4CLCE

Crystal structure of ybr137w protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
172
structure length
172
Chain Sequence
MVVLDKKLLERLTSRKTPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMAVSSLIAFANESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0303 PROTEIN YBR137W
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 58
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcE00
3FPWA 5CX7A 4CLCE 4CLCB 4BMWA 2A2LA 3FPVA 4CLCD 4CLCA 4CLCC 4NKPA
chains in the Genus database with same CATH superfamily
3UE1A 5IT5A 1H8MA 3ICYA 3F1NA 3G31A 2J7VA 3LIBA 4N9KA 5HDSA 1LSVA 3IX3A 4GHIA 3NY4A 4PM7A 4E3LA 2O9CA 3ISGA 5TFQA 3BWLA 4LCLA 5HWVA 4BBUA 3CPTB 3LGOA 3ZNYA 5HZHA 4LPZA 2M7VA 4L9FA 4GW9A 4BJPA 1NZUA 3B47A 2R9WA 4H6JA 2GDNA 3UMDA 4O8GA 5FAQA 3MZDA 3F1PB 2WKPA 1SKOB 2WKQA 3BRMA 1RP5A 2PU4A 3T4JA 3L7HA 5HL1A 4NXGA 3T4QA 4G3VA 3T1QB 3IF6A 3CPTA 3NOPC 4YOFA 1D1JA 5G4YA 4KG5A 5HARA 3N8LA 2H28A 3I7JA 5J7EA 2QWSA 5F1GA 2PYRA 4EV4A 1LHYA 4HBUA 3PAGA 1SKOA 3HREA 1IFQA 5K5BA 2IA2A 3IT9A 1FR1A 4JKTA 2OLVA 3G34A 1E3UA 3QP2A 3VE3A 3ITAA 4QJGA 4OPQA 3MS6A 1MXOA 2ZC5B 2CMNA 1XJ2A 4KQQA 4S2PA 3IBJA 1Q2PA 5AJGA 4C3QA 2G2WA 5EM0A 2PYPA 1PWGA 4N1XA 3Q81A 3SOIA 1PFLA 5CGSA 3N8SA 3UPPA 1H3QA 1CI8A 3BEBA 5CGXA 1SHVA 4MN7A 3IWQA 3S7OA 1TDGA 2PR5A 3QP1A 4CLCA 1E4DA 1XX2A 1MPLA 1K38A 4E3OA 4MCWA 3SH9A 3N6IA 3OCNA 5C5KA 4JXSA 3H82A 3OC2A 3BY8A 1NRFA 3PBNA 3CJMA 5TGFA 2BASA 3PTEA 1BLPA 3OPHA 4MEZA 1FSYA 4UEYA 1OPXA 1D7EA 4LLOB 5L07A 3NI9A 1MWUA 4C75A 3V3RA 3E4PA 5FASA 1VM1A 4X25A 3UE6A 4QPRA 5CXWA 4BL3A 3PAEA 5E2GA 3KYQA 4LENA 3TG9A 2KOIA 3TW8A 1EI5A 1FIKA 3D9YA 4ZJ3A 2DRWA 2WKEA 1GA0A 2PD8A 3O5YA 1RCJA 3TSGA 5FSRA 2PRFA 3CI6A 1WYCA 2VGKA 3JVUA 4OQHA 4CLCE 2EA9A 4ZAMA 4B4XA 5EVEA 3KX0X 2JHEA 1E25A 1GHMA 4DJ2A 4KZ8A 3SH7A 1YM1A 2VGJA 4WF0A 4B93A 2X01A 2QYBA 3T1RA 4QWOA 3CG5A 4PM9A 1TS7A 5CTNA 5EV0A 3FYZA 2C6WB 1LSWA 1TEMA 5DJTA 1T1AA 3DW0A 4ETXA 3SH8A 4CJNA 2C5WB 2UWXA 2HF6A 1Z09A 3MBZA 2K31A 1ERQA 5IHVA 2V20A 3SS5A 3GRJA 3MFXA 4X68A 4Q0HA 2PHYA 4MN6A 4PAUA 3ZG7B 2NUPC 1BT5A 2OWJA 4UA6A 4YFMA 4WEKA 1IYPA 1K55A 4RA7A 4UQIS 2HP5A 2E8IA 4WMCD 4JPMA 3B33A 3CUEA 3LR4A 2Q9MA 4U0XA 4BWIA 4Q8IA 5GLBA 3MXQA 4WYYA 2GZAA 3T4SA 4BQMA 4DKIA 1WE4A 1FQGA 3IWOA 1IYSA 3O88A 1YMSA 5FQ9A 2ZC6B 5HPIA 3BY9A 3IXBA 4NK3A 1Y28A 4EWFA 1GA9A 2P08A 1NXYA 1K4EA 3K2NA 4Z1WA 5FA7A 1LSXA 1K4FA 2B5RA 5EPHA 3IHBA 2OV5A 4ZDXA 3W4OA 1HD8A 3E2LA 3GR2A 3HLBA 4BENA 2Z2MB 2Y2KA 4I3JA 4ID4A 1W63M 3BQAA 4HJ3A 4YINA 3OZHA 1KGFA 4A5RA 2LB9A 3ZG5A 2XA7S 3BLSA 5FI6A 2XK1A 3VP4A 2X71A 5CHJA 1KVLA 2ZMVA 5L2FA 4IBRA 2O99A 4E6XA 4BL2A 2D02A 4UAAA 3DAVA 5HFOA 3OCLA 4UQIM 4Y0OA 4WBGA 3HJKA 3KYZA 3FWLA 2JCHA 4LRYC 4I38A 4IUKA 3U4LP 3NCKA 3FC7A 2HDQA 3VE4A 2ZM8A 1LT0A 3A3EA 4HBTA 4HP4A 2PD7A 3T12B 2B02A 2NUTC 1RGYA 2DNSA 1T1BA 4LV0A 4KZ4A 2J9OA 1W5DA 3EEHA 5FDHA 3ZDJA 3GTCA 4HESA 5J4EA 4ZTKA 3M2KA 5GLDA 2Z6DA 3IXDA 2A24B 4UA7A 3BQ8A 3TRCA 1FSWA 2Y2MA 1G28A 4HEFA 5AQAA 1NRJA 4K0XA 2DMWA 4HIAA 4BBVA 1RGZA 1GHPA 3MFDA 2QMIA 5I5LA 3WS1A 4I3AA 4PPRA 4S2NC 4GCZA 4ARZB 1N9BA 2XA7M 3PHYA 4WLAA 3HLGA 1OMEA 3UB6A 5EE8A 2L1MA 3ZG9B 1N9OA 2A24A 5U47A 2AVXA 5DKKA 4DRTA 4FUWA 2JBFA 2P74A 4QU3A 3T4OA 4BLMA 3NJAA 4S2LA 3C4OA 3UY6A 3C8CA 2ZQ9A 1CQAA 5TR7A 3NOTC 3G30A 5FEGA 1PWCA 5KSHA 1YT4A 2VV8A 4L0LA 1EROA 2A2LA 4KUKA 2ZJ9A 1VEUA 2VJWA 4ESPA 1BZAA 3O87A 5FQIA 5A93A 2ZBBA 4E3KA 1CEFA 1JWPA 2Y55A 3V39A 2PDRA 2OWHA 4DMZA 2I9VA 3OLOA 4KQOA 4ZRRA 2HDRA 3QP6A 4RVAA 4R70A 1X0OA 2ZMFA 3JPUA 4HJ4A 4F94A 1YKDA 2H10A 1KGEA 2VX8A 4U0TA 1I2WA 4KZAA 3RXWA 5A90A 2XROA 4XUXA 1XA7A 3IH8A 1IKIA 3PBRA 3KSHA 3BFEA 2WK0A 3LIAA 3EOIA 3LI8A 1CI9A 1ZG4A 2Y2HA 1CK3A 1XXMA 3F1NB 1SDEA 4WL9A 5GHXA 2XEPA 4HOIA 1ALQA 3ZVWA 2H5SA 4EXOA 4OPYA 3OPPA 4MN5A 4EBNA 4Z9QA 3WS2A 1YPRA 3MKEA 4E04A 5A91A 3N8RA 1K57A 3EQUA 3OPLA 2JKRI 2V9AA 4K08A 2Y59A 4CQHA 2EWVA 4UHUA 2WGIA 3ZGAB 1CJFA 5CEDA 1DJBA 2DCFA 1YLYA 1OT9A 1OTIA 4P0MA 4XT2A 1GSXA 4M4XA 3S22A 2Y2NA 3IF6B 4M3KA 1XJ4A 3LUQA 5MC7A 1IYQA 3JVVA 4GKUA 2VZWA 3A0SA 1GSVA 3VP1A 3ZG0A 1NY0A 1YLPA 3LY4A 4HP9A 3P98A 1NLYA 2XLNA 1DP8A 2O9AA 5F6AA 2J9PA 1WA9A 3FZCA 4ME4A 3TJZC 1SCWA 2V0UA 4UA9A 3CWFA 1S1YA 2FFYA 1J9MA 5HL6A 3EEAA 4R0QA 4I3IA 2ZLYA 2M7UA 3WRZA 4RYEA 3CHWP 3UPNA 2ZQCA 1E3UD 3ZVTA 2WAEA 1Y4OA 2XFSA 3CMZA 1YAXA 4EUZA 3N4IA 4L9EA 1UWNX 1G68A 4O0PA 4Y5FA 4OP8A 3ZG8B 1FCNA 2HP6A 2YKFA 3OOVA 1NLZA 3M6HA 3BFGA 5EOOA 3A0VA 3EWKA 4LGWA 2Y2LA 4CLCB 3S1YA 4JXWA 4YWZA 1K56A 3R7WB 3LIFA 3H82B 4OVDA 4S2KA 3LIEA 3KSFA 4CLCD 3B3XA 1SDNA 1MWSA 4LV3A 1OTEA 1ZTUA 4X69A 2IWDA 1MBLA 5CEBA 5AVFA 3T4KA 3HVFA 3R7WA 1I2SA 3IX8A 1T18A 4ZJ2A 1JWVA 3HJIA 4AFIA 3V50A 1SKFA 1QMEA 3IHAA 3B42A 5GLCA 2XD5A 2KDKA 4Y0UA 4P87A 2OSUA 1WYBA 1IELA 2G7UA 3FKWA 2Y8HA 1J3WA 3BECA 3T4LA 3LR5A 3PBTA 2W1TA 3NDEA 3A0RA 1JVJA 2VV7A 3UNWA 1S1ZA 5CRFA 5FAPA 4OQ0A 3SW1A 3K3DA 3VP0A 5FDSA 2OAQ1 1PI5A 2W0NA 2ZMAA 2Z6CA 1V9ZA 3CAXA 2Y2PA 4NG2A 4EEUA 4EQIA 1JNUA 4X6TA 4QB8A 3CZDA 5EVIA 4DF6A 2O9BA 2XQZA 3HBRA 1O07A 1KE4A 2OOLA 3G2YA 4WELA 5EUAA 4LRZE 3MQQA 3Q1FA 2Y2OA 5AQ9A 3M2JA 2BLSA 1PW1A 3UB5P 2WGWB 1TS6A 4FH4A 3BW6A 2Q9NA 1TS0A 1N9NA 1W8YA 5DTTA 3VP2A 5KZHA 3RJUA 4PKYA 2ZM2A 4X53A 3R4KA 2Y79A 2PT7A 2Y2IA 4N1HA 1BLSA 5CECA 1KVMA 5AVEA 4NXBA 1M6KA 4E3IA 5G4ZA 4KQDA 1FR6A 4O01A 2WGWA 3LYXA 3D4FA 4OLDA 2Y2GA 3PYPA 5A92A 1EW0A 3WRTA 5EECA 2QJ7A 4ZBEA 2JKRM 2Y91A 4HH3A 1BLHA 5HWTA 1L3LA 1PRQA 4R3BA 3BM6A 1YSQA 1Q2QA 2QZ6A 2VEAA 1YLTA 4PHTA 2J3TC 3FKVA 3T50A 3RH8B 2QHKA 4MBKA 3GECA 5HPFA 1P0ZA 1OTDA 5AQBA 2VKSA 2GX5A 3A3IA 1NYMA 3QP5A 4MNRA 1PWDA 4X56A 1PZPA 3G6OA 3UPOA 4FOFA 2JKFA 4GNUA 5GLAA 4JF4A 3G2ZA 2INWA 4LV2A 2H0YA 5DTSA 1O7EA 3RXXA 3Q7VB 1YLJA 3LR0A 1VHMA 4X55A 1KOUA 4JGQA 3V3SA 4GS9A 4OPZA 5HDCA 4Q0IA 5DKLA 3W8KA 2EWWA 2EXBA 1I5QA 3WWXA 1ESIA 5F69A 3FPWA 3NIAA 1FCOA 1Z6FA 1BSGA 3H7WA 1MKMA 3LEQA 5JYOA 5HDDA 3UDIA 1NZOA 5HX9A 2V1ZA 5KSCA 2QPNA 3RFBA 3Q7VA 4KG6A 2CC1A 2PR6A 4OQIA 3A3FA 3O3VA 2HGVA 4II7A 2J3TD 5L8MA 1GCEA 3GSGA 3FV7A 1NJ4A 4HH2A 3QP8A 4B88A 2OAP1 1S4RA 5TBMB 1VETB 3S7PA 3ITBA 3ZNTA 3Q82A 3C5AA 3LEZA 4MBHA 4OONA 4DE2A 5F5YA 4Y13A 3Q7ZA 5FQJA 3V5MA 2ZOIA 1Y54A 2EX9A 2R78A 4P85A 5HD3A 3UMEA 3BJNA 5GHZA 2XDMA 2ZOHA 5BOHA 4LFUA 1D06A 1YLZA 2WADA 2XSSA 4DE3A 5TBMA 1VETA 1P97A 5HAIA 1VEUB 1NWZA 4Y17A 1FILA 2JE5A 1XFNA 3G4PA 3MMHA 2L0WA 4N9LA 3ZYTA 3PR6A 2ZD8A 3UN7A 3ZHHA 2OLUA 3NOUC 1YQSA 4HQAA 4DXCA 2W3EA 1QMFA 2WGVA 3GV9A 3HUNA 3IS2A 2M1CA 1MWRA 1TDLA 4QY6A 5HAPA 4Y15A 2J80A 4KZBA 5J3WA 3VFHA 1HZOA 5FQKA 2Y2JA 3C4PA 2KLIA 1L2SA 2Y4AA 1H8YA 1H8ZA 2Y2QA 4GN2A 2A49A 2ZQAA 4RX2A 4PM8A 3T1SA 3UB9A 4BBTA 2PBYA 4JGPA 3QP4A 3HLFA 1KDWA 3LI9A 1L0DA 4GB7A 4X1MA 1LLBA 5CHUA 2FZ0A 4KZ3A 2JN7A 3DTMA 2V1BA 1OJGA 2QKPA 1N4OA 1EWZA 1K54A 4KZ7A 4LV1A 4D2OA 4KQRA 3P09A 3UE0A 1S4SA 1BYWA 3NHQA 2I72A 4R3AA 2PAVP 3ZQ5A 3SS3A 1XJ3A 4KENB 4R6LA 3C2WA 3W2ZA 1ODVA 1DY6A 5GHYA 2EFUA 1VB6A 4QHCA 2HP9A 2JKTI 2QJ5A 3IF6C 2V8FA 3MR0A 3S7NA 1L0FA 3DTIA 3VOYA 1KE0A 2XFTA 3LIDA 2PU2A 4S2NA 1MZUA 3UB7A 4E3NA 3CITA 1TS8A 2W3GA 3NECA 4HY8A 1AWIA 4H8RA 4XT2B 3HL9A 4BMWA 2Z2LB 2HPBA 4DXBA 4EQ1A 3F1OA 3H9WA 3IX4A 5DJUA 4R38A 2YKHA 5F83A 1JWZA 4L9GA 4JXVA 1V9YA 3MF0A 3QNBA 5EOEA 2J8YA 4JGOA 4NXEA 1OTBA 4HJ6A 4PM6A 3VP3A 2HV1A 2ZQ7A 4OOLA 4IVIA 1S66L 1G6OA 2V0WA 2W27A 3IXGA 4EETB 4JBFA 4CLCC 3VV4A 3C30A 2WZZA 2V1AA 4R4RA 4WUJA 1K6RA 4QY5A 5FI2A 1STZA 3O86A 1PYYA 5DTKA 3KSGA 3DBAA 4S2IA 3WS4A 1XFQA 4JF6A 4K91A 1ES2A 3BYDA 2PBDP 1ES5A 3VMAA 2WKRA 1BTLA 3PBQA 3FG8A 1JTGA 1GSWA 2P9VB 2O0YA 5IS1A 3U2AA 1ESUA 5CTMA 5HW3A 3GDIA 3IBRA 5KIZA 5M18A 1FCMA 5HWWA 5EFWA 1K56D 1XJ6A 4D60A 5DFXA 1UGUA 2ZL1B 4F3LB 1F2KA 4U3TA 3M6BA 4EU0A 4DJ3A 1SZVA 4E3JA 1IKGA 2P9VA 4GLQA 3F1PA 2W3FA 4HHDA 4WZ5A 3VOZA 2K2NA 1XA1A 3MQOA 4G3WA 5EVIC 1UWPX 2ZL1A 1F9IA 3L9KA 4F3LA 4WM9A 3HLWA 4O7DA 5M19A 1ERMA 4GOGA 3UO9A 2LB5A 5D3OA 4KZ9A 4DDSA 2W1TB 1LL9A 5CERA 4DN0A 3V67A 4I5SA 4OOYA 4DDYA 3WS5A 4JLFA 3QNCA 1KE3A 3S4XA 4EUVA 2EX6A 4WEJA 4JGRA 2GJ3A 3DWZA 3VFFA 4GD6A 5HD5A 2Q0OA 3MKFA 5L09A 3GQZA 1ZC2A 1M40A 4N92A 3QHYA 2EXAA 3LR3A 4HNBA 3WS0A 1K55C 2ACGA 3E4OA 3IF5A 1TVFA 5EVIB 3E2KA 5M1AA 3CUEC 3E4QA 5HAQA 3IH9A 5EVID 4P6BA 2FH5A 1XP4A 4EEPA 2P7JA 4Y7PA 5DF8A 2JKGA 4JF5A 3NC8A 1T19A 5E2EA 3Q07A 4C6YA 4DE1A 4FD8A 1LL5A 4YNRA 5AQ7A 1AXBA 3NDGA 4WN5A 3W4PA 1W79A 3KYEA 2D01A 1N9LA 3E98A 3C38A 1PI4A 5FQMA 3HLEA 1ES3A 1F98A 4OH0A 3G35A 2R9XA 4NEED 4IUHA 4FSFA 2ZQDA 3A3JA 4IVKA 1MC0A 3MSHA 2ZQ8A 1ES4A 4MLLA 2B95A 3LO7A 3PBOA 2KX6A 4NKPA 4GDBA 5DF7A 3AGDA 4QD4A 1VQQA 2JKTM 4Y0TA 5IU1A 5J8XA 4XUZA 1L0EA 5EVLA 1C3BA 1K25A 3HCYA 3P01A 5E2HA 2XF3A 3FPVA 3SS4A 1BUEA 3HLDA 3IQAA 2VGLS 1P9RA 4PKYG 2ZC7A 1YLWA 4DE0A 3NULA 4IEDA 1OJ5A 1T1CA 3MXSA 3VSKA 3UDFA 3UE3A 3BFCA 1K6SA 1NYYA 4R4SA 1PW8A 3HUMA 5I94A 1CEGA 2XD1A 1DJAA 3D72A 4GS9B 1P9WA 1XPBA 4OQGA 1IEMA 5EM1A 3SZTA 1S67L 2K7SA 3OBFA 5HSQA 3CLOA 3DWKA 3UDXA 1XKZA 1KDSA 4S2JA 4ZJ1A 4WMCA 4JXGA 1IYOA 3P7NA 5DF9A 1HLUP 2H0TA 2WKHA 2XGNA 3BFDA 4WZ4A 2A3UA 3H7WB 4NETA 4RX3A 4GZBA 4LCMA 3RTYA 4KZ5A 3GVBA 3AGFA 3MXRA 1BULA 3AGEA 4KG2A 1YMXA 1W7FA 5CHMA 5F68A 1MWTA 2WZXA 1ACFA 4FCFA 4R3JA 1ZG6A 1XGJA 1PZOA 3VOLA 1HVBA 4EBLA 1OT6A 4IJGA 2UV0E 1OTAA 4P6ZS 1LI9A 4IBXA 3E0YA 2VGLM 4S2OA 2B18A 4NXFA 2RL3A 1TF1A 1CF0A 3VSLA 3LY3A 4IHQA 5GL9A 1DP9A 3HUOA 1PIOA 4XXRA 1DJCA 4EERA 2G2UA 4CPKA 3S7QA 4GDNA 1G6AA 3C7UA 2GNXA 2RCXA 1MKIA 2EX2A 2IWBA 2ZC3B 4LRXC 4I39A 2L4RA 1H5XA 1LL8A 3LFVA 3T4TA 2HZ5A 3UB8A 1K54C 2ZM0A 2FFFB 5DVAA 3IWIA 1KGGA 3PXPA 2W3HA 3IS2B 4MDZA 4FTXA 3DTEA 4BD1A 2XRNA 5TJJA 3OPRA 2WAFA 3LICA 3ZCZA 2BTFP 5FL3A 3EGDC 1A0KA 1XGIA 2WUQA 5L10A 2VV6A 3MJQA 3BFFA 2W3DA 5JYPA 4S2MA 5A8BA 1YSPA 4OLGA 4MMNA 1FOFA 2W1RA 5FQQA 4P6ZM 1K0KA 2E8JA 1IOUA 2X02A 5CGWA 3GMWA 4E3MA 5KMWA 2WYXA 4KZ6A 4R23A 5G18A 1K57C 2HDSA 3NBLA 1U60A 4GD8A 1BLCA 3BLMA 4ETZA 3JYIA 4FH2A 3EGXC 3ULFA 4ARZA 2BG1A 2J3WA 4PMAA 2V8CA 2EX8A 4B9OA 3MZEA 4EBPA 4R1GA 1ZKJA 3TE8A 3W4QA 4X1LA 1ONGA 1MY8A 3T1XA 1F5MA 3MQ0A 1S6RA 4G3KA 2XR0A 5CX7A 2XH9A 4BD0A 2VA0A 3K3CA 4RQ9A 4PM5A 2HJ9C 1L0GA 4B4ZA 3A3DA 1DP6A 3MZFA 2VLGA 4KUOA 3KSIA 2WKIA 1GHIA 3LCEA 3KO6A 1S0WA 2V2FF 2MJ6A 3F1OB 1G5UA 4Q0JA 5FAOA 5LBRA 1PNEA 3TOIA 3N7WA 1DRMA 1JTDA 4GJ4A 5F82A 4EESA 4OPRA 4K0WA 3D3OA 5FATA 3EQVA 1H0MA 5E43A 4OKPA 5FI7A 2JC7A 3C7VA 3PBSA 2IWCA 3DTKA 4EW7A 4E6WA 4OP5A 2P04A 1LI0A 5E2FA 4GHIB 3G32A 5F1FA 2ZC4B 2EFXA 1W63Q 5DFYA 2VK3A 3HLCA 4Y3IA 4MBFA 1HTZA 4WZ5C 3ZFZA 3IXHA 2HDUA 2HJEA 4HI4A 1TD5A 4Y2FA 5FEFA 1ZHHB 1W8QA 4H6JB 4OOMA 1ONHA
chains in the Genus database with same CATH topology
1N9OA 2A24A 1YSQA 5IT5A 1H8MA 3ICYA 3F1NA 3LR3A 4HNBA 5DKKA 2VEAA 3LIBA 2J3TC 3E4OA 4PHTA 5HDSA 1LSVA 3T50A 3RH8B 4GHIA 2QHKA 3CUEC 3T4OA 3E4QA 3GECA 2O9CA 5HPFA 3NJAA 1P0ZA 1OTDA 3BWLA 5HWVA 2VKSA 2GX5A 3C8CA 4BBUA 5HZHA 3G6OA 4FOFA 4LPZA 2M7VA 4L9FA 3NOTC 2INWA 4GW9A 4BJPA 2FH5A 4EEPA 5KSHA 3B47A 2VV8A 4H6JA 3UMDA 2P7JA 4L0LA 3LR0A 2A2LA 4KUKA 1VHMA 4O8GA 1KOUA 4JGQA 2VJWA 4GS9A 1T19A 3F1PB 2WKPA 2WKQA 2ZBBA 5HDCA 4Q0IA 5DKLA 3T4JA 2EWWA 4YNRA 2PDRA 2OWHA 4DMZA 2I9VA 4WN5A 3OLOA 4KQOA 4NXGA 3FPWA 5F69A 3T4QA 4ZRRA 4G3VA 2D01A 3NOPC 1N9LA 3E98A 4YOFA 4R70A 3C38A 5G4YA 3H7WA 1X0OA 1MKMA 2H28A 2ZMFA 5J7EA 2QWSA 4HJ4A 5HDDA 1F98A 2PYRA 1YKDA 3RFBA 4NEED 2VX8A 4IUHA 4FSFA 2PR6A 4II7A 2HGVA 1MC0A 1IFQA 5K5BA 2XROA 2J3TD 2IA2A 5L8MA 3PBOA 2KX6A 3PBRA 4NKPA 3KSHA 3VE3A 4HH2A 3LIAA 2JKTM 2OAP1 3EOIA 2CMNA 1S4RA 1XJ2A 3LI8A 5TBMB 5IU1A 3S7PA 3IBJA 5AJGA 3F1NB 4WL9A 2PYPA 3HCYA 5F5YA 4HOIA 3P01A 3FPVA 2ZOIA 4EXOA 2R78A 1H3QA 4MN5A 5HD3A 3UMEA 2VGLS 3BJNA 1P9RA 4MN7A 4E04A 4PKYG 3S7OA 2PR5A 4CLCA 2ZOHA 1OJ5A 4MCWA 1T1CA 1D06A 2XSSA 3OCNA 5TBMA 1P97A 3UE3A 5C5KA 3H82A 3OC2A 3BY8A 3EQUA 3D72A 1NWZA 2JKRI 4GS9B 1P9WA 2V9AA 4K08A 4CQHA 3PBNA 2EWVA 1XFNA 3MMHA 2L0WA 2BASA 3ZYTA 1S67L 3PR6A 2K7SA 3OBFA 5HSQA 3CLOA 4UEYA 1OPXA 3NOUC 4HQAA 1D7EA 1OT9A 2W3EA 1OTIA 4LLOB 3IS2A 2M1CA 1GSXA 4M4XA 4XT2A 3P7NA 5DF9A 3E4PA 1XJ4A 3LUQA 3UE6A 5MC7A 2J80A 3H7WB 3JVVA 5J3WA 4QPRA 2VZWA 3A0SA 1GSVA 2KLIA 3KYQA 3RTYA 2KOIA 3TW8A 4HP9A 1NLYA 5F6AA 1DP8A 2O9AA 1WA9A 4ME4A 3TJZC 3UB9A 4BBTA 2PD8A 2V0UA 3O5YA 3CWFA 4JGPA 5F68A 1S1YA 5HL6A 3EEAA 3LI9A 3CI6A 4I3IA 3VOLA 2M7UA 3JVUA 4CLCE 2EA9A 2FZ0A 3KX0X 2JN7A 2JHEA 2V1BA 1OJGA 1OT6A 4IJGA 4DJ2A 2QKPA 1OTAA 4P6ZS 4WF0A 3E0YA 2VGLM 4B93A 1YAXA 2QYBA 1S4SA 4L9EA 1UWNX 4O0PA 2B18A 1BYWA 4NXFA 3NHQA 4Y5FA 1TF1A 2YKFA 4R3AA 1TS7A 3OOVA 1NLZA 4IHQA 3ZQ5A 1XJ3A 1LSWA 1DP9A 3A0VA 4R6LA 3C2WA 3W2ZA 3EWKA 5DJTA 1T1AA 1ODVA 4ETXA 4CLCB 4EERA 4YWZA 3S7QA 2HF6A 1VB6A 3R7WB 2GNXA 2K31A 2JKTI 3LIFA 3H82B 2QJ5A 4LRXC 3MR0A 4I39A 2L4RA 3S7NA 3LIEA 3KSFA 4CLCD 3LIDA 1LL8A 1MZUA 3UB7A 3LFVA 3T4TA 3UB8A 3MFXA 3CITA 4Q0HA 1TS8A 2W3GA 2PHYA 1OTEA 4MN6A 4HY8A 3PXPA 1ZTUA 4PAUA 2NUPC 2W3HA 3IS2B 4XT2B 2OWJA 4MDZA 4BMWA 4WEKA 2XRNA 5TJJA 3LICA 4UQIS 5AVFA 3T4KA 4EQ1A 3R7WA 3F1OA 3H9WA 3B33A 3CUEA 1T18A 5DJUA 3LR4A 4R38A 3EGDC 2YKHA 5FL3A 3HJIA 4AFIA 4BWIA 4L9GA 2VV6A 3MJQA 1V9YA 2W3DA 3MF0A 3MXQA 3B42A 5A8BA 1YSPA 2KDKA 2GZAA 4JGOA 2W1RA 4MMNA 4NXEA 3T4SA 1OTBA 4HJ6A 4P6ZM 2HV1A 5HPIA 2G7UA 4OOLA 2Y8HA 3BY9A 1IOUA 1S66L 1G6OA 3T4LA 2V0WA 3LR5A 2W27A 1Y28A 4EETB 3PBTA 4CLCC 2W1TA 3VV4A 2P08A 3C30A 3A0RA 2VV7A 2V1AA 3K2NA 4Z1WA 4WUJA 1STZA 1LSXA 4ETZA 1S1ZA 3KSGA 3DBAA 1XFQA 3SW1A 3K3DA 3EGXC 3ULFA 4ARZA 2J3WA 2OAQ1 2W0NA 4I3JA 1W63M 2WKRA 4B9OA 2Z6CA 3BQAA 3PBQA 4HJ3A 1V9ZA 3FG8A 1GSWA 3CAXA 3TE8A 2LB9A 2O0YA 5IS1A 2XA7S 3U2AA 4EEUA 1F5MA 3GDIA 3MQ0A 4G3KA 5CX7A 1JNUA 3IBRA 2VA0A 2ZMVA 3K3CA 5KIZA 4RQ9A 5HWWA 5EFWA 2O99A 2D02A 1XJ6A 5DFXA 1UGUA 2O9BA 2HJ9C 1DP6A 3OCLA 4UQIM 4F3LB 2OOLA 2VLGA 3HJKA 3KYZA 4KUOA 4LRYC 4WELA 4I38A 3KSIA 4LRZE 4IUKA 3MQQA 3FC7A 4EU0A 4DJ3A 3KO6A 3VE4A 1LT0A 2MJ6A 3F1OB 4HP4A 4Q0JA 2PD7A 5LBRA 4GLQA 3F1PA 1TS6A 2B02A 2W3FA 3BW6A 1DRMA 4GJ4A 4HHDA 4EESA 1TS0A 2K2NA 2NUTC 3D3OA 3MQOA 1N9NA 4G3WA 1T1BA 1UWPX 3EQVA 1F9IA 3EEHA 4F3LA 4PKYA 3PBSA 5J4EA 3R4KA 2Y79A 2PT7A 2Z6DA 4EW7A 2A24B 3BQ8A 3TRCA 2LB5A 1G28A 5AVEA 2W1TB 2P04A 1NRJA 4DN0A 3V67A 4NXBA 2DMWA 4HIAA 5G4ZA 4KQDA 4GHIB 4I5SA 4O01A 4BBVA 1W63Q 5DFYA 3LYXA 5I5LA 4Y3IA 3PYPA 4I3AA 4GCZA 4EUVA 4ARZB 4WEJA 4JGRA 2GJ3A 2HJEA 1EW0A 2XA7M 4HI4A 1TD5A 3PHYA 4WLAA 4Y2FA 5HD5A 1ZHHB 2QJ7A 3UB6A 2L1MA 4H6JB 2JKRM 4OOMA 4HH3A 5HWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPW A;  5CX7 A;  4CLC E;  4CLC B;  4BMW A;  2A2L A;  3FPV A;  4CLC D;  4CLC A;  4CLC C;  4NKP A; 
#chains in the Genus database with same CATH topology
 3UE1 A;  5IT5 A;  1H8M A;  3ICY A;  3F1N A;  3G31 A;  2J7V A;  3LIB A;  4N9K A;  5HDS A;  1LSV A;  3IX3 A;  4GHI A;  3NY4 A;  4PM7 A;  4E3L A;  2O9C A;  3ISG A;  5TFQ A;  3BWL A;  4LCL A;  5HWV A;  4BBU A;  3CPT B;  3LGO A;  3ZNY A;  5HZH A;  4LPZ A;  2M7V A;  4L9F A;  4GW9 A;  4BJP A;  1NZU A;  3B47 A;  2R9W A;  4H6J A;  2GDN A;  3UMD A;  4O8G A;  5FAQ A;  3MZD A;  3F1P B;  2WKP A;  1SKO B;  2WKQ A;  3BRM A;  1RP5 A;  2PU4 A;  3T4J A;  3L7H A;  5HL1 A;  4NXG A;  3T4Q A;  4G3V A;  3T1Q B;  3IF6 A;  3CPT A;  3NOP C;  4YOF A;  1D1J A;  5G4Y A;  4KG5 A;  5HAR A;  3N8L A;  2H28 A;  3I7J A;  5J7E A;  2QWS A;  5F1G A;  2PYR A;  4EV4 A;  1LHY A;  4HBU A;  3PAG A;  1SKO A;  3HRE A;  1IFQ A;  5K5B A;  2IA2 A;  3IT9 A;  1FR1 A;  4JKT A;  2OLV A;  3G34 A;  1E3U A;  3QP2 A;  3VE3 A;  3ITA A;  4QJG A;  4OPQ A;  3MS6 A;  1MXO A;  2ZC5 B;  2CMN A;  1XJ2 A;  4KQQ A;  4S2P A;  3IBJ A;  1Q2P A;  5AJG A;  4C3Q A;  2G2W A;  5EM0 A;  2PYP A;  1PWG A;  4N1X A;  3Q81 A;  3SOI A;  1PFL A;  5CGS A;  3N8S A;  3UPP A;  1H3Q A;  1CI8 A;  3BEB A;  5CGX A;  1SHV A;  4MN7 A;  3IWQ A;  3S7O A;  1TDG A;  2PR5 A;  3QP1 A;  4CLC A;  1E4D A;  1XX2 A;  1MPL A;  1K38 A;  4E3O A;  4MCW A;  3SH9 A;  3N6I A;  3OCN A;  5C5K A;  4JXS A;  3H82 A;  3OC2 A;  3BY8 A;  1NRF A;  3PBN A;  3CJM A;  5TGF A;  2BAS A;  3PTE A;  1BLP A;  3OPH A;  4MEZ A;  1FSY A;  4UEY A;  1OPX A;  1D7E A;  4LLO B;  5L07 A;  3NI9 A;  1MWU A;  4C75 A;  3V3R A;  3E4P A;  5FAS A;  1VM1 A;  4X25 A;  3UE6 A;  4QPR A;  5CXW A;  4BL3 A;  3PAE A;  5E2G A;  3KYQ A;  4LEN A;  3TG9 A;  2KOI A;  3TW8 A;  1EI5 A;  1FIK A;  3D9Y A;  4ZJ3 A;  2DRW A;  2WKE A;  1GA0 A;  2PD8 A;  3O5Y A;  1RCJ A;  3TSG A;  5FSR A;  2PRF A;  3CI6 A;  1WYC A;  2VGK A;  3JVU A;  4OQH A;  4CLC E;  2EA9 A;  4ZAM A;  4B4X A;  5EVE A;  3KX0 X;  2JHE A;  1E25 A;  1GHM A;  4DJ2 A;  4KZ8 A;  3SH7 A;  1YM1 A;  2VGJ A;  4WF0 A;  4B93 A;  2X01 A;  2QYB A;  3T1R A;  4QWO A;  3CG5 A;  4PM9 A;  1TS7 A;  5CTN A;  5EV0 A;  3FYZ A;  2C6W B;  1LSW A;  1TEM A;  5DJT A;  1T1A A;  3DW0 A;  4ETX A;  3SH8 A;  4CJN A;  2C5W B;  2UWX A;  2HF6 A;  1Z09 A;  3MBZ A;  2K31 A;  1ERQ A;  5IHV A;  2V20 A;  3SS5 A;  3GRJ A;  3MFX A;  4X68 A;  4Q0H A;  2PHY A;  4MN6 A;  4PAU A;  3ZG7 B;  2NUP C;  1BT5 A;  2OWJ A;  4UA6 A;  4YFM A;  4WEK A;  1IYP A;  1K55 A;  4RA7 A;  4UQI S;  2HP5 A;  2E8I A;  4WMC D;  4JPM A;  3B33 A;  3CUE A;  3LR4 A;  2Q9M A;  4U0X A;  4BWI A;  4Q8I A;  5GLB A;  3MXQ A;  4WYY A;  2GZA A;  3T4S A;  4BQM A;  4DKI A;  1WE4 A;  1FQG A;  3IWO A;  1IYS A;  3O88 A;  1YMS A;  5FQ9 A;  2ZC6 B;  5HPI A;  3BY9 A;  3IXB A;  4NK3 A;  1Y28 A;  4EWF A;  1GA9 A;  2P08 A;  1NXY A;  1K4E A;  3K2N A;  4Z1W A;  5FA7 A;  1LSX A;  1K4F A;  2B5R A;  5EPH A;  3IHB A;  2OV5 A;  4ZDX A;  3W4O A;  1HD8 A;  3E2L A;  3GR2 A;  3HLB A;  4BEN A;  2Z2M B;  2Y2K A;  4I3J A;  4ID4 A;  1W63 M;  3BQA A;  4HJ3 A;  4YIN A;  3OZH A;  1KGF A;  4A5R A;  2LB9 A;  3ZG5 A;  2XA7 S;  3BLS A;  5FI6 A;  2XK1 A;  3VP4 A;  2X71 A;  5CHJ A;  1KVL A;  2ZMV A;  5L2F A;  4IBR A;  2O99 A;  4E6X A;  4BL2 A;  2D02 A;  4UAA A;  3DAV A;  5HFO A;  3OCL A;  4UQI M;  4Y0O A;  4WBG A;  3HJK A;  3KYZ A;  3FWL A;  2JCH A;  4LRY C;  4I38 A;  4IUK A;  3U4L P;  3NCK A;  3FC7 A;  2HDQ A;  3VE4 A;  2ZM8 A;  1LT0 A;  3A3E A;  4HBT A;  4HP4 A;  2PD7 A;  3T12 B;  2B02 A;  2NUT C;  1RGY A;  2DNS A;  1T1B A;  4LV0 A;  4KZ4 A;  2J9O A;  1W5D A;  3EEH A;  5FDH A;  3ZDJ A;  3GTC A;  4HES A;  5J4E A;  4ZTK A;  3M2K A;  5GLD A;  2Z6D A;  3IXD A;  2A24 B;  4UA7 A;  3BQ8 A;  3TRC A;  1FSW A;  2Y2M A;  1G28 A;  4HEF A;  5AQA A;  1NRJ A;  4K0X A;  2DMW A;  4HIA A;  4BBV A;  1RGZ A;  1GHP A;  3MFD A;  2QMI A;  5I5L A;  3WS1 A;  4I3A A;  4PPR A;  4S2N C;  4GCZ A;  4ARZ B;  1N9B A;  2XA7 M;  3PHY A;  4WLA A;  3HLG A;  1OME A;  3UB6 A;  5EE8 A;  2L1M A;  3ZG9 B;  1N9O A;  2A24 A;  5U47 A;  2AVX A;  5DKK A;  4DRT A;  4FUW A;  2JBF A;  2P74 A;  4QU3 A;  3T4O A;  4BLM A;  3NJA A;  4S2L A;  3C4O A;  3UY6 A;  3C8C A;  2ZQ9 A;  1CQA A;  5TR7 A;  3NOT C;  3G30 A;  5FEG A;  1PWC A;  5KSH A;  1YT4 A;  2VV8 A;  4L0L A;  1ERO A;  2A2L A;  4KUK A;  2ZJ9 A;  1VEU A;  2VJW A;  4ESP A;  1BZA A;  3O87 A;  5FQI A;  5A93 A;  2ZBB A;  4E3K A;  1CEF A;  1JWP A;  2Y55 A;  3V39 A;  2PDR A;  2OWH A;  4DMZ A;  2I9V A;  3OLO A;  4KQO A;  4ZRR A;  2HDR A;  3QP6 A;  4RVA A;  4R70 A;  1X0O A;  2ZMF A;  3JPU A;  4HJ4 A;  4F94 A;  1YKD A;  2H10 A;  1KGE A;  2VX8 A;  4U0T A;  1I2W A;  4KZA A;  3RXW A;  5A90 A;  2XRO A;  4XUX A;  1XA7 A;  3IH8 A;  1IKI A;  3PBR A;  3KSH A;  3BFE A;  2WK0 A;  3LIA A;  3EOI A;  3LI8 A;  1CI9 A;  1ZG4 A;  2Y2H A;  1CK3 A;  1XXM A;  3F1N B;  1SDE A;  4WL9 A;  5GHX A;  2XEP A;  4HOI A;  1ALQ A;  3ZVW A;  2H5S A;  4EXO A;  4OPY A;  3OPP A;  4MN5 A;  4EBN A;  4Z9Q A;  3WS2 A;  1YPR A;  3MKE A;  4E04 A;  5A91 A;  3N8R A;  1K57 A;  3EQU A;  3OPL A;  2JKR I;  2V9A A;  4K08 A;  2Y59 A;  4CQH A;  2EWV A;  4UHU A;  2WGI A;  3ZGA B;  1CJF A;  5CED A;  1DJB A;  2DCF A;  1YLY A;  1OT9 A;  1OTI A;  4P0M A;  4XT2 A;  1GSX A;  4M4X A;  3S22 A;  2Y2N A;  3IF6 B;  4M3K A;  1XJ4 A;  3LUQ A;  5MC7 A;  1IYQ A;  3JVV A;  4GKU A;  2VZW A;  3A0S A;  1GSV A;  3VP1 A;  3ZG0 A;  1NY0 A;  1YLP A;  3LY4 A;  4HP9 A;  3P98 A;  1NLY A;  2XLN A;  1DP8 A;  2O9A A;  5F6A A;  2J9P A;  1WA9 A;  3FZC A;  4ME4 A;  3TJZ C;  1SCW A;  2V0U A;  4UA9 A;  3CWF A;  1S1Y A;  2FFY A;  1J9M A;  5HL6 A;  3EEA A;  4R0Q A;  4I3I A;  2ZLY A;  2M7U A;  3WRZ A;  4RYE A;  3CHW P;  3UPN A;  2ZQC A;  1E3U D;  3ZVT A;  2WAE A;  1Y4O A;  2XFS A;  3CMZ A;  1YAX A;  4EUZ A;  3N4I A;  4L9E A;  1UWN X;  1G68 A;  4O0P A;  4Y5F A;  4OP8 A;  3ZG8 B;  1FCN A;  2HP6 A;  2YKF A;  3OOV A;  1NLZ A;  3M6H A;  3BFG A;  5EOO A;  3A0V A;  3EWK A;  4LGW A;  2Y2L A;  4CLC B;  3S1Y A;  4JXW A;  4YWZ A;  1K56 A;  3R7W B;  3LIF A;  3H82 B;  4OVD A;  4S2K A;  3LIE A;  3KSF A;  4CLC D;  3B3X A;  1SDN A;  1MWS A;  4LV3 A;  1OTE A;  1ZTU A;  4X69 A;  2IWD A;  1MBL A;  5CEB A;  5AVF A;  3T4K A;  3HVF A;  3R7W A;  1I2S A;  3IX8 A;  1T18 A;  4ZJ2 A;  1JWV A;  3HJI A;  4AFI A;  3V50 A;  1SKF A;  1QME A;  3IHA A;  3B42 A;  5GLC A;  2XD5 A;  2KDK A;  4Y0U A;  4P87 A;  2OSU A;  1WYB A;  1IEL A;  2G7U A;  3FKW A;  2Y8H A;  1J3W A;  3BEC A;  3T4L A;  3LR5 A;  3PBT A;  2W1T A;  3NDE A;  3A0R A;  1JVJ A;  2VV7 A;  3UNW A;  1S1Z A;  5CRF A;  5FAP A;  4OQ0 A;  3SW1 A;  3K3D A;  3VP0 A;  5FDS A;  2OAQ 1;  1PI5 A;  2W0N A;  2ZMA A;  2Z6C A;  1V9Z A;  3CAX A;  2Y2P A;  4NG2 A;  4EEU A;  4EQI A;  1JNU A;  4X6T A;  4QB8 A;  3CZD A;  5EVI A;  4DF6 A;  2O9B A;  2XQZ A;  3HBR A;  1O07 A;  1KE4 A;  2OOL A;  3G2Y A;  4WEL A;  5EUA A;  4LRZ E;  3MQQ A;  3Q1F A;  2Y2O A;  5AQ9 A;  3M2J A;  2BLS A;  1PW1 A;  3UB5 P;  2WGW B;  1TS6 A;  4FH4 A;  3BW6 A;  2Q9N A;  1TS0 A;  1N9N A;  1W8Y A;  5DTT A;  3VP2 A;  5KZH A;  3RJU A;  4PKY A;  2ZM2 A;  4X53 A;  3R4K A;  2Y79 A;  2PT7 A;  2Y2I A;  4N1H A;  1BLS A;  5CEC A;  1KVM A;  5AVE A;  4NXB A;  1M6K A;  4E3I A;  5G4Z A;  4KQD A;  1FR6 A;  4O01 A;  2WGW A;  3LYX A;  3D4F A;  4OLD A;  2Y2G A;  3PYP A;  5A92 A;  1EW0 A;  3WRT A;  5EEC A;  2QJ7 A;  4ZBE A;  2JKR M;  2Y91 A;  4HH3 A;  1BLH A;  5HWT A;  1L3L A;  1PRQ A;  4R3B A;  3BM6 A;  1YSQ A;  1Q2Q A;  2QZ6 A;  2VEA A;  1YLT A;  4PHT A;  2J3T C;  3FKV A;  3T50 A;  3RH8 B;  2QHK A;  4MBK A;  3GEC A;  5HPF A;  1P0Z A;  1OTD A;  5AQB A;  2VKS A;  2GX5 A;  3A3I A;  1NYM A;  3QP5 A;  4MNR A;  1PWD A;  4X56 A;  1PZP A;  3G6O A;  3UPO A;  4FOF A;  2JKF A;  4GNU A;  5GLA A;  4JF4 A;  3G2Z A;  2INW A;  4LV2 A;  2H0Y A;  5DTS A;  1O7E A;  3RXX A;  3Q7V B;  1YLJ A;  3LR0 A;  1VHM A;  4X55 A;  1KOU A;  4JGQ A;  3V3S A;  4GS9 A;  4OPZ A;  5HDC A;  4Q0I A;  5DKL A;  3W8K A;  2EWW A;  2EXB A;  1I5Q A;  3WWX A;  1ESI A;  5F69 A;  3FPW A;  3NIA A;  1FCO A;  1Z6F A;  1BSG A;  3H7W A;  1MKM A;  3LEQ A;  5JYO A;  5HDD A;  3UDI A;  1NZO A;  5HX9 A;  2V1Z A;  5KSC A;  2QPN A;  3RFB A;  3Q7V A;  4KG6 A;  2CC1 A;  2PR6 A;  4OQI A;  3A3F A;  3O3V A;  2HGV A;  4II7 A;  2J3T D;  5L8M A;  1GCE A;  3GSG A;  3FV7 A;  1NJ4 A;  4HH2 A;  3QP8 A;  4B88 A;  2OAP 1;  1S4R A;  5TBM B;  1VET B;  3S7P A;  3ITB A;  3ZNT A;  3Q82 A;  3C5A A;  3LEZ A;  4MBH A;  4OON A;  4DE2 A;  5F5Y A;  4Y13 A;  3Q7Z A;  5FQJ A;  3V5M A;  2ZOI A;  1Y54 A;  2EX9 A;  2R78 A;  4P85 A;  5HD3 A;  3UME A;  3BJN A;  5GHZ A;  2XDM A;  2ZOH A;  5BOH A;  4LFU A;  1D06 A;  1YLZ A;  2WAD A;  2XSS A;  4DE3 A;  5TBM A;  1VET A;  1P97 A;  5HAI A;  1VEU B;  1NWZ A;  4Y17 A;  1FIL A;  2JE5 A;  1XFN A;  3G4P A;  3MMH A;  2L0W A;  4N9L A;  3ZYT A;  3PR6 A;  2ZD8 A;  3UN7 A;  3ZHH A;  2OLU A;  3NOU C;  1YQS A;  4HQA A;  4DXC A;  2W3E A;  1QMF A;  2WGV A;  3GV9 A;  3HUN A;  3IS2 A;  2M1C A;  1MWR A;  1TDL A;  4QY6 A;  5HAP A;  4Y15 A;  2J80 A;  4KZB A;  5J3W A;  3VFH A;  1HZO A;  5FQK A;  2Y2J A;  3C4P A;  2KLI A;  1L2S A;  2Y4A A;  1H8Y A;  1H8Z A;  2Y2Q A;  4GN2 A;  2A49 A;  2ZQA A;  4RX2 A;  4PM8 A;  3T1S A;  3UB9 A;  4BBT A;  2PBY A;  4JGP A;  3QP4 A;  3HLF A;  1KDW A;  3LI9 A;  1L0D A;  4GB7 A;  4X1M A;  1LLB A;  5CHU A;  2FZ0 A;  4KZ3 A;  2JN7 A;  3DTM A;  2V1B A;  1OJG A;  2QKP A;  1N4O A;  1EWZ A;  1K54 A;  4KZ7 A;  4LV1 A;  4D2O A;  4KQR A;  3P09 A;  3UE0 A;  1S4S A;  1BYW A;  3NHQ A;  2I72 A;  4R3A A;  2PAV P;  3ZQ5 A;  3SS3 A;  1XJ3 A;  4KEN B;  4R6L A;  3C2W A;  3W2Z A;  1ODV A;  1DY6 A;  5GHY A;  2EFU A;  1VB6 A;  4QHC A;  2HP9 A;  2JKT I;  2QJ5 A;  3IF6 C;  2V8F A;  3MR0 A;  3S7N A;  1L0F A;  3DTI A;  3VOY A;  1KE0 A;  2XFT A;  3LID A;  2PU2 A;  4S2N A;  1MZU A;  3UB7 A;  4E3N A;  3CIT A;  1TS8 A;  2W3G A;  3NEC A;  4HY8 A;  1AWI A;  4H8R A;  4XT2 B;  3HL9 A;  4BMW A;  2Z2L B;  2HPB A;  4DXB A;  4EQ1 A;  3F1O A;  3H9W A;  3IX4 A;  5DJU A;  4R38 A;  2YKH A;  5F83 A;  1JWZ A;  4L9G A;  4JXV A;  1V9Y A;  3MF0 A;  3QNB A;  5EOE A;  2J8Y A;  4JGO A;  4NXE A;  1OTB A;  4HJ6 A;  4PM6 A;  3VP3 A;  2HV1 A;  2ZQ7 A;  4OOL A;  4IVI A;  1S66 L;  1G6O A;  2V0W A;  2W27 A;  3IXG A;  4EET B;  4JBF A;  4CLC C;  3VV4 A;  3C30 A;  2WZZ A;  2V1A A;  4R4R A;  4WUJ A;  1K6R A;  4QY5 A;  5FI2 A;  1STZ A;  3O86 A;  1PYY A;  5DTK A;  3KSG A;  3DBA A;  4S2I A;  3WS4 A;  1XFQ A;  4JF6 A;  4K91 A;  1ES2 A;  3BYD A;  2PBD P;  1ES5 A;  3VMA A;  2WKR A;  1BTL A;  3PBQ A;  3FG8 A;  1JTG A;  1GSW A;  2P9V B;  2O0Y A;  5IS1 A;  3U2A A;  1ESU A;  5CTM A;  5HW3 A;  3GDI A;  3IBR A;  5KIZ A;  5M18 A;  1FCM A;  5HWW A;  5EFW A;  1K56 D;  1XJ6 A;  4D60 A;  5DFX A;  1UGU A;  2ZL1 B;  4F3L B;  1F2K A;  4U3T A;  3M6B A;  4EU0 A;  4DJ3 A;  1SZV A;  4E3J A;  1IKG A;  2P9V A;  4GLQ A;  3F1P A;  2W3F A;  4HHD A;  4WZ5 A;  3VOZ A;  2K2N A;  1XA1 A;  3MQO A;  4G3W A;  5EVI C;  1UWP X;  2ZL1 A;  1F9I A;  3L9K A;  4F3L A;  4WM9 A;  3HLW A;  4O7D A;  5M19 A;  1ERM A;  4GOG A;  3UO9 A;  2LB5 A;  5D3O A;  4KZ9 A;  4DDS A;  2W1T B;  1LL9 A;  5CER A;  4DN0 A;  3V67 A;  4I5S A;  4OOY A;  4DDY A;  3WS5 A;  4JLF A;  3QNC A;  1KE3 A;  3S4X A;  4EUV A;  2EX6 A;  4WEJ A;  4JGR A;  2GJ3 A;  3DWZ A;  3VFF A;  4GD6 A;  5HD5 A;  2Q0O A;  3MKF A;  5L09 A;  3GQZ A;  1ZC2 A;  1M40 A;  4N92 A;  3QHY A;  2EXA A;  3LR3 A;  4HNB A;  3WS0 A;  1K55 C;  2ACG A;  3E4O A;  3IF5 A;  1TVF A;  5EVI B;  3E2K A;  5M1A A;  3CUE C;  3E4Q A;  5HAQ A;  3IH9 A;  5EVI D;  4P6B A;  2FH5 A;  1XP4 A;  4EEP A;  2P7J A;  4Y7P A;  5DF8 A;  2JKG A;  4JF5 A;  3NC8 A;  1T19 A;  5E2E A;  3Q07 A;  4C6Y A;  4DE1 A;  4FD8 A;  1LL5 A;  4YNR A;  5AQ7 A;  1AXB A;  3NDG A;  4WN5 A;  3W4P A;  1W79 A;  3KYE A;  2D01 A;  1N9L A;  3E98 A;  3C38 A;  1PI4 A;  5FQM A;  3HLE A;  1ES3 A;  1F98 A;  4OH0 A;  3G35 A;  2R9X A;  4NEE D;  4IUH A;  4FSF A;  2ZQD A;  3A3J A;  4IVK A;  1MC0 A;  3MSH A;  2ZQ8 A;  1ES4 A;  4MLL A;  2B95 A;  3LO7 A;  3PBO A;  2KX6 A;  4NKP A;  4GDB A;  5DF7 A;  3AGD A;  4QD4 A;  1VQQ A;  2JKT M;  4Y0T A;  5IU1 A;  5J8X A;  4XUZ A;  1L0E A;  5EVL A;  1C3B A;  1K25 A;  3HCY A;  3P01 A;  5E2H A;  2XF3 A;  3FPV A;  3SS4 A;  1BUE A;  3HLD A;  3IQA A;  2VGL S;  1P9R A;  4PKY G;  2ZC7 A;  1YLW A;  4DE0 A;  3NUL A;  4IED A;  1OJ5 A;  1T1C A;  3MXS A;  3VSK A;  3UDF A;  3UE3 A;  3BFC A;  1K6S A;  1NYY A;  4R4S A;  1PW8 A;  3HUM A;  5I94 A;  1CEG A;  2XD1 A;  1DJA A;  3D72 A;  4GS9 B;  1P9W A;  1XPB A;  4OQG A;  1IEM A;  5EM1 A;  3SZT A;  1S67 L;  2K7S A;  3OBF A;  5HSQ A;  3CLO A;  3DWK A;  3UDX A;  1XKZ A;  1KDS A;  4S2J A;  4ZJ1 A;  4WMC A;  4JXG A;  1IYO A;  3P7N A;  5DF9 A;  1HLU P;  2H0T A;  2WKH A;  2XGN A;  3BFD A;  4WZ4 A;  2A3U A;  3H7W B;  4NET A;  4RX3 A;  4GZB A;  4LCM A;  3RTY A;  4KZ5 A;  3GVB A;  3AGF A;  3MXR A;  1BUL A;  3AGE A;  4KG2 A;  1YMX A;  1W7F A;  5CHM A;  5F68 A;  1MWT A;  2WZX A;  1ACF A;  4FCF A;  4R3J A;  1ZG6 A;  1XGJ A;  1PZO A;  3VOL A;  1HVB A;  4EBL A;  1OT6 A;  4IJG A;  2UV0 E;  1OTA A;  4P6Z S;  1LI9 A;  4IBX A;  3E0Y A;  2VGL M;  4S2O A;  2B18 A;  4NXF A;  2RL3 A;  1TF1 A;  1CF0 A;  3VSL A;  3LY3 A;  4IHQ A;  5GL9 A;  1DP9 A;  3HUO A;  1PIO A;  4XXR A;  1DJC A;  4EER A;  2G2U A;  4CPK A;  3S7Q A;  4GDN A;  1G6A A;  3C7U A;  2GNX A;  2RCX A;  1MKI A;  2EX2 A;  2IWB A;  2ZC3 B;  4LRX C;  4I39 A;  2L4R A;  1H5X A;  1LL8 A;  3LFV A;  3T4T A;  2HZ5 A;  3UB8 A;  1K54 C;  2ZM0 A;  2FFF B;  5DVA A;  3IWI A;  1KGG A;  3PXP A;  2W3H A;  3IS2 B;  4MDZ A;  4FTX A;  3DTE A;  4BD1 A;  2XRN A;  5TJJ A;  3OPR A;  2WAF A;  3LIC A;  3ZCZ A;  2BTF P;  5FL3 A;  3EGD C;  1A0K A;  1XGI A;  2WUQ A;  5L10 A;  2VV6 A;  3MJQ A;  3BFF A;  2W3D A;  5JYP A;  4S2M A;  5A8B A;  1YSP A;  4OLG A;  4MMN A;  1FOF A;  2W1R A;  5FQQ A;  4P6Z M;  1K0K A;  2E8J A;  1IOU A;  2X02 A;  5CGW A;  3GMW A;  4E3M A;  5KMW A;  2WYX A;  4KZ6 A;  4R23 A;  5G18 A;  1K57 C;  2HDS A;  3NBL A;  1U60 A;  4GD8 A;  1BLC A;  3BLM A;  4ETZ A;  3JYI A;  4FH2 A;  3EGX C;  3ULF A;  4ARZ A;  2BG1 A;  2J3W A;  4PMA A;  2V8C A;  2EX8 A;  4B9O A;  3MZE A;  4EBP A;  4R1G A;  1ZKJ A;  3TE8 A;  3W4Q A;  4X1L A;  1ONG A;  1MY8 A;  3T1X A;  1F5M A;  3MQ0 A;  1S6R A;  4G3K A;  2XR0 A;  5CX7 A;  2XH9 A;  4BD0 A;  2VA0 A;  3K3C A;  4RQ9 A;  4PM5 A;  2HJ9 C;  1L0G A;  4B4Z A;  3A3D A;  1DP6 A;  3MZF A;  2VLG A;  4KUO A;  3KSI A;  2WKI A;  1GHI A;  3LCE A;  3KO6 A;  1S0W A;  2V2F F;  2MJ6 A;  3F1O B;  1G5U A;  4Q0J A;  5FAO A;  5LBR A;  1PNE A;  3TOI A;  3N7W A;  1DRM A;  1JTD A;  4GJ4 A;  5F82 A;  4EES A;  4OPR A;  4K0W A;  3D3O A;  5FAT A;  3EQV A;  1H0M A;  5E43 A;  4OKP A;  5FI7 A;  2JC7 A;  3C7V A;  3PBS A;  2IWC A;  3DTK A;  4EW7 A;  4E6W A;  4OP5 A;  2P04 A;  1LI0 A;  5E2F A;  4GHI B;  3G32 A;  5F1F A;  2ZC4 B;  2EFX A;  1W63 Q;  5DFY A;  2VK3 A;  3HLC A;  4Y3I A;  4MBF A;  1HTZ A;  4WZ5 C;  3ZFZ A;  3IXH A;  2HDU A;  2HJE A;  4HI4 A;  1TD5 A;  4Y2F A;  5FEF A;  1ZHH B;  1W8Q A;  4H6J B;  4OOM A;  1ONH A; 
#chains in the Genus database with same CATH homology
 1N9O A;  2A24 A;  1YSQ A;  5IT5 A;  1H8M A;  3ICY A;  3F1N A;  3LR3 A;  4HNB A;  5DKK A;  2VEA A;  3LIB A;  2J3T C;  3E4O A;  4PHT A;  5HDS A;  1LSV A;  3T50 A;  3RH8 B;  4GHI A;  2QHK A;  3CUE C;  3T4O A;  3E4Q A;  3GEC A;  2O9C A;  5HPF A;  3NJA A;  1P0Z A;  1OTD A;  3BWL A;  5HWV A;  2VKS A;  2GX5 A;  3C8C A;  4BBU A;  5HZH A;  3G6O A;  4FOF A;  4LPZ A;  2M7V A;  4L9F A;  3NOT C;  2INW A;  4GW9 A;  4BJP A;  2FH5 A;  4EEP A;  5KSH A;  3B47 A;  2VV8 A;  4H6J A;  3UMD A;  2P7J A;  4L0L A;  3LR0 A;  2A2L A;  4KUK A;  1VHM A;  4O8G A;  1KOU A;  4JGQ A;  2VJW A;  4GS9 A;  1T19 A;  3F1P B;  2WKP A;  2WKQ A;  2ZBB A;  5HDC A;  4Q0I A;  5DKL A;  3T4J A;  2EWW A;  4YNR A;  2PDR A;  2OWH A;  4DMZ A;  2I9V A;  4WN5 A;  3OLO A;  4KQO A;  4NXG A;  3FPW A;  5F69 A;  3T4Q A;  4ZRR A;  4G3V A;  2D01 A;  3NOP C;  1N9L A;  3E98 A;  4YOF A;  4R70 A;  3C38 A;  5G4Y A;  3H7W A;  1X0O A;  1MKM A;  2H28 A;  2ZMF A;  5J7E A;  2QWS A;  4HJ4 A;  5HDD A;  1F98 A;  2PYR A;  1YKD A;  3RFB A;  4NEE D;  2VX8 A;  4IUH A;  4FSF A;  2PR6 A;  4II7 A;  2HGV A;  1MC0 A;  1IFQ A;  5K5B A;  2XRO A;  2J3T D;  2IA2 A;  5L8M A;  3PBO A;  2KX6 A;  3PBR A;  4NKP A;  3KSH A;  3VE3 A;  4HH2 A;  3LIA A;  2JKT M;  2OAP 1;  3EOI A;  2CMN A;  1S4R A;  1XJ2 A;  3LI8 A;  5TBM B;  5IU1 A;  3S7P A;  3IBJ A;  5AJG A;  3F1N B;  4WL9 A;  2PYP A;  3HCY A;  5F5Y A;  4HOI A;  3P01 A;  3FPV A;  2ZOI A;  4EXO A;  2R78 A;  1H3Q A;  4MN5 A;  5HD3 A;  3UME A;  2VGL S;  3BJN A;  1P9R A;  4MN7 A;  4E04 A;  4PKY G;  3S7O A;  2PR5 A;  4CLC A;  2ZOH A;  1OJ5 A;  4MCW A;  1T1C A;  1D06 A;  2XSS A;  3OCN A;  5TBM A;  1P97 A;  3UE3 A;  5C5K A;  3H82 A;  3OC2 A;  3BY8 A;  3EQU A;  3D72 A;  1NWZ A;  2JKR I;  4GS9 B;  1P9W A;  2V9A A;  4K08 A;  4CQH A;  3PBN A;  2EWV A;  1XFN A;  3MMH A;  2L0W A;  2BAS A;  3ZYT A;  1S67 L;  3PR6 A;  2K7S A;  3OBF A;  5HSQ A;  3CLO A;  4UEY A;  1OPX A;  3NOU C;  4HQA A;  1D7E A;  1OT9 A;  2W3E A;  1OTI A;  4LLO B;  3IS2 A;  2M1C A;  1GSX A;  4M4X A;  4XT2 A;  3P7N A;  5DF9 A;  3E4P A;  1XJ4 A;  3LUQ A;  3UE6 A;  5MC7 A;  2J80 A;  3H7W B;  3JVV A;  5J3W A;  4QPR A;  2VZW A;  3A0S A;  1GSV A;  2KLI A;  3KYQ A;  3RTY A;  2KOI A;  3TW8 A;  4HP9 A;  1NLY A;  5F6A A;  1DP8 A;  2O9A A;  1WA9 A;  4ME4 A;  3TJZ C;  3UB9 A;  4BBT A;  2PD8 A;  2V0U A;  3O5Y A;  3CWF A;  4JGP A;  5F68 A;  1S1Y A;  5HL6 A;  3EEA A;  3LI9 A;  3CI6 A;  4I3I A;  3VOL A;  2M7U A;  3JVU A;  4CLC E;  2EA9 A;  2FZ0 A;  3KX0 X;  2JN7 A;  2JHE A;  2V1B A;  1OJG A;  1OT6 A;  4IJG A;  4DJ2 A;  2QKP A;  1OTA A;  4P6Z S;  4WF0 A;  3E0Y A;  2VGL M;  4B93 A;  1YAX A;  2QYB A;  1S4S A;  4L9E A;  1UWN X;  4O0P A;  2B18 A;  1BYW A;  4NXF A;  3NHQ A;  4Y5F A;  1TF1 A;  2YKF A;  4R3A A;  1TS7 A;  3OOV A;  1NLZ A;  4IHQ A;  3ZQ5 A;  1XJ3 A;  1LSW A;  1DP9 A;  3A0V A;  4R6L A;  3C2W A;  3W2Z A;  3EWK A;  5DJT A;  1T1A A;  1ODV A;  4ETX A;  4CLC B;  4EER A;  4YWZ A;  3S7Q A;  2HF6 A;  1VB6 A;  3R7W B;  2GNX A;  2K31 A;  2JKT I;  3LIF A;  3H82 B;  2QJ5 A;  4LRX C;  3MR0 A;  4I39 A;  2L4R A;  3S7N A;  3LIE A;  3KSF A;  4CLC D;  3LID A;  1LL8 A;  1MZU A;  3UB7 A;  3LFV A;  3T4T A;  3UB8 A;  3MFX A;  3CIT A;  4Q0H A;  1TS8 A;  2W3G A;  2PHY A;  1OTE A;  4MN6 A;  4HY8 A;  3PXP A;  1ZTU A;  4PAU A;  2NUP C;  2W3H A;  3IS2 B;  4XT2 B;  2OWJ A;  4MDZ A;  4BMW A;  4WEK A;  2XRN A;  5TJJ A;  3LIC A;  4UQI S;  5AVF A;  3T4K A;  4EQ1 A;  3R7W A;  3F1O A;  3H9W A;  3B33 A;  3CUE A;  1T18 A;  5DJU A;  3LR4 A;  4R38 A;  3EGD C;  2YKH A;  5FL3 A;  3HJI A;  4AFI A;  4BWI A;  4L9G A;  2VV6 A;  3MJQ A;  1V9Y A;  2W3D A;  3MF0 A;  3MXQ A;  3B42 A;  5A8B A;  1YSP A;  2KDK A;  2GZA A;  4JGO A;  2W1R A;  4MMN A;  4NXE A;  3T4S A;  1OTB A;  4HJ6 A;  4P6Z M;  2HV1 A;  5HPI A;  2G7U A;  4OOL A;  2Y8H A;  3BY9 A;  1IOU A;  1S66 L;  1G6O A;  3T4L A;  2V0W A;  3LR5 A;  2W27 A;  1Y28 A;  4EET B;  3PBT A;  4CLC C;  2W1T A;  3VV4 A;  2P08 A;  3C30 A;  3A0R A;  2VV7 A;  2V1A A;  3K2N A;  4Z1W A;  4WUJ A;  1STZ A;  1LSX A;  4ETZ A;  1S1Z A;  3KSG A;  3DBA A;  1XFQ A;  3SW1 A;  3K3D A;  3EGX C;  3ULF A;  4ARZ A;  2J3W A;  2OAQ 1;  2W0N A;  4I3J A;  1W63 M;  2WKR A;  4B9O A;  2Z6C A;  3BQA A;  3PBQ A;  4HJ3 A;  1V9Z A;  3FG8 A;  1GSW A;  3CAX A;  3TE8 A;  2LB9 A;  2O0Y A;  5IS1 A;  2XA7 S;  3U2A A;  4EEU A;  1F5M A;  3GDI A;  3MQ0 A;  4G3K A;  5CX7 A;  1JNU A;  3IBR A;  2VA0 A;  2ZMV A;  3K3C A;  5KIZ A;  4RQ9 A;  5HWW A;  5EFW A;  2O99 A;  2D02 A;  1XJ6 A;  5DFX A;  1UGU A;  2O9B A;  2HJ9 C;  1DP6 A;  3OCL A;  4UQI M;  4F3L B;  2OOL A;  2VLG A;  3HJK A;  3KYZ A;  4KUO A;  4LRY C;  4WEL A;  4I38 A;  3KSI A;  4LRZ E;  4IUK A;  3MQQ A;  3FC7 A;  4EU0 A;  4DJ3 A;  3KO6 A;  3VE4 A;  1LT0 A;  2MJ6 A;  3F1O B;  4HP4 A;  4Q0J A;  2PD7 A;  5LBR A;  4GLQ A;  3F1P A;  1TS6 A;  2B02 A;  2W3F A;  3BW6 A;  1DRM A;  4GJ4 A;  4HHD A;  4EES A;  1TS0 A;  2K2N A;  2NUT C;  3D3O A;  3MQO A;  1N9N A;  4G3W A;  1T1B A;  1UWP X;  3EQV A;  1F9I A;  3EEH A;  4F3L A;  4PKY A;  3PBS A;  5J4E A;  3R4K A;  2Y79 A;  2PT7 A;  2Z6D A;  4EW7 A;  2A24 B;  3BQ8 A;  3TRC A;  2LB5 A;  1G28 A;  5AVE A;  2W1T B;  2P04 A;  1NRJ A;  4DN0 A;  3V67 A;  4NXB A;  2DMW A;  4HIA A;  5G4Z A;  4KQD A;  4GHI B;  4I5S A;  4O01 A;  4BBV A;  1W63 Q;  5DFY A;  3LYX A;  5I5L A;  4Y3I A;  3PYP A;  4I3A A;  4GCZ A;  4EUV A;  4ARZ B;  4WEJ A;  4JGR A;  2GJ3 A;  2HJE A;  1EW0 A;  2XA7 M;  4HI4 A;  1TD5 A;  3PHY A;  4WLA A;  4Y2F A;  5HD5 A;  1ZHH B;  2QJ7 A;  3UB6 A;  2L1M A;  4H6J B;  2JKR M;  4OOM A;  4HH3 A;  5HWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...