4CLCE

Crystal structure of ybr137w protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
172
structure length
172
Chain Sequence
MVVLDKKLLERLTSRKTPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMAVSSLIAFANESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords UPF0303 PROTEIN YBR137W
total genus 58
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcE00
4CLCA 4CLCB 4CLCC 2A2LA 4CLCE 3FPWA 4NKPA 4BMWA 5CX7A 4CLCD 3FPVA
chains in the Genus database with same CATH superfamily
2WYXA 3K2NA 4ESPA 5GHXA 2HDRA 4KZ7A 4KUKA 1XJ3A 2ZQAA 4GN2A 1HZOA 2QJ5A 2Z2MB 1NYYA 2P7JA 4FCFA 4X69A 2EWWA 4I39A 4S2NA 1ZTUA 1SDEA 4HH3A 4LENA 3JYIA 1C3BA 1YSQA 3W4QA 4E3OA 1NJ4A 2NUTC 1ESUA 5FAPA 4PM5A 4F94A 4MN6A 1PW8A 1XFQA 5CTMA 2QYBA 3KYEA 3G34A 1VHMA 3B33A 1MWRA 2IWDA 4S2MA 1W63M 5M1AA 2J9PA 2X02A 3CPTB 3MF0A 1LHYA 3CUEA 1WE4A 4EBLA 5F1FA 4LV2A 1S6RA 1LL5A 3BWLA 1W7FA 3H7WB 3BQAA 5HWWA 1YT4A 4PM7A 4OPZA 3NOUC 2JKRM 3T4KA 2FFFB 1KGFA 2X01A 2VX8A 1NRFA 4QB8A 1HD8A 3L7HA 2HPBA 2LB9A 1PWDA 3PBRA 4X68A 1MKMA 3IT9A 1P97A 2XLNA 4PKYA 4Q0IA 2XROA 2W0NA 3OPRA 4X25A 4JF6A 2IA2A 3LIEA 1JWVA 2WKQA 4I3IA 2ZL1B 4M4XA 2ZM8A 4HI4A 1BYWA 2HJEA 2VGKA 3VSKA 1TDGA 3GMWA 2UWXA 2BASA 2W3EA 2ZQDA 2QPNA 3ZVTA 1TVFA 1E4DA 2FZ0A 3LEZA 1ZG4A 5HFOA 3BYDA 3CZDA 1YPRA 1JNUA 1ZHHB 4X56A 2PHYA 4UEYA 3TG9A 4MBFA 5F83A 3BEBA 3Q7VA 5GHZA 1TDLA 5M18A 1H8ZA 1LT0A 3RXWA 3G30A 1YSPA 2QJ7A 4BBTA 3GTCA 4Z9QA 4HHDA 4C6YA 3MZEA 1Z09A 4KG2A 3VSLA 4ZTKA 1IYSA 3MKEA 1YLYA 4DDSA 2HZ5A 5HDCA 2Y2KA 1DY6A 1O7EA 3OPPA 1GHPA 2QZ6A 1BLSA 3OC2A 4NEED 4LRXC 1A0KA 5E2GA 2G2WA 2ZQ7A 2Y2GA 4Y5FA 2IWBA 4UHUA 1W8QA 2WZZA 4DXCA 1P0ZA 4KZ6A 5U47A 1DJBA 1I5QA 1VEUA 3NOTC 4R70A 3UMDA 4EV4A 3QHYA 4G3WA 1K57A 4FH4A 3DW0A 4E6WA 1KVLA 1NZUA 5CHMA 1NLZA 3NBLA 2PRFA 3FC7A 3T1RA 4RVAA 3IX8A 3OPLA 2WKHA 3V50A 3BFEA 3VP3A 1CI8A 5CEDA 4OH0A 1IELA 2L4RA 5CHJA 3C7UA 1S66L 3D3OA 1NYMA 4BD0A 5AVEA 3FKWA 2XH9A 2J3WA 4I38A 1YLTA 3O86A 4HESA 5HWVA 1KE4A 3TOIA 4BMWA 4UQIS 5EUAA 3IF6C 2GJ3A 5L8MA 1DRMA 1E25A 1LSVA 3Q81A 3MS6A 3A0VA 2Y8HA 2HJ9C 5DJTA 3OPHA 5DFXA 2VGJA 2Y2MA 4KZ8A 2XF3A 5CXWA 3P01A 4FH2A 4IBXA 1MPLA 1EI5A 3Q7ZA 5CEBA 4HBTA 1FQGA 4GJ4A 2OWJA 3S7NA 1L0DA 2OOLA 4ZAMA 2ZOHA 3S7PA 1PZPA 4S2KA 2G2UA 1PNEA 1NXYA 3BFGA 3SS3A 1BT5A 3UE6A 3HLBA 4BWIA 3B3XA 4PM8A 1FCOA 5EM1A 2KX6A 3WS4A 3BJNA 3LR4A 3LCEA 4U3TA 3QP2A 4WBGA 2W3GA 4P0MA 5IU1A 4PKYG 4P6ZM 2H10A 4HP9A 3D72A 5FAQA 3T1SA 5F68A 1HLUP 2XQZA 5AQAA 2OAP1 3GDIA 4UQIM 3T4QA 3QP6A 2KDKA 1IYPA 3C4PA 5A8BA 5FI2A 3FG8A 3CHWP 4PHTA 2Y2NA 2XA7M 2M1CA 3QP5A 1OJGA 4IVIA 2A49A 2L1MA 5L09A 3KSIA 4OVDA 3HLFA 2RCXA 1BLPA 1YLWA 4I3AA 3VE3A 4GS9A 1NY0A 4C3QA 4IBRA 5GL9A 2VJWA 4O7DA 2V1AA 2Y55A 3HL9A 3WRTA 3MXQA 4HJ3A 1BULA 1CEFA 1MZUA 1V9ZA 3OOVA 2W1TB 5FQJA 1STZA 2A24A 2D02A 2YKFA 1G68A 3NIAA 3KSFA 2WAFA 1XJ2A 3UB8A 4E04A 3G2ZA 5CRFA 4S2IA 3LGOA 3SZTA 4OONA 4NXFA 2ZBBA 3MFXA 4FOFA 3C4OA 2ZL1A 3LEQA 2HDQA 2A3UA 2M7UA 4LPZA 4YFMA 3T4TA 4LRZE 3PXPA 3S1YA 1G5UA 4PMAA 4Y15A 2VGLS 4RX3A 3G32A 3R7WB 4XUZA 4EETB 4L9GA 2ZC7A 4FD8A 3NECA 4YOFA 1ACFA 2V0UA 4K08A 4DF6A 3EGDC 3ZYTA 1IYOA 2ZMAA 2P74A 4E3JA 5EV0A 1PWGA 3TE8A 1KDSA 1K54C 2ZC6B 4LCMA 2WKEA 5EVIB 1OPXA 2C6WB 2GZAA 2PR6A 3C7VA 2DRWA 1K55A 2WAEA 3ZVWA 3BECA 1FSYA 2YKHA 4O01A 1HTZA 3VP4A 3S4XA 5DJUA 1L0FA 1YLJA 5KIZA 1D06A 3R4KA 2V8CA 2AVXA 1XXMA 3CJMA 5E2HA 1M6KA 1W79A 4LV3A 1ERQA 2ZC4B 3UE1A 4Y13A 2E8IA 4G3KA 3O87A 4GHIB 2JBFA 2O99A 4I5SA 3HUOA 4N92A 2MJ6A 1ES5A 1IEMA 1RCJA 3WWXA 3A3IA 2W3DA 3LIDA 4OP8A 5M19A 2ZQ8A 1UWNX 4KUOA 1K54A 4EUZA 1Q2QA 3T4SA 4WUJA 4CLCE 1EWZA 3LR0A 3CMZA 2B5RA 5TBMA 4EESA 1XA1A 2OSUA 4R23A 3IXGA 3E98A 4LV1A 4E3LA 5HD5A 1DP9A 4GNUA 4WZ5C 4KQDA 1FR6A 5EVID 4K0WA 1MKIA 1W63Q 4WYYA 3DBAA 4WM9A 2EX9A 4MMNA 3ZG8B 3EQUA 3LIBA 2PT7A 3S22A 5KMWA 2CC1A 3QP1A 1PZOA 1ONHA 4H6JA 5J8XA 4R4RA 4MBKA 5FAOA 3Q82A 3PAGA 1FILA 5G18A 5IT5A 5CGXA 4EBPA 1LI0A 2Z6CA 4GOGA 3UB6A 2H5SA 2OLUA 2WZXA 5AQ9A 4ZRRA 2JKFA 5I94A 3OCNA 2HGVA 4OPRA 5DKKA 5EVIA 2VK3A 3I7JA 1W5DA 4HQAA 4RA7A 5FA7A 1E3UD 4HY8A 3ITBA 2ZOIA 3A0RA 2H28A 3DTIA 3A3JA 5E2EA 2P9VA 4HBUA 3UNWA 2WADA 1D7EA 3IWIA 3T50A 1UGUA 3BW6A 3IBJA 2R78A 5HWTA 1KE0A 4BL3A 4Y2FA 3RH8B 5IS1A 1SKOB 1K4FA 3AGDA 4GD6A 3PHYA 3SS5A 1OTIA 1KOUA 1Z6FA 3JVVA 3EQVA 3F1OB 4JGRA 4UA6A 4JXWA 3BFDA 4JF5A 3HLGA 3UDIA 5K5BA 4Q0JA 3F1PA 3NULA 1MY8A 1VM1A 4GDBA 5HARA 1GSVA 5CHUA 3GVBA 2W1TA 1IFQA 2Q9MA 4LFUA 1ES3A 4WMCA 4U0TA 2HF6A 4Y0OA 3V39A 3VE4A 5A90A 3V3RA 2ZD8A 4QY5A 5F5YA 1H8YA 1YM1A 3B42A 1H5XA 3PBQA 4HH2A 5CX7A 3MQOA 3B47A 2XD1A 3C2WA 3V3SA 4PM6A 3LYXA 1SKFA 3MZFA 4M3KA 4ZJ2A 4OOMA 1F5MA 3E4OA 4IHQA 1VETA 2O0YA 1K4EA 4GS9B 3UB5P 2ZMFA 4KQQA 3N4IA 5FDSA 3R7WA 5J3WA 5EFWA 1F98A 3HVFA 2ZMVA 4BENA 2Q0OA 3JPUA 4B93A 3K3DA 4PAUA 1YKDA 1K56A 1L2SA 1OT6A 4OOYA 2V9AA 2A24B 2V1ZA 4EQIA 1N4OA 5EECA 5GHYA 4NK3A 4HNBA 3IHAA 3EEAA 2VGLM 3NJAA 5FI6A 5GLBA 5FI7A 4O8GA 2JCHA 3LR3A 2VV7A 5HW3A 3L9KA 4WELA 3IXDA 2EXBA 2DNSA 2P9VB 1OMEA 5CTNA 3ITAA 4JXSA 1MXOA 4CQHA 2ZJ9A 1XA7A 2XFTA 5HDSA 3UE0A 4CPKA 4QD4A 1F2KA 2D01A 3HJKA 3C38A 3LY4A 1CJFA 4KQRA 4CLCD 3OZHA 4HP4A 3VP2A 2VZWA 2ZC3B 2HP5A 4OQHA 1FCMA 4XXRA 4L9EA 2WGIA 3F1OA 3DWZA 4OQGA 1JWZA 2ZQ9A 4Q8IA 1LSWA 3F1NA 3LIAA 3O5YA 5EM0A 4UA9A 3F1PB 3KSHA 1BUEA 3G35A 5CERA 4BBUA 5CECA 1I2WA 2J9OA 1I2SA 3BLMA 3ZNYA 2J3TC 2PAVP 4Y0TA 4EWFA 4NXGA 2P04A 3IXHA 2JKRI 4N9KA 1KE3A 5HAPA 3PTEA 3E2KA 2V1BA 2Y2QA 5TBMB 3ZFZA 4X55A 2PR5A 4QHCA 2Y2OA 4CLCA 4R3AA 2ZM0A 3SH8A 3BY8A 1ALQA 4I3JA 1T18A 5TR7A 4S2OA 5FATA 5L10A 2K7SA 1K57C 4Y3IA 4ZJ1A 4H6JB 1CK3A 2XGNA 5IHVA 3WS2A 3QNBA 2WGWA 4BD1A 2OLVA 1S67L 3MZDA 1BSGA 2M7VA 3CLOA 4DE2A 3V67A 1MWUA 3LR5A 4GHIA 4EERA 1BLCA 1CI9A 1OJ5A 1YAXA 4D60A 2VV6A 3MKFA 4ZJ3A 5HL6A 1YQSA 2G7UA 1PI4A 5AQ7A 4B88A 4OPYA 1K56D 3BM6A 3P09A 1CF0A 1MWSA 2RL3A 1PRQA 3MFDA 3UMEA 1PW1A 3IWQA 5CGWA 1FCNA 3JVUA 4YINA 2WKPA 3HJIA 1ODVA 4N9LA 4IEDA 2GNXA 4B4XA 3PYPA 3TRCA 4MCWA 5DF9A 1H3QA 1ES4A 3IH8A 4GD8A 3E4PA 1WYCA 4IUHA 3ZG9B 4P6ZS 3NDGA 3HLDA 2QMIA 3FYZA 2NUPC 4L0LA 1TF1A 4BBVA 3IWOA 1OTDA 1GA0A 3FPWA 1VQQA 3M2KA 3HLWA 2FFYA 4LCLA 1Y28A 5F6AA 4S2PA 1LL8A 3VOZA 1T1AA 1NRJA 2PU4A 3FV7A 2VA0A 1QMFA 2XEPA 2XFSA 1HVBA 1KDWA 4ETZA 4P6BA 2HP9A 3VV4A 5L2FA 1LL9A 3GR2A 3P98A 1PWCA 5KSCA 1SKOA 4OLDA 2VV8A 2HDUA 1Y54A 5E2FA 1S4SA 3LICA 1NZOA 1E3UA 2BG1A 2PBDP 2V8FA 2EA9A 3T1XA 1EW0A 2J3TD 3H82B 4HIAA 3PBNA 2Y2PA 3TSGA 3OBFA 4EQ1A 3PAEA 1OT9A 3DAVA 4R6LA 1ESIA 2GX5A 4OOLA 4Y0UA 2W27A 1ZKJA 3BLSA 4II7A 3T12B 2Y2LA 5HAIA 1D1JA 1MC0A 3UE3A 4FSFA 4MN5A 4MBHA 3ZG7B 1WA9A 1BZAA 2V0WA 2VEAA 4E3IA 3SOIA 2HDSA 3PR6A 4DMZA 1YLZA 1U60A 2C5WB 3NY4A 5I5LA 4GLQA 5E43A 4RYEA 4G3VA 5A91A 1XGJA 1K55C 4KQOA 5L07A 3CI6A 1FR1A 5HZHA 2JKGA 2INWA 1BTLA 4OKPA 2JE5A 3DWKA 3T4OA 4JF4A 1XFNA 1RGYA 5AQBA 1DJAA 4JGPA 1G28A 2ZC5B 3NC8A 3Q1FA 4DE3A 3BY9A 5MC7A 3U4LP 1KGEA 1CQAA 4KZAA 3ZG0A 4C75A 3KX0X 1K38A 5FDHA 1Q2PA 3CWFA 4QU3A 5TFQA 1L0EA 3P7NA 1N9OA 4MNRA 3A3EA 5EOOA 3C30A 2XRNA 2WKIA 3E2LA 3KYQA 4RX2A 2PDRA 5FQMA 1P9WA 4R0QA 3KYZA 1J3WA 1UWPX 1IYQA 2Y4AA 4E3MA 2H0YA 1FSWA 3VP0A 1XKZA 1YMSA 2Y2JA 5DKLA 1N9NA 1NWZA 3BFCA 3LFVA 1TS7A 3VMAA 3WRZA 3PBSA 4WEJA 4NG2A 2DCFA 4Y17A 1GHMA 1T1BA 3UB7A 3N8SA 4F3LB 3D4FA 4KENB 2XDMA 3ZDJA 4DDYA 2VKSA 4CLCB 5FL3A 3ULFA 1F9IA 2L0WA 5HPFA 3M2JA 3VOLA 1KVMA 4UA7A 3EOIA 5AJGA 2EX8A 2O9BA 3VFHA 3BQ8A 2W3FA 2IWCA 3F1NB 3KSGA 1RP5A 4JXVA 2ZM2A 4WZ4A 3QP4A 5D3OA 4QWOA 3RFBA 1IKGA 5DTTA 4MN7A 2HV1A 2V2FF 1K25A 4KG5A 3IX3A 1K0KA 3D9YA 3GSGA 5HX9A 5F69A 3HUNA 2W1RA 2QHKA 3TJZC 4R3JA 1LSXA 4EUVA 1BLHA 1CEGA 3MBZA 5EVIC 3LY3A 1GSWA 3LUQA 5A92A 1MBLA 4R3BA 4R4SA 3MQQA 1WYBA 4IVKA 4QY6A 5EVLA 1DP8A 3CUEC 4GZBA 2Y2HA 4ARZA 5KSHA 5J7EA 2WK0A 4GW9A 4DJ3A 1MWTA 3O3VA 5GLAA 1S0WA 1GCEA 4N1XA 3K3CA 2XA7S 2B95A 1AXBA 3IX4A 1G6AA 3A0SA 5LBRA 4B9OA 2H0TA 2Y59A 4JPMA 2R9XA 3UY6A 4HJ4A 3IF6B 3T4JA 3EWKA 3IBRA 3LIFA 2E8JA 1TD5A 3DTEA 4F3LA 1N9BA 4KZ9A 3IF5A 3PBOA 3NDEA 5G4ZA 4XT2B 1PFLA 1SZVA 5FQKA 3HBRA 1L3LA 3UO9A 2JC7A 3FKVA 4KZBA 5HSQA 1IOUA 4KG6A 1M40A 3DTKA 5G4YA 2JN7A 3CITA 3HUMA 1K6RA 3ICYA 2I72A 4GB7A 2WUQA 2Y91A 1JTGA 3VFFA 2EXAA 1S4RA 5BOHA 5FQ9A 4YWZA 2PD8A 3GQZA 2EX6A 3BRMA 4R1GA 4DN0A 4WZ5A 2J8YA 1W8YA 4EEUA 4EW7A 3ZHHA 5GLDA 3RXXA 5JYOA 3S7OA 2OWHA 2Q9NA 2Z2LB 4QPRA 2JKTM 1TEMA 3DTMA 4X53A 5HAQA 4ME4A 5HDDA 3G4PA 3HREA 2ZQCA 4LRYC 3OLOA 3A3DA 4DKIA 4H8RA 1GSXA 1O07A 1XP4A 2DMWA 4S2NC 4WF0A 5FQQA 5DF8A 5FASA 4R38A 2V20A 3NCKA 5EVEA 5F82A 4A5RA 4BJPA 2PYPA 2EFUA 5EE8A 1TS0A 1GA9A 3ISGA 4FTXA 5EOEA 1LLBA 4KZ5A 3MSHA 5DVAA 2XD5A 1V9YA 3G6OA 3RTYA 1DJCA 1XJ6A 2OV5A 1J9MA 3GECA 1SDNA 4XUXA 1XJ4A 3H82A 3UPPA 5HD3A 4HOIA 3HLCA 1X0OA 4Q0HA 3EGXC 3LI8A 3IQAA 2CMNA 4EEPA 2R9WA 1FIKA 1YMXA 2WGVA 1S1YA 3UDFA 4ETXA 4X6TA 3W8KA 1GHIA 1G6OA 2EWVA 2K31A 3OCLA 3IXBA 4E3NA 3MXSA 2GDNA 1H8MA 4X1LA 3IS2B 2LB5A 1TS6A 4N1HA 1ZC2A 3ZG5A 5FQIA 3Q07A 5JYPA 3SH9A 3VP1A 3GV9A 3MQ0A 4QJGA 1LI9A 4EU0A 4ID4A 4CLCC 5DFYA 2KOIA 1PI5A 1SHVA 1PIOA 5DF7A 1S1ZA 4EBNA 4JKTA 1L0GA 4MEZA 2PBYA 4LGWA 5DTKA 3EEHA 1AWIA 2A2LA 3T4LA 3G31A 3UPNA 2ACGA 2VLGA 2XK1A 2Y2IA 3H9WA 1ZG6A 4S2JA 4E3KA 4EXOA 4P87A 5GLCA 3T1QB 2HP6A 5AVFA 2I9VA 5TJJA 4K0XA 4OP5A 1XPBA 1T19A 1XGIA 1VB6A 4BL2A 2K2NA 4JGOA 5EPHA 3N8LA 1PYYA 1OTBA 4IUKA 4JLFA 3G2YA 3AGFA 3CPTA 3SH7A 4P85A 4Y7PA 1K6SA 2X71A 3C8CA 4ARZB 4WEKA 3M6BA 1VETB 4GKUA 3UPOA 3UDXA 1DP6A 3PBTA 1T1CA 3UN7A 4HJ6A 1Y4OA 2XSSA 1ERMA 4Z1WA 1N9LA 3HCYA 2XR0A 4OLGA 3Q7VB 3M6HA 4OQ0A 3E4QA 3CAXA 4LV0A 4NETA 3O88A 3A3FA 4ZBEA 4DE0A 3IF6A 3WS1A 2ZLYA 5TGFA 3ZNTA 2PD7A 1H0MA 1EROA 2FH5A 3KO6A 3NI9A 2BLSA 1FOFA 4BQMA 4XT2A 3TW8A 2QKPA 5FEFA 4NKPA 1YLPA 1OTAA 4NXEA 4L9FA 4GDNA 3E0YA 2B18A 1OTEA 4HEFA 4AFIA 1SCWA 2BTFP 5A93A 3BFFA 2J7VA 3NHQA 4IJGA 3N8RA 4D2OA 4MLLA 4DRTA 3GRJA 4OQIA 2OAQ1 2WKRA 4LLOB 2UV0E 1ES2A 4WLAA 3MR0A 3FPVA 5FEGA 3N6IA 4JXGA 2PYRA 2QWSA 3NOPC 4X1MA 4WMCD 3VOYA 1XX2A 4PM9A 1KGGA 2Z6DA 3N7WA 5J4EA 2O9CA 2W3HA 3FWLA 4NXBA 4MDZA 1TS8A 4JBFA 4OPQA 4UAAA 1QMEA 4GCZA 2EFXA 4S2LA 4O0PA 3IH9A 4PPRA 1JTDA 1VEUB 3UB9A 1IKIA 5KZHA 3C5AA 3CG5A 3FZCA 3ZGAB 4KZ4A 1P9RA 4U0XA 2WGWB 4E6XA 4WN5A 5C5KA 2KLIA 3H7WA 4KZ3A 3ZQ5A 3W2ZA 3LI9A 3RJUA 5CGSA 4YNRA 2Y79A 4JGQA 3V5MA 2B02A 4RQ9A 1ONGA 4K91A 2JHEA 3QP8A 3AGEA 1JVJA 3SS4A 3IHBA 3WS0A 5FSRA 2PU2A 4CJNA 2EX2A 3S7QA 4FUWA 5HL1A 3IS2A 2P08A 3W4PA 4WL9A 4DJ2A 4B4ZA 2JKTI 3MJQA 5F1GA 1NLYA 4DXBA 3SW1A 5DTSA 3WS5A 3ZCZA 3LO7A 2O9AA 3U2AA 3MMHA 4DE1A 3QNCA 3MXRA 4BLMA 1RGZA 5HPIA 2J80A 1JWPA 3HLEA 4ZDXA 3W4OA
chains in the Genus database with same CATH topology
4Y3IA 4H6JB 4YWZA 2VGLS 2PD8A 3K2NA 1S67L 2M7VA 3R7WB 3CLOA 4DN0A 4EEUA 4EW7A 4EETB 4L9GA 3V67A 3LR5A 4GHIA 4EERA 4KUKA 1XJ3A 1OJ5A 1YAXA 3S7OA 2OWHA 4YOFA 2VV6A 4K08A 2V0UA 2QJ5A 3EGDC 2JKTM 4QPRA 5HL6A 3ZYTA 4ME4A 5HDDA 2G7UA 2P7JA 4LRYC 3OLOA 3TE8A 1GSXA 2EWWA 4I39A 2DMWA 4WF0A 1ZTUA 4HH3A 1YSQA 4R38A 2NUTC 4BJPA 3UMEA 2PYPA 1OPXA 2GZAA 2PR6A 3JVUA 1TS0A 4MN6A 2WKPA 3HJIA 1ODVA 1XFQA 2YKHA 4O01A 1V9YA 2GNXA 2QYBA 5DJUA 3PYPA 1VHMA 3B33A 3TRCA 3G6OA 4MCWA 5KIZA 3RTYA 1D06A 1W63M 1XJ6A 3R4KA 1H3QA 5DF9A 3MF0A 3CUEA 3E4PA 4IUHA 3GECA 4P6ZS 1XJ4A 3H82A 3BWLA 5HD3A 4HOIA 3H7WB 1X0OA 3BQAA 2NUPC 4Q0HA 3EGXC 3LI8A 5HWWA 4L0LA 1TF1A 2CMNA 3NOUC 2JKRM 4BBVA 1OTDA 4EEPA 3FPWA 3T4KA 4G3KA 4GHIB 1S1YA 2O99A 4I5SA 1Y28A 2MJ6A 5F6AA 2VX8A 1LL8A 2W3DA 3LIDA 2LB9A 1T1AA 4ETXA 1NRJA 1UWNX 4KUOA 3PBRA 3T4SA 4WUJA 2VA0A 1MKMA 4CLCE 1G6OA 2EWVA 1P97A 2K31A 3LR0A 4PKYA 4Q0IA 3OCLA 2XROA 2W0NA 5TBMA 4EESA 2IA2A 1H8MA 3IS2B 3LIEA 3E98A 2WKQA 4I3IA 5HD5A 2LB5A 1DP9A 1TS6A 4M4XA 4KQDA 4HI4A 1BYWA 2HJEA 4ETZA 1W63Q 3DBAA 3MQ0A 2BASA 4MMNA 4EU0A 3VV4A 3EQUA 2W3EA 3LIBA 4CLCC 2PT7A 5DFYA 2VV8A 1S4SA 3LICA 2FZ0A 2KOIA 4H6JA 1S1ZA 1S4RA 2EA9A 1EW0A 2J3TD 3H82B 4HIAA 3PBNA 1JNUA 1ZHHB 3OBFA 4EQ1A 1OT9A 5IT5A 2PHYA 4R6LA 4UEYA 2GX5A 3EEHA 4OOLA 2W27A 4II7A 2Z6CA 2A2LA 3T4LA 3UB6A 1MC0A 3UE3A 4FSFA 4MN5A 2VLGA 1LT0A 1WA9A 1YSPA 4ZRRA 2QJ7A 4BBTA 3H9WA 2V0WA 2VEAA 4HHDA 3OCNA 2HGVA 4EXOA 5DKKA 5AVFA 3PR6A 4DMZA 5HDCA 4HQAA 5I5LA 4GLQA 2I9VA 5TJJA 4HY8A 2ZOIA 1T19A 2H28A 3A0RA 3OC2A 1VB6A 4G3VA 4NEED 2K2NA 4LRXC 4JGOA 4KQOA 1OTBA 1D7EA 4Y5FA 3CI6A 5HZHA 4IUKA 3T50A 1UGUA 2INWA 3BW6A 1P0ZA 3IBJA 2R78A 5HWTA 4Y2FA 3RH8B 5IS1A 3NOTC 4R70A 3UMDA 3C8CA 4ARZB 4WEKA 4G3WA 3T4OA 3PHYA 1OTIA 1XFNA 1DP6A 1KOUA 3PBTA 4JGPA 1G28A 1NLZA 3JVVA 3EQVA 1T1CA 3F1OB 3FC7A 4JGRA 3BY9A 5MC7A 4HJ6A 2XSSA 5K5BA 3KX0X 3CWFA 4Q0JA 3P7NA 4Z1WA 1N9OA 2L4RA 1N9LA 3F1PA 3HCYA 1S66L 3C30A 2XRNA 1GSVA 3D3OA 5AVEA 3KYQA 3E4QA 2PDRA 3CAXA 1P9WA 2W1TA 2J3WA 1IFQA 4I38A 3KYZA 1UWPX 5HWVA 4BMWA 4UQIS 2GJ3A 5L8MA 1DRMA 1LSVA 5DKLA 2HF6A 1N9NA 1NWZA 3LFVA 1TS7A 3A0VA 2Y8HA 2HJ9C 3PBSA 4WEJA 5DJTA 2PD7A 5DFXA 3VE4A 2FH5A 5F5YA 1T1BA 3KO6A 3UB7A 4F3LB 3B42A 3PBQA 4HH2A 4XT2A 2VKSA 5CX7A 3MQOA 3B47A 3P01A 4CLCB 3C2WA 3TW8A 2QKPA 5FL3A 3ULFA 1F9IA 4NKPA 3LYXA 1OTAA 4NXEA 4L9FA 3E0YA 4GJ4A 2L0WA 5HPFA 2OWJA 2B18A 3S7NA 1OTEA 3VOLA 2OOLA 4OOMA 1F5MA 3E4OA 2ZOHA 4AFIA 3EOIA 4IHQA 3S7PA 5AJGA 2O0YA 4GS9B 2O9BA 2ZMFA 3BQ8A 3NHQA 2W3FA 4IJGA 3F1NB 3KSGA 3R7WA 3UE6A 5J3WA 5EFWA 1F98A 4BWIA 2ZMVA 3RFBA 2KX6A 4B93A 3K3DA 4PAUA 3BJNA 1YKDA 3LR4A 2OAQ1 2WKRA 4LLOB 4MN7A 1OT6A 2HV1A 4WLAA 2V9AA 2A24B 3MR0A 3FPVA 2W3GA 4HNBA 5F69A 2PYRA 2QWSA 3NOPC 5IU1A 3EEAA 4PKYG 2W1RA 4P6ZM 2QHKA 3TJZC 2VGLM 3NJAA 1LSXA 4O8GA 2Z6DA 3LR3A 4HP9A 2VV7A 4EUVA 3D72A 5F68A 5J4EA 2O9CA 2W3HA 4WELA 4NXBA 4MDZA 1TS8A 2OAP1 1GSWA 3LUQA 3GDIA 4GCZA 4UQIM 3T4QA 2KDKA 4CQHA 4O0PA 5HDSA 3MQQA 5A8BA 3FG8A 2D01A 4PHTA 3HJKA 3C38A 1DP8A 3CUEC 4CLCD 2XA7M 3UB9A 2M1CA 4ARZA 5KSHA 4HP4A 5J7EA 4GW9A 1OJGA 2VZWA 4DJ3A 2L1MA 3KSIA 1P9RA 4L9EA 3F1OA 4WN5A 4I3AA 3VE3A 5C5KA 4GS9A 2KLIA 3H7WA 3K3CA 2XA7S 3ZQ5A 3W2ZA 2VJWA 1LSWA 3LI9A 3F1NA 3LIAA 4YNRA 3O5YA 3F1PB 3KSHA 3A0SA 2V1AA 2Y79A 5LBRA 4B9OA 4BBUA 3MXQA 4JGQA 2B02A 4HJ3A 4RQ9A 3OOVA 1MZUA 1V9ZA 2W1TB 1STZA 2A24A 2J3TC 2JHEA 2D02A 2YKFA 4HJ4A 3KSFA 3T4JA 4NXGA 2P04A 3UB8A 1XJ2A 3EWKA 3IBRA 2JKRI 3LIFA 4E04A 2V1BA 5TBMB 3S7QA 1TD5A 4NXFA 2ZBBA 3MFXA 3IS2A 2P08A 4FOFA 4F3LA 2PR5A 4WL9A 3PBOA 5G4ZA 4XT2B 4DJ2A 4CLCA 4R3AA 2M7UA 2JKTI 4LPZA 3MJQA 5HSQA 1NLYA 1IOUA 3SW1A 5G4YA 3BY8A 2JN7A 2O9AA 3CITA 3T4TA 4I3JA 3ICYA 3U2AA 4LRZE 3MMHA 3PXPA 1T18A 5HPIA 2J80A 2K7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC A;  4CLC B;  4CLC C;  2A2L A;  4CLC E;  3FPW A;  4NKP A;  4BMW A;  5CX7 A;  4CLC D;  3FPV A; 
#chains in the Genus database with same CATH topology
 2WYX A;  3K2N A;  4ESP A;  5GHX A;  2HDR A;  4KZ7 A;  4KUK A;  1XJ3 A;  2ZQA A;  4GN2 A;  1HZO A;  2QJ5 A;  2Z2M B;  1NYY A;  2P7J A;  4FCF A;  4X69 A;  2EWW A;  4I39 A;  4S2N A;  1ZTU A;  1SDE A;  4HH3 A;  4LEN A;  3JYI A;  1C3B A;  1YSQ A;  3W4Q A;  4E3O A;  1NJ4 A;  2NUT C;  1ESU A;  5FAP A;  4PM5 A;  4F94 A;  4MN6 A;  1PW8 A;  1XFQ A;  5CTM A;  2QYB A;  3KYE A;  3G34 A;  1VHM A;  3B33 A;  1MWR A;  2IWD A;  4S2M A;  1W63 M;  5M1A A;  2J9P A;  2X02 A;  3CPT B;  3MF0 A;  1LHY A;  3CUE A;  1WE4 A;  4EBL A;  5F1F A;  4LV2 A;  1S6R A;  1LL5 A;  3BWL A;  1W7F A;  3H7W B;  3BQA A;  5HWW A;  1YT4 A;  4PM7 A;  4OPZ A;  3NOU C;  2JKR M;  3T4K A;  2FFF B;  1KGF A;  2X01 A;  2VX8 A;  1NRF A;  4QB8 A;  1HD8 A;  3L7H A;  2HPB A;  2LB9 A;  1PWD A;  3PBR A;  4X68 A;  1MKM A;  3IT9 A;  1P97 A;  2XLN A;  4PKY A;  4Q0I A;  2XRO A;  2W0N A;  3OPR A;  4X25 A;  4JF6 A;  2IA2 A;  3LIE A;  1JWV A;  2WKQ A;  4I3I A;  2ZL1 B;  4M4X A;  2ZM8 A;  4HI4 A;  1BYW A;  2HJE A;  2VGK A;  3VSK A;  1TDG A;  3GMW A;  2UWX A;  2BAS A;  2W3E A;  2ZQD A;  2QPN A;  3ZVT A;  1TVF A;  1E4D A;  2FZ0 A;  3LEZ A;  1ZG4 A;  5HFO A;  3BYD A;  3CZD A;  1YPR A;  1JNU A;  1ZHH B;  4X56 A;  2PHY A;  4UEY A;  3TG9 A;  4MBF A;  5F83 A;  3BEB A;  3Q7V A;  5GHZ A;  1TDL A;  5M18 A;  1H8Z A;  1LT0 A;  3RXW A;  3G30 A;  1YSP A;  2QJ7 A;  4BBT A;  3GTC A;  4Z9Q A;  4HHD A;  4C6Y A;  3MZE A;  1Z09 A;  4KG2 A;  3VSL A;  4ZTK A;  1IYS A;  3MKE A;  1YLY A;  4DDS A;  2HZ5 A;  5HDC A;  2Y2K A;  1DY6 A;  1O7E A;  3OPP A;  1GHP A;  2QZ6 A;  1BLS A;  3OC2 A;  4NEE D;  4LRX C;  1A0K A;  5E2G A;  2G2W A;  2ZQ7 A;  2Y2G A;  4Y5F A;  2IWB A;  4UHU A;  1W8Q A;  2WZZ A;  4DXC A;  1P0Z A;  4KZ6 A;  5U47 A;  1DJB A;  1I5Q A;  1VEU A;  3NOT C;  4R70 A;  3UMD A;  4EV4 A;  3QHY A;  4G3W A;  1K57 A;  4FH4 A;  3DW0 A;  4E6W A;  1KVL A;  1NZU A;  5CHM A;  1NLZ A;  3NBL A;  2PRF A;  3FC7 A;  3T1R A;  4RVA A;  3IX8 A;  3OPL A;  2WKH A;  3V50 A;  3BFE A;  3VP3 A;  1CI8 A;  5CED A;  4OH0 A;  1IEL A;  2L4R A;  5CHJ A;  3C7U A;  1S66 L;  3D3O A;  1NYM A;  4BD0 A;  5AVE A;  3FKW A;  2XH9 A;  2J3W A;  4I38 A;  1YLT A;  3O86 A;  4HES A;  5HWV A;  1KE4 A;  3TOI A;  4BMW A;  4UQI S;  5EUA A;  3IF6 C;  2GJ3 A;  5L8M A;  1DRM A;  1E25 A;  1LSV A;  3Q81 A;  3MS6 A;  3A0V A;  2Y8H A;  2HJ9 C;  5DJT A;  3OPH A;  5DFX A;  2VGJ A;  2Y2M A;  4KZ8 A;  2XF3 A;  5CXW A;  3P01 A;  4FH2 A;  4IBX A;  1MPL A;  1EI5 A;  3Q7Z A;  5CEB A;  4HBT A;  1FQG A;  4GJ4 A;  2OWJ A;  3S7N A;  1L0D A;  2OOL A;  4ZAM A;  2ZOH A;  3S7P A;  1PZP A;  4S2K A;  2G2U A;  1PNE A;  1NXY A;  3BFG A;  3SS3 A;  1BT5 A;  3UE6 A;  3HLB A;  4BWI A;  3B3X A;  4PM8 A;  1FCO A;  5EM1 A;  2KX6 A;  3WS4 A;  3BJN A;  3LR4 A;  3LCE A;  4U3T A;  3QP2 A;  4WBG A;  2W3G A;  4P0M A;  5IU1 A;  4PKY G;  4P6Z M;  2H10 A;  4HP9 A;  3D72 A;  5FAQ A;  3T1S A;  5F68 A;  1HLU P;  2XQZ A;  5AQA A;  2OAP 1;  3GDI A;  4UQI M;  3T4Q A;  3QP6 A;  2KDK A;  1IYP A;  3C4P A;  5A8B A;  5FI2 A;  3FG8 A;  3CHW P;  4PHT A;  2Y2N A;  2XA7 M;  2M1C A;  3QP5 A;  1OJG A;  4IVI A;  2A49 A;  2L1M A;  5L09 A;  3KSI A;  4OVD A;  3HLF A;  2RCX A;  1BLP A;  1YLW A;  4I3A A;  3VE3 A;  4GS9 A;  1NY0 A;  4C3Q A;  4IBR A;  5GL9 A;  2VJW A;  4O7D A;  2V1A A;  2Y55 A;  3HL9 A;  3WRT A;  3MXQ A;  4HJ3 A;  1BUL A;  1CEF A;  1MZU A;  1V9Z A;  3OOV A;  2W1T B;  5FQJ A;  1STZ A;  2A24 A;  2D02 A;  2YKF A;  1G68 A;  3NIA A;  3KSF A;  2WAF A;  1XJ2 A;  3UB8 A;  4E04 A;  3G2Z A;  5CRF A;  4S2I A;  3LGO A;  3SZT A;  4OON A;  4NXF A;  2ZBB A;  3MFX A;  4FOF A;  3C4O A;  2ZL1 A;  3LEQ A;  2HDQ A;  2A3U A;  2M7U A;  4LPZ A;  4YFM A;  3T4T A;  4LRZ E;  3PXP A;  3S1Y A;  1G5U A;  4PMA A;  4Y15 A;  2VGL S;  4RX3 A;  3G32 A;  3R7W B;  4XUZ A;  4EET B;  4L9G A;  2ZC7 A;  4FD8 A;  3NEC A;  4YOF A;  1ACF A;  2V0U A;  4K08 A;  4DF6 A;  3EGD C;  3ZYT A;  1IYO A;  2ZMA A;  2P74 A;  4E3J A;  5EV0 A;  1PWG A;  3TE8 A;  1KDS A;  1K54 C;  2ZC6 B;  4LCM A;  2WKE A;  5EVI B;  1OPX A;  2C6W B;  2GZA A;  2PR6 A;  3C7V A;  2DRW A;  1K55 A;  2WAE A;  3ZVW A;  3BEC A;  1FSY A;  2YKH A;  4O01 A;  1HTZ A;  3VP4 A;  3S4X A;  5DJU A;  1L0F A;  1YLJ A;  5KIZ A;  1D06 A;  3R4K A;  2V8C A;  2AVX A;  1XXM A;  3CJM A;  5E2H A;  1M6K A;  1W79 A;  4LV3 A;  1ERQ A;  2ZC4 B;  3UE1 A;  4Y13 A;  2E8I A;  4G3K A;  3O87 A;  4GHI B;  2JBF A;  2O99 A;  4I5S A;  3HUO A;  4N92 A;  2MJ6 A;  1ES5 A;  1IEM A;  1RCJ A;  3WWX A;  3A3I A;  2W3D A;  3LID A;  4OP8 A;  5M19 A;  2ZQ8 A;  1UWN X;  4KUO A;  1K54 A;  4EUZ A;  1Q2Q A;  3T4S A;  4WUJ A;  4CLC E;  1EWZ A;  3LR0 A;  3CMZ A;  2B5R A;  5TBM A;  4EES A;  1XA1 A;  2OSU A;  4R23 A;  3IXG A;  3E98 A;  4LV1 A;  4E3L A;  5HD5 A;  1DP9 A;  4GNU A;  4WZ5 C;  4KQD A;  1FR6 A;  5EVI D;  4K0W A;  1MKI A;  1W63 Q;  4WYY A;  3DBA A;  4WM9 A;  2EX9 A;  4MMN A;  3ZG8 B;  3EQU A;  3LIB A;  2PT7 A;  3S22 A;  5KMW A;  2CC1 A;  3QP1 A;  1PZO A;  1ONH A;  4H6J A;  5J8X A;  4R4R A;  4MBK A;  5FAO A;  3Q82 A;  3PAG A;  1FIL A;  5G18 A;  5IT5 A;  5CGX A;  4EBP A;  1LI0 A;  2Z6C A;  4GOG A;  3UB6 A;  2H5S A;  2OLU A;  2WZX A;  5AQ9 A;  4ZRR A;  2JKF A;  5I94 A;  3OCN A;  2HGV A;  4OPR A;  5DKK A;  5EVI A;  2VK3 A;  3I7J A;  1W5D A;  4HQA A;  4RA7 A;  5FA7 A;  1E3U D;  4HY8 A;  3ITB A;  2ZOI A;  3A0R A;  2H28 A;  3DTI A;  3A3J A;  5E2E A;  2P9V A;  4HBU A;  3UNW A;  2WAD A;  1D7E A;  3IWI A;  3T50 A;  1UGU A;  3BW6 A;  3IBJ A;  2R78 A;  5HWT A;  1KE0 A;  4BL3 A;  4Y2F A;  3RH8 B;  5IS1 A;  1SKO B;  1K4F A;  3AGD A;  4GD6 A;  3PHY A;  3SS5 A;  1OTI A;  1KOU A;  1Z6F A;  3JVV A;  3EQV A;  3F1O B;  4JGR A;  4UA6 A;  4JXW A;  3BFD A;  4JF5 A;  3HLG A;  3UDI A;  5K5B A;  4Q0J A;  3F1P A;  3NUL A;  1MY8 A;  1VM1 A;  4GDB A;  5HAR A;  1GSV A;  5CHU A;  3GVB A;  2W1T A;  1IFQ A;  2Q9M A;  4LFU A;  1ES3 A;  4WMC A;  4U0T A;  2HF6 A;  4Y0O A;  3V39 A;  3VE4 A;  5A90 A;  3V3R A;  2ZD8 A;  4QY5 A;  5F5Y A;  1H8Y A;  1YM1 A;  3B42 A;  1H5X A;  3PBQ A;  4HH2 A;  5CX7 A;  3MQO A;  3B47 A;  2XD1 A;  3C2W A;  3V3S A;  4PM6 A;  3LYX A;  1SKF A;  3MZF A;  4M3K A;  4ZJ2 A;  4OOM A;  1F5M A;  3E4O A;  4IHQ A;  1VET A;  2O0Y A;  1K4E A;  4GS9 B;  3UB5 P;  2ZMF A;  4KQQ A;  3N4I A;  5FDS A;  3R7W A;  5J3W A;  5EFW A;  1F98 A;  3HVF A;  2ZMV A;  4BEN A;  2Q0O A;  3JPU A;  4B93 A;  3K3D A;  4PAU A;  1YKD A;  1K56 A;  1L2S A;  1OT6 A;  4OOY A;  2V9A A;  2A24 B;  2V1Z A;  4EQI A;  1N4O A;  5EEC A;  5GHY A;  4NK3 A;  4HNB A;  3IHA A;  3EEA A;  2VGL M;  3NJA A;  5FI6 A;  5GLB A;  5FI7 A;  4O8G A;  2JCH A;  3LR3 A;  2VV7 A;  5HW3 A;  3L9K A;  4WEL A;  3IXD A;  2EXB A;  2DNS A;  2P9V B;  1OME A;  5CTN A;  3ITA A;  4JXS A;  1MXO A;  4CQH A;  2ZJ9 A;  1XA7 A;  2XFT A;  5HDS A;  3UE0 A;  4CPK A;  4QD4 A;  1F2K A;  2D01 A;  3HJK A;  3C38 A;  3LY4 A;  1CJF A;  4KQR A;  4CLC D;  3OZH A;  4HP4 A;  3VP2 A;  2VZW A;  2ZC3 B;  2HP5 A;  4OQH A;  1FCM A;  4XXR A;  4L9E A;  2WGI A;  3F1O A;  3DWZ A;  4OQG A;  1JWZ A;  2ZQ9 A;  4Q8I A;  1LSW A;  3F1N A;  3LIA A;  3O5Y A;  5EM0 A;  4UA9 A;  3F1P B;  3KSH A;  1BUE A;  3G35 A;  5CER A;  4BBU A;  5CEC A;  1I2W A;  2J9O A;  1I2S A;  3BLM A;  3ZNY A;  2J3T C;  2PAV P;  4Y0T A;  4EWF A;  4NXG A;  2P04 A;  3IXH A;  2JKR I;  4N9K A;  1KE3 A;  5HAP A;  3PTE A;  3E2K A;  2V1B A;  2Y2Q A;  5TBM B;  3ZFZ A;  4X55 A;  2PR5 A;  4QHC A;  2Y2O A;  4CLC A;  4R3A A;  2ZM0 A;  3SH8 A;  3BY8 A;  1ALQ A;  4I3J A;  1T18 A;  5TR7 A;  4S2O A;  5FAT A;  5L10 A;  2K7S A;  1K57 C;  4Y3I A;  4ZJ1 A;  4H6J B;  1CK3 A;  2XGN A;  5IHV A;  3WS2 A;  3QNB A;  2WGW A;  4BD1 A;  2OLV A;  1S67 L;  3MZD A;  1BSG A;  2M7V A;  3CLO A;  4DE2 A;  3V67 A;  1MWU A;  3LR5 A;  4GHI A;  4EER A;  1BLC A;  1CI9 A;  1OJ5 A;  1YAX A;  4D60 A;  2VV6 A;  3MKF A;  4ZJ3 A;  5HL6 A;  1YQS A;  2G7U A;  1PI4 A;  5AQ7 A;  4B88 A;  4OPY A;  1K56 D;  3BM6 A;  3P09 A;  1CF0 A;  1MWS A;  2RL3 A;  1PRQ A;  3MFD A;  3UME A;  1PW1 A;  3IWQ A;  5CGW A;  1FCN A;  3JVU A;  4YIN A;  2WKP A;  3HJI A;  1ODV A;  4N9L A;  4IED A;  2GNX A;  4B4X A;  3PYP A;  3TRC A;  4MCW A;  5DF9 A;  1H3Q A;  1ES4 A;  3IH8 A;  4GD8 A;  3E4P A;  1WYC A;  4IUH A;  3ZG9 B;  4P6Z S;  3NDG A;  3HLD A;  2QMI A;  3FYZ A;  2NUP C;  4L0L A;  1TF1 A;  4BBV A;  3IWO A;  1OTD A;  1GA0 A;  3FPW A;  1VQQ A;  3M2K A;  3HLW A;  2FFY A;  4LCL A;  1Y28 A;  5F6A A;  4S2P A;  1LL8 A;  3VOZ A;  1T1A A;  1NRJ A;  2PU4 A;  3FV7 A;  2VA0 A;  1QMF A;  2XEP A;  2XFS A;  1HVB A;  1KDW A;  4ETZ A;  4P6B A;  2HP9 A;  3VV4 A;  5L2F A;  1LL9 A;  3GR2 A;  3P98 A;  1PWC A;  5KSC A;  1SKO A;  4OLD A;  2VV8 A;  2HDU A;  1Y54 A;  5E2F A;  1S4S A;  3LIC A;  1NZO A;  1E3U A;  2BG1 A;  2PBD P;  2V8F A;  2EA9 A;  3T1X A;  1EW0 A;  2J3T D;  3H82 B;  4HIA A;  3PBN A;  2Y2P A;  3TSG A;  3OBF A;  4EQ1 A;  3PAE A;  1OT9 A;  3DAV A;  4R6L A;  1ESI A;  2GX5 A;  4OOL A;  4Y0U A;  2W27 A;  1ZKJ A;  3BLS A;  4II7 A;  3T12 B;  2Y2L A;  5HAI A;  1D1J A;  1MC0 A;  3UE3 A;  4FSF A;  4MN5 A;  4MBH A;  3ZG7 B;  1WA9 A;  1BZA A;  2V0W A;  2VEA A;  4E3I A;  3SOI A;  2HDS A;  3PR6 A;  4DMZ A;  1YLZ A;  1U60 A;  2C5W B;  3NY4 A;  5I5L A;  4GLQ A;  5E43 A;  4RYE A;  4G3V A;  5A91 A;  1XGJ A;  1K55 C;  4KQO A;  5L07 A;  3CI6 A;  1FR1 A;  5HZH A;  2JKG A;  2INW A;  1BTL A;  4OKP A;  2JE5 A;  3DWK A;  3T4O A;  4JF4 A;  1XFN A;  1RGY A;  5AQB A;  1DJA A;  4JGP A;  1G28 A;  2ZC5 B;  3NC8 A;  3Q1F A;  4DE3 A;  3BY9 A;  5MC7 A;  3U4L P;  1KGE A;  1CQA A;  4KZA A;  3ZG0 A;  4C75 A;  3KX0 X;  1K38 A;  5FDH A;  1Q2P A;  3CWF A;  4QU3 A;  5TFQ A;  1L0E A;  3P7N A;  1N9O A;  4MNR A;  3A3E A;  5EOO A;  3C30 A;  2XRN A;  2WKI A;  3E2L A;  3KYQ A;  4RX2 A;  2PDR A;  5FQM A;  1P9W A;  4R0Q A;  3KYZ A;  1J3W A;  1UWP X;  1IYQ A;  2Y4A A;  4E3M A;  2H0Y A;  1FSW A;  3VP0 A;  1XKZ A;  1YMS A;  2Y2J A;  5DKL A;  1N9N A;  1NWZ A;  3BFC A;  3LFV A;  1TS7 A;  3VMA A;  3WRZ A;  3PBS A;  4WEJ A;  4NG2 A;  2DCF A;  4Y17 A;  1GHM A;  1T1B A;  3UB7 A;  3N8S A;  4F3L B;  3D4F A;  4KEN B;  2XDM A;  3ZDJ A;  4DDY A;  2VKS A;  4CLC B;  5FL3 A;  3ULF A;  1F9I A;  2L0W A;  5HPF A;  3M2J A;  3VOL A;  1KVM A;  4UA7 A;  3EOI A;  5AJG A;  2EX8 A;  2O9B A;  3VFH A;  3BQ8 A;  2W3F A;  2IWC A;  3F1N B;  3KSG A;  1RP5 A;  4JXV A;  2ZM2 A;  4WZ4 A;  3QP4 A;  5D3O A;  4QWO A;  3RFB A;  1IKG A;  5DTT A;  4MN7 A;  2HV1 A;  2V2F F;  1K25 A;  4KG5 A;  3IX3 A;  1K0K A;  3D9Y A;  3GSG A;  5HX9 A;  5F69 A;  3HUN A;  2W1R A;  2QHK A;  3TJZ C;  4R3J A;  1LSX A;  4EUV A;  1BLH A;  1CEG A;  3MBZ A;  5EVI C;  3LY3 A;  1GSW A;  3LUQ A;  5A92 A;  1MBL A;  4R3B A;  4R4S A;  3MQQ A;  1WYB A;  4IVK A;  4QY6 A;  5EVL A;  1DP8 A;  3CUE C;  4GZB A;  2Y2H A;  4ARZ A;  5KSH A;  5J7E A;  2WK0 A;  4GW9 A;  4DJ3 A;  1MWT A;  3O3V A;  5GLA A;  1S0W A;  1GCE A;  4N1X A;  3K3C A;  2XA7 S;  2B95 A;  1AXB A;  3IX4 A;  1G6A A;  3A0S A;  5LBR A;  4B9O A;  2H0T A;  2Y59 A;  4JPM A;  2R9X A;  3UY6 A;  4HJ4 A;  3IF6 B;  3T4J A;  3EWK A;  3IBR A;  3LIF A;  2E8J A;  1TD5 A;  3DTE A;  4F3L A;  1N9B A;  4KZ9 A;  3IF5 A;  3PBO A;  3NDE A;  5G4Z A;  4XT2 B;  1PFL A;  1SZV A;  5FQK A;  3HBR A;  1L3L A;  3UO9 A;  2JC7 A;  3FKV A;  4KZB A;  5HSQ A;  1IOU A;  4KG6 A;  1M40 A;  3DTK A;  5G4Y A;  2JN7 A;  3CIT A;  3HUM A;  1K6R A;  3ICY A;  2I72 A;  4GB7 A;  2WUQ A;  2Y91 A;  1JTG A;  3VFF A;  2EXA A;  1S4R A;  5BOH A;  5FQ9 A;  4YWZ A;  2PD8 A;  3GQZ A;  2EX6 A;  3BRM A;  4R1G A;  4DN0 A;  4WZ5 A;  2J8Y A;  1W8Y A;  4EEU A;  4EW7 A;  3ZHH A;  5GLD A;  3RXX A;  5JYO A;  3S7O A;  2OWH A;  2Q9N A;  2Z2L B;  4QPR A;  2JKT M;  1TEM A;  3DTM A;  4X53 A;  5HAQ A;  4ME4 A;  5HDD A;  3G4P A;  3HRE A;  2ZQC A;  4LRY C;  3OLO A;  3A3D A;  4DKI A;  4H8R A;  1GSX A;  1O07 A;  1XP4 A;  2DMW A;  4S2N C;  4WF0 A;  5FQQ A;  5DF8 A;  5FAS A;  4R38 A;  2V20 A;  3NCK A;  5EVE A;  5F82 A;  4A5R A;  4BJP A;  2PYP A;  2EFU A;  5EE8 A;  1TS0 A;  1GA9 A;  3ISG A;  4FTX A;  5EOE A;  1LLB A;  4KZ5 A;  3MSH A;  5DVA A;  2XD5 A;  1V9Y A;  3G6O A;  3RTY A;  1DJC A;  1XJ6 A;  2OV5 A;  1J9M A;  3GEC A;  1SDN A;  4XUX A;  1XJ4 A;  3H82 A;  3UPP A;  5HD3 A;  4HOI A;  3HLC A;  1X0O A;  4Q0H A;  3EGX C;  3LI8 A;  3IQA A;  2CMN A;  4EEP A;  2R9W A;  1FIK A;  1YMX A;  2WGV A;  1S1Y A;  3UDF A;  4ETX A;  4X6T A;  3W8K A;  1GHI A;  1G6O A;  2EWV A;  2K31 A;  3OCL A;  3IXB A;  4E3N A;  3MXS A;  2GDN A;  1H8M A;  4X1L A;  3IS2 B;  2LB5 A;  1TS6 A;  4N1H A;  1ZC2 A;  3ZG5 A;  5FQI A;  3Q07 A;  5JYP A;  3SH9 A;  3VP1 A;  3GV9 A;  3MQ0 A;  4QJG A;  1LI9 A;  4EU0 A;  4ID4 A;  4CLC C;  5DFY A;  2KOI A;  1PI5 A;  1SHV A;  1PIO A;  5DF7 A;  1S1Z A;  4EBN A;  4JKT A;  1L0G A;  4MEZ A;  2PBY A;  4LGW A;  5DTK A;  3EEH A;  1AWI A;  2A2L A;  3T4L A;  3G31 A;  3UPN A;  2ACG A;  2VLG A;  2XK1 A;  2Y2I A;  3H9W A;  1ZG6 A;  4S2J A;  4E3K A;  4EXO A;  4P87 A;  5GLC A;  3T1Q B;  2HP6 A;  5AVF A;  2I9V A;  5TJJ A;  4K0X A;  4OP5 A;  1XPB A;  1T19 A;  1XGI A;  1VB6 A;  4BL2 A;  2K2N A;  4JGO A;  5EPH A;  3N8L A;  1PYY A;  1OTB A;  4IUK A;  4JLF A;  3G2Y A;  3AGF A;  3CPT A;  3SH7 A;  4P85 A;  4Y7P A;  1K6S A;  2X71 A;  3C8C A;  4ARZ B;  4WEK A;  3M6B A;  1VET B;  4GKU A;  3UPO A;  3UDX A;  1DP6 A;  3PBT A;  1T1C A;  3UN7 A;  4HJ6 A;  1Y4O A;  2XSS A;  1ERM A;  4Z1W A;  1N9L A;  3HCY A;  2XR0 A;  4OLG A;  3Q7V B;  3M6H A;  4OQ0 A;  3E4Q A;  3CAX A;  4LV0 A;  4NET A;  3O88 A;  3A3F A;  4ZBE A;  4DE0 A;  3IF6 A;  3WS1 A;  2ZLY A;  5TGF A;  3ZNT A;  2PD7 A;  1H0M A;  1ERO A;  2FH5 A;  3KO6 A;  3NI9 A;  2BLS A;  1FOF A;  4BQM A;  4XT2 A;  3TW8 A;  2QKP A;  5FEF A;  4NKP A;  1YLP A;  1OTA A;  4NXE A;  4L9F A;  4GDN A;  3E0Y A;  2B18 A;  1OTE A;  4HEF A;  4AFI A;  1SCW A;  2BTF P;  5A93 A;  3BFF A;  2J7V A;  3NHQ A;  4IJG A;  3N8R A;  4D2O A;  4MLL A;  4DRT A;  3GRJ A;  4OQI A;  2OAQ 1;  2WKR A;  4LLO B;  2UV0 E;  1ES2 A;  4WLA A;  3MR0 A;  3FPV A;  5FEG A;  3N6I A;  4JXG A;  2PYR A;  2QWS A;  3NOP C;  4X1M A;  4WMC D;  3VOY A;  1XX2 A;  4PM9 A;  1KGG A;  2Z6D A;  3N7W A;  5J4E A;  2O9C A;  2W3H A;  3FWL A;  4NXB A;  4MDZ A;  1TS8 A;  4JBF A;  4OPQ A;  4UAA A;  1QME A;  4GCZ A;  2EFX A;  4S2L A;  4O0P A;  3IH9 A;  4PPR A;  1JTD A;  1VEU B;  3UB9 A;  1IKI A;  5KZH A;  3C5A A;  3CG5 A;  3FZC A;  3ZGA B;  4KZ4 A;  1P9R A;  4U0X A;  2WGW B;  4E6X A;  4WN5 A;  5C5K A;  2KLI A;  3H7W A;  4KZ3 A;  3ZQ5 A;  3W2Z A;  3LI9 A;  3RJU A;  5CGS A;  4YNR A;  2Y79 A;  4JGQ A;  3V5M A;  2B02 A;  4RQ9 A;  1ONG A;  4K91 A;  2JHE A;  3QP8 A;  3AGE A;  1JVJ A;  3SS4 A;  3IHB A;  3WS0 A;  5FSR A;  2PU2 A;  4CJN A;  2EX2 A;  3S7Q A;  4FUW A;  5HL1 A;  3IS2 A;  2P08 A;  3W4P A;  4WL9 A;  4DJ2 A;  4B4Z A;  2JKT I;  3MJQ A;  5F1G A;  1NLY A;  4DXB A;  3SW1 A;  5DTS A;  3WS5 A;  3ZCZ A;  3LO7 A;  2O9A A;  3U2A A;  3MMH A;  4DE1 A;  3QNC A;  3MXR A;  4BLM A;  1RGZ A;  5HPI A;  2J80 A;  1JWP A;  3HLE A;  4ZDX A;  3W4O A; 
#chains in the Genus database with same CATH homology
 4Y3I A;  4H6J B;  4YWZ A;  2VGL S;  2PD8 A;  3K2N A;  1S67 L;  2M7V A;  3R7W B;  3CLO A;  4DN0 A;  4EEU A;  4EW7 A;  4EET B;  4L9G A;  3V67 A;  3LR5 A;  4GHI A;  4EER A;  4KUK A;  1XJ3 A;  1OJ5 A;  1YAX A;  3S7O A;  2OWH A;  4YOF A;  2VV6 A;  4K08 A;  2V0U A;  2QJ5 A;  3EGD C;  2JKT M;  4QPR A;  5HL6 A;  3ZYT A;  4ME4 A;  5HDD A;  2G7U A;  2P7J A;  4LRY C;  3OLO A;  3TE8 A;  1GSX A;  2EWW A;  4I39 A;  2DMW A;  4WF0 A;  1ZTU A;  4HH3 A;  1YSQ A;  4R38 A;  2NUT C;  4BJP A;  3UME A;  2PYP A;  1OPX A;  2GZA A;  2PR6 A;  3JVU A;  1TS0 A;  4MN6 A;  2WKP A;  3HJI A;  1ODV A;  1XFQ A;  2YKH A;  4O01 A;  1V9Y A;  2GNX A;  2QYB A;  5DJU A;  3PYP A;  1VHM A;  3B33 A;  3TRC A;  3G6O A;  4MCW A;  5KIZ A;  3RTY A;  1D06 A;  1W63 M;  1XJ6 A;  3R4K A;  1H3Q A;  5DF9 A;  3MF0 A;  3CUE A;  3E4P A;  4IUH A;  3GEC A;  4P6Z S;  1XJ4 A;  3H82 A;  3BWL A;  5HD3 A;  4HOI A;  3H7W B;  1X0O A;  3BQA A;  2NUP C;  4Q0H A;  3EGX C;  3LI8 A;  5HWW A;  4L0L A;  1TF1 A;  2CMN A;  3NOU C;  2JKR M;  4BBV A;  1OTD A;  4EEP A;  3FPW A;  3T4K A;  4G3K A;  4GHI B;  1S1Y A;  2O99 A;  4I5S A;  1Y28 A;  2MJ6 A;  5F6A A;  2VX8 A;  1LL8 A;  2W3D A;  3LID A;  2LB9 A;  1T1A A;  4ETX A;  1NRJ A;  1UWN X;  4KUO A;  3PBR A;  3T4S A;  4WUJ A;  2VA0 A;  1MKM A;  4CLC E;  1G6O A;  2EWV A;  1P97 A;  2K31 A;  3LR0 A;  4PKY A;  4Q0I A;  3OCL A;  2XRO A;  2W0N A;  5TBM A;  4EES A;  2IA2 A;  1H8M A;  3IS2 B;  3LIE A;  3E98 A;  2WKQ A;  4I3I A;  5HD5 A;  2LB5 A;  1DP9 A;  1TS6 A;  4M4X A;  4KQD A;  4HI4 A;  1BYW A;  2HJE A;  4ETZ A;  1W63 Q;  3DBA A;  3MQ0 A;  2BAS A;  4MMN A;  4EU0 A;  3VV4 A;  3EQU A;  2W3E A;  3LIB A;  4CLC C;  2PT7 A;  5DFY A;  2VV8 A;  1S4S A;  3LIC A;  2FZ0 A;  2KOI A;  4H6J A;  1S1Z A;  1S4R A;  2EA9 A;  1EW0 A;  2J3T D;  3H82 B;  4HIA A;  3PBN A;  1JNU A;  1ZHH B;  3OBF A;  4EQ1 A;  1OT9 A;  5IT5 A;  2PHY A;  4R6L A;  4UEY A;  2GX5 A;  3EEH A;  4OOL A;  2W27 A;  4II7 A;  2Z6C A;  2A2L A;  3T4L A;  3UB6 A;  1MC0 A;  3UE3 A;  4FSF A;  4MN5 A;  2VLG A;  1LT0 A;  1WA9 A;  1YSP A;  4ZRR A;  2QJ7 A;  4BBT A;  3H9W A;  2V0W A;  2VEA A;  4HHD A;  3OCN A;  2HGV A;  4EXO A;  5DKK A;  5AVF A;  3PR6 A;  4DMZ A;  5HDC A;  4HQA A;  5I5L A;  4GLQ A;  2I9V A;  5TJJ A;  4HY8 A;  2ZOI A;  1T19 A;  2H28 A;  3A0R A;  3OC2 A;  1VB6 A;  4G3V A;  4NEE D;  2K2N A;  4LRX C;  4JGO A;  4KQO A;  1OTB A;  1D7E A;  4Y5F A;  3CI6 A;  5HZH A;  4IUK A;  3T50 A;  1UGU A;  2INW A;  3BW6 A;  1P0Z A;  3IBJ A;  2R78 A;  5HWT A;  4Y2F A;  3RH8 B;  5IS1 A;  3NOT C;  4R70 A;  3UMD A;  3C8C A;  4ARZ B;  4WEK A;  4G3W A;  3T4O A;  3PHY A;  1OTI A;  1XFN A;  1DP6 A;  1KOU A;  3PBT A;  4JGP A;  1G28 A;  1NLZ A;  3JVV A;  3EQV A;  1T1C A;  3F1O B;  3FC7 A;  4JGR A;  3BY9 A;  5MC7 A;  4HJ6 A;  2XSS A;  5K5B A;  3KX0 X;  3CWF A;  4Q0J A;  3P7N A;  4Z1W A;  1N9O A;  2L4R A;  1N9L A;  3F1P A;  3HCY A;  1S66 L;  3C30 A;  2XRN A;  1GSV A;  3D3O A;  5AVE A;  3KYQ A;  3E4Q A;  2PDR A;  3CAX A;  1P9W A;  2W1T A;  2J3W A;  1IFQ A;  4I38 A;  3KYZ A;  1UWP X;  5HWV A;  4BMW A;  4UQI S;  2GJ3 A;  5L8M A;  1DRM A;  1LSV A;  5DKL A;  2HF6 A;  1N9N A;  1NWZ A;  3LFV A;  1TS7 A;  3A0V A;  2Y8H A;  2HJ9 C;  3PBS A;  4WEJ A;  5DJT A;  2PD7 A;  5DFX A;  3VE4 A;  2FH5 A;  5F5Y A;  1T1B A;  3KO6 A;  3UB7 A;  4F3L B;  3B42 A;  3PBQ A;  4HH2 A;  4XT2 A;  2VKS A;  5CX7 A;  3MQO A;  3B47 A;  3P01 A;  4CLC B;  3C2W A;  3TW8 A;  2QKP A;  5FL3 A;  3ULF A;  1F9I A;  4NKP A;  3LYX A;  1OTA A;  4NXE A;  4L9F A;  3E0Y A;  4GJ4 A;  2L0W A;  5HPF A;  2OWJ A;  2B18 A;  3S7N A;  1OTE A;  3VOL A;  2OOL A;  4OOM A;  1F5M A;  3E4O A;  2ZOH A;  4AFI A;  3EOI A;  4IHQ A;  3S7P A;  5AJG A;  2O0Y A;  4GS9 B;  2O9B A;  2ZMF A;  3BQ8 A;  3NHQ A;  2W3F A;  4IJG A;  3F1N B;  3KSG A;  3R7W A;  3UE6 A;  5J3W A;  5EFW A;  1F98 A;  4BWI A;  2ZMV A;  3RFB A;  2KX6 A;  4B93 A;  3K3D A;  4PAU A;  3BJN A;  1YKD A;  3LR4 A;  2OAQ 1;  2WKR A;  4LLO B;  4MN7 A;  1OT6 A;  2HV1 A;  4WLA A;  2V9A A;  2A24 B;  3MR0 A;  3FPV A;  2W3G A;  4HNB A;  5F69 A;  2PYR A;  2QWS A;  3NOP C;  5IU1 A;  3EEA A;  4PKY G;  2W1R A;  4P6Z M;  2QHK A;  3TJZ C;  2VGL M;  3NJA A;  1LSX A;  4O8G A;  2Z6D A;  3LR3 A;  4HP9 A;  2VV7 A;  4EUV A;  3D72 A;  5F68 A;  5J4E A;  2O9C A;  2W3H A;  4WEL A;  4NXB A;  4MDZ A;  1TS8 A;  2OAP 1;  1GSW A;  3LUQ A;  3GDI A;  4GCZ A;  4UQI M;  3T4Q A;  2KDK A;  4CQH A;  4O0P A;  5HDS A;  3MQQ A;  5A8B A;  3FG8 A;  2D01 A;  4PHT A;  3HJK A;  3C38 A;  1DP8 A;  3CUE C;  4CLC D;  2XA7 M;  3UB9 A;  2M1C A;  4ARZ A;  5KSH A;  4HP4 A;  5J7E A;  4GW9 A;  1OJG A;  2VZW A;  4DJ3 A;  2L1M A;  3KSI A;  1P9R A;  4L9E A;  3F1O A;  4WN5 A;  4I3A A;  3VE3 A;  5C5K A;  4GS9 A;  2KLI A;  3H7W A;  3K3C A;  2XA7 S;  3ZQ5 A;  3W2Z A;  2VJW A;  1LSW A;  3LI9 A;  3F1N A;  3LIA A;  4YNR A;  3O5Y A;  3F1P B;  3KSH A;  3A0S A;  2V1A A;  2Y79 A;  5LBR A;  4B9O A;  4BBU A;  3MXQ A;  4JGQ A;  2B02 A;  4HJ3 A;  4RQ9 A;  3OOV A;  1MZU A;  1V9Z A;  2W1T B;  1STZ A;  2A24 A;  2J3T C;  2JHE A;  2D02 A;  2YKF A;  4HJ4 A;  3KSF A;  3T4J A;  4NXG A;  2P04 A;  3UB8 A;  1XJ2 A;  3EWK A;  3IBR A;  2JKR I;  3LIF A;  4E04 A;  2V1B A;  5TBM B;  3S7Q A;  1TD5 A;  4NXF A;  2ZBB A;  3MFX A;  3IS2 A;  2P08 A;  4FOF A;  4F3L A;  2PR5 A;  4WL9 A;  3PBO A;  5G4Z A;  4XT2 B;  4DJ2 A;  4CLC A;  4R3A A;  2M7U A;  2JKT I;  4LPZ A;  3MJQ A;  5HSQ A;  1NLY A;  1IOU A;  3SW1 A;  5G4Y A;  3BY8 A;  2JN7 A;  2O9A A;  3CIT A;  3T4T A;  4I3J A;  3ICY A;  3U2A A;  4LRZ E;  3MMH A;  3PXP A;  1T18 A;  5HPI A;  2J80 A;  2K7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...