1OTEA

E46q mutant of photoactive yellow protein, p65 at 110k
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords photoactive yellow protein, PYP
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 33
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1oteA00
1T1AA 5J7EA 3F1OA 1DRMA 2D01A 3LUQA 4L9GA 4BBUA 1DP8A 4L9FA 2YKFA 4LRXC 4NXEA 3UMEA 1LSXA 4K08A 4XT2A 3UB8A 3OLOA 2H28A 3MR0A 3PHYA 4HH3A 4EXOA 1OTBA 3UE6A 1XFNA 2VV6A 2A24A 2EA9A 3F1NA 3VE4A 4R6LA 5F5YA 5AVEA 2JN7A 4KUKA 4YWZA 4NXFA 2K7SA 2Z6DA 2ZOIA 3MQQA 4GHIA 5HWTA 2QHKA 3RH8B 1LSWA 3E4OA 5EFWA 4HJ3A 3ZQ5A 4KQDA 1GSXA 2I9VA 4JGRA 1OJGA 1T1CA 1MZUA 2WKRA 2VEAA 3HJIA 3D72A 1OT9A 3UB9A 3GECA 3C8CA 4JGQA 2W27A 1XJ4A 1T1BA 3MJQA 2KX6A 3FC7A 1XJ3A 4M4XA 1S67L 5TBMB 1BYWA 1P97A 4EQ1A 3LIFA 5TBMA 4DJ2A 3MQOA 4JGOA 2ZOHA 5I5LA 1P0ZA 5HDDA 4HP9A 3H82A 1KOUA 1VB6A 2L0WA 4GW9A 4WL9A 4HP4A 4WUJA 3HJKA 3A0VA 3H7WB 1UWNX 4WLAA 4WF0A 3A0SA 4LLOB 4EW7A 4GCZA 4HHDA 2CMNA 3IS2B 3VOLA 2D02A 3F1PB 3UMDA 2BASA 4WN5A 4I3AA 3ICYA 3EWKA 5HDSA 4H6JB 3E4QA 1S66L 4EEUA 3P7NA 3H9WA 2L4RA 2J80A 2Z6CA 4HQAA 2QJ5A 5HWWA 1OJ5A 5DJUA 1OTEA 4HY8A 1ODVA 3C2WA 3NOTC 3NJAA 4EESA 3LIAA 3EEHA 1S4RA 2OWHA 3SW1A 1S4SA 1S1YA 3VE3A 3CAXA 4PKYA 3UB7A 4HOIA 1T19A 5DKKA 3FG8A 4GS9B 1V9YA 2VV8A 3B33A 3NOPC 5HDCA 1JNUA 3CWFA 2ZBBA 1X0OA 2QJ7A 1T18A 4MN6A 4R38A 1UGUA 2PD8A 1S1ZA 3MXQA 2WKQA 1WA9A 4F3LB 4HH2A 5IU1A 1DP9A 3RTYA 2PD7A 2PDRA 3BWLA 2V0WA 3NOUC 5J4EA 1UWPX 3UB6A 1XJ6A 5KIZA 2QWSA 3BY9A 4LRYC 2QKPA 2PHYA 4HNBA 2V9AA 2INWA 1EW0A 1Y28A 4I38A 5AVFA 2R78A 3LYXA 1F98A 2HV1A 3LI8A 3G6OA 2PR6A 3LIEA 1V9ZA 4E04A 1XJ2A 3E4PA 1OT6A 3KX0X 3H7WA 4HJ6A 1GSVA 4HIAA 2OWJA 2M1CA 5HWVA 3F1OB 3IS2A 1D06A 4L9EA 3F1PA 2PYPA 5G4ZA 4H6JA 4HJ4A 4EETB 1N9OA 3GDIA 1TS0A 5HD3A 4XT2B 2VLGA 5F69A 4I5SA 2V1BA 5HSQA 4R70A 3LICA 3LIDA 1OTDA 2V1AA 4BBTA 2YKHA 1F9IA 2PR5A 2B02A 2V0UA 4NXBA 1DP6A 2L1MA 5A8BA 4RQ9A 2A24B 1D7EA 1TS7A 3F1NB 5DJTA 1XFQA 4KUOA 4GS9A 3ULFA 3MFXA 5J3WA 1LSVA 4JGPA 5F68A 4LRZE 4I3JA 3PYPA 4DJ3A 4NXGA 4GHIB 5IS1A 4HI4A 3BY8A 5HZHA 5HD5A 4F3LA 4BBVA 1GSWA 4MN5A 1G28A 5DKLA 3LI9A 4LPZA 3K3DA 2P7JA 3A0RA 5G4YA 4B9OA 2KDKA 2GJ3A 3T50A 1N9LA 1TS8A 1N9NA 2W0NA 3LIBA 4PKYG 1OTAA 2OOLA 4EEPA 3IBRA 1LT0A 1TS6A 4R3AA 2WKPA 1LL8A 1OTIA 2JHEA 2PYRA 3CLOA 2VV7A 3K3CA 5F6AA 3NHQA 1NWZA 4I39A 4EERA 3H82B 4I3IA
chains in the Genus database with same CATH superfamily
1T1AA 2ZC3B 2D01A 3B42A 4L9GA 4ZBEA 3GRJA 1FOFA 1DP8A 4L9FA 3NDGA 1XKZA 3S7NA 4H8RA 4LENA 2O0YA 3UDIA 4ESPA 1ALQA 4IUKA 3UB8A 2ZC6B 3T4OA 5CGSA 1MPLA 4IJGA 4EWFA 3OLOA 4UEYA 3ZFZA 2ZQAA 2EXBA 2H28A 1SZVA 4DRTA 5DF9A 4LCMA 1RGZA 2Y2IA 4PM7A 3VOZA 3CJMA 4UA7A 3JPUA 5HFOA 4JF6A 3VV4A 5HAIA 5DF8A 4ZJ1A 3Q7VA 4GJ4A 3MZEA 1LI0A 2V8CA 3F1NA 3BEBA 2JC7A 4R6LA 5F5YA 5AVEA 3CUEA 4CQHA 4Y15A 2UWXA 2XR0A 1BLHA 4S2NC 4E6XA 4NXFA 2ZOIA 5HWTA 2WKIA 1L0DA 5EM1A 1STZA 4KQDA 1ESUA 2Y2HA 1CK3A 4E3KA 3UO9A 2VEAA 2O9BA 3TG9A 3TJZC 3E98A 2HP5A 1OT9A 3IF5A 3PTEA 1ES5A 3U2AA 1K0KA 4JGQA 3PBSA 2GNXA 4Y0OA 2Y2NA 3HREA 3EQUA 1Y4OA 3UNWA 5GHZA 1HVBA 1T1BA 3DTEA 3W4OA 1G6OA 1SKFA 1XJ3A 5EVIA 1S67L 3V67A 3LIFA 2XFSA 2HDQA 3V3SA 2W1RA 2JKFA 3A3DA 2M7VA 2ZOHA 2P74A 4RYEA 2MJ6A 1ONGA 1KOUA 2H0YA 3UPPA 1H8MA 4BLMA 3R4KA 4ZTKA 2HDSA 4WUJA 3UDFA 1K38A 5GL9A 5TGFA 3A0VA 3W2ZA 3CG5A 1UWNX 4LLOB 1SDEA 3NDEA 4HHDA 5F1FA 5FEFA 3VOLA 4RX3A 3F1PB 4CLCA 4DE3A 5HAPA 2EFUA 4WN5A 3RFBA 4NKPA 4N9KA 1JTGA 3EWKA 2P08A 4KENB 3OCNA 2X71A 1TF1A 2QZ6A 1S66L 3WS5A 3P7NA 3H9WA 1YSQA 1FQGA 2OLUA 3DTMA 4JF5A 4UAAA 4HQAA 4Y0TA 2QJ5A 4P0MA 5G18A 3C2WA 3NOTC 4PPRA 2W3GA 3OPRA 2O9CA 1S1YA 4R23A 2Y91A 5CERA 1T19A 4L0LA 3MBZA 2XD5A 5DKKA 3OPHA 5L07A 1MBLA 1BTLA 5DVAA 5KSCA 2HDRA 3Q81A 3N4IA 4Q0HA 4MN6A 2Y79A 1S1ZA 1WA9A 4OKPA 1Q2QA 2E8IA 2EWWA 3WWXA 1IOUA 4O0PA 3OZHA 2B95A 1DP9A 1K54A 2R9WA 2DCFA 1H8ZA 3UB6A 4ARZA 2X01A 3BY9A 4JF4A 1DJBA 1K6RA 2V9AA 1KVMA 4YOFA 4CLCD 1NZOA 3UN7A 2HV1A 2Y2OA 3MXSA 3W4PA 4ZJ2A 2Y2GA 3LR3A 4U0TA 3LIEA 2JKTM 4S2KA 5EOEA 3W8KA 1YPRA 1XJ2A 1VETA 3E4PA 4ETXA 1OT6A 4OOYA 3HUOA 3KX0X 4FUWA 5CHJA 1GSVA 3T12B 2M1CA 2PT7A 5HWVA 3WS2A 5IT5A 3U4LP 2O99A 5FAOA 1Y54A 5CEBA 4KZ8A 2P04A 4FD8A 5G4ZA 1K56A 4GDNA 2PBDP 3DWKA 4PAUA 1SHVA 3T4SA 3QNCA 1AXBA 3P98A 3NY4A 3QNBA 3S7OA 4EETB 3GDIA 4QWOA 5HD3A 1K4FA 3KSHA 3CPTA 1Z09A 3IXHA 3S22A 2XROA 5F69A 1PIOA 1KE3A 1KE4A 5AQBA 2V1AA 4BBTA 3T1QB 1F9IA 2B02A 2V1ZA 3NIAA 1RGYA 4BD1A 2BTFP 1H3QA 2QYBA 5A8BA 2DNSA 3BJNA 4RQ9A 2A24B 1D7EA 3C30A 3K2NA 4KG2A 1ERMA 3IQAA 3TW8A 5DTTA 4LV0A 4PM5A 4HEFA 2ZC7A 4R4SA 2OV5A 3ULFA 4O7DA 3MFXA 1LSVA 1E4DA 4JGPA 3T4TA 2XD1A 5F68A 3WS4A 2OLVA 4ETZA 3PYPA 2K31A 4MEZA 5FL3A 1Q2PA 3CI6A 1YMXA 2GDNA 1CJFA 3BW6A 4HI4A 5HZHA 4OOMA 1ES2A 5FI2A 5TR7A 4F3LA 5GHXA 1H8YA 2ACGA 2PU2A 4MLLA 3T4JA 1SKOB 2EWVA 3OOVA 3JVUA 4YFMA 3C7VA 1KGGA 4GD8A 1F5MA 3IH9A 4PKYG 1OTAA 2HZ5A 2OOLA 1A0KA 2QMIA 4WMCA 4EEPA 4GN2A 3E2LA 4C6YA 4R3AA 1IELA 1K56D 1LL8A 1OTIA 3ZG9B 2VX8A 4GKUA 4LCLA 4Z1WA 4K0WA 1ONHA 3QP5A 1P9RA 3K3CA 5F6AA 5EE8A 1NWZA 3H82B 3FKWA 2XK1A 2XA7M 4OLGA 2C6WB 4K91A 3GQZA 1CI9A 1ZKJA 2WKEA 5K5BA 1PW1A 1XA7A 2A49A 3ISGA 5FASA 1L0GA 4GZBA 4G3VA 1YT4A 5DTSA 2W3HA 5EPHA 4FH4A 4K08A 1ZG4A 2R9XA 4QHCA 5FQ9A 1MWRA 3T1RA 4MMNA 3DBAA 4KZ7A 4HBUA 1RCJA 4X6TA 3DWZA 1D1JA 3G34A 2EX8A 1IFQA 3G32A 2VV6A 5M1AA 1BLPA 1GHPA 3E2KA 3VE4A 1JVJA 3I7JA 5AQ7A 4E6WA 3EEAA 1K25A 4YWZA 4YINA 4DXCA 4EQIA 4ME4A 4X1MA 5DFYA 2K7SA 1YKDA 4DDYA 2PAVP 4UQIS 2DMWA 1CEFA 3IF6B 2J9PA 3D3OA 4Y3IA 4Y13A 4HJ3A 1LL9A 1GSXA 3IF6C 1MZUA 3QP6A 4WMCD 3VFHA 2H0TA 4WELA 3JYIA 2XLNA 1H5XA 3UB5P 3HJIA 3D72A 2G7UA 5AJGA 3C8CA 3M6HA 1ZG6A 4Y17A 1L0FA 2ZC4B 2ZQCA 2Y59A 3PBRA 3RXXA 1P9WA 2PBYA 3MKEA 3MJQA 1MKMA 4D60A 1FILA 2GX5A 4X69A 3N6IA 2VGLM 5CEDA 2ZM8A 4KQRA 4WZ5A 3IHAA 1YSPA 4JGOA 1G68A 5I5LA 4Q0JA 1L0EA 5EOOA 5HDDA 3M2KA 4HP9A 3IHBA 5E2EA 4EV4A 2WAEA 2L0WA 1GA9A 3UE1A 4WL9A 1YLZA 2VGJA 3HCYA 3G31A 5L2FA 1BSGA 2Z2MB 4OLDA 4B88A 3C4OA 3H7WB 4EW7A 4GCZA 1VM1A 2J3TD 2CMNA 1BT5A 2VGKA 2D02A 3C38A 3UMDA 3IXBA 1HD8A 4GDBA 1KDWA 3GV9A 4H6JB 4EEUA 3DW0A 5HL1A 1TDGA 2L4RA 4Q8IA 4PMAA 3UE0A 2J80A 1YLYA 1HZOA 5HWWA 2XFTA 4QPRA 2FFFB 3LEQA 3PXPA 4QY5A 4S2NA 3A3IA 3GSGA 4JXGA 3MFDA 1IKGA 4X68A 3IT9A 3SW1A 4N9LA 1NLYA 2Z2LB 3D9YA 3UPOA 3L9KA 4HOIA 1PI4A 4UQIM 3PBTA 4JXWA 2IA2A 4R3JA 3NOPC 4FSFA 4NEED 3BQAA 3T4KA 3B3XA 1PZOA 3OPLA 1X0OA 2P9VB 1GA0A 1PWGA 1FCNA 2IWCA 2XDMA 2ZQ7A 4U0XA 5JYOA 4R4RA 3KO6A 3BECA 3MXQA 4KG6A 3FV7A 2O9AA 1J3WA 4DN0A 2VA0A 4CJNA 3C5AA 3WS1A 2PD7A 2PDRA 4MBFA 1IYPA 3BWLA 4RA7A 4IBXA 3V3RA 5J4EA 5KSHA 5HW3A 5FQMA 4CLCE 1PYYA 3TE8A 4LRYC 1NY0A 2PHYA 2INWA 3IX3A 5AVFA 4S2JA 3LYXA 1PNEA 2M7UA 1BLCA 3LI8A 3S1YA 2FZ0A 2HDUA 3G6OA 1JWVA 4NG2A 4IEDA 4BD0A 1G5UA 3EQVA 1XP4A 4GB7A 4HJ6A 1IYOA 2OWJA 2J9OA 3SS3A 1ZC2A 5HX9A 4IUHA 3F1OB 3S4XA 3F1PA 4PHTA 5DF7A 4P85A 3KYQA 5M18A 5DFXA 1N4OA 2Y4AA 3OCLA 3MZDA 3RXWA 3P01A 1I5QA 2V8FA 3VP2A 2HP9A 1ES3A 1TS0A 4XT2B 3LR5A 5HSQA 4P87A 4MDZA 4U3TA 3BFFA 2PR5A 3FZCA 2V0UA 4NXBA 4LV1A 3ZGAB 4K0XA 3WRZA 5GLCA 2WZZA 3M2JA 1W79A 2W3DA 2BLSA 3HVFA 4FH2A 2JKRI 3Q82A 5DJTA 4EBLA 3JVVA 5E2GA 3GTCA 4KUOA 3HUMA 4OQ0A 5J3WA 3NI9A 4ZRRA 2C5WB 5HL6A 4LRZE 3V50A 5CHMA 4I3JA 3FYZA 3VP1A 1N9BA 4QJGA 4OVDA 4GHIB 5IS1A 3MF0A 5BOHA 5EVID 3DTIA 3ZVWA 3ZYTA 5DKLA 3LI9A 3IWQA 2W1TB 4Y5FA 3CMZA 3A0RA 3EOIA 5HAQA 3MKFA 2EX6A 5G4YA 4B9OA 1TS8A 2Y2QA 3HLCA 4E3NA 1N9NA 4B4XA 3QHYA 1MWSA 1LLBA 3HLDA 3NC8A 2Y2PA 3BRMA 3IBRA 2H10A 3G2YA 1LT0A 2WGVA 2X02A 1I2WA 1K57C 1AWIA 2PYRA 3CLOA 2B18A 3LCEA 3IX4A 3NECA 3LR4A 5A91A 3QP8A 5J7EA 2ZL1B 2XA7S 4Y2FA 3IXDA 3LUQA 1PW8A 4BBUA 3ZG0A 1K55C 4KG5A 3PBOA 3O87A 3R7WB 5I94A 3B47A 3SH9A 2YKFA 4LRXC 3VP4A 3ZG8B 2UV0E 5J8XA 3UMEA 5FQKA 2FFYA 1NZUA 1FIKA 4IBRA 3MQ0A 1FSWA 2A2LA 4E3OA 1SDNA 4DDSA 4O8GA 4EXOA 1OTBA 3UE6A 4KZBA 2A24A 3MS6A 3UY6A 2Y8HA 4AFIA 2VJWA 4UHUA 1CF0A 1LL5A 3SOIA 4KUKA 5EUAA 2Z6DA 5EVLA 3BYDA 3WRTA 3LY4A 2QHKA 1DJAA 3RH8B 3UE3A 3E4OA 1E3UA 1NYMA 1PWDA 1ZHHB 1IYSA 5EECA 2I9VA 4JGRA 4QB8A 1LI9A 3ITAA 1W8YA 2WKRA 2OAQ1 2J7VA 4MCWA 4OP8A 1SKOA 2A3UA 4C75A 4C3QA 2W27A 2DRWA 3HLGA 3S7PA 4KZ5A 3C7UA 4BMWA 3FC7A 4DF6A 2OSUA 3SH7A 2FH5A 4M4XA 4ID4A 2VGLS 5TBMB 4Z9QA 4EQ1A 2W3EA 5TBMA 5HPIA 4DJ2A 3O3VA 4R0QA 3AGFA 3W4QA 1P0ZA 4QU3A 3H82A 2EXAA 4JXSA 4OPRA 4S2PA 2G2WA 4S2LA 4IVIA 1MY8A 1G6AA 4R3BA 3HJKA 4WLAA 4Q0IA 3E0YA 3IS2B 2WK0A 4X25A 2J8YA 1NYYA 2E8JA 2QPNA 3VSKA 5FSRA 4I3AA 2H5SA 1W5DA 1U60A 3O86A 3EGXC 5FI6A 5HDSA 2IWBA 2ZMAA 3E4QA 5CECA 1CQAA 5FQIA 5DJUA 1OTEA 4HY8A 3ZHHA 1PFLA 2Y2JA 1VEUB 3BFEA 2J3WA 3EEHA 1HLUP 1S4SA 5CGXA 2XSSA 3HL9A 3BM6A 2WADA 3UB7A 4BJPA 2EX2A 3HUNA 3DAVA 4PM8A 1OMEA 1BULA 4EUVA 3IF6A 1IYQA 1PI5A 4JXVA 4OPZA 3FG8A 5GLBA 4GS9B 2VV8A 3B33A 1JNUA 1FCOA 4S2IA 3LY3A 4IHQA 1TEMA 2QJ7A 1EWZA 3ZCZA 3LO7A 4GOGA 2XF3A 1BZAA 1UGUA 3CHWP 2PD8A 4P6BA 2WKQA 2ZLYA 1BUEA 4KZ3A 4HH2A 2XH9A 2KOIA 1YLJA 1PRQA 2ZC5B 4E3MA 5FQJA 3RTYA 3UPNA 2V0WA 3MMHA 3NOUC 4DMZA 3GVBA 4JPMA 3VP0A 3SS5A 3HLEA 1XJ6A 5KIZA 3EGDC 2QKPA 3LFVA 3BFGA 2ZQDA 1MKIA 1EW0A 4QY6A 2JE5A 1F98A 3AGDA 5F82A 3V39A 3IH8A 2PR6A 1V9ZA 4BL3A 3KSFA 4E04A 3OPPA 3A3FA 3H7WA 1VQQA 4CPKA 2VKSA 5FDSA 4HIAA 4WBGA 3OC2A 1D06A 2ZM0A 3P09A 5EV0A 1GCEA 2Y2MA 5E43A 3G4PA 4H6JA 3LEZA 3TRCA 3LGOA 4XXRA 1L3LA 1N9OA 5A92A 2CC1A 2W3FA 2VLGA 4I5SA 4R70A 5JYPA 4FTXA 1FSYA 1OTDA 3SH8A 2JBFA 3NBLA 3T1XA 1FR1A 3WS0A 2LB9A 2VZWA 4GNUA 4E3JA 5C5KA 3SS4A 3Q7VB 1EROA 5HARA 1XGJA 3F1NB 5CX7A 4UA9A 5FI7A 3BFDA 4E3LA 1I2SA 1XFQA 1NXYA 2XQZA 1WYBA 4OOLA 5L10A 5IHVA 3ITBA 5CRFA 1YMSA 5FA7A 1XXMA 1LHYA 3CUEC 4DJ3A 4GLQA 2P9VA 4LV2A 4NXGA 5CGWA 1J9MA 3BY8A 4PM9A 4B93A 4S2OA 1CI8A 5EVEA 2WGIA 4BBVA 1GSWA 4NETA 1QMFA 4G3KA 5D3OA 4KZ4A 3K3DA 2ZQ8A 3PAGA 3T1SA 4MN7A 3DTKA 3T50A 5GLDA 3FPWA 1IKIA 1NRJA 1VHMA 2W0NA 3A3EA 2GZAA 3CZDA 1GHIA 2JKTI 1FCMA 5EVIB 1S6RA 1W7FA 2WKPA 4LGWA 5GLAA 1C3BA 4KZ9A 2B5RA 4N1XA 3NHQA 4E3IA 4IVKA 4EERA 5EVIC 4OH0A 2EFXA 4NK3A 1O07A 4X55A 2K2NA 3F1OA 1DRMA 5CHUA 3VOYA 3D4FA 1PZPA 3PAEA 4X56A 4NXEA 5LBRA 4CLCB 3KSGA 1LSXA 3T4LA 4XT2A 1JTDA 2WUQA 4JBFA 1MWUA 4DE2A 4MNRA 3FKVA 1YM1A 3ZG5A 3ZNYA 4CLCC 3MR0A 3Q1FA 3PHYA 4HH3A 3MSHA 3TOIA 1XFNA 4S2MA 2ZMFA 2EA9A 4OPYA 3VFFA 1MC0A 1CEGA 1YLPA 5AQ9A 4OQHA 2JN7A 1S0WA 3IWIA 1F2KA 2LB5A 3MQQA 4GHIA 4A5RA 5AQAA 1LSWA 4DE0A 5EFWA 1XPBA 3ZQ5A 5U47A 2V2FF 1OJGA 2ZM2A 1YQSA 1T1CA 5TFQA 3BFCA 2W1TA 5GHYA 2ZJ9A 5CTNA 1TD5A 3MXRA 1O7EA 4HESA 3UB9A 2WZXA 3GECA 4P6ZS 2KLIA 3ZNTA 4G3WA 3BQ8A 4WM9A 1W8QA 2HJ9C 2XRNA 1K57A 1XJ4A 3TSGA 3VSLA 2Q9NA 2KX6A 3ZDJA 3PBQA 4ARZB 4YNRA 2XGNA 1BYWA 1P97A 4QD4A 3O88A 1K54C 3MQOA 2Y2KA 2ZMVA 4RVAA 1M6KA 1RP5A 3G2ZA 1MXOA 1K55A 3PBNA 4JLFA 1VB6A 1M40A 5FAPA 3HLFA 4GW9A 3S7QA 2ZL1A 3M6BA 4HP4A 5F83A 1TVFA 1E25A 4JKTA 4EU0A 1VETB 1XGIA 4WF0A 3A0SA 3R7WA 3RJUA 3FPVA 3VMAA 1WYCA 3Q07A 3Q7ZA 2V20A 1ESIA 2BASA 3IBJA 3O5YA 3ICYA 3KYZA 3HLWA 3GR2A 5MC7A 5E2FA 3N7WA 1Z6FA 4II7A 4OONA 4B4ZA 3CPTB 4ZAMA 4BENA 1YLWA 2Q0OA 2Z6CA 1TDLA 1GHMA 1OJ5A 1DY6A 4WYYA 1ODVA 3PR6A 3NJAA 1ZTUA 2Y55A 4EESA 3A3JA 5M19A 3LIAA 4KQQA 1S4RA 2OWHA 3VE3A 4WZ4A 3CAXA 4PKYA 1ACFA 4OP5A 1JWPA 2WKHA 4OQGA 3LR0A 3HBRA 4XUXA 5EM0A 4BWIA 5CTMA 3QP1A 5TJJA 3BLSA 1V9YA 4FOFA 2JKRM 1KVLA 5HDCA 2NUPC 3CWFA 2ZBBA 3BLMA 3HLBA 3IXGA 3ZG7B 3UDXA 1T18A 5A93A 1IEMA 1K6SA 3G35A 5FQQA 4R38A 5A90A 4WEJA 4LV3A 4P6ZM 4F3LB 3NULA 5IU1A 4BQMA 5CXWA 1FR6A 2ZD8A 2IWDA 1SCWA 3KSIA 4OQIA 4N1HA 1KGFA 3FWLA 1UWPX 1MWTA 4MBKA 2QWSA 2JKGA 4DKIA 4LFUA 4MBHA 4HNBA 5FATA 2NUTC 4I38A 1Y28A 4EUZA 2R78A 2HPBA 1ES4A 4XUZA 1EI5A 4Y7PA 4ZJ3A 1W63M 1KGEA 3QP4A 2XEPA 3IWOA 3VP3A 3OBFA 2WYXA 3IS2A 4L9EA 3N8SA 4F94A 5KZHA 5L8MA 2PYPA 5FEGA 4PM6A 4KZ6A 4HJ4A 4EBNA 1K4EA 4GD6A 1QMEA 2I72A 4ZDXA 2RL3A 2EX9A 4X53A 4Y0UA 3C4PA 5FAQA 4BL2A 5E2HA 3MZFA 1NLZA 1KDSA 2JCHA 2V1BA 2HJEA 3L7HA 3LICA 3T4QA 3LIDA 4FCFA 2YKHA 5F1GA 4X1LA 4R1GA 4N92A 1VEUA 1E3UD 2HP6A 1DP6A 1L2SA 4D2OA 4KZAA 3IX8A 1W63Q 5DTKA 2L1MA 1KE0A 4RX2A 2HGVA 2BG1A 1NRFA 1HTZA 4EBPA 1NJ4A 1TS7A 5FDHA 2J3TC 2VK3A 2PRFA 1WE4A 5KMWA 4GS9A 2HF6A 2G2UA 4M3KA 2RCXA 1DJCA 4OPQA 3ZVTA 1XA1A 4DE1A 2PU4A 5L09A 2WGWB 3V5MA 2WGWA 1PWCA 1XX2A 2AVXA 1ERQA 5HD5A 4MN5A 1G28A 3KYEA 1BLSA 4LPZA 3NCKA 2P7JA 4DXBA 2ZQ9A 1JWZA 3GMWA 2Y2LA 4WEKA 3CITA 4UA6A 2KDKA 2GJ3A 1N9LA 3N8RA 3QP2A 3G30A 4O01A 3LIBA 4HBTA 1H0MA 2WAFA 1YAXA 4KQOA 1TS6A 5HPFA 1OPXA 2JHEA 1YLTA 2OAP1 2VV7A 3AGEA 3N8LA 4I39A 3SZTA 4WZ5C 4I3IA 2Q9MA
chains in the Genus database with same CATH topology
1T1AA 5J7EA 3F1OA 2XA7M 2XA7S 4Y2FA 1DRMA 2D01A 3LUQA 3B42A 4L9GA 4BBUA 1DP8A 4L9FA 5K5BA 3PBOA 3S7NA 3R7WB 4G3VA 3B47A 2O0YA 2YKFA 4LRXC 4NXEA 2W3HA 5LBRA 4CLCB 3UMEA 3KSGA 1LSXA 4K08A 4IUKA 3T4LA 4XT2A 3UB8A 3T4OA 4IJGA 3MQ0A 3OLOA 4UEYA 2A2LA 2H28A 4MMNA 3DBAA 4CLCC 5DF9A 3MR0A 4O8GA 3PHYA 4HH3A 4EXOA 1OTBA 3VV4A 1IFQA 3UE6A 1XFNA 4GJ4A 2VV6A 2A24A 2ZMFA 2EA9A 3F1NA 1MC0A 3VE4A 2Y8HA 4R6LA 4AFIA 5F5YA 5AVEA 3CUEA 2VJWA 4CQHA 2JN7A 4KUKA 3EEAA 4YWZA 4NXFA 4ME4A 5DFYA 2K7SA 1YKDA 2Z6DA 2ZOIA 2LB5A 3MQQA 4UQIS 2DMWA 4GHIA 5HWTA 2QHKA 3RH8B 3D3OA 4Y3IA 3UE3A 1LSWA 1STZA 3E4OA 5EFWA 4HJ3A 1ZHHB 3ZQ5A 4KQDA 1GSXA 2I9VA 4JGRA 1OJGA 1T1CA 1MZUA 2WKRA 2VEAA 4WELA 2O9BA 2W1TA 2OAQ1 3TJZC 3HJIA 4MCWA 3E98A 3D72A 2G7UA 1OT9A 1TD5A 3UB9A 5AJGA 3GECA 3C8CA 3U2AA 4JGQA 3PBSA 2GNXA 4P6ZS 2KLIA 4G3WA 3BQ8A 2HJ9C 3EQUA 2W27A 3PBRA 2XRNA 3S7PA 1XJ4A 1P9WA 1T1BA 3MJQA 1MKMA 4BMWA 2KX6A 3FC7A 2GX5A 1G6OA 3PBQA 2FH5A 1XJ3A 4YNRA 4M4XA 4ARZB 2VGLM 1S67L 2VGLS 5TBMB 1BYWA 1P97A 2W3EA 3V67A 4EQ1A 3LIFA 5TBMA 5HPIA 4DJ2A 1YSPA 2W1RA 3MQOA 4JGOA 2M7VA 2ZMVA 2ZOHA 5I5LA 1P0ZA 4Q0JA 5HDDA 2MJ6A 4HP9A 3H82A 1KOUA 3PBNA 1VB6A 1H8MA 2L0WA 4GW9A 3S7QA 4WL9A 4HP4A 3R4KA 4WUJA 3HCYA 3HJKA 4EU0A 3A0VA 3W2ZA 3H7WB 1UWNX 4WLAA 4WF0A 3A0SA 3R7WA 3FPVA 4LLOB 4EW7A 4GCZA 2J3TD 4HHDA 4Q0IA 2CMNA 3E0YA 3IS2B 3VOLA 2D02A 3C38A 4CLCA 3F1PB 3UMDA 2BASA 3IBJA 3O5YA 4WN5A 3RFBA 4I3AA 4NKPA 3ICYA 3KYZA 3EGXC 3EWKA 2P08A 5HDSA 5MC7A 3OCNA 4II7A 4H6JB 3E4QA 1TF1A 1S66L 4EEUA 3P7NA 3H9WA 1YSQA 2L4RA 2J80A 2Z6CA 4HQAA 2QJ5A 5HWWA 1OJ5A 4QPRA 5DJUA 1OTEA 3PXPA 4HY8A 1ODVA 3C2WA 3NOTC 3PR6A 3NJAA 1ZTUA 4EESA 2W3GA 3LIAA 3EEHA 2J3WA 1S4RA 2OWHA 3SW1A 2O9CA 1NLYA 1S4SA 1S1YA 3VE3A 3CAXA 2XSSA 4PKYA 3UB7A 4BJPA 4HOIA 1T19A 3LR0A 4L0LA 4UQIM 5DKKA 4BWIA 4EUVA 5TJJA 3PBTA 2IA2A 3FG8A 4GS9B 1V9YA 2VV8A 3B33A 4FOFA 3NOPC 2JKRM 4FSFA 5HDCA 1JNUA 4NEED 3BQAA 2NUPC 3T4KA 3CWFA 2ZBBA 4Q0HA 4IHQA 1X0OA 2QJ7A 1T18A 4MN6A 2Y79A 4R38A 1UGUA 4WEJA 2PD8A 1S1ZA 3KO6A 3MXQA 2WKQA 1WA9A 2O9AA 4P6ZM 4F3LB 4HH2A 2KOIA 2EWWA 4DN0A 1IOUA 2VA0A 5IU1A 4O0PA 1DP9A 3RTYA 2PD7A 2PDRA 3BWLA 3KSIA 2V0WA 3MMHA 3NOUC 4DMZA 5J4EA 1UWPX 5KSHA 3UB6A 4ARZA 4CLCE 1XJ6A 5KIZA 2QWSA 3BY9A 3TE8A 4LRYC 3EGDC 2QKPA 2PHYA 4HNBA 3LFVA 2V9AA 2INWA 2NUTC 1EW0A 1Y28A 4I38A 5AVFA 4YOFA 2R78A 4CLCD 3LYXA 1F98A 2HV1A 3LI8A 2M7UA 2FZ0A 3G6OA 2PR6A 3LR3A 3LIEA 1V9ZA 2JKTM 3KSFA 4E04A 1XJ2A 3E4PA 4ETXA 1OT6A 3EQVA 1W63M 3KX0X 3H7WA 4HJ6A 2VKSA 1GSVA 4HIAA 2OWJA 3OBFA 4IUHA 2M1CA 2PT7A 3F1OB 3OC2A 5HWVA 5IT5A 3IS2A 1D06A 2O99A 4L9EA 3F1PA 4PHTA 3KYQA 5L8MA 2PYPA 5DFXA 2P04A 5G4ZA 3OCLA 4PAUA 3T4SA 3P01A 4H6JA 4HJ4A 3TRCA 3S7OA 4EETB 1N9OA 3GDIA 1TS0A 5HD3A 3KSHA 4XT2B 2W3FA 2VLGA 1NLZA 2XROA 5F69A 4I5SA 2V1BA 3LR5A 5HSQA 4R70A 2HJEA 4MDZA 3LICA 3T4QA 3LIDA 1OTDA 2V1AA 4BBTA 2YKHA 1F9IA 2PR5A 2B02A 2V0UA 4NXBA 1DP6A 2LB9A 2VZWA 1H3QA 1W63Q 5C5KA 2L1MA 2W3DA 2QYBA 5A8BA 2HGVA 3BJNA 4RQ9A 2A24B 1D7EA 2JKRI 3C30A 3K2NA 1TS7A 3F1NB 5CX7A 5DJTA 3JVVA 2J3TC 3TW8A 1XFQA 4KUOA 4OOLA 4GS9A 3ULFA 3MFXA 5J3WA 1LSVA 2HF6A 4JGPA 3T4TA 4ZRRA 5F68A 5HL6A 4LRZE 4ETZA 4I3JA 3PYPA 2K31A 5FL3A 3CUEC 3CI6A 4DJ3A 4GLQA 4NXGA 4GHIB 3BW6A 3MF0A 5IS1A 4HI4A 3BY8A 4B93A 5HZHA 4OOMA 5HD5A 4F3LA 4BBVA 1GSWA 4MN5A 1G28A 3ZYTA 4G3KA 3LI9A 5DKLA 4LPZA 3K3DA 2W1TB 2P7JA 4Y5FA 3A0RA 3EOIA 3T4JA 4WEKA 5G4YA 4B9OA 2EWVA 3CITA 3OOVA 2KDKA 3JVUA 4MN7A 2GJ3A 3T50A 1N9LA 1TS8A 3FPWA 1NRJA 1N9NA 1VHMA 2W0NA 2GZAA 4O01A 1F5MA 3LIBA 4PKYG 1OTAA 2JKTI 2OOLA 4EEPA 3IBRA 1YAXA 4KQOA 1LT0A 1TS6A 4R3AA 2WKPA 1LL8A 1OTIA 5HPFA 1OPXA 2JHEA 2VX8A 2PYRA 3CLOA 4Z1WA 2OAP1 2VV7A 2B18A 1P9RA 3K3CA 5F6AA 3NHQA 1NWZA 4I39A 4EERA 3H82B 3LR4A 2K2NA 4I3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1A A;  5J7E A;  3F1O A;  1DRM A;  2D01 A;  3LUQ A;  4L9G A;  4BBU A;  1DP8 A;  4L9F A;  2YKF A;  4LRX C;  4NXE A;  3UME A;  1LSX A;  4K08 A;  4XT2 A;  3UB8 A;  3OLO A;  2H28 A;  3MR0 A;  3PHY A;  4HH3 A;  4EXO A;  1OTB A;  3UE6 A;  1XFN A;  2VV6 A;  2A24 A;  2EA9 A;  3F1N A;  3VE4 A;  4R6L A;  5F5Y A;  5AVE A;  2JN7 A;  4KUK A;  4YWZ A;  4NXF A;  2K7S A;  2Z6D A;  2ZOI A;  3MQQ A;  4GHI A;  5HWT A;  2QHK A;  3RH8 B;  1LSW A;  3E4O A;  5EFW A;  4HJ3 A;  3ZQ5 A;  4KQD A;  1GSX A;  2I9V A;  4JGR A;  1OJG A;  1T1C A;  1MZU A;  2WKR A;  2VEA A;  3HJI A;  3D72 A;  1OT9 A;  3UB9 A;  3GEC A;  3C8C A;  4JGQ A;  2W27 A;  1XJ4 A;  1T1B A;  3MJQ A;  2KX6 A;  3FC7 A;  1XJ3 A;  4M4X A;  1S67 L;  5TBM B;  1BYW A;  1P97 A;  4EQ1 A;  3LIF A;  5TBM A;  4DJ2 A;  3MQO A;  4JGO A;  2ZOH A;  5I5L A;  1P0Z A;  5HDD A;  4HP9 A;  3H82 A;  1KOU A;  1VB6 A;  2L0W A;  4GW9 A;  4WL9 A;  4HP4 A;  4WUJ A;  3HJK A;  3A0V A;  3H7W B;  1UWN X;  4WLA A;  4WF0 A;  3A0S A;  4LLO B;  4EW7 A;  4GCZ A;  4HHD A;  2CMN A;  3IS2 B;  3VOL A;  2D02 A;  3F1P B;  3UMD A;  2BAS A;  4WN5 A;  4I3A A;  3ICY A;  3EWK A;  5HDS A;  4H6J B;  3E4Q A;  1S66 L;  4EEU A;  3P7N A;  3H9W A;  2L4R A;  2J80 A;  2Z6C A;  4HQA A;  2QJ5 A;  5HWW A;  1OJ5 A;  5DJU A;  1OTE A;  4HY8 A;  1ODV A;  3C2W A;  3NOT C;  3NJA A;  4EES A;  3LIA A;  3EEH A;  1S4R A;  2OWH A;  3SW1 A;  1S4S A;  1S1Y A;  3VE3 A;  3CAX A;  4PKY A;  3UB7 A;  4HOI A;  1T19 A;  5DKK A;  3FG8 A;  4GS9 B;  1V9Y A;  2VV8 A;  3B33 A;  3NOP C;  5HDC A;  1JNU A;  3CWF A;  2ZBB A;  1X0O A;  2QJ7 A;  1T18 A;  4MN6 A;  4R38 A;  1UGU A;  2PD8 A;  1S1Z A;  3MXQ A;  2WKQ A;  1WA9 A;  4F3L B;  4HH2 A;  5IU1 A;  1DP9 A;  3RTY A;  2PD7 A;  2PDR A;  3BWL A;  2V0W A;  3NOU C;  5J4E A;  1UWP X;  3UB6 A;  1XJ6 A;  5KIZ A;  2QWS A;  3BY9 A;  4LRY C;  2QKP A;  2PHY A;  4HNB A;  2V9A A;  2INW A;  1EW0 A;  1Y28 A;  4I38 A;  5AVF A;  2R78 A;  3LYX A;  1F98 A;  2HV1 A;  3LI8 A;  3G6O A;  2PR6 A;  3LIE A;  1V9Z A;  4E04 A;  1XJ2 A;  3E4P A;  1OT6 A;  3KX0 X;  3H7W A;  4HJ6 A;  1GSV A;  4HIA A;  2OWJ A;  2M1C A;  5HWV A;  3F1O B;  3IS2 A;  1D06 A;  4L9E A;  3F1P A;  2PYP A;  5G4Z A;  4H6J A;  4HJ4 A;  4EET B;  1N9O A;  3GDI A;  1TS0 A;  5HD3 A;  4XT2 B;  2VLG A;  5F69 A;  4I5S A;  2V1B A;  5HSQ A;  4R70 A;  3LIC A;  3LID A;  1OTD A;  2V1A A;  4BBT A;  2YKH A;  1F9I A;  2PR5 A;  2B02 A;  2V0U A;  4NXB A;  1DP6 A;  2L1M A;  5A8B A;  4RQ9 A;  2A24 B;  1D7E A;  1TS7 A;  3F1N B;  5DJT A;  1XFQ A;  4KUO A;  4GS9 A;  3ULF A;  3MFX A;  5J3W A;  1LSV A;  4JGP A;  5F68 A;  4LRZ E;  4I3J A;  3PYP A;  4DJ3 A;  4NXG A;  4GHI B;  5IS1 A;  4HI4 A;  3BY8 A;  5HZH A;  5HD5 A;  4F3L A;  4BBV A;  1GSW A;  4MN5 A;  1G28 A;  5DKL A;  3LI9 A;  4LPZ A;  3K3D A;  2P7J A;  3A0R A;  5G4Y A;  4B9O A;  2KDK A;  2GJ3 A;  3T50 A;  1N9L A;  1TS8 A;  1N9N A;  2W0N A;  3LIB A;  4PKY G;  1OTA A;  2OOL A;  4EEP A;  3IBR A;  1LT0 A;  1TS6 A;  4R3A A;  2WKP A;  1LL8 A;  1OTI A;  2JHE A;  2PYR A;  3CLO A;  2VV7 A;  3K3C A;  5F6A A;  3NHQ A;  1NWZ A;  4I39 A;  4EER A;  3H82 B;  4I3I A; 
#chains in the Genus database with same CATH topology
 1T1A A;  2ZC3 B;  2D01 A;  3B42 A;  4L9G A;  4ZBE A;  3GRJ A;  1FOF A;  1DP8 A;  4L9F A;  3NDG A;  1XKZ A;  3S7N A;  4H8R A;  4LEN A;  2O0Y A;  3UDI A;  4ESP A;  1ALQ A;  4IUK A;  3UB8 A;  2ZC6 B;  3T4O A;  5CGS A;  1MPL A;  4IJG A;  4EWF A;  3OLO A;  4UEY A;  3ZFZ A;  2ZQA A;  2EXB A;  2H28 A;  1SZV A;  4DRT A;  5DF9 A;  4LCM A;  1RGZ A;  2Y2I A;  4PM7 A;  3VOZ A;  3CJM A;  4UA7 A;  3JPU A;  5HFO A;  4JF6 A;  3VV4 A;  5HAI A;  5DF8 A;  4ZJ1 A;  3Q7V A;  4GJ4 A;  3MZE A;  1LI0 A;  2V8C A;  3F1N A;  3BEB A;  2JC7 A;  4R6L A;  5F5Y A;  5AVE A;  3CUE A;  4CQH A;  4Y15 A;  2UWX A;  2XR0 A;  1BLH A;  4S2N C;  4E6X A;  4NXF A;  2ZOI A;  5HWT A;  2WKI A;  1L0D A;  5EM1 A;  1STZ A;  4KQD A;  1ESU A;  2Y2H A;  1CK3 A;  4E3K A;  3UO9 A;  2VEA A;  2O9B A;  3TG9 A;  3TJZ C;  3E98 A;  2HP5 A;  1OT9 A;  3IF5 A;  3PTE A;  1ES5 A;  3U2A A;  1K0K A;  4JGQ A;  3PBS A;  2GNX A;  4Y0O A;  2Y2N A;  3HRE A;  3EQU A;  1Y4O A;  3UNW A;  5GHZ A;  1HVB A;  1T1B A;  3DTE A;  3W4O A;  1G6O A;  1SKF A;  1XJ3 A;  5EVI A;  1S67 L;  3V67 A;  3LIF A;  2XFS A;  2HDQ A;  3V3S A;  2W1R A;  2JKF A;  3A3D A;  2M7V A;  2ZOH A;  2P74 A;  4RYE A;  2MJ6 A;  1ONG A;  1KOU A;  2H0Y A;  3UPP A;  1H8M A;  4BLM A;  3R4K A;  4ZTK A;  2HDS A;  4WUJ A;  3UDF A;  1K38 A;  5GL9 A;  5TGF A;  3A0V A;  3W2Z A;  3CG5 A;  1UWN X;  4LLO B;  1SDE A;  3NDE A;  4HHD A;  5F1F A;  5FEF A;  3VOL A;  4RX3 A;  3F1P B;  4CLC A;  4DE3 A;  5HAP A;  2EFU A;  4WN5 A;  3RFB A;  4NKP A;  4N9K A;  1JTG A;  3EWK A;  2P08 A;  4KEN B;  3OCN A;  2X71 A;  1TF1 A;  2QZ6 A;  1S66 L;  3WS5 A;  3P7N A;  3H9W A;  1YSQ A;  1FQG A;  2OLU A;  3DTM A;  4JF5 A;  4UAA A;  4HQA A;  4Y0T A;  2QJ5 A;  4P0M A;  5G18 A;  3C2W A;  3NOT C;  4PPR A;  2W3G A;  3OPR A;  2O9C A;  1S1Y A;  4R23 A;  2Y91 A;  5CER A;  1T19 A;  4L0L A;  3MBZ A;  2XD5 A;  5DKK A;  3OPH A;  5L07 A;  1MBL A;  1BTL A;  5DVA A;  5KSC A;  2HDR A;  3Q81 A;  3N4I A;  4Q0H A;  4MN6 A;  2Y79 A;  1S1Z A;  1WA9 A;  4OKP A;  1Q2Q A;  2E8I A;  2EWW A;  3WWX A;  1IOU A;  4O0P A;  3OZH A;  2B95 A;  1DP9 A;  1K54 A;  2R9W A;  2DCF A;  1H8Z A;  3UB6 A;  4ARZ A;  2X01 A;  3BY9 A;  4JF4 A;  1DJB A;  1K6R A;  2V9A A;  1KVM A;  4YOF A;  4CLC D;  1NZO A;  3UN7 A;  2HV1 A;  2Y2O A;  3MXS A;  3W4P A;  4ZJ2 A;  2Y2G A;  3LR3 A;  4U0T A;  3LIE A;  2JKT M;  4S2K A;  5EOE A;  3W8K A;  1YPR A;  1XJ2 A;  1VET A;  3E4P A;  4ETX A;  1OT6 A;  4OOY A;  3HUO A;  3KX0 X;  4FUW A;  5CHJ A;  1GSV A;  3T12 B;  2M1C A;  2PT7 A;  5HWV A;  3WS2 A;  5IT5 A;  3U4L P;  2O99 A;  5FAO A;  1Y54 A;  5CEB A;  4KZ8 A;  2P04 A;  4FD8 A;  5G4Z A;  1K56 A;  4GDN A;  2PBD P;  3DWK A;  4PAU A;  1SHV A;  3T4S A;  3QNC A;  1AXB A;  3P98 A;  3NY4 A;  3QNB A;  3S7O A;  4EET B;  3GDI A;  4QWO A;  5HD3 A;  1K4F A;  3KSH A;  3CPT A;  1Z09 A;  3IXH A;  3S22 A;  2XRO A;  5F69 A;  1PIO A;  1KE3 A;  1KE4 A;  5AQB A;  2V1A A;  4BBT A;  3T1Q B;  1F9I A;  2B02 A;  2V1Z A;  3NIA A;  1RGY A;  4BD1 A;  2BTF P;  1H3Q A;  2QYB A;  5A8B A;  2DNS A;  3BJN A;  4RQ9 A;  2A24 B;  1D7E A;  3C30 A;  3K2N A;  4KG2 A;  1ERM A;  3IQA A;  3TW8 A;  5DTT A;  4LV0 A;  4PM5 A;  4HEF A;  2ZC7 A;  4R4S A;  2OV5 A;  3ULF A;  4O7D A;  3MFX A;  1LSV A;  1E4D A;  4JGP A;  3T4T A;  2XD1 A;  5F68 A;  3WS4 A;  2OLV A;  4ETZ A;  3PYP A;  2K31 A;  4MEZ A;  5FL3 A;  1Q2P A;  3CI6 A;  1YMX A;  2GDN A;  1CJF A;  3BW6 A;  4HI4 A;  5HZH A;  4OOM A;  1ES2 A;  5FI2 A;  5TR7 A;  4F3L A;  5GHX A;  1H8Y A;  2ACG A;  2PU2 A;  4MLL A;  3T4J A;  1SKO B;  2EWV A;  3OOV A;  3JVU A;  4YFM A;  3C7V A;  1KGG A;  4GD8 A;  1F5M A;  3IH9 A;  4PKY G;  1OTA A;  2HZ5 A;  2OOL A;  1A0K A;  2QMI A;  4WMC A;  4EEP A;  4GN2 A;  3E2L A;  4C6Y A;  4R3A A;  1IEL A;  1K56 D;  1LL8 A;  1OTI A;  3ZG9 B;  2VX8 A;  4GKU A;  4LCL A;  4Z1W A;  4K0W A;  1ONH A;  3QP5 A;  1P9R A;  3K3C A;  5F6A A;  5EE8 A;  1NWZ A;  3H82 B;  3FKW A;  2XK1 A;  2XA7 M;  4OLG A;  2C6W B;  4K91 A;  3GQZ A;  1CI9 A;  1ZKJ A;  2WKE A;  5K5B A;  1PW1 A;  1XA7 A;  2A49 A;  3ISG A;  5FAS A;  1L0G A;  4GZB A;  4G3V A;  1YT4 A;  5DTS A;  2W3H A;  5EPH A;  4FH4 A;  4K08 A;  1ZG4 A;  2R9X A;  4QHC A;  5FQ9 A;  1MWR A;  3T1R A;  4MMN A;  3DBA A;  4KZ7 A;  4HBU A;  1RCJ A;  4X6T A;  3DWZ A;  1D1J A;  3G34 A;  2EX8 A;  1IFQ A;  3G32 A;  2VV6 A;  5M1A A;  1BLP A;  1GHP A;  3E2K A;  3VE4 A;  1JVJ A;  3I7J A;  5AQ7 A;  4E6W A;  3EEA A;  1K25 A;  4YWZ A;  4YIN A;  4DXC A;  4EQI A;  4ME4 A;  4X1M A;  5DFY A;  2K7S A;  1YKD A;  4DDY A;  2PAV P;  4UQI S;  2DMW A;  1CEF A;  3IF6 B;  2J9P A;  3D3O A;  4Y3I A;  4Y13 A;  4HJ3 A;  1LL9 A;  1GSX A;  3IF6 C;  1MZU A;  3QP6 A;  4WMC D;  3VFH A;  2H0T A;  4WEL A;  3JYI A;  2XLN A;  1H5X A;  3UB5 P;  3HJI A;  3D72 A;  2G7U A;  5AJG A;  3C8C A;  3M6H A;  1ZG6 A;  4Y17 A;  1L0F A;  2ZC4 B;  2ZQC A;  2Y59 A;  3PBR A;  3RXX A;  1P9W A;  2PBY A;  3MKE A;  3MJQ A;  1MKM A;  4D60 A;  1FIL A;  2GX5 A;  4X69 A;  3N6I A;  2VGL M;  5CED A;  2ZM8 A;  4KQR A;  4WZ5 A;  3IHA A;  1YSP A;  4JGO A;  1G68 A;  5I5L A;  4Q0J A;  1L0E A;  5EOO A;  5HDD A;  3M2K A;  4HP9 A;  3IHB A;  5E2E A;  4EV4 A;  2WAE A;  2L0W A;  1GA9 A;  3UE1 A;  4WL9 A;  1YLZ A;  2VGJ A;  3HCY A;  3G31 A;  5L2F A;  1BSG A;  2Z2M B;  4OLD A;  4B88 A;  3C4O A;  3H7W B;  4EW7 A;  4GCZ A;  1VM1 A;  2J3T D;  2CMN A;  1BT5 A;  2VGK A;  2D02 A;  3C38 A;  3UMD A;  3IXB A;  1HD8 A;  4GDB A;  1KDW A;  3GV9 A;  4H6J B;  4EEU A;  3DW0 A;  5HL1 A;  1TDG A;  2L4R A;  4Q8I A;  4PMA A;  3UE0 A;  2J80 A;  1YLY A;  1HZO A;  5HWW A;  2XFT A;  4QPR A;  2FFF B;  3LEQ A;  3PXP A;  4QY5 A;  4S2N A;  3A3I A;  3GSG A;  4JXG A;  3MFD A;  1IKG A;  4X68 A;  3IT9 A;  3SW1 A;  4N9L A;  1NLY A;  2Z2L B;  3D9Y A;  3UPO A;  3L9K A;  4HOI A;  1PI4 A;  4UQI M;  3PBT A;  4JXW A;  2IA2 A;  4R3J A;  3NOP C;  4FSF A;  4NEE D;  3BQA A;  3T4K A;  3B3X A;  1PZO A;  3OPL A;  1X0O A;  2P9V B;  1GA0 A;  1PWG A;  1FCN A;  2IWC A;  2XDM A;  2ZQ7 A;  4U0X A;  5JYO A;  4R4R A;  3KO6 A;  3BEC A;  3MXQ A;  4KG6 A;  3FV7 A;  2O9A A;  1J3W A;  4DN0 A;  2VA0 A;  4CJN A;  3C5A A;  3WS1 A;  2PD7 A;  2PDR A;  4MBF A;  1IYP A;  3BWL A;  4RA7 A;  4IBX A;  3V3R A;  5J4E A;  5KSH A;  5HW3 A;  5FQM A;  4CLC E;  1PYY A;  3TE8 A;  4LRY C;  1NY0 A;  2PHY A;  2INW A;  3IX3 A;  5AVF A;  4S2J A;  3LYX A;  1PNE A;  2M7U A;  1BLC A;  3LI8 A;  3S1Y A;  2FZ0 A;  2HDU A;  3G6O A;  1JWV A;  4NG2 A;  4IED A;  4BD0 A;  1G5U A;  3EQV A;  1XP4 A;  4GB7 A;  4HJ6 A;  1IYO A;  2OWJ A;  2J9O A;  3SS3 A;  1ZC2 A;  5HX9 A;  4IUH A;  3F1O B;  3S4X A;  3F1P A;  4PHT A;  5DF7 A;  4P85 A;  3KYQ A;  5M18 A;  5DFX A;  1N4O A;  2Y4A A;  3OCL A;  3MZD A;  3RXW A;  3P01 A;  1I5Q A;  2V8F A;  3VP2 A;  2HP9 A;  1ES3 A;  1TS0 A;  4XT2 B;  3LR5 A;  5HSQ A;  4P87 A;  4MDZ A;  4U3T A;  3BFF A;  2PR5 A;  3FZC A;  2V0U A;  4NXB A;  4LV1 A;  3ZGA B;  4K0X A;  3WRZ A;  5GLC A;  2WZZ A;  3M2J A;  1W79 A;  2W3D A;  2BLS A;  3HVF A;  4FH2 A;  2JKR I;  3Q82 A;  5DJT A;  4EBL A;  3JVV A;  5E2G A;  3GTC A;  4KUO A;  3HUM A;  4OQ0 A;  5J3W A;  3NI9 A;  4ZRR A;  2C5W B;  5HL6 A;  4LRZ E;  3V50 A;  5CHM A;  4I3J A;  3FYZ A;  3VP1 A;  1N9B A;  4QJG A;  4OVD A;  4GHI B;  5IS1 A;  3MF0 A;  5BOH A;  5EVI D;  3DTI A;  3ZVW A;  3ZYT A;  5DKL A;  3LI9 A;  3IWQ A;  2W1T B;  4Y5F A;  3CMZ A;  3A0R A;  3EOI A;  5HAQ A;  3MKF A;  2EX6 A;  5G4Y A;  4B9O A;  1TS8 A;  2Y2Q A;  3HLC A;  4E3N A;  1N9N A;  4B4X A;  3QHY A;  1MWS A;  1LLB A;  3HLD A;  3NC8 A;  2Y2P A;  3BRM A;  3IBR A;  2H10 A;  3G2Y A;  1LT0 A;  2WGV A;  2X02 A;  1I2W A;  1K57 C;  1AWI A;  2PYR A;  3CLO A;  2B18 A;  3LCE A;  3IX4 A;  3NEC A;  3LR4 A;  5A91 A;  3QP8 A;  5J7E A;  2ZL1 B;  2XA7 S;  4Y2F A;  3IXD A;  3LUQ A;  1PW8 A;  4BBU A;  3ZG0 A;  1K55 C;  4KG5 A;  3PBO A;  3O87 A;  3R7W B;  5I94 A;  3B47 A;  3SH9 A;  2YKF A;  4LRX C;  3VP4 A;  3ZG8 B;  2UV0 E;  5J8X A;  3UME A;  5FQK A;  2FFY A;  1NZU A;  1FIK A;  4IBR A;  3MQ0 A;  1FSW A;  2A2L A;  4E3O A;  1SDN A;  4DDS A;  4O8G A;  4EXO A;  1OTB A;  3UE6 A;  4KZB A;  2A24 A;  3MS6 A;  3UY6 A;  2Y8H A;  4AFI A;  2VJW A;  4UHU A;  1CF0 A;  1LL5 A;  3SOI A;  4KUK A;  5EUA A;  2Z6D A;  5EVL A;  3BYD A;  3WRT A;  3LY4 A;  2QHK A;  1DJA A;  3RH8 B;  3UE3 A;  3E4O A;  1E3U A;  1NYM A;  1PWD A;  1ZHH B;  1IYS A;  5EEC A;  2I9V A;  4JGR A;  4QB8 A;  1LI9 A;  3ITA A;  1W8Y A;  2WKR A;  2OAQ 1;  2J7V A;  4MCW A;  4OP8 A;  1SKO A;  2A3U A;  4C75 A;  4C3Q A;  2W27 A;  2DRW A;  3HLG A;  3S7P A;  4KZ5 A;  3C7U A;  4BMW A;  3FC7 A;  4DF6 A;  2OSU A;  3SH7 A;  2FH5 A;  4M4X A;  4ID4 A;  2VGL S;  5TBM B;  4Z9Q A;  4EQ1 A;  2W3E A;  5TBM A;  5HPI A;  4DJ2 A;  3O3V A;  4R0Q A;  3AGF A;  3W4Q A;  1P0Z A;  4QU3 A;  3H82 A;  2EXA A;  4JXS A;  4OPR A;  4S2P A;  2G2W A;  4S2L A;  4IVI A;  1MY8 A;  1G6A A;  4R3B A;  3HJK A;  4WLA A;  4Q0I A;  3E0Y A;  3IS2 B;  2WK0 A;  4X25 A;  2J8Y A;  1NYY A;  2E8J A;  2QPN A;  3VSK A;  5FSR A;  4I3A A;  2H5S A;  1W5D A;  1U60 A;  3O86 A;  3EGX C;  5FI6 A;  5HDS A;  2IWB A;  2ZMA A;  3E4Q A;  5CEC A;  1CQA A;  5FQI A;  5DJU A;  1OTE A;  4HY8 A;  3ZHH A;  1PFL A;  2Y2J A;  1VEU B;  3BFE A;  2J3W A;  3EEH A;  1HLU P;  1S4S A;  5CGX A;  2XSS A;  3HL9 A;  3BM6 A;  2WAD A;  3UB7 A;  4BJP A;  2EX2 A;  3HUN A;  3DAV A;  4PM8 A;  1OME A;  1BUL A;  4EUV A;  3IF6 A;  1IYQ A;  1PI5 A;  4JXV A;  4OPZ A;  3FG8 A;  5GLB A;  4GS9 B;  2VV8 A;  3B33 A;  1JNU A;  1FCO A;  4S2I A;  3LY3 A;  4IHQ A;  1TEM A;  2QJ7 A;  1EWZ A;  3ZCZ A;  3LO7 A;  4GOG A;  2XF3 A;  1BZA A;  1UGU A;  3CHW P;  2PD8 A;  4P6B A;  2WKQ A;  2ZLY A;  1BUE A;  4KZ3 A;  4HH2 A;  2XH9 A;  2KOI A;  1YLJ A;  1PRQ A;  2ZC5 B;  4E3M A;  5FQJ A;  3RTY A;  3UPN A;  2V0W A;  3MMH A;  3NOU C;  4DMZ A;  3GVB A;  4JPM A;  3VP0 A;  3SS5 A;  3HLE A;  1XJ6 A;  5KIZ A;  3EGD C;  2QKP A;  3LFV A;  3BFG A;  2ZQD A;  1MKI A;  1EW0 A;  4QY6 A;  2JE5 A;  1F98 A;  3AGD A;  5F82 A;  3V39 A;  3IH8 A;  2PR6 A;  1V9Z A;  4BL3 A;  3KSF A;  4E04 A;  3OPP A;  3A3F A;  3H7W A;  1VQQ A;  4CPK A;  2VKS A;  5FDS A;  4HIA A;  4WBG A;  3OC2 A;  1D06 A;  2ZM0 A;  3P09 A;  5EV0 A;  1GCE A;  2Y2M A;  5E43 A;  3G4P A;  4H6J A;  3LEZ A;  3TRC A;  3LGO A;  4XXR A;  1L3L A;  1N9O A;  5A92 A;  2CC1 A;  2W3F A;  2VLG A;  4I5S A;  4R70 A;  5JYP A;  4FTX A;  1FSY A;  1OTD A;  3SH8 A;  2JBF A;  3NBL A;  3T1X A;  1FR1 A;  3WS0 A;  2LB9 A;  2VZW A;  4GNU A;  4E3J A;  5C5K A;  3SS4 A;  3Q7V B;  1ERO A;  5HAR A;  1XGJ A;  3F1N B;  5CX7 A;  4UA9 A;  5FI7 A;  3BFD A;  4E3L A;  1I2S A;  1XFQ A;  1NXY A;  2XQZ A;  1WYB A;  4OOL A;  5L10 A;  5IHV A;  3ITB A;  5CRF A;  1YMS A;  5FA7 A;  1XXM A;  1LHY A;  3CUE C;  4DJ3 A;  4GLQ A;  2P9V A;  4LV2 A;  4NXG A;  5CGW A;  1J9M A;  3BY8 A;  4PM9 A;  4B93 A;  4S2O A;  1CI8 A;  5EVE A;  2WGI A;  4BBV A;  1GSW A;  4NET A;  1QMF A;  4G3K A;  5D3O A;  4KZ4 A;  3K3D A;  2ZQ8 A;  3PAG A;  3T1S A;  4MN7 A;  3DTK A;  3T50 A;  5GLD A;  3FPW A;  1IKI A;  1NRJ A;  1VHM A;  2W0N A;  3A3E A;  2GZA A;  3CZD A;  1GHI A;  2JKT I;  1FCM A;  5EVI B;  1S6R A;  1W7F A;  2WKP A;  4LGW A;  5GLA A;  1C3B A;  4KZ9 A;  2B5R A;  4N1X A;  3NHQ A;  4E3I A;  4IVK A;  4EER A;  5EVI C;  4OH0 A;  2EFX A;  4NK3 A;  1O07 A;  4X55 A;  2K2N A;  3F1O A;  1DRM A;  5CHU A;  3VOY A;  3D4F A;  1PZP A;  3PAE A;  4X56 A;  4NXE A;  5LBR A;  4CLC B;  3KSG A;  1LSX A;  3T4L A;  4XT2 A;  1JTD A;  2WUQ A;  4JBF A;  1MWU A;  4DE2 A;  4MNR A;  3FKV A;  1YM1 A;  3ZG5 A;  3ZNY A;  4CLC C;  3MR0 A;  3Q1F A;  3PHY A;  4HH3 A;  3MSH A;  3TOI A;  1XFN A;  4S2M A;  2ZMF A;  2EA9 A;  4OPY A;  3VFF A;  1MC0 A;  1CEG A;  1YLP A;  5AQ9 A;  4OQH A;  2JN7 A;  1S0W A;  3IWI A;  1F2K A;  2LB5 A;  3MQQ A;  4GHI A;  4A5R A;  5AQA A;  1LSW A;  4DE0 A;  5EFW A;  1XPB A;  3ZQ5 A;  5U47 A;  2V2F F;  1OJG A;  2ZM2 A;  1YQS A;  1T1C A;  5TFQ A;  3BFC A;  2W1T A;  5GHY A;  2ZJ9 A;  5CTN A;  1TD5 A;  3MXR A;  1O7E A;  4HES A;  3UB9 A;  2WZX A;  3GEC A;  4P6Z S;  2KLI A;  3ZNT A;  4G3W A;  3BQ8 A;  4WM9 A;  1W8Q A;  2HJ9 C;  2XRN A;  1K57 A;  1XJ4 A;  3TSG A;  3VSL A;  2Q9N A;  2KX6 A;  3ZDJ A;  3PBQ A;  4ARZ B;  4YNR A;  2XGN A;  1BYW A;  1P97 A;  4QD4 A;  3O88 A;  1K54 C;  3MQO A;  2Y2K A;  2ZMV A;  4RVA A;  1M6K A;  1RP5 A;  3G2Z A;  1MXO A;  1K55 A;  3PBN A;  4JLF A;  1VB6 A;  1M40 A;  5FAP A;  3HLF A;  4GW9 A;  3S7Q A;  2ZL1 A;  3M6B A;  4HP4 A;  5F83 A;  1TVF A;  1E25 A;  4JKT A;  4EU0 A;  1VET B;  1XGI A;  4WF0 A;  3A0S A;  3R7W A;  3RJU A;  3FPV A;  3VMA A;  1WYC A;  3Q07 A;  3Q7Z A;  2V20 A;  1ESI A;  2BAS A;  3IBJ A;  3O5Y A;  3ICY A;  3KYZ A;  3HLW A;  3GR2 A;  5MC7 A;  5E2F A;  3N7W A;  1Z6F A;  4II7 A;  4OON A;  4B4Z A;  3CPT B;  4ZAM A;  4BEN A;  1YLW A;  2Q0O A;  2Z6C A;  1TDL A;  1GHM A;  1OJ5 A;  1DY6 A;  4WYY A;  1ODV A;  3PR6 A;  3NJA A;  1ZTU A;  2Y55 A;  4EES A;  3A3J A;  5M19 A;  3LIA A;  4KQQ A;  1S4R A;  2OWH A;  3VE3 A;  4WZ4 A;  3CAX A;  4PKY A;  1ACF A;  4OP5 A;  1JWP A;  2WKH A;  4OQG A;  3LR0 A;  3HBR A;  4XUX A;  5EM0 A;  4BWI A;  5CTM A;  3QP1 A;  5TJJ A;  3BLS A;  1V9Y A;  4FOF A;  2JKR M;  1KVL A;  5HDC A;  2NUP C;  3CWF A;  2ZBB A;  3BLM A;  3HLB A;  3IXG A;  3ZG7 B;  3UDX A;  1T18 A;  5A93 A;  1IEM A;  1K6S A;  3G35 A;  5FQQ A;  4R38 A;  5A90 A;  4WEJ A;  4LV3 A;  4P6Z M;  4F3L B;  3NUL A;  5IU1 A;  4BQM A;  5CXW A;  1FR6 A;  2ZD8 A;  2IWD A;  1SCW A;  3KSI A;  4OQI A;  4N1H A;  1KGF A;  3FWL A;  1UWP X;  1MWT A;  4MBK A;  2QWS A;  2JKG A;  4DKI A;  4LFU A;  4MBH A;  4HNB A;  5FAT A;  2NUT C;  4I38 A;  1Y28 A;  4EUZ A;  2R78 A;  2HPB A;  1ES4 A;  4XUZ A;  1EI5 A;  4Y7P A;  4ZJ3 A;  1W63 M;  1KGE A;  3QP4 A;  2XEP A;  3IWO A;  3VP3 A;  3OBF A;  2WYX A;  3IS2 A;  4L9E A;  3N8S A;  4F94 A;  5KZH A;  5L8M A;  2PYP A;  5FEG A;  4PM6 A;  4KZ6 A;  4HJ4 A;  4EBN A;  1K4E A;  4GD6 A;  1QME A;  2I72 A;  4ZDX A;  2RL3 A;  2EX9 A;  4X53 A;  4Y0U A;  3C4P A;  5FAQ A;  4BL2 A;  5E2H A;  3MZF A;  1NLZ A;  1KDS A;  2JCH A;  2V1B A;  2HJE A;  3L7H A;  3LIC A;  3T4Q A;  3LID A;  4FCF A;  2YKH A;  5F1G A;  4X1L A;  4R1G A;  4N92 A;  1VEU A;  1E3U D;  2HP6 A;  1DP6 A;  1L2S A;  4D2O A;  4KZA A;  3IX8 A;  1W63 Q;  5DTK A;  2L1M A;  1KE0 A;  4RX2 A;  2HGV A;  2BG1 A;  1NRF A;  1HTZ A;  4EBP A;  1NJ4 A;  1TS7 A;  5FDH A;  2J3T C;  2VK3 A;  2PRF A;  1WE4 A;  5KMW A;  4GS9 A;  2HF6 A;  2G2U A;  4M3K A;  2RCX A;  1DJC A;  4OPQ A;  3ZVT A;  1XA1 A;  4DE1 A;  2PU4 A;  5L09 A;  2WGW B;  3V5M A;  2WGW A;  1PWC A;  1XX2 A;  2AVX A;  1ERQ A;  5HD5 A;  4MN5 A;  1G28 A;  3KYE A;  1BLS A;  4LPZ A;  3NCK A;  2P7J A;  4DXB A;  2ZQ9 A;  1JWZ A;  3GMW A;  2Y2L A;  4WEK A;  3CIT A;  4UA6 A;  2KDK A;  2GJ3 A;  1N9L A;  3N8R A;  3QP2 A;  3G30 A;  4O01 A;  3LIB A;  4HBT A;  1H0M A;  2WAF A;  1YAX A;  4KQO A;  1TS6 A;  5HPF A;  1OPX A;  2JHE A;  1YLT A;  2OAP 1;  2VV7 A;  3AGE A;  3N8L A;  4I39 A;  3SZT A;  4WZ5 C;  4I3I A;  2Q9M A; 
#chains in the Genus database with same CATH homology
 1T1A A;  5J7E A;  3F1O A;  2XA7 M;  2XA7 S;  4Y2F A;  1DRM A;  2D01 A;  3LUQ A;  3B42 A;  4L9G A;  4BBU A;  1DP8 A;  4L9F A;  5K5B A;  3PBO A;  3S7N A;  3R7W B;  4G3V A;  3B47 A;  2O0Y A;  2YKF A;  4LRX C;  4NXE A;  2W3H A;  5LBR A;  4CLC B;  3UME A;  3KSG A;  1LSX A;  4K08 A;  4IUK A;  3T4L A;  4XT2 A;  3UB8 A;  3T4O A;  4IJG A;  3MQ0 A;  3OLO A;  4UEY A;  2A2L A;  2H28 A;  4MMN A;  3DBA A;  4CLC C;  5DF9 A;  3MR0 A;  4O8G A;  3PHY A;  4HH3 A;  4EXO A;  1OTB A;  3VV4 A;  1IFQ A;  3UE6 A;  1XFN A;  4GJ4 A;  2VV6 A;  2A24 A;  2ZMF A;  2EA9 A;  3F1N A;  1MC0 A;  3VE4 A;  2Y8H A;  4R6L A;  4AFI A;  5F5Y A;  5AVE A;  3CUE A;  2VJW A;  4CQH A;  2JN7 A;  4KUK A;  3EEA A;  4YWZ A;  4NXF A;  4ME4 A;  5DFY A;  2K7S A;  1YKD A;  2Z6D A;  2ZOI A;  2LB5 A;  3MQQ A;  4UQI S;  2DMW A;  4GHI A;  5HWT A;  2QHK A;  3RH8 B;  3D3O A;  4Y3I A;  3UE3 A;  1LSW A;  1STZ A;  3E4O A;  5EFW A;  4HJ3 A;  1ZHH B;  3ZQ5 A;  4KQD A;  1GSX A;  2I9V A;  4JGR A;  1OJG A;  1T1C A;  1MZU A;  2WKR A;  2VEA A;  4WEL A;  2O9B A;  2W1T A;  2OAQ 1;  3TJZ C;  3HJI A;  4MCW A;  3E98 A;  3D72 A;  2G7U A;  1OT9 A;  1TD5 A;  3UB9 A;  5AJG A;  3GEC A;  3C8C A;  3U2A A;  4JGQ A;  3PBS A;  2GNX A;  4P6Z S;  2KLI A;  4G3W A;  3BQ8 A;  2HJ9 C;  3EQU A;  2W27 A;  3PBR A;  2XRN A;  3S7P A;  1XJ4 A;  1P9W A;  1T1B A;  3MJQ A;  1MKM A;  4BMW A;  2KX6 A;  3FC7 A;  2GX5 A;  1G6O A;  3PBQ A;  2FH5 A;  1XJ3 A;  4YNR A;  4M4X A;  4ARZ B;  2VGL M;  1S67 L;  2VGL S;  5TBM B;  1BYW A;  1P97 A;  2W3E A;  3V67 A;  4EQ1 A;  3LIF A;  5TBM A;  5HPI A;  4DJ2 A;  1YSP A;  2W1R A;  3MQO A;  4JGO A;  2M7V A;  2ZMV A;  2ZOH A;  5I5L A;  1P0Z A;  4Q0J A;  5HDD A;  2MJ6 A;  4HP9 A;  3H82 A;  1KOU A;  3PBN A;  1VB6 A;  1H8M A;  2L0W A;  4GW9 A;  3S7Q A;  4WL9 A;  4HP4 A;  3R4K A;  4WUJ A;  3HCY A;  3HJK A;  4EU0 A;  3A0V A;  3W2Z A;  3H7W B;  1UWN X;  4WLA A;  4WF0 A;  3A0S A;  3R7W A;  3FPV A;  4LLO B;  4EW7 A;  4GCZ A;  2J3T D;  4HHD A;  4Q0I A;  2CMN A;  3E0Y A;  3IS2 B;  3VOL A;  2D02 A;  3C38 A;  4CLC A;  3F1P B;  3UMD A;  2BAS A;  3IBJ A;  3O5Y A;  4WN5 A;  3RFB A;  4I3A A;  4NKP A;  3ICY A;  3KYZ A;  3EGX C;  3EWK A;  2P08 A;  5HDS A;  5MC7 A;  3OCN A;  4II7 A;  4H6J B;  3E4Q A;  1TF1 A;  1S66 L;  4EEU A;  3P7N A;  3H9W A;  1YSQ A;  2L4R A;  2J80 A;  2Z6C A;  4HQA A;  2QJ5 A;  5HWW A;  1OJ5 A;  4QPR A;  5DJU A;  1OTE A;  3PXP A;  4HY8 A;  1ODV A;  3C2W A;  3NOT C;  3PR6 A;  3NJA A;  1ZTU A;  4EES A;  2W3G A;  3LIA A;  3EEH A;  2J3W A;  1S4R A;  2OWH A;  3SW1 A;  2O9C A;  1NLY A;  1S4S A;  1S1Y A;  3VE3 A;  3CAX A;  2XSS A;  4PKY A;  3UB7 A;  4BJP A;  4HOI A;  1T19 A;  3LR0 A;  4L0L A;  4UQI M;  5DKK A;  4BWI A;  4EUV A;  5TJJ A;  3PBT A;  2IA2 A;  3FG8 A;  4GS9 B;  1V9Y A;  2VV8 A;  3B33 A;  4FOF A;  3NOP C;  2JKR M;  4FSF A;  5HDC A;  1JNU A;  4NEE D;  3BQA A;  2NUP C;  3T4K A;  3CWF A;  2ZBB A;  4Q0H A;  4IHQ A;  1X0O A;  2QJ7 A;  1T18 A;  4MN6 A;  2Y79 A;  4R38 A;  1UGU A;  4WEJ A;  2PD8 A;  1S1Z A;  3KO6 A;  3MXQ A;  2WKQ A;  1WA9 A;  2O9A A;  4P6Z M;  4F3L B;  4HH2 A;  2KOI A;  2EWW A;  4DN0 A;  1IOU A;  2VA0 A;  5IU1 A;  4O0P A;  1DP9 A;  3RTY A;  2PD7 A;  2PDR A;  3BWL A;  3KSI A;  2V0W A;  3MMH A;  3NOU C;  4DMZ A;  5J4E A;  1UWP X;  5KSH A;  3UB6 A;  4ARZ A;  4CLC E;  1XJ6 A;  5KIZ A;  2QWS A;  3BY9 A;  3TE8 A;  4LRY C;  3EGD C;  2QKP A;  2PHY A;  4HNB A;  3LFV A;  2V9A A;  2INW A;  2NUT C;  1EW0 A;  1Y28 A;  4I38 A;  5AVF A;  4YOF A;  2R78 A;  4CLC D;  3LYX A;  1F98 A;  2HV1 A;  3LI8 A;  2M7U A;  2FZ0 A;  3G6O A;  2PR6 A;  3LR3 A;  3LIE A;  1V9Z A;  2JKT M;  3KSF A;  4E04 A;  1XJ2 A;  3E4P A;  4ETX A;  1OT6 A;  3EQV A;  1W63 M;  3KX0 X;  3H7W A;  4HJ6 A;  2VKS A;  1GSV A;  4HIA A;  2OWJ A;  3OBF A;  4IUH A;  2M1C A;  2PT7 A;  3F1O B;  3OC2 A;  5HWV A;  5IT5 A;  3IS2 A;  1D06 A;  2O99 A;  4L9E A;  3F1P A;  4PHT A;  3KYQ A;  5L8M A;  2PYP A;  5DFX A;  2P04 A;  5G4Z A;  3OCL A;  4PAU A;  3T4S A;  3P01 A;  4H6J A;  4HJ4 A;  3TRC A;  3S7O A;  4EET B;  1N9O A;  3GDI A;  1TS0 A;  5HD3 A;  3KSH A;  4XT2 B;  2W3F A;  2VLG A;  1NLZ A;  2XRO A;  5F69 A;  4I5S A;  2V1B A;  3LR5 A;  5HSQ A;  4R70 A;  2HJE A;  4MDZ A;  3LIC A;  3T4Q A;  3LID A;  1OTD A;  2V1A A;  4BBT A;  2YKH A;  1F9I A;  2PR5 A;  2B02 A;  2V0U A;  4NXB A;  1DP6 A;  2LB9 A;  2VZW A;  1H3Q A;  1W63 Q;  5C5K A;  2L1M A;  2W3D A;  2QYB A;  5A8B A;  2HGV A;  3BJN A;  4RQ9 A;  2A24 B;  1D7E A;  2JKR I;  3C30 A;  3K2N A;  1TS7 A;  3F1N B;  5CX7 A;  5DJT A;  3JVV A;  2J3T C;  3TW8 A;  1XFQ A;  4KUO A;  4OOL A;  4GS9 A;  3ULF A;  3MFX A;  5J3W A;  1LSV A;  2HF6 A;  4JGP A;  3T4T A;  4ZRR A;  5F68 A;  5HL6 A;  4LRZ E;  4ETZ A;  4I3J A;  3PYP A;  2K31 A;  5FL3 A;  3CUE C;  3CI6 A;  4DJ3 A;  4GLQ A;  4NXG A;  4GHI B;  3BW6 A;  3MF0 A;  5IS1 A;  4HI4 A;  3BY8 A;  4B93 A;  5HZH A;  4OOM A;  5HD5 A;  4F3L A;  4BBV A;  1GSW A;  4MN5 A;  1G28 A;  3ZYT A;  4G3K A;  3LI9 A;  5DKL A;  4LPZ A;  3K3D A;  2W1T B;  2P7J A;  4Y5F A;  3A0R A;  3EOI A;  3T4J A;  4WEK A;  5G4Y A;  4B9O A;  2EWV A;  3CIT A;  3OOV A;  2KDK A;  3JVU A;  4MN7 A;  2GJ3 A;  3T50 A;  1N9L A;  1TS8 A;  3FPW A;  1NRJ A;  1N9N A;  1VHM A;  2W0N A;  2GZA A;  4O01 A;  1F5M A;  3LIB A;  4PKY G;  1OTA A;  2JKT I;  2OOL A;  4EEP A;  3IBR A;  1YAX A;  4KQO A;  1LT0 A;  1TS6 A;  4R3A A;  2WKP A;  1LL8 A;  1OTI A;  5HPF A;  1OPX A;  2JHE A;  2VX8 A;  2PYR A;  3CLO A;  4Z1W A;  2OAP 1;  2VV7 A;  2B18 A;  1P9R A;  3K3C A;  5F6A A;  3NHQ A;  1NWZ A;  4I39 A;  4EER A;  3H82 B;  3LR4 A;  2K2N A;  4I3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...