4CLCE

Crystal structure of ybr137w protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
172
structure length
172
Chain Sequence
MVVLDKKLLERLTSRKTPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMAVSSLIAFANESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords UPF0303 PROTEIN YBR137W
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 58
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcE00
4CLCE 4BMWA 2A2LA 4CLCC 4CLCB 3FPVA 5CX7A 4CLCA 4CLCD 3FPWA 4NKPA
chains in the Genus database with same CATH superfamily
3BWLA 3HUNA 3EWKA 2GJ3A 5DF7A 3V67A 4KZ9A 4JF6A 1YLWA 1WA9A 1JWZA 2WKEA 2UWXA 1S1YA 3ZG9B 3UPNA 1BTLA 3FPWA 4OP5A 1ERQA 2PRFA 2P08A 2W27A 3M6HA 1YQSA 4JF4A 3V3SA 2EA9A 3OPPA 2PR6A 2PU2A 3P09A 4JPMA 1SKFA 4GNUA 3QNCA 4EUVA 2O0YA 2HDUA 3LEQA 4RA7A 1ERMA 5D3OA 4KG5A 3CMZA 5EUAA 4WELA 4HH3A 1VB6A 1OTEA 4BD0A 1G68A 4I5SA 3UDFA 1DJAA 4F3LA 3CITA 3BFDA 2KOIA 2J80A 2W3DA 3DAVA 2QPNA 4JGOA 2R9XA 4LV2A 4R38A 2Y2QA 4IVIA 2XRNA 2D02A 3PBTA 4K0WA 3DWKA 3F1NB 3AGFA 3LIFA 3QP6A 4DJ3A 5CX7A 4I39A 3N8SA 3O87A 3MXSA 3ZVTA 1ZG6A 5HWTA 4S2MA 2OWHA 3BECA 2CC1A 1YAXA 3T4JA 5TGFA 4NEED 3NIAA 5HL6A 1PNEA 2Y2JA 2DNSA 1GA9A 2PU4A 1G6OA 1DP9A 2QJ7A 4BBVA 3A0SA 3V5MA 3R4KA 1K0KA 1W79A 3BFEA 4ID4A 3KSIA 2G2UA 4GW9A 3DTMA 1S1ZA 2XH9A 1CI9A 3UPOA 4R3JA 2PBDP 2RL3A 2B02A 2DMWA 2OAP1 3T4SA 4ETXA 4GKUA 2M7UA 1FIKA 3D3OA 3PBNA 3MSHA 1XGIA 1ZHHB 2K7SA 2Y2MA 1SDEA 3OPHA 3ZCZA 4CLCC 1N9NA 4HY8A 4HBTA 2EXAA 3TG9A 1T1AA 1CK3A 3B3XA 3EGDC 3QP4A 5A93A 3LYXA 4PM6A 5KSCA 2Y91A 4LFUA 5L09A 1XXMA 3T1RA 3NOUC 3CLOA 2J3TC 2P74A 2ZQ9A 3OCLA 4F3LB 4I3AA 5JYPA 1DJBA 2JC7A 3HUMA 3IF6A 3BM6A 5TFQA 4R4SA 3UMDA 5EVIC 4EBNA 5CEDA 1IEMA 2ZC3B 3MQOA 5L8MA 1MKIA 1L2SA 5DFXA 3GTCA 2H0YA 3SH7A 3SS5A 4UA6A 4KZ5A 1BZAA 3NDGA 3DWZA 1L0FA 4KG6A 3C7VA 4DJ2A 3IH8A 4EV4A 4OPYA 5FDHA 1AWIA 4KQDA 4E3JA 1NLYA 1E25A 4QWOA 1RCJA 2WZZA 4P0MA 4L0LA 3T1SA 5AVFA 5IS1A 3LR3A 3UDIA 4L9GA 1SZVA 1HTZA 4EETB 3L7HA 1UGUA 1ALQA 4ME4A 4WEJA 3T1QB 5HD3A 1MWRA 2XQZA 5CHJA 3QP5A 5CECA 1LSXA 5F5YA 3E98A 1TS8A 2QKPA 5F1FA 1XJ6A 2ZC6B 4D60A 2Y2NA 3PAEA 1XGJA 3UE6A 5L2FA 2EX6A 2J7VA 2L4RA 2XEPA 4Y13A 2XFSA 3NCKA 4HH2A 4EBLA 1N9BA 2V1AA 4EXOA 5CGXA 5KIZA 3D9YA 4ZJ1A 1MPLA 4FCFA 3PBQA 2ZQDA 5E2GA 5HL1A 2VGJA 1Z09A 3IXDA 3G2ZA 2LB9A 1XJ3A 1EROA 2JKFA 1CQAA 1GSXA 4DMZA 2A2LA 1LL9A 4IBRA 5J4EA 3EEAA 3IF6B 1OTIA 3T4LA 1GSVA 3IT9A 4DKIA 1NWZA 4KZ7A 5F6AA 2RCXA 3ZNYA 2Z6DA 4R3BA 4R3AA 5FQKA 4JBFA 3VV4A 5HARA 4QPRA 4PHTA 3U4LP 1ESIA 4E04A 3PBSA 1K6RA 3BY9A 3RXWA 1MKMA 1IOUA 1TVFA 3T4OA 2OV5A 5HWVA 1ODVA 1DP8A 4IVKA 3BEBA 5DJTA 5DJUA 1MWUA 5AQAA 4N1XA 1O7EA 4XXRA 3BLSA 5AQBA 3QNBA 2EFXA 1K55A 1WYBA 4FTXA 3VP1A 3C4OA 2PYRA 1RGZA 2XK1A 4XUZA 1PI4A 3M6BA 1RP5A 4GS9A 1T1BA 1KVMA 3HLEA 4G3WA 4PMAA 3H7WA 2IWBA 4DF6A 3A3EA 3LO7A 4DE1A 1PFLA 2XSSA 2Y2OA 4WUJA 5J8XA 3WS2A 5BOHA 3IXHA 3RXXA 2UV0E 2WKIA 4IHQA 4WZ4A 4U0XA 2E8JA 4OQHA 3IWOA 5A8BA 1FOFA 5EE8A 3HUOA 2FZ0A 1CI8A 4JXWA 4YOFA 3C7UA 3OBFA 1TEMA 3OLOA 4DE0A 1GHIA 1L0GA 1YM1A 5IU1A 1ONHA 2PT7A 3N8LA 4P6ZM 3HJKA 2GX5A 5J7EA 5HAQA 1PWCA 2IWDA 3PHYA 3G2YA 5FEFA 1V9YA 4BWIA 2HDSA 1H0MA 2HF6A 2WADA 4H8RA 2JKTM 2ZM0A 5GLBA 4JKTA 3W2ZA 1DP6A 4C6YA 3IX4A 3KSFA 4Q0IA 3PYPA 1NRFA 3BFCA 4X1MA 2XDMA 2PAVP 4GCZA 1XPBA 3LR5A 2PDRA 3E0YA 4M3KA 3QP2A 4S2JA 2HP6A 4DN0A 3P01A 5HWWA 4P87A 4LENA 1D1JA 3FC7A 1QMEA 3MR0A 2XD5A 1ES3A 4NXGA 4OOYA 3A3IA 4KENB 4HJ3A 5E2FA 2Q9NA 3KX0X 4QY6A 2Y2LA 3BFFA 1K4EA 5IT5A 4B93A 3N8RA 3A0RA 4OPZA 4ZAMA 3W8KA 4P85A 3BJNA 4GS9B 3S7QA 4DE2A 3DBAA 2WGVA 3H7WB 2Q9MA 2XROA 2ZJ9A 2H5SA 3SW1A 1VEUA 1OTAA 3ZGAB 3G31A 1G5UA 2ZM2A 4EBPA 4PM5A 4ZBEA 4DXBA 1XKZA 3D4FA 4E3KA 3E2LA 1ACFA 4HQAA 2OSUA 2HGVA 3IBRA 1SHVA 2WUQA 5FI6A 4Y5FA 4Y2FA 3Q7VA 4CQHA 3M2KA 1JWVA 1KGGA 2EX8A 1I2WA 2VK3A 1SKOB 4YINA 1KOUA 5EFWA 3SH8A 2ZLYA 1PIOA 5MC7A 5K5BA 1NYMA 1SDNA 3BYDA 1PRQA 1OTBA 3WS0A 3MMHA 1JWPA 5FASA 4C3QA 1FILA 1C3BA 1K57C 2W3HA 2O9BA 3RH8B 3N7WA 3RJUA 1TDLA 1GSWA 1LL8A 5FATA 3K3DA 4ZRRA 2WGIA 4KZ3A 2ZMVA 2PD7A 1ZTUA 2Y2KA 3Q7ZA 1IELA 3HLCA 1YKDA 2WK0A 2CMNA 4MNRA 3HLGA 3O88A 3D72A 4NXBA 5G4ZA 1IYOA 3EGXC 4E3NA 2P7JA 3G32A 1XP4A 3IF6C 4JXVA 4P6ZS 4LRYC 4EERA 5CEBA 2W1RA 3A0VA 1GA0A 3EOIA 2NUTC 1MZUA 4EQIA 5M18A 3UPPA 4WF0A 1PZPA 4KUOA 3MJQA 4G3KA 1W63Q 3TRCA 3VSLA 1TDGA 4ZJ2A 2V9AA 3VP0A 4N1HA 2WGWB 3DTEA 4HIAA 3UY6A 4GN2A 2QZ6A 5J3WA 3G34A 4G3VA 3CG5A 1NJ4A 3AGEA 3NC8A 5CERA 2GDNA 3OC2A 3KSGA 3BFGA 5E2EA 3F1PA 5FQ9A 3HLBA 3Q7VB 2GZAA 2EX9A 2HPBA 5FI2A 2PBYA 3V50A 3BRMA 1CF0A 3JVUA 2I72A 3FZCA 4O0PA 2B5RA 4OVDA 3O3VA 2VV7A 5C5KA 5HDDA 2W3GA 3K3CA 4ARZA 4OQGA 3C30A 3NECA 2EFUA 5EM1A 1IFQA 2I9VA 5GLDA 3GSGA 1ES5A 3CZDA 4Y15A 5FA7A 4R0QA 5DF9A 4Y0TA 1MWTA 3WRTA 1KE0A 2O9AA 2Z2MB 5FAQA 3LCEA 1P97A 3MXRA 5FQQA 2W3EA 4OOMA 2J3TD 3VFFA 3LUQA 5HW3A 3UE3A 3NBLA 1BLSA 4S2LA 4X55A 4X56A 5HPIA 1PZOA 1W5DA 4AFIA 1XX2A 3FPVA 3OPRA 2PR5A 3SZTA 5EVID 1X0OA 2HP5A 2ZBBA 1K54C 4MEZA 5HD5A 3R7WA 5GHYA 5EM0A 1TS7A 5HFOA 1FCMA 3LY4A 3G30A 1OMEA 1UWNX 3TSGA 4WN5A 2ZL1A 4N9KA 4P6BA 2XD1A 1ZG4A 4NXEA 3ULFA 4Z9QA 1BUEA 5FI7A 3KYZA 1LLBA 1XFNA 4GZBA 4EEUA 1W8QA 4EWFA 4F94A 3PTEA 3IXGA 2KX6A 4WL9A 3WS4A 4HP4A 3P7NA 2K2NA 4S2NC 4OH0A 1OT9A 2ZC4B 5FQJA 3VOLA 2V20A 5U47A 3UN7A 2DRWA 1L3LA 4RVAA 1NXYA 2ZOIA 2JN7A 4H6JA 5CHMA 4XUXA 1FSWA 3UB5P 1K25A 4II7A 4PM9A 2R9WA 2AVXA 3T50A 2J8YA 5HX9A 1CEFA 1S4SA 2FH5A 4ARZB 3C2WA 3HJIA 3UB9A 1XA1A 3HVFA 1XJ2A 2P9VA 2ZMFA 5F82A 3SOIA 1KE4A 3MFDA 1NLZA 3MFXA 4GJ4A 2J3WA 2ZD8A 4KZ4A 4ZTKA 1I5QA 4GOGA 4Y7PA 4GDBA 1OJGA 1DJCA 5FAPA 4E3IA 4N9LA 1EW0A 1STZA 1Y28A 2JKGA 2ZOHA 4GLQA 3TE8A 3NJAA 4X69A 5A90A 1KDSA 1TD5A 4HHDA 3S7NA 4BBTA 3IQAA 4WZ5A 3LIBA 4X1LA 3R7WB 4PM8A 2XGNA 4WMCD 4R1GA 1IKIA 2VGKA 4WLAA 2EWVA 1JTDA 3GRJA 4NK3A 3GR2A 1LSWA 1BSGA 1S6RA 3W4OA 2A24A 3MXQA 3C5AA 4QB8A 5EVIA 3IX8A 5EVEA 3JYIA 5DVAA 5L10A 4LRZE 3CPTA 4FH2A 4I3JA 1JNUA 2JCHA 3OPLA 2W0NA 4UA9A 3GV9A 4OLDA 3C38A 4O7DA 3LI9A 4NG2A 1TS6A 3K2NA 3P98A 5JYOA 3Q81A 3T4QA 3WWXA 4H6JB 1MC0A 3E2KA 4M4XA 1YSPA 5M19A 1F98A 1LHYA 3SS4A 3WRZA 1XJ4A 1N9LA 3VP3A 5HZHA 4MMNA 2Y59A 2D01A 2J9OA 3O86A 5TR7A 4LV1A 1ES4A 4HJ4A 4LCLA 1KE3A 3GDIA 2ZM8A 1K38A 3Q07A 3BW6A 2P9VB 5TBMA 1YLYA 1Y54A 2Y2IA 3V3RA 1VM1A 1RGYA 4OPQA 1T19A 4IEDA 1P9RA 1SCWA 1TF1A 1LL5A 1NZOA 1Q2PA 4FH4A 4XT2A 2VA0A 1UWPX 3UDXA 1OTDA 4QU3A 1TS0A 2WKPA 2ZQ7A 5EOOA 3H82A 3ZHHA 4GB7A 3UMEA 3E4QA 5A92A 3EQVA 3ZQ5A 5CGSA 5KSHA 2OWJA 3NDEA 1OPXA 2WAEA 2JKTI 4WBGA 3CWFA 3VOZA 3JPUA 4LRXC 3ZVWA 2A24B 4MBKA 2R78A 1FR6A 1E4DA 4MBFA 3S22A 2XFTA 2Y2HA 4RQ9A 2J9PA 3CPTB 1F5MA 1G6AA 1L0DA 2G7UA 4WMCA 4DRTA 2PD8A 3ZDJA 5L07A 3NOTC 3E4OA 3ZG7B 5DKLA 5E43A 4JLFA 1S66L 3UE1A 2V8FA 1M6KA 3OCNA 1M40A 1YLPA 4DE3A 4JGPA 2JKRM 3NHQA 3DTKA 3IWIA 1PWDA 2B95A 3CJMA 1H5XA 2X71A 3ZFZA 3BY8A 1FSYA 4Q0HA 2HJ9C 5FAOA 2Y8HA 1PI5A 3ZG8B 3LR4A 4BMWA 4DDSA 3IXBA 5DTTA 4HNBA 4HP9A 5TBMB 2L1MA 5HAPA 3BLMA 2P04A 4BQMA 3LIDA 4OLGA 5I94A 3FV7A 1OT6A 4Y0OA 2EWWA 4X53A 2BLSA 3T4TA 3UB6A 1OJ5A 4HJ6A 2ZQCA 4GD8A 2HV1A 4MN5A 1YSQA 3PXPA 4S2IA 2VJWA 5CXWA 4WM9A 3ICYA 4XT2B 1T18A 3HLWA 4WEKA 4BLMA 1NY0A 4ZDXA 3A3DA 3H82B 3B42A 3MQQA 4Q0JA 1H8MA 4IUHA 1S0WA 1ZC2A 1MWSA 1T1CA 2H28A 4BENA 1WYCA 4N92A 2NUPC 4B88A 2BTFP 2PHYA 1PWGA 1ES2A 3WS1A 2VZWA 1V9ZA 5FQMA 5FL3A 3IBJA 5TJJA 1PYYA 2V1BA 1XA7A 3T4KA 1J3WA 1VQQA 3A3JA 3SH9A 5FSRA 5M1AA 5EECA 3BQAA 4IBXA 4OPRA 3PR6A 3LEZA 3RFBA 2Y55A 4ESPA 3ZG5A 4BD1A 1NRJA 2MJ6A 1Y4OA 4JGQA 2O99A 4BJPA 3MZEA 3U2AA 3M2JA 3B33A 2V0UA 5DKKA 3MZFA 1A0KA 5IHVA 3FYZA 4S2OA 2EXBA 1VEUB 3LFVA 3L9KA 4I3IA 5F1GA 4LLOB 1PW1A 2PYPA 1LI0A 4PM7A 3CUEA 3CAXA 4FD8A 2VV6A 4ETZA 4R6LA 2HJEA 3MS6A 4B4XA 5HAIA 4L9EA 2ZQAA 1IYSA 4FOFA 2JBFA 3V39A 1IYPA 4U0TA 1CEGA 4EU0A 3HLDA 1BYWA 3TOIA 3HLFA 2INWA 3VE4A 3CHWP 3MBZA 2Z2LB 3S7PA 3DTIA 4PKYA 4E6WA 1HZOA 1N9OA 2VX8A 5FDSA 1E3UD 3LI8A 5GLAA 4UHUA 1EI5A 1YPRA 4RX2A 1W7FA 1KGFA 3VE3A 4KQRA 4A5RA 4MDZA 4CLCD 1P0ZA 1MXOA 5FEGA 4HOIA 4EQ1A 1ESUA 1GHPA 1JVJA 5DTKA 3VSKA 2Z6CA 3IF5A 1K57A 1KDWA 2WZXA 2HP9A 3KYEA 4KQQA 4K0XA 3UO9A 2XA7M 4UQIM 5HPFA 1LT0A 5CTMA 4WZ5C 3SS3A 4MCWA 1BULA 3QHYA 3VOYA 5G18A 3QP8A 4DDYA 2JE5A 4LPZA 4OQIA 4WYYA 2WKQA 1H8ZA 4KZ8A 2G2WA 4D2OA 2XR0A 2V0WA 2HZ5A 2YKHA 3LIEA 3C8CA 4ZJ3A 5CHUA 4Y3IA 1PW8A 4GDNA 2EX2A 4E3LA 1K56D 2HDQA 4UAAA 4E6XA 5KMWA 3BQ8A 5AJGA 3MKFA 2WKHA 4JGRA 2XF3A 3F1PB 4Z1WA 4MN6A 3LR0A 5GL9A 1O07A 3PBOA 4IUKA 4R4RA 5KZHA 4BBUA 1YLZA 4E3OA 4FSFA 4Y0UA 3S1YA 1FCOA 1G28A 2GNXA 3VP4A 2VGLM 3VFHA 1GCEA 4S2PA 3VMAA 3IS2A 2BG1A 1K55C 1K6SA 2ZQ8A 2Q0OA 4JXSA 4L9FA 2ZC5B 2QWSA 5HDCA 5GHZA 4K08A 4IJGA 4PPRA 5F83A 5HSQA 4NKPA 1BLCA 2QYBA 4C75A 4R70A 2BASA 4HESA 4QHCA 1E3UA 3KYQA 1YT4A 2K31A 4X6TA 2QJ5A 3G4PA 5DFYA 3A3FA 5E2HA 4B4ZA 3IWQA 4RYEA 3TJZC 4CLCA 4RX3A 4NXFA 5CRFA 4UA7A 3ITAA 3EQUA 5LBRA 1FCNA 5HDSA 3E4PA 4KZBA 3TW8A 2FFFB 3H9WA 3GVBA 4B9OA 1H8YA 1K4FA 2XLNA 2WAFA 3W4QA 2V1ZA 1IKGA 2OLVA 3MKEA 3G6OA 3LICA 4CJNA 2ZL1B 3ZG0A 1LSVA 1U60A 3F1OA 3IHAA 4LCMA 1DY6A 2OAQ1 1K54A 1CJFA 3CI6A 3PAGA 1S4RA 3T12B 3MQ0A 3LGOA 5EVLA 3PBRA 2QMIA 4CPKA 4GHIA 5DF8A 3NI9A 1BLPA 1Z6FA 2IWCA 3RTYA 4E3MA 2Y2PA 2XA7S 3IX3A 1MBLA 3FWLA 4LV3A 4UQIS 4Q8IA 4BL2A 3LIAA 3FG8A 4S2KA 2L0WA 1GHMA 4EW7A 3IS2B 4HBUA 1VETA 1K56A 3UB8A 1P9WA 4S2NA 3VP2A 2C6WB 2OLUA 4EESA 3OZHA 2V8CA 1ONGA 2IA2A 5FQIA 2X02A 2C5WB 3N4IA 4R23A 4X68A 4HEFA 1FR1A 4QJGA 4PKYG 1ZKJA 1I2SA 2KDKA 4NETA 3HL9A 4Y17A 5EV0A 3OOVA 4LGWA 1NZUA 1NYYA 4YWZA 1IYQA 2W1TA 2E8IA 5EOEA 3HBRA 3GMWA 3B47A 4OOLA 5F68A 4KZ6A 1HD8A 2FFYA 3ZNTA 1DRMA 4MBHA 4CLCB 4MN7A 4EEPA 3KO6A 4LV0A 1AXBA 1S67L 2Y4AA 3JVVA 4UEYA 4HI4A 4OP8A 2VGLS 2WKRA 4JF5A 5AQ9A 1HLUP 2H10A 5GHXA 2O9CA 3KSHA 1WE4A 1XFQA 2DCFA 4X25A 1YLJA 4PAUA 1SKOA 1W8YA 3Q82A 3IH9A 3GQZA 2M7VA 3FKVA 3MF0A 2VKSA 4K91A 2X01A 3UE0A 5I5LA 1D06A 3F1OB 1YMXA 5DTSA 5EVIB 4CLCE 1QMFA 2Y2GA 2OOLA 1YMSA 4FUWA 2ZC7A 3IHBA 2V2FF 3UNWA 4GHIB 5G4YA 2B18A 2VLGA 2ZMAA 1Q2QA 4KZAA 1D7EA 4KG2A 3G35A 1HVBA 1L0EA 3NULA 4OONA 3LY3A 2JHEA 1W63M 3MZDA 2JKRI 5CTNA 3HREA 4I38A 3DW0A 1F2KA 3EEHA 4U3TA 3FKWA 2LB5A 1YLTA 5CGWA 1VETB 1KVLA 2VV8A 3N6IA 3WS5A 3NOPC 1VHMA 4O01A 1N4OA 2WYXA 1EWZA 3HCYA 3T1XA 3W4PA 4DXCA 4OKPA 3ITBA 2M1CA 1H3QA 4YNRA 2HDRA 2A3UA 1KGEA 2A49A 3ISGA 1MY8A 3CUEC 3S4XA 2W1TB 1BLHA 5F69A 4KQOA 4JXGA 3F1NA 5EPHA 4YFMA 1FQGA 1LI9A 3NY4A 4QY5A 4BL3A 3S7OA 2WGWA 3I7JA 4QD4A 1BT5A 4KUKA 1J9MA 2H0TA 1JTGA 2KLIA 2W3FA 3AGDA 5AVEA 3GECA 3C4PA 3ZYTA 2VEAA 2Y79A 5GLCA 2ACGA 2QHKA 5A91A 3UB7A 2YKFA 5AQ7A 4MLLA 3QP1A 3O5YA 4OQ0A 4O8GA 1F9IA 3Q1FA 4EUZA 4GD6A
chains in the Genus database with same CATH topology
3BWLA 3EWKA 2GJ3A 2Z6CA 1OJGA 3V67A 2FZ0A 4YOFA 1WA9A 3OBFA 1EW0A 1STZA 3OLOA 1Y28A 2ZOHA 4GLQA 3TE8A 5IU1A 3NJAA 1S1YA 2PT7A 1TD5A 3HJKA 2GX5A 4P6ZM 5J7EA 4HHDA 3S7NA 4BBTA 3FPWA 3PHYA 2XA7M 4UQIM 1V9YA 2P08A 2W27A 4BWIA 5HPFA 3LIBA 2EA9A 2HF6A 1LT0A 2JKTM 2PR6A 3R7WB 4EUVA 3W2ZA 2O0YA 4WLAA 1DP6A 2EWVA 3KSFA 4Q0IA 3PYPA 4WELA 4HH3A 4MCWA 1VB6A 1LSWA 4GCZA 2A24A 3LR5A 2PDRA 3MXQA 1OTEA 3E0YA 4I5SA 4DN0A 4LPZA 3P01A 2WKQA 5HWWA 3FC7A 4LRZE 3MR0A 2V0WA 4NXGA 2YKHA 4F3LA 4I3JA 3LIEA 3C8CA 3CITA 2KOIA 4Y3IA 2J80A 2W3DA 4HJ3A 4JGOA 1JNUA 2W0NA 3KX0X 4R38A 3C38A 3BQ8A 5AJGA 3LI9A 5IT5A 1TS6A 2XRNA 3K2NA 4B93A 2D02A 3PBTA 4JGRA 3A0RA 3F1PB 4Z1WA 4MN6A 3LR0A 3PBOA 3T4QA 4IUKA 3F1NB 4H6JB 3LIFA 1MC0A 4M4XA 4BBUA 1YSPA 4DJ3A 4FSFA 5CX7A 4I39A 3BJNA 4GS9B 3S7QA 1F98A 3DBAA 3H7WB 1XJ4A 2XROA 1G28A 1N9LA 2GNXA 5HWTA 5HZHA 2VGLM 4MMNA 2D01A 3IS2A 2OWHA 3SW1A 1YAXA 3T4JA 1OTAA 4HJ4A 4NEED 3GDIA 5HL6A 1G6OA 1DP9A 3BW6A 2QJ7A 4L9FA 5TBMA 4BBVA 3A0SA 2QWSA 3R4KA 4HQAA 2HGVA 3IBRA 5HDCA 4K08A 4IJGA 3KSIA 5HSQA 4GW9A 4NKPA 4Y5FA 1T19A 2QYBA 4Y2FA 1S1ZA 4R70A 4CQHA 1P9RA 2BASA 1TF1A 2K31A 3KYQA 2B02A 2DMWA 2OAP1 1KOUA 5EFWA 2QJ5A 3T4SA 4ETXA 5DFYA 5MC7A 4XT2A 2VA0A 5K5BA 1UWPX 1OTBA 1OTDA 1TS0A 2WKPA 2M7UA 3D3OA 3TJZC 3MMHA 4CLCA 4NXFA 3PBNA 3H82A 3UMEA 3EQUA 2W3HA 1ZHHB 2K7SA 3E4QA 5LBRA 5HDSA 3E4PA 3EQVA 3ZQ5A 2O9BA 5KSHA 3RH8B 2OWJA 3TW8A 4CLCC 1N9NA 1GSWA 1LL8A 1OPXA 2JKTI 4HY8A 3H9WA 3K3DA 3CWFA 4ZRRA 4B9OA 2ZMVA 1T1AA 2PD7A 1ZTUA 3EGDC 3LYXA 4LRXC 2A24B 1YKDA 3G6OA 3NOUC 2R78A 3LICA 3CLOA 2J3TC 3OCLA 1LSVA 3F1OA 4RQ9A 2CMNA 4F3LB 2OAQ1 4I3AA 1F5MA 3D72A 2G7UA 3CI6A 2PD8A 4NXBA 5G4ZA 1S4RA 3MQ0A 3NOTC 3E4OA 5DKLA 3UMDA 3EGXC 3PBRA 1S66L 2P7JA 3OCNA 4GHIA 4P6ZS 3RTYA 3MQOA 5L8MA 4LRYC 2XA7S 5DFXA 2W1RA 4UQIS 3A0VA 4EERA 4JGPA 2JKRM 3NHQA 3EOIA 2NUTC 1MZUA 3LIAA 3FG8A 2L0WA 4WF0A 4KUOA 3MJQA 4G3KA 1W63Q 3TRCA 4DJ2A 4EW7A 3IS2B 3BY8A 3UB8A 1P9WA 4Q0HA 2HJ9C 2V9AA 2Y8HA 4EESA 4HIAA 4KQDA 4BMWA 3LR4A 2IA2A 1NLYA 4HNBA 4HP9A 4L0LA 5TBMB 2L1MA 5J3WA 5AVFA 4G3VA 5IS1A 3LR3A 2P04A 3LIDA 4L9GA 4PKYG 4EETB 3OC2A 1OT6A 3KSGA 1UGUA 2KDKA 2EWWA 3F1PA 4ME4A 4WEJA 3OOVA 2GZAA 3T4TA 3UB6A 1OJ5A 4HJ6A 4YWZA 2HV1A 5HD3A 2W1TA 4MN5A 1YSQA 3PXPA 3B47A 4OOLA 5F68A 2VJWA 3JVUA 3ICYA 1LSXA 4XT2B 5F5YA 1T18A 3E98A 4O0PA 1DRMA 1TS8A 4WEKA 2QKPA 1XJ6A 4CLCB 3H82B 4MN7A 2VV7A 3UE6A 4EEPA 5C5KA 3KO6A 3B42A 5HDDA 3MQQA 1S67L 2W3GA 3JVVA 3K3CA 4UEYA 4Q0JA 4ARZA 1H8MA 4HI4A 2L4RA 2VGLS 4IUHA 3C30A 2WKRA 1T1CA 2H28A 4HH2A 2NUPC 2O9CA 2V1AA 2PHYA 1IFQA 3KSHA 1XFQA 2I9VA 4EXOA 2VZWA 1V9ZA 5KIZA 4PAUA 5FL3A 5DF9A 3IBJA 2O9AA 3PBQA 1P97A 5TJJA 2V1BA 2LB9A 1XJ3A 2W3EA 3T4KA 2M7VA 3MF0A 2VKSA 1GSXA 5I5LA 4DMZA 4OOMA 1D06A 3F1OB 2A2LA 2J3TD 5J4EA 3LUQA 4CLCE 3UE3A 3EEAA 5HPIA 1OTIA 3T4LA 3BQAA 2OOLA 1GSVA 4AFIA 3PR6A 3RFBA 3FPVA 4GHIB 5G4YA 2B18A 2VLGA 2PR5A 1D7EA 1X0OA 2ZBBA 5HD5A 2JHEA 1W63M 1NWZA 3R7WA 5F6AA 2JKRI 1NRJA 2Z6DA 4I38A 4R3AA 1TS7A 3EEHA 2MJ6A 2O99A 2LB5A 4JGQA 4QPRA 4PHTA 3VV4A 4BJPA 1UWNX 4WN5A 3U2AA 4E04A 3PBSA 3BY9A 2VV8A 1MKMA 3NOPC 1IOUA 3B33A 1VHMA 2V0UA 4NXEA 5DKKA 3ULFA 4O01A 3KYZA 1XFNA 3T4OA 3LFVA 4EEUA 4I3IA 5HWVA 4LLOB 1ODVA 1DP8A 3HCYA 2KX6A 2PYPA 4WL9A 4HP4A 3P7NA 5DJTA 5DJUA 3CUEA 3CAXA 2K2NA 1OT9A 2M1CA 1H3QA 2VV6A 4ETZA 4YNRA 4R6LA 2HJEA 3VOLA 4L9EA 3CUEC 2W1TB 4FOFA 2ZOIA 2JN7A 5F69A 4KQOA 2PYRA 3F1NA 4H6JA 4EU0A 1BYWA 4GS9A 1T1BA 4G3WA 3S7OA 2INWA 3H7WA 3VE4A 4II7A 3T50A 4KUKA 3S7PA 4PKYA 2KLIA 1S4SA 2FH5A 2W3FA 2XSSA 5AVEA 1N9OA 4ARZB 3C2WA 2VX8A 3GECA 3HJIA 3LI8A 4WUJA 3UB9A 3ZYTA 2VEAA 2Y79A 1XJ2A 2ZMFA 3VE3A 2QHKA 4IHQA 3UB7A 4MDZA 2YKFA 4CLCD 1NLZA 3MFXA 3O5YA 4GJ4A 5A8BA 1P0ZA 4O8GA 2J3WA 1F9IA 4HOIA 4EQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC E;  4BMW A;  2A2L A;  4CLC C;  4CLC B;  3FPV A;  5CX7 A;  4CLC A;  4CLC D;  3FPW A;  4NKP A; 
#chains in the Genus database with same CATH topology
 3BWL A;  3HUN A;  3EWK A;  2GJ3 A;  5DF7 A;  3V67 A;  4KZ9 A;  4JF6 A;  1YLW A;  1WA9 A;  1JWZ A;  2WKE A;  2UWX A;  1S1Y A;  3ZG9 B;  3UPN A;  1BTL A;  3FPW A;  4OP5 A;  1ERQ A;  2PRF A;  2P08 A;  2W27 A;  3M6H A;  1YQS A;  4JF4 A;  3V3S A;  2EA9 A;  3OPP A;  2PR6 A;  2PU2 A;  3P09 A;  4JPM A;  1SKF A;  4GNU A;  3QNC A;  4EUV A;  2O0Y A;  2HDU A;  3LEQ A;  4RA7 A;  1ERM A;  5D3O A;  4KG5 A;  3CMZ A;  5EUA A;  4WEL A;  4HH3 A;  1VB6 A;  1OTE A;  4BD0 A;  1G68 A;  4I5S A;  3UDF A;  1DJA A;  4F3L A;  3CIT A;  3BFD A;  2KOI A;  2J80 A;  2W3D A;  3DAV A;  2QPN A;  4JGO A;  2R9X A;  4LV2 A;  4R38 A;  2Y2Q A;  4IVI A;  2XRN A;  2D02 A;  3PBT A;  4K0W A;  3DWK A;  3F1N B;  3AGF A;  3LIF A;  3QP6 A;  4DJ3 A;  5CX7 A;  4I39 A;  3N8S A;  3O87 A;  3MXS A;  3ZVT A;  1ZG6 A;  5HWT A;  4S2M A;  2OWH A;  3BEC A;  2CC1 A;  1YAX A;  3T4J A;  5TGF A;  4NEE D;  3NIA A;  5HL6 A;  1PNE A;  2Y2J A;  2DNS A;  1GA9 A;  2PU4 A;  1G6O A;  1DP9 A;  2QJ7 A;  4BBV A;  3A0S A;  3V5M A;  3R4K A;  1K0K A;  1W79 A;  3BFE A;  4ID4 A;  3KSI A;  2G2U A;  4GW9 A;  3DTM A;  1S1Z A;  2XH9 A;  1CI9 A;  3UPO A;  4R3J A;  2PBD P;  2RL3 A;  2B02 A;  2DMW A;  2OAP 1;  3T4S A;  4ETX A;  4GKU A;  2M7U A;  1FIK A;  3D3O A;  3PBN A;  3MSH A;  1XGI A;  1ZHH B;  2K7S A;  2Y2M A;  1SDE A;  3OPH A;  3ZCZ A;  4CLC C;  1N9N A;  4HY8 A;  4HBT A;  2EXA A;  3TG9 A;  1T1A A;  1CK3 A;  3B3X A;  3EGD C;  3QP4 A;  5A93 A;  3LYX A;  4PM6 A;  5KSC A;  2Y91 A;  4LFU A;  5L09 A;  1XXM A;  3T1R A;  3NOU C;  3CLO A;  2J3T C;  2P74 A;  2ZQ9 A;  3OCL A;  4F3L B;  4I3A A;  5JYP A;  1DJB A;  2JC7 A;  3HUM A;  3IF6 A;  3BM6 A;  5TFQ A;  4R4S A;  3UMD A;  5EVI C;  4EBN A;  5CED A;  1IEM A;  2ZC3 B;  3MQO A;  5L8M A;  1MKI A;  1L2S A;  5DFX A;  3GTC A;  2H0Y A;  3SH7 A;  3SS5 A;  4UA6 A;  4KZ5 A;  1BZA A;  3NDG A;  3DWZ A;  1L0F A;  4KG6 A;  3C7V A;  4DJ2 A;  3IH8 A;  4EV4 A;  4OPY A;  5FDH A;  1AWI A;  4KQD A;  4E3J A;  1NLY A;  1E25 A;  4QWO A;  1RCJ A;  2WZZ A;  4P0M A;  4L0L A;  3T1S A;  5AVF A;  5IS1 A;  3LR3 A;  3UDI A;  4L9G A;  1SZV A;  1HTZ A;  4EET B;  3L7H A;  1UGU A;  1ALQ A;  4ME4 A;  4WEJ A;  3T1Q B;  5HD3 A;  1MWR A;  2XQZ A;  5CHJ A;  3QP5 A;  5CEC A;  1LSX A;  5F5Y A;  3E98 A;  1TS8 A;  2QKP A;  5F1F A;  1XJ6 A;  2ZC6 B;  4D60 A;  2Y2N A;  3PAE A;  1XGJ A;  3UE6 A;  5L2F A;  2EX6 A;  2J7V A;  2L4R A;  2XEP A;  4Y13 A;  2XFS A;  3NCK A;  4HH2 A;  4EBL A;  1N9B A;  2V1A A;  4EXO A;  5CGX A;  5KIZ A;  3D9Y A;  4ZJ1 A;  1MPL A;  4FCF A;  3PBQ A;  2ZQD A;  5E2G A;  5HL1 A;  2VGJ A;  1Z09 A;  3IXD A;  3G2Z A;  2LB9 A;  1XJ3 A;  1ERO A;  2JKF A;  1CQA A;  1GSX A;  4DMZ A;  2A2L A;  1LL9 A;  4IBR A;  5J4E A;  3EEA A;  3IF6 B;  1OTI A;  3T4L A;  1GSV A;  3IT9 A;  4DKI A;  1NWZ A;  4KZ7 A;  5F6A A;  2RCX A;  3ZNY A;  2Z6D A;  4R3B A;  4R3A A;  5FQK A;  4JBF A;  3VV4 A;  5HAR A;  4QPR A;  4PHT A;  3U4L P;  1ESI A;  4E04 A;  3PBS A;  1K6R A;  3BY9 A;  3RXW A;  1MKM A;  1IOU A;  1TVF A;  3T4O A;  2OV5 A;  5HWV A;  1ODV A;  1DP8 A;  4IVK A;  3BEB A;  5DJT A;  5DJU A;  1MWU A;  5AQA A;  4N1X A;  1O7E A;  4XXR A;  3BLS A;  5AQB A;  3QNB A;  2EFX A;  1K55 A;  1WYB A;  4FTX A;  3VP1 A;  3C4O A;  2PYR A;  1RGZ A;  2XK1 A;  4XUZ A;  1PI4 A;  3M6B A;  1RP5 A;  4GS9 A;  1T1B A;  1KVM A;  3HLE A;  4G3W A;  4PMA A;  3H7W A;  2IWB A;  4DF6 A;  3A3E A;  3LO7 A;  4DE1 A;  1PFL A;  2XSS A;  2Y2O A;  4WUJ A;  5J8X A;  3WS2 A;  5BOH A;  3IXH A;  3RXX A;  2UV0 E;  2WKI A;  4IHQ A;  4WZ4 A;  4U0X A;  2E8J A;  4OQH A;  3IWO A;  5A8B A;  1FOF A;  5EE8 A;  3HUO A;  2FZ0 A;  1CI8 A;  4JXW A;  4YOF A;  3C7U A;  3OBF A;  1TEM A;  3OLO A;  4DE0 A;  1GHI A;  1L0G A;  1YM1 A;  5IU1 A;  1ONH A;  2PT7 A;  3N8L A;  4P6Z M;  3HJK A;  2GX5 A;  5J7E A;  5HAQ A;  1PWC A;  2IWD A;  3PHY A;  3G2Y A;  5FEF A;  1V9Y A;  4BWI A;  2HDS A;  1H0M A;  2HF6 A;  2WAD A;  4H8R A;  2JKT M;  2ZM0 A;  5GLB A;  4JKT A;  3W2Z A;  1DP6 A;  4C6Y A;  3IX4 A;  3KSF A;  4Q0I A;  3PYP A;  1NRF A;  3BFC A;  4X1M A;  2XDM A;  2PAV P;  4GCZ A;  1XPB A;  3LR5 A;  2PDR A;  3E0Y A;  4M3K A;  3QP2 A;  4S2J A;  2HP6 A;  4DN0 A;  3P01 A;  5HWW A;  4P87 A;  4LEN A;  1D1J A;  3FC7 A;  1QME A;  3MR0 A;  2XD5 A;  1ES3 A;  4NXG A;  4OOY A;  3A3I A;  4KEN B;  4HJ3 A;  5E2F A;  2Q9N A;  3KX0 X;  4QY6 A;  2Y2L A;  3BFF A;  1K4E A;  5IT5 A;  4B93 A;  3N8R A;  3A0R A;  4OPZ A;  4ZAM A;  3W8K A;  4P85 A;  3BJN A;  4GS9 B;  3S7Q A;  4DE2 A;  3DBA A;  2WGV A;  3H7W B;  2Q9M A;  2XRO A;  2ZJ9 A;  2H5S A;  3SW1 A;  1VEU A;  1OTA A;  3ZGA B;  3G31 A;  1G5U A;  2ZM2 A;  4EBP A;  4PM5 A;  4ZBE A;  4DXB A;  1XKZ A;  3D4F A;  4E3K A;  3E2L A;  1ACF A;  4HQA A;  2OSU A;  2HGV A;  3IBR A;  1SHV A;  2WUQ A;  5FI6 A;  4Y5F A;  4Y2F A;  3Q7V A;  4CQH A;  3M2K A;  1JWV A;  1KGG A;  2EX8 A;  1I2W A;  2VK3 A;  1SKO B;  4YIN A;  1KOU A;  5EFW A;  3SH8 A;  2ZLY A;  1PIO A;  5MC7 A;  5K5B A;  1NYM A;  1SDN A;  3BYD A;  1PRQ A;  1OTB A;  3WS0 A;  3MMH A;  1JWP A;  5FAS A;  4C3Q A;  1FIL A;  1C3B A;  1K57 C;  2W3H A;  2O9B A;  3RH8 B;  3N7W A;  3RJU A;  1TDL A;  1GSW A;  1LL8 A;  5FAT A;  3K3D A;  4ZRR A;  2WGI A;  4KZ3 A;  2ZMV A;  2PD7 A;  1ZTU A;  2Y2K A;  3Q7Z A;  1IEL A;  3HLC A;  1YKD A;  2WK0 A;  2CMN A;  4MNR A;  3HLG A;  3O88 A;  3D72 A;  4NXB A;  5G4Z A;  1IYO A;  3EGX C;  4E3N A;  2P7J A;  3G32 A;  1XP4 A;  3IF6 C;  4JXV A;  4P6Z S;  4LRY C;  4EER A;  5CEB A;  2W1R A;  3A0V A;  1GA0 A;  3EOI A;  2NUT C;  1MZU A;  4EQI A;  5M18 A;  3UPP A;  4WF0 A;  1PZP A;  4KUO A;  3MJQ A;  4G3K A;  1W63 Q;  3TRC A;  3VSL A;  1TDG A;  4ZJ2 A;  2V9A A;  3VP0 A;  4N1H A;  2WGW B;  3DTE A;  4HIA A;  3UY6 A;  4GN2 A;  2QZ6 A;  5J3W A;  3G34 A;  4G3V A;  3CG5 A;  1NJ4 A;  3AGE A;  3NC8 A;  5CER A;  2GDN A;  3OC2 A;  3KSG A;  3BFG A;  5E2E A;  3F1P A;  5FQ9 A;  3HLB A;  3Q7V B;  2GZA A;  2EX9 A;  2HPB A;  5FI2 A;  2PBY A;  3V50 A;  3BRM A;  1CF0 A;  3JVU A;  2I72 A;  3FZC A;  4O0P A;  2B5R A;  4OVD A;  3O3V A;  2VV7 A;  5C5K A;  5HDD A;  2W3G A;  3K3C A;  4ARZ A;  4OQG A;  3C30 A;  3NEC A;  2EFU A;  5EM1 A;  1IFQ A;  2I9V A;  5GLD A;  3GSG A;  1ES5 A;  3CZD A;  4Y15 A;  5FA7 A;  4R0Q A;  5DF9 A;  4Y0T A;  1MWT A;  3WRT A;  1KE0 A;  2O9A A;  2Z2M B;  5FAQ A;  3LCE A;  1P97 A;  3MXR A;  5FQQ A;  2W3E A;  4OOM A;  2J3T D;  3VFF A;  3LUQ A;  5HW3 A;  3UE3 A;  3NBL A;  1BLS A;  4S2L A;  4X55 A;  4X56 A;  5HPI A;  1PZO A;  1W5D A;  4AFI A;  1XX2 A;  3FPV A;  3OPR A;  2PR5 A;  3SZT A;  5EVI D;  1X0O A;  2HP5 A;  2ZBB A;  1K54 C;  4MEZ A;  5HD5 A;  3R7W A;  5GHY A;  5EM0 A;  1TS7 A;  5HFO A;  1FCM A;  3LY4 A;  3G30 A;  1OME A;  1UWN X;  3TSG A;  4WN5 A;  2ZL1 A;  4N9K A;  4P6B A;  2XD1 A;  1ZG4 A;  4NXE A;  3ULF A;  4Z9Q A;  1BUE A;  5FI7 A;  3KYZ A;  1LLB A;  1XFN A;  4GZB A;  4EEU A;  1W8Q A;  4EWF A;  4F94 A;  3PTE A;  3IXG A;  2KX6 A;  4WL9 A;  3WS4 A;  4HP4 A;  3P7N A;  2K2N A;  4S2N C;  4OH0 A;  1OT9 A;  2ZC4 B;  5FQJ A;  3VOL A;  2V20 A;  5U47 A;  3UN7 A;  2DRW A;  1L3L A;  4RVA A;  1NXY A;  2ZOI A;  2JN7 A;  4H6J A;  5CHM A;  4XUX A;  1FSW A;  3UB5 P;  1K25 A;  4II7 A;  4PM9 A;  2R9W A;  2AVX A;  3T50 A;  2J8Y A;  5HX9 A;  1CEF A;  1S4S A;  2FH5 A;  4ARZ B;  3C2W A;  3HJI A;  3UB9 A;  1XA1 A;  3HVF A;  1XJ2 A;  2P9V A;  2ZMF A;  5F82 A;  3SOI A;  1KE4 A;  3MFD A;  1NLZ A;  3MFX A;  4GJ4 A;  2J3W A;  2ZD8 A;  4KZ4 A;  4ZTK A;  1I5Q A;  4GOG A;  4Y7P A;  4GDB A;  1OJG A;  1DJC A;  5FAP A;  4E3I A;  4N9L A;  1EW0 A;  1STZ A;  1Y28 A;  2JKG A;  2ZOH A;  4GLQ A;  3TE8 A;  3NJA A;  4X69 A;  5A90 A;  1KDS A;  1TD5 A;  4HHD A;  3S7N A;  4BBT A;  3IQA A;  4WZ5 A;  3LIB A;  4X1L A;  3R7W B;  4PM8 A;  2XGN A;  4WMC D;  4R1G A;  1IKI A;  2VGK A;  4WLA A;  2EWV A;  1JTD A;  3GRJ A;  4NK3 A;  3GR2 A;  1LSW A;  1BSG A;  1S6R A;  3W4O A;  2A24 A;  3MXQ A;  3C5A A;  4QB8 A;  5EVI A;  3IX8 A;  5EVE A;  3JYI A;  5DVA A;  5L10 A;  4LRZ E;  3CPT A;  4FH2 A;  4I3J A;  1JNU A;  2JCH A;  3OPL A;  2W0N A;  4UA9 A;  3GV9 A;  4OLD A;  3C38 A;  4O7D A;  3LI9 A;  4NG2 A;  1TS6 A;  3K2N A;  3P98 A;  5JYO A;  3Q81 A;  3T4Q A;  3WWX A;  4H6J B;  1MC0 A;  3E2K A;  4M4X A;  1YSP A;  5M19 A;  1F98 A;  1LHY A;  3SS4 A;  3WRZ A;  1XJ4 A;  1N9L A;  3VP3 A;  5HZH A;  4MMN A;  2Y59 A;  2D01 A;  2J9O A;  3O86 A;  5TR7 A;  4LV1 A;  1ES4 A;  4HJ4 A;  4LCL A;  1KE3 A;  3GDI A;  2ZM8 A;  1K38 A;  3Q07 A;  3BW6 A;  2P9V B;  5TBM A;  1YLY A;  1Y54 A;  2Y2I A;  3V3R A;  1VM1 A;  1RGY A;  4OPQ A;  1T19 A;  4IED A;  1P9R A;  1SCW A;  1TF1 A;  1LL5 A;  1NZO A;  1Q2P A;  4FH4 A;  4XT2 A;  2VA0 A;  1UWP X;  3UDX A;  1OTD A;  4QU3 A;  1TS0 A;  2WKP A;  2ZQ7 A;  5EOO A;  3H82 A;  3ZHH A;  4GB7 A;  3UME A;  3E4Q A;  5A92 A;  3EQV A;  3ZQ5 A;  5CGS A;  5KSH A;  2OWJ A;  3NDE A;  1OPX A;  2WAE A;  2JKT I;  4WBG A;  3CWF A;  3VOZ A;  3JPU A;  4LRX C;  3ZVW A;  2A24 B;  4MBK A;  2R78 A;  1FR6 A;  1E4D A;  4MBF A;  3S22 A;  2XFT A;  2Y2H A;  4RQ9 A;  2J9P A;  3CPT B;  1F5M A;  1G6A A;  1L0D A;  2G7U A;  4WMC A;  4DRT A;  2PD8 A;  3ZDJ A;  5L07 A;  3NOT C;  3E4O A;  3ZG7 B;  5DKL A;  5E43 A;  4JLF A;  1S66 L;  3UE1 A;  2V8F A;  1M6K A;  3OCN A;  1M40 A;  1YLP A;  4DE3 A;  4JGP A;  2JKR M;  3NHQ A;  3DTK A;  3IWI A;  1PWD A;  2B95 A;  3CJM A;  1H5X A;  2X71 A;  3ZFZ A;  3BY8 A;  1FSY A;  4Q0H A;  2HJ9 C;  5FAO A;  2Y8H A;  1PI5 A;  3ZG8 B;  3LR4 A;  4BMW A;  4DDS A;  3IXB A;  5DTT A;  4HNB A;  4HP9 A;  5TBM B;  2L1M A;  5HAP A;  3BLM A;  2P04 A;  4BQM A;  3LID A;  4OLG A;  5I94 A;  3FV7 A;  1OT6 A;  4Y0O A;  2EWW A;  4X53 A;  2BLS A;  3T4T A;  3UB6 A;  1OJ5 A;  4HJ6 A;  2ZQC A;  4GD8 A;  2HV1 A;  4MN5 A;  1YSQ A;  3PXP A;  4S2I A;  2VJW A;  5CXW A;  4WM9 A;  3ICY A;  4XT2 B;  1T18 A;  3HLW A;  4WEK A;  4BLM A;  1NY0 A;  4ZDX A;  3A3D A;  3H82 B;  3B42 A;  3MQQ A;  4Q0J A;  1H8M A;  4IUH A;  1S0W A;  1ZC2 A;  1MWS A;  1T1C A;  2H28 A;  4BEN A;  1WYC A;  4N92 A;  2NUP C;  4B88 A;  2BTF P;  2PHY A;  1PWG A;  1ES2 A;  3WS1 A;  2VZW A;  1V9Z A;  5FQM A;  5FL3 A;  3IBJ A;  5TJJ A;  1PYY A;  2V1B A;  1XA7 A;  3T4K A;  1J3W A;  1VQQ A;  3A3J A;  3SH9 A;  5FSR A;  5M1A A;  5EEC A;  3BQA A;  4IBX A;  4OPR A;  3PR6 A;  3LEZ A;  3RFB A;  2Y55 A;  4ESP A;  3ZG5 A;  4BD1 A;  1NRJ A;  2MJ6 A;  1Y4O A;  4JGQ A;  2O99 A;  4BJP A;  3MZE A;  3U2A A;  3M2J A;  3B33 A;  2V0U A;  5DKK A;  3MZF A;  1A0K A;  5IHV A;  3FYZ A;  4S2O A;  2EXB A;  1VEU B;  3LFV A;  3L9K A;  4I3I A;  5F1G A;  4LLO B;  1PW1 A;  2PYP A;  1LI0 A;  4PM7 A;  3CUE A;  3CAX A;  4FD8 A;  2VV6 A;  4ETZ A;  4R6L A;  2HJE A;  3MS6 A;  4B4X A;  5HAI A;  4L9E A;  2ZQA A;  1IYS A;  4FOF A;  2JBF A;  3V39 A;  1IYP A;  4U0T A;  1CEG A;  4EU0 A;  3HLD A;  1BYW A;  3TOI A;  3HLF A;  2INW A;  3VE4 A;  3CHW P;  3MBZ A;  2Z2L B;  3S7P A;  3DTI A;  4PKY A;  4E6W A;  1HZO A;  1N9O A;  2VX8 A;  5FDS A;  1E3U D;  3LI8 A;  5GLA A;  4UHU A;  1EI5 A;  1YPR A;  4RX2 A;  1W7F A;  1KGF A;  3VE3 A;  4KQR A;  4A5R A;  4MDZ A;  4CLC D;  1P0Z A;  1MXO A;  5FEG A;  4HOI A;  4EQ1 A;  1ESU A;  1GHP A;  1JVJ A;  5DTK A;  3VSK A;  2Z6C A;  3IF5 A;  1K57 A;  1KDW A;  2WZX A;  2HP9 A;  3KYE A;  4KQQ A;  4K0X A;  3UO9 A;  2XA7 M;  4UQI M;  5HPF A;  1LT0 A;  5CTM A;  4WZ5 C;  3SS3 A;  4MCW A;  1BUL A;  3QHY A;  3VOY A;  5G18 A;  3QP8 A;  4DDY A;  2JE5 A;  4LPZ A;  4OQI A;  4WYY A;  2WKQ A;  1H8Z A;  4KZ8 A;  2G2W A;  4D2O A;  2XR0 A;  2V0W A;  2HZ5 A;  2YKH A;  3LIE A;  3C8C A;  4ZJ3 A;  5CHU A;  4Y3I A;  1PW8 A;  4GDN A;  2EX2 A;  4E3L A;  1K56 D;  2HDQ A;  4UAA A;  4E6X A;  5KMW A;  3BQ8 A;  5AJG A;  3MKF A;  2WKH A;  4JGR A;  2XF3 A;  3F1P B;  4Z1W A;  4MN6 A;  3LR0 A;  5GL9 A;  1O07 A;  3PBO A;  4IUK A;  4R4R A;  5KZH A;  4BBU A;  1YLZ A;  4E3O A;  4FSF A;  4Y0U A;  3S1Y A;  1FCO A;  1G28 A;  2GNX A;  3VP4 A;  2VGL M;  3VFH A;  1GCE A;  4S2P A;  3VMA A;  3IS2 A;  2BG1 A;  1K55 C;  1K6S A;  2ZQ8 A;  2Q0O A;  4JXS A;  4L9F A;  2ZC5 B;  2QWS A;  5HDC A;  5GHZ A;  4K08 A;  4IJG A;  4PPR A;  5F83 A;  5HSQ A;  4NKP A;  1BLC A;  2QYB A;  4C75 A;  4R70 A;  2BAS A;  4HES A;  4QHC A;  1E3U A;  3KYQ A;  1YT4 A;  2K31 A;  4X6T A;  2QJ5 A;  3G4P A;  5DFY A;  3A3F A;  5E2H A;  4B4Z A;  3IWQ A;  4RYE A;  3TJZ C;  4CLC A;  4RX3 A;  4NXF A;  5CRF A;  4UA7 A;  3ITA A;  3EQU A;  5LBR A;  1FCN A;  5HDS A;  3E4P A;  4KZB A;  3TW8 A;  2FFF B;  3H9W A;  3GVB A;  4B9O A;  1H8Y A;  1K4F A;  2XLN A;  2WAF A;  3W4Q A;  2V1Z A;  1IKG A;  2OLV A;  3MKE A;  3G6O A;  3LIC A;  4CJN A;  2ZL1 B;  3ZG0 A;  1LSV A;  1U60 A;  3F1O A;  3IHA A;  4LCM A;  1DY6 A;  2OAQ 1;  1K54 A;  1CJF A;  3CI6 A;  3PAG A;  1S4R A;  3T12 B;  3MQ0 A;  3LGO A;  5EVL A;  3PBR A;  2QMI A;  4CPK A;  4GHI A;  5DF8 A;  3NI9 A;  1BLP A;  1Z6F A;  2IWC A;  3RTY A;  4E3M A;  2Y2P A;  2XA7 S;  3IX3 A;  1MBL A;  3FWL A;  4LV3 A;  4UQI S;  4Q8I A;  4BL2 A;  3LIA A;  3FG8 A;  4S2K A;  2L0W A;  1GHM A;  4EW7 A;  3IS2 B;  4HBU A;  1VET A;  1K56 A;  3UB8 A;  1P9W A;  4S2N A;  3VP2 A;  2C6W B;  2OLU A;  4EES A;  3OZH A;  2V8C A;  1ONG A;  2IA2 A;  5FQI A;  2X02 A;  2C5W B;  3N4I A;  4R23 A;  4X68 A;  4HEF A;  1FR1 A;  4QJG A;  4PKY G;  1ZKJ A;  1I2S A;  2KDK A;  4NET A;  3HL9 A;  4Y17 A;  5EV0 A;  3OOV A;  4LGW A;  1NZU A;  1NYY A;  4YWZ A;  1IYQ A;  2W1T A;  2E8I A;  5EOE A;  3HBR A;  3GMW A;  3B47 A;  4OOL A;  5F68 A;  4KZ6 A;  1HD8 A;  2FFY A;  3ZNT A;  1DRM A;  4MBH A;  4CLC B;  4MN7 A;  4EEP A;  3KO6 A;  4LV0 A;  1AXB A;  1S67 L;  2Y4A A;  3JVV A;  4UEY A;  4HI4 A;  4OP8 A;  2VGL S;  2WKR A;  4JF5 A;  5AQ9 A;  1HLU P;  2H10 A;  5GHX A;  2O9C A;  3KSH A;  1WE4 A;  1XFQ A;  2DCF A;  4X25 A;  1YLJ A;  4PAU A;  1SKO A;  1W8Y A;  3Q82 A;  3IH9 A;  3GQZ A;  2M7V A;  3FKV A;  3MF0 A;  2VKS A;  4K91 A;  2X01 A;  3UE0 A;  5I5L A;  1D06 A;  3F1O B;  1YMX A;  5DTS A;  5EVI B;  4CLC E;  1QMF A;  2Y2G A;  2OOL A;  1YMS A;  4FUW A;  2ZC7 A;  3IHB A;  2V2F F;  3UNW A;  4GHI B;  5G4Y A;  2B18 A;  2VLG A;  2ZMA A;  1Q2Q A;  4KZA A;  1D7E A;  4KG2 A;  3G35 A;  1HVB A;  1L0E A;  3NUL A;  4OON A;  3LY3 A;  2JHE A;  1W63 M;  3MZD A;  2JKR I;  5CTN A;  3HRE A;  4I38 A;  3DW0 A;  1F2K A;  3EEH A;  4U3T A;  3FKW A;  2LB5 A;  1YLT A;  5CGW A;  1VET B;  1KVL A;  2VV8 A;  3N6I A;  3WS5 A;  3NOP C;  1VHM A;  4O01 A;  1N4O A;  2WYX A;  1EWZ A;  3HCY A;  3T1X A;  3W4P A;  4DXC A;  4OKP A;  3ITB A;  2M1C A;  1H3Q A;  4YNR A;  2HDR A;  2A3U A;  1KGE A;  2A49 A;  3ISG A;  1MY8 A;  3CUE C;  3S4X A;  2W1T B;  1BLH A;  5F69 A;  4KQO A;  4JXG A;  3F1N A;  5EPH A;  4YFM A;  1FQG A;  1LI9 A;  3NY4 A;  4QY5 A;  4BL3 A;  3S7O A;  2WGW A;  3I7J A;  4QD4 A;  1BT5 A;  4KUK A;  1J9M A;  2H0T A;  1JTG A;  2KLI A;  2W3F A;  3AGD A;  5AVE A;  3GEC A;  3C4P A;  3ZYT A;  2VEA A;  2Y79 A;  5GLC A;  2ACG A;  2QHK A;  5A91 A;  3UB7 A;  2YKF A;  5AQ7 A;  4MLL A;  3QP1 A;  3O5Y A;  4OQ0 A;  4O8G A;  1F9I A;  3Q1F A;  4EUZ A;  4GD6 A; 
#chains in the Genus database with same CATH homology
 3BWL A;  3EWK A;  2GJ3 A;  2Z6C A;  1OJG A;  3V67 A;  2FZ0 A;  4YOF A;  1WA9 A;  3OBF A;  1EW0 A;  1STZ A;  3OLO A;  1Y28 A;  2ZOH A;  4GLQ A;  3TE8 A;  5IU1 A;  3NJA A;  1S1Y A;  2PT7 A;  1TD5 A;  3HJK A;  2GX5 A;  4P6Z M;  5J7E A;  4HHD A;  3S7N A;  4BBT A;  3FPW A;  3PHY A;  2XA7 M;  4UQI M;  1V9Y A;  2P08 A;  2W27 A;  4BWI A;  5HPF A;  3LIB A;  2EA9 A;  2HF6 A;  1LT0 A;  2JKT M;  2PR6 A;  3R7W B;  4EUV A;  3W2Z A;  2O0Y A;  4WLA A;  1DP6 A;  2EWV A;  3KSF A;  4Q0I A;  3PYP A;  4WEL A;  4HH3 A;  4MCW A;  1VB6 A;  1LSW A;  4GCZ A;  2A24 A;  3LR5 A;  2PDR A;  3MXQ A;  1OTE A;  3E0Y A;  4I5S A;  4DN0 A;  4LPZ A;  3P01 A;  2WKQ A;  5HWW A;  3FC7 A;  4LRZ E;  3MR0 A;  2V0W A;  4NXG A;  2YKH A;  4F3L A;  4I3J A;  3LIE A;  3C8C A;  3CIT A;  2KOI A;  4Y3I A;  2J80 A;  2W3D A;  4HJ3 A;  4JGO A;  1JNU A;  2W0N A;  3KX0 X;  4R38 A;  3C38 A;  3BQ8 A;  5AJG A;  3LI9 A;  5IT5 A;  1TS6 A;  2XRN A;  3K2N A;  4B93 A;  2D02 A;  3PBT A;  4JGR A;  3A0R A;  3F1P B;  4Z1W A;  4MN6 A;  3LR0 A;  3PBO A;  3T4Q A;  4IUK A;  3F1N B;  4H6J B;  3LIF A;  1MC0 A;  4M4X A;  4BBU A;  1YSP A;  4DJ3 A;  4FSF A;  5CX7 A;  4I39 A;  3BJN A;  4GS9 B;  3S7Q A;  1F98 A;  3DBA A;  3H7W B;  1XJ4 A;  2XRO A;  1G28 A;  1N9L A;  2GNX A;  5HWT A;  5HZH A;  2VGL M;  4MMN A;  2D01 A;  3IS2 A;  2OWH A;  3SW1 A;  1YAX A;  3T4J A;  1OTA A;  4HJ4 A;  4NEE D;  3GDI A;  5HL6 A;  1G6O A;  1DP9 A;  3BW6 A;  2QJ7 A;  4L9F A;  5TBM A;  4BBV A;  3A0S A;  2QWS A;  3R4K A;  4HQA A;  2HGV A;  3IBR A;  5HDC A;  4K08 A;  4IJG A;  3KSI A;  5HSQ A;  4GW9 A;  4NKP A;  4Y5F A;  1T19 A;  2QYB A;  4Y2F A;  1S1Z A;  4R70 A;  4CQH A;  1P9R A;  2BAS A;  1TF1 A;  2K31 A;  3KYQ A;  2B02 A;  2DMW A;  2OAP 1;  1KOU A;  5EFW A;  2QJ5 A;  3T4S A;  4ETX A;  5DFY A;  5MC7 A;  4XT2 A;  2VA0 A;  5K5B A;  1UWP X;  1OTB A;  1OTD A;  1TS0 A;  2WKP A;  2M7U A;  3D3O A;  3TJZ C;  3MMH A;  4CLC A;  4NXF A;  3PBN A;  3H82 A;  3UME A;  3EQU A;  2W3H A;  1ZHH B;  2K7S A;  3E4Q A;  5LBR A;  5HDS A;  3E4P A;  3EQV A;  3ZQ5 A;  2O9B A;  5KSH A;  3RH8 B;  2OWJ A;  3TW8 A;  4CLC C;  1N9N A;  1GSW A;  1LL8 A;  1OPX A;  2JKT I;  4HY8 A;  3H9W A;  3K3D A;  3CWF A;  4ZRR A;  4B9O A;  2ZMV A;  1T1A A;  2PD7 A;  1ZTU A;  3EGD C;  3LYX A;  4LRX C;  2A24 B;  1YKD A;  3G6O A;  3NOU C;  2R78 A;  3LIC A;  3CLO A;  2J3T C;  3OCL A;  1LSV A;  3F1O A;  4RQ9 A;  2CMN A;  4F3L B;  2OAQ 1;  4I3A A;  1F5M A;  3D72 A;  2G7U A;  3CI6 A;  2PD8 A;  4NXB A;  5G4Z A;  1S4R A;  3MQ0 A;  3NOT C;  3E4O A;  5DKL A;  3UMD A;  3EGX C;  3PBR A;  1S66 L;  2P7J A;  3OCN A;  4GHI A;  4P6Z S;  3RTY A;  3MQO A;  5L8M A;  4LRY C;  2XA7 S;  5DFX A;  2W1R A;  4UQI S;  3A0V A;  4EER A;  4JGP A;  2JKR M;  3NHQ A;  3EOI A;  2NUT C;  1MZU A;  3LIA A;  3FG8 A;  2L0W A;  4WF0 A;  4KUO A;  3MJQ A;  4G3K A;  1W63 Q;  3TRC A;  4DJ2 A;  4EW7 A;  3IS2 B;  3BY8 A;  3UB8 A;  1P9W A;  4Q0H A;  2HJ9 C;  2V9A A;  2Y8H A;  4EES A;  4HIA A;  4KQD A;  4BMW A;  3LR4 A;  2IA2 A;  1NLY A;  4HNB A;  4HP9 A;  4L0L A;  5TBM B;  2L1M A;  5J3W A;  5AVF A;  4G3V A;  5IS1 A;  3LR3 A;  2P04 A;  3LID A;  4L9G A;  4PKY G;  4EET B;  3OC2 A;  1OT6 A;  3KSG A;  1UGU A;  2KDK A;  2EWW A;  3F1P A;  4ME4 A;  4WEJ A;  3OOV A;  2GZA A;  3T4T A;  3UB6 A;  1OJ5 A;  4HJ6 A;  4YWZ A;  2HV1 A;  5HD3 A;  2W1T A;  4MN5 A;  1YSQ A;  3PXP A;  3B47 A;  4OOL A;  5F68 A;  2VJW A;  3JVU A;  3ICY A;  1LSX A;  4XT2 B;  5F5Y A;  1T18 A;  3E98 A;  4O0P A;  1DRM A;  1TS8 A;  4WEK A;  2QKP A;  1XJ6 A;  4CLC B;  3H82 B;  4MN7 A;  2VV7 A;  3UE6 A;  4EEP A;  5C5K A;  3KO6 A;  3B42 A;  5HDD A;  3MQQ A;  1S67 L;  2W3G A;  3JVV A;  3K3C A;  4UEY A;  4Q0J A;  4ARZ A;  1H8M A;  4HI4 A;  2L4R A;  2VGL S;  4IUH A;  3C30 A;  2WKR A;  1T1C A;  2H28 A;  4HH2 A;  2NUP C;  2O9C A;  2V1A A;  2PHY A;  1IFQ A;  3KSH A;  1XFQ A;  2I9V A;  4EXO A;  2VZW A;  1V9Z A;  5KIZ A;  4PAU A;  5FL3 A;  5DF9 A;  3IBJ A;  2O9A A;  3PBQ A;  1P97 A;  5TJJ A;  2V1B A;  2LB9 A;  1XJ3 A;  2W3E A;  3T4K A;  2M7V A;  3MF0 A;  2VKS A;  1GSX A;  5I5L A;  4DMZ A;  4OOM A;  1D06 A;  3F1O B;  2A2L A;  2J3T D;  5J4E A;  3LUQ A;  4CLC E;  3UE3 A;  3EEA A;  5HPI A;  1OTI A;  3T4L A;  3BQA A;  2OOL A;  1GSV A;  4AFI A;  3PR6 A;  3RFB A;  3FPV A;  4GHI B;  5G4Y A;  2B18 A;  2VLG A;  2PR5 A;  1D7E A;  1X0O A;  2ZBB A;  5HD5 A;  2JHE A;  1W63 M;  1NWZ A;  3R7W A;  5F6A A;  2JKR I;  1NRJ A;  2Z6D A;  4I38 A;  4R3A A;  1TS7 A;  3EEH A;  2MJ6 A;  2O99 A;  2LB5 A;  4JGQ A;  4QPR A;  4PHT A;  3VV4 A;  4BJP A;  1UWN X;  4WN5 A;  3U2A A;  4E04 A;  3PBS A;  3BY9 A;  2VV8 A;  1MKM A;  3NOP C;  1IOU A;  3B33 A;  1VHM A;  2V0U A;  4NXE A;  5DKK A;  3ULF A;  4O01 A;  3KYZ A;  1XFN A;  3T4O A;  3LFV A;  4EEU A;  4I3I A;  5HWV A;  4LLO B;  1ODV A;  1DP8 A;  3HCY A;  2KX6 A;  2PYP A;  4WL9 A;  4HP4 A;  3P7N A;  5DJT A;  5DJU A;  3CUE A;  3CAX A;  2K2N A;  1OT9 A;  2M1C A;  1H3Q A;  2VV6 A;  4ETZ A;  4YNR A;  4R6L A;  2HJE A;  3VOL A;  4L9E A;  3CUE C;  2W1T B;  4FOF A;  2ZOI A;  2JN7 A;  5F69 A;  4KQO A;  2PYR A;  3F1N A;  4H6J A;  4EU0 A;  1BYW A;  4GS9 A;  1T1B A;  4G3W A;  3S7O A;  2INW A;  3H7W A;  3VE4 A;  4II7 A;  3T50 A;  4KUK A;  3S7P A;  4PKY A;  2KLI A;  1S4S A;  2FH5 A;  2W3F A;  2XSS A;  5AVE A;  1N9O A;  4ARZ B;  3C2W A;  2VX8 A;  3GEC A;  3HJI A;  3LI8 A;  4WUJ A;  3UB9 A;  3ZYT A;  2VEA A;  2Y79 A;  1XJ2 A;  2ZMF A;  3VE3 A;  2QHK A;  4IHQ A;  3UB7 A;  4MDZ A;  2YKF A;  4CLC D;  1NLZ A;  3MFX A;  3O5Y A;  4GJ4 A;  5A8B A;  1P0Z A;  4O8G A;  2J3W A;  1F9I A;  4HOI A;  4EQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...