4CLCE

Crystal structure of ybr137w protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
172
structure length
172
Chain Sequence
MVVLDKKLLERLTSRKTPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMAVSSLIAFANESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords UPF0303 PROTEIN YBR137W
total genus 58
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcE00
5CX7A 3FPVA 4CLCB 4NKPA 4CLCD 4CLCA 4BMWA 4CLCC 2A2LA 3FPWA 4CLCE
chains in the Genus database with same CATH superfamily
2Z6CA 5FATA 4B88A 2Y2JA 4Y17A 3UPOA 3C4OA 4ID4A 2V0UA 1CEGA 4WZ5C 2WKHA 3NY4A 3KSGA 3UE6A 2PYPA 1KE3A 2IA2A 2QPNA 3IF6C 4Q0JA 4EUVA 3A0VA 4QY6A 2JE5A 2BASA 5TGFA 2VA0A 4E3LA 5I5LA 4GD6A 4DKIA 4RX2A 1PW1A 4M4XA 4AFIA 3ZFZA 4UQIM 5EVLA 4PHTA 3QP1A 5J8XA 2LB9A 3JYIA 3O86A 3CLOA 4MLLA 5DJTA 4FUWA 1WE4A 1TS6A 2O0YA 3BQAA 4KG5A 3B3XA 3HLWA 3C38A 3PTEA 3VP1A 4HJ4A 4JF4A 1VM1A 4JKTA 5CEBA 5DTKA 4E3NA 2W27A 4BL2A 3MMHA 3IBRA 4PMAA 3CWFA 4WEKA 3S7PA 4F94A 4Y5FA 3E0YA 1IKIA 4RYEA 1E3UA 1ONGA 2Y2QA 2EXBA 4HI4A 2J9PA 3N8SA 4DJ3A 2DMWA 1JNUA 4R3BA 4NKPA 3K2NA 4C75A 2L0WA 5L09A 3LO7A 4RA7A 1ZKJA 2O9CA 3ZDJA 2BLSA 4X56A 3BM6A 3BECA 4RVAA 2B5RA 3KYEA 2JKGA 3VP4A 4HESA 4X55A 3QP8A 3JVVA 4S2MA 3VP0A 1K4FA 2J3TD 4E6XA 2IWCA 3M6HA 4PM6A 1HTZA 1L0DA 2R9XA 4QPRA 3T4SA 2ZM0A 4CLCB 1JTGA 2ZJ9A 4IHQA 4MN7A 4O01A 2C6WB 3IF6A 3WRZA 4A5RA 5A91A 4BWIA 3NC8A 3P7NA 1OPXA 3NI9A 4ETZA 3UPNA 3F1NB 1S1YA 3CMZA 4Y15A 2KX6A 2DCFA 4B9OA 5DFYA 4Y3IA 3AGEA 3MF0A 3PXPA 2V20A 2XQZA 3E98A 3PBQA 2P04A 1SZVA 2EA9A 4NXBA 5HWVA 3GDIA 1TD5A 3N6IA 4LV0A 1OTAA 1FSWA 3TJZC 2H10A 2XR0A 3H7WB 2XH9A 4C3QA 3MJQA 3T1XA 1U60A 2W3FA 1QMEA 3IX8A 3Q82A 4BBTA 5HZHA 1X0OA 4YOFA 2EX8A 3UMEA 2HJEA 2PR5A 4S2LA 4JXGA 4OONA 4X69A 1JTDA 5C5KA 4HBUA 3ZQ5A 4LLOB 4JPMA 2ZLYA 4WL9A 1FCNA 2X71A 4U0XA 3GR2A 2JKRM 3EWKA 3IBJA 2VX8A 1SDNA 3N7WA 3ZG8B 1TDLA 1F5MA 2HPBA 1NRJA 5AQAA 3OCLA 1MBLA 3T4KA 4YINA 4NXEA 1FR6A 1NXYA 1YMXA 3ZG9B 2OLUA 4F3LA 2K2NA 1DP8A 4JXVA 3OC2A 2XLNA 3ICYA 2J80A 5CHMA 1S0WA 3KO6A 2EFXA 4BBVA 4IBXA 4DXCA 1P9WA 3TE8A 1XJ3A 3HLFA 3O87A 1F2KA 1KGEA 4K08A 2ZMFA 4P6BA 3A3DA 2ZL1B 1YT4A 3B47A 2VGLS 1EROA 4DDYA 1HD8A 3ZG0A 3FPWA 3E2LA 2PBDP 4MNRA 4R0QA 3IF6B 1W63M 3OLOA 2W1TA 3UNWA 4DDSA 1K0KA 5EM1A 4E6WA 1PYYA 3TG9A 1IKGA 2ZC4B 5M19A 1ES3A 1STZA 1FIKA 1S4RA 4KG6A 3G30A 3CPTA 3IXHA 3ZYTA 1MWRA 2WADA 1M6KA 5E2EA 2H0TA 5FSRA 5DF8A 2XD5A 2WKIA 1GHIA 2A3UA 1YSQA 2HDQA 4E3OA 4LV2A 5FAQA 1Y4OA 3M2KA 4OOYA 4BLMA 3LCEA 3BWLA 4MDZA 3E2KA 3VP2A 5KSHA 4JGQA 1S66L 3HUMA 4XUXA 4KZ9A 3N8LA 3SS4A 1UGUA 1LSWA 4LRXC 3CG5A 2QWSA 1GHPA 3DTIA 2FH5A 4II7A 3T12B 1W8QA 1KVMA 2JKRI 3EGXC 2VGLM 4HJ6A 2J9OA 1BYWA 4BD0A 1GA0A 4E3MA 4GKUA 3IX4A 2J3WA 3A3IA 3LY4A 1MWSA 4KQQA 3UPPA 4N92A 4QJGA 4EETB 3VFFA 2FFFB 2O99A 2Y4AA 1IFQA 1T1AA 3VE4A 3UE0A 4P87A 1NY0A 1YAXA 1XFQA 2XD1A 3ZG7B 3T4QA 4IUKA 1LL5A 4B4XA 1S4SA 5K5BA 5EPHA 3LUQA 3GVBA 3W4QA 2QKPA 3BFFA 2VV6A 5E43A 3BY8A 3SH9A 1H8ZA 3UB6A 3MXRA 4H6JA 1ONHA 1RGYA 1OT6A 4ARZB 3NIAA 3E4PA 5M18A 2Y79A 4IUHA 1W8YA 4Q0HA 3TSGA 2VEAA 2J7VA 5IHVA 5TBMA 3B42A 2I72A 5HWWA 4E3KA 3RJUA 3D3OA 1NLZA 1GHMA 3KSIA 4X53A 4XT2B 4FH4A 2Y55A 5AQBA 3O88A 3BQ8A 4NG2A 2Z2LB 4M3KA 2Z6DA 2ZC3B 1ZHHB 4EWFA 4CLCD 4U0TA 4JF6A 5TR7A 1JWZA 3BY9A 3LI9A 1DY6A 3MBZA 1UWPX 1FCOA 1ACFA 1SKFA 1ZG4A 3C7VA 5CHUA 3L9KA 1XPBA 3QP5A 1T1BA 3S4XA 3UY6A 1YQSA 3G6OA 4ARZA 5FASA 5CXWA 4ZJ1A 4KUOA 2M1CA 2OSUA 2VKSA 3FPVA 4KQOA 5EUAA 1G6AA 3VOYA 5KMWA 1GSWA 4S2IA 5CX7A 3OPHA 5CGXA 1OTBA 3D72A 2JN7A 5L8MA 4CQHA 1PNEA 5KZHA 2JKTI 4H6JB 3VSKA 3O3VA 1VETB 1BLPA 1CI9A 5D3OA 4MEZA 5F69A 2V1AA 4DF6A 3ITBA 1PWDA 4KZ3A 4DE2A 2PYRA 3ZNTA 3V3RA 2WZZA 3KYQA 2GNXA 4ZDXA 3IXDA 1K57C 5G4YA 3RXXA 4PAUA 2G2UA 5DVAA 5AJGA 4KQDA 1BTLA 4D2OA 3VSLA 3MKEA 3MXQA 1XJ4A 1JWVA 5F82A 3LIDA 4G3WA 4WLAA 1EWZA 2C5WB 5EOEA 1FCMA 2Y2KA 1XP4A 3CUEC 1J9MA 2PD8A 1Y28A 2E8IA 3PAGA 3V5MA 1P0ZA 4IVIA 4JLFA 4LGWA 4NXGA 5E2HA 3FV7A 2Y2PA 3M6BA 3Q7VA 5J3WA 3Q7ZA 4WN5A 4ZJ3A 2NUPC 5LBRA 5A92A 2Y2LA 1ERQA 1IYPA 4NXFA 3ZHHA 3Q7VB 1N9OA 3HUNA 4GHIA 5JYOA 2PR6A 2HDSA 3MZEA 5F83A 2HP5A 5HAQA 4GB7A 4UEYA 1VQQA 1BLHA 2JBFA 5EV0A 5CHJA 3WS2A 1LI0A 4DRTA 2Y2IA 1H8YA 4I3IA 1MZUA 2J3TC 3RH8B 3MZFA 4BL3A 3ITAA 1PI4A 3V3SA 2HZ5A 2H0YA 2PDRA 3R4KA 1T1CA 5DJUA 3BYDA 3PBRA 3OPPA 4UA7A 4DMZA 4F3LB 5M1AA 1NZUA 2PBYA 1DP9A 3A3JA 3NOUC 2WKQA 2GX5A 3NOTC 4FCFA 4MCWA 1Z09A 1SKOA 1HVBA 4GHIB 1BZAA 1YLWA 3FYZA 1BULA 5HW3A 3HREA 4GJ4A 3MXSA 2ZC6B 4KZ7A 2Q9MA 1UWNX 5FI6A 1S1ZA 4LRYC 2WGIA 2X01A 5AVFA 1E3UD 3G31A 1D7EA 4LV3A 2ZQCA 1GSVA 1YPRA 2A24A 4WYYA 3V50A 1WYCA 4L9EA 1TDGA 5EM0A 5DTSA 4X1LA 2ZBBA 4I5SA 4UA6A 1K54C 2WYXA 2W0NA 4FTXA 5FDHA 1M40A 3GMWA 3PBTA 2Y59A 3HBRA 1IYSA 2DNSA 4EQ1A 1K38A 4Y0UA 1G68A 3LICA 3UDIA 1VHMA 4E04A 4HBTA 4JXWA 2WKPA 3HL9A 2JKTM 3H82A 3KYZA 3HLGA 4QHCA 1ERMA 3UB5P 4WF0A 4MN6A 4N1XA 4R38A 1F98A 5CGWA 5FQQA 1NLYA 3T1RA 2R9WA 2VJWA 5HFOA 4LPZA 5HPIA 3IQAA 3QNBA 5J7EA 1N9BA 4FSFA 1T18A 2I9VA 3CITA 2XROA 2HF6A 5I94A 2A2LA 1I2SA 3C7UA 1AWIA 4R6LA 1BLCA 4HHDA 4KZ8A 4WZ4A 1ODVA 1LSVA 3Q1FA 2LB5A 4XUZA 5AVEA 1F9IA 5E2FA 2CC1A 5EVIB 4MBHA 3S1YA 2GZAA 3TRCA 1ESUA 1KGGA 3RFBA 1GA9A 4LENA 3LR3A 3WS4A 4HEFA 2FZ0A 1MXOA 3KSFA 1ZG6A 4KG2A 3IHBA 2ZQAA 4GCZA 3AGFA 4WMCA 5HDSA 3G32A 2MJ6A 1J3WA 4BMWA 2GDNA 1XJ6A 3NECA 4N9KA 3RXWA 4CPKA 4Y7PA 3CAXA 3CJMA 4B93A 3G34A 4IEDA 1CEFA 1YKDA 3LR5A 1LI9A 4D60A 3G2ZA 3H7WA 1XA1A 4L9FA 3T4JA 2NUTC 1N9NA 1GSXA 1E25A 2B02A 3D4FA 3H9WA 5L07A 1DJBA 3PBSA 2ZQ9A 5J4EA 1V9YA 3IWIA 1SDEA 3TOIA 1SKOB 1LLBA 4RQ9A 2XEPA 4BENA 3G4PA 1YLTA 2VK3A 2XFSA 5CERA 1PI5A 4UQIS 5DF7A 3W2ZA 2R78A 2JC7A 1BUEA 5BOHA 3SS3A 3ULFA 3N8RA 2ZMAA 5IU1A 3BLSA 2W3GA 4BBUA 1P97A 5HDCA 2M7UA 3LFVA 3BEBA 5FA7A 4C6YA 4G3VA 2KOIA 4H8RA 1XGIA 2RCXA 3QP6A 1W7FA 1W63Q 2JHEA 1N4OA 4QY5A 1ALQA 3OBFA 2OAP1 3GV9A 1OMEA 3SOIA 4E3IA 4GD8A 2Y2MA 4JGRA 5HAPA 1IELA 4UAAA 4P6ZM 4Y0OA 3W4OA 5FL3A 1LSXA 1PZOA 1K6SA 3GTCA 1OTEA 1K56A 1PFLA 4N9LA 3FWLA 4R4SA 5FQMA 2XRNA 3ISGA 3IS2B 2XSSA 1KDWA 5EOOA 3GSGA 4OQ0A 4HH3A 4MBKA 1PWCA 3BJNA 2Y2OA 4GNUA 3ZVWA 2PAVP 1LHYA 3O5YA 3QHYA 4K0WA 3IWQA 5FAPA 3DWZA 1H8MA 5F1GA 1YSPA 4KENB 2QYBA 3BLMA 4ZRRA 5GHXA 2ZC5B 2HDRA 5HD3A 5EVIA 3T4OA 1ZC2A 4WELA 5AQ9A 3HCYA 3QNCA 4OPQA 3AGDA 4JF5A 3R7WA 3MQ0A 2ZC7A 2HP6A 2H28A 1XA7A 5AQ7A 1TF1A 1PZPA 3RTYA 4L0LA 2ZMVA 2BTFP 4EBLA 3B33A 3NDGA 1NZOA 2W1TB 3OZHA 2OOLA 3F1OA 3LEZA 1NJ4A 1YLZA 3V67A 2ZL1A 3MZDA 1OTIA 1DJAA 4FD8A 4XT2A 4DN0A 1E4DA 3PYPA 1K6RA 1RCJA 1A0KA 2P9VA 3K3DA 3E4QA 4QU3A 3BRMA 3UB8A 4DJ2A 4KZ6A 5HD5A 4NK3A 4JBFA 2OAQ1 2Y8HA 4IVKA 2Y2HA 1K4EA 4OLDA 4K0XA 2Q0OA 3HUOA 3VOZA 2PD7A 2VGKA 3SH7A 2WAEA 5KIZA 1K55C 1NWZA 3BFCA 2OWHA 3ZNYA 3NDEA 4HY8A 4L9GA 5FI2A 3HLCA 3NJAA 3FKWA 3IHAA 2WK0A 5HX9A 3LY3A 4FH2A 2QHKA 1MWTA 1TEMA 5F1FA 4P85A 4EQIA 4DE0A 5KSCA 1XGJA 3EGDC 5HPFA 4GOGA 4CLCA 1L0EA 3LIAA 5FEFA 3LR4A 3D9YA 3S7QA 3W4PA 2D02A 2EWVA 2ACGA 1KGFA 4OPZA 4DXBA 3IF5A 3F1OB 4HH2A 2V1ZA 4X68A 4CLCC 4HJ3A 5G4ZA 1YLPA 1SCWA 1N9LA 3V39A 5DFXA 4Y0TA 3HJIA 3BFEA 2GJ3A 4PPRA 2WGVA 2WGWA 3SS5A 1O07A 1K55A 2VLGA 5F6AA 3N4IA 1TS7A 2P7JA 5IS1A 4EBNA 4PM9A 5F68A 3LI8A 4OQHA 3CZDA 1O7EA 3VFHA 4O8GA 3DTEA 1BT5A 3GECA 5EFWA 3UE1A 2EX6A 2K7SA 3QP4A 4DE3A 1G5UA 1S67L 3UN7A 4CJNA 2JCHA 1K56D 2ZOIA 2Y2GA 2PRFA 4I3AA 4PKYG 4WMCD 2ZD8A 1EI5A 2JKFA 1XX2A 4UHUA 1W5DA 1Z6FA 3T50A 1PWGA 4EEPA 3F1PA 3NOPC 2WGWB 1ES4A 2VZWA 4HOIA 3KX0X 1WA9A 4BJPA 5EVIC 5FQIA 3IXGA 3LIEA 1KOUA 1XXMA 1MY8A 2D01A 1K57A 3EEAA 1CJFA 1CI8A 2YKHA 1ESIA 4PM8A 4NEED 1IYQA 5HL1A 1MC0A 2IWDA 1P9RA 2DRWA 1G28A 3PBOA 4HIAA 3UDFA 1YM1A 4KUKA 2XDMA 5CRFA 3SZTA 4QWOA 3A3EA 3MS6A 1L3LA 1BLSA 3W8KA 1ES5A 3NHQA 4LV1A 4YNRA 2HJ9C 3P98A 2B95A 1D1JA 1RP5A 2OWJA 2EX2A 4R1GA 1C3BA 3U4LP 1AXBA 2QJ5A 3DBAA 4UA9A 3EOIA 4I3JA 1H0MA 1S6RA 1T19A 3CPTB 5TBMB 1DRMA 3IS2A 3S7NA 3UO9A 2XA7M 4E3JA 1BSGA 3CI6A 3MSHA 4MMNA 3PHYA 5HARA 4Z9QA 3F1NA 2INWA 3F1PB 4S2PA 4GDNA 5DTTA 2IWBA 2AVXA 1W79A 4P6ZS 3SH8A 3IH8A 1LT0A 1NYMA 4MN5A 1JWPA 4EW7A 1DP6A 2HDUA 3G2YA 2PU4A 1NYYA 4LFUA 3HLDA 3TW8A 4ME4A 2OLVA 4RX3A 3Q81A 2XF3A 4EU0A 3P01A 1KDSA 2A49A 4KQRA 3CUEA 4KZBA 1PW8A 5GHZA 5E2GA 3G35A 3BW6A 4OOMA 3A3FA 2V8CA 3MKFA 1QMFA 2XK1A 3I7JA 4JGPA 1KE4A 3PAEA 1K25A 3C30A 3S22A 2G7UA 2G2WA 5A93A 1MKIA 3BFGA 3VE3A 3NCKA 5EECA 3ZGAB 4ZAMA 2HP9A 1FQGA 4S2JA 1KVLA 3EEHA 4IJGA 4PM7A 1IEMA 4OQGA 4Q0IA 2WKEA 3IWOA 1RGZA 4P0MA 3DAVA 3C2WA 4ZJ2A 4LCMA 4BQMA 4EBPA 3DTKA 4Y2FA 4JGOA 4HNBA 1MPLA 4EXOA 1I5QA 1OJ5A 2KLIA 4GS9A 1TS0A 2W3HA 1FILA 3WRTA 2WAFA 3LIFA 5FQ9A 3MQOA 5TFQA 5DKLA 4N1HA 1LL8A 1IYOA 1PRQA 4WUJA 3FC7A 1LL9A 2XFTA 4PM5A 1DJCA 2PT7A 3HLBA 5CGSA 2FFYA 1CQAA 2A24B 5GL9A 5F5YA 4WEJA 4Q8IA 2E8JA 2EWWA 1MKMA 4OLGA 5EVEA 4HP9A 4ESPA 4O0PA 3MFDA 2XA7S 1EW0A 2QMIA 3HLEA 4KZAA 1FR1A 4OPYA 2P9VB 2WKRA 4Z1WA 2EFUA 3BFDA 4ETXA 4I39A 5GLCA 2O9BA 2QJ7A 3T1SA 4PKYA 3WS1A 1K54A 3WS0A 3UB9A 2M7VA 2Y2NA 4LCLA 5DF9A 3ZG5A 1YMSA 5L10A 3VMAA 3C4PA 5CECA 1GCEA 1YLJA 4IBRA 4OKPA 4OVDA 2V9AA 1VB6A 2V8FA 2XGNA 3GRJA 3WWXA 3R7WB 4QB8A 4U3TA 3S7OA 2UV0E 1MWUA 3QP2A 2QZ6A 3LIBA 5TJJA 3GQZA 2HV1A 3DTMA 4GLQA 3PBNA 1FOFA 3UE3A 4OOLA 2B18A 4I38A 4EV4A 4OP8A 4DE1A 4WBGA 1YLYA 4ZBEA 1L0FA 1OT9A 5U47A 3LGOA 4CLCE 4EESA 2L4RA 5HDDA 3LR0A 3UB7A 5FEGA 5HAIA 2L1MA 1OJGA 1TS8A 3OPLA 2BG1A 1NRFA 1VETA 4YFMA 4BD1A 2RL3A 2ZQ7A 5FQKA 3DWKA 3LEQA 1H3QA 5GLBA 2PHYA 3NBLA 2V2FF 3H82B 3T1QB 4R4RA 2ZM2A 1FSYA 1TVFA 5CTNA 1HZOA 1G6OA 1XJ2A 2O9AA 2HGVA 4K91A 3L7HA 5GLDA 3C5AA 4KZ5A 5HL6A 3FZCA 5FQJA 2J8YA 1Q2PA 1CF0A 5EVID 2EXAA 3T4LA 1H5XA 1WYBA 5MC7A 3EQUA 4GW9A 4Y13A 2ZQ8A 2W3DA 1KE0A 3KSHA 5DKKA 1V9ZA 3JVUA 5G18A 3C8CA 3EQVA 4OP5A 4QD4A 5FDSA 4WZ5A 4HP4A 4S2NA 5GHYA 5FAOA 3P09A 4WM9A 4S2NC 4OH0A 1VEUB 3VV4A 2WUQA 2YKFA 4FOFA 4GDBA 2W3EA 2H5SA 3M2JA 3JPUA 4MBFA 5IT5A 2K31A 3IH9A 5FI7A 3OCNA 5A8BA 3IXBA 4G3KA 4S2KA 5HSQA 1ES2A 4YWZA 4O7DA 3E4OA 3A0SA 1XFNA 2V0WA 4OPRA 2CMNA 3VOLA 5CEDA 4GZBA 1L2SA 3HJKA 3NULA 3ZCZA 4R3JA 5GLAA 2KDKA 4B4ZA 2UWXA 3FKVA 4S2OA 3VP3A 3WS5A 4EUZA 2V1BA 2VV7A 3MQQA 4OQIA 1L0GA 2Z2MB 5JYPA 1D06A 2P08A 3MFXA 3MR0A 3OOVA 3CHWP 5HWTA 2X02A 2Q9NA 1HLUP 3OPRA 1Q2QA 2ZM8A 2WZXA 5A90A 2VGJA 1JVJA 1Y54A 2P74A 4GS9B 1SHVA 4HQAA 2VV8A 4GN2A 2Y91A 1VEUA 4EEUA 1OTDA 4X6TA 3Q07A 1IOUA 5L2FA 2W1RA 1XKZA 5CTMA 2EX9A 1CK3A 4XXRA 1I2WA 2ZOHA 3A0RA 3UMDA 2PU2A 3HVFA 4NETA 3PR6A 4X25A 3FG8A 5EE8A 3IT9A 3IX3A 3U2AA 3K3CA 4R3AA 4ZTKA 4LRZE 4X1MA 1PIOA 3T4TA 4JXSA 4EERA 4KZ4A 3DW0A 3UDXA 4R70A 4R23A 2ZQDA 1ZTUA 3LYXA 3ZVTA 2OV5A 3SW1A
chains in the Genus database with same CATH topology
2Z6CA 4OOMA 3W2ZA 2R78A 3E4PA 2Y79A 4IUHA 4Q0HA 4JGPA 2VEAA 2V0UA 3ULFA 3C30A 5TBMA 3B42A 2G7UA 5IU1A 2W3GA 4BBUA 5HWWA 1P97A 5HDCA 2M7UA 3LFVA 3KSGA 3UE6A 3D3OA 2PYPA 4Q0JA 2IA2A 3VE3A 1NLZA 4EUVA 3KSIA 4G3VA 3A0VA 4XT2B 2KOIA 3BQ8A 2BASA 3EEHA 4IJGA 1W63Q 2JHEA 4Q0IA 2VA0A 2Z6DA 5I5LA 1ZHHB 4CLCD 3OBFA 4M4XA 4AFIA 2OAP1 3C2WA 3BY9A 3LI9A 4UQIM 4JGRA 4PHTA 4Y2FA 2LB9A 1UWPX 4P6ZM 4JGOA 4HNBA 5FL3A 1LSXA 4EXOA 1OJ5A 1T1BA 2KLIA 3CLOA 4GS9A 5DJTA 1TS0A 1OTEA 1TS6A 4ARZB 2W3HA 2O0YA 3G6OA 4ARZA 3BQAA 4KUOA 2M1CA 2XRNA 3C38A 2VKSA 3IS2B 3LIFA 4HJ4A 2XSSA 3MQOA 3FPVA 5DKLA 4HH3A 1LL8A 4KQOA 3BJNA 4WUJA 2W27A 1GSWA 3FC7A 3MMHA 3IBRA 5CX7A 2PT7A 3CWFA 3O5YA 4WEKA 3S7PA 1OTBA 3D72A 2JN7A 5L8MA 4CQHA 4Y5FA 2JKTI 2A24B 1H8MA 5F5YA 4WEJA 3E0YA 4H6JB 1YSPA 2EWWA 1MKMA 2QYBA 4HP9A 4HI4A 4ZRRA 4O0PA 5HD3A 4DJ3A 2DMWA 3T4OA 1JNUA 4WELA 2XA7S 4NKPA 1EW0A 5F69A 3HCYA 3K2NA 2L0WA 2V1AA 3R7WA 3MQ0A 2WKRA 4Z1WA 2H28A 1TF1A 2PYRA 4ETXA 2O9CA 3RTYA 4L0LA 2ZMVA 4I39A 2O9BA 2GNXA 3KYQA 3B33A 2QJ7A 2W1TB 2OOLA 3F1OA 5G4YA 4PKYA 4PAUA 3UB9A 2M7VA 5DF9A 5AJGA 4KQDA 3JVVA 3V67A 2J3TD 3MXQA 1OTIA 1XJ4A 2V9AA 4DN0A 4XT2A 3PYPA 3LIDA 1VB6A 4QPRA 3T4SA 4CLCB 4G3WA 3R7WB 4IHQA 4MN7A 4WLAA 3K3DA 4O01A 3E4QA 3UB8A 4DJ2A 5HD5A 4BWIA 3S7OA 3CUEC 2PD8A 1Y28A 3P7NA 1OPXA 2OAQ1 4ETZA 2Y8HA 1P0ZA 3F1NB 3LIBA 4NXGA 1S1YA 5TJJA 2HV1A 4GLQA 2KX6A 3PBNA 2PD7A 5J3WA 3UE3A 5KIZA 4OOLA 4B9OA 4WN5A 2B18A 5DFYA 4Y3IA 5LBRA 2NUPC 1NWZA 2OWHA 4I38A 4HY8A 3MF0A 3PXPA 4NXFA 4L9GA 3E98A 3PBQA 1OT9A 4CLCE 3NJAA 4EESA 2L4RA 1N9OA 2P04A 4GHIA 5HDDA 3LR0A 2EA9A 2PR6A 4NXBA 5HWVA 3UB7A 3GDIA 1TD5A 2L1MA 1OJGA 1OTAA 3TJZC 2QHKA 1TS8A 4UEYA 3H7WB 3EGDC 3MJQA 1H3QA 5HPFA 2PHYA 4CLCA 2W3FA 3LIAA 3H82B 4I3IA 1MZUA 2J3TC 4BBTA 3RH8B 3LR4A 3S7QA 5HZHA 2D02A 1X0OA 2PDRA 3R4KA 4YOFA 1T1CA 5DJUA 1G6OA 2EWVA 2HJEA 3UMEA 2PR5A 1XJ2A 3PBRA 2O9AA 3F1OB 4HH2A 2HGVA 5C5KA 4DMZA 4F3LB 4CLCC 5HL6A 4HJ3A 5G4ZA 1N9LA 3ZQ5A 4LLOB 5DFXA 3HJIA 1DP9A 2GJ3A 4WL9A 3NOUC 2WKQA 2GX5A 2JKRM 3NOTC 2VLGA 3EWKA 3T4LA 3IBJA 4MCWA 5F6AA 2VX8A 1TS7A 2P7JA 5MC7A 3EQUA 5IS1A 4GW9A 4GHIB 1F5MA 2W3DA 3LI8A 3KSHA 5F68A 1NRJA 3OCLA 5DKKA 4GJ4A 4O8GA 1V9ZA 3JVUA 3C8CA 3GECA 3T4KA 1UWNX 5EFWA 3EQVA 1S1ZA 4NXEA 4LRYC 4F3LA 2K2NA 1DP8A 2K7SA 3OC2A 5AVFA 4HP4A 1D7EA 3ICYA 2J80A 1GSVA 1S67L 2A24A 3KO6A 4BBVA 1P9WA 3TE8A 1XJ3A 4L9EA 2ZOIA 4K08A 2ZMFA 3VV4A 4I3AA 4PKYG 2ZBBA 4I5SA 2YKFA 4FOFA 2W3EA 3B47A 3T50A 2VGLS 2W0NA 4EEPA 3F1PA 3NOPC 3PBTA 3FPWA 5IT5A 2K31A 4EQ1A 2VZWA 4HOIA 3OCNA 3OLOA 1W63M 2W1TA 3KX0X 3LICA 1WA9A 5A8BA 4G3KA 1VHMA 4E04A 5HSQA 4YWZA 2WKPA 2JKTM 3E4OA 4BJPA 3H82A 3KYZA 3A0SA 3LIEA 1STZA 1KOUA 2D01A 4WF0A 1XFNA 2V0WA 4MN6A 1S4RA 2CMNA 3VOLA 3EEAA 3ZYTA 4R38A 1F98A 3HJKA 1NLYA 2YKHA 2VJWA 1YSQA 4LPZA 5HPIA 5J7EA 4NEED 4FSFA 1MC0A 1T18A 1P9RA 1G28A 2I9VA 2KDKA 3CITA 3PBOA 4HIAA 2XROA 2HF6A 2A2LA 4KUKA 4R6LA 3BWLA 2V1BA 2VV7A 4MDZA 3MQQA 4HHDA 5KSHA 4JGQA 1ODVA 1S66L 1LSVA 2LB5A 5AVEA 1F9IA 1D06A 3NHQA 4YNRA 2P08A 2HJ9C 3MFXA 3MR0A 1UGUA 2GZAA 1LSWA 4LRXC 3TRCA 3OOVA 2OWJA 5HWTA 2QWSA 3RFBA 2FH5A 4II7A 3LR3A 2QJ5A 3DBAA 2JKRI 2FZ0A 3EGXC 4GS9B 3EOIA 4I3JA 3KSFA 4HQAA 2VGLM 1T19A 2VV8A 4HJ6A 4GCZA 1BYWA 5HDSA 5TBMB 1DRMA 2MJ6A 4EEUA 3IS2A 3S7NA 4BMWA 1OTDA 1XJ6A 2XA7M 2J3WA 3CAXA 3CI6A 4B93A 1IOUA 4MMNA 2W1RA 3PHYA 3F1NA 2INWA 1YKDA 3LR5A 3F1PB 4EETB 3H7WA 4L9FA 2ZOHA 2O99A 4P6ZS 3A0RA 3T4JA 3UMDA 1T1AA 1IFQA 1LT0A 3VE4A 4MN5A 4EW7A 1DP6A 2NUTC 3PR6A 1N9NA 1GSXA 3FG8A 1YAXA 1XFQA 2B02A 3TW8A 4ME4A 3H9WA 3T4QA 4IUKA 3PBSA 3U2AA 1S4SA 3K3CA 4R3AA 4EU0A 4LRZE 5J4EA 5K5BA 3LUQA 3P01A 1V9YA 2QKPA 3T4TA 4EERA 2VV6A 3BY8A 4R70A 3CUEA 4RQ9A 1ZTUA 3LYXA 3UB6A 4H6JA 1OT6A 3SW1A 4UQIS 3BW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CX7 A;  3FPV A;  4CLC B;  4NKP A;  4CLC D;  4CLC A;  4BMW A;  4CLC C;  2A2L A;  3FPW A;  4CLC E; 
#chains in the Genus database with same CATH topology
 2Z6C A;  5FAT A;  4B88 A;  2Y2J A;  4Y17 A;  3UPO A;  3C4O A;  4ID4 A;  2V0U A;  1CEG A;  4WZ5 C;  2WKH A;  3NY4 A;  3KSG A;  3UE6 A;  2PYP A;  1KE3 A;  2IA2 A;  2QPN A;  3IF6 C;  4Q0J A;  4EUV A;  3A0V A;  4QY6 A;  2JE5 A;  2BAS A;  5TGF A;  2VA0 A;  4E3L A;  5I5L A;  4GD6 A;  4DKI A;  4RX2 A;  1PW1 A;  4M4X A;  4AFI A;  3ZFZ A;  4UQI M;  5EVL A;  4PHT A;  3QP1 A;  5J8X A;  2LB9 A;  3JYI A;  3O86 A;  3CLO A;  4MLL A;  5DJT A;  4FUW A;  1WE4 A;  1TS6 A;  2O0Y A;  3BQA A;  4KG5 A;  3B3X A;  3HLW A;  3C38 A;  3PTE A;  3VP1 A;  4HJ4 A;  4JF4 A;  1VM1 A;  4JKT A;  5CEB A;  5DTK A;  4E3N A;  2W27 A;  4BL2 A;  3MMH A;  3IBR A;  4PMA A;  3CWF A;  4WEK A;  3S7P A;  4F94 A;  4Y5F A;  3E0Y A;  1IKI A;  4RYE A;  1E3U A;  1ONG A;  2Y2Q A;  2EXB A;  4HI4 A;  2J9P A;  3N8S A;  4DJ3 A;  2DMW A;  1JNU A;  4R3B A;  4NKP A;  3K2N A;  4C75 A;  2L0W A;  5L09 A;  3LO7 A;  4RA7 A;  1ZKJ A;  2O9C A;  3ZDJ A;  2BLS A;  4X56 A;  3BM6 A;  3BEC A;  4RVA A;  2B5R A;  3KYE A;  2JKG A;  3VP4 A;  4HES A;  4X55 A;  3QP8 A;  3JVV A;  4S2M A;  3VP0 A;  1K4F A;  2J3T D;  4E6X A;  2IWC A;  3M6H A;  4PM6 A;  1HTZ A;  1L0D A;  2R9X A;  4QPR A;  3T4S A;  2ZM0 A;  4CLC B;  1JTG A;  2ZJ9 A;  4IHQ A;  4MN7 A;  4O01 A;  2C6W B;  3IF6 A;  3WRZ A;  4A5R A;  5A91 A;  4BWI A;  3NC8 A;  3P7N A;  1OPX A;  3NI9 A;  4ETZ A;  3UPN A;  3F1N B;  1S1Y A;  3CMZ A;  4Y15 A;  2KX6 A;  2DCF A;  4B9O A;  5DFY A;  4Y3I A;  3AGE A;  3MF0 A;  3PXP A;  2V20 A;  2XQZ A;  3E98 A;  3PBQ A;  2P04 A;  1SZV A;  2EA9 A;  4NXB A;  5HWV A;  3GDI A;  1TD5 A;  3N6I A;  4LV0 A;  1OTA A;  1FSW A;  3TJZ C;  2H10 A;  2XR0 A;  3H7W B;  2XH9 A;  4C3Q A;  3MJQ A;  3T1X A;  1U60 A;  2W3F A;  1QME A;  3IX8 A;  3Q82 A;  4BBT A;  5HZH A;  1X0O A;  4YOF A;  2EX8 A;  3UME A;  2HJE A;  2PR5 A;  4S2L A;  4JXG A;  4OON A;  4X69 A;  1JTD A;  5C5K A;  4HBU A;  3ZQ5 A;  4LLO B;  4JPM A;  2ZLY A;  4WL9 A;  1FCN A;  2X71 A;  4U0X A;  3GR2 A;  2JKR M;  3EWK A;  3IBJ A;  2VX8 A;  1SDN A;  3N7W A;  3ZG8 B;  1TDL A;  1F5M A;  2HPB A;  1NRJ A;  5AQA A;  3OCL A;  1MBL A;  3T4K A;  4YIN A;  4NXE A;  1FR6 A;  1NXY A;  1YMX A;  3ZG9 B;  2OLU A;  4F3L A;  2K2N A;  1DP8 A;  4JXV A;  3OC2 A;  2XLN A;  3ICY A;  2J80 A;  5CHM A;  1S0W A;  3KO6 A;  2EFX A;  4BBV A;  4IBX A;  4DXC A;  1P9W A;  3TE8 A;  1XJ3 A;  3HLF A;  3O87 A;  1F2K A;  1KGE A;  4K08 A;  2ZMF A;  4P6B A;  3A3D A;  2ZL1 B;  1YT4 A;  3B47 A;  2VGL S;  1ERO A;  4DDY A;  1HD8 A;  3ZG0 A;  3FPW A;  3E2L A;  2PBD P;  4MNR A;  4R0Q A;  3IF6 B;  1W63 M;  3OLO A;  2W1T A;  3UNW A;  4DDS A;  1K0K A;  5EM1 A;  4E6W A;  1PYY A;  3TG9 A;  1IKG A;  2ZC4 B;  5M19 A;  1ES3 A;  1STZ A;  1FIK A;  1S4R A;  4KG6 A;  3G30 A;  3CPT A;  3IXH A;  3ZYT A;  1MWR A;  2WAD A;  1M6K A;  5E2E A;  2H0T A;  5FSR A;  5DF8 A;  2XD5 A;  2WKI A;  1GHI A;  2A3U A;  1YSQ A;  2HDQ A;  4E3O A;  4LV2 A;  5FAQ A;  1Y4O A;  3M2K A;  4OOY A;  4BLM A;  3LCE A;  3BWL A;  4MDZ A;  3E2K A;  3VP2 A;  5KSH A;  4JGQ A;  1S66 L;  3HUM A;  4XUX A;  4KZ9 A;  3N8L A;  3SS4 A;  1UGU A;  1LSW A;  4LRX C;  3CG5 A;  2QWS A;  1GHP A;  3DTI A;  2FH5 A;  4II7 A;  3T12 B;  1W8Q A;  1KVM A;  2JKR I;  3EGX C;  2VGL M;  4HJ6 A;  2J9O A;  1BYW A;  4BD0 A;  1GA0 A;  4E3M A;  4GKU A;  3IX4 A;  2J3W A;  3A3I A;  3LY4 A;  1MWS A;  4KQQ A;  3UPP A;  4N92 A;  4QJG A;  4EET B;  3VFF A;  2FFF B;  2O99 A;  2Y4A A;  1IFQ A;  1T1A A;  3VE4 A;  3UE0 A;  4P87 A;  1NY0 A;  1YAX A;  1XFQ A;  2XD1 A;  3ZG7 B;  3T4Q A;  4IUK A;  1LL5 A;  4B4X A;  1S4S A;  5K5B A;  5EPH A;  3LUQ A;  3GVB A;  3W4Q A;  2QKP A;  3BFF A;  2VV6 A;  5E43 A;  3BY8 A;  3SH9 A;  1H8Z A;  3UB6 A;  3MXR A;  4H6J A;  1ONH A;  1RGY A;  1OT6 A;  4ARZ B;  3NIA A;  3E4P A;  5M18 A;  2Y79 A;  4IUH A;  1W8Y A;  4Q0H A;  3TSG A;  2VEA A;  2J7V A;  5IHV A;  5TBM A;  3B42 A;  2I72 A;  5HWW A;  4E3K A;  3RJU A;  3D3O A;  1NLZ A;  1GHM A;  3KSI A;  4X53 A;  4XT2 B;  4FH4 A;  2Y55 A;  5AQB A;  3O88 A;  3BQ8 A;  4NG2 A;  2Z2L B;  4M3K A;  2Z6D A;  2ZC3 B;  1ZHH B;  4EWF A;  4CLC D;  4U0T A;  4JF6 A;  5TR7 A;  1JWZ A;  3BY9 A;  3LI9 A;  1DY6 A;  3MBZ A;  1UWP X;  1FCO A;  1ACF A;  1SKF A;  1ZG4 A;  3C7V A;  5CHU A;  3L9K A;  1XPB A;  3QP5 A;  1T1B A;  3S4X A;  3UY6 A;  1YQS A;  3G6O A;  4ARZ A;  5FAS A;  5CXW A;  4ZJ1 A;  4KUO A;  2M1C A;  2OSU A;  2VKS A;  3FPV A;  4KQO A;  5EUA A;  1G6A A;  3VOY A;  5KMW A;  1GSW A;  4S2I A;  5CX7 A;  3OPH A;  5CGX A;  1OTB A;  3D72 A;  2JN7 A;  5L8M A;  4CQH A;  1PNE A;  5KZH A;  2JKT I;  4H6J B;  3VSK A;  3O3V A;  1VET B;  1BLP A;  1CI9 A;  5D3O A;  4MEZ A;  5F69 A;  2V1A A;  4DF6 A;  3ITB A;  1PWD A;  4KZ3 A;  4DE2 A;  2PYR A;  3ZNT A;  3V3R A;  2WZZ A;  3KYQ A;  2GNX A;  4ZDX A;  3IXD A;  1K57 C;  5G4Y A;  3RXX A;  4PAU A;  2G2U A;  5DVA A;  5AJG A;  4KQD A;  1BTL A;  4D2O A;  3VSL A;  3MKE A;  3MXQ A;  1XJ4 A;  1JWV A;  5F82 A;  3LID A;  4G3W A;  4WLA A;  1EWZ A;  2C5W B;  5EOE A;  1FCM A;  2Y2K A;  1XP4 A;  3CUE C;  1J9M A;  2PD8 A;  1Y28 A;  2E8I A;  3PAG A;  3V5M A;  1P0Z A;  4IVI A;  4JLF A;  4LGW A;  4NXG A;  5E2H A;  3FV7 A;  2Y2P A;  3M6B A;  3Q7V A;  5J3W A;  3Q7Z A;  4WN5 A;  4ZJ3 A;  2NUP C;  5LBR A;  5A92 A;  2Y2L A;  1ERQ A;  1IYP A;  4NXF A;  3ZHH A;  3Q7V B;  1N9O A;  3HUN A;  4GHI A;  5JYO A;  2PR6 A;  2HDS A;  3MZE A;  5F83 A;  2HP5 A;  5HAQ A;  4GB7 A;  4UEY A;  1VQQ A;  1BLH A;  2JBF A;  5EV0 A;  5CHJ A;  3WS2 A;  1LI0 A;  4DRT A;  2Y2I A;  1H8Y A;  4I3I A;  1MZU A;  2J3T C;  3RH8 B;  3MZF A;  4BL3 A;  3ITA A;  1PI4 A;  3V3S A;  2HZ5 A;  2H0Y A;  2PDR A;  3R4K A;  1T1C A;  5DJU A;  3BYD A;  3PBR A;  3OPP A;  4UA7 A;  4DMZ A;  4F3L B;  5M1A A;  1NZU A;  2PBY A;  1DP9 A;  3A3J A;  3NOU C;  2WKQ A;  2GX5 A;  3NOT C;  4FCF A;  4MCW A;  1Z09 A;  1SKO A;  1HVB A;  4GHI B;  1BZA A;  1YLW A;  3FYZ A;  1BUL A;  5HW3 A;  3HRE A;  4GJ4 A;  3MXS A;  2ZC6 B;  4KZ7 A;  2Q9M A;  1UWN X;  5FI6 A;  1S1Z A;  4LRY C;  2WGI A;  2X01 A;  5AVF A;  1E3U D;  3G31 A;  1D7E A;  4LV3 A;  2ZQC A;  1GSV A;  1YPR A;  2A24 A;  4WYY A;  3V50 A;  1WYC A;  4L9E A;  1TDG A;  5EM0 A;  5DTS A;  4X1L A;  2ZBB A;  4I5S A;  4UA6 A;  1K54 C;  2WYX A;  2W0N A;  4FTX A;  5FDH A;  1M40 A;  3GMW A;  3PBT A;  2Y59 A;  3HBR A;  1IYS A;  2DNS A;  4EQ1 A;  1K38 A;  4Y0U A;  1G68 A;  3LIC A;  3UDI A;  1VHM A;  4E04 A;  4HBT A;  4JXW A;  2WKP A;  3HL9 A;  2JKT M;  3H82 A;  3KYZ A;  3HLG A;  4QHC A;  1ERM A;  3UB5 P;  4WF0 A;  4MN6 A;  4N1X A;  4R38 A;  1F98 A;  5CGW A;  5FQQ A;  1NLY A;  3T1R A;  2R9W A;  2VJW A;  5HFO A;  4LPZ A;  5HPI A;  3IQA A;  3QNB A;  5J7E A;  1N9B A;  4FSF A;  1T18 A;  2I9V A;  3CIT A;  2XRO A;  2HF6 A;  5I94 A;  2A2L A;  1I2S A;  3C7U A;  1AWI A;  4R6L A;  1BLC A;  4HHD A;  4KZ8 A;  4WZ4 A;  1ODV A;  1LSV A;  3Q1F A;  2LB5 A;  4XUZ A;  5AVE A;  1F9I A;  5E2F A;  2CC1 A;  5EVI B;  4MBH A;  3S1Y A;  2GZA A;  3TRC A;  1ESU A;  1KGG A;  3RFB A;  1GA9 A;  4LEN A;  3LR3 A;  3WS4 A;  4HEF A;  2FZ0 A;  1MXO A;  3KSF A;  1ZG6 A;  4KG2 A;  3IHB A;  2ZQA A;  4GCZ A;  3AGF A;  4WMC A;  5HDS A;  3G32 A;  2MJ6 A;  1J3W A;  4BMW A;  2GDN A;  1XJ6 A;  3NEC A;  4N9K A;  3RXW A;  4CPK A;  4Y7P A;  3CAX A;  3CJM A;  4B93 A;  3G34 A;  4IED A;  1CEF A;  1YKD A;  3LR5 A;  1LI9 A;  4D60 A;  3G2Z A;  3H7W A;  1XA1 A;  4L9F A;  3T4J A;  2NUT C;  1N9N A;  1GSX A;  1E25 A;  2B02 A;  3D4F A;  3H9W A;  5L07 A;  1DJB A;  3PBS A;  2ZQ9 A;  5J4E A;  1V9Y A;  3IWI A;  1SDE A;  3TOI A;  1SKO B;  1LLB A;  4RQ9 A;  2XEP A;  4BEN A;  3G4P A;  1YLT A;  2VK3 A;  2XFS A;  5CER A;  1PI5 A;  4UQI S;  5DF7 A;  3W2Z A;  2R78 A;  2JC7 A;  1BUE A;  5BOH A;  3SS3 A;  3ULF A;  3N8R A;  2ZMA A;  5IU1 A;  3BLS A;  2W3G A;  4BBU A;  1P97 A;  5HDC A;  2M7U A;  3LFV A;  3BEB A;  5FA7 A;  4C6Y A;  4G3V A;  2KOI A;  4H8R A;  1XGI A;  2RCX A;  3QP6 A;  1W7F A;  1W63 Q;  2JHE A;  1N4O A;  4QY5 A;  1ALQ A;  3OBF A;  2OAP 1;  3GV9 A;  1OME A;  3SOI A;  4E3I A;  4GD8 A;  2Y2M A;  4JGR A;  5HAP A;  1IEL A;  4UAA A;  4P6Z M;  4Y0O A;  3W4O A;  5FL3 A;  1LSX A;  1PZO A;  1K6S A;  3GTC A;  1OTE A;  1K56 A;  1PFL A;  4N9L A;  3FWL A;  4R4S A;  5FQM A;  2XRN A;  3ISG A;  3IS2 B;  2XSS A;  1KDW A;  5EOO A;  3GSG A;  4OQ0 A;  4HH3 A;  4MBK A;  1PWC A;  3BJN A;  2Y2O A;  4GNU A;  3ZVW A;  2PAV P;  1LHY A;  3O5Y A;  3QHY A;  4K0W A;  3IWQ A;  5FAP A;  3DWZ A;  1H8M A;  5F1G A;  1YSP A;  4KEN B;  2QYB A;  3BLM A;  4ZRR A;  5GHX A;  2ZC5 B;  2HDR A;  5HD3 A;  5EVI A;  3T4O A;  1ZC2 A;  4WEL A;  5AQ9 A;  3HCY A;  3QNC A;  4OPQ A;  3AGD A;  4JF5 A;  3R7W A;  3MQ0 A;  2ZC7 A;  2HP6 A;  2H28 A;  1XA7 A;  5AQ7 A;  1TF1 A;  1PZP A;  3RTY A;  4L0L A;  2ZMV A;  2BTF P;  4EBL A;  3B33 A;  3NDG A;  1NZO A;  2W1T B;  3OZH A;  2OOL A;  3F1O A;  3LEZ A;  1NJ4 A;  1YLZ A;  3V67 A;  2ZL1 A;  3MZD A;  1OTI A;  1DJA A;  4FD8 A;  4XT2 A;  4DN0 A;  1E4D A;  3PYP A;  1K6R A;  1RCJ A;  1A0K A;  2P9V A;  3K3D A;  3E4Q A;  4QU3 A;  3BRM A;  3UB8 A;  4DJ2 A;  4KZ6 A;  5HD5 A;  4NK3 A;  4JBF A;  2OAQ 1;  2Y8H A;  4IVK A;  2Y2H A;  1K4E A;  4OLD A;  4K0X A;  2Q0O A;  3HUO A;  3VOZ A;  2PD7 A;  2VGK A;  3SH7 A;  2WAE A;  5KIZ A;  1K55 C;  1NWZ A;  3BFC A;  2OWH A;  3ZNY A;  3NDE A;  4HY8 A;  4L9G A;  5FI2 A;  3HLC A;  3NJA A;  3FKW A;  3IHA A;  2WK0 A;  5HX9 A;  3LY3 A;  4FH2 A;  2QHK A;  1MWT A;  1TEM A;  5F1F A;  4P85 A;  4EQI A;  4DE0 A;  5KSC A;  1XGJ A;  3EGD C;  5HPF A;  4GOG A;  4CLC A;  1L0E A;  3LIA A;  5FEF A;  3LR4 A;  3D9Y A;  3S7Q A;  3W4P A;  2D02 A;  2EWV A;  2ACG A;  1KGF A;  4OPZ A;  4DXB A;  3IF5 A;  3F1O B;  4HH2 A;  2V1Z A;  4X68 A;  4CLC C;  4HJ3 A;  5G4Z A;  1YLP A;  1SCW A;  1N9L A;  3V39 A;  5DFX A;  4Y0T A;  3HJI A;  3BFE A;  2GJ3 A;  4PPR A;  2WGV A;  2WGW A;  3SS5 A;  1O07 A;  1K55 A;  2VLG A;  5F6A A;  3N4I A;  1TS7 A;  2P7J A;  5IS1 A;  4EBN A;  4PM9 A;  5F68 A;  3LI8 A;  4OQH A;  3CZD A;  1O7E A;  3VFH A;  4O8G A;  3DTE A;  1BT5 A;  3GEC A;  5EFW A;  3UE1 A;  2EX6 A;  2K7S A;  3QP4 A;  4DE3 A;  1G5U A;  1S67 L;  3UN7 A;  4CJN A;  2JCH A;  1K56 D;  2ZOI A;  2Y2G A;  2PRF A;  4I3A A;  4PKY G;  4WMC D;  2ZD8 A;  1EI5 A;  2JKF A;  1XX2 A;  4UHU A;  1W5D A;  1Z6F A;  3T50 A;  1PWG A;  4EEP A;  3F1P A;  3NOP C;  2WGW B;  1ES4 A;  2VZW A;  4HOI A;  3KX0 X;  1WA9 A;  4BJP A;  5EVI C;  5FQI A;  3IXG A;  3LIE A;  1KOU A;  1XXM A;  1MY8 A;  2D01 A;  1K57 A;  3EEA A;  1CJF A;  1CI8 A;  2YKH A;  1ESI A;  4PM8 A;  4NEE D;  1IYQ A;  5HL1 A;  1MC0 A;  2IWD A;  1P9R A;  2DRW A;  1G28 A;  3PBO A;  4HIA A;  3UDF A;  1YM1 A;  4KUK A;  2XDM A;  5CRF A;  3SZT A;  4QWO A;  3A3E A;  3MS6 A;  1L3L A;  1BLS A;  3W8K A;  1ES5 A;  3NHQ A;  4LV1 A;  4YNR A;  2HJ9 C;  3P98 A;  2B95 A;  1D1J A;  1RP5 A;  2OWJ A;  2EX2 A;  4R1G A;  1C3B A;  3U4L P;  1AXB A;  2QJ5 A;  3DBA A;  4UA9 A;  3EOI A;  4I3J A;  1H0M A;  1S6R A;  1T19 A;  3CPT B;  5TBM B;  1DRM A;  3IS2 A;  3S7N A;  3UO9 A;  2XA7 M;  4E3J A;  1BSG A;  3CI6 A;  3MSH A;  4MMN A;  3PHY A;  5HAR A;  4Z9Q A;  3F1N A;  2INW A;  3F1P B;  4S2P A;  4GDN A;  5DTT A;  2IWB A;  2AVX A;  1W79 A;  4P6Z S;  3SH8 A;  3IH8 A;  1LT0 A;  1NYM A;  4MN5 A;  1JWP A;  4EW7 A;  1DP6 A;  2HDU A;  3G2Y A;  2PU4 A;  1NYY A;  4LFU A;  3HLD A;  3TW8 A;  4ME4 A;  2OLV A;  4RX3 A;  3Q81 A;  2XF3 A;  4EU0 A;  3P01 A;  1KDS A;  2A49 A;  4KQR A;  3CUE A;  4KZB A;  1PW8 A;  5GHZ A;  5E2G A;  3G35 A;  3BW6 A;  4OOM A;  3A3F A;  2V8C A;  3MKF A;  1QMF A;  2XK1 A;  3I7J A;  4JGP A;  1KE4 A;  3PAE A;  1K25 A;  3C30 A;  3S22 A;  2G7U A;  2G2W A;  5A93 A;  1MKI A;  3BFG A;  3VE3 A;  3NCK A;  5EEC A;  3ZGA B;  4ZAM A;  2HP9 A;  1FQG A;  4S2J A;  1KVL A;  3EEH A;  4IJG A;  4PM7 A;  1IEM A;  4OQG A;  4Q0I A;  2WKE A;  3IWO A;  1RGZ A;  4P0M A;  3DAV A;  3C2W A;  4ZJ2 A;  4LCM A;  4BQM A;  4EBP A;  3DTK A;  4Y2F A;  4JGO A;  4HNB A;  1MPL A;  4EXO A;  1I5Q A;  1OJ5 A;  2KLI A;  4GS9 A;  1TS0 A;  2W3H A;  1FIL A;  3WRT A;  2WAF A;  3LIF A;  5FQ9 A;  3MQO A;  5TFQ A;  5DKL A;  4N1H A;  1LL8 A;  1IYO A;  1PRQ A;  4WUJ A;  3FC7 A;  1LL9 A;  2XFT A;  4PM5 A;  1DJC A;  2PT7 A;  3HLB A;  5CGS A;  2FFY A;  1CQA A;  2A24 B;  5GL9 A;  5F5Y A;  4WEJ A;  4Q8I A;  2E8J A;  2EWW A;  1MKM A;  4OLG A;  5EVE A;  4HP9 A;  4ESP A;  4O0P A;  3MFD A;  2XA7 S;  1EW0 A;  2QMI A;  3HLE A;  4KZA A;  1FR1 A;  4OPY A;  2P9V B;  2WKR A;  4Z1W A;  2EFU A;  3BFD A;  4ETX A;  4I39 A;  5GLC A;  2O9B A;  2QJ7 A;  3T1S A;  4PKY A;  3WS1 A;  1K54 A;  3WS0 A;  3UB9 A;  2M7V A;  2Y2N A;  4LCL A;  5DF9 A;  3ZG5 A;  1YMS A;  5L10 A;  3VMA A;  3C4P A;  5CEC A;  1GCE A;  1YLJ A;  4IBR A;  4OKP A;  4OVD A;  2V9A A;  1VB6 A;  2V8F A;  2XGN A;  3GRJ A;  3WWX A;  3R7W B;  4QB8 A;  4U3T A;  3S7O A;  2UV0 E;  1MWU A;  3QP2 A;  2QZ6 A;  3LIB A;  5TJJ A;  3GQZ A;  2HV1 A;  3DTM A;  4GLQ A;  3PBN A;  1FOF A;  3UE3 A;  4OOL A;  2B18 A;  4I38 A;  4EV4 A;  4OP8 A;  4DE1 A;  4WBG A;  1YLY A;  4ZBE A;  1L0F A;  1OT9 A;  5U47 A;  3LGO A;  4CLC E;  4EES A;  2L4R A;  5HDD A;  3LR0 A;  3UB7 A;  5FEG A;  5HAI A;  2L1M A;  1OJG A;  1TS8 A;  3OPL A;  2BG1 A;  1NRF A;  1VET A;  4YFM A;  4BD1 A;  2RL3 A;  2ZQ7 A;  5FQK A;  3DWK A;  3LEQ A;  1H3Q A;  5GLB A;  2PHY A;  3NBL A;  2V2F F;  3H82 B;  3T1Q B;  4R4R A;  2ZM2 A;  1FSY A;  1TVF A;  5CTN A;  1HZO A;  1G6O A;  1XJ2 A;  2O9A A;  2HGV A;  4K91 A;  3L7H A;  5GLD A;  3C5A A;  4KZ5 A;  5HL6 A;  3FZC A;  5FQJ A;  2J8Y A;  1Q2P A;  1CF0 A;  5EVI D;  2EXA A;  3T4L A;  1H5X A;  1WYB A;  5MC7 A;  3EQU A;  4GW9 A;  4Y13 A;  2ZQ8 A;  2W3D A;  1KE0 A;  3KSH A;  5DKK A;  1V9Z A;  3JVU A;  5G18 A;  3C8C A;  3EQV A;  4OP5 A;  4QD4 A;  5FDS A;  4WZ5 A;  4HP4 A;  4S2N A;  5GHY A;  5FAO A;  3P09 A;  4WM9 A;  4S2N C;  4OH0 A;  1VEU B;  3VV4 A;  2WUQ A;  2YKF A;  4FOF A;  4GDB A;  2W3E A;  2H5S A;  3M2J A;  3JPU A;  4MBF A;  5IT5 A;  2K31 A;  3IH9 A;  5FI7 A;  3OCN A;  5A8B A;  3IXB A;  4G3K A;  4S2K A;  5HSQ A;  1ES2 A;  4YWZ A;  4O7D A;  3E4O A;  3A0S A;  1XFN A;  2V0W A;  4OPR A;  2CMN A;  3VOL A;  5CED A;  4GZB A;  1L2S A;  3HJK A;  3NUL A;  3ZCZ A;  4R3J A;  5GLA A;  2KDK A;  4B4Z A;  2UWX A;  3FKV A;  4S2O A;  3VP3 A;  3WS5 A;  4EUZ A;  2V1B A;  2VV7 A;  3MQQ A;  4OQI A;  1L0G A;  2Z2M B;  5JYP A;  1D06 A;  2P08 A;  3MFX A;  3MR0 A;  3OOV A;  3CHW P;  5HWT A;  2X02 A;  2Q9N A;  1HLU P;  3OPR A;  1Q2Q A;  2ZM8 A;  2WZX A;  5A90 A;  2VGJ A;  1JVJ A;  1Y54 A;  2P74 A;  4GS9 B;  1SHV A;  4HQA A;  2VV8 A;  4GN2 A;  2Y91 A;  1VEU A;  4EEU A;  1OTD A;  4X6T A;  3Q07 A;  1IOU A;  5L2F A;  2W1R A;  1XKZ A;  5CTM A;  2EX9 A;  1CK3 A;  4XXR A;  1I2W A;  2ZOH A;  3A0R A;  3UMD A;  2PU2 A;  3HVF A;  4NET A;  3PR6 A;  4X25 A;  3FG8 A;  5EE8 A;  3IT9 A;  3IX3 A;  3U2A A;  3K3C A;  4R3A A;  4ZTK A;  4LRZ E;  4X1M A;  1PIO A;  3T4T A;  4JXS A;  4EER A;  4KZ4 A;  3DW0 A;  3UDX A;  4R70 A;  4R23 A;  2ZQD A;  1ZTU A;  3LYX A;  3ZVT A;  2OV5 A;  3SW1 A; 
#chains in the Genus database with same CATH homology
 2Z6C A;  4OOM A;  3W2Z A;  2R78 A;  3E4P A;  2Y79 A;  4IUH A;  4Q0H A;  4JGP A;  2VEA A;  2V0U A;  3ULF A;  3C30 A;  5TBM A;  3B42 A;  2G7U A;  5IU1 A;  2W3G A;  4BBU A;  5HWW A;  1P97 A;  5HDC A;  2M7U A;  3LFV A;  3KSG A;  3UE6 A;  3D3O A;  2PYP A;  4Q0J A;  2IA2 A;  3VE3 A;  1NLZ A;  4EUV A;  3KSI A;  4G3V A;  3A0V A;  4XT2 B;  2KOI A;  3BQ8 A;  2BAS A;  3EEH A;  4IJG A;  1W63 Q;  2JHE A;  4Q0I A;  2VA0 A;  2Z6D A;  5I5L A;  1ZHH B;  4CLC D;  3OBF A;  4M4X A;  4AFI A;  2OAP 1;  3C2W A;  3BY9 A;  3LI9 A;  4UQI M;  4JGR A;  4PHT A;  4Y2F A;  2LB9 A;  1UWP X;  4P6Z M;  4JGO A;  4HNB A;  5FL3 A;  1LSX A;  4EXO A;  1OJ5 A;  1T1B A;  2KLI A;  3CLO A;  4GS9 A;  5DJT A;  1TS0 A;  1OTE A;  1TS6 A;  4ARZ B;  2W3H A;  2O0Y A;  3G6O A;  4ARZ A;  3BQA A;  4KUO A;  2M1C A;  2XRN A;  3C38 A;  2VKS A;  3IS2 B;  3LIF A;  4HJ4 A;  2XSS A;  3MQO A;  3FPV A;  5DKL A;  4HH3 A;  1LL8 A;  4KQO A;  3BJN A;  4WUJ A;  2W27 A;  1GSW A;  3FC7 A;  3MMH A;  3IBR A;  5CX7 A;  2PT7 A;  3CWF A;  3O5Y A;  4WEK A;  3S7P A;  1OTB A;  3D72 A;  2JN7 A;  5L8M A;  4CQH A;  4Y5F A;  2JKT I;  2A24 B;  1H8M A;  5F5Y A;  4WEJ A;  3E0Y A;  4H6J B;  1YSP A;  2EWW A;  1MKM A;  2QYB A;  4HP9 A;  4HI4 A;  4ZRR A;  4O0P A;  5HD3 A;  4DJ3 A;  2DMW A;  3T4O A;  1JNU A;  4WEL A;  2XA7 S;  4NKP A;  1EW0 A;  5F69 A;  3HCY A;  3K2N A;  2L0W A;  2V1A A;  3R7W A;  3MQ0 A;  2WKR A;  4Z1W A;  2H28 A;  1TF1 A;  2PYR A;  4ETX A;  2O9C A;  3RTY A;  4L0L A;  2ZMV A;  4I39 A;  2O9B A;  2GNX A;  3KYQ A;  3B33 A;  2QJ7 A;  2W1T B;  2OOL A;  3F1O A;  5G4Y A;  4PKY A;  4PAU A;  3UB9 A;  2M7V A;  5DF9 A;  5AJG A;  4KQD A;  3JVV A;  3V67 A;  2J3T D;  3MXQ A;  1OTI A;  1XJ4 A;  2V9A A;  4DN0 A;  4XT2 A;  3PYP A;  3LID A;  1VB6 A;  4QPR A;  3T4S A;  4CLC B;  4G3W A;  3R7W B;  4IHQ A;  4MN7 A;  4WLA A;  3K3D A;  4O01 A;  3E4Q A;  3UB8 A;  4DJ2 A;  5HD5 A;  4BWI A;  3S7O A;  3CUE C;  2PD8 A;  1Y28 A;  3P7N A;  1OPX A;  2OAQ 1;  4ETZ A;  2Y8H A;  1P0Z A;  3F1N B;  3LIB A;  4NXG A;  1S1Y A;  5TJJ A;  2HV1 A;  4GLQ A;  2KX6 A;  3PBN A;  2PD7 A;  5J3W A;  3UE3 A;  5KIZ A;  4OOL A;  4B9O A;  4WN5 A;  2B18 A;  5DFY A;  4Y3I A;  5LBR A;  2NUP C;  1NWZ A;  2OWH A;  4I38 A;  4HY8 A;  3MF0 A;  3PXP A;  4NXF A;  4L9G A;  3E98 A;  3PBQ A;  1OT9 A;  4CLC E;  3NJA A;  4EES A;  2L4R A;  1N9O A;  2P04 A;  4GHI A;  5HDD A;  3LR0 A;  2EA9 A;  2PR6 A;  4NXB A;  5HWV A;  3UB7 A;  3GDI A;  1TD5 A;  2L1M A;  1OJG A;  1OTA A;  3TJZ C;  2QHK A;  1TS8 A;  4UEY A;  3H7W B;  3EGD C;  3MJQ A;  1H3Q A;  5HPF A;  2PHY A;  4CLC A;  2W3F A;  3LIA A;  3H82 B;  4I3I A;  1MZU A;  2J3T C;  4BBT A;  3RH8 B;  3LR4 A;  3S7Q A;  5HZH A;  2D02 A;  1X0O A;  2PDR A;  3R4K A;  4YOF A;  1T1C A;  5DJU A;  1G6O A;  2EWV A;  2HJE A;  3UME A;  2PR5 A;  1XJ2 A;  3PBR A;  2O9A A;  3F1O B;  4HH2 A;  2HGV A;  5C5K A;  4DMZ A;  4F3L B;  4CLC C;  5HL6 A;  4HJ3 A;  5G4Z A;  1N9L A;  3ZQ5 A;  4LLO B;  5DFX A;  3HJI A;  1DP9 A;  2GJ3 A;  4WL9 A;  3NOU C;  2WKQ A;  2GX5 A;  2JKR M;  3NOT C;  2VLG A;  3EWK A;  3T4L A;  3IBJ A;  4MCW A;  5F6A A;  2VX8 A;  1TS7 A;  2P7J A;  5MC7 A;  3EQU A;  5IS1 A;  4GW9 A;  4GHI B;  1F5M A;  2W3D A;  3LI8 A;  3KSH A;  5F68 A;  1NRJ A;  3OCL A;  5DKK A;  4GJ4 A;  4O8G A;  1V9Z A;  3JVU A;  3C8C A;  3GEC A;  3T4K A;  1UWN X;  5EFW A;  3EQV A;  1S1Z A;  4NXE A;  4LRY C;  4F3L A;  2K2N A;  1DP8 A;  2K7S A;  3OC2 A;  5AVF A;  4HP4 A;  1D7E A;  3ICY A;  2J80 A;  1GSV A;  1S67 L;  2A24 A;  3KO6 A;  4BBV A;  1P9W A;  3TE8 A;  1XJ3 A;  4L9E A;  2ZOI A;  4K08 A;  2ZMF A;  3VV4 A;  4I3A A;  4PKY G;  2ZBB A;  4I5S A;  2YKF A;  4FOF A;  2W3E A;  3B47 A;  3T50 A;  2VGL S;  2W0N A;  4EEP A;  3F1P A;  3NOP C;  3PBT A;  3FPW A;  5IT5 A;  2K31 A;  4EQ1 A;  2VZW A;  4HOI A;  3OCN A;  3OLO A;  1W63 M;  2W1T A;  3KX0 X;  3LIC A;  1WA9 A;  5A8B A;  4G3K A;  1VHM A;  4E04 A;  5HSQ A;  4YWZ A;  2WKP A;  2JKT M;  3E4O A;  4BJP A;  3H82 A;  3KYZ A;  3A0S A;  3LIE A;  1STZ A;  1KOU A;  2D01 A;  4WF0 A;  1XFN A;  2V0W A;  4MN6 A;  1S4R A;  2CMN A;  3VOL A;  3EEA A;  3ZYT A;  4R38 A;  1F98 A;  3HJK A;  1NLY A;  2YKH A;  2VJW A;  1YSQ A;  4LPZ A;  5HPI A;  5J7E A;  4NEE D;  4FSF A;  1MC0 A;  1T18 A;  1P9R A;  1G28 A;  2I9V A;  2KDK A;  3CIT A;  3PBO A;  4HIA A;  2XRO A;  2HF6 A;  2A2L A;  4KUK A;  4R6L A;  3BWL A;  2V1B A;  2VV7 A;  4MDZ A;  3MQQ A;  4HHD A;  5KSH A;  4JGQ A;  1ODV A;  1S66 L;  1LSV A;  2LB5 A;  5AVE A;  1F9I A;  1D06 A;  3NHQ A;  4YNR A;  2P08 A;  2HJ9 C;  3MFX A;  3MR0 A;  1UGU A;  2GZA A;  1LSW A;  4LRX C;  3TRC A;  3OOV A;  2OWJ A;  5HWT A;  2QWS A;  3RFB A;  2FH5 A;  4II7 A;  3LR3 A;  2QJ5 A;  3DBA A;  2JKR I;  2FZ0 A;  3EGX C;  4GS9 B;  3EOI A;  4I3J A;  3KSF A;  4HQA A;  2VGL M;  1T19 A;  2VV8 A;  4HJ6 A;  4GCZ A;  1BYW A;  5HDS A;  5TBM B;  1DRM A;  2MJ6 A;  4EEU A;  3IS2 A;  3S7N A;  4BMW A;  1OTD A;  1XJ6 A;  2XA7 M;  2J3W A;  3CAX A;  3CI6 A;  4B93 A;  1IOU A;  4MMN A;  2W1R A;  3PHY A;  3F1N A;  2INW A;  1YKD A;  3LR5 A;  3F1P B;  4EET B;  3H7W A;  4L9F A;  2ZOH A;  2O99 A;  4P6Z S;  3A0R A;  3T4J A;  3UMD A;  1T1A A;  1IFQ A;  1LT0 A;  3VE4 A;  4MN5 A;  4EW7 A;  1DP6 A;  2NUT C;  3PR6 A;  1N9N A;  1GSX A;  3FG8 A;  1YAX A;  1XFQ A;  2B02 A;  3TW8 A;  4ME4 A;  3H9W A;  3T4Q A;  4IUK A;  3PBS A;  3U2A A;  1S4S A;  3K3C A;  4R3A A;  4EU0 A;  4LRZ E;  5J4E A;  5K5B A;  3LUQ A;  3P01 A;  1V9Y A;  2QKP A;  3T4T A;  4EER A;  2VV6 A;  3BY8 A;  4R70 A;  3CUE A;  4RQ9 A;  1ZTU A;  3LYX A;  3UB6 A;  4H6J A;  1OT6 A;  3SW1 A;  4UQI S;  3BW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...