4CLCE

Crystal structure of ybr137w protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
172
structure length
172
Chain Sequence
b'MVVLDKKLLERLTSRKTPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMAVSSLIAFANESL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0303 PROTEIN YBR137W
molecule tags Protein transport
source organism Saccharomyces cerevisiae
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
total genus 58
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcE00
4CLCC 4BMWA 3FPWA 5CX7A 4CLCA 2A2LA 4CLCD 4CLCB 4CLCE 3FPVA 4NKPA
chains in the Genus database with same CATH superfamily
3NY4A 3UMDA 3Q07A 1S66L 1T1AA 5CEBA 2VKSA 3MSHA 1PW1A 1FIKA 2ZM8A 3ZNTA 4WF0A 4EESA 1PNEA 5DKLA 3N7WA 1FR6A 5DJUA 5DTSA 2WKQA 2QYBA 3E2KA 5F6AA 1JTGA 4JKTA 3GV9A 4LGWA 2Y2NA 3UN7A 1XP4A 1KVMA 3UDIA 1K6RA 1OJ5A 5TJJA 4X68A 3SH7A 4NKPA 1H3QA 1G5UA 3N8SA 5IU1A 3U2AA 2A49A 2IA2A 4OOLA 2V2FF 1VQQA 4NEED 4B88A 1YKDA 3MQOA 3N4IA 3NC8A 3LI9A 2EX6A 3HCYA 1F2KA 3DAVA 3FG8A 3LCEA 5E2EA 4L9FA 3MJQA 4X1MA 3VOZA 1YMSA 1OJGA 4QB8A 3OLOA 3PAEA 5DF7A 2YKFA 4HOIA 1KVLA 4R38A 5KZHA 1VEUB 3EGXC 2KDKA 2JKRI 1G6OA 5GHXA 1IOUA 2X02A 2K7SA 4Z1WA 3F1OA 4OPRA 3G2YA 3M6HA 3PBQA 3BYDA 1V9YA 3TOIA 1YLJA 2NUTC 1LSXA 1K55C 4I5SA 4BBUA 2PR5A 3KSHA 4GOGA 2PYRA 3UE0A 1YSQA 3FPWA 1ZG4A 5HL6A 4OQIA 4DE1A 2W3FA 1Q2QA 1IYOA 4PKYG 3IWQA 2OWJA 4P85A 2W0NA 2ZQ8A 3DTIA 1RP5A 4WBGA 1N9NA 3QP6A 4EEUA 2PU4A 2VX8A 4S2PA 4LRYC 2EFXA 4FCFA 5GHYA 1A0KA 1U60A 3T1XA 1XGIA 5DF8A 3GR2A 3M6BA 5GL9A 3UE1A 3MXQA 2Y55A 1E3UD 1CK3A 2XH9A 4LRXC 4OLDA 1L0GA 1K55A 5DTKA 1OPXA 1YLTA 4CLCC 1YLYA 2W3EA 3OZHA 4E04A 4EQ1A 3UB7A 4OPZA 1J3WA 3OPHA 1BLPA 3TG9A 2WKHA 3R7WA 5U47A 3CUEC 4E3JA 4PM5A 5CTMA 2PYPA 5A91A 1L0EA 1L0DA 4S2NA 3KO6A 3P09A 1KDWA 3ICYA 1N9BA 3OC2A 4O0PA 3BQ8A 3KSIA 5JYPA 1FR1A 1K4FA 1G28A 5L2FA 5FEFA 4LV1A 2O9AA 5DFXA 5CECA 3FPVA 4XXRA 5I5LA 4OVDA 3VFFA 1T1BA 5GLBA 3QP2A 5EVIC 3HJKA 2WUQA 3UPOA 3MS6A 3O86A 1FCOA 2PRFA 4DF6A 3SS4A 4MN5A 1GHIA 3ZVTA 5CGXA 1EW0A 1YAXA 4ARZB 4BWIA 1K56D 4NXGA 5I94A 1N4OA 2Y2IA 4LV3A 5LBRA 1T1CA 4R4RA 3LO7A 1S4RA 3JYIA 2X71A 1DRMA 2D02A 4UAAA 4B93A 1IYPA 3PBTA 2W3HA 4QU3A 2HF6A 3C5AA 1E25A 4GB7A 3BEBA 3ZVWA 4ARZA 3IHAA 1K0KA 5FAPA 3CITA 2J80A 2QWSA 1KDSA 3KSGA 1BUEA 4GLQA 2JC7A 4ZRRA 1PW8A 1OT6A 3RXXA 4NXBA 5HDDA 4HJ6A 3VOYA 3OPRA 5TBMB 2BG1A 2VGLM 5FSRA 1GCEA 2V8CA 2XA7M 3HUMA 4YNRA 3LI8A 4O8GA 4EU0A 3A3FA 1MWTA 4M4XA 3UY6A 5FAQA 3HREA 3L9KA 1H8ZA 4ESPA 5L09A 2KX6A 3TRCA 3DWZA 4C75A 1FOFA 2FFYA 3C7VA 3NOPC 4DDYA 3BECA 2G2WA 3L7HA 4BJPA 4DE2A 3VE4A 2XD1A 2Y91A 3HBRA 5HX9A 3S7NA 3UB6A 2AVXA 2PU2A 1AWIA 2OSUA 2OLVA 3G32A 2HJEA 5EOEA 4N1XA 2G7UA 1I5QA 5EV0A 2J7VA 1W79A 1DP9A 3NULA 2GX5A 2JKFA 3ITBA 3IT9A 1YLWA 3H82A 3UDXA 2WKRA 4MBHA 3HJIA 4DE0A 3ZQ5A 4Y0TA 2ZC5B 5D3OA 4MDZA 3IX4A 5FASA 4MNRA 1SDNA 3NDEA 5HAPA 3IXBA 4FTXA 4JXSA 4QY6A 3T50A 2GNXA 3HUOA 2HDSA 5A93A 5EVLA 4D2OA 4BL3A 1S67L 4BL2A 4B4ZA 4OKPA 1JNUA 3G35A 3E4PA 3D9YA 1F98A 4UA6A 2VV8A 3V3RA 4LCLA 4H6JA 4O7DA 4I3AA 3BY8A 4KUKA 3CJMA 1NLZA 3W2ZA 4KG5A 1PI5A 3SS3A 3C2WA 2IWBA 4IBRA 3BJNA 1MXOA 2A24B 3UB9A 1CI8A 4KZ4A 4N9LA 4S2NC 2PDRA 1H0MA 2ZM0A 3KX0X 1BULA 2WK0A 2HDRA 3PBSA 3LFVA 3BLSA 3W4OA 1G68A 4DXBA 3UB8A 5K5BA 1GSXA 3T4KA 3N6IA 3HLBA 5DVAA 3FKWA 4PPRA 2ZL1B 4P6ZM 5F83A 3C4OA 5CHJA 2XD5A 3S22A 4HHDA 3LY3A 3WS0A 4E6XA 5E2GA 4B4XA 1P9RA 5HARA 5AVFA 3ZYTA 5EOOA 3PHYA 1BZAA 1TS0A 2HZ5A 2UWXA 1SKOA 4X25A 2I72A 1YPRA 3A3DA 3ZNYA 3F1PA 4JPMA 4CQHA 1O7EA 3V5MA 4FH4A 2M7VA 3A0SA 2HJ9C 5L8MA 1O07A 1NJ4A 4UQIM 4ZTKA 3AGFA 4EERA 4EV4A 3FYZA 2PBYA 3P01A 2EX9A 1ACFA 4CJNA 4UHUA 5FDHA 3MZEA 3ZCZA 4PM6A 2QMIA 1GHPA 1HZOA 2C5WB 4QY5A 3NCKA 3BFDA 4MCWA 4X53A 3W8KA 1JWZA 1TF1A 3MFXA 3T4OA 2XA7S 5DKKA 2XRNA 3MMHA 1ONHA 1GA0A 1Y28A 4HIAA 5FQQA 4BLMA 3LR0A 4JF6A 4OP8A 4PM7A 1C3BA 5AVEA 1SCWA 2PD8A 3U4LP 4WYYA 5EUAA 1IFQA 2HP9A 3V67A 4L9EA 4EQIA 2QPNA 3FKVA 2C6WB 4E3KA 1BSGA 2JKTI 2J9OA 3EGDC 3CAXA 3LUQA 5E2FA 3SOIA 2PAVP 5M18A 1K54C 5F1GA 5DFYA 4X55A 2A3UA 1PRQA 1CEFA 3C7UA 3C4PA 1WA9A 3MF0A 2B5RA 1NXYA 2M1CA 1LSWA 3O88A 1WE4A 1GSWA 1QMEA 4OONA 3TJZC 5FQKA 1FCNA 3FWLA 4OPYA 3SW1A 4ME4A 2ACGA 1T18A 2L1MA 3DWKA 4IEDA 2Z6CA 5HW3A 2XFTA 4WZ5C 1ES4A 3T1RA 4HNBA 4KZ8A 4Q0JA 1JVJA 3CWFA 4E3MA 2P7JA 2JKGA 1RGYA 1K54A 1XJ4A 3BM6A 3EEAA 3Q81A 4LFUA 4QWOA 1NZUA 4F94A 3NDGA 3WS5A 1S1YA 1ES5A 5FATA 2O9BA 2ZM2A 5CGWA 5EVIB 4R70A 1XPBA 2ZLYA 1EROA 3MBZA 1XX2A 1BYWA 2J3TD 4JF5A 5EE8A 3E4OA 4QPRA 1NY0A 4NXEA 2H0YA 3CMZA 1ZC2A 3HLGA 4OH0A 3IS2A 5EVID 4I3IA 4KZ5A 5AQ7A 4Q0IA 1ZHHB 4UQIS 4IBXA 1KE0A 3RTYA 5FAOA 4UA9A 4EUVA 1BT5A 3DBAA 2QKPA 1L3LA 1YLZA 3G2ZA 3IF5A 1K4EA 4MBKA 1EI5A 3CLOA 4WEJA 1PI4A 1VEUA 3D4FA 4R3BA 2XROA 4R1GA 4R6LA 1UWPX 1HTZA 3NIAA 3O5YA 4JXWA 4MN7A 1S6RA 4FSFA 3WS1A 1LLBA 3A0VA 4NXFA 3V3SA 2JBFA 2O99A 3LEZA 2ZQDA 1DP8A 4P6ZS 3AGEA 4KG6A 2V1ZA 1OT9A 5E2HA 5M19A 2XF3A 3BFGA 4Q0HA 2V9AA 5F5YA 3LR3A 5HFOA 4MMNA 4BENA 1DP6A 1W8QA 4QHCA 1K56A 3BFEA 3IBRA 2BTFP 3MZDA 3GQZA 2V20A 3QP5A 5EM1A 3T4TA 2V1BA 1IKGA 4KZBA 2EFUA 5HWVA 1XJ6A 1TDGA 3D72A 1D1JA 4PMAA 4Y0OA 2VEAA 1OTIA 4KQQA 1ZG6A 3E2LA 1KGEA 4DMZA 2ZMFA 4LCMA 1XFQA 4HY8A 1IKIA 4MEZA 4GCZA 3GECA 3IH8A 3IHBA 1GHMA 1F5MA 4JXGA 1NLYA 3UPPA 3LICA 5HDSA 1RGZA 3IX8A 3JVVA 1P9WA 3BY9A 3FV7A 1XFNA 3H82B 4EEPA 1MKIA 3P98A 3UE3A 5BOHA 4GNUA 4DDSA 3QNCA 3NHQA 1ONGA 3K3CA 5FEGA 1K6SA 2WAFA 4WZ4A 5CEDA 4GZBA 3HLDA 3NOTC 2BLSA 4S2JA 2OAQ1 1FCMA 4EETB 2EA9A 2VK3A 3GTCA 4OQ0A 4YOFA 1NYYA 4BMWA 1FQGA 1NYMA 3A3EA 4Y0UA 5HPIA 4GKUA 4WMCD 1NRFA 1MZUA 4BQMA 5CXWA 3VSKA 5FQMA 3F1OB 3M2KA 2HV1A 4R3AA 1LHYA 3G34A 4DJ2A 1M6KA 2P9VA 3CPTB 3T1SA 1VHMA 3E4QA 3Q7VB 2GJ3A 2I9VA 3M2JA 5DF9A 4CLCB 3IXHA 3UB5P 4N1HA 4G3KA 3GRJA 5CERA 4XT2B 1VB6A 4E3OA 2WGIA 3D3OA 3LIBA 4KQDA 2Y2KA 2O9CA 3PBNA 4GHIA 1YM1A 2JHEA 4A5RA 2LB5A 4GJ4A 4ETXA 1TS8A 4EBNA 2WKIA 5GLAA 1CEGA 1MKMA 5HD3A 4B9OA 1RCJA 4ZBEA 1S1ZA 1PZOA 1ES3A 4WELA 4RVAA 1LI0A 3E98A 2H10A 3B47A 2A2LA 3B3XA 5HSQA 4G3VA 3LEQA 3NECA 1OTBA 3IX3A 4CPKA 1Y4OA 4U0XA 2J3WA 4PM8A 4BD0A 1DJBA 5GLDA 4U0TA 5AQ9A 1EWZA 4EUZA 3OCNA 1PWDA 4XT2A 4BBVA 3T4QA 3GMWA 4CLCE 2EWWA 4MN6A 4NETA 4IVIA 1L0FA 3CHWP 3Q7VA 4O01A 5CTNA 3EOIA 3B42A 2WGWB 4Y7PA 2ZC7A 1XGJA 3CUEA 1YMXA 2Y2OA 3H7WB 5GHZA 3LYXA 4Y17A 5EECA 5F82A 4DN0A 1CF0A 4WUJA 4E3NA 4EBLA 2P08A 2INWA 3LY4A 4R23A 2ZQ7A 3SH9A 4ID4A 1Z09A 3MKEA 5J4EA 2O0YA 2ZQ9A 4S2LA 4XUXA 4WEKA 2JCHA 2W27A 4XUZA 2L4RA 3MQQA 5DTTA 3F1PB 3IS2B 3OBFA 2WAEA 4I38A 1W63Q 3VE3A 4K91A 3ZHHA 2VGJA 4BD1A 3BRMA 2J9PA 1IYQA 1H5XA 4HESA 5EVIA 3WRZA 4WN5A 3DTEA 5DJTA 4NK3A 1ESUA 4HJ3A 3ZDJA 2ZL1A 2GZAA 2IWCA 2HPBA 1E3UA 4YINA 2W3DA 1WYBA 3C30A 3QNBA 4RQ9A 3Q7ZA 2ZJ9A 5TGFA 4C6YA 3PBOA 1IELA 1SDEA 3H7WA 4Y3IA 4X69A 4R3JA 4DJ3A 2K2NA 2GDNA 3TSGA 4K0XA 4UEYA 3P7NA 5J3WA 1STZA 2VZWA 3ZFZA 2XDMA 2KOIA 5KSHA 4LLOB 5HL1A 5EPHA 2Q9NA 4IUKA 1HVBA 3KSFA 2XSSA 3MFDA 4EXOA 3K3DA 2Y8HA 1KE3A 2FH5A 3LIAA 4QD4A 4H8RA 3ZGAB 4LPZA 2BASA 2EX2A 1K57C 2R9XA 4ETZA 4JGPA 1YSPA 5M1AA 2QHKA 3LIDA 3JPUA 4Y15A 3S4XA 4PM9A 2XR0A 3ZG5A 2Z2LB 3T4LA 5CHMA 4OPQA 4L9GA 2Y2QA 3LIEA 3BFFA 2Z2MB 4HI4A 5J8XA 4LENA 2VJWA 2Y2JA 1JWPA 3UMEA 1BLHA 1F9IA 2RL3A 2ZMAA 3S1YA 3W4PA 4GHIB 1PIOA 1BLSA 4Z9QA 4KQOA 2V8FA 3I7JA 4RX2A 3G4PA 3ITAA 4KUOA 2VGLS 1TD5A 4BBTA 2EX8A 4E6WA 2R78A 2YKHA 1OMEA 4CLCD 4GD6A 3R7WB 4ZAMA 5GLCA 3PTEA 1ZKJA 3MR0A 3WWXA 3KYEA 1AXBA 1MY8A 2DMWA 1P0ZA 3EQVA 3O87A 3IF6A 1XXMA 3ZG7B 1M40A 3NOUC 4EWFA 5FI6A 3HLFA 4S2MA 3BQAA 4L0LA 3FZCA 2E8JA 2V0WA 1ESIA 3F1NA 4HP4A 3MZFA 1LL5A 4KG2A 1W7FA 3K2NA 3T4SA 1NWZA 1LL9A 4P6BA 1MWRA 2VA0A 3QP4A 2ZC3B 1LL8A 1DJAA 1S0WA 1ERMA 2H5SA 2V0UA 2H28A 4C3QA 5FI7A 5IHVA 3NJAA 1E4DA 5J7EA 4EW7A 3VP4A 1CJFA 4GS9B 2XLNA 2E8IA 2V1AA 1PWGA 5A8BA 1FILA 4IHQA 3E0YA 1KOUA 2G2UA 2EWVA 4KZAA 4YFMA 4K0WA 3ISGA 1ALQA 4OLGA 3RFBA 1TEMA 4WL9A 2XQZA 5CGSA 1XKZA 1TS6A 4HBTA 3S7PA 4X1LA 1ZTUA 2VLGA 1UWNX 1JWVA 4JF4A 3PAGA 1GA9A 1CI9A 1KE4A 3HLEA 5G4YA 5CRFA 1UGUA 4LRZE 3WS2A 2JKTM 4OP5A 1TS7A 1TDLA 3OCLA 2Y2LA 1MC0A 3BFCA 2J3TC 4DKIA 2Z6DA 4E3LA 3HLWA 5FL3A 1Y54A 3TW8A 4KZ7A 5AQBA 5C5KA 3UO9A 3PBRA 4H6JB 5L10A 2OAP1 2WADA 3OOVA 1OTAA 4OQHA 1ERQA 5HZHA 5G4ZA 3LR4A 3IXDA 1MWSA 3LR5A 1PZPA 2Y2GA 2X01A 4M3KA 2JN7A 2ZC6B 1H8YA 2ZD8A 3VFHA 3VMAA 2UV0E 4KENB 4PKYA 4N9KA 3OPPA 1P97A 2ZOIA 4X56A 3AGDA 1K57A 3R4KA 4MBFA 2XK1A 4IJGA 1BTLA 1IYSA 4HJ4A 2P04A 3UE6A 5CHUA 5FDSA 4LV2A 4IUHA 2ZQAA 2ZBBA 1PYYA 3KYQA 3BWLA 3CG5A 1N9OA 2OWHA 3F1NB 3EWKA 5EM0A 3RXWA 2VV7A 3SZTA 4DXCA 4I39A 1KGGA 4S2IA 5HWTA 3N8RA 3IH9A 4JLFA 1D7EA 4Q8IA 2HDUA 5FA7A 3QP8A 4NG2A 2XGNA 5JYOA 3PXPA 3CZDA 4DRTA 3UNWA 3B33A 3WRTA 2Q9MA 2MJ6A 2HP6A 2NUPC 2OV5A 5CX7A 3ZG9B 1W63M 4JBFA 4S2KA 4GN2A 5TBMA 4QJGA 2WKPA 1Z6FA 1Q2PA 2ZC4B 2Y4AA 1KGFA 2PT7A 3NBLA 5HDCA 4HH3A 2Y2HA 5F1FA 1VETB 1N9LA 1G6AA 4PHTA 1LSVA 5KSCA 1V9ZA 3GDIA 3QHYA 3VP0A 3DTMA 5IT5A 4KQRA 5IS1A 2H0TA 1SKFA 4KZ6A 5TFQA 5KIZA 1VM1A 1YT4A 3H9WA 3QP1A 4ZJ1A 3IWIA 5HPFA 4IVKA 1FSYA 2FFFB 5HAIA 1XA1A 3T1QB 1BLCA 3SH8A 3A3JA 2Y79A 1VETA 2CC1A 3SS5A 4GS9A 3T12B 3N8LA 4DE3A 1PFLA 1LI9A 3ULFA 2KLIA 2PBDP 2Y2PA 3G6OA 2CMNA 3TE8A 2P74A 5F69A 2OLUA 5MC7A 3A0RA 3LIFA 4JGRA 1TVFA 4MLLA 4II7A 1WYCA 4EBPA 4FOFA 4S2OA 1SZVA 1W5DA 2Q0OA 2Y2MA 3PR6A 4HH2A 1W8YA 4CLCA 3V39A 2ZQCA 1XJ3A 3VOLA 3V50A 3NI9A 5AJGA 1YLPA 3RH8B 3VP3A 1IEMA 1XA7A 5FI2A 3GVBA 3VP2A 3HLCA 1MBLA 3OPLA 4WM9A 3DTKA 1I2WA 4F3LB 2XEPA 1X0OA 3C8CA 5G18A 4WLAA 5HWWA 4P87A 5L07A 1SKOB 5KMWA 5EVEA 5HAQA 2ZOHA 4PAUA 1ES2A 1YQSA 4R4SA 1QMFA 2OOLA 2HP5A 4GW9A 1K25A 2B95A 3ZG8B 4K08A 4HP9A 3Q1FA 2RCXA 3IXGA 2R9WA 3MQ0A 2IWDA 3IBJA 1L2SA 3Q82A 2VGKA 4JGQA 4F3LA 4FH2A 3IF6C 2W3GA 3EQUA 4UA7A 2JKRM 4JXVA 1PWCA 2EXBA 2HDQA 5HD5A 1H8MA 4AFIA 4P0MA 1ODVA 3KYZA 2PHYA 4ZJ3A 2FZ0A 2WGWA 3G31A 1MWUA 2A24A 2D01A 2DNSA 3VV4A 3DW0A 4OOMA 4RX3A 3UPNA 4G3WA 5A92A 2WYXA 4Y13A 2ZMVA 5FQJA 2QJ5A 1FSWA 4FD8A 4Y5FA 1T19A 3JVUA 1NRJA 1OTDA 3WS4A 2PD7A 3FC7A 2XFSA 1D06A 3GSGA 4U3TA 3ZG0A 4I3JA 4KZ3A 2VV6A 4E3IA 2M7UA 2K31A 2WZZA 3LGOA 5TR7A 3RJUA 4KZ9A 4WZ5A 5A90A 2HGVA 2QZ6A 2PR6A 2L0WA 3HL9A 3G30A 4R0QA 4GD8A 2WKEA 1CQAA 4ZJ2A 3UDFA 1S4SA 3A3IA 4FUWA 1K38A 3T4JA 3IQAA 3VP1A 2W1RA 2WZXA 1LT0A 1JTDA 1MPLA 3O3VA 3CI6A 2B02A 1J9MA 4Y2FA 3S7OA 2WGVA 1GSVA 4RA7A 1HD8A 5EFWA 3VSLA 1I2SA 4HQAA 3C38A 1OTEA 4D60A 2B18A 3HVFA 3IWOA 5AQAA 4OQGA 1XJ2A 2P9VB 4N92A 2J8YA 4GDNA 1HLUP 2LB9A 3MXSA 2W1TB 3W4QA 3CPTA 4HBUA 3MXRA 5E43A 5F68A 3S7QA 2JE5A 3BW6A 4GDBA 2Y59A 4X6TA 3BLMA 4ZDXA 1SHVA 4RYEA 2DCFA 3IF6B 4HEFA 4WMCA 4JGOA 2DRWA 1DY6A 3EEHA 5FQIA 5FQ9A 1NZOA 4YWZA 2EXAA 4LV0A 1DJCA 3MKFA 3HUNA 4OOYA 2W1TA 3PYPA 2QJ7A
chains in the Genus database with same CATH topology
2JN7A 5DF9A 3UMDA 4CLCB 1S66L 1T1AA 2PDRA 4G3KA 2VKSA 4XT2B 3KX0X 3PBSA 1VB6A 4PKYA 4WF0A 3LFVA 4EESA 3D3OA 1P97A 3LIBA 4KQDA 5DKLA 2ZOIA 5DJUA 2WKQA 2O9CA 3UB8A 3PBNA 2QYBA 1GSXA 4GHIA 5K5BA 3T4KA 2JHEA 5F6AA 3R4KA 2LB5A 4GJ4A 4IJGA 4ETXA 4P6ZM 1TS8A 1MKMA 4HJ4A 4HHDA 5HD3A 2P04A 3UE6A 4B9OA 1OJ5A 1S1ZA 5TJJA 4WELA 4NKPA 3E98A 1H3QA 1P9RA 5IU1A 3U2AA 4IUHA 2IA2A 4OOLA 3B47A 2A2LA 2ZBBA 5HSQA 4G3VA 3KYQA 3BWLA 5AVFA 3ZYTA 2QJ7A 3PHYA 1N9OA 1OTBA 1TS0A 2OWHA 3F1NB 2J3WA 3EWKA 2VV7A 4NEED 1YKDA 4I39A 3F1PA 3MQOA 5HWTA 4CQHA 1D7EA 3LI9A 3HCYA 3FG8A 2M7VA 3A0SA 4L9FA 3MJQA 3OCNA 1OJGA 2HJ9C 4XT2A 5L8MA 4BBVA 3T4QA 3PXPA 4CLCE 2EWWA 3OLOA 4MN6A 2YKFA 3B33A 4HOIA 4UQIM 4EERA 2MJ6A 2NUPC 5CX7A 3P01A 4O01A 1W63M 4R38A 3EOIA 3EGXC 2KDKA 2JKRI 1G6OA 3B42A 1IOUA 3CUEA 2K7SA 3H7WB 5TBMA 3LYXA 4Z1WA 3F1OA 2WKPA 4MCWA 4DN0A 3PBQA 4WUJA 1TF1A 2P08A 3MFXA 1V9YA 2INWA 2NUTC 1LSXA 3T4OA 2XA7S 2PT7A 5DKKA 2XRNA 5HDCA 4HH3A 4I5SA 3MMHA 4BBUA 2PR5A 3KSHA 1Y28A 4HIAA 2PYRA 3LR0A 1YSQA 3FPWA 5J4EA 1N9LA 2O0YA 4PHTA 5HL6A 1LSVA 2W3FA 4WEKA 1V9ZA 3GDIA 5AVEA 2W27A 2L4RA 3MQQA 2PD8A 5IT5A 4PKYG 3F1PB 5IS1A 1IFQA 2OWJA 3IS2B 3V67A 3OBFA 4L9EA 5KIZA 4I38A 1W63Q 2W0NA 3VE3A 3H9WA 2JKTI 5HPFA 3EGDC 1N9NA 4EEUA 3CAXA 3LUQA 2VX8A 4LRYC 4WN5A 5DJTA 2Y79A 5DFYA 4HJ3A 4GS9A 2GZAA 1WA9A 3ULFA 3MXQA 2KLIA 3MF0A 3G6OA 2W3DA 2CMNA 3C30A 3TE8A 2M1CA 4RQ9A 1LSWA 4LRXC 5F69A 1OPXA 5MC7A 4CLCC 1GSWA 3PBOA 3A0RA 3LIFA 4JGRA 3H7WA 3TJZC 2W3EA 4Y3IA 4E04A 4II7A 4EQ1A 2I9VA 4FOFA 4DJ3A 2K2NA 3UB7A 3PR6A 4HH2A 4CLCA 3SW1A 4ME4A 3R7WA 1T18A 4UEYA 3P7NA 3CUEC 2L1MA 1XJ3A 3VOLA 2PYPA 5AJGA 5J3WA 1STZA 2VZWA 3KO6A 3RH8B 3ICYA 2Z6CA 3OC2A 4O0PA 2KOIA 3BQ8A 5KSHA 4LLOB 3KSIA 4IUKA 4HNBA 3KSFA 1G28A 2XSSA 2O9AA 4EXOA 4Q0JA 5DFXA 3CWFA 3K3DA 3FPVA 5I5LA 4F3LB 2Y8HA 2P7JA 1T1BA 2FH5A 1XJ4A 1X0OA 3C8CA 3EEAA 3LIAA 3HJKA 4WLAA 5HWWA 4LPZA 2BASA 4ETZA 4JGPA 4MN5A 1S1YA 1YSPA 2ZOHA 4PAUA 4ARZB 1EW0A 1YAXA 4BWIA 4NXGA 2O9BA 2QHKA 3LIDA 5LBRA 4R70A 1T1CA 1S4RA 1BYWA 3T4LA 2OOLA 4GW9A 2J3TD 1DRMA 4L9GA 3E4OA 2D02A 4QPRA 3LIEA 4NXEA 4HI4A 4B93A 3PBTA 2W3HA 2HF6A 4ARZA 3IS2A 4K08A 4HP9A 2VJWA 4I3IA 3CITA 4Q0IA 1ZHHB 2J80A 4UQIS 3RTYA 2QWSA 3UMEA 3KSGA 1F9IA 4GLQA 3MQ0A 4EUVA 3IBJA 4ZRRA 1OT6A 4GHIB 4NXBA 4JGQA 4F3LA 5HDDA 2W3GA 3EQUA 2JKRM 3DBAA 4HJ6A 4KQOA 2QKPA 5TBMB 2VGLM 5HD5A 4KUOA 2VGLS 2XA7M 1TD5A 4YNRA 3LI8A 4BBTA 1H8MA 2R78A 2YKHA 3CLOA 4O8GA 4AFIA 4EU0A 4WEJA 1ODVA 3KYZA 4M4XA 2PHYA 4CLCD 2XROA 2FZ0A 4R6LA 1UWPX 3R7WB 2A24A 3O5YA 2D01A 3VV4A 4MN7A 4OOMA 4FSFA 3A0VA 4G3WA 3MR0A 4NXFA 2KX6A 3TRCA 2ZMVA 2O99A 2QJ5A 2DMWA 1P0ZA 3EQVA 3NOPC 1DP8A 4P6ZS 4Y5FA 1T19A 3JVUA 4BJPA 1NRJA 3VE4A 1OTDA 3NOUC 2PD7A 3FC7A 3S7NA 3UB6A 1D06A 3BQAA 4L0LA 1OT9A 2V0WA 4Q0HA 2V9AA 3F1NA 4HP4A 4I3JA 2VV6A 3K2NA 2HJEA 5F5YA 1NWZA 3LR3A 2M7UA 3T4SA 2K31A 2VA0A 4MMNA 2G7UA 1DP6A 1LL8A 1DP9A 2GX5A 2HGVA 3IBRA 2PR6A 2L0WA 2V0UA 3H82A 2H28A 3T4TA 3NJAA 2V1BA 2WKRA 3HJIA 3ZQ5A 5J7EA 5HWVA 1XJ6A 3D72A 4EW7A 4MDZA 2VEAA 4GS9B 1S4SA 1OTIA 3T4JA 2V1AA 5A8BA 4DMZA 2ZMFA 1XFQA 4HY8A 2W1RA 4IHQA 1LT0A 4GCZA 3GECA 3E0YA 1KOUA 2EWVA 3T50A 2GNXA 1F5MA 3CI6A 2B02A 4Y2FA 3S7OA 1NLYA 3RFBA 1GSVA 4WL9A 3LICA 5EFWA 5HDSA 4HQAA 3C38A 1OTEA 3JVVA 1P9WA 3BY9A 1TS6A 1S67L 1XFNA 1JNUA 3S7PA 3H82B 1ZTUA 2B18A 2VLGA 3E4PA 1UWNX 4EEPA 1XJ2A 1F98A 3UE3A 2VV8A 3NHQA 5G4YA 3K3CA 4H6JA 2LB9A 1UGUA 2W1TB 4LRZE 2JKTM 3NOTC 2OAQ1 4I3AA 1TS7A 4EETB 3BY8A 3OCLA 2EA9A 5F68A 4YOFA 3S7QA 3BW6A 4KUKA 1MC0A 4BMWA 2J3TC 5HPIA 1NLZA 2Z6DA 3W2ZA 1MZUA 5FL3A 3TW8A 5C5KA 3F1OB 3PBRA 4JGOA 2HV1A 4R3AA 3C2WA 3EEHA 4H6JB 4DJ2A 2OAP1 3OOVA 1OTAA 4YWZA 3BJNA 5HZHA 5G4ZA 1VHMA 2A24B 3LR4A 3E4QA 2W1TA 3PYPA 3UB9A 2GJ3A 3LR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC C;  4BMW A;  3FPW A;  5CX7 A;  4CLC A;  2A2L A;  4CLC D;  4CLC B;  4CLC E;  3FPV A;  4NKP A; 
#chains in the Genus database with same CATH topology
 3NY4 A;  3UMD A;  3Q07 A;  1S66 L;  1T1A A;  5CEB A;  2VKS A;  3MSH A;  1PW1 A;  1FIK A;  2ZM8 A;  3ZNT A;  4WF0 A;  4EES A;  1PNE A;  5DKL A;  3N7W A;  1FR6 A;  5DJU A;  5DTS A;  2WKQ A;  2QYB A;  3E2K A;  5F6A A;  1JTG A;  4JKT A;  3GV9 A;  4LGW A;  2Y2N A;  3UN7 A;  1XP4 A;  1KVM A;  3UDI A;  1K6R A;  1OJ5 A;  5TJJ A;  4X68 A;  3SH7 A;  4NKP A;  1H3Q A;  1G5U A;  3N8S A;  5IU1 A;  3U2A A;  2A49 A;  2IA2 A;  4OOL A;  2V2F F;  1VQQ A;  4NEE D;  4B88 A;  1YKD A;  3MQO A;  3N4I A;  3NC8 A;  3LI9 A;  2EX6 A;  3HCY A;  1F2K A;  3DAV A;  3FG8 A;  3LCE A;  5E2E A;  4L9F A;  3MJQ A;  4X1M A;  3VOZ A;  1YMS A;  1OJG A;  4QB8 A;  3OLO A;  3PAE A;  5DF7 A;  2YKF A;  4HOI A;  1KVL A;  4R38 A;  5KZH A;  1VEU B;  3EGX C;  2KDK A;  2JKR I;  1G6O A;  5GHX A;  1IOU A;  2X02 A;  2K7S A;  4Z1W A;  3F1O A;  4OPR A;  3G2Y A;  3M6H A;  3PBQ A;  3BYD A;  1V9Y A;  3TOI A;  1YLJ A;  2NUT C;  1LSX A;  1K55 C;  4I5S A;  4BBU A;  2PR5 A;  3KSH A;  4GOG A;  2PYR A;  3UE0 A;  1YSQ A;  3FPW A;  1ZG4 A;  5HL6 A;  4OQI A;  4DE1 A;  2W3F A;  1Q2Q A;  1IYO A;  4PKY G;  3IWQ A;  2OWJ A;  4P85 A;  2W0N A;  2ZQ8 A;  3DTI A;  1RP5 A;  4WBG A;  1N9N A;  3QP6 A;  4EEU A;  2PU4 A;  2VX8 A;  4S2P A;  4LRY C;  2EFX A;  4FCF A;  5GHY A;  1A0K A;  1U60 A;  3T1X A;  1XGI A;  5DF8 A;  3GR2 A;  3M6B A;  5GL9 A;  3UE1 A;  3MXQ A;  2Y55 A;  1E3U D;  1CK3 A;  2XH9 A;  4LRX C;  4OLD A;  1L0G A;  1K55 A;  5DTK A;  1OPX A;  1YLT A;  4CLC C;  1YLY A;  2W3E A;  3OZH A;  4E04 A;  4EQ1 A;  3UB7 A;  4OPZ A;  1J3W A;  3OPH A;  1BLP A;  3TG9 A;  2WKH A;  3R7W A;  5U47 A;  3CUE C;  4E3J A;  4PM5 A;  5CTM A;  2PYP A;  5A91 A;  1L0E A;  1L0D A;  4S2N A;  3KO6 A;  3P09 A;  1KDW A;  3ICY A;  1N9B A;  3OC2 A;  4O0P A;  3BQ8 A;  3KSI A;  5JYP A;  1FR1 A;  1K4F A;  1G28 A;  5L2F A;  5FEF A;  4LV1 A;  2O9A A;  5DFX A;  5CEC A;  3FPV A;  4XXR A;  5I5L A;  4OVD A;  3VFF A;  1T1B A;  5GLB A;  3QP2 A;  5EVI C;  3HJK A;  2WUQ A;  3UPO A;  3MS6 A;  3O86 A;  1FCO A;  2PRF A;  4DF6 A;  3SS4 A;  4MN5 A;  1GHI A;  3ZVT A;  5CGX A;  1EW0 A;  1YAX A;  4ARZ B;  4BWI A;  1K56 D;  4NXG A;  5I94 A;  1N4O A;  2Y2I A;  4LV3 A;  5LBR A;  1T1C A;  4R4R A;  3LO7 A;  1S4R A;  3JYI A;  2X71 A;  1DRM A;  2D02 A;  4UAA A;  4B93 A;  1IYP A;  3PBT A;  2W3H A;  4QU3 A;  2HF6 A;  3C5A A;  1E25 A;  4GB7 A;  3BEB A;  3ZVW A;  4ARZ A;  3IHA A;  1K0K A;  5FAP A;  3CIT A;  2J80 A;  2QWS A;  1KDS A;  3KSG A;  1BUE A;  4GLQ A;  2JC7 A;  4ZRR A;  1PW8 A;  1OT6 A;  3RXX A;  4NXB A;  5HDD A;  4HJ6 A;  3VOY A;  3OPR A;  5TBM B;  2BG1 A;  2VGL M;  5FSR A;  1GCE A;  2V8C A;  2XA7 M;  3HUM A;  4YNR A;  3LI8 A;  4O8G A;  4EU0 A;  3A3F A;  1MWT A;  4M4X A;  3UY6 A;  5FAQ A;  3HRE A;  3L9K A;  1H8Z A;  4ESP A;  5L09 A;  2KX6 A;  3TRC A;  3DWZ A;  4C75 A;  1FOF A;  2FFY A;  3C7V A;  3NOP C;  4DDY A;  3BEC A;  2G2W A;  3L7H A;  4BJP A;  4DE2 A;  3VE4 A;  2XD1 A;  2Y91 A;  3HBR A;  5HX9 A;  3S7N A;  3UB6 A;  2AVX A;  2PU2 A;  1AWI A;  2OSU A;  2OLV A;  3G32 A;  2HJE A;  5EOE A;  4N1X A;  2G7U A;  1I5Q A;  5EV0 A;  2J7V A;  1W79 A;  1DP9 A;  3NUL A;  2GX5 A;  2JKF A;  3ITB A;  3IT9 A;  1YLW A;  3H82 A;  3UDX A;  2WKR A;  4MBH A;  3HJI A;  4DE0 A;  3ZQ5 A;  4Y0T A;  2ZC5 B;  5D3O A;  4MDZ A;  3IX4 A;  5FAS A;  4MNR A;  1SDN A;  3NDE A;  5HAP A;  3IXB A;  4FTX A;  4JXS A;  4QY6 A;  3T50 A;  2GNX A;  3HUO A;  2HDS A;  5A93 A;  5EVL A;  4D2O A;  4BL3 A;  1S67 L;  4BL2 A;  4B4Z A;  4OKP A;  1JNU A;  3G35 A;  3E4P A;  3D9Y A;  1F98 A;  4UA6 A;  2VV8 A;  3V3R A;  4LCL A;  4H6J A;  4O7D A;  4I3A A;  3BY8 A;  4KUK A;  3CJM A;  1NLZ A;  3W2Z A;  4KG5 A;  1PI5 A;  3SS3 A;  3C2W A;  2IWB A;  4IBR A;  3BJN A;  1MXO A;  2A24 B;  3UB9 A;  1CI8 A;  4KZ4 A;  4N9L A;  4S2N C;  2PDR A;  1H0M A;  2ZM0 A;  3KX0 X;  1BUL A;  2WK0 A;  2HDR A;  3PBS A;  3LFV A;  3BLS A;  3W4O A;  1G68 A;  4DXB A;  3UB8 A;  5K5B A;  1GSX A;  3T4K A;  3N6I A;  3HLB A;  5DVA A;  3FKW A;  4PPR A;  2ZL1 B;  4P6Z M;  5F83 A;  3C4O A;  5CHJ A;  2XD5 A;  3S22 A;  4HHD A;  3LY3 A;  3WS0 A;  4E6X A;  5E2G A;  4B4X A;  1P9R A;  5HAR A;  5AVF A;  3ZYT A;  5EOO A;  3PHY A;  1BZA A;  1TS0 A;  2HZ5 A;  2UWX A;  1SKO A;  4X25 A;  2I72 A;  1YPR A;  3A3D A;  3ZNY A;  3F1P A;  4JPM A;  4CQH A;  1O7E A;  3V5M A;  4FH4 A;  2M7V A;  3A0S A;  2HJ9 C;  5L8M A;  1O07 A;  1NJ4 A;  4UQI M;  4ZTK A;  3AGF A;  4EER A;  4EV4 A;  3FYZ A;  2PBY A;  3P01 A;  2EX9 A;  1ACF A;  4CJN A;  4UHU A;  5FDH A;  3MZE A;  3ZCZ A;  4PM6 A;  2QMI A;  1GHP A;  1HZO A;  2C5W B;  4QY5 A;  3NCK A;  3BFD A;  4MCW A;  4X53 A;  3W8K A;  1JWZ A;  1TF1 A;  3MFX A;  3T4O A;  2XA7 S;  5DKK A;  2XRN A;  3MMH A;  1ONH A;  1GA0 A;  1Y28 A;  4HIA A;  5FQQ A;  4BLM A;  3LR0 A;  4JF6 A;  4OP8 A;  4PM7 A;  1C3B A;  5AVE A;  1SCW A;  2PD8 A;  3U4L P;  4WYY A;  5EUA A;  1IFQ A;  2HP9 A;  3V67 A;  4L9E A;  4EQI A;  2QPN A;  3FKV A;  2C6W B;  4E3K A;  1BSG A;  2JKT I;  2J9O A;  3EGD C;  3CAX A;  3LUQ A;  5E2F A;  3SOI A;  2PAV P;  5M18 A;  1K54 C;  5F1G A;  5DFY A;  4X55 A;  2A3U A;  1PRQ A;  1CEF A;  3C7U A;  3C4P A;  1WA9 A;  3MF0 A;  2B5R A;  1NXY A;  2M1C A;  1LSW A;  3O88 A;  1WE4 A;  1GSW A;  1QME A;  4OON A;  3TJZ C;  5FQK A;  1FCN A;  3FWL A;  4OPY A;  3SW1 A;  4ME4 A;  2ACG A;  1T18 A;  2L1M A;  3DWK A;  4IED A;  2Z6C A;  5HW3 A;  2XFT A;  4WZ5 C;  1ES4 A;  3T1R A;  4HNB A;  4KZ8 A;  4Q0J A;  1JVJ A;  3CWF A;  4E3M A;  2P7J A;  2JKG A;  1RGY A;  1K54 A;  1XJ4 A;  3BM6 A;  3EEA A;  3Q81 A;  4LFU A;  4QWO A;  1NZU A;  4F94 A;  3NDG A;  3WS5 A;  1S1Y A;  1ES5 A;  5FAT A;  2O9B A;  2ZM2 A;  5CGW A;  5EVI B;  4R70 A;  1XPB A;  2ZLY A;  1ERO A;  3MBZ A;  1XX2 A;  1BYW A;  2J3T D;  4JF5 A;  5EE8 A;  3E4O A;  4QPR A;  1NY0 A;  4NXE A;  2H0Y A;  3CMZ A;  1ZC2 A;  3HLG A;  4OH0 A;  3IS2 A;  5EVI D;  4I3I A;  4KZ5 A;  5AQ7 A;  4Q0I A;  1ZHH B;  4UQI S;  4IBX A;  1KE0 A;  3RTY A;  5FAO A;  4UA9 A;  4EUV A;  1BT5 A;  3DBA A;  2QKP A;  1L3L A;  1YLZ A;  3G2Z A;  3IF5 A;  1K4E A;  4MBK A;  1EI5 A;  3CLO A;  4WEJ A;  1PI4 A;  1VEU A;  3D4F A;  4R3B A;  2XRO A;  4R1G A;  4R6L A;  1UWP X;  1HTZ A;  3NIA A;  3O5Y A;  4JXW A;  4MN7 A;  1S6R A;  4FSF A;  3WS1 A;  1LLB A;  3A0V A;  4NXF A;  3V3S A;  2JBF A;  2O99 A;  3LEZ A;  2ZQD A;  1DP8 A;  4P6Z S;  3AGE A;  4KG6 A;  2V1Z A;  1OT9 A;  5E2H A;  5M19 A;  2XF3 A;  3BFG A;  4Q0H A;  2V9A A;  5F5Y A;  3LR3 A;  5HFO A;  4MMN A;  4BEN A;  1DP6 A;  1W8Q A;  4QHC A;  1K56 A;  3BFE A;  3IBR A;  2BTF P;  3MZD A;  3GQZ A;  2V20 A;  3QP5 A;  5EM1 A;  3T4T A;  2V1B A;  1IKG A;  4KZB A;  2EFU A;  5HWV A;  1XJ6 A;  1TDG A;  3D72 A;  1D1J A;  4PMA A;  4Y0O A;  2VEA A;  1OTI A;  4KQQ A;  1ZG6 A;  3E2L A;  1KGE A;  4DMZ A;  2ZMF A;  4LCM A;  1XFQ A;  4HY8 A;  1IKI A;  4MEZ A;  4GCZ A;  3GEC A;  3IH8 A;  3IHB A;  1GHM A;  1F5M A;  4JXG A;  1NLY A;  3UPP A;  3LIC A;  5HDS A;  1RGZ A;  3IX8 A;  3JVV A;  1P9W A;  3BY9 A;  3FV7 A;  1XFN A;  3H82 B;  4EEP A;  1MKI A;  3P98 A;  3UE3 A;  5BOH A;  4GNU A;  4DDS A;  3QNC A;  3NHQ A;  1ONG A;  3K3C A;  5FEG A;  1K6S A;  2WAF A;  4WZ4 A;  5CED A;  4GZB A;  3HLD A;  3NOT C;  2BLS A;  4S2J A;  2OAQ 1;  1FCM A;  4EET B;  2EA9 A;  2VK3 A;  3GTC A;  4OQ0 A;  4YOF A;  1NYY A;  4BMW A;  1FQG A;  1NYM A;  3A3E A;  4Y0U A;  5HPI A;  4GKU A;  4WMC D;  1NRF A;  1MZU A;  4BQM A;  5CXW A;  3VSK A;  5FQM A;  3F1O B;  3M2K A;  2HV1 A;  4R3A A;  1LHY A;  3G34 A;  4DJ2 A;  1M6K A;  2P9V A;  3CPT B;  3T1S A;  1VHM A;  3E4Q A;  3Q7V B;  2GJ3 A;  2I9V A;  3M2J A;  5DF9 A;  4CLC B;  3IXH A;  3UB5 P;  4N1H A;  4G3K A;  3GRJ A;  5CER A;  4XT2 B;  1VB6 A;  4E3O A;  2WGI A;  3D3O A;  3LIB A;  4KQD A;  2Y2K A;  2O9C A;  3PBN A;  4GHI A;  1YM1 A;  2JHE A;  4A5R A;  2LB5 A;  4GJ4 A;  4ETX A;  1TS8 A;  4EBN A;  2WKI A;  5GLA A;  1CEG A;  1MKM A;  5HD3 A;  4B9O A;  1RCJ A;  4ZBE A;  1S1Z A;  1PZO A;  1ES3 A;  4WEL A;  4RVA A;  1LI0 A;  3E98 A;  2H10 A;  3B47 A;  2A2L A;  3B3X A;  5HSQ A;  4G3V A;  3LEQ A;  3NEC A;  1OTB A;  3IX3 A;  4CPK A;  1Y4O A;  4U0X A;  2J3W A;  4PM8 A;  4BD0 A;  1DJB A;  5GLD A;  4U0T A;  5AQ9 A;  1EWZ A;  4EUZ A;  3OCN A;  1PWD A;  4XT2 A;  4BBV A;  3T4Q A;  3GMW A;  4CLC E;  2EWW A;  4MN6 A;  4NET A;  4IVI A;  1L0F A;  3CHW P;  3Q7V A;  4O01 A;  5CTN A;  3EOI A;  3B42 A;  2WGW B;  4Y7P A;  2ZC7 A;  1XGJ A;  3CUE A;  1YMX A;  2Y2O A;  3H7W B;  5GHZ A;  3LYX A;  4Y17 A;  5EEC A;  5F82 A;  4DN0 A;  1CF0 A;  4WUJ A;  4E3N A;  4EBL A;  2P08 A;  2INW A;  3LY4 A;  4R23 A;  2ZQ7 A;  3SH9 A;  4ID4 A;  1Z09 A;  3MKE A;  5J4E A;  2O0Y A;  2ZQ9 A;  4S2L A;  4XUX A;  4WEK A;  2JCH A;  2W27 A;  4XUZ A;  2L4R A;  3MQQ A;  5DTT A;  3F1P B;  3IS2 B;  3OBF A;  2WAE A;  4I38 A;  1W63 Q;  3VE3 A;  4K91 A;  3ZHH A;  2VGJ A;  4BD1 A;  3BRM A;  2J9P A;  1IYQ A;  1H5X A;  4HES A;  5EVI A;  3WRZ A;  4WN5 A;  3DTE A;  5DJT A;  4NK3 A;  1ESU A;  4HJ3 A;  3ZDJ A;  2ZL1 A;  2GZA A;  2IWC A;  2HPB A;  1E3U A;  4YIN A;  2W3D A;  1WYB A;  3C30 A;  3QNB A;  4RQ9 A;  3Q7Z A;  2ZJ9 A;  5TGF A;  4C6Y A;  3PBO A;  1IEL A;  1SDE A;  3H7W A;  4Y3I A;  4X69 A;  4R3J A;  4DJ3 A;  2K2N A;  2GDN A;  3TSG A;  4K0X A;  4UEY A;  3P7N A;  5J3W A;  1STZ A;  2VZW A;  3ZFZ A;  2XDM A;  2KOI A;  5KSH A;  4LLO B;  5HL1 A;  5EPH A;  2Q9N A;  4IUK A;  1HVB A;  3KSF A;  2XSS A;  3MFD A;  4EXO A;  3K3D A;  2Y8H A;  1KE3 A;  2FH5 A;  3LIA A;  4QD4 A;  4H8R A;  3ZGA B;  4LPZ A;  2BAS A;  2EX2 A;  1K57 C;  2R9X A;  4ETZ A;  4JGP A;  1YSP A;  5M1A A;  2QHK A;  3LID A;  3JPU A;  4Y15 A;  3S4X A;  4PM9 A;  2XR0 A;  3ZG5 A;  2Z2L B;  3T4L A;  5CHM A;  4OPQ A;  4L9G A;  2Y2Q A;  3LIE A;  3BFF A;  2Z2M B;  4HI4 A;  5J8X A;  4LEN A;  2VJW A;  2Y2J A;  1JWP A;  3UME A;  1BLH A;  1F9I A;  2RL3 A;  2ZMA A;  3S1Y A;  3W4P A;  4GHI B;  1PIO A;  1BLS A;  4Z9Q A;  4KQO A;  2V8F A;  3I7J A;  4RX2 A;  3G4P A;  3ITA A;  4KUO A;  2VGL S;  1TD5 A;  4BBT A;  2EX8 A;  4E6W A;  2R78 A;  2YKH A;  1OME A;  4CLC D;  4GD6 A;  3R7W B;  4ZAM A;  5GLC A;  3PTE A;  1ZKJ A;  3MR0 A;  3WWX A;  3KYE A;  1AXB A;  1MY8 A;  2DMW A;  1P0Z A;  3EQV A;  3O87 A;  3IF6 A;  1XXM A;  3ZG7 B;  1M40 A;  3NOU C;  4EWF A;  5FI6 A;  3HLF A;  4S2M A;  3BQA A;  4L0L A;  3FZC A;  2E8J A;  2V0W A;  1ESI A;  3F1N A;  4HP4 A;  3MZF A;  1LL5 A;  4KG2 A;  1W7F A;  3K2N A;  3T4S A;  1NWZ A;  1LL9 A;  4P6B A;  1MWR A;  2VA0 A;  3QP4 A;  2ZC3 B;  1LL8 A;  1DJA A;  1S0W A;  1ERM A;  2H5S A;  2V0U A;  2H28 A;  4C3Q A;  5FI7 A;  5IHV A;  3NJA A;  1E4D A;  5J7E A;  4EW7 A;  3VP4 A;  1CJF A;  4GS9 B;  2XLN A;  2E8I A;  2V1A A;  1PWG A;  5A8B A;  1FIL A;  4IHQ A;  3E0Y A;  1KOU A;  2G2U A;  2EWV A;  4KZA A;  4YFM A;  4K0W A;  3ISG A;  1ALQ A;  4OLG A;  3RFB A;  1TEM A;  4WL9 A;  2XQZ A;  5CGS A;  1XKZ A;  1TS6 A;  4HBT A;  3S7P A;  4X1L A;  1ZTU A;  2VLG A;  1UWN X;  1JWV A;  4JF4 A;  3PAG A;  1GA9 A;  1CI9 A;  1KE4 A;  3HLE A;  5G4Y A;  5CRF A;  1UGU A;  4LRZ E;  3WS2 A;  2JKT M;  4OP5 A;  1TS7 A;  1TDL A;  3OCL A;  2Y2L A;  1MC0 A;  3BFC A;  2J3T C;  4DKI A;  2Z6D A;  4E3L A;  3HLW A;  5FL3 A;  1Y54 A;  3TW8 A;  4KZ7 A;  5AQB A;  5C5K A;  3UO9 A;  3PBR A;  4H6J B;  5L10 A;  2OAP 1;  2WAD A;  3OOV A;  1OTA A;  4OQH A;  1ERQ A;  5HZH A;  5G4Z A;  3LR4 A;  3IXD A;  1MWS A;  3LR5 A;  1PZP A;  2Y2G A;  2X01 A;  4M3K A;  2JN7 A;  2ZC6 B;  1H8Y A;  2ZD8 A;  3VFH A;  3VMA A;  2UV0 E;  4KEN B;  4PKY A;  4N9K A;  3OPP A;  1P97 A;  2ZOI A;  4X56 A;  3AGD A;  1K57 A;  3R4K A;  4MBF A;  2XK1 A;  4IJG A;  1BTL A;  1IYS A;  4HJ4 A;  2P04 A;  3UE6 A;  5CHU A;  5FDS A;  4LV2 A;  4IUH A;  2ZQA A;  2ZBB A;  1PYY A;  3KYQ A;  3BWL A;  3CG5 A;  1N9O A;  2OWH A;  3F1N B;  3EWK A;  5EM0 A;  3RXW A;  2VV7 A;  3SZT A;  4DXC A;  4I39 A;  1KGG A;  4S2I A;  5HWT A;  3N8R A;  3IH9 A;  4JLF A;  1D7E A;  4Q8I A;  2HDU A;  5FA7 A;  3QP8 A;  4NG2 A;  2XGN A;  5JYO A;  3PXP A;  3CZD A;  4DRT A;  3UNW A;  3B33 A;  3WRT A;  2Q9M A;  2MJ6 A;  2HP6 A;  2NUP C;  2OV5 A;  5CX7 A;  3ZG9 B;  1W63 M;  4JBF A;  4S2K A;  4GN2 A;  5TBM A;  4QJG A;  2WKP A;  1Z6F A;  1Q2P A;  2ZC4 B;  2Y4A A;  1KGF A;  2PT7 A;  3NBL A;  5HDC A;  4HH3 A;  2Y2H A;  5F1F A;  1VET B;  1N9L A;  1G6A A;  4PHT A;  1LSV A;  5KSC A;  1V9Z A;  3GDI A;  3QHY A;  3VP0 A;  3DTM A;  5IT5 A;  4KQR A;  5IS1 A;  2H0T A;  1SKF A;  4KZ6 A;  5TFQ A;  5KIZ A;  1VM1 A;  1YT4 A;  3H9W A;  3QP1 A;  4ZJ1 A;  3IWI A;  5HPF A;  4IVK A;  1FSY A;  2FFF B;  5HAI A;  1XA1 A;  3T1Q B;  1BLC A;  3SH8 A;  3A3J A;  2Y79 A;  1VET A;  2CC1 A;  3SS5 A;  4GS9 A;  3T12 B;  3N8L A;  4DE3 A;  1PFL A;  1LI9 A;  3ULF A;  2KLI A;  2PBD P;  2Y2P A;  3G6O A;  2CMN A;  3TE8 A;  2P74 A;  5F69 A;  2OLU A;  5MC7 A;  3A0R A;  3LIF A;  4JGR A;  1TVF A;  4MLL A;  4II7 A;  1WYC A;  4EBP A;  4FOF A;  4S2O A;  1SZV A;  1W5D A;  2Q0O A;  2Y2M A;  3PR6 A;  4HH2 A;  1W8Y A;  4CLC A;  3V39 A;  2ZQC A;  1XJ3 A;  3VOL A;  3V50 A;  3NI9 A;  5AJG A;  1YLP A;  3RH8 B;  3VP3 A;  1IEM A;  1XA7 A;  5FI2 A;  3GVB A;  3VP2 A;  3HLC A;  1MBL A;  3OPL A;  4WM9 A;  3DTK A;  1I2W A;  4F3L B;  2XEP A;  1X0O A;  3C8C A;  5G18 A;  4WLA A;  5HWW A;  4P87 A;  5L07 A;  1SKO B;  5KMW A;  5EVE A;  5HAQ A;  2ZOH A;  4PAU A;  1ES2 A;  1YQS A;  4R4S A;  1QMF A;  2OOL A;  2HP5 A;  4GW9 A;  1K25 A;  2B95 A;  3ZG8 B;  4K08 A;  4HP9 A;  3Q1F A;  2RCX A;  3IXG A;  2R9W A;  3MQ0 A;  2IWD A;  3IBJ A;  1L2S A;  3Q82 A;  2VGK A;  4JGQ A;  4F3L A;  4FH2 A;  3IF6 C;  2W3G A;  3EQU A;  4UA7 A;  2JKR M;  4JXV A;  1PWC A;  2EXB A;  2HDQ A;  5HD5 A;  1H8M A;  4AFI A;  4P0M A;  1ODV A;  3KYZ A;  2PHY A;  4ZJ3 A;  2FZ0 A;  2WGW A;  3G31 A;  1MWU A;  2A24 A;  2D01 A;  2DNS A;  3VV4 A;  3DW0 A;  4OOM A;  4RX3 A;  3UPN A;  4G3W A;  5A92 A;  2WYX A;  4Y13 A;  2ZMV A;  5FQJ A;  2QJ5 A;  1FSW A;  4FD8 A;  4Y5F A;  1T19 A;  3JVU A;  1NRJ A;  1OTD A;  3WS4 A;  2PD7 A;  3FC7 A;  2XFS A;  1D06 A;  3GSG A;  4U3T A;  3ZG0 A;  4I3J A;  4KZ3 A;  2VV6 A;  4E3I A;  2M7U A;  2K31 A;  2WZZ A;  3LGO A;  5TR7 A;  3RJU A;  4KZ9 A;  4WZ5 A;  5A90 A;  2HGV A;  2QZ6 A;  2PR6 A;  2L0W A;  3HL9 A;  3G30 A;  4R0Q A;  4GD8 A;  2WKE A;  1CQA A;  4ZJ2 A;  3UDF A;  1S4S A;  3A3I A;  4FUW A;  1K38 A;  3T4J A;  3IQA A;  3VP1 A;  2W1R A;  2WZX A;  1LT0 A;  1JTD A;  1MPL A;  3O3V A;  3CI6 A;  2B02 A;  1J9M A;  4Y2F A;  3S7O A;  2WGV A;  1GSV A;  4RA7 A;  1HD8 A;  5EFW A;  3VSL A;  1I2S A;  4HQA A;  3C38 A;  1OTE A;  4D60 A;  2B18 A;  3HVF A;  3IWO A;  5AQA A;  4OQG A;  1XJ2 A;  2P9V B;  4N92 A;  2J8Y A;  4GDN A;  1HLU P;  2LB9 A;  3MXS A;  2W1T B;  3W4Q A;  3CPT A;  4HBU A;  3MXR A;  5E43 A;  5F68 A;  3S7Q A;  2JE5 A;  3BW6 A;  4GDB A;  2Y59 A;  4X6T A;  3BLM A;  4ZDX A;  1SHV A;  4RYE A;  2DCF A;  3IF6 B;  4HEF A;  4WMC A;  4JGO A;  2DRW A;  1DY6 A;  3EEH A;  5FQI A;  5FQ9 A;  1NZO A;  4YWZ A;  2EXA A;  4LV0 A;  1DJC A;  3MKF A;  3HUN A;  4OOY A;  2W1T A;  3PYP A;  2QJ7 A; 
#chains in the Genus database with same CATH homology
 2JN7 A;  5DF9 A;  3UMD A;  4CLC B;  1S66 L;  1T1A A;  2PDR A;  4G3K A;  2VKS A;  4XT2 B;  3KX0 X;  3PBS A;  1VB6 A;  4PKY A;  4WF0 A;  3LFV A;  4EES A;  3D3O A;  1P97 A;  3LIB A;  4KQD A;  5DKL A;  2ZOI A;  5DJU A;  2WKQ A;  2O9C A;  3UB8 A;  3PBN A;  2QYB A;  1GSX A;  4GHI A;  5K5B A;  3T4K A;  2JHE A;  5F6A A;  3R4K A;  2LB5 A;  4GJ4 A;  4IJG A;  4ETX A;  4P6Z M;  1TS8 A;  1MKM A;  4HJ4 A;  4HHD A;  5HD3 A;  2P04 A;  3UE6 A;  4B9O A;  1OJ5 A;  1S1Z A;  5TJJ A;  4WEL A;  4NKP A;  3E98 A;  1H3Q A;  1P9R A;  5IU1 A;  3U2A A;  4IUH A;  2IA2 A;  4OOL A;  3B47 A;  2A2L A;  2ZBB A;  5HSQ A;  4G3V A;  3KYQ A;  3BWL A;  5AVF A;  3ZYT A;  2QJ7 A;  3PHY A;  1N9O A;  1OTB A;  1TS0 A;  2OWH A;  3F1N B;  2J3W A;  3EWK A;  2VV7 A;  4NEE D;  1YKD A;  4I39 A;  3F1P A;  3MQO A;  5HWT A;  4CQH A;  1D7E A;  3LI9 A;  3HCY A;  3FG8 A;  2M7V A;  3A0S A;  4L9F A;  3MJQ A;  3OCN A;  1OJG A;  2HJ9 C;  4XT2 A;  5L8M A;  4BBV A;  3T4Q A;  3PXP A;  4CLC E;  2EWW A;  3OLO A;  4MN6 A;  2YKF A;  3B33 A;  4HOI A;  4UQI M;  4EER A;  2MJ6 A;  2NUP C;  5CX7 A;  3P01 A;  4O01 A;  1W63 M;  4R38 A;  3EOI A;  3EGX C;  2KDK A;  2JKR I;  1G6O A;  3B42 A;  1IOU A;  3CUE A;  2K7S A;  3H7W B;  5TBM A;  3LYX A;  4Z1W A;  3F1O A;  2WKP A;  4MCW A;  4DN0 A;  3PBQ A;  4WUJ A;  1TF1 A;  2P08 A;  3MFX A;  1V9Y A;  2INW A;  2NUT C;  1LSX A;  3T4O A;  2XA7 S;  2PT7 A;  5DKK A;  2XRN A;  5HDC A;  4HH3 A;  4I5S A;  3MMH A;  4BBU A;  2PR5 A;  3KSH A;  1Y28 A;  4HIA A;  2PYR A;  3LR0 A;  1YSQ A;  3FPW A;  5J4E A;  1N9L A;  2O0Y A;  4PHT A;  5HL6 A;  1LSV A;  2W3F A;  4WEK A;  1V9Z A;  3GDI A;  5AVE A;  2W27 A;  2L4R A;  3MQQ A;  2PD8 A;  5IT5 A;  4PKY G;  3F1P B;  5IS1 A;  1IFQ A;  2OWJ A;  3IS2 B;  3V67 A;  3OBF A;  4L9E A;  5KIZ A;  4I38 A;  1W63 Q;  2W0N A;  3VE3 A;  3H9W A;  2JKT I;  5HPF A;  3EGD C;  1N9N A;  4EEU A;  3CAX A;  3LUQ A;  2VX8 A;  4LRY C;  4WN5 A;  5DJT A;  2Y79 A;  5DFY A;  4HJ3 A;  4GS9 A;  2GZA A;  1WA9 A;  3ULF A;  3MXQ A;  2KLI A;  3MF0 A;  3G6O A;  2W3D A;  2CMN A;  3C30 A;  3TE8 A;  2M1C A;  4RQ9 A;  1LSW A;  4LRX C;  5F69 A;  1OPX A;  5MC7 A;  4CLC C;  1GSW A;  3PBO A;  3A0R A;  3LIF A;  4JGR A;  3H7W A;  3TJZ C;  2W3E A;  4Y3I A;  4E04 A;  4II7 A;  4EQ1 A;  2I9V A;  4FOF A;  4DJ3 A;  2K2N A;  3UB7 A;  3PR6 A;  4HH2 A;  4CLC A;  3SW1 A;  4ME4 A;  3R7W A;  1T18 A;  4UEY A;  3P7N A;  3CUE C;  2L1M A;  1XJ3 A;  3VOL A;  2PYP A;  5AJG A;  5J3W A;  1STZ A;  2VZW A;  3KO6 A;  3RH8 B;  3ICY A;  2Z6C A;  3OC2 A;  4O0P A;  2KOI A;  3BQ8 A;  5KSH A;  4LLO B;  3KSI A;  4IUK A;  4HNB A;  3KSF A;  1G28 A;  2XSS A;  2O9A A;  4EXO A;  4Q0J A;  5DFX A;  3CWF A;  3K3D A;  3FPV A;  5I5L A;  4F3L B;  2Y8H A;  2P7J A;  1T1B A;  2FH5 A;  1XJ4 A;  1X0O A;  3C8C A;  3EEA A;  3LIA A;  3HJK A;  4WLA A;  5HWW A;  4LPZ A;  2BAS A;  4ETZ A;  4JGP A;  4MN5 A;  1S1Y A;  1YSP A;  2ZOH A;  4PAU A;  4ARZ B;  1EW0 A;  1YAX A;  4BWI A;  4NXG A;  2O9B A;  2QHK A;  3LID A;  5LBR A;  4R70 A;  1T1C A;  1S4R A;  1BYW A;  3T4L A;  2OOL A;  4GW9 A;  2J3T D;  1DRM A;  4L9G A;  3E4O A;  2D02 A;  4QPR A;  3LIE A;  4NXE A;  4HI4 A;  4B93 A;  3PBT A;  2W3H A;  2HF6 A;  4ARZ A;  3IS2 A;  4K08 A;  4HP9 A;  2VJW A;  4I3I A;  3CIT A;  4Q0I A;  1ZHH B;  2J80 A;  4UQI S;  3RTY A;  2QWS A;  3UME A;  3KSG A;  1F9I A;  4GLQ A;  3MQ0 A;  4EUV A;  3IBJ A;  4ZRR A;  1OT6 A;  4GHI B;  4NXB A;  4JGQ A;  4F3L A;  5HDD A;  2W3G A;  3EQU A;  2JKR M;  3DBA A;  4HJ6 A;  4KQO A;  2QKP A;  5TBM B;  2VGL M;  5HD5 A;  4KUO A;  2VGL S;  2XA7 M;  1TD5 A;  4YNR A;  3LI8 A;  4BBT A;  1H8M A;  2R78 A;  2YKH A;  3CLO A;  4O8G A;  4AFI A;  4EU0 A;  4WEJ A;  1ODV A;  3KYZ A;  4M4X A;  2PHY A;  4CLC D;  2XRO A;  2FZ0 A;  4R6L A;  1UWP X;  3R7W B;  2A24 A;  3O5Y A;  2D01 A;  3VV4 A;  4MN7 A;  4OOM A;  4FSF A;  3A0V A;  4G3W A;  3MR0 A;  4NXF A;  2KX6 A;  3TRC A;  2ZMV A;  2O99 A;  2QJ5 A;  2DMW A;  1P0Z A;  3EQV A;  3NOP C;  1DP8 A;  4P6Z S;  4Y5F A;  1T19 A;  3JVU A;  4BJP A;  1NRJ A;  3VE4 A;  1OTD A;  3NOU C;  2PD7 A;  3FC7 A;  3S7N A;  3UB6 A;  1D06 A;  3BQA A;  4L0L A;  1OT9 A;  2V0W A;  4Q0H A;  2V9A A;  3F1N A;  4HP4 A;  4I3J A;  2VV6 A;  3K2N A;  2HJE A;  5F5Y A;  1NWZ A;  3LR3 A;  2M7U A;  3T4S A;  2K31 A;  2VA0 A;  4MMN A;  2G7U A;  1DP6 A;  1LL8 A;  1DP9 A;  2GX5 A;  2HGV A;  3IBR A;  2PR6 A;  2L0W A;  2V0U A;  3H82 A;  2H28 A;  3T4T A;  3NJA A;  2V1B A;  2WKR A;  3HJI A;  3ZQ5 A;  5J7E A;  5HWV A;  1XJ6 A;  3D72 A;  4EW7 A;  4MDZ A;  2VEA A;  4GS9 B;  1S4S A;  1OTI A;  3T4J A;  2V1A A;  5A8B A;  4DMZ A;  2ZMF A;  1XFQ A;  4HY8 A;  2W1R A;  4IHQ A;  1LT0 A;  4GCZ A;  3GEC A;  3E0Y A;  1KOU A;  2EWV A;  3T50 A;  2GNX A;  1F5M A;  3CI6 A;  2B02 A;  4Y2F A;  3S7O A;  1NLY A;  3RFB A;  1GSV A;  4WL9 A;  3LIC A;  5EFW A;  5HDS A;  4HQA A;  3C38 A;  1OTE A;  3JVV A;  1P9W A;  3BY9 A;  1TS6 A;  1S67 L;  1XFN A;  1JNU A;  3S7P A;  3H82 B;  1ZTU A;  2B18 A;  2VLG A;  3E4P A;  1UWN X;  4EEP A;  1XJ2 A;  1F98 A;  3UE3 A;  2VV8 A;  3NHQ A;  5G4Y A;  3K3C A;  4H6J A;  2LB9 A;  1UGU A;  2W1T B;  4LRZ E;  2JKT M;  3NOT C;  2OAQ 1;  4I3A A;  1TS7 A;  4EET B;  3BY8 A;  3OCL A;  2EA9 A;  5F68 A;  4YOF A;  3S7Q A;  3BW6 A;  4KUK A;  1MC0 A;  4BMW A;  2J3T C;  5HPI A;  1NLZ A;  2Z6D A;  3W2Z A;  1MZU A;  5FL3 A;  3TW8 A;  5C5K A;  3F1O B;  3PBR A;  4JGO A;  2HV1 A;  4R3A A;  3C2W A;  3EEH A;  4H6J B;  4DJ2 A;  2OAP 1;  3OOV A;  1OTA A;  4YWZ A;  3BJN A;  5HZH A;  5G4Z A;  1VHM A;  2A24 B;  3LR4 A;  3E4Q A;  2W1T A;  3PYP A;  3UB9 A;  2GJ3 A;  3LR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...