1OTEA

E46q mutant of photoactive yellow protein, p65 at 110k
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords photoactive yellow protein, PYP
total genus 33
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1oteA00
5HD5A 1F98A 2PD8A 2W0NA 5TBMB 5AVEA 5KIZA 1N9LA 4LRYC 4BBTA 1OTAA 3E4QA 4HI4A 3F1NB 2ZBBA 4MN5A 4LLOB 4NXFA 5J4EA 5J3WA 2BASA 1EW0A 1S4RA 2D02A 2J80A 1DP8A 4EEUA 3GDIA 2EA9A 4WL9A 3A0SA 4R70A 3FG8A 3ZQ5A 3K3CA 2QJ7A 3D72A 4K08A 1OT6A 2V0UA 2QKPA 5G4ZA 4GS9A 2KX6A 1XJ6A 2V9AA 4HY8A 4PKYA 2PYPA 1VB6A 4DJ3A 3H9WA 2KDKA 2L1MA 2ZOIA 3H82B 3LIAA 2VV6A 1LSWA 2PR6A 3ICYA 5HSQA 2B02A 3LI9A 1N9OA 3PYPA 3UE6A 1TS6A 2VV7A 2OWJA 3SW1A 5F68A 4HH2A 3BY9A 2K7SA 3LI8A 5EFWA 3LYXA 4JGQA 3UB6A 3NOUC 5IU1A 2A24B 3MR0A 1TS0A 1BYWA 2JHEA 4RQ9A 2YKHA 5F69A 2V0WA 4HIAA 5AVFA 1OTIA 3ULFA 3H7WB 4WUJA 3UMEA 2WKPA 1S66L 3E4PA 4HOIA 4JGOA 3GECA 3MJQA 1LT0A 2D01A 1KOUA 1OTDA 4GHIA 1LL8A 5F5YA 2PD7A 3NOTC 3LIDA 5A8BA 1XFNA 3G6OA 1V9YA 1DRMA 2HV1A 4L9GA 3LIBA 4H6JA 4HQAA 3UMDA 2A24A 5IS1A 4HP9A 4KQDA 2PYRA 3HJIA 4L9EA 4E04A 1GSVA 4HJ4A 4NXBA 5G4YA 3CWFA 4HJ6A 1G28A 4MN6A 3MXQA 3VE4A 4JGRA 1DP9A 4HP4A 4DJ2A 1OTBA 2JN7A 2VV8A 3IBRA 1F9IA 4R3AA 4R6LA 3UB9A 2V1BA 1XJ3A 1T1BA 3F1NA 4WN5A 3B33A 1D7EA 3CAXA 5HWTA 3UB8A 5HDSA 5HZHA 1D06A 3LIFA 2W27A 4LPZA 1Y28A 3C2WA 1P97A 1T1CA 3BY8A 4I3JA 2VLGA 4WF0A 4BBVA 2QHKA 4I38A 4NXGA 4B9OA 3LIEA 1X0OA 3EEHA 5DJUA 1S1YA 4F3LA 5TBMA 3IS2A 4L9FA 3MQOA 4I39A 3IS2B 3CLOA 5J7EA 4HHDA 1OJGA 2OWHA 3NHQA 1UWPX 3F1OA 3H82A 2P7JA 2VEAA 2GJ3A 3OLOA 2PHYA 2QWSA 4GHIB 3A0VA 4HJ3A 2PR5A 4KUOA 4M4XA 5HDCA 4NXEA 4EERA 1P0ZA 1T1AA 1XJ4A 3F1PA 2PDRA 2OOLA 3FC7A 3P7NA 2CMNA 4JGPA 3H7WA 3E4OA 3LUQA 1N9NA 5F6AA 3K3DA 4HH3A 4EXOA 4BBUA 1JNUA 1S1ZA 3PHYA 2M1CA 3A0RA 4KUKA 1T19A 4R38A 5HWWA 4EW7A 1T18A 2I9VA 3MFXA 2Z6CA 3NOPC 4F3LB 3HJKA 3VE3A 5HDDA 1OT9A 2WKRA 4LRXC 1TS7A 2WKQA 4GS9B 4HNBA 3F1PB 3LICA 2R78A 2L0WA 1LSXA 3MQQA 3NJAA 5HD3A 1V9ZA 1WA9A 4GCZA 2V1AA 4LRZE 3F1OB 1XFQA 3RH8B 3VOLA 4WLAA 1NWZA 1UGUA 5DKLA 3RTYA 1LSVA 1S67L 1GSWA 1OJ5A 1TS8A 1XJ2A 3UB7A 4YWZA 2INWA 3KX0X 4GW9A 1OTEA 2L4RA 4I5SA 4XT2B 4EETB 2Z6DA 1S4SA 4I3AA 4EESA 1DP6A 4EQ1A 3BWLA 3C8CA 3EWKA 5DJTA 4PKYG 1ODVA 4EEPA 5DKKA 2ZOHA 4H6JB 4XT2A 5I5LA 3T50A 1MZUA 5HWVA 2YKFA 4I3IA 1UWNX 1GSXA 2H28A 2QJ5A
chains in the Genus database with same CATH superfamily
3E4QA 3U4LP 3IXDA 4LLOB 4XUXA 3BLMA 3IXGA 5EOEA 3FV7A 2HP6A 3GDIA 5L8MA 3IX8A 2FFFB 3O3VA 2PYPA 3ZHHA 2PR6A 3CJMA 5L07A 3UE6A 4KZBA 3JVVA 4UA6A 3G2ZA 5CGXA 2GZAA 2PU2A 2X01A 5GLDA 5EE8A 3UMEA 2WKPA 4DDYA 2D01A 3LIDA 3LCEA 5L10A 1V9YA 4IEDA 1K56A 1VETB 5G18A 3TG9A 1NYYA 4DJ2A 4MBHA 2ZC6B 1VHMA 1YLTA 5FI2A 1D06A 5IHVA 1YM1A 5CEDA 4LPZA 1NRJA 3BJNA 2XF3A 1KE0A 2FZ0A 1ONGA 4QU3A 3HBRA 1LL5A 5K5BA 2OWHA 1LHYA 5D3OA 5HDCA 4NXEA 5EOOA 1JNUA 3NY4A 3C38A 1T18A 2I9VA 3Q81A 4OH0A 4BWIA 2WKEA 3F1PB 1LSXA 3UPPA 3W4PA 1K6SA 3VOLA 4K0XA 4OOLA 2INWA 5HAIA 4EETB 4CLCE 4WMCD 2HP5A 1NYMA 3HLBA 4FUWA 4XT2A 1FCOA 2G7UA 4Y3IA 4BBTA 3DBAA 3WS1A 4U3TA 3OPLA 3Q82A 1EW0A 3CMZA 3QP8A 5FI6A 1MPLA 3ZNYA 4G3KA 1JWVA 3EQUA 1TS6A 2VV7A 3IWIA 4IJGA 1TEMA 3HLDA 3BYDA 2ZM0A 5CHJA 3BFGA 1ONHA 5F1GA 1MWRA 1DRMA 3BFEA 3SOIA 5DTTA 1XA7A 3IBRA 3HVFA 2K2NA 5HWTA 2ZQAA 3T4KA 4KG6A 1ES5A 4U0TA 1T1CA 5KZHA 4BBVA 1G6OA 1L0GA 1W8YA 3ZG5A 4CLCA 4I39A 4HHDA 1OJGA 2Y79A 2XR0A 4E3KA 3DWZA 3KSFA 1GHPA 5KMWA 3DTMA 1NLYA 4NK3A 4HBTA 4GDBA 3DTEA 5U47A 1MY8A 2Z6CA 3PBSA 4LRXC 3V67A 1VQQA 3LY3A 3QP1A 2GDNA 2A3UA 5AQ7A 1TDGA 3F1OB 5DKLA 1OJ5A 2J3TC 4C3QA 4P85A 4I5SA 4P6BA 1L0DA 3HUMA 5FQMA 4R3BA 3AGDA 4GD6A 2Y55A 1U60A 4KZ8A 4WMCA 3TOIA 3IX3A 3B47A 1M40A 3MXSA 2A2LA 3A0SA 2XRNA 3D72A 3LO7A 3O86A 4WBGA 3G30A 3CITA 4E6XA 3VV4A 3H82B 4KQOA 4RX2A 3LIAA 4OONA 1LSWA 4EV4A 2G2WA 2KLIA 2EXAA 3D3OA 5FATA 5F68A 5CGWA 2R9WA 3VP2A 3NOUC 1BYWA 1W8QA 5M19A 5DF7A 4GHIA 3GTCA 2Q0OA 5A8BA 4NEED 2Y91A 2HJEA 3ZCZA 3IH9A 3ZNTA 1FR6A 3MFDA 5CERA 1YLJA 3LGOA 3R4KA 3UB8A 1OMEA 5TJJA 3DTIA 4DKIA 2ZJ9A 3T12B 4I38A 5FEGA 2ZC3B 3S7OA 3KYZA 3MQOA 1IOUA 2Y2OA 3KSHA 2XH9A 4OQGA 1YMSA 3MZEA 4QY6A 3QP6A 5F83A 1GA9A 4G3WA 5GHYA 4DXCA 3LY4A 1GSWA 3R7WA 1XJ2A 2ZQCA 1YMXA 4CLCC 1NRFA 4EQ1A 1Q2QA 1YLZA 3P98A 5HPFA 3T50A 1XPBA 1QMFA 5I5LA 2FFYA 2PU4A 2Y2HA 5MC7A 1K56D 4HI4A 3F1NB 2XFSA 4WEKA 4B88A 2QPNA 1BUEA 2O99A 5KSHA 1S4RA 3NDEA 3OPPA 4EEUA 4GNUA 4R70A 1EROA 1MXOA 2WAEA 4X56A 1VB6A 2L1MA 3HCYA 2WGWB 4MDZA 3UE0A 1L3LA 1VETA 3BW6A 4RQ9A 5F69A 2YKHA 2EX2A 1YPRA 3MKEA 1S66L 1OTDA 2XROA 4LCMA 3FKVA 3LIBA 3S7QA 3B3XA 5KSCA 2O0YA 1FOFA 4RX3A 1D7EA 1KGFA 1PI4A 2LB9A 1D1JA 4Y5FA 2Y2LA 2VGLS 5F82A 3IF6B 5TBMA 4L9FA 2W3DA 4YINA 3V3RA 3A3IA 2ZMVA 3UY6A 3RXXA 4Y0UA 4YNRA 4HESA 1HZOA 3S7PA 3VOYA 4EERA 4JGPA 1C3BA 5A93A 2W3EA 3A0RA 2B95A 3V3SA 4H8RA 4CPKA 3PR6A 3FWLA 2L0WA 4GB7A 3PBQA 4D2OA 4BMWA 2UV0E 2OV5A 3ZG9B 2RCXA 1YLYA 2P74A 4OP5A 1ODVA 5TR7A 3S4XA 4K0WA 2R9XA 3IXBA 1MWUA 4E3JA 3IXHA 4WL9A 3FG8A 4IVKA 4PKYA 3VP3A 5AVEA 5JYPA 1YLPA 1I5QA 4Z9QA 3LR0A 4ETXA 4WZ4A 4JXWA 4ESPA 1LL8A 3NOTC 4DE3A 1CK3A 1MKMA 4EBPA 4BL2A 1CF0A 2VX8A 1XJ3A 4OOMA 3UE1A 1YQSA 1L0EA 2X71A 2W27A 1P9WA 1PIOA 1DJAA 2VLGA 4B9OA 4KZAA 3EEHA 1K55A 3LR4A 4O8GA 1UWPX 5HL1A 2VEAA 3VSLA 2NUPC 4UA7A 4GHIB 1ESUA 3F1PA 3H7WA 2XA7M 3CI6A 4WM9A 5LBRA 5HW3A 1HVBA 4JXVA 5E2FA 2WGIA 3LR5A 3BFFA 5TGFA 2Z6DA 3PTEA 5EM1A 2YKFA 1N9LA 3MF0A 4WYYA 5CECA 1JVJA 2J9OA 5EVLA 5FDHA 4WEJA 1I2SA 4LENA 3MBZA 3T1SA 2W3HA 5A91A 1VM1A 3BQ8A 5AQ9A 1CQAA 5F1FA 5EFWA 3KO6A 3L7HA 2VJWA 3MR0A 4GZBA 3Q1FA 2JC7A 2I72A 3ZVWA 1CEFA 3OOVA 3G6OA 3V39A 3NULA 4E04A 3I7JA 4II7A 4Y15A 4GDNA 1OTBA 3HLFA 1F9IA 4ZTKA 3S22A 4WN5A 2WK0A 1J9MA 1L0FA 3ZDJA 3A3FA 2GNXA 5EVEA 5GL9A 4S2OA 4MEZA 1BLCA 2G2UA 4BENA 5FQJA 2IWDA 3WRZA 3T1QB 3BFCA 4HH3A 1S1ZA 4EW7A 3NOPC 3HJKA 4K91A 4HNBA 1XFQA 4YWZA 1Q2PA 5L09A 1J3WA 4FH2A 1XXMA 4WZ5C 4PMAA 3FYZA 3C5AA 3ZG0A 4Y7PA 1ES2A 1UWNX 4LRYC 4S2IA 1RP5A 5GHXA 5HAQA 2WUQA 2VGKA 4DE0A 4N9LA 1DP8A 3DTKA 4PAUA 2Y2NA 4R1GA 4GS9A 4OQHA 5FQIA 5EV0A 3BRMA 5HSQA 4QY5A 3MXRA 3IX4A 1TF1A 2EWWA 3IHAA 3ZVTA 4ID4A 5DF9A 3PXPA 4JLFA 2JKFA 3UB6A 1TS0A 1CEGA 3N6IA 5GLAA 2OLVA 1L2SA 1Y54A 5GLBA 3ZGAB 4B93A 4Q0HA 5G4YA 4JGRA 4HP4A 2VV8A 2ZC7A 4IBXA 1DY6A 5FA7A 3OCLA 4MCWA 1GCEA 1P97A 1WYBA 4CQHA 1KDSA 3D4FA 2HDQA 2ZM8A 4S2MA 1ERQA 3BFDA 4S2KA 2HDRA 5AQAA 4N1HA 3F1OA 1KVMA 3MSHA 1TVFA 3DAVA 3SH9A 2PR5A 3RFBA 3DWKA 3VE3A 1YSPA 3OCNA 4F94A 1SDEA 3Q7ZA 4PM8A 2XD5A 3NJAA 1PW1A 4Q0JA 4X55A 1UGUA 1BLHA 4MBFA 2ZD8A 1OTEA 1S4SA 1SCWA 5FSRA 1HD8A 1LI0A 3FZCA 5M1AA 2JKRI 1FILA 2IA2A 4S2LA 1JTDA 1H0MA 4X1MA 4MN5A 4NXFA 3G34A 1K4EA 5A90A 3CHWP 5EM0A 2QKPA 2V9AA 1XJ6A 2Z2MB 2ZM2A 4BL3A 3LEQA 3OC2A 4HH2A 1ZG6A 3T4LA 3HUOA 4IUHA 3V5MA 2JHEA 1Z09A 4HIAA 2PRFA 3SS5A 2IWBA 1FCMA 2HV1A 4L9GA 5IS1A 1F5MA 5EUAA 2W3GA 3A3DA 3VE4A 4ZJ3A 2M7VA 3WWXA 2W1RA 3W4QA 3A3JA 4FD8A 4CLCD 4JXGA 3QP4A 5C5KA 5BOHA 1VEUA 2UWXA 3C7VA 3QP2A 3IWQA 2OAP1 3OLOA 4KUOA 1IYOA 3M2JA 2ZQ8A 1H3QA 4EUZA 3T4TA 4ZRRA 4F3LB 1SKOA 1KE3A 2H10A 1MWSA 2R78A 4DN0A 3IH8A 4OPZA 4ETZA 4UA9A 3SH8A 1DJCA 4AFIA 3EWKA 3HLWA 4H6JB 3EGDC 3UDIA 4I3IA 3FPWA 5HD5A 1F98A 2P04A 2VGJA 5TBMB 1EWZA 4EQIA 2DNSA 4OP8A 5J4EA 4KZ7A 2H0TA 4EU0A 4K08A 4DRTA 4DXBA 2ZLYA 3AGFA 3Q07A 3EOIA 2H0YA 2EFUA 3CG5A 2XQZA 1NJ4A 2Y4AA 4DMZA 4ZBEA 1NZUA 1QMEA 5IU1A 2E8JA 3G32A 1PYYA 4U0XA 5DFYA 4NG2A 4DF6A 1KOUA 2XEPA 3T1XA 4B4XA 2EWVA 2P9VA 5E2HA 3KYQA 3IF6C 3E2KA 1GSVA 5FAPA 3CWFA 4KQQA 4ARZA 4HBUA 4OQIA 1GA0A 1I2WA 1W5DA 3CAXA 4CLCB 1YKDA 5HDSA 3LIFA 4QJGA 1MWTA 4S2NA 2QHKA 2EX9A 1KGEA 1G6AA 1LI9A 4EBLA 3IS2A 3RJUA 4PM7A 4WELA 3SZTA 4RA7A 2OLUA 2PHYA 3KYEA 3FC7A 1N9NA 4KENB 3CUEC 3OZHA 3MFXA 4E6WA 5HD3A 3T4JA 2VGLM 4P87A 1LSVA 2JBFA 3ZYTA 4GW9A 1FSYA 4KG2A 5J8XA 4ME4A 4EEPA 1MZUA 5HWVA 3OPRA 1GSXA 4BQMA 1G5UA 2HGVA 1BT5A 2PT7A 3N8RA 1XGIA 2HDUA 3MZDA 4MN7A 1XX2A 3GR2A 3C4OA 2EA9A 1PWCA 4LGWA 5TFQA 1FIKA 4GJ4A 4HY8A 2QMIA 4FCFA 3LI9A 3PYPA 3SS3A 1K54A 4JGQA 4EWFA 1FR1A 2FH5A 3S7NA 5FQ9A 4JGOA 4X53A 3GECA 2JKTI 4QHCA 3UMDA 2ZMFA 3IF5A 3UDFA 1GHMA 2VA0A 4UAAA 5IT5A 2BTFP 1NLZA 1Y4OA 2Y59A 4YFMA 3W8KA 2OAQ1 3N8SA 4FSFA 1RCJA 4I3JA 3CPTB 4O01A 4WF0A 1XP4A 2PBDP 3LIEA 1FSWA 4MBKA 1DJBA 3CLOA 1AWIA 4LV1A 3N7WA 1S0WA 2EFXA 4OLGA 4Y17A 1E25A 1T1AA 3L9KA 3E4OA 4N92A 4D60A 3R7WB 4R23A 3PAEA 5EVIA 1IEMA 4Z1WA 3PBOA 2W1TA 1V9ZA 1IKIA 3MMHA 3ISGA 3P09A 1TS8A 2Q9NA 5FEFA 1PZOA 3FKWA 4RVAA 2W3FA 4MLLA 2Z2LB 4BLMA 3PBTA 1RGYA 4GN2A 2ZBBA 3SS4A 2WKHA 1GHIA 1A0KA 2Y2KA 3BM6A 4OVDA 4GLQA 3K3CA 5CTNA 5EVIC 4GOGA 2HZ5A 5AJGA 4LCLA 4O0PA 1XA1A 1KE4A 5EVIB 3LI8A 1XGJA 3NIAA 5A92A 2A24B 3C7UA 2J7VA 3G35A 2EXBA 1K0KA 5GHZA 2ZQDA 2XLNA 3UO9A 4ZAMA 5HPIA 4BJPA 3VOZA 4P6ZS 4HJ6A 1K57A 4JPMA 1DP9A 2JN7A 3Q7VB 1F2KA 3C2WA 2V2FF 3ZG7B 2VK3A 1S1YA 1CI8A 4Q8IA 3NCKA 4PPRA 5J7EA 2V8CA 3NHQA 4KQRA 3H82A 2P7JA 4KZ6A 2DMWA 4HJ3A 3T1RA 3HLGA 3LFVA 1G68A 1T19A 4E3MA 4NKPA 2XGNA 3TE8A 3JPUA 2WKRA 4QWOA 3LICA 1OPXA 4UQIS 5JYOA 4LRZE 1BULA 3RH8B 3E0YA 1Z6FA 3O88A 3V50A 2Y2JA 3BWLA 2Y2GA 4DDSA 3IWOA 2WYXA 2XK1A 2W0NA 4R4RA 1RGZA 3BECA 3VMAA 2JE5A 2Y2QA 1JWPA 2WGWA 5J3WA 3TJZC 3TRCA 3ICYA 2B02A 4JF6A 1ESIA 5EECA 4LV0A 2BLSA 3TW8A 2XDMA 4OLDA 4WUJA 3VP0A 2JKRM 2ZQ9A 3M6BA 1MBLA 1YAXA 1ALQA 4M3KA 2HP9A 4GD8A 4X6TA 3MXQA 4WZ5A 5HFOA 3RXWA 1W63M 4KZ5A 1T1BA 4Y0OA 3VFHA 1HLUP 3JYIA 3M2KA 1WYCA 3ITBA 3OPHA 5DJUA 5HAPA 1EI5A 4PM9A 2Y2PA 5FQQA 1FCNA 5DTSA 1SDNA 3G2YA 3T4SA 4OPYA 2Y2MA 2CMNA 3LUQA 1H8MA 2MJ6A 2RL3A 1TS7A 4R0QA 2ZL1B 2V1AA 4YOFA 1W7FA 3RTYA 4A5RA 1IKGA 1O07A 2L4RA 1NXYA 4FOFA 2VKSA 4KZ3A 1N4OA 1HTZA 3IQAA 2HF6A 4ZJ2A 2EX6A 2AVXA 4JXSA 2GX5A 3C30A 3VP1A 1KVLA 5G4ZA 2JKTM 3H9WA 2ZQ7A 3OBFA 5AQBA 2OWJA 1W79A 3BY9A 3QNCA 5DTKA 1ZHHB 2WZXA 3LYXA 5FQKA 4C6YA 1JWZA 1P9RA 1PWDA 1OTIA 3WS5A 5GLCA 3H7WB 4HOIA 2PBYA 4X68A 2ZL1A 5F5YA 1K25A 2PD7A 1PWGA 3QHYA 1JTGA 5EVID 1VEUB 3HJIA 4FH4A 3LEZA 3MS6A 1BTLA 3WS0A 4RYEA 1BLSA 3B33A 5CEBA 2J3WA 2PAVP 3N4IA 4NETA 4F3LA 1H8YA 4G3VA 5FASA 2X02A 4BD1A 1NY0A 2GJ3A 1XJ4A 5FI7A 3WRTA 3P7NA 2OOLA 1ERMA 5F6AA 1O7EA 1H8ZA 3NECA 3PHYA 4LV2A 2M1CA 4KZ4A 5HWWA 3U2AA 4Y2FA 1ZC2A 2ZMAA 2XSSA 2Q9MA 5E43A 4IVIA 3B42A 2EX8A 4QPRA 1S67L 1IELA 3KX0X 2QZ6A 1E3UA 4I3AA 3C8CA 4PKYG 3BEBA 4UEYA 2ZC5B 1LL9A 5CGSA 2H28A 2QJ5A 5HARA 1ZTUA 3MQ0A 4JF5A 1OTAA 1TD5A 2DRWA 3HLCA 1SHVA 4MNRA 2M7UA 3UNWA 3CPTA 1YT4A 1ES4A 2QJ7A 4EUVA 2V0UA 2E8IA 4LFUA 1PNEA 3PAGA 4DJ3A 2P08A 3GQZA 3UPNA 2J8YA 1BZAA 4N1XA 2OSUA 3SW1A 4E3LA 5AVFA 3UB5P 2C6WB 4E3NA 3E4PA 5FAOA 3MJQA 1LT0A 2LB5A 4IBRA 2W1TB 2A49A 4HQAA 4UHUA 1LLBA 4JKTA 2QYBA 2XA7S 4MN6A 4PM5A 4C75A 2V1BA 5CTMA 1KGGA 1Y28A 3TSGA 3BY8A 1ES3A 1TDLA 4P6ZM 3NC8A 3T4QA 4NXGA 1X0OA 1PFLA 4JF4A 3GVBA 3NDGA 4OKPA 4ZJ1A 3A0VA 1K54C 4OPRA 3E98A 4EXOA 1PZPA 4L0LA 3QNBA 1OT9A 3WS4A 1IYQA 3HL9A 3GSGA 1WA9A 1K38A 1IYSA 1CJFA 3D9YA 1MC0A 2Y2IA 2C5WB 4R3JA 1YLWA 3G4PA 1FQGA 5HX9A 2V1ZA 5DKKA 1BSGA 3KSGA 3VSKA 1KDWA 3ZG8B 4H6JA 2B18A 2PD8A 5KIZA 3IBJA 1E3UD 2ZC4B 3UDXA 3A3EA 2BASA 2D02A 3N8LA 4DE2A 3VFFA 3ZQ5A 3HREA 1MKIA 4S2PA 3UN7A 5L2FA 4UQIM 4X1LA 5FAQA 1XKZA 2KDKA 2VV6A 2O9CA 4ZDXA 3CZDA 3CUEA 1BLPA 2V20A 2K7SA 5FDSA 2B5RA 5HDDA 3LR3A 3ULFA 1IFQA 2WZZA 3IT9A 1ZG4A 4OPQA 2WGVA 1IYPA 2XD1A 3GV9A 1XFNA 4HP9A 4KQDA 4L9EA 4HJ4A 4NXBA 3EEAA 5CXWA 1PW8A 4R3AA 5CHMA 3UB9A 3VP4A 5HZHA 4Q0IA 5CHUA 4Y0TA 4GKUA 5EPHA 3O87A 3SH7A 2KOIA 2HPBA 4X69A 2O9BA 3IS2B 3EGXC 5DVAA 5FL3A 3QP5A 5E2GA 1K55C 4M4XA 1PRQA 1P0ZA 2PDRA 4LV3A 2P9VB 1E4DA 3E2LA 3K3DA 5M18A 4BBUA 4KUKA 4R38A 3IHBA 4ARZB 4JBFA 2J9PA 1S6RA 3UPOA 3MQQA 3IF6A 1N9BA 2HDSA 2XFTA 2WKIA 3W4OA 4IHQA 1M6KA 3P01A 4WLAA 2V8FA 1SKFA 2ACGA 1K57C 3MKFA 3UB7A 2Y8HA 3MZFA 2NUTC 4EESA 4KZ9A 1CI9A 4E3IA 3W2ZA 4S2NC 5DFXA 4XT2B 3C4PA 3AGEA 4QD4A 4P0MA 2IWCA 2O9AA 4B4ZA 4XXRA 2J3TD 4OOYA 2J80A 5DF8A 3M6HA 3HUNA 4S2JA 1OT6A 5CRFA 2KX6A 5CX7A 3PBRA 4XUZA 2ZOIA 4N9KA 1N9OA 2K31A 1PI5A 4X25A 1AXBA 3UE3A 2HJ9C 4MMNA 1WE4A 3JVUA 2V0WA 3Q7VA 4IUKA 3O5YA 1SKOB 2DCFA 3DW0A 4BD0A 3HLEA 2A24A 2H5SA 2PYRA 4EBNA 2CC1A 4R4SA 3G31A 4QB8A 4DE1A 1G28A 1YSQA 1STZA 4R6LA 1NZOA 3EQVA 3F1NA 4FTXA 5E2EA 3WS2A 3FPVA 3NBLA 2WADA 2JCHA 3ITAA 1ZKJA 3NI9A 2JKGA 3PBNA 2BG1A 4O7DA 5HL6A 1K6RA 4CJNA 4OQ0A 3KSIA 1H5XA 4KG5A 2QWSA 5I94A 4Y13A 3K2NA 3T4OA 3GMWA 3GRJA 1K4FA 3S1YA 2WAFA 3BQAA 2WKQA 2VZWA 4GS9B 4PM6A 3ZFZA 4GCZA 1NWZA 4HEFA 4E3OA 1W63Q 4PHTA 1DP6A 1SZVA 5DJTA 3BLSA 1ACFA 2ZOHA
chains in the Genus database with same CATH topology
5HD5A 1F98A 2P04A 5TBMB 3E4QA 2HF6A 4LLOB 5J4EA 2GX5A 3C30A 3GDIA 4EU0A 4WL9A 5L8MA 3FG8A 4K08A 5G4ZA 2JKTM 2PYPA 4PKYA 3H9WA 5AVEA 3EOIA 3OBFA 2PR6A 3UE6A 3JVVA 2OWJA 3BY9A 1ZHHB 3LYXA 4DMZA 3LR0A 4ETXA 2GZAA 5IU1A 1P9RA 1OTIA 5DFYA 3H7WB 3UMEA 2WKPA 4HOIA 2D01A 1KOUA 1LL8A 5F5YA 2PD7A 3NOTC 3LIDA 1V9YA 2EWVA 3KYQA 1MKMA 3HJIA 1GSVA 3CWFA 4ARZA 4DJ2A 2VX8A 1VHMA 1XJ3A 4OOMA 3B33A 3CAXA 4CLCB 1YKDA 5HDSA 1D06A 3LIFA 2W27A 1P9WA 2J3WA 4LPZA 1NRJA 3BJNA 2VLGA 2QHKA 4B9OA 2FZ0A 4F3LA 3EEHA 3IS2A 4G3VA 4WELA 3LR4A 5K5BA 2OWHA 4O8GA 1UWPX 2VEAA 2GJ3A 2NUPC 2PHYA 4GHIB 5HDCA 4NXEA 1XJ4A 3F1PA 3FC7A 3P7NA 2OOLA 5F6AA 3H7WA 1N9NA 3CUEC 2XA7M 1JNUA 3PHYA 2M1CA 5HWWA 3C38A 1T18A 2I9VA 3MFXA 3U2AA 4Y2FA 4BWIA 3CI6A 2XSSA 3F1PB 5LBRA 5HD3A 1LSXA 3T4JA 3B42A 2VGLM 3VOLA 4QPRA 1LSVA 1S67L 3LR5A 4OOLA 3ZYTA 2INWA 3KX0X 4GW9A 4EETB 4CLCE 2Z6DA 4I3AA 4ME4A 3C8CA 4PKYG 4EEPA 4UEYA 4XT2A 1MZUA 5HWVA 2YKFA 2G7UA 1GSXA 2H28A 2QJ5A 4Y3IA 1ZTUA 1N9LA 3DBAA 3MF0A 4BBTA 3MQ0A 1OTAA 2HGVA 2PT7A 1TD5A 2M7UA 1EW0A 4WEJA 4MN7A 2EA9A 4GJ4A 2QJ7A 4EUVA 2V0UA 2W3HA 4HY8A 4G3KA 4DJ3A 2P08A 3EQUA 3LI9A 3PYPA 3BQ8A 1TS6A 2VV7A 3SW1A 4IJGA 5EFWA 4JGQA 3KO6A 2VJWA 3MR0A 2FH5A 5AVFA 3S7NA 3E4PA 4JGOA 3GECA 3MJQA 1LT0A 2LB5A 3OOVA 2JKTI 2W1TB 3G6OA 1DRMA 4HQAA 3UMDA 2ZMFA 2QYBA 2VA0A 4E04A 5IT5A 2XA7S 4II7A 1NLZA 4MN6A 1OTBA 3IBRA 1F9IA 2V1BA 2K2NA 4WN5A 5HWTA 2OAQ1 3T4KA 4FSFA 1Y28A 4I3JA 1T1CA 3BY8A 2GNXA 4O01A 4WF0A 4BBVA 4P6ZM 3T4QA 1G6OA 4NXGA 3LIEA 1X0OA 4CLCA 4I39A 3CLOA 4HHDA 1OJGA 2Y79A 3KSFA 3A0VA 1T1AA 3E98A 1NLYA 3E4OA 4EXOA 4HH3A 1S1ZA 4L0LA 4EW7A 3NOPC 3R7WB 2Z6CA 3PBSA 3HJKA 1OT9A 4LRXC 4HNBA 3V67A 4Z1WA 3PBOA 2W1TA 1V9ZA 1WA9A 3F1OB 1XFQA 3MMHA 5DKLA 1MC0A 1OJ5A 1TS8A 2J3TC 4YWZA 4I5SA 2W3FA 5DKKA 3KSGA 1UWNX 4H6JA 2B18A 2PD8A 5KIZA 3IBJA 4LRYC 3PBTA 2ZBBA 3B47A 2BASA 2A2LA 2D02A 1DP8A 4PAUA 3A0SA 2XRNA 4GLQA 3ZQ5A 3K3CA 3D72A 4GS9A 4UQIM 3CITA 3VV4A 2KDKA 3H82B 4KQOA 3LIAA 2VV6A 1LSWA 2O9CA 5AJGA 5HSQA 4O0PA 3CUEA 1TF1A 2EWWA 2KLIA 3D3OA 5F68A 2K7SA 3LI8A 5DF9A 3PXPA 3UB6A 3NOUC 2A24B 5HDDA 1TS0A 1BYWA 3LR3A 3ULFA 1IFQA 4GHIA 5A8BA 1XFNA 5HPIA 4HP9A 4KQDA 4BJPA 4L9EA 4NEED 4B93A 4HJ4A 4NXBA 3EEAA 4P6ZS 4Q0HA 4HJ6A 2HJEA 5G4YA 4JGRA 1DP9A 4HP4A 2JN7A 2VV8A 4R3AA 3UB9A 3R4KA 3UB8A 5HZHA 4Q0IA 3OCLA 4MCWA 5TJJA 3C2WA 1P97A 4CQHA 4I38A 1S1YA 3S7OA 2KOIA 3KYZA 3MQOA 2O9BA 3IS2B 5J7EA 1IOUA 3EGXC 3KSHA 3NHQA 5FL3A 3F1OA 3H82A 2P7JA 2DMWA 4HJ3A 2PR5A 4M4XA 3RFBA 1P0ZA 2PDRA 3VE3A 3K3DA 4BBUA 3LFVA 1YSPA 3OCNA 4KUKA 4R38A 1T19A 4NKPA 3TE8A 4ARZB 2WKRA 3LICA 1OPXA 4G3WA 3MQQA 3NJAA 4UQIS 4Q0JA 4LRZE 3RH8B 4IHQA 3E0YA 3P01A 1UGUA 4WLAA 1GSWA 3R7WA 1XJ2A 3UB7A 4CLCC 1OTEA 2Y8HA 1S4SA 2NUTC 4EESA 4EQ1A 3BWLA 5HPFA 3T50A 5I5LA 3W2ZA 2JKRI 2IA2A 5DFXA 4XT2B 2W0NA 5MC7A 4HI4A 3F1NB 4WEKA 4MN5A 2O9AA 4NXFA 2J3TD 2O99A 5J3WA 5KSHA 1S4RA 2J80A 4EEUA 4R70A 3TJZC 1OT6A 2QKPA 2KX6A 1XJ6A 2V9AA 1VB6A 3PBRA 5CX7A 2L1MA 2ZOIA 3HCYA 3TRCA 3ICYA 2B02A 4MDZA 1N9OA 3OC2A 2K31A 4HH2A 3T4LA 3UE3A 2HJ9C 4IUHA 3BW6A 4MMNA 4RQ9A 5F69A 2JHEA 3JVUA 2YKHA 2V0WA 4HIAA 3TW8A 4WUJA 4IUKA 3O5YA 1S66L 2JKRM 1OTDA 2XROA 2HV1A 4L9GA 3LIBA 5IS1A 2A24A 3S7QA 1YAXA 1F5MA 2PYRA 2O0YA 1G28A 1YSQA 2W3GA 1STZA 3MXQA 3VE4A 4R6LA 1W63M 3F1NA 3EQVA 1T1BA 2W1RA 2M7VA 1D7EA 3FPVA 2LB9A 4Y5FA 2VGLS 3PBNA 4CLCD 5DJUA 5HL6A 5TBMA 4L9FA 2W3DA 5C5KA 3KSIA 2ZMVA 2OAP1 3OLOA 2QWSA 4KUOA 4YNRA 3S7PA 4EERA 4JGPA 3T4SA 2CMNA 3K2NA 3LUQA 1H8MA 3T4OA 1H3QA 2MJ6A 2W3EA 3A0RA 3T4TA 4ZRRA 4F3LB 3BQAA 1TS7A 2VZWA 2WKQA 4GS9B 2R78A 3PR6A 4DN0A 2L0WA 4GCZA 4ETZA 2V1AA 3PBQA 4YOFA 3RTYA 1NWZA 4BMWA 2L4RA 1W63Q 1DP6A 4PHTA 5DJTA 3EWKA 4FOFA 4AFIA 1ODVA 2ZOHA 4H6JB 2VKSA 3EGDC 4I3IA 3FPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HD5 A;  1F98 A;  2PD8 A;  2W0N A;  5TBM B;  5AVE A;  5KIZ A;  1N9L A;  4LRY C;  4BBT A;  1OTA A;  3E4Q A;  4HI4 A;  3F1N B;  2ZBB A;  4MN5 A;  4LLO B;  4NXF A;  5J4E A;  5J3W A;  2BAS A;  1EW0 A;  1S4R A;  2D02 A;  2J80 A;  1DP8 A;  4EEU A;  3GDI A;  2EA9 A;  4WL9 A;  3A0S A;  4R70 A;  3FG8 A;  3ZQ5 A;  3K3C A;  2QJ7 A;  3D72 A;  4K08 A;  1OT6 A;  2V0U A;  2QKP A;  5G4Z A;  4GS9 A;  2KX6 A;  1XJ6 A;  2V9A A;  4HY8 A;  4PKY A;  2PYP A;  1VB6 A;  4DJ3 A;  3H9W A;  2KDK A;  2L1M A;  2ZOI A;  3H82 B;  3LIA A;  2VV6 A;  1LSW A;  2PR6 A;  3ICY A;  5HSQ A;  2B02 A;  3LI9 A;  1N9O A;  3PYP A;  3UE6 A;  1TS6 A;  2VV7 A;  2OWJ A;  3SW1 A;  5F68 A;  4HH2 A;  3BY9 A;  2K7S A;  3LI8 A;  5EFW A;  3LYX A;  4JGQ A;  3UB6 A;  3NOU C;  5IU1 A;  2A24 B;  3MR0 A;  1TS0 A;  1BYW A;  2JHE A;  4RQ9 A;  2YKH A;  5F69 A;  2V0W A;  4HIA A;  5AVF A;  1OTI A;  3ULF A;  3H7W B;  4WUJ A;  3UME A;  2WKP A;  1S66 L;  3E4P A;  4HOI A;  4JGO A;  3GEC A;  3MJQ A;  1LT0 A;  2D01 A;  1KOU A;  1OTD A;  4GHI A;  1LL8 A;  5F5Y A;  2PD7 A;  3NOT C;  3LID A;  5A8B A;  1XFN A;  3G6O A;  1V9Y A;  1DRM A;  2HV1 A;  4L9G A;  3LIB A;  4H6J A;  4HQA A;  3UMD A;  2A24 A;  5IS1 A;  4HP9 A;  4KQD A;  2PYR A;  3HJI A;  4L9E A;  4E04 A;  1GSV A;  4HJ4 A;  4NXB A;  5G4Y A;  3CWF A;  4HJ6 A;  1G28 A;  4MN6 A;  3MXQ A;  3VE4 A;  4JGR A;  1DP9 A;  4HP4 A;  4DJ2 A;  1OTB A;  2JN7 A;  2VV8 A;  3IBR A;  1F9I A;  4R3A A;  4R6L A;  3UB9 A;  2V1B A;  1XJ3 A;  1T1B A;  3F1N A;  4WN5 A;  3B33 A;  1D7E A;  3CAX A;  5HWT A;  3UB8 A;  5HDS A;  5HZH A;  1D06 A;  3LIF A;  2W27 A;  4LPZ A;  1Y28 A;  3C2W A;  1P97 A;  1T1C A;  3BY8 A;  4I3J A;  2VLG A;  4WF0 A;  4BBV A;  2QHK A;  4I38 A;  4NXG A;  4B9O A;  3LIE A;  1X0O A;  3EEH A;  5DJU A;  1S1Y A;  4F3L A;  5TBM A;  3IS2 A;  4L9F A;  3MQO A;  4I39 A;  3IS2 B;  3CLO A;  5J7E A;  4HHD A;  1OJG A;  2OWH A;  3NHQ A;  1UWP X;  3F1O A;  3H82 A;  2P7J A;  2VEA A;  2GJ3 A;  3OLO A;  2PHY A;  2QWS A;  4GHI B;  3A0V A;  4HJ3 A;  2PR5 A;  4KUO A;  4M4X A;  5HDC A;  4NXE A;  4EER A;  1P0Z A;  1T1A A;  1XJ4 A;  3F1P A;  2PDR A;  2OOL A;  3FC7 A;  3P7N A;  2CMN A;  4JGP A;  3H7W A;  3E4O A;  3LUQ A;  1N9N A;  5F6A A;  3K3D A;  4HH3 A;  4EXO A;  4BBU A;  1JNU A;  1S1Z A;  3PHY A;  2M1C A;  3A0R A;  4KUK A;  1T19 A;  4R38 A;  5HWW A;  4EW7 A;  1T18 A;  2I9V A;  3MFX A;  2Z6C A;  3NOP C;  4F3L B;  3HJK A;  3VE3 A;  5HDD A;  1OT9 A;  2WKR A;  4LRX C;  1TS7 A;  2WKQ A;  4GS9 B;  4HNB A;  3F1P B;  3LIC A;  2R78 A;  2L0W A;  1LSX A;  3MQQ A;  3NJA A;  5HD3 A;  1V9Z A;  1WA9 A;  4GCZ A;  2V1A A;  4LRZ E;  3F1O B;  1XFQ A;  3RH8 B;  3VOL A;  4WLA A;  1NWZ A;  1UGU A;  5DKL A;  3RTY A;  1LSV A;  1S67 L;  1GSW A;  1OJ5 A;  1TS8 A;  1XJ2 A;  3UB7 A;  4YWZ A;  2INW A;  3KX0 X;  4GW9 A;  1OTE A;  2L4R A;  4I5S A;  4XT2 B;  4EET B;  2Z6D A;  1S4S A;  4I3A A;  4EES A;  1DP6 A;  4EQ1 A;  3BWL A;  3C8C A;  3EWK A;  5DJT A;  4PKY G;  1ODV A;  4EEP A;  5DKK A;  2ZOH A;  4H6J B;  4XT2 A;  5I5L A;  3T50 A;  1MZU A;  5HWV A;  2YKF A;  4I3I A;  1UWN X;  1GSX A;  2H28 A;  2QJ5 A; 
#chains in the Genus database with same CATH topology
 3E4Q A;  3U4L P;  3IXD A;  4LLO B;  4XUX A;  3BLM A;  3IXG A;  5EOE A;  3FV7 A;  2HP6 A;  3GDI A;  5L8M A;  3IX8 A;  2FFF B;  3O3V A;  2PYP A;  3ZHH A;  2PR6 A;  3CJM A;  5L07 A;  3UE6 A;  4KZB A;  3JVV A;  4UA6 A;  3G2Z A;  5CGX A;  2GZA A;  2PU2 A;  2X01 A;  5GLD A;  5EE8 A;  3UME A;  2WKP A;  4DDY A;  2D01 A;  3LID A;  3LCE A;  5L10 A;  1V9Y A;  4IED A;  1K56 A;  1VET B;  5G18 A;  3TG9 A;  1NYY A;  4DJ2 A;  4MBH A;  2ZC6 B;  1VHM A;  1YLT A;  5FI2 A;  1D06 A;  5IHV A;  1YM1 A;  5CED A;  4LPZ A;  1NRJ A;  3BJN A;  2XF3 A;  1KE0 A;  2FZ0 A;  1ONG A;  4QU3 A;  3HBR A;  1LL5 A;  5K5B A;  2OWH A;  1LHY A;  5D3O A;  5HDC A;  4NXE A;  5EOO A;  1JNU A;  3NY4 A;  3C38 A;  1T18 A;  2I9V A;  3Q81 A;  4OH0 A;  4BWI A;  2WKE A;  3F1P B;  1LSX A;  3UPP A;  3W4P A;  1K6S A;  3VOL A;  4K0X A;  4OOL A;  2INW A;  5HAI A;  4EET B;  4CLC E;  4WMC D;  2HP5 A;  1NYM A;  3HLB A;  4FUW A;  4XT2 A;  1FCO A;  2G7U A;  4Y3I A;  4BBT A;  3DBA A;  3WS1 A;  4U3T A;  3OPL A;  3Q82 A;  1EW0 A;  3CMZ A;  3QP8 A;  5FI6 A;  1MPL A;  3ZNY A;  4G3K A;  1JWV A;  3EQU A;  1TS6 A;  2VV7 A;  3IWI A;  4IJG A;  1TEM A;  3HLD A;  3BYD A;  2ZM0 A;  5CHJ A;  3BFG A;  1ONH A;  5F1G A;  1MWR A;  1DRM A;  3BFE A;  3SOI A;  5DTT A;  1XA7 A;  3IBR A;  3HVF A;  2K2N A;  5HWT A;  2ZQA A;  3T4K A;  4KG6 A;  1ES5 A;  4U0T A;  1T1C A;  5KZH A;  4BBV A;  1G6O A;  1L0G A;  1W8Y A;  3ZG5 A;  4CLC A;  4I39 A;  4HHD A;  1OJG A;  2Y79 A;  2XR0 A;  4E3K A;  3DWZ A;  3KSF A;  1GHP A;  5KMW A;  3DTM A;  1NLY A;  4NK3 A;  4HBT A;  4GDB A;  3DTE A;  5U47 A;  1MY8 A;  2Z6C A;  3PBS A;  4LRX C;  3V67 A;  1VQQ A;  3LY3 A;  3QP1 A;  2GDN A;  2A3U A;  5AQ7 A;  1TDG A;  3F1O B;  5DKL A;  1OJ5 A;  2J3T C;  4C3Q A;  4P85 A;  4I5S A;  4P6B A;  1L0D A;  3HUM A;  5FQM A;  4R3B A;  3AGD A;  4GD6 A;  2Y55 A;  1U60 A;  4KZ8 A;  4WMC A;  3TOI A;  3IX3 A;  3B47 A;  1M40 A;  3MXS A;  2A2L A;  3A0S A;  2XRN A;  3D72 A;  3LO7 A;  3O86 A;  4WBG A;  3G30 A;  3CIT A;  4E6X A;  3VV4 A;  3H82 B;  4KQO A;  4RX2 A;  3LIA A;  4OON A;  1LSW A;  4EV4 A;  2G2W A;  2KLI A;  2EXA A;  3D3O A;  5FAT A;  5F68 A;  5CGW A;  2R9W A;  3VP2 A;  3NOU C;  1BYW A;  1W8Q A;  5M19 A;  5DF7 A;  4GHI A;  3GTC A;  2Q0O A;  5A8B A;  4NEE D;  2Y91 A;  2HJE A;  3ZCZ A;  3IH9 A;  3ZNT A;  1FR6 A;  3MFD A;  5CER A;  1YLJ A;  3LGO A;  3R4K A;  3UB8 A;  1OME A;  5TJJ A;  3DTI A;  4DKI A;  2ZJ9 A;  3T12 B;  4I38 A;  5FEG A;  2ZC3 B;  3S7O A;  3KYZ A;  3MQO A;  1IOU A;  2Y2O A;  3KSH A;  2XH9 A;  4OQG A;  1YMS A;  3MZE A;  4QY6 A;  3QP6 A;  5F83 A;  1GA9 A;  4G3W A;  5GHY A;  4DXC A;  3LY4 A;  1GSW A;  3R7W A;  1XJ2 A;  2ZQC A;  1YMX A;  4CLC C;  1NRF A;  4EQ1 A;  1Q2Q A;  1YLZ A;  3P98 A;  5HPF A;  3T50 A;  1XPB A;  1QMF A;  5I5L A;  2FFY A;  2PU4 A;  2Y2H A;  5MC7 A;  1K56 D;  4HI4 A;  3F1N B;  2XFS A;  4WEK A;  4B88 A;  2QPN A;  1BUE A;  2O99 A;  5KSH A;  1S4R A;  3NDE A;  3OPP A;  4EEU A;  4GNU A;  4R70 A;  1ERO A;  1MXO A;  2WAE A;  4X56 A;  1VB6 A;  2L1M A;  3HCY A;  2WGW B;  4MDZ A;  3UE0 A;  1L3L A;  1VET A;  3BW6 A;  4RQ9 A;  5F69 A;  2YKH A;  2EX2 A;  1YPR A;  3MKE A;  1S66 L;  1OTD A;  2XRO A;  4LCM A;  3FKV A;  3LIB A;  3S7Q A;  3B3X A;  5KSC A;  2O0Y A;  1FOF A;  4RX3 A;  1D7E A;  1KGF A;  1PI4 A;  2LB9 A;  1D1J A;  4Y5F A;  2Y2L A;  2VGL S;  5F82 A;  3IF6 B;  5TBM A;  4L9F A;  2W3D A;  4YIN A;  3V3R A;  3A3I A;  2ZMV A;  3UY6 A;  3RXX A;  4Y0U A;  4YNR A;  4HES A;  1HZO A;  3S7P A;  3VOY A;  4EER A;  4JGP A;  1C3B A;  5A93 A;  2W3E A;  3A0R A;  2B95 A;  3V3S A;  4H8R A;  4CPK A;  3PR6 A;  3FWL A;  2L0W A;  4GB7 A;  3PBQ A;  4D2O A;  4BMW A;  2UV0 E;  2OV5 A;  3ZG9 B;  2RCX A;  1YLY A;  2P74 A;  4OP5 A;  1ODV A;  5TR7 A;  3S4X A;  4K0W A;  2R9X A;  3IXB A;  1MWU A;  4E3J A;  3IXH A;  4WL9 A;  3FG8 A;  4IVK A;  4PKY A;  3VP3 A;  5AVE A;  5JYP A;  1YLP A;  1I5Q A;  4Z9Q A;  3LR0 A;  4ETX A;  4WZ4 A;  4JXW A;  4ESP A;  1LL8 A;  3NOT C;  4DE3 A;  1CK3 A;  1MKM A;  4EBP A;  4BL2 A;  1CF0 A;  2VX8 A;  1XJ3 A;  4OOM A;  3UE1 A;  1YQS A;  1L0E A;  2X71 A;  2W27 A;  1P9W A;  1PIO A;  1DJA A;  2VLG A;  4B9O A;  4KZA A;  3EEH A;  1K55 A;  3LR4 A;  4O8G A;  1UWP X;  5HL1 A;  2VEA A;  3VSL A;  2NUP C;  4UA7 A;  4GHI B;  1ESU A;  3F1P A;  3H7W A;  2XA7 M;  3CI6 A;  4WM9 A;  5LBR A;  5HW3 A;  1HVB A;  4JXV A;  5E2F A;  2WGI A;  3LR5 A;  3BFF A;  5TGF A;  2Z6D A;  3PTE A;  5EM1 A;  2YKF A;  1N9L A;  3MF0 A;  4WYY A;  5CEC A;  1JVJ A;  2J9O A;  5EVL A;  5FDH A;  4WEJ A;  1I2S A;  4LEN A;  3MBZ A;  3T1S A;  2W3H A;  5A91 A;  1VM1 A;  3BQ8 A;  5AQ9 A;  1CQA A;  5F1F A;  5EFW A;  3KO6 A;  3L7H A;  2VJW A;  3MR0 A;  4GZB A;  3Q1F A;  2JC7 A;  2I72 A;  3ZVW A;  1CEF A;  3OOV A;  3G6O A;  3V39 A;  3NUL A;  4E04 A;  3I7J A;  4II7 A;  4Y15 A;  4GDN A;  1OTB A;  3HLF A;  1F9I A;  4ZTK A;  3S22 A;  4WN5 A;  2WK0 A;  1J9M A;  1L0F A;  3ZDJ A;  3A3F A;  2GNX A;  5EVE A;  5GL9 A;  4S2O A;  4MEZ A;  1BLC A;  2G2U A;  4BEN A;  5FQJ A;  2IWD A;  3WRZ A;  3T1Q B;  3BFC A;  4HH3 A;  1S1Z A;  4EW7 A;  3NOP C;  3HJK A;  4K91 A;  4HNB A;  1XFQ A;  4YWZ A;  1Q2P A;  5L09 A;  1J3W A;  4FH2 A;  1XXM A;  4WZ5 C;  4PMA A;  3FYZ A;  3C5A A;  3ZG0 A;  4Y7P A;  1ES2 A;  1UWN X;  4LRY C;  4S2I A;  1RP5 A;  5GHX A;  5HAQ A;  2WUQ A;  2VGK A;  4DE0 A;  4N9L A;  1DP8 A;  3DTK A;  4PAU A;  2Y2N A;  4R1G A;  4GS9 A;  4OQH A;  5FQI A;  5EV0 A;  3BRM A;  5HSQ A;  4QY5 A;  3MXR A;  3IX4 A;  1TF1 A;  2EWW A;  3IHA A;  3ZVT A;  4ID4 A;  5DF9 A;  3PXP A;  4JLF A;  2JKF A;  3UB6 A;  1TS0 A;  1CEG A;  3N6I A;  5GLA A;  2OLV A;  1L2S A;  1Y54 A;  5GLB A;  3ZGA B;  4B93 A;  4Q0H A;  5G4Y A;  4JGR A;  4HP4 A;  2VV8 A;  2ZC7 A;  4IBX A;  1DY6 A;  5FA7 A;  3OCL A;  4MCW A;  1GCE A;  1P97 A;  1WYB A;  4CQH A;  1KDS A;  3D4F A;  2HDQ A;  2ZM8 A;  4S2M A;  1ERQ A;  3BFD A;  4S2K A;  2HDR A;  5AQA A;  4N1H A;  3F1O A;  1KVM A;  3MSH A;  1TVF A;  3DAV A;  3SH9 A;  2PR5 A;  3RFB A;  3DWK A;  3VE3 A;  1YSP A;  3OCN A;  4F94 A;  1SDE A;  3Q7Z A;  4PM8 A;  2XD5 A;  3NJA A;  1PW1 A;  4Q0J A;  4X55 A;  1UGU A;  1BLH A;  4MBF A;  2ZD8 A;  1OTE A;  1S4S A;  1SCW A;  5FSR A;  1HD8 A;  1LI0 A;  3FZC A;  5M1A A;  2JKR I;  1FIL A;  2IA2 A;  4S2L A;  1JTD A;  1H0M A;  4X1M A;  4MN5 A;  4NXF A;  3G34 A;  1K4E A;  5A90 A;  3CHW P;  5EM0 A;  2QKP A;  2V9A A;  1XJ6 A;  2Z2M B;  2ZM2 A;  4BL3 A;  3LEQ A;  3OC2 A;  4HH2 A;  1ZG6 A;  3T4L A;  3HUO A;  4IUH A;  3V5M A;  2JHE A;  1Z09 A;  4HIA A;  2PRF A;  3SS5 A;  2IWB A;  1FCM A;  2HV1 A;  4L9G A;  5IS1 A;  1F5M A;  5EUA A;  2W3G A;  3A3D A;  3VE4 A;  4ZJ3 A;  2M7V A;  3WWX A;  2W1R A;  3W4Q A;  3A3J A;  4FD8 A;  4CLC D;  4JXG A;  3QP4 A;  5C5K A;  5BOH A;  1VEU A;  2UWX A;  3C7V A;  3QP2 A;  3IWQ A;  2OAP 1;  3OLO A;  4KUO A;  1IYO A;  3M2J A;  2ZQ8 A;  1H3Q A;  4EUZ A;  3T4T A;  4ZRR A;  4F3L B;  1SKO A;  1KE3 A;  2H10 A;  1MWS A;  2R78 A;  4DN0 A;  3IH8 A;  4OPZ A;  4ETZ A;  4UA9 A;  3SH8 A;  1DJC A;  4AFI A;  3EWK A;  3HLW A;  4H6J B;  3EGD C;  3UDI A;  4I3I A;  3FPW A;  5HD5 A;  1F98 A;  2P04 A;  2VGJ A;  5TBM B;  1EWZ A;  4EQI A;  2DNS A;  4OP8 A;  5J4E A;  4KZ7 A;  2H0T A;  4EU0 A;  4K08 A;  4DRT A;  4DXB A;  2ZLY A;  3AGF A;  3Q07 A;  3EOI A;  2H0Y A;  2EFU A;  3CG5 A;  2XQZ A;  1NJ4 A;  2Y4A A;  4DMZ A;  4ZBE A;  1NZU A;  1QME A;  5IU1 A;  2E8J A;  3G32 A;  1PYY A;  4U0X A;  5DFY A;  4NG2 A;  4DF6 A;  1KOU A;  2XEP A;  3T1X A;  4B4X A;  2EWV A;  2P9V A;  5E2H A;  3KYQ A;  3IF6 C;  3E2K A;  1GSV A;  5FAP A;  3CWF A;  4KQQ A;  4ARZ A;  4HBU A;  4OQI A;  1GA0 A;  1I2W A;  1W5D A;  3CAX A;  4CLC B;  1YKD A;  5HDS A;  3LIF A;  4QJG A;  1MWT A;  4S2N A;  2QHK A;  2EX9 A;  1KGE A;  1G6A A;  1LI9 A;  4EBL A;  3IS2 A;  3RJU A;  4PM7 A;  4WEL A;  3SZT A;  4RA7 A;  2OLU A;  2PHY A;  3KYE A;  3FC7 A;  1N9N A;  4KEN B;  3CUE C;  3OZH A;  3MFX A;  4E6W A;  5HD3 A;  3T4J A;  2VGL M;  4P87 A;  1LSV A;  2JBF A;  3ZYT A;  4GW9 A;  1FSY A;  4KG2 A;  5J8X A;  4ME4 A;  4EEP A;  1MZU A;  5HWV A;  3OPR A;  1GSX A;  4BQM A;  1G5U A;  2HGV A;  1BT5 A;  2PT7 A;  3N8R A;  1XGI A;  2HDU A;  3MZD A;  4MN7 A;  1XX2 A;  3GR2 A;  3C4O A;  2EA9 A;  1PWC A;  4LGW A;  5TFQ A;  1FIK A;  4GJ4 A;  4HY8 A;  2QMI A;  4FCF A;  3LI9 A;  3PYP A;  3SS3 A;  1K54 A;  4JGQ A;  4EWF A;  1FR1 A;  2FH5 A;  3S7N A;  5FQ9 A;  4JGO A;  4X53 A;  3GEC A;  2JKT I;  4QHC A;  3UMD A;  2ZMF A;  3IF5 A;  3UDF A;  1GHM A;  2VA0 A;  4UAA A;  5IT5 A;  2BTF P;  1NLZ A;  1Y4O A;  2Y59 A;  4YFM A;  3W8K A;  2OAQ 1;  3N8S A;  4FSF A;  1RCJ A;  4I3J A;  3CPT B;  4O01 A;  4WF0 A;  1XP4 A;  2PBD P;  3LIE A;  1FSW A;  4MBK A;  1DJB A;  3CLO A;  1AWI A;  4LV1 A;  3N7W A;  1S0W A;  2EFX A;  4OLG A;  4Y17 A;  1E25 A;  1T1A A;  3L9K A;  3E4O A;  4N92 A;  4D60 A;  3R7W B;  4R23 A;  3PAE A;  5EVI A;  1IEM A;  4Z1W A;  3PBO A;  2W1T A;  1V9Z A;  1IKI A;  3MMH A;  3ISG A;  3P09 A;  1TS8 A;  2Q9N A;  5FEF A;  1PZO A;  3FKW A;  4RVA A;  2W3F A;  4MLL A;  2Z2L B;  4BLM A;  3PBT A;  1RGY A;  4GN2 A;  2ZBB A;  3SS4 A;  2WKH A;  1GHI A;  1A0K A;  2Y2K A;  3BM6 A;  4OVD A;  4GLQ A;  3K3C A;  5CTN A;  5EVI C;  4GOG A;  2HZ5 A;  5AJG A;  4LCL A;  4O0P A;  1XA1 A;  1KE4 A;  5EVI B;  3LI8 A;  1XGJ A;  3NIA A;  5A92 A;  2A24 B;  3C7U A;  2J7V A;  3G35 A;  2EXB A;  1K0K A;  5GHZ A;  2ZQD A;  2XLN A;  3UO9 A;  4ZAM A;  5HPI A;  4BJP A;  3VOZ A;  4P6Z S;  4HJ6 A;  1K57 A;  4JPM A;  1DP9 A;  2JN7 A;  3Q7V B;  1F2K A;  3C2W A;  2V2F F;  3ZG7 B;  2VK3 A;  1S1Y A;  1CI8 A;  4Q8I A;  3NCK A;  4PPR A;  5J7E A;  2V8C A;  3NHQ A;  4KQR A;  3H82 A;  2P7J A;  4KZ6 A;  2DMW A;  4HJ3 A;  3T1R A;  3HLG A;  3LFV A;  1G68 A;  1T19 A;  4E3M A;  4NKP A;  2XGN A;  3TE8 A;  3JPU A;  2WKR A;  4QWO A;  3LIC A;  1OPX A;  4UQI S;  5JYO A;  4LRZ E;  1BUL A;  3RH8 B;  3E0Y A;  1Z6F A;  3O88 A;  3V50 A;  2Y2J A;  3BWL A;  2Y2G A;  4DDS A;  3IWO A;  2WYX A;  2XK1 A;  2W0N A;  4R4R A;  1RGZ A;  3BEC A;  3VMA A;  2JE5 A;  2Y2Q A;  1JWP A;  2WGW A;  5J3W A;  3TJZ C;  3TRC A;  3ICY A;  2B02 A;  4JF6 A;  1ESI A;  5EEC A;  4LV0 A;  2BLS A;  3TW8 A;  2XDM A;  4OLD A;  4WUJ A;  3VP0 A;  2JKR M;  2ZQ9 A;  3M6B A;  1MBL A;  1YAX A;  1ALQ A;  4M3K A;  2HP9 A;  4GD8 A;  4X6T A;  3MXQ A;  4WZ5 A;  5HFO A;  3RXW A;  1W63 M;  4KZ5 A;  1T1B A;  4Y0O A;  3VFH A;  1HLU P;  3JYI A;  3M2K A;  1WYC A;  3ITB A;  3OPH A;  5DJU A;  5HAP A;  1EI5 A;  4PM9 A;  2Y2P A;  5FQQ A;  1FCN A;  5DTS A;  1SDN A;  3G2Y A;  3T4S A;  4OPY A;  2Y2M A;  2CMN A;  3LUQ A;  1H8M A;  2MJ6 A;  2RL3 A;  1TS7 A;  4R0Q A;  2ZL1 B;  2V1A A;  4YOF A;  1W7F A;  3RTY A;  4A5R A;  1IKG A;  1O07 A;  2L4R A;  1NXY A;  4FOF A;  2VKS A;  4KZ3 A;  1N4O A;  1HTZ A;  3IQA A;  2HF6 A;  4ZJ2 A;  2EX6 A;  2AVX A;  4JXS A;  2GX5 A;  3C30 A;  3VP1 A;  1KVL A;  5G4Z A;  2JKT M;  3H9W A;  2ZQ7 A;  3OBF A;  5AQB A;  2OWJ A;  1W79 A;  3BY9 A;  3QNC A;  5DTK A;  1ZHH B;  2WZX A;  3LYX A;  5FQK A;  4C6Y A;  1JWZ A;  1P9R A;  1PWD A;  1OTI A;  3WS5 A;  5GLC A;  3H7W B;  4HOI A;  2PBY A;  4X68 A;  2ZL1 A;  5F5Y A;  1K25 A;  2PD7 A;  1PWG A;  3QHY A;  1JTG A;  5EVI D;  1VEU B;  3HJI A;  4FH4 A;  3LEZ A;  3MS6 A;  1BTL A;  3WS0 A;  4RYE A;  1BLS A;  3B33 A;  5CEB A;  2J3W A;  2PAV P;  3N4I A;  4NET A;  4F3L A;  1H8Y A;  4G3V A;  5FAS A;  2X02 A;  4BD1 A;  1NY0 A;  2GJ3 A;  1XJ4 A;  5FI7 A;  3WRT A;  3P7N A;  2OOL A;  1ERM A;  5F6A A;  1O7E A;  1H8Z A;  3NEC A;  3PHY A;  4LV2 A;  2M1C A;  4KZ4 A;  5HWW A;  3U2A A;  4Y2F A;  1ZC2 A;  2ZMA A;  2XSS A;  2Q9M A;  5E43 A;  4IVI A;  3B42 A;  2EX8 A;  4QPR A;  1S67 L;  1IEL A;  3KX0 X;  2QZ6 A;  1E3U A;  4I3A A;  3C8C A;  4PKY G;  3BEB A;  4UEY A;  2ZC5 B;  1LL9 A;  5CGS A;  2H28 A;  2QJ5 A;  5HAR A;  1ZTU A;  3MQ0 A;  4JF5 A;  1OTA A;  1TD5 A;  2DRW A;  3HLC A;  1SHV A;  4MNR A;  2M7U A;  3UNW A;  3CPT A;  1YT4 A;  1ES4 A;  2QJ7 A;  4EUV A;  2V0U A;  2E8I A;  4LFU A;  1PNE A;  3PAG A;  4DJ3 A;  2P08 A;  3GQZ A;  3UPN A;  2J8Y A;  1BZA A;  4N1X A;  2OSU A;  3SW1 A;  4E3L A;  5AVF A;  3UB5 P;  2C6W B;  4E3N A;  3E4P A;  5FAO A;  3MJQ A;  1LT0 A;  2LB5 A;  4IBR A;  2W1T B;  2A49 A;  4HQA A;  4UHU A;  1LLB A;  4JKT A;  2QYB A;  2XA7 S;  4MN6 A;  4PM5 A;  4C75 A;  2V1B A;  5CTM A;  1KGG A;  1Y28 A;  3TSG A;  3BY8 A;  1ES3 A;  1TDL A;  4P6Z M;  3NC8 A;  3T4Q A;  4NXG A;  1X0O A;  1PFL A;  4JF4 A;  3GVB A;  3NDG A;  4OKP A;  4ZJ1 A;  3A0V A;  1K54 C;  4OPR A;  3E98 A;  4EXO A;  1PZP A;  4L0L A;  3QNB A;  1OT9 A;  3WS4 A;  1IYQ A;  3HL9 A;  3GSG A;  1WA9 A;  1K38 A;  1IYS A;  1CJF A;  3D9Y A;  1MC0 A;  2Y2I A;  2C5W B;  4R3J A;  1YLW A;  3G4P A;  1FQG A;  5HX9 A;  2V1Z A;  5DKK A;  1BSG A;  3KSG A;  3VSK A;  1KDW A;  3ZG8 B;  4H6J A;  2B18 A;  2PD8 A;  5KIZ A;  3IBJ A;  1E3U D;  2ZC4 B;  3UDX A;  3A3E A;  2BAS A;  2D02 A;  3N8L A;  4DE2 A;  3VFF A;  3ZQ5 A;  3HRE A;  1MKI A;  4S2P A;  3UN7 A;  5L2F A;  4UQI M;  4X1L A;  5FAQ A;  1XKZ A;  2KDK A;  2VV6 A;  2O9C A;  4ZDX A;  3CZD A;  3CUE A;  1BLP A;  2V20 A;  2K7S A;  5FDS A;  2B5R A;  5HDD A;  3LR3 A;  3ULF A;  1IFQ A;  2WZZ A;  3IT9 A;  1ZG4 A;  4OPQ A;  2WGV A;  1IYP A;  2XD1 A;  3GV9 A;  1XFN A;  4HP9 A;  4KQD A;  4L9E A;  4HJ4 A;  4NXB A;  3EEA A;  5CXW A;  1PW8 A;  4R3A A;  5CHM A;  3UB9 A;  3VP4 A;  5HZH A;  4Q0I A;  5CHU A;  4Y0T A;  4GKU A;  5EPH A;  3O87 A;  3SH7 A;  2KOI A;  2HPB A;  4X69 A;  2O9B A;  3IS2 B;  3EGX C;  5DVA A;  5FL3 A;  3QP5 A;  5E2G A;  1K55 C;  4M4X A;  1PRQ A;  1P0Z A;  2PDR A;  4LV3 A;  2P9V B;  1E4D A;  3E2L A;  3K3D A;  5M18 A;  4BBU A;  4KUK A;  4R38 A;  3IHB A;  4ARZ B;  4JBF A;  2J9P A;  1S6R A;  3UPO A;  3MQQ A;  3IF6 A;  1N9B A;  2HDS A;  2XFT A;  2WKI A;  3W4O A;  4IHQ A;  1M6K A;  3P01 A;  4WLA A;  2V8F A;  1SKF A;  2ACG A;  1K57 C;  3MKF A;  3UB7 A;  2Y8H A;  3MZF A;  2NUT C;  4EES A;  4KZ9 A;  1CI9 A;  4E3I A;  3W2Z A;  4S2N C;  5DFX A;  4XT2 B;  3C4P A;  3AGE A;  4QD4 A;  4P0M A;  2IWC A;  2O9A A;  4B4Z A;  4XXR A;  2J3T D;  4OOY A;  2J80 A;  5DF8 A;  3M6H A;  3HUN A;  4S2J A;  1OT6 A;  5CRF A;  2KX6 A;  5CX7 A;  3PBR A;  4XUZ A;  2ZOI A;  4N9K A;  1N9O A;  2K31 A;  1PI5 A;  4X25 A;  1AXB A;  3UE3 A;  2HJ9 C;  4MMN A;  1WE4 A;  3JVU A;  2V0W A;  3Q7V A;  4IUK A;  3O5Y A;  1SKO B;  2DCF A;  3DW0 A;  4BD0 A;  3HLE A;  2A24 A;  2H5S A;  2PYR A;  4EBN A;  2CC1 A;  4R4S A;  3G31 A;  4QB8 A;  4DE1 A;  1G28 A;  1YSQ A;  1STZ A;  4R6L A;  1NZO A;  3EQV A;  3F1N A;  4FTX A;  5E2E A;  3WS2 A;  3FPV A;  3NBL A;  2WAD A;  2JCH A;  3ITA A;  1ZKJ A;  3NI9 A;  2JKG A;  3PBN A;  2BG1 A;  4O7D A;  5HL6 A;  1K6R A;  4CJN A;  4OQ0 A;  3KSI A;  1H5X A;  4KG5 A;  2QWS A;  5I94 A;  4Y13 A;  3K2N A;  3T4O A;  3GMW A;  3GRJ A;  1K4F A;  3S1Y A;  2WAF A;  3BQA A;  2WKQ A;  2VZW A;  4GS9 B;  4PM6 A;  3ZFZ A;  4GCZ A;  1NWZ A;  4HEF A;  4E3O A;  1W63 Q;  4PHT A;  1DP6 A;  1SZV A;  5DJT A;  3BLS A;  1ACF A;  2ZOH A; 
#chains in the Genus database with same CATH homology
 5HD5 A;  1F98 A;  2P04 A;  5TBM B;  3E4Q A;  2HF6 A;  4LLO B;  5J4E A;  2GX5 A;  3C30 A;  3GDI A;  4EU0 A;  4WL9 A;  5L8M A;  3FG8 A;  4K08 A;  5G4Z A;  2JKT M;  2PYP A;  4PKY A;  3H9W A;  5AVE A;  3EOI A;  3OBF A;  2PR6 A;  3UE6 A;  3JVV A;  2OWJ A;  3BY9 A;  1ZHH B;  3LYX A;  4DMZ A;  3LR0 A;  4ETX A;  2GZA A;  5IU1 A;  1P9R A;  1OTI A;  5DFY A;  3H7W B;  3UME A;  2WKP A;  4HOI A;  2D01 A;  1KOU A;  1LL8 A;  5F5Y A;  2PD7 A;  3NOT C;  3LID A;  1V9Y A;  2EWV A;  3KYQ A;  1MKM A;  3HJI A;  1GSV A;  3CWF A;  4ARZ A;  4DJ2 A;  2VX8 A;  1VHM A;  1XJ3 A;  4OOM A;  3B33 A;  3CAX A;  4CLC B;  1YKD A;  5HDS A;  1D06 A;  3LIF A;  2W27 A;  1P9W A;  2J3W A;  4LPZ A;  1NRJ A;  3BJN A;  2VLG A;  2QHK A;  4B9O A;  2FZ0 A;  4F3L A;  3EEH A;  3IS2 A;  4G3V A;  4WEL A;  3LR4 A;  5K5B A;  2OWH A;  4O8G A;  1UWP X;  2VEA A;  2GJ3 A;  2NUP C;  2PHY A;  4GHI B;  5HDC A;  4NXE A;  1XJ4 A;  3F1P A;  3FC7 A;  3P7N A;  2OOL A;  5F6A A;  3H7W A;  1N9N A;  3CUE C;  2XA7 M;  1JNU A;  3PHY A;  2M1C A;  5HWW A;  3C38 A;  1T18 A;  2I9V A;  3MFX A;  3U2A A;  4Y2F A;  4BWI A;  3CI6 A;  2XSS A;  3F1P B;  5LBR A;  5HD3 A;  1LSX A;  3T4J A;  3B42 A;  2VGL M;  3VOL A;  4QPR A;  1LSV A;  1S67 L;  3LR5 A;  4OOL A;  3ZYT A;  2INW A;  3KX0 X;  4GW9 A;  4EET B;  4CLC E;  2Z6D A;  4I3A A;  4ME4 A;  3C8C A;  4PKY G;  4EEP A;  4UEY A;  4XT2 A;  1MZU A;  5HWV A;  2YKF A;  2G7U A;  1GSX A;  2H28 A;  2QJ5 A;  4Y3I A;  1ZTU A;  1N9L A;  3DBA A;  3MF0 A;  4BBT A;  3MQ0 A;  1OTA A;  2HGV A;  2PT7 A;  1TD5 A;  2M7U A;  1EW0 A;  4WEJ A;  4MN7 A;  2EA9 A;  4GJ4 A;  2QJ7 A;  4EUV A;  2V0U A;  2W3H A;  4HY8 A;  4G3K A;  4DJ3 A;  2P08 A;  3EQU A;  3LI9 A;  3PYP A;  3BQ8 A;  1TS6 A;  2VV7 A;  3SW1 A;  4IJG A;  5EFW A;  4JGQ A;  3KO6 A;  2VJW A;  3MR0 A;  2FH5 A;  5AVF A;  3S7N A;  3E4P A;  4JGO A;  3GEC A;  3MJQ A;  1LT0 A;  2LB5 A;  3OOV A;  2JKT I;  2W1T B;  3G6O A;  1DRM A;  4HQA A;  3UMD A;  2ZMF A;  2QYB A;  2VA0 A;  4E04 A;  5IT5 A;  2XA7 S;  4II7 A;  1NLZ A;  4MN6 A;  1OTB A;  3IBR A;  1F9I A;  2V1B A;  2K2N A;  4WN5 A;  5HWT A;  2OAQ 1;  3T4K A;  4FSF A;  1Y28 A;  4I3J A;  1T1C A;  3BY8 A;  2GNX A;  4O01 A;  4WF0 A;  4BBV A;  4P6Z M;  3T4Q A;  1G6O A;  4NXG A;  3LIE A;  1X0O A;  4CLC A;  4I39 A;  3CLO A;  4HHD A;  1OJG A;  2Y79 A;  3KSF A;  3A0V A;  1T1A A;  3E98 A;  1NLY A;  3E4O A;  4EXO A;  4HH3 A;  1S1Z A;  4L0L A;  4EW7 A;  3NOP C;  3R7W B;  2Z6C A;  3PBS A;  3HJK A;  1OT9 A;  4LRX C;  4HNB A;  3V67 A;  4Z1W A;  3PBO A;  2W1T A;  1V9Z A;  1WA9 A;  3F1O B;  1XFQ A;  3MMH A;  5DKL A;  1MC0 A;  1OJ5 A;  1TS8 A;  2J3T C;  4YWZ A;  4I5S A;  2W3F A;  5DKK A;  3KSG A;  1UWN X;  4H6J A;  2B18 A;  2PD8 A;  5KIZ A;  3IBJ A;  4LRY C;  3PBT A;  2ZBB A;  3B47 A;  2BAS A;  2A2L A;  2D02 A;  1DP8 A;  4PAU A;  3A0S A;  2XRN A;  4GLQ A;  3ZQ5 A;  3K3C A;  3D72 A;  4GS9 A;  4UQI M;  3CIT A;  3VV4 A;  2KDK A;  3H82 B;  4KQO A;  3LIA A;  2VV6 A;  1LSW A;  2O9C A;  5AJG A;  5HSQ A;  4O0P A;  3CUE A;  1TF1 A;  2EWW A;  2KLI A;  3D3O A;  5F68 A;  2K7S A;  3LI8 A;  5DF9 A;  3PXP A;  3UB6 A;  3NOU C;  2A24 B;  5HDD A;  1TS0 A;  1BYW A;  3LR3 A;  3ULF A;  1IFQ A;  4GHI A;  5A8B A;  1XFN A;  5HPI A;  4HP9 A;  4KQD A;  4BJP A;  4L9E A;  4NEE D;  4B93 A;  4HJ4 A;  4NXB A;  3EEA A;  4P6Z S;  4Q0H A;  4HJ6 A;  2HJE A;  5G4Y A;  4JGR A;  1DP9 A;  4HP4 A;  2JN7 A;  2VV8 A;  4R3A A;  3UB9 A;  3R4K A;  3UB8 A;  5HZH A;  4Q0I A;  3OCL A;  4MCW A;  5TJJ A;  3C2W A;  1P97 A;  4CQH A;  4I38 A;  1S1Y A;  3S7O A;  2KOI A;  3KYZ A;  3MQO A;  2O9B A;  3IS2 B;  5J7E A;  1IOU A;  3EGX C;  3KSH A;  3NHQ A;  5FL3 A;  3F1O A;  3H82 A;  2P7J A;  2DMW A;  4HJ3 A;  2PR5 A;  4M4X A;  3RFB A;  1P0Z A;  2PDR A;  3VE3 A;  3K3D A;  4BBU A;  3LFV A;  1YSP A;  3OCN A;  4KUK A;  4R38 A;  1T19 A;  4NKP A;  3TE8 A;  4ARZ B;  2WKR A;  3LIC A;  1OPX A;  4G3W A;  3MQQ A;  3NJA A;  4UQI S;  4Q0J A;  4LRZ E;  3RH8 B;  4IHQ A;  3E0Y A;  3P01 A;  1UGU A;  4WLA A;  1GSW A;  3R7W A;  1XJ2 A;  3UB7 A;  4CLC C;  1OTE A;  2Y8H A;  1S4S A;  2NUT C;  4EES A;  4EQ1 A;  3BWL A;  5HPF A;  3T50 A;  5I5L A;  3W2Z A;  2JKR I;  2IA2 A;  5DFX A;  4XT2 B;  2W0N A;  5MC7 A;  4HI4 A;  3F1N B;  4WEK A;  4MN5 A;  2O9A A;  4NXF A;  2J3T D;  2O99 A;  5J3W A;  5KSH A;  1S4R A;  2J80 A;  4EEU A;  4R70 A;  3TJZ C;  1OT6 A;  2QKP A;  2KX6 A;  1XJ6 A;  2V9A A;  1VB6 A;  3PBR A;  5CX7 A;  2L1M A;  2ZOI A;  3HCY A;  3TRC A;  3ICY A;  2B02 A;  4MDZ A;  1N9O A;  3OC2 A;  2K31 A;  4HH2 A;  3T4L A;  3UE3 A;  2HJ9 C;  4IUH A;  3BW6 A;  4MMN A;  4RQ9 A;  5F69 A;  2JHE A;  3JVU A;  2YKH A;  2V0W A;  4HIA A;  3TW8 A;  4WUJ A;  4IUK A;  3O5Y A;  1S66 L;  2JKR M;  1OTD A;  2XRO A;  2HV1 A;  4L9G A;  3LIB A;  5IS1 A;  2A24 A;  3S7Q A;  1YAX A;  1F5M A;  2PYR A;  2O0Y A;  1G28 A;  1YSQ A;  2W3G A;  1STZ A;  3MXQ A;  3VE4 A;  4R6L A;  1W63 M;  3F1N A;  3EQV A;  1T1B A;  2W1R A;  2M7V A;  1D7E A;  3FPV A;  2LB9 A;  4Y5F A;  2VGL S;  3PBN A;  4CLC D;  5DJU A;  5HL6 A;  5TBM A;  4L9F A;  2W3D A;  5C5K A;  3KSI A;  2ZMV A;  2OAP 1;  3OLO A;  2QWS A;  4KUO A;  4YNR A;  3S7P A;  4EER A;  4JGP A;  3T4S A;  2CMN A;  3K2N A;  3LUQ A;  1H8M A;  3T4O A;  1H3Q A;  2MJ6 A;  2W3E A;  3A0R A;  3T4T A;  4ZRR A;  4F3L B;  3BQA A;  1TS7 A;  2VZW A;  2WKQ A;  4GS9 B;  2R78 A;  3PR6 A;  4DN0 A;  2L0W A;  4GCZ A;  4ETZ A;  2V1A A;  3PBQ A;  4YOF A;  3RTY A;  1NWZ A;  4BMW A;  2L4R A;  1W63 Q;  1DP6 A;  4PHT A;  5DJT A;  3EWK A;  4FOF A;  4AFI A;  1ODV A;  2ZOH A;  4H6J B;  2VKS A;  3EGD C;  4I3I A;  3FPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...