G3KA 1GSXA 4KQOA 2VZWA 2HV1A 4YOFA 4HNBA 1N9LA 4H6JA 2A24A 3JVVA 2A2LA 4Q0IA 2WKRA 1BYWA 1OT9A 3O5YA 3MQ0A 2QKPA 4OOLA 4EERA 2ZMFA 3OLOA 2BASA 3HJKA 3PR6A 3GDIA 4HJ6A 2J80A 2PHYA 5I5LA 1UWNX 2W3HA 3S7OA 3BWLA 2QHKA 4EXOA 2WKQA 4P6ZM 1OT6A 3CAXA 2XA7S 2XSSA 5F69A 2OOLA 4Y3IA 1XFNA 3EEHA 2D02A 4I3IA 3MFXA 5TBMB 3UB7A 1W63Q 4B9OA 3H7WB 5HWTA 3T4JA 4NXEA 1NLYA 2V1BA 1VHMA 3GECA 4XT2B 3R7WB 3TJZC 4BBTA 5G4ZA 2O9BA 4DJ3A 1S4SA 2W3EA 4ARZB 5A8BA 2KDKA 1YAXA 4I5SA 4KQDA 5LBRA 4P6ZS 3NHQA 4MN5A 1F5MA 3F1OA 5KSHA 4PKYG 2PYRA 1UGUA 1YSPA 5TJJA 3D3OA 3KSHA 2JN7A 3ZYTA 2PT7A 1X0OA 1S1ZA 4MN6A 1XFQA 3B47A 1OTDA 3KX0X 3IBJA 3CI6A 2B02A 1DRMA 1OPXA 3E4QA 3ULFA 3LIAA 1MZUA 2WKPA 5AVEA 2HGVA 2PR5A 5HDCA 3PBQA 4HQAA 1KOUA 1T1BA 5CX7A 2JHEA 2INWA 1D06A 4HJ3A 4BBUA 3H9WA 4MN7A 4WEJA 1IFQA 1WA9A 1OTAA 3F1NA 3BQAA 5HD5A 3S7PA 2O9CA 4K08A 2J3TD 2HJEA 1H3QA 3HCYA 4IJGA 4HIAA 2K31A 3NOTC 3LFVA 4I3JA 1N9OA 2VKSA 2W1TB 2OAQ1 2KOIA 4L9GA 2VJWA 5AVFA 1N9NA 3E4PA 2G7UA 3LIDA 3UE6A 4O01A 4O8GA 2P08A 2YKHA 4GCZA 5J3WA 4L9EA 5HSQA 5G4YA 3TW8A 4RQ9A 2W1RA 3DBAA 4LRYC 4HHDA 4JGQA 2O0YA 2QJ5A 4M4XA 5FL3A 1LSVA 4NEED 3HJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUK A;  5I5L A;  2QWS A;  1UWN X;  1Y28 A;  3VE3 A;  1OTI A;  5DJU A;  3LIB A;  5HDS A;  5TBM A;  2V0U A;  3IBR A;  3H82 B;  2VV8 A;  3BWL A;  2QHK A;  4EXO A;  2WKQ A;  4WF0 A;  2L4R A;  1OT6 A;  3CAX A;  4PKY A;  5F69 A;  4I38 A;  4GW9 A;  1OTE A;  2OOL A;  2H28 A;  1P97 A;  1XFN A;  3EEH A;  1V9Z A;  1LL8 A;  3UME A;  2D02 A;  4I3I A;  1TS6 A;  1ODV A;  3H7W A;  3MFX A;  5TBM B;  1G28 A;  3LI8 A;  3UB7 A;  4WUJ A;  2EA9 A;  3C8C A;  4LLO B;  1LT0 A;  4B9O A;  3H7W B;  2PR6 A;  4I3A A;  4NXG A;  5HWT A;  4EEP A;  4NXE A;  3C2W A;  1GSV A;  2V1B A;  2VLG A;  3GEC A;  2VV6 A;  1T18 A;  4JGR A;  4H6J B;  1TS7 A;  4XT2 B;  1T1C A;  3EWK A;  3NOP C;  3BY9 A;  2K7S A;  4LPZ A;  1UWP X;  2VV7 A;  4BBT A;  5G4Z A;  1F9I A;  3E4O A;  4DJ3 A;  4GHI B;  1S4S A;  1XJ3 A;  4R70 A;  4R3A A;  1LSX A;  5A8B A;  3SW1 A;  2KDK A;  3FC7 A;  4I5S A;  3VOL A;  3A0V A;  4KQD A;  1DP8 A;  3MQO A;  2VEA A;  4WN5 A;  5DKK A;  3MJQ A;  3ZQ5 A;  4KUO A;  5F68 A;  2Z6D A;  3MXQ A;  3NHQ A;  3IS2 A;  4MN5 A;  4XT2 A;  2V0W A;  1XJ4 A;  2L1M A;  3NOU C;  3RTY A;  1P0Z A;  2OWJ A;  4HP9 A;  5J7E A;  4WLA A;  1T1A A;  3F1O A;  4GHI A;  4HJ4 A;  3F1N B;  1S67 L;  5IS1 A;  4PKY G;  1OJ5 A;  1UGU A;  2PYR A;  2V9A A;  4WL9 A;  5J4E A;  1VB6 A;  2JN7 A;  3IS2 B;  1X0O A;  4HY8 A;  3LI9 A;  3F1P A;  3UMD A;  1S1Z A;  1OJG A;  1XJ2 A;  1XJ6 A;  3LUQ A;  1XFQ A;  4MN6 A;  3LIC A;  1OTD A;  3KX0 X;  4L9F A;  2W0N A;  3MR0 A;  1DP6 A;  2ZBB A;  4LRX C;  5KIZ A;  4LRZ E;  2CMN A;  2V1A A;  2PYP A;  3UB9 A;  3A0R A;  5HZH A;  1S4R A;  2B02 A;  3NJA A;  1DRM A;  4R6L A;  1T19 A;  3E4Q A;  3ULF A;  3LIA A;  3H82 A;  4GS9 A;  1GSW A;  1MZU A;  2WKP A;  2ZOH A;  5AVE A;  1TS0 A;  4E04 A;  2YKF A;  4EET B;  5HDD A;  3UB6 A;  2PD7 A;  2PR5 A;  1D7E A;  2ZOI A;  5HDC A;  4HQA A;  1KOU A;  1V9Y A;  2P7J A;  4EES A;  3T50 A;  1JNU A;  3A0S A;  1OTB A;  3D72 A;  3F1P B;  3BY8 A;  1T1B A;  4I39 A;  2JHE A;  5IU1 A;  4GS9 B;  2INW A;  1D06 A;  3CLO A;  4HJ3 A;  3UB8 A;  2D01 A;  3H9W A;  3LIF A;  4BBU A;  5HWW A;  2KX6 A;  1DP9 A;  1WA9 A;  1OTA A;  3F1N A;  3LYX A;  3P7N A;  5DJT A;  3F1O B;  4YWZ A;  2GJ3 A;  1F98 A;  3LIE A;  5HD5 A;  4F3L A;  4HH2 A;  4BBV A;  1S1Y A;  4EW7 A;  1TS8 A;  2PD8 A;  4K08 A;  3K3C A;  4F3L B;  2Z6C A;  4NXB A;  5DKL A;  2PDR A;  5F5Y A;  5HD3 A;  2W27 A;  4HIA A;  3FG8 A;  3MQQ A;  3NOT C;  4HH3 A;  3ICY A;  1LSW A;  2I9V A;  1GSX A;  3K3D A;  1N9O A;  3PHY A;  2QJ7 A;  4I3J A;  2A24 B;  2HV1 A;  4HOI A;  4L9G A;  5AVF A;  2M1C A;  3B33 A;  1N9N A;  2L0W A;  1N9L A;  1S66 L;  3E4P A;  4HI4 A;  4HNB A;  4H6J A;  3CWF A;  2A24 A;  4EEU A;  5EFW A;  2OWH A;  3LID A;  3UE6 A;  2WKR A;  5F6A A;  3G6O A;  3VE4 A;  1BYW A;  4JGP A;  1OT9 A;  2YKH A;  5J3W A;  4GCZ A;  4HP4 A;  4L9E A;  3RH8 B;  4NXF A;  2QKP A;  5HSQ A;  5G4Y A;  4R38 A;  4RQ9 A;  3OLO A;  4DJ2 A;  2BAS A;  4EER A;  3HJK A;  4LRY C;  1EW0 A;  5HWV A;  4HHD A;  4JGQ A;  4EQ1 A;  2QJ5 A;  3GDI A;  4HJ6 A;  4JGO A;  3PYP A;  4M4X A;  1LSV A;  1NWZ A;  2J80 A;  2PHY A;  2R78 A;  3HJI A; 
#chains in the Genus database with same CATH topology
 5DJU A;  4LV2 A;  4OPZ A;  3IBR A;  1PZP A;  4G3W A;  2XEP A;  4GW9 A;  4BMW A;  5DFY A;  1K4F A;  4IHQ A;  1G28 A;  3T1S A;  1WYB A;  2Y4A A;  3A3E A;  2EX8 A;  4NXG A;  1YKD A;  4KZ5 A;  4E3K A;  2ZL1 B;  4U3T A;  2XD1 A;  3EWK A;  4GN2 A;  4MDZ A;  3HLE A;  1KDW A;  4HES A;  2QMI A;  1I2S A;  4Y15 A;  5DKK A;  3FPV A;  3MZF A;  3V50 A;  4GNU A;  4PM6 A;  3SH9 A;  1XJ2 A;  4GKU A;  1FSW A;  1DP6 A;  3MKE A;  1YLW A;  3H82 A;  4JF4 A;  4DE2 A;  1EWZ A;  5CTN A;  3PBT A;  4MBK A;  3UB8 A;  1ERM A;  4E3O A;  2J7V A;  3T4S A;  3MXR A;  3VSK A;  4EBN A;  2QYB A;  4UA7 A;  2HP9 A;  4XXR A;  3B33 A;  3PTE A;  5DTS A;  3VP1 A;  3T4L A;  4EEU A;  5EFW A;  1N4O A;  4IVI A;  2LB5 A;  1ONH A;  3NI9 A;  4DE0 A;  3IXB A;  4LV0 A;  3QNC A;  4NG2 A;  1FIL A;  4DDS A;  1SDN A;  5DFX A;  4JGO A;  3V39 A;  3P09 A;  5E2F A;  5TBM A;  4ZRR A;  2E8I A;  4E6W A;  1OTE A;  2RL3 A;  1P9R A;  3BRM A;  3IWI A;  2GX5 A;  2JBF A;  2VGJ A;  4WMC A;  2VLG A;  1HD8 A;  4DXC A;  3HUO A;  1IYS A;  1JWZ A;  2HDR A;  4P87 A;  4R70 A;  1XJ3 A;  3SW1 A;  3VOL A;  3A0V A;  4WN5 A;  3IWQ A;  5L8M A;  4DDY A;  3WS2 A;  4UAA A;  3ZVW A;  3UDI A;  3MXQ A;  4XT2 A;  4R4S A;  4Y0O A;  2GNX A;  4WL9 A;  1K56 D;  3IS2 B;  2ZMV A;  1K6S A;  4MCW A;  5FQM A;  5CHM A;  1H5X A;  2V1A A;  2PYP A;  3A0R A;  2XF3 A;  3SOI A;  4GLQ A;  3LR4 A;  1WE4 A;  3MZD A;  4E04 A;  4OPR A;  5HDD A;  1GHI A;  4UQI M;  3MS6 A;  3ZCZ A;  4B93 A;  1NY0 A;  3BY8 A;  1G68 A;  4NET A;  2OSU A;  1DP9 A;  5M19 A;  3P7N A;  4MMN A;  4F3L A;  4OLD A;  5DKL A;  2V1Z A;  2B95 A;  5F5Y A;  3MQQ A;  2HDU A;  4QU3 A;  3R4K A;  4MBF A;  5K5B A;  5U47 A;  2J9O A;  4ZDX A;  3CWF A;  3N6I A;  4S2L A;  3RH8 B;  3OPP A;  4OQH A;  2P9V A;  2QZ6 A;  3IF6 C;  1KE3 A;  3AGD A;  2X01 A;  2VV8 A;  3T1R A;  1NYM A;  1CEG A;  2C5W B;  2KLI A;  4ETZ A;  1SDE A;  2EWV A;  5FI7 A;  1Z6F A;  5FSR A;  4YNR A;  4PHT A;  3ZG9 B;  1FOF A;  5DF8 A;  1P9W A;  4O0P A;  3RTY A;  1J3W A;  2GZA A;  3OBF A;  4OKP A;  2HJ9 C;  4QPR A;  2X02 A;  4O7D A;  3LUQ A;  3MR0 A;  2ZQA A;  1YPR A;  2XFS A;  3I7J A;  4GOG A;  4R6L A;  4QWO A;  4GS9 A;  4OON A;  2XRN A;  1CI8 A;  2K2N A;  3IH9 A;  3E2K A;  1V9Y A;  3LR3 A;  4WEL A;  3BQ8 A;  3M2K A;  1L3L A;  4QJG A;  1LLB A;  2H5S A;  3JVU A;  1L0D A;  3C30 A;  2GJ3 A;  2JE5 A;  4JLF A;  4BL3 A;  5HPI A;  2JKR M;  3DTI A;  4ZAM A;  3VP4 A;  1DY6 A;  4HH3 A;  1LSW A;  5CEC A;  4G3K A;  3UPP A;  4GB7 A;  2HV1 A;  3M2J A;  3IF5 A;  4OQI A;  1E25 A;  4H6J A;  4E3L A;  2WKR A;  5FAQ A;  3HVF A;  4RX3 A;  3OLO A;  2BAS A;  5HAI A;  3Q1F A;  5FAS A;  3BYD A;  3LY4 A;  1AXB A;  3CG5 A;  5I5L A;  1UWN X;  2J8Y A;  4WZ5 A;  3S7O A;  3BWL A;  1PW8 A;  5F69 A;  4MEZ A;  5CGS A;  4Y3I A;  3N7W A;  1XFN A;  4PPR A;  1NXY A;  4S2K A;  4I3I A;  3MFX A;  5TBM B;  1W63 Q;  4LGW A;  3H7W B;  2V8C A;  1JWV A;  2EFX A;  3NY4 A;  5DVA A;  2WGW B;  4PM8 A;  5CHJ A;  4S2N A;  4BBT A;  1FCO A;  3G4P A;  1ESI A;  1S0W A;  3JPU A;  4FUW A;  4MN5 A;  3F1O A;  3UE1 A;  3NEC A;  3D3O A;  1X0O A;  4YFM A;  1K0K A;  3CZD A;  4MN6 A;  1OTD A;  3IHA A;  5GHX A;  1LI9 A;  1VQQ A;  3ZNT A;  1E4D A;  3FYZ A;  1MZU A;  1Z09 A;  1SKO A;  2HGV A;  3MSH A;  4HQA A;  2HDQ A;  3NCK A;  5CX7 A;  4R23 A;  2INW A;  3UE0 A;  4WEJ A;  1BLS A;  1OTA A;  4JXW A;  3A3I A;  2O9C A;  2HJE A;  3HCY A;  2XQZ A;  4HIA A;  2K31 A;  4GDN A;  3GQZ A;  3WRZ A;  1PRQ A;  4I3J A;  2VKS A;  2VJW A;  4JF5 A;  5FDS A;  4X55 A;  4O01 A;  3UDX A;  4O8G A;  5J3W A;  4L9E A;  5HSQ A;  5G4Y A;  1TVF A;  2ZC5 B;  4BD0 A;  4JGQ A;  1FCN A;  4ID4 A;  4EBL A;  4BQM A;  2R9X A;  2ZQ7 A;  1K4E A;  1Y54 A;  3BJN A;  5M1A A;  2PBD P;  4OP5 A;  2IWC A;  1KGE A;  3NDE A;  4OLG A;  2G2W A;  1YMX A;  5EOE A;  2M7V A;  1MWS A;  3WS1 A;  2Q9N A;  1W8Q A;  2ZQ9 A;  3LEQ A;  3VSL A;  5CER A;  1T1C A;  1YLP A;  2K7S A;  3IXH A;  2VV7 A;  2R9W A;  1GA9 A;  3C38 A;  1XJ4 A;  2W3F A;  1S67 L;  1FSY A;  2V9A A;  1CQA A;  3HUN A;  5EOO A;  5HFO A;  4S2I A;  2ZBB A;  4Y7P A;  3TOI A;  2CMN A;  3UY6 A;  4BJP A;  2WAD A;  1YMS A;  3FZC A;  1D7E A;  2O99 A;  2FFY A;  3A0S A;  2Y2L A;  3ZG8 B;  2W3D A;  3KYE A;  4Y2F A;  5EVE A;  4Y17 A;  5HWW A;  4CLC A;  4UEY A;  4BBV A;  2XGN A;  2PD8 A;  3OC2 A;  2EX9 A;  2PDR A;  3MF0 A;  2ZJ9 A;  3DWK A;  3G2Z A;  1E3U D;  3LR0 A;  3PHY A;  3B3X A;  5GLA A;  2A24 B;  4B4Z A;  3LCE A;  3NIA A;  1PWC A;  2X71 A;  5AJG A;  4R38 A;  3R7W A;  3G32 A;  2JKG A;  5CED A;  3TE8 A;  2Y2N A;  4OOM A;  3G2Y A;  5JYP A;  2FZ0 A;  4DMZ A;  1K55 C;  2ZC7 A;  3Q7V B;  5TR7 A;  3KO6 A;  1L2S A;  4CLC C;  1GHP A;  5A92 A;  4N9K A;  1TS6 A;  2H0Y A;  4QHC A;  1M40 A;  1VET B;  3DTM A;  4IUH A;  2ZQ8 A;  4WMC D;  5HW3 A;  2Y2O A;  3V67 A;  4R3A A;  3LY3 A;  1BLP A;  2VEA A;  4FSF A;  4ZJ3 A;  4N1H A;  5AQ9 A;  2L1M A;  3A3J A;  3NOU C;  1TD5 A;  1O7E A;  4KZ7 A;  4HY8 A;  4IVK A;  3GV9 A;  3TG9 A;  4LRZ E;  1O07 A;  4PAU A;  3T1X A;  4DRT A;  4ETX A;  4OQ0 A;  4QB8 A;  3G35 A;  4L0L A;  4G3V A;  1SKO B;  4UQI S;  1XPB A;  5HAR A;  3F1P B;  3BW6 A;  5IU1 A;  3PBO A;  4WBG A;  3F1O B;  1F98 A;  4HH2 A;  2ZC4 B;  2Y2I A;  1GCE A;  2PAV P;  2GDN A;  3S7N A;  1KVL A;  3NUL A;  3OOV A;  2XA7 M;  4II7 A;  4IUK A;  4S2N C;  4HI4 A;  5A91 A;  2ZL1 A;  5F6A A;  4PMA A;  3CUE C;  2ZMA A;  4JF6 A;  1EW0 A;  1NLZ A;  5E2H A;  3H7W A;  2Y2P A;  3D4F A;  2C6W B;  5HDS A;  3WS0 A;  2L4R A;  3T4T A;  2Z2M B;  2OV5 A;  1M6K A;  4KQQ A;  1NZO A;  4HEF A;  3RFB A;  4EBP A;  5TFQ A;  3HLB A;  4EUZ A;  4EUV A;  4H6J B;  3NOP C;  2DCF A;  1OME A;  2J9P A;  3BLS A;  1F9I A;  1SZV A;  3E98 A;  3PBR A;  3FKW A;  1CK3 A;  4LV1 A;  5J7E A;  3F1N B;  1OJ5 A;  4LEN A;  4OPY A;  1IYP A;  1VB6 A;  5JYO A;  1KVM A;  1G6O A;  1OJG A;  4X6T A;  1LL9 A;  2DNS A;  4WZ4 A;  2Y2K A;  3BLM A;  1KDS A;  4PM7 A;  4RVA A;  3IH8 A;  3CJM A;  1EI5 A;  3IF6 A;  2M7U A;  4OOY A;  1BSG A;  1YQS A;  2P7J A;  3T50 A;  1JNU A;  5FI6 A;  1KE0 A;  1W7F A;  3EQV A;  1ALQ A;  1SKF A;  4N9L A;  3LIF A;  1XA1 A;  4OVD A;  3CUE A;  1S1Y A;  3BFD A;  4X69 A;  1TS8 A;  2JKT I;  3E2L A;  2Z6C A;  1VEU A;  1KE4 A;  2Y55 A;  3TSG A;  4YOF A;  4YIN A;  1N9L A;  3ZVT A;  1D1J A;  1MWR A;  5FAT A;  3O5Y A;  3O86 A;  1BUE A;  2XFT A;  3BM6 A;  3GDI A;  4HJ6 A;  2PHY A;  4IBR A;  2PRF A;  4X1L A;  3HBR A;  2WUQ A;  2QHK A;  1TDL A;  1K6R A;  4LCM A;  3SH7 A;  3Q7V A;  2Y2G A;  2D02 A;  1PYY A;  1W5D A;  3T4J A;  1W8Y A;  1ONG A;  1HTZ A;  1VHM A;  2WZZ A;  5FQI A;  1KGG A;  3ISG A;  2ZM8 A;  3WWX A;  4FTX A;  2WZX A;  2O9B A;  4DJ3 A;  4EWF A;  4ARZ B;  2H10 A;  1GHM A;  1IEM A;  3GVB A;  4P6Z S;  1F5M A;  2PBY A;  1SHV A;  1HZO A;  4PKY G;  1UGU A;  1K25 A;  3KX0 X;  2EX2 A;  1RGY A;  1DRM A;  5KMW A;  3E4Q A;  2AVX A;  3Q7Z A;  1K54 A;  3FKV A;  1YM1 A;  3DW0 A;  3HL9 A;  2PU4 A;  1T1B A;  4S2P A;  1D06 A;  4K0X A;  1ERO A;  1GA0 A;  5EVI A;  3BQA A;  3WS4 A;  5FI2 A;  3S7P A;  4BLM A;  1K57 C;  3Q07 A;  3NDG A;  3LFV A;  5GHY A;  4FCF A;  2OAQ 1;  2E8J A;  5EVL A;  3E4P A;  4ESP A;  2G7U A;  3LID A;  4Y0T A;  4RA7 A;  2W1R A;  3DBA A;  2O0Y A;  3ZGA B;  5AQ7 A;  3MKF A;  5FL3 A;  5F1F A;  3T12 B;  2VK3 A;  2QWS A;  2NUP C;  1L0E A;  3NBL A;  5GLD A;  1ZG4 A;  2H28 A;  5EE8 A;  2FFF B;  1LL8 A;  3CHW P;  3UME A;  4LV3 A;  1ODV A;  3LI8 A;  2BLS A;  4EEP A;  4I3A A;  3C2W A;  1VM1 A;  1ES5 A;  3ZG7 B;  4JKT A;  4JGR A;  1MC0 A;  3MMH A;  2A3U A;  5E2G A;  1RP5 A;  1PNE A;  5EM1 A;  1ZTU A;  4BEN A;  4Z9Q A;  1TF1 A;  5CRF A;  4S2M A;  4BD1 A;  4DE3 A;  3CMZ A;  3IQA A;  1P0Z A;  4WLA A;  5F83 A;  5FDH A;  2WK0 A;  3KSI A;  3FWL A;  3LI9 A;  3F1P A;  3C7V A;  3T4Q A;  2Y2M A;  2HPB A;  3LIC A;  2O9A A;  1QME A;  5KIZ A;  3GR2 A;  4WM9 A;  3OCN A;  2J3W A;  2EXA A;  3CPT B;  3QP2 A;  1K38 A;  2ZOH A;  2ACG A;  1TS0 A;  3CPT A;  3AGF A;  3JYI A;  5CTM A;  3VP3 A;  2ZQC A;  3L9K A;  3CLO A;  3BFF A;  2BG1 A;  1XA7 A;  3P01 A;  5CGW A;  2EXB A;  3IHB A;  4IBX A;  2P9V B;  3OPR A;  1QMF A;  3CIT A;  3EGD C;  4NXB A;  1TDG A;  5DF9 A;  3GRJ A;  2W27 A;  1I5Q A;  5AQB A;  3O87 A;  1LI0 A;  3K3D A;  3BFE A;  2M1C A;  1S66 L;  5KSC A;  1YLJ A;  4FH4 A;  2V8F A;  3VE4 A;  4A5R A;  4CPK A;  4HP4 A;  4DKI A;  3KSG A;  4GZB A;  1Y4O A;  4F3L B;  1Q2P A;  1IKI A;  1OTI A;  2V0U A;  3DTK A;  2XH9 A;  4WYY A;  3U2A A;  4PKY A;  1ES2 A;  4I38 A;  1V9Z A;  4X53 A;  5CEB A;  3T4K A;  1K56 A;  4KZ6 A;  1XGI A;  1ZC2 A;  5E2E A;  3GSG A;  3ITA A;  4LLO B;  1LT0 A;  4UA9 A;  2XRO A;  5TGF A;  3M6B A;  4CQH A;  3E4O A;  1ZHH B;  3MFD A;  1DP8 A;  3VOZ A;  4LFU A;  3MJQ A;  3ZQ5 A;  2FH5 A;  3QHY A;  4HP9 A;  1C3B A;  1MWU A;  5AQA A;  4CLC B;  3A3F A;  4WZ5 C;  3DTE A;  3ZNY A;  2W0N A;  4P6B A;  3E0Y A;  2MJ6 A;  5HZH A;  1H8Y A;  2XLN A;  2ZM0 A;  2PD7 A;  4P85 A;  1JTD A;  1MKI A;  2JKT M;  2NUT C;  3FV7 A;  5EEC A;  2VGL S;  4FD8 A;  3LIE A;  4ZJ2 A;  5E43 A;  1DJB A;  3FG8 A;  2QJ7 A;  4HOI A;  3OCL A;  2L0W A;  3KSF A;  4KEN B;  4C75 A;  1H0M A;  4ME4 A;  2OWH A;  1YSQ A;  3EOI A;  2W1T A;  4JXS A;  3UPO A;  3ZDJ A;  4NXF A;  1RGZ A;  4DJ2 A;  5A90 A;  2DRW A;  3KYQ A;  3PXP A;  4KG2 A;  4ZTK A;  4Q0H A;  4PM9 A;  5EVI D;  3LGO A;  1JVJ A;  3DWZ A;  1Y28 A;  1VEU B;  1G6A A;  2PU2 A;  4PM5 A;  3BEB A;  3MBZ A;  5BOH A;  3BEC A;  4R4R A;  2A49 A;  1TS7 A;  3U4L P;  3ZFZ A;  4GHI B;  1PI5 A;  1F2K A;  3VP2 A;  3TRC A;  1WYC A;  2Z6D A;  3IX8 A;  5GHZ A;  3LR5 A;  3EEA A;  4QY6 A;  2Y79 A;  3T4O A;  4K91 A;  1XJ6 A;  2B5R A;  1PIO A;  3C5A A;  2WGW A;  3G31 A;  4HBU A;  1S4R A;  3VV4 A;  4GDB A;  5L09 A;  2ZC6 B;  4B4X A;  1PWD A;  3A3D A;  3S1Y A;  2LB9 A;  1XKZ A;  1OTB A;  5FQ9 A;  3VFF A;  1HVB A;  4I39 A;  3SS5 A;  1W63 M;  1IOU A;  2WKE A;  4YWZ A;  1E3U A;  4KQR A;  5HD3 A;  3ICY A;  2OAP 1;  4KQO A;  4JBF A;  3L7H A;  4Y0U A;  1ZKJ A;  4HNB A;  2A24 A;  3JVV A;  2WYX A;  1BYW A;  3ITB A;  1OT9 A;  4KG5 A;  3GMW A;  2QKP A;  4R3B A;  4EER A;  2ZMF A;  1IEL A;  3PR6 A;  1ZG6 A;  5GLB A;  4RX2 A;  5EVI B;  2J80 A;  4JXV A;  3G30 A;  3OPL A;  3LEZ A;  1MY8 A;  4U0X A;  2W3H A;  4X25 A;  1OT6 A;  3CAX A;  2XA7 S;  2XSS A;  1PFL A;  4H8R A;  2VGK A;  3UB7 A;  3IX3 A;  4B9O A;  5HWT A;  4ZBE A;  4NXE A;  1NLY A;  1KGF A;  2V1B A;  4XT2 B;  1MPL A;  5KZH A;  2UV0 E;  1L0F A;  5A8B A;  2KDK A;  4I5S A;  5HL1 A;  4KQD A;  4M3K A;  3NHQ A;  3SZT A;  3BFC A;  1YLZ A;  4MNR A;  1YSP A;  5TJJ A;  3HLG A;  1YLY A;  2ZC3 B;  2PT7 A;  1XFQ A;  3B47 A;  3T1Q B;  2OLV A;  3ZG5 A;  3IXG A;  1K55 A;  3CI6 A;  3IBJ A;  2B02 A;  5FQQ A;  3ULF A;  5AVE A;  2WKP A;  4OQG A;  3QP8 A;  1FR6 A;  3LO7 A;  2PR5 A;  1Q2Q A;  3P98 A;  1KOU A;  3QNB A;  2JHE A;  1BZA A;  4HJ3 A;  4BBU A;  4MN7 A;  3UPN A;  1WA9 A;  4S2O A;  5HD5 A;  3UN7 A;  3GTC A;  1IYO A;  4K08 A;  4CJN A;  2Y91 A;  5D3O A;  3NOT C;  2HP5 A;  2W1T B;  4D60 A;  2KOI A;  4E6X A;  1N9N A;  3RXW A;  5EM0 A;  3C4O A;  4GCZ A;  5CHU A;  1G5U A;  5CGX A;  4RQ9 A;  4LRY C;  4HBT A;  1LSV A;  1BUL A;  4KZ8 A;  4KUK A;  3C4P A;  3HLD A;  3VE3 A;  3LIB A;  2XR0 A;  3H82 B;  4WF0 A;  4OH0 A;  4D2O A;  3IF6 B;  1FQG A;  1XP4 A;  3PBS A;  5HAP A;  3UDF A;  3C8C A;  3ZHH A;  1IKG A;  1ES3 A;  1FIK A;  3QP1 A;  4LPZ A;  2Z2L B;  3C7U A;  2Q0O A;  4GJ4 A;  1MBL A;  1LSX A;  3ZG0 A;  3SS4 A;  1J9M A;  1DJC A;  1BT5 A;  2HP6 A;  2XDM A;  5F68 A;  1ERQ A;  2Y59 A;  2VA0 A;  3IS2 A;  3N8L A;  2OWJ A;  2OLU A;  4U0T A;  4NKP A;  1YLT A;  4HJ4 A;  2IWD A;  1L0G A;  4CLC D;  5IS1 A;  5HX9 A;  3RXX A;  1AWI A;  3D9Y A;  4KZB A;  4L9F A;  3UB9 A;  4S2J A;  5L07 A;  4RYE A;  1N9B A;  4EU0 A;  2YKF A;  4DXB A;  4LCL A;  3UB6 A;  2VX8 A;  5GLC A;  4EES A;  1MWT A;  3D72 A;  4KZ9 A;  5F1G A;  3FPW A;  1PW1 A;  4MBH A;  3Q81 A;  5DJT A;  2WAE A;  4UA6 A;  3K2N A;  4EW7 A;  3RJU A;  3K3C A;  3PAG A;  3QP5 A;  2WGV A;  2I9V A;  5C5K A;  1STZ A;  3VP0 A;  2JKR I;  5A93 A;  1U60 A;  5MC7 A;  4C6Y A;  4JGP A;  4K0W A;  4EQ1 A;  2W3G A;  3QP6 A;  5F82 A;  1K54 C;  3V5M A;  1MKM A;  2R78 A;  2ZD8 A;  5FA7 A;  3VFH A;  1CF0 A;  5EPH A;  4E3J A;  3IX4 A;  3O3V A;  3EGX C;  5FAP A;  4Q0J A;  4AFI A;  1TEM A;  5EVI C;  4WUJ A;  1NRF A;  3V3R A;  2PR6 A;  1GSV A;  5I94 A;  1H8M A;  1T18 A;  1LL5 A;  1UWP X;  5FEF A;  3WS5 A;  2HF6 A;  4ZJ1 A;  1PZO A;  3FC7 A;  5IT5 A;  5EUA A;  1I2W A;  3MQO A;  4GD6 A;  4MLL A;  2EFU A;  2JCH A;  3KYZ A;  2RCX A;  4E3M A;  1JWP A;  4GHI A;  1A0K A;  4KZ3 A;  4F94 A;  3O88 A;  1MXO A;  4JPM A;  5J4E A;  4E3I A;  2P04 A;  2ZQD A;  1ESU A;  4N1X A;  4WEK A;  3MZE A;  4LRX C;  1CEF A;  1VET A;  4KG6 A;  4Y13 A;  2WKH A;  3NJA A;  2DMW A;  1GSW A;  4EET B;  1PI4 A;  4X56 A;  3W4P A;  2Y8H A;  4DF6 A;  2VGL M;  5FAO A;  1CI9 A;  2KX6 A;  3LYX A;  3W4Q A;  3AGE A;  3PAE A;  1DJA A;  1JTG A;  3G34 A;  5L10 A;  2I72 A;  5DF7 A;  2Q9M A;  2WAF A;  2EX6 A;  3G6O A;  4BWI A;  5DTT A;  3HLW A;  4Y5F A;  1BLC A;  5HWV A;  1XGJ A;  3W4O A;  3W8K A;  3S4X A;  3PYP A;  4R0Q A;  1NWZ A;  4N92 A;  4IED A;  5HAQ A;  3SS3 A;  1YT4 A;  2Y2H A;  2XD5 A;  1BLH A;  2Y2Q A;  1P97 A;  2Y2J A;  4KZA A;  1NRJ A;  4R1G A;  2EA9 A;  3UE3 A;  4OPQ A;  1NJ4 A;  2VV6 A;  3IWO A;  5HL6 A;  3BY9 A;  3PBN A;  2J3T C;  4FOF A;  3B42 A;  3OZH A;  4Z1W A;  4KUO A;  2JC7 A;  2EWW A;  2V0W A;  4XUX A;  1T1A A;  4EV4 A;  3S7Q A;  5FQJ A;  2IA2 A;  3UMD A;  3EQU A;  2WGI A;  1BTL A;  2ZM2 A;  2B18 A;  3UNW A;  4FH2 A;  1T19 A;  2HDS A;  4CLC E;  3W2Z A;  3SH8 A;  4Q8I A;  2ZOI A;  2G2U A;  3OPH A;  4DN0 A;  3N4I A;  2HZ5 A;  4GS9 B;  2D01 A;  1S6R A;  5HPF A;  2V20 A;  5DTK A;  4GD8 A;  4KZ4 A;  1FCM A;  1XXM A;  4ARZ A;  4BL2 A;  1GSX A;  2VZW A;  2BTF P;  4X1M A;  5CXW A;  3VOY A;  2JKF A;  2V2F F;  2A2L A;  4Q0I A;  5EV0 A;  1RCJ A;  3MQ0 A;  3VMA A;  1K57 A;  4OOL A;  3HRE A;  3HJK A;  1NZU A;  1XX2 A;  1H8Z A;  1FR1 A;  3QP4 A;  4UHU A;  3IXD A;  1IYQ A;  1W79 A;  3BFG A;  4EXO A;  2UWX A;  2WKQ A;  4QY5 A;  2P74 A;  4P6Z M;  3IT9 A;  1HLU P;  5L2F A;  2OOL A;  3HUM A;  2H0T A;  3EEH A;  5M18 A;  2QPN A;  5GL9 A;  3GEC A;  1SCW A;  5IHV A;  2WKI A;  3R7W B;  3TJZ C;  2XK1 A;  5G4Z A;  4JXG A;  4XUZ A;  1S4S A;  2W3E A;  1YAX A;  3HLC A;  3N8R A;  3N8S A;  4EQI A;  5LBR A;  3WRT A;  5G18 A;  1ACF A;  5KSH A;  3Q82 A;  2PYR A;  3KSH A;  2JN7 A;  3S22 A;  3MXS A;  3ZYT A;  3DAV A;  4NK3 A;  1CJF A;  1S1Z A;  4P0M A;  1PWG A;  1NYY A;  3UO9 A;  4OP8 A;  2CC1 A;  1OPX A;  3LIA A;  3UB5 P;  4C3Q A;  4X68 A;  5HDC A;  3PBQ A;  4E3N A;  3H9W A;  1IFQ A;  3F1N A;  5FQK A;  4R3J A;  2J3T D;  2ZLY A;  1H3Q A;  4IJG A;  3HLF A;  5FEG A;  1N9O A;  4L9G A;  4QD4 A;  5AVF A;  4DE1 A;  3UE6 A;  2P08 A;  2YKH A;  5J8X A;  3TW8 A;  2IWB A;  3M6H A;  1ES4 A;  4HHD A;  2QJ5 A;  3V3S A;  4M4X A;  4B88 A;  4NEE D;  1LHY A;  3HJI A;  3NC8 A; 
#chains in the Genus database with same CATH homology
 4KUK A;  2QWS A;  2NUP C;  3VE3 A;  5DJU A;  3LIB A;  3IBR A;  3H82 B;  4WF0 A;  4G3W A;  3BJN A;  4GW9 A;  4BMW A;  2H28 A;  5DFY A;  1LL8 A;  3UME A;  3PBS A;  1ODV A;  4IHQ A;  1G28 A;  3LI8 A;  2M7V A;  3C8C A;  4NXG A;  4I3A A;  4EEP A;  1YKD A;  3C2W A;  4JGR A;  1MC0 A;  1T1C A;  3EWK A;  3MMH A;  4MDZ A;  2K7S A;  4LPZ A;  1ZTU A;  2VV7 A;  4GJ4 A;  1LSX A;  1TF1 A;  5DKK A;  3C38 A;  5F68 A;  2VA0 A;  3IS2 A;  3FPV A;  1XJ4 A;  2W3F A;  1P0Z A;  2OWJ A;  4NKP A;  4WLA A;  4HJ4 A;  4CLC D;  1S67 L;  5IS1 A;  2V9A A;  3KSI A;  3LI9 A;  3F1P A;  3T4Q A;  1XJ2 A;  3LIC A;  2O9A A;  4L9F A;  5KIZ A;  1DP6 A;  2ZBB A;  2CMN A;  3UB9 A;  4BJP A;  3OCN A;  2J3W A;  4EU0 A;  3H82 A;  2ZOH A;  1TS0 A;  2YKF A;  3UB6 A;  1D7E A;  2VX8 A;  2O99 A;  4EES A;  3PBT A;  3A0S A;  3D72 A;  2W3D A;  3FPW A;  4Y2F A;  3UB8 A;  3CLO A;  5HWW A;  4CLC A;  4UEY A;  3P01 A;  5DJT A;  3T4S A;  4BBV A;  3K2N A;  4EW7 A;  3CIT A;  2PD8 A;  3EGD C;  3K3C A;  3OC2 A;  4NXB A;  2PDR A;  3MF0 A;  5DF9 A;  2W27 A;  2QYB A;  2I9V A;  5C5K A;  3K3D A;  3LR0 A;  3PHY A;  1STZ A;  2A24 B;  2M1C A;  3B33 A;  1S66 L;  2JKR I;  3T4L A;  5MC7 A;  4EEU A;  5EFW A;  5AJG A;  3VE4 A;  4JGP A;  2LB5 A;  4HP4 A;  4R38 A;  3R7W A;  4EQ1 A;  3KSG A;  3TE8 A;  2W3G A;  5DFX A;  4JGO A;  4OOM A;  4F3L B;  2R78 A;  1MKM A;  1OTI A;  5TBM A;  4ZRR A;  2V0U A;  2FZ0 A;  4DMZ A;  3EGX C;  3U2A A;  3KO6 A;  4PKY A;  4I38 A;  4Q0J A;  4AFI A;  1OTE A;  4CLC C;  1V9Z A;  3T4K A;  1P9R A;  1TS6 A;  2GX5 A;  4WUJ A;  4LLO B;  1LT0 A;  2PR6 A;  1GSV A;  2VLG A;  1H8M A;  1T18 A;  2XRO A;  4IUH A;  1UWP X;  4CQH A;  3E4O A;  2HF6 A;  4R70 A;  1XJ3 A;  3V67 A;  4R3A A;  3SW1 A;  1ZHH B;  3FC7 A;  3VOL A;  5IT5 A;  3A0V A;  4WN5 A;  1DP8 A;  3MQO A;  2VEA A;  5L8M A;  4FSF A;  3MJQ A;  3ZQ5 A;  2FH5 A;  3MXQ A;  4XT2 A;  2L1M A;  3NOU C;  3KYZ A;  4HP9 A;  4GHI A;  2GNX A;  1TD5 A;  4CLC B;  4WL9 A;  5J4E A;  2P04 A;  3IS2 B;  2ZMV A;  4HY8 A;  4MCW A;  4WEK A;  2W0N A;  4LRX C;  4LRZ E;  2V1A A;  2MJ6 A;  2PYP A;  3A0R A;  3E0Y A;  4PAU A;  5HZH A;  3NJA A;  4GLQ A;  3LR4 A;  4ETX A;  2DMW A;  1GSW A;  4EET B;  4E04 A;  5HDD A;  4UQI M;  2PD7 A;  4L0L A;  4G3V A;  2Y8H A;  4UQI S;  2JKT M;  4B93 A;  2NUT C;  2VGL M;  3BY8 A;  3F1P B;  3BW6 A;  5IU1 A;  2VGL S;  3PBO A;  2KX6 A;  1DP9 A;  3LYX A;  3P7N A;  4MMN A;  3F1O B;  1F98 A;  3LIE A;  4F3L A;  4HH2 A;  5DKL A;  5F5Y A;  3FG8 A;  3MQQ A;  3S7N A;  3OOV A;  2QJ7 A;  2XA7 M;  4HOI A;  4II7 A;  4IUK A;  3R4K A;  5K5B A;  3OCL A;  2L0W A;  4HI4 A;  3KSF A;  3CWF A;  4ME4 A;  2OWH A;  1YSQ A;  3EOI A;  2W1T A;  3G6O A;  5F6A A;  3CUE C;  3RH8 B;  4NXF A;  4BWI A;  4DJ2 A;  4Y5F A;  1EW0 A;  3KYQ A;  5HWV A;  3PXP A;  4Q0H A;  1NLZ A;  3PYP A;  1NWZ A;  3H7W A;  1Y28 A;  5HDS A;  2VV8 A;  2L4R A;  3T4T A;  2KLI A;  4ETZ A;  1P97 A;  1NRJ A;  3RFB A;  2EA9 A;  3UE3 A;  2EWV A;  2VV6 A;  5HL6 A;  4H6J B;  1TS7 A;  4EUV A;  3NOP C;  3BY9 A;  4YNR A;  4PHT A;  3PBN A;  2J3T C;  4FOF A;  3B42 A;  1F9I A;  4GHI B;  4Z1W A;  3TRC A;  4KUO A;  3E98 A;  3PBR A;  2Z6D A;  2EWW A;  1P9W A;  4O0P A;  2V0W A;  3RTY A;  2GZA A;  3OBF A;  4QPR A;  2HJ9 C;  5J7E A;  1T1A A;  3F1N B;  3LR5 A;  3EEA A;  3S7Q A;  1OJ5 A;  2Y79 A;  1VB6 A;  3T4O A;  2IA2 A;  3UMD A;  1XJ6 A;  1G6O A;  1OJG A;  3LUQ A;  3EQU A;  3MR0 A;  1S4R A;  2B18 A;  4R6L A;  3VV4 A;  1T19 A;  4GS9 A;  2XRN A;  4CLC E;  2M7U A;  3W2Z A;  2K2N A;  2ZOI A;  4WEL A;  1V9Y A;  2P7J A;  3LR3 A;  4DN0 A;  3T50 A;  1JNU A;  2LB9 A;  1OTB A;  3BQ8 A;  4I39 A;  3EQV A;  1W63 M;  4GS9 B;  2D01 A;  3JVU A;  3LIF A;  1IOU A;  3C30 A;  4YWZ A;  5HPF A;  2GJ3 A;  3CUE A;  1S1Y A;  5HPI A;  1TS8 A;  2JKT I;  2JKR M;  2Z6C A;  5HD3 A;  4HH3 A;  3ICY A;  2OAP 1;  1LSW A;  4ARZ A;  4G3K A;  1GSX A;  4KQO A;  2VZW A;  2HV1 A;  4YOF A;  4HNB A;  1N9L A;  4H6J A;  2A24 A;  3JVV A;  2A2L A;  4Q0I A;  2WKR A;  1BYW A;  1OT9 A;  3O5Y A;  3MQ0 A;  2QKP A;  4OOL A;  4EER A;  2ZMF A;  3OLO A;  2BAS A;  3HJK A;  3PR6 A;  3GDI A;  4HJ6 A;  2J80 A;  2PHY A;  5I5L A;  1UWN X;  2W3H A;  3S7O A;  3BWL A;  2QHK A;  4EXO A;  2WKQ A;  4P6Z M;  1OT6 A;  3CAX A;  2XA7 S;  2XSS A;  5F69 A;  2OOL A;  4Y3I A;  1XFN A;  3EEH A;  2D02 A;  4I3I A;  3MFX A;  5TBM B;  3UB7 A;  1W63 Q;  4B9O A;  3H7W B;  5HWT A;  3T4J A;  4NXE A;  1NLY A;  2V1B A;  1VHM A;  3GEC A;  4XT2 B;  3R7W B;  3TJZ C;  4BBT A;  5G4Z A;  2O9B A;  4DJ3 A;  1S4S A;  2W3E A;  4ARZ B;  5A8B A;  2KDK A;  1YAX A;  4I5S A;  4KQD A;  5LBR A;  4P6Z S;  3NHQ A;  4MN5 A;  1F5M A;  3F1O A;  5KSH A;  4PKY G;  2PYR A;  1UGU A;  1YSP A;  5TJJ A;  3D3O A;  3KSH A;  2JN7 A;  3ZYT A;  2PT7 A;  1X0O A;  1S1Z A;  4MN6 A;  1XFQ A;  3B47 A;  1OTD A;  3KX0 X;  3IBJ A;  3CI6 A;  2B02 A;  1DRM A;  1OPX A;  3E4Q A;  3ULF A;  3LIA A;  1MZU A;  2WKP A;  5AVE A;  2HGV A;  2PR5 A;  5HDC A;  3PBQ A;  4HQA A;  1KOU A;  1T1B A;  5CX7 A;  2JHE A;  2INW A;  1D06 A;  4HJ3 A;  4BBU A;  3H9W A;  4MN7 A;  4WEJ A;  1IFQ A;  1WA9 A;  1OTA A;  3F1N A;  3BQA A;  5HD5 A;  3S7P A;  2O9C A;  4K08 A;  2J3T D;  2HJE A;  1H3Q A;  3HCY A;  4IJG A;  4HIA A;  2K31 A;  3NOT C;  3LFV A;  4I3J A;  1N9O A;  2VKS A;  2W1T B;  2OAQ 1;  2KOI A;  4L9G A;  2VJW A;  5AVF A;  1N9N A;  3E4P A;  2G7U A;  3LID A;  3UE6 A;  4O01 A;  4O8G A;  2P08 A;  2YKH A;  4GCZ A;  5J3W A;  4L9E A;  5HSQ A;  5G4Y A;  3TW8 A;  4RQ9 A;  2W1R A;  3DBA A;  4LRY C;  4HHD A;  4JGQ A;  2O0Y A;  2QJ5 A;  4M4X A;  5FL3 A;  1LSV A;  4NEE D;  3HJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...