2M1CA

Haddock structure of gtyybt pas homodimer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
113
structure length
113
Chain Sequence
RGSHMRSLHKELQQYISNLSYRVKKVSEEALMQMPIGILLLDEEDKIEWSNRFLAACFKEQTLIGRSLAELSEPLAAFVKKGKTDEEIIELNGKQLKVIVHRHERLLYFFDVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DHH subfamily 1 protein
publication title Solution Structure of the PAS Domain of a Thermophilic YybT Protein Homolog Reveals a Potential Ligand-binding Site.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans
molecule tags Hydrolase
total genus 19
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2m1cA00
3BY9A 3H7WA 3IS2B 3EWKA 2WKQA 1D06A 5AVEA 4GS9B 2ZOIA 3NOPC 2D02A 4HJ4A 2ZBBA 5HD3A 4I39A 4XT2A 4EW7A 4PKYA 4NXGA 2KX6A 1S66L 4L9GA 1S1ZA 1T18A 1UGUA 4L9EA 4WLAA 1DRMA 5F69A 5EFWA 1EW0A 3LICA 1TS7A 3CAXA 1XFQA 1N9NA 4HP9A 3FC7A 4BBVA 1XJ6A 2VV7A 1P97A 3CLOA 5TBMA 1JNUA 5J7EA 1KOUA 3F1NB 4EEPA 2L0WA 2HV1A 1LL8A 4NXEA 2OWJA 3GDIA 1S1YA 4BBTA 3G6OA 1OJ5A 5HWTA 1S4RA 3F1PA 1DP8A 2VLGA 5IU1A 3A0SA 4YWZA 4HHDA 1OTAA 2H28A 5I5LA 2I9VA 3LIFA 4HNBA 1V9YA 3VE4A 2QWSA 3BY8A 2W27A 4HH3A 1OTBA 1XJ2A 4GHIA 4RQ9A 4NXFA 4JGQA 2JHEA 2QHKA 4H6JB 4EETB 3K3DA 2GJ3A 1Y28A 1T1CA 4WUJA 4NXBA 1TS6A 2A24A 3NHQA 4I5SA 4EXOA 1UWPX 4HQAA 3IS2A 1OTDA 2VV6A 1GSXA 3LIEA 4EESA 3ULFA 2K7SA 2JN7A 2M1CA 1V9ZA 4GS9A 2W0NA 3UE6A 4R3AA 5HD5A 3D72A 4EERA 5HWVA 4R38A 5F68A 2PYPA 4K08A 2Z6CA 3NOUC 2ZOHA 1LSVA 3FG8A 4GW9A 4PKYG 3UMEA 2KDKA 3MJQA 1UWNX 2Z6DA 1XJ3A 4LRZE 2QJ5A 1T19A 1TS8A 3LIBA 3P7NA 1F9IA 1P0ZA 1T1AA 4I3IA 2OOLA 3C2WA 1GSWA 4DJ2A 2BASA 2CMNA 2J80A 4HY8A 4L9FA 3F1NA 5AVFA 4I3AA 3MXQA 2OWHA 3E4QA 5HDCA 4MN6A 3F1OB 5G4ZA 5TBMB 3UB8A 1XFNA 1N9OA 3H82B 4KUOA 1BYWA 3VE3A 2PHYA 3E4OA 4LRXC 3LI8A 1OTEA 3BWLA 3RTYA 2PR6A 5J3WA 4GCZA 4LRYC 3GECA 1D7EA 3MFXA 3LYXA 1OJGA 4R6LA 1F98A 4HP4A 3IBRA 3NOTC 1OTIA 4HIAA 3HJKA 5DKKA 4LLOB 3HJIA 1N9LA 2V1BA 2P7JA 5DJTA 4F3LB 2L4RA 1NWZA 2VEAA 3CWFA 4H6JA 5IS1A 4HJ6A 1T1BA 2D01A 2PR5A 2V1AA 3UB7A 2YKHA 3E4PA 3OLOA 4BBUA 4JGRA 4WN5A 1MZUA 1DP9A 2V0UA 4EEUA 2PD8A 5HDSA 3B33A 5DJUA 3LIDA 2INWA 3H7WB 5F6AA 4E04A 5F5YA 2EA9A 4KUKA 1DP6A 2PD7A 1LSWA 3C8CA 3VOLA 4DJ3A 5DKLA 5KIZA 4M4XA 3H9WA 4HJ3A 4XT2B 4I3JA 2WKPA 3NJAA 1LSXA 3KX0X 3LUQA 4HH2A 5HWWA 4WF0A 4I38A 1TS0A 3ICYA 3LI9A 4R70A 1XJ4A 4B9OA 1VB6A 1ODVA 2L1MA 3MR0A 3F1OA 3EEHA 2V9AA 1WA9A 2WKRA 1S4SA 4JGPA 3ZQ5A 1OT6A 3H82A 3A0VA 2B02A 3RH8B 2YKFA 3K3CA 1X0OA 2R78A 5HDDA 5HZHA 3F1PB 5G4YA 1G28A 1GSVA 3MQQA 4KQDA 2PYRA 1LT0A 2QJ7A 4MN5A 2V0WA 3PHYA 3UB9A 4HOIA 2VV8A 3UB6A 3SW1A 3UMDA 4EQ1A 5J4EA 3T50A 4GHIB 4F3LA 2QKPA 2PDRA 4HI4A 3LIAA 3PYPA 5HSQA 4JGOA 5A8BA 1S67L 3A0RA 1OT9A 4LPZA 3MQOA 4WL9A 2A24B
chains in the Genus database with same CATH superfamily
3BY9A 4KZ4A 3EWKA 2X01A 2Y2PA 4O7DA 5HL6A 3IXHA 1IYOA 3NIAA 4BQMA 3NOPC 5KSHA 1Q2PA 4I39A 2VZWA 4XT2A 1KGFA 3VV4A 3UPNA 1G6OA 4NXGA 2KX6A 5GLDA 1BT5A 1YM1A 2ZC3B 1T18A 1TEMA 4EUZA 1G5UA 5FAOA 2Y79A 1PIOA 2K31A 1W63M 5CGXA 3UB5P 3MSHA 1G6AA 5GLBA 5EFWA 2BG1A 1EW0A 3M6BA 3LICA 4DRTA 4HP9A 1H5XA 2VKSA 5FATA 3UO9A 4BBVA 2JCHA 1Y54A 4E3OA 5TBMA 5J7EA 2X71A 2L0WA 3Q7VB 4OPRA 1MWUA 3BFFA 4D60A 3NDGA 1JVJA 1PRQA 5C5KA 5EV0A 4QD4A 4G3VA 1BTLA 4R0QA 1SKFA 3ZYTA 3W4PA 2WGIA 4LCMA 1ES4A 3A0SA 5IU1A 3S7NA 3IH9A 3R4KA 2DMWA 4ARZA 4HNBA 2LB9A 5KZHA 4E3NA 2Y2HA 2WK0A 3VP1A 4JLFA 3L9KA 4IBRA 5EECA 4PM6A 3EOIA 2H0TA 2ZMVA 4RQ9A 4HEFA 2Y8HA 2M7VA 1KE0A 3DTKA 1FSYA 3MS6A 4HBTA 4BLMA 4WYYA 4JF5A 3FKWA 3C30A 4WMCD 2WAEA 1Y28A 4Y15A 4WUJA 4PMAA 1PWCA 2VGLS 4EXOA 1FCMA 4Y13A 1LI0A 2W3EA 3IS2A 1OTDA 4NEED 3T4TA 4M3KA 4EESA 3IF6A 2JN7A 5GL9A 3BJNA 3T1RA 2EX8A 1SDEA 4R3AA 5EUAA 2XDMA 3A3IA 2KLIA 4K08A 2HDRA 2Z6CA 4CLCD 3NOUC 1LSVA 1NZOA 1P9WA 4FH4A 3V67A 1TD5A 5E2FA 4KENB 3S22A 2KDKA 2J3WA 1K4FA 4FOFA 4UEYA 1GHPA 3LCEA 4QY6A 2JKTI 2Y2IA 1BLHA 1YQSA 2H5SA 1XJ3A 2QJ5A 5FDSA 2XD5A 3CUEC 3LIBA 5HAIA 4Z1WA 1T1AA 2OOLA 3S4XA 4DE1A 4KZAA 4H8RA 5AVFA 3WS1A 4UA6A 2ZMFA 1C3BA 3EGXC 4Y0TA 5HAPA 2OWHA 3W4OA 3PR6A 1L0EA 5F82A 2WGWA 5HDCA 5G4ZA 1AXBA 4JBFA 4KQOA 4S2MA 2W3DA 2P9VB 3E0YA 4KQQA 3UDIA 5BOHA 4KUOA 1PI4A 3VE3A 4YOFA 4WZ4A 1XGIA 3OPRA 2WYXA 3TG9A 2GX5A 3VP0A 3BWLA 3RTYA 3ZDJA 4QWOA 5DF7A 5J3WA 3KSFA 3PBRA 4U0XA 3GMWA 3HCYA 3LYXA 3I7JA 4LV1A 5CX7A 1Z09A 2K2NA 1XPBA 1FSWA 5A91A 2RCXA 3IBRA 2Q0OA 3NOTC 4JPMA 3BLMA 5L09A 1N9LA 4OP5A 2P7JA 2L4RA 4KG5A 4H6JA 2B95A 3S7OA 2GNXA 1T1BA 3QP8A 3BYDA 3BFDA 4NK3A 1KE3A 5DTTA 1KDWA 3IHAA 3HUOA 3E4PA 3TRCA 5HARA 3EEAA 2HJ9C 4JGRA 3KO6A 1WE4A 4ETZA 1HLUP 2XA7S 3RFBA 4B4XA 5TFQA 3SH9A 4B4ZA 2O99A 4EEUA 5HDSA 3BRMA 4PM9A 4XXRA 4S2IA 4R1GA 4KZ6A 4X25A 3DWKA 3L7HA 3QP5A 2OLVA 3ZVTA 4KUKA 3IH8A 1LSWA 1IFQA 2WADA 3B47A 5F1FA 4XT2B 4I3JA 2WKPA 4LCLA 1A0KA 5EPHA 2HZ5A 1TF1A 2QZ6A 3LUQA 4HH2A 1GA0A 4WF0A 1GCEA 2ZL1A 2XGNA 1YLJA 1I2SA 4CLCC 3QP2A 2XK1A 3CPTA 1S0WA 2H0YA 3BM6A 2ZQ7A 1Y4OA 2EX9A 2XFTA 3LEQA 3MXRA 2V8CA 1PZPA 2HJEA 3MR0A 3EEHA 5TR7A 1CQAA 4IBXA 1K54C 1E3UD 4OQGA 1NLYA 1ZC2A 1S4SA 3T1QB 3BLSA 3LY3A 3M6HA 4LV0A 3H82A 3A0VA 1PW8A 2B02A 4OP8A 3HBRA 5I94A 4BWIA 2XROA 1PFLA 2FH5A 2R78A 1JWPA 3HUNA 3N8RA 2J3TD 5HZHA 1HVBA 5EM0A 3ZHHA 4E3LA 3B3XA 1CJFA 1GSVA 1QMFA 2PBDP 2UV0E 4KQDA 3HREA 3B42A 2V20A 2QJ7A 4ARZB 5EVIA 3UB9A 1BZAA 3O87A 3IWOA 4R3BA 3FZCA 3SW1A 3G2ZA 3UMDA 1YSPA 4EQ1A 4GOGA 1HD8A 4X68A 4P0MA 3UN7A 3ZFZA 4E3IA 2QKPA 4KZBA 1N4OA 4QHCA 4BL2A 2PDRA 5CHJA 1J9MA 5AQ9A 3LIAA 2WZZA 2FZ0A 3UPOA 3U2AA 4JGOA 3IX8A 4XUXA 3DBAA 1LLBA 2XD1A 4ME4A 2Y2QA 1OT9A 3SH8A 2NUPC 2EWWA 4WL9A 4HBUA 3VSLA 5GLAA 3TOIA 2V2FF 4WM9A 4CJNA 3IS2B 3V39A 3DTEA 4EBPA 4LV2A 3KSHA 1PNEA 4CLCE 2ZQ8A 3IF6B 4G3KA 4A5RA 1L0GA 2UWXA 5JYOA 2JC7A 4PKYA 5G18A 4UQIS 2XH9A 4MBHA 4X69A 1U60A 5DFXA 3MMHA 2HP6A 5FQIA 4OQIA 4MBKA 1XFQA 1EI5A 1CEFA 2R9XA 1YLTA 1IOUA 4PM7A 3EQVA 3UY6A 1LL9A 3ISGA 3LFVA 2O9BA 3HLWA 1BLSA 1JNUA 3RJUA 4ZTKA 3VMAA 4EEPA 2ZQDA 4O0PA 4WBGA 2PBYA 2WGWB 3G6OA 1OJ5A 5A92A 5EOOA 1D1JA 5EE8A 1XKZA 4GDBA 2GDNA 4X6TA 1S4RA 3F1PA 3G35A 2VLGA 4F94A 3T4LA 4GD6A 1BULA 5I5LA 2I9VA 4MEZA 4FCFA 4QJGA 4WELA 2QWSA 2ZJ9A 4WZ5A 1GHIA 5FASA 2I72A 2Q9MA 1K56D 1K57C 3ZGAB 5FI6A 5CHMA 4JGQA 3U4LP 1ZTUA 2QHKA 1RGZA 4YNRA 1I2WA 1NJ4A 5CERA 3S7QA 3PAGA 4RX2A 4H6JB 2Z2MB 4EETB 2EFXA 1TS6A 2WAFA 1K25A 1NYYA 2A24A 5FSRA 2WZXA 5CGSA 4FUWA 4HQAA 1ES3A 2VV6A 4II7A 2VJWA 5IT5A 2WKIA 3KSGA 2K7SA 2M1CA 4GS9A 3AGDA 4OPQA 1DY6A 1H3QA 5HD5A 3HL9A 2ZQAA 1PW1A 4QY5A 2IWDA 2W3GA 3IX3A 2C5WB 3T4KA 4EBNA 2ZOHA 4GW9A 4PKYG 1J3WA 5DFYA 3AGFA 3S1YA 3UMEA 3V3RA 2ZC5B 3EQUA 4P6ZS 1FR6A 3IF5A 1VQQA 2Z6DA 4DMZA 5DF8A 4EQIA 4O8GA 2P04A 4GLQA 1T19A 1M6KA 1F9IA 2ZL1B 5CGWA 4R4SA 3N8LA 3CPTB 2P74A 2CMNA 5FQMA 4FSFA 4L9FA 2PU2A 2HP5A 3GQZA 4GZBA 1BLPA 3V3SA 2Y2KA 3BQAA 3FPWA 2RL3A 3JYIA 4EUVA 3CG5A 4O01A 1ONHA 3WRTA 2DNSA 1VEUA 1XFNA 4PAUA 3QNCA 3H82B 3UPPA 1BYWA 1IKIA 4GNUA 3E4OA 4LRXC 1SHVA 5FI2A 3GV9A 4Y7PA 1I5QA 2P08A 3BEBA 4B88A 2HPBA 2PR6A 2HDUA 5HL1A 1L2SA 2IWCA 1D7EA 1YPRA 4E6WA 5EVIB 2W3HA 1DJAA 2A3UA 5M19A 4HP4A 3MF0A 4NG2A 4HIAA 1QMEA 1H8YA 2ACGA 5DKKA 5TGFA 2XLNA 1NWZA 1ERMA 3CWFA 2VGKA 1PZOA 4MLLA 5KMWA 2PU4A 5L07A 1K54A 4BBUA 1NLZA 3WS5A 4DDYA 2JKGA 2PD8A 1CK3A 5GHYA 2ZMAA 2HP9A 5DJUA 2ZC7A 4K91A 3ITAA 2INWA 4E04A 4OH0A 4OVDA 1TDGA 3QNBA 2QYBA 4G3WA 2PD7A 2EX2A 3C8CA 3LR5A 3NECA 5DKLA 4M4XA 1YKDA 1LI9A 3LO7A 3C5AA 4LENA 4OOLA 1F2KA 3JVUA 2NUTC 2W1TA 3C4OA 4YINA 4KQRA 5HWWA 4S2NA 1RGYA 1KGEA 3QP6A 4S2OA 3ICYA 3VP4A 4EBLA 2EXAA 1XJ4A 3N8SA 4B9OA 2XEPA 3T1SA 2BTFP 4OQHA 4E3MA 1FOFA 1ODVA 2DRWA 2L1MA 3E2KA 4FTXA 5LBRA 4PHTA 3F1OA 5AQAA 2WKRA 4Q0IA 3SS5A 1OT6A 5IHVA 3RH8B 1IYSA 1W8QA 5GHZA 2WUQA 3G2YA 2VK3A 2G2UA 3F1PB 1G28A 3MQQA 5EVLA 4IVKA 4S2PA 3Q07A 2V0WA 3PHYA 2J8YA 1YT4A 3NI9A 5TJJA 1SZVA 3BQ8A 4OLGA 4F3LA 3DWZA 3MFDA 3OPLA 4C75A 1XA1A 4HI4A 3BECA 1FIKA 5FQ9A 5A8BA 4IUKA 1L0FA 3MXSA 4EV4A 2JKTM 2A24B 5CECA 3Q7ZA 2ZM0A 4GD8A 3TSGA 4ESPA 4MN7A 1IELA 1ONGA 1D06A 5AVEA 2Y2GA 4MNRA 4GS9B 3WS0A 2VX8A 4X53A 2HGVA 3T4JA 4HJ4A 4RX3A 2ZBBA 3MQ0A 5HD3A 4E3JA 3P09A 4KZ8A 3ZG9B 4ZBEA 1ERQA 4BD0A 1ACFA 1CEGA 1YLYA 1S66L 1IYQA 3KSIA 5K5BA 1W79A 3DAVA 1GA9A 1NXYA 1LHYA 4GDNA 1UGUA 3RXXA 4KZ7A 5FDHA 4L9EA 4UA9A 4L0LA 3TJZC 4WLAA 1DRMA 4JXVA 5CEDA 5FI7A 5E2EA 2HDQA 4KZ3A 1N9NA 3FC7A 1MKMA 3WS2A 5HPFA 4GJ4A 4GKUA 1VM1A 1P97A 1MBLA 3V50A 2J9OA 3LR0A 2HV1A 3VFFA 3HLGA 1LL8A 4NXEA 4Q0HA 2OWJA 1NRJA 3ZNYA 4OOYA 1FR1A 3LR3A 3DW0A 2Y91A 1VEUB 4S2JA 2VGLM 5U47A 5FQJA 1L0DA 4Z9QA 4YWZA 1JWZA 3IF6C 2H28A 3R7WA 1ZG4A 3LIFA 5A90A 3VE4A 3SZTA 2EWVA 3BY8A 4PM8A 4BJPA 4HH3A 3BFCA 4GHIA 1PI5A 4X1MA 4NXFA 1CI9A 1W5DA 5E43A 1K0KA 5M1AA 4ETXA 5FQQA 5JYPA 3K3DA 1T1CA 1N9BA 4P85A 4NXBA 4BD1A 4I5SA 1VETA 3T4SA 1IYPA 1ESUA 1UWPX 2OLUA 1PYYA 1W8YA 3G32A 3ULFA 1RP5A 2Y2OA 4KG6A 4QPRA 1VHMA 3W4QA 1V9ZA 2Y55A 3UE6A 4Q8IA 3IXDA 3IBJA 3OOVA 5HWVA 4N1XA 4OOMA 4FD8A 5EVID 3NY4A 4JF4A 3MBZA 1OPXA 1KGGA 1KVMA 3K2NA 2J7VA 1K38A 3MJQA 1UWNX 3M2KA 4IJGA 1IEMA 3N7WA 3UNWA 2W1TB 4UHUA 4LRZE 3UDXA 3T1XA 3BFEA 2Q9NA 5HW3A 3P7NA 1PWGA 1YLZA 4I3IA 3C2WA 3BFGA 1BUEA 1H8ZA 4DJ2A 3O3VA 4HY8A 3F1NA 3C7UA 1XA7A 1FILA 5A93A 4MN6A 3F1OB 4R4RA 3MKEA 2JKFA 4OONA 3UB8A 3FV7A 3UE3A 3QP1A 5EM1A 1BLCA 1ZKJA 2VA0A 4PPRA 4N1HA 4RVAA 2PHYA 3O5YA 3CJMA 3FYZA 3LI8A 2JKRM 1OTEA 2WKHA 2XA7M 3PTEA 3HLCA 3GR2A 3CUEA 3EGDC 4UAAA 3D3OA 1ES5A 2V1ZA 3G31A 4R6LA 1F98A 5HPIA 1S6RA 2ZLYA 3PBTA 2J3TC 1XP4A 3CMZA 1OTIA 2DCFA 3HJKA 3KYZA 3LR4A 5E2GA 3FWLA 2V1BA 2ZM2A 2OV5A 5DJTA 4F3LB 4Y2FA 4ZJ1A 4HJ6A 4GB7A 3A3FA 2PR5A 2V1AA 1JWVA 4DE3A 4RA7A 1NY0A 3OLOA 2XQZA 3C7VA 1MPLA 4DE0A 4WN5A 5CTNA 2E8JA 1DP9A 3OC2A 5F83A 2FFFB 4IHQA 1NRFA 3B33A 1HZOA 2PAVP 3NCKA 2A49A 1MKIA 3KYEA 1K6SA 3MKFA 3UDFA 3OPHA 1Z6FA 3PBQA 1DP6A 5M18A 3IXBA 3VOLA 4DJ3A 2X02A 4NKPA 3HLBA 1M40A 3T4QA 4AFIA 1PWDA 4X55A 3GSGA 3S7PA 3NJAA 3VFHA 1LSXA 1P9RA 3KYQA 2OSUA 1Q2QA 4I38A 3GVBA 2EXBA 3LI9A 5EVIC 1VB6A 3OBFA 1DJCA 5GLCA 1K55C 3Q81A 2B5RA 2ZQ9A 3O86A 3ZVWA 3WS4A 2IWBA 5HX9A 4WMCA 1ESIA 4N9KA 3N4IA 1SDNA 2XF3A 2IA2A 5FQKA 4S2LA 3T12B 1EWZA 5DTSA 2QPNA 5DTKA 2YKFA 3HLDA 3C38A 2EX6A 3K3CA 3PAEA 3VP2A 3SH7A 5CXWA 4RYEA 3BW6A 2XSSA 5G4YA 3M2JA 5L8MA 4MN5A 5DF9A 3R7WB 4C3QA 4CLCA 4KG2A 3ZG7B 5J4EA 5CHUA 1E25A 1MWRA 1HTZA 5GHXA 1STZA 4IVIA 1CF0A 4MDZA 3GRJA 3PBOA 4GHIB 5AQ7A 2EFUA 2WGVA 2O9CA 4UQIM 4Y0OA 1O7EA 3FKVA 1E4DA 5HSQA 3E2LA 3A3JA 3G4PA 3ZG5A 5J8XA 5CTMA 2Y59A 3MQOA 5AQBA 1VETB 4GN2A 3H7WA 1WYBA 4XUZA 3VOYA 2WKQA 3RXWA 2ZOIA 2D02A 2JBFA 3CZDA 2GZAA 4DN0A 2XRNA 3SOIA 5L2FA 4EW7A 2Y4AA 4JXSA 3Q1FA 2QMIA 3Q82A 4L9GA 5L10A 1S1ZA 2H10A 4HESA 4JF6A 3G30A 1NYMA 4LFUA 4IEDA 3ITBA 5F69A 4CQHA 3LEZA 3IWQA 3UE1A 1MXOA 1TS7A 3A3EA 3CAXA 4WZ5C 4WEJA 4DE2A 5EVEA 1TVFA 2J9PA 4Y17A 1XJ6A 1W63Q 2VV7A 5MC7A 3CLOA 1KOUA 3F1NB 4OKPA 1G68A 1TDLA 3GDIA 3MZDA 3WWXA 1S1YA 1YLPA 5CRFA 2LB5A 4BBTA 5D3OA 5HWTA 1MC0A 3ZNTA 1MWSA 3VOZA 4MBFA 1DP8A 4Y3IA 4R23A 4HHDA 1OTAA 2E8IA 3SS3A 1H0MA 4DXCA 3IXGA 2VGJA 5HAQA 5FEFA 4FH2A 4OQ0A 1V9YA 2Y2NA 4OPZA 4ID4A 1GHMA 4R3JA 2W27A 4Y5FA 1OTBA 1SKOA 1XJ2A 1YLWA 5KSCA 2Y2JA 4DKIA 3CHWP 1O07A 4YFMA 3OPPA 3ZG0A 3IX4A 4ZJ3A 2JHEA 2JE5A 2KOIA 4P6ZM 3W2ZA 3SS4A 2GJ3A 3IQAA 3AGEA 3VP3A 3NHQA 1YMSA 4BENA 3LGOA 3OCNA 4JXWA 1GSXA 3LIEA 4NETA 4K0XA 4K0WA 3PBSA 2W0NA 1E3UA 3D72A 4EERA 4R38A 3D4FA 5F68A 2PYPA 4EWFA 2G7UA 2ZD8A 3FG8A 1ZHHB 1K57A 4ZDXA 4X1LA 5E2HA 1SCWA 2M7UA 3P98A 2HDSA 3HLEA 1YMXA 4QU3A 1TS8A 4EU0A 1P0ZA 3CI6A 4P6BA 1GSWA 3IHBA 3QHYA 3C4PA 2BASA 2ZM8A 3QP4A 2J80A 3Q7VA 3ZCZA 3TW8A 4CPKA 4I3AA 2PRFA 3MXQA 3E4QA 1F5MA 2Z2LB 4JXGA 1OMEA 4UA7A 4LV3A 5CEBA 5TBMB 4WEKA 4DF6A 2PT7A 4Q0JA 3VSKA 5FL3A 1N9OA 4D2OA 3OCLA 2O0YA 1ES2A 3PXPA 4BMWA 3DTIA 2ZC4B 5FA7A 3GTCA 4OPYA 4DDSA 4LGWA 3A3DA 4PM5A 2OAP1 4GCZA 1BSGA 4LRYC 3GECA 3MFXA 4KZ5A 2R9WA 2XFSA 1OJGA 3G34A 4CLCB 5FAQA 3MZFA 2CC1A 2W1RA 3O88A 3HLFA 1WYCA 4LLOB 3HJIA 4JKTA 3T4OA 3NC8A 2Y2LA 5F1GA 2V8FA 1ZG6A 2B18A 2VEAA 3D9YA 5IS1A 3TE8A 1K55A 2D01A 1MWTA 1XX2A 1MY8A 2AVXA 4S2NC 2WKEA 4QB8A 3UB7A 2YKHA 3E98A 4ZJ2A 3FPVA 2JKRI 5EOEA 4BL3A 1MZUA 4C6YA 2V0UA 1JTGA 4X56A 3ZG8B 5HFOA 1LL5A 4KZ9A 3LIDA 3V5MA 3H7WB 1CI8A 4N92A 5F6AA 4S2KA 1L3LA 1XGJA 4ZAMA 5F5YA 2W3FA 2EA9A 1EROA 3IT9A 1FCNA 3UE0A 5FAPA 5KIZA 5FEGA 3H9WA 4HJ3A 1FCOA 1KE4A 1RCJA 2A2LA 3HVFA 1XXMA 2G2WA 3NULA 3MZEA 3KX0X 1YSQA 2ZQCA 2ZC6B 3LY4A 4P87A 1ALQA 3OZHA 2Y2MA 1TS0A 4R70A 4B93A 4ZRRA 3HUMA 4MMNA 3JPUA 2MJ6A 1K56A 3N6IA 1W7FA 1K6RA 4U0TA 3JVVA 2FFYA 4MCWA 4IUHA 1KDSA 2V9AA 3P01A 1WA9A 4JGPA 3ZQ5A 2P9VA 2XR0A 3DTMA 1X0OA 2BLSA 4U3TA 1YAXA 5HDDA 1DJBA 1K4EA 3PBNA 4DXBA 3W8KA 1KVLA 4Y0UA 2PYRA 1H8MA 1LT0A 4OLDA 1JTDA 4HOIA 2VV8A 2HF6A 5DVAA 3UB6A 1AWIA 1FQGA 3NBLA 4N9LA 3T50A 1SKOB 4E3KA 3NDEA 2O9AA 3WRZA 2C6WB 4E6XA 3PYPA 1S67L 3A0RA 3IWIA 2OAQ1 3CITA 5AJGA 4LPZA 1NZUA 1IKGA
chains in the Genus database with same CATH topology
3BY9A 3H7WA 3IS2B 3EWKA 4MN7A 3KSHA 2WKQA 1D06A 5AVEA 4CLCE 5HL6A 4G3KA 4GS9B 2VX8A 2ZOIA 3NOPC 2D02A 2HGVA 3T4JA 4HJ4A 2GZAA 5KSHA 2ZBBA 3MQ0A 5HD3A 4I39A 4DN0A 2VZWA 2XRNA 4XT2A 4EW7A 3VV4A 1G6OA 4NXGA 4PKYA 2KX6A 4UQIS 1S66L 4L9GA 3KSIA 5K5BA 1S1ZA 1T18A 5DFXA 1UGUA 3MMHA 2Y79A 4L9EA 2K31A 4L0LA 3TJZC 1W63M 4WLAA 1DRMA 5F69A 5EFWA 4CQHA 1EW0A 3LICA 1TS7A 3CAXA 1XFQA 4WEJA 1N9NA 4HP9A 3FC7A 2VKSA 1IOUA 1MKMA 4BBVA 3EQVA 5HPFA 1XJ6A 1W63Q 2VV7A 4GJ4A 1P97A 5MC7A 3CLOA 2O9BA 3LFVA 5TBMA 1JNUA 5J7EA 1KOUA 3F1NB 4EEPA 2L0WA 3LR0A 2HV1A 1LL8A 4NXEA 4Q0HA 2OWJA 4O0PA 3GDIA 1S1YA 1NRJA 2LB5A 5C5KA 4BBTA 3G6OA 1OJ5A 4G3VA 3LR3A 5HWTA 1MC0A 2VGLM 3ZYTA 1S4RA 3F1PA 1DP8A 2VLGA 5IU1A 3A0SA 3S7NA 4YWZA 4Y3IA 4HHDA 1OTAA 3T4LA 2H28A 3R4KA 5I5LA 3R7WA 2I9VA 2DMWA 4ARZA 3LIFA 4HNBA 2LB9A 1V9YA 3VE4A 4WELA 2EWVA 2QWSA 3BY8A 2W27A 4Y5FA 4BJPA 4HH3A 1OTBA 1XJ2A 3EOIA 4GHIA 2ZMVA 4RQ9A 2Y8HA 2M7VA 4NXFA 4JGQA 1ZTUA 2JHEA 2QHKA 4YNRA 3C30A 3S7QA 4ETXA 4H6JB 2KOIA 4P6ZM 4EETB 3W2ZA 3K3DA 2GJ3A 1Y28A 1T1CA 4WUJA 4NXBA 1TS6A 2A24A 2VGLS 3NHQA 4I5SA 4EXOA 2W3EA 3T4SA 1UWPX 4HQAA 3IS2A 1OTDA 3OCNA 2VV6A 4NEED 3T4TA 4II7A 2VJWA 5IT5A 1GSXA 3KSGA 3LIEA 4EESA 3ULFA 2K7SA 2JN7A 4QPRA 2M1CA 3PBSA 1VHMA 3BJNA 1V9ZA 4GS9A 2W0NA 3UE6A 1H3QA 4R3AA 5HD5A 3D72A 3IBJA 4EERA 3OOVA 5HWVA 4R38A 4OOMA 5F68A 2PYPA 2KLIA 4K08A 2W3GA 2Z6CA 4CLCD 3NOUC 3T4KA 2ZOHA 1LSVA 2G7UA 3FG8A 4GW9A 4PKYG 1P9WA 1OPXA 5DFYA 3V67A 1TD5A 1ZHHB 3UMEA 3K2NA 2KDKA 2J3WA 2M7UA 3MJQA 1UWNX 4FOFA 4UEYA 4IJGA 3EQUA 4P6ZS 2JKTI 2W1TB 2Z6DA 4DMZA 1XJ3A 4LRZE 4O8GA 2QJ5A 2P04A 4GLQA 3CUEC 1T19A 1TS8A 3LIBA 3P7NA 4EU0A 4Z1WA 1F9IA 1P0ZA 1T1AA 3CI6A 4I3IA 2OOLA 3C2WA 1GSWA 4DJ2A 2BASA 2CMNA 4FSFA 2J80A 4HY8A 4L9FA 3F1NA 5AVFA 3TW8A 2ZMFA 4I3AA 3EGXC 3MXQA 2OWHA 3BQAA 3FPWA 3PR6A 3E4QA 1F5MA 4MN6A 3F1OB 5HDCA 4EUVA 4O01A 5G4ZA 4WEKA 5TBMB 2PT7A 4Q0JA 3UB8A 3UE3A 5FL3A 4PAUA 1XFNA 1N9OA 4KQOA 2W3DA 3E0YA 3H82B 3OCLA 4KUOA 2VA0A 2O0YA 3PXPA 1BYWA 3VE3A 4YOFA 2PHYA 3E4OA 4LRXC 4BMWA 3O5YA 2GX5A 3LI8A 2JKRM 1OTEA 2XA7M 2P08A 3BWLA 3RTYA 2PR6A 2OAP1 5J3WA 4GCZA 3KSFA 4LRYC 3PBRA 3GECA 1D7EA 3CUEA 3EGDC 3D3OA 3MFXA 3HCYA 3LYXA 5CX7A 2K2NA 1OJGA 2W3HA 4R6LA 1F98A 5HPIA 4HP4A 4CLCB 3IBRA 3PBTA 2J3TC 3MF0A 3NOTC 2W1RA 1OTIA 4HIAA 3HJKA 5DKKA 3KYZA 4LLOB 3HJIA 1N9LA 3LR4A 3T4OA 2V1BA 2P7JA 5DJTA 4F3LB 4Y2FA 2L4RA 1NWZA 2B18A 2VEAA 3CWFA 4H6JA 3TE8A 5IS1A 3S7OA 2GNXA 1T1BA 2D01A 4HJ6A 2PR5A 2V1AA 3UB7A 2YKHA 3E4PA 3TRCA 3E98A 2HJ9C 3EEAA 3OLOA 4BBUA 1NLZA 3FPVA 4JGRA 3KO6A 2JKRI 4WN5A 4ETZA 1MZUA 2XA7S 3RFBA 1DP9A 3OC2A 2V0UA 2O99A 4IHQA 4EEUA 2PD8A 5HDSA 3B33A 5DJUA 3LIDA 2INWA 3H7WB 5F6AA 4E04A 5F5YA 2QYBA 3PBQA 2W3FA 2EA9A 4KUKA 1DP6A 4G3WA 2PD7A 1LSWA 3C8CA 1IFQA 3LR5A 3VOLA 3B47A 4DJ3A 5DKLA 5KIZA 4M4XA 1YKDA 4NKPA 4OOLA 3H9WA 3JVUA 4HJ3A 4XT2B 3T4QA 4I3JA 2NUTC 4AFIA 2WKPA 2A2LA 2W1TA 3S7PA 1TF1A 3NJAA 1LSXA 1P9RA 3KYQA 3KX0X 1YSQA 3LUQA 4HH2A 5HWWA 4WF0A 4I38A 1TS0A 3ICYA 3LI9A 4R70A 1XJ4A 4B9OA 4CLCC 1VB6A 3OBFA 4B93A 4ZRRA 4MMNA 2MJ6A 1ODVA 2L1MA 3JVVA 5LBRA 4PHTA 4MCWA 2HJEA 3MR0A 4IUHA 3F1OA 3EEHA 2V9AA 3P01A 1WA9A 1NLYA 2WKRA 1S4SA 2IA2A 4Q0IA 4JGPA 3ZQ5A 1OT6A 3H82A 3A0VA 2B02A 3RH8B 2YKFA 3C38A 3K3CA 4BWIA 2XROA 1X0OA 2FH5A 2R78A 5HDDA 1YAXA 2J3TD 5HZHA 3PBNA 3BW6A 3F1PB 2XSSA 1G28A 5G4YA 1GSVA 3MQQA 4KQDA 3B42A 2PYRA 1H8MA 5L8MA 1LT0A 2QJ7A 4MN5A 5DF9A 3R7WB 4ARZB 2V0WA 3PHYA 3UB9A 4HOIA 2VV8A 2HF6A 4CLCA 3UB6A 3SW1A 3UMDA 1YSPA 4EQ1A 5J4EA 5TJJA 1STZA 3T50A 4MDZA 3PBOA 4GHIB 3BQ8A 4F3LA 2O9AA 2O9CA 2QKPA 4UQIM 2PDRA 4HI4A 3LIAA 3PYPA 2FZ0A 5HSQA 3U2AA 4JGOA 5A8BA 4IUKA 1S67L 3A0RA 3DBAA 2OAQ1 3CITA 4ME4A 5AJGA 1OT9A 2NUPC 2EWWA 4LPZA 2JKTM 3MQOA 4WL9A 2A24B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY9 A;  3H7W A;  3IS2 B;  3EWK A;  2WKQ A;  1D06 A;  5AVE A;  4GS9 B;  2ZOI A;  3NOP C;  2D02 A;  4HJ4 A;  2ZBB A;  5HD3 A;  4I39 A;  4XT2 A;  4EW7 A;  4PKY A;  4NXG A;  2KX6 A;  1S66 L;  4L9G A;  1S1Z A;  1T18 A;  1UGU A;  4L9E A;  4WLA A;  1DRM A;  5F69 A;  5EFW A;  1EW0 A;  3LIC A;  1TS7 A;  3CAX A;  1XFQ A;  1N9N A;  4HP9 A;  3FC7 A;  4BBV A;  1XJ6 A;  2VV7 A;  1P97 A;  3CLO A;  5TBM A;  1JNU A;  5J7E A;  1KOU A;  3F1N B;  4EEP A;  2L0W A;  2HV1 A;  1LL8 A;  4NXE A;  2OWJ A;  3GDI A;  1S1Y A;  4BBT A;  3G6O A;  1OJ5 A;  5HWT A;  1S4R A;  3F1P A;  1DP8 A;  2VLG A;  5IU1 A;  3A0S A;  4YWZ A;  4HHD A;  1OTA A;  2H28 A;  5I5L A;  2I9V A;  3LIF A;  4HNB A;  1V9Y A;  3VE4 A;  2QWS A;  3BY8 A;  2W27 A;  4HH3 A;  1OTB A;  1XJ2 A;  4GHI A;  4RQ9 A;  4NXF A;  4JGQ A;  2JHE A;  2QHK A;  4H6J B;  4EET B;  3K3D A;  2GJ3 A;  1Y28 A;  1T1C A;  4WUJ A;  4NXB A;  1TS6 A;  2A24 A;  3NHQ A;  4I5S A;  4EXO A;  1UWP X;  4HQA A;  3IS2 A;  1OTD A;  2VV6 A;  1GSX A;  3LIE A;  4EES A;  3ULF A;  2K7S A;  2JN7 A;  2M1C A;  1V9Z A;  4GS9 A;  2W0N A;  3UE6 A;  4R3A A;  5HD5 A;  3D72 A;  4EER A;  5HWV A;  4R38 A;  5F68 A;  2PYP A;  4K08 A;  2Z6C A;  3NOU C;  2ZOH A;  1LSV A;  3FG8 A;  4GW9 A;  4PKY G;  3UME A;  2KDK A;  3MJQ A;  1UWN X;  2Z6D A;  1XJ3 A;  4LRZ E;  2QJ5 A;  1T19 A;  1TS8 A;  3LIB A;  3P7N A;  1F9I A;  1P0Z A;  1T1A A;  4I3I A;  2OOL A;  3C2W A;  1GSW A;  4DJ2 A;  2BAS A;  2CMN A;  2J80 A;  4HY8 A;  4L9F A;  3F1N A;  5AVF A;  4I3A A;  3MXQ A;  2OWH A;  3E4Q A;  5HDC A;  4MN6 A;  3F1O B;  5G4Z A;  5TBM B;  3UB8 A;  1XFN A;  1N9O A;  3H82 B;  4KUO A;  1BYW A;  3VE3 A;  2PHY A;  3E4O A;  4LRX C;  3LI8 A;  1OTE A;  3BWL A;  3RTY A;  2PR6 A;  5J3W A;  4GCZ A;  4LRY C;  3GEC A;  1D7E A;  3MFX A;  3LYX A;  1OJG A;  4R6L A;  1F98 A;  4HP4 A;  3IBR A;  3NOT C;  1OTI A;  4HIA A;  3HJK A;  5DKK A;  4LLO B;  3HJI A;  1N9L A;  2V1B A;  2P7J A;  5DJT A;  4F3L B;  2L4R A;  1NWZ A;  2VEA A;  3CWF A;  4H6J A;  5IS1 A;  4HJ6 A;  1T1B A;  2D01 A;  2PR5 A;  2V1A A;  3UB7 A;  2YKH A;  3E4P A;  3OLO A;  4BBU A;  4JGR A;  4WN5 A;  1MZU A;  1DP9 A;  2V0U A;  4EEU A;  2PD8 A;  5HDS A;  3B33 A;  5DJU A;  3LID A;  2INW A;  3H7W B;  5F6A A;  4E04 A;  5F5Y A;  2EA9 A;  4KUK A;  1DP6 A;  2PD7 A;  1LSW A;  3C8C A;  3VOL A;  4DJ3 A;  5DKL A;  5KIZ A;  4M4X A;  3H9W A;  4HJ3 A;  4XT2 B;  4I3J A;  2WKP A;  3NJA A;  1LSX A;  3KX0 X;  3LUQ A;  4HH2 A;  5HWW A;  4WF0 A;  4I38 A;  1TS0 A;  3ICY A;  3LI9 A;  4R70 A;  1XJ4 A;  4B9O A;  1VB6 A;  1ODV A;  2L1M A;  3MR0 A;  3F1O A;  3EEH A;  2V9A A;  1WA9 A;  2WKR A;  1S4S A;  4JGP A;  3ZQ5 A;  1OT6 A;  3H82 A;  3A0V A;  2B02 A;  3RH8 B;  2YKF A;  3K3C A;  1X0O A;  2R78 A;  5HDD A;  5HZH A;  3F1P B;  5G4Y A;  1G28 A;  1GSV A;  3MQQ A;  4KQD A;  2PYR A;  1LT0 A;  2QJ7 A;  4MN5 A;  2V0W A;  3PHY A;  3UB9 A;  4HOI A;  2VV8 A;  3UB6 A;  3SW1 A;  3UMD A;  4EQ1 A;  5J4E A;  3T50 A;  4GHI B;  4F3L A;  2QKP A;  2PDR A;  4HI4 A;  3LIA A;  3PYP A;  5HSQ A;  4JGO A;  5A8B A;  1S67 L;  3A0R A;  1OT9 A;  4LPZ A;  3MQO A;  4WL9 A;  2A24 B; 
#chains in the Genus database with same CATH topology
 3BY9 A;  4KZ4 A;  3EWK A;  2X01 A;  2Y2P A;  4O7D A;  5HL6 A;  3IXH A;  1IYO A;  3NIA A;  4BQM A;  3NOP C;  5KSH A;  1Q2P A;  4I39 A;  2VZW A;  4XT2 A;  1KGF A;  3VV4 A;  3UPN A;  1G6O A;  4NXG A;  2KX6 A;  5GLD A;  1BT5 A;  1YM1 A;  2ZC3 B;  1T18 A;  1TEM A;  4EUZ A;  1G5U A;  5FAO A;  2Y79 A;  1PIO A;  2K31 A;  1W63 M;  5CGX A;  3UB5 P;  3MSH A;  1G6A A;  5GLB A;  5EFW A;  2BG1 A;  1EW0 A;  3M6B A;  3LIC A;  4DRT A;  4HP9 A;  1H5X A;  2VKS A;  5FAT A;  3UO9 A;  4BBV A;  2JCH A;  1Y54 A;  4E3O A;  5TBM A;  5J7E A;  2X71 A;  2L0W A;  3Q7V B;  4OPR A;  1MWU A;  3BFF A;  4D60 A;  3NDG A;  1JVJ A;  1PRQ A;  5C5K A;  5EV0 A;  4QD4 A;  4G3V A;  1BTL A;  4R0Q A;  1SKF A;  3ZYT A;  3W4P A;  2WGI A;  4LCM A;  1ES4 A;  3A0S A;  5IU1 A;  3S7N A;  3IH9 A;  3R4K A;  2DMW A;  4ARZ A;  4HNB A;  2LB9 A;  5KZH A;  4E3N A;  2Y2H A;  2WK0 A;  3VP1 A;  4JLF A;  3L9K A;  4IBR A;  5EEC A;  4PM6 A;  3EOI A;  2H0T A;  2ZMV A;  4RQ9 A;  4HEF A;  2Y8H A;  2M7V A;  1KE0 A;  3DTK A;  1FSY A;  3MS6 A;  4HBT A;  4BLM A;  4WYY A;  4JF5 A;  3FKW A;  3C30 A;  4WMC D;  2WAE A;  1Y28 A;  4Y15 A;  4WUJ A;  4PMA A;  1PWC A;  2VGL S;  4EXO A;  1FCM A;  4Y13 A;  1LI0 A;  2W3E A;  3IS2 A;  1OTD A;  4NEE D;  3T4T A;  4M3K A;  4EES A;  3IF6 A;  2JN7 A;  5GL9 A;  3BJN A;  3T1R A;  2EX8 A;  1SDE A;  4R3A A;  5EUA A;  2XDM A;  3A3I A;  2KLI A;  4K08 A;  2HDR A;  2Z6C A;  4CLC D;  3NOU C;  1LSV A;  1NZO A;  1P9W A;  4FH4 A;  3V67 A;  1TD5 A;  5E2F A;  4KEN B;  3S22 A;  2KDK A;  2J3W A;  1K4F A;  4FOF A;  4UEY A;  1GHP A;  3LCE A;  4QY6 A;  2JKT I;  2Y2I A;  1BLH A;  1YQS A;  2H5S A;  1XJ3 A;  2QJ5 A;  5FDS A;  2XD5 A;  3CUE C;  3LIB A;  5HAI A;  4Z1W A;  1T1A A;  2OOL A;  3S4X A;  4DE1 A;  4KZA A;  4H8R A;  5AVF A;  3WS1 A;  4UA6 A;  2ZMF A;  1C3B A;  3EGX C;  4Y0T A;  5HAP A;  2OWH A;  3W4O A;  3PR6 A;  1L0E A;  5F82 A;  2WGW A;  5HDC A;  5G4Z A;  1AXB A;  4JBF A;  4KQO A;  4S2M A;  2W3D A;  2P9V B;  3E0Y A;  4KQQ A;  3UDI A;  5BOH A;  4KUO A;  1PI4 A;  3VE3 A;  4YOF A;  4WZ4 A;  1XGI A;  3OPR A;  2WYX A;  3TG9 A;  2GX5 A;  3VP0 A;  3BWL A;  3RTY A;  3ZDJ A;  4QWO A;  5DF7 A;  5J3W A;  3KSF A;  3PBR A;  4U0X A;  3GMW A;  3HCY A;  3LYX A;  3I7J A;  4LV1 A;  5CX7 A;  1Z09 A;  2K2N A;  1XPB A;  1FSW A;  5A91 A;  2RCX A;  3IBR A;  2Q0O A;  3NOT C;  4JPM A;  3BLM A;  5L09 A;  1N9L A;  4OP5 A;  2P7J A;  2L4R A;  4KG5 A;  4H6J A;  2B95 A;  3S7O A;  2GNX A;  1T1B A;  3QP8 A;  3BYD A;  3BFD A;  4NK3 A;  1KE3 A;  5DTT A;  1KDW A;  3IHA A;  3HUO A;  3E4P A;  3TRC A;  5HAR A;  3EEA A;  2HJ9 C;  4JGR A;  3KO6 A;  1WE4 A;  4ETZ A;  1HLU P;  2XA7 S;  3RFB A;  4B4X A;  5TFQ A;  3SH9 A;  4B4Z A;  2O99 A;  4EEU A;  5HDS A;  3BRM A;  4PM9 A;  4XXR A;  4S2I A;  4R1G A;  4KZ6 A;  4X25 A;  3DWK A;  3L7H A;  3QP5 A;  2OLV A;  3ZVT A;  4KUK A;  3IH8 A;  1LSW A;  1IFQ A;  2WAD A;  3B47 A;  5F1F A;  4XT2 B;  4I3J A;  2WKP A;  4LCL A;  1A0K A;  5EPH A;  2HZ5 A;  1TF1 A;  2QZ6 A;  3LUQ A;  4HH2 A;  1GA0 A;  4WF0 A;  1GCE A;  2ZL1 A;  2XGN A;  1YLJ A;  1I2S A;  4CLC C;  3QP2 A;  2XK1 A;  3CPT A;  1S0W A;  2H0Y A;  3BM6 A;  2ZQ7 A;  1Y4O A;  2EX9 A;  2XFT A;  3LEQ A;  3MXR A;  2V8C A;  1PZP A;  2HJE A;  3MR0 A;  3EEH A;  5TR7 A;  1CQA A;  4IBX A;  1K54 C;  1E3U D;  4OQG A;  1NLY A;  1ZC2 A;  1S4S A;  3T1Q B;  3BLS A;  3LY3 A;  3M6H A;  4LV0 A;  3H82 A;  3A0V A;  1PW8 A;  2B02 A;  4OP8 A;  3HBR A;  5I94 A;  4BWI A;  2XRO A;  1PFL A;  2FH5 A;  2R78 A;  1JWP A;  3HUN A;  3N8R A;  2J3T D;  5HZH A;  1HVB A;  5EM0 A;  3ZHH A;  4E3L A;  3B3X A;  1CJF A;  1GSV A;  1QMF A;  2PBD P;  2UV0 E;  4KQD A;  3HRE A;  3B42 A;  2V20 A;  2QJ7 A;  4ARZ B;  5EVI A;  3UB9 A;  1BZA A;  3O87 A;  3IWO A;  4R3B A;  3FZC A;  3SW1 A;  3G2Z A;  3UMD A;  1YSP A;  4EQ1 A;  4GOG A;  1HD8 A;  4X68 A;  4P0M A;  3UN7 A;  3ZFZ A;  4E3I A;  2QKP A;  4KZB A;  1N4O A;  4QHC A;  4BL2 A;  2PDR A;  5CHJ A;  1J9M A;  5AQ9 A;  3LIA A;  2WZZ A;  2FZ0 A;  3UPO A;  3U2A A;  4JGO A;  3IX8 A;  4XUX A;  3DBA A;  1LLB A;  2XD1 A;  4ME4 A;  2Y2Q A;  1OT9 A;  3SH8 A;  2NUP C;  2EWW A;  4WL9 A;  4HBU A;  3VSL A;  5GLA A;  3TOI A;  2V2F F;  4WM9 A;  4CJN A;  3IS2 B;  3V39 A;  3DTE A;  4EBP A;  4LV2 A;  3KSH A;  1PNE A;  4CLC E;  2ZQ8 A;  3IF6 B;  4G3K A;  4A5R A;  1L0G A;  2UWX A;  5JYO A;  2JC7 A;  4PKY A;  5G18 A;  4UQI S;  2XH9 A;  4MBH A;  4X69 A;  1U60 A;  5DFX A;  3MMH A;  2HP6 A;  5FQI A;  4OQI A;  4MBK A;  1XFQ A;  1EI5 A;  1CEF A;  2R9X A;  1YLT A;  1IOU A;  4PM7 A;  3EQV A;  3UY6 A;  1LL9 A;  3ISG A;  3LFV A;  2O9B A;  3HLW A;  1BLS A;  1JNU A;  3RJU A;  4ZTK A;  3VMA A;  4EEP A;  2ZQD A;  4O0P A;  4WBG A;  2PBY A;  2WGW B;  3G6O A;  1OJ5 A;  5A92 A;  5EOO A;  1D1J A;  5EE8 A;  1XKZ A;  4GDB A;  2GDN A;  4X6T A;  1S4R A;  3F1P A;  3G35 A;  2VLG A;  4F94 A;  3T4L A;  4GD6 A;  1BUL A;  5I5L A;  2I9V A;  4MEZ A;  4FCF A;  4QJG A;  4WEL A;  2QWS A;  2ZJ9 A;  4WZ5 A;  1GHI A;  5FAS A;  2I72 A;  2Q9M A;  1K56 D;  1K57 C;  3ZGA B;  5FI6 A;  5CHM A;  4JGQ A;  3U4L P;  1ZTU A;  2QHK A;  1RGZ A;  4YNR A;  1I2W A;  1NJ4 A;  5CER A;  3S7Q A;  3PAG A;  4RX2 A;  4H6J B;  2Z2M B;  4EET B;  2EFX A;  1TS6 A;  2WAF A;  1K25 A;  1NYY A;  2A24 A;  5FSR A;  2WZX A;  5CGS A;  4FUW A;  4HQA A;  1ES3 A;  2VV6 A;  4II7 A;  2VJW A;  5IT5 A;  2WKI A;  3KSG A;  2K7S A;  2M1C A;  4GS9 A;  3AGD A;  4OPQ A;  1DY6 A;  1H3Q A;  5HD5 A;  3HL9 A;  2ZQA A;  1PW1 A;  4QY5 A;  2IWD A;  2W3G A;  3IX3 A;  2C5W B;  3T4K A;  4EBN A;  2ZOH A;  4GW9 A;  4PKY G;  1J3W A;  5DFY A;  3AGF A;  3S1Y A;  3UME A;  3V3R A;  2ZC5 B;  3EQU A;  4P6Z S;  1FR6 A;  3IF5 A;  1VQQ A;  2Z6D A;  4DMZ A;  5DF8 A;  4EQI A;  4O8G A;  2P04 A;  4GLQ A;  1T19 A;  1M6K A;  1F9I A;  2ZL1 B;  5CGW A;  4R4S A;  3N8L A;  3CPT B;  2P74 A;  2CMN A;  5FQM A;  4FSF A;  4L9F A;  2PU2 A;  2HP5 A;  3GQZ A;  4GZB A;  1BLP A;  3V3S A;  2Y2K A;  3BQA A;  3FPW A;  2RL3 A;  3JYI A;  4EUV A;  3CG5 A;  4O01 A;  1ONH A;  3WRT A;  2DNS A;  1VEU A;  1XFN A;  4PAU A;  3QNC A;  3H82 B;  3UPP A;  1BYW A;  1IKI A;  4GNU A;  3E4O A;  4LRX C;  1SHV A;  5FI2 A;  3GV9 A;  4Y7P A;  1I5Q A;  2P08 A;  3BEB A;  4B88 A;  2HPB A;  2PR6 A;  2HDU A;  5HL1 A;  1L2S A;  2IWC A;  1D7E A;  1YPR A;  4E6W A;  5EVI B;  2W3H A;  1DJA A;  2A3U A;  5M19 A;  4HP4 A;  3MF0 A;  4NG2 A;  4HIA A;  1QME A;  1H8Y A;  2ACG A;  5DKK A;  5TGF A;  2XLN A;  1NWZ A;  1ERM A;  3CWF A;  2VGK A;  1PZO A;  4MLL A;  5KMW A;  2PU4 A;  5L07 A;  1K54 A;  4BBU A;  1NLZ A;  3WS5 A;  4DDY A;  2JKG A;  2PD8 A;  1CK3 A;  5GHY A;  2ZMA A;  2HP9 A;  5DJU A;  2ZC7 A;  4K91 A;  3ITA A;  2INW A;  4E04 A;  4OH0 A;  4OVD A;  1TDG A;  3QNB A;  2QYB A;  4G3W A;  2PD7 A;  2EX2 A;  3C8C A;  3LR5 A;  3NEC A;  5DKL A;  4M4X A;  1YKD A;  1LI9 A;  3LO7 A;  3C5A A;  4LEN A;  4OOL A;  1F2K A;  3JVU A;  2NUT C;  2W1T A;  3C4O A;  4YIN A;  4KQR A;  5HWW A;  4S2N A;  1RGY A;  1KGE A;  3QP6 A;  4S2O A;  3ICY A;  3VP4 A;  4EBL A;  2EXA A;  1XJ4 A;  3N8S A;  4B9O A;  2XEP A;  3T1S A;  2BTF P;  4OQH A;  4E3M A;  1FOF A;  1ODV A;  2DRW A;  2L1M A;  3E2K A;  4FTX A;  5LBR A;  4PHT A;  3F1O A;  5AQA A;  2WKR A;  4Q0I A;  3SS5 A;  1OT6 A;  5IHV A;  3RH8 B;  1IYS A;  1W8Q A;  5GHZ A;  2WUQ A;  3G2Y A;  2VK3 A;  2G2U A;  3F1P B;  1G28 A;  3MQQ A;  5EVL A;  4IVK A;  4S2P A;  3Q07 A;  2V0W A;  3PHY A;  2J8Y A;  1YT4 A;  3NI9 A;  5TJJ A;  1SZV A;  3BQ8 A;  4OLG A;  4F3L A;  3DWZ A;  3MFD A;  3OPL A;  4C75 A;  1XA1 A;  4HI4 A;  3BEC A;  1FIK A;  5FQ9 A;  5A8B A;  4IUK A;  1L0F A;  3MXS A;  4EV4 A;  2JKT M;  2A24 B;  5CEC A;  3Q7Z A;  2ZM0 A;  4GD8 A;  3TSG A;  4ESP A;  4MN7 A;  1IEL A;  1ONG A;  1D06 A;  5AVE A;  2Y2G A;  4MNR A;  4GS9 B;  3WS0 A;  2VX8 A;  4X53 A;  2HGV A;  3T4J A;  4HJ4 A;  4RX3 A;  2ZBB A;  3MQ0 A;  5HD3 A;  4E3J A;  3P09 A;  4KZ8 A;  3ZG9 B;  4ZBE A;  1ERQ A;  4BD0 A;  1ACF A;  1CEG A;  1YLY A;  1S66 L;  1IYQ A;  3KSI A;  5K5B A;  1W79 A;  3DAV A;  1GA9 A;  1NXY A;  1LHY A;  4GDN A;  1UGU A;  3RXX A;  4KZ7 A;  5FDH A;  4L9E A;  4UA9 A;  4L0L A;  3TJZ C;  4WLA A;  1DRM A;  4JXV A;  5CED A;  5FI7 A;  5E2E A;  2HDQ A;  4KZ3 A;  1N9N A;  3FC7 A;  1MKM A;  3WS2 A;  5HPF A;  4GJ4 A;  4GKU A;  1VM1 A;  1P97 A;  1MBL A;  3V50 A;  2J9O A;  3LR0 A;  2HV1 A;  3VFF A;  3HLG A;  1LL8 A;  4NXE A;  4Q0H A;  2OWJ A;  1NRJ A;  3ZNY A;  4OOY A;  1FR1 A;  3LR3 A;  3DW0 A;  2Y91 A;  1VEU B;  4S2J A;  2VGL M;  5U47 A;  5FQJ A;  1L0D A;  4Z9Q A;  4YWZ A;  1JWZ A;  3IF6 C;  2H28 A;  3R7W A;  1ZG4 A;  3LIF A;  5A90 A;  3VE4 A;  3SZT A;  2EWV A;  3BY8 A;  4PM8 A;  4BJP A;  4HH3 A;  3BFC A;  4GHI A;  1PI5 A;  4X1M A;  4NXF A;  1CI9 A;  1W5D A;  5E43 A;  1K0K A;  5M1A A;  4ETX A;  5FQQ A;  5JYP A;  3K3D A;  1T1C A;  1N9B A;  4P85 A;  4NXB A;  4BD1 A;  4I5S A;  1VET A;  3T4S A;  1IYP A;  1ESU A;  1UWP X;  2OLU A;  1PYY A;  1W8Y A;  3G32 A;  3ULF A;  1RP5 A;  2Y2O A;  4KG6 A;  4QPR A;  1VHM A;  3W4Q A;  1V9Z A;  2Y55 A;  3UE6 A;  4Q8I A;  3IXD A;  3IBJ A;  3OOV A;  5HWV A;  4N1X A;  4OOM A;  4FD8 A;  5EVI D;  3NY4 A;  4JF4 A;  3MBZ A;  1OPX A;  1KGG A;  1KVM A;  3K2N A;  2J7V A;  1K38 A;  3MJQ A;  1UWN X;  3M2K A;  4IJG A;  1IEM A;  3N7W A;  3UNW A;  2W1T B;  4UHU A;  4LRZ E;  3UDX A;  3T1X A;  3BFE A;  2Q9N A;  5HW3 A;  3P7N A;  1PWG A;  1YLZ A;  4I3I A;  3C2W A;  3BFG A;  1BUE A;  1H8Z A;  4DJ2 A;  3O3V A;  4HY8 A;  3F1N A;  3C7U A;  1XA7 A;  1FIL A;  5A93 A;  4MN6 A;  3F1O B;  4R4R A;  3MKE A;  2JKF A;  4OON A;  3UB8 A;  3FV7 A;  3UE3 A;  3QP1 A;  5EM1 A;  1BLC A;  1ZKJ A;  2VA0 A;  4PPR A;  4N1H A;  4RVA A;  2PHY A;  3O5Y A;  3CJM A;  3FYZ A;  3LI8 A;  2JKR M;  1OTE A;  2WKH A;  2XA7 M;  3PTE A;  3HLC A;  3GR2 A;  3CUE A;  3EGD C;  4UAA A;  3D3O A;  1ES5 A;  2V1Z A;  3G31 A;  4R6L A;  1F98 A;  5HPI A;  1S6R A;  2ZLY A;  3PBT A;  2J3T C;  1XP4 A;  3CMZ A;  1OTI A;  2DCF A;  3HJK A;  3KYZ A;  3LR4 A;  5E2G A;  3FWL A;  2V1B A;  2ZM2 A;  2OV5 A;  5DJT A;  4F3L B;  4Y2F A;  4ZJ1 A;  4HJ6 A;  4GB7 A;  3A3F A;  2PR5 A;  2V1A A;  1JWV A;  4DE3 A;  4RA7 A;  1NY0 A;  3OLO A;  2XQZ A;  3C7V A;  1MPL A;  4DE0 A;  4WN5 A;  5CTN A;  2E8J A;  1DP9 A;  3OC2 A;  5F83 A;  2FFF B;  4IHQ A;  1NRF A;  3B33 A;  1HZO A;  2PAV P;  3NCK A;  2A49 A;  1MKI A;  3KYE A;  1K6S A;  3MKF A;  3UDF A;  3OPH A;  1Z6F A;  3PBQ A;  1DP6 A;  5M18 A;  3IXB A;  3VOL A;  4DJ3 A;  2X02 A;  4NKP A;  3HLB A;  1M40 A;  3T4Q A;  4AFI A;  1PWD A;  4X55 A;  3GSG A;  3S7P A;  3NJA A;  3VFH A;  1LSX A;  1P9R A;  3KYQ A;  2OSU A;  1Q2Q A;  4I38 A;  3GVB A;  2EXB A;  3LI9 A;  5EVI C;  1VB6 A;  3OBF A;  1DJC A;  5GLC A;  1K55 C;  3Q81 A;  2B5R A;  2ZQ9 A;  3O86 A;  3ZVW A;  3WS4 A;  2IWB A;  5HX9 A;  4WMC A;  1ESI A;  4N9K A;  3N4I A;  1SDN A;  2XF3 A;  2IA2 A;  5FQK A;  4S2L A;  3T12 B;  1EWZ A;  5DTS A;  2QPN A;  5DTK A;  2YKF A;  3HLD A;  3C38 A;  2EX6 A;  3K3C A;  3PAE A;  3VP2 A;  3SH7 A;  5CXW A;  4RYE A;  3BW6 A;  2XSS A;  5G4Y A;  3M2J A;  5L8M A;  4MN5 A;  5DF9 A;  3R7W B;  4C3Q A;  4CLC A;  4KG2 A;  3ZG7 B;  5J4E A;  5CHU A;  1E25 A;  1MWR A;  1HTZ A;  5GHX A;  1STZ A;  4IVI A;  1CF0 A;  4MDZ A;  3GRJ A;  3PBO A;  4GHI B;  5AQ7 A;  2EFU A;  2WGV A;  2O9C A;  4UQI M;  4Y0O A;  1O7E A;  3FKV A;  1E4D A;  5HSQ A;  3E2L A;  3A3J A;  3G4P A;  3ZG5 A;  5J8X A;  5CTM A;  2Y59 A;  3MQO A;  5AQB A;  1VET B;  4GN2 A;  3H7W A;  1WYB A;  4XUZ A;  3VOY A;  2WKQ A;  3RXW A;  2ZOI A;  2D02 A;  2JBF A;  3CZD A;  2GZA A;  4DN0 A;  2XRN A;  3SOI A;  5L2F A;  4EW7 A;  2Y4A A;  4JXS A;  3Q1F A;  2QMI A;  3Q82 A;  4L9G A;  5L10 A;  1S1Z A;  2H10 A;  4HES A;  4JF6 A;  3G30 A;  1NYM A;  4LFU A;  4IED A;  3ITB A;  5F69 A;  4CQH A;  3LEZ A;  3IWQ A;  3UE1 A;  1MXO A;  1TS7 A;  3A3E A;  3CAX A;  4WZ5 C;  4WEJ A;  4DE2 A;  5EVE A;  1TVF A;  2J9P A;  4Y17 A;  1XJ6 A;  1W63 Q;  2VV7 A;  5MC7 A;  3CLO A;  1KOU A;  3F1N B;  4OKP A;  1G68 A;  1TDL A;  3GDI A;  3MZD A;  3WWX A;  1S1Y A;  1YLP A;  5CRF A;  2LB5 A;  4BBT A;  5D3O A;  5HWT A;  1MC0 A;  3ZNT A;  1MWS A;  3VOZ A;  4MBF A;  1DP8 A;  4Y3I A;  4R23 A;  4HHD A;  1OTA A;  2E8I A;  3SS3 A;  1H0M A;  4DXC A;  3IXG A;  2VGJ A;  5HAQ A;  5FEF A;  4FH2 A;  4OQ0 A;  1V9Y A;  2Y2N A;  4OPZ A;  4ID4 A;  1GHM A;  4R3J A;  2W27 A;  4Y5F A;  1OTB A;  1SKO A;  1XJ2 A;  1YLW A;  5KSC A;  2Y2J A;  4DKI A;  3CHW P;  1O07 A;  4YFM A;  3OPP A;  3ZG0 A;  3IX4 A;  4ZJ3 A;  2JHE A;  2JE5 A;  2KOI A;  4P6Z M;  3W2Z A;  3SS4 A;  2GJ3 A;  3IQA A;  3AGE A;  3VP3 A;  3NHQ A;  1YMS A;  4BEN A;  3LGO A;  3OCN A;  4JXW A;  1GSX A;  3LIE A;  4NET A;  4K0X A;  4K0W A;  3PBS A;  2W0N A;  1E3U A;  3D72 A;  4EER A;  4R38 A;  3D4F A;  5F68 A;  2PYP A;  4EWF A;  2G7U A;  2ZD8 A;  3FG8 A;  1ZHH B;  1K57 A;  4ZDX A;  4X1L A;  5E2H A;  1SCW A;  2M7U A;  3P98 A;  2HDS A;  3HLE A;  1YMX A;  4QU3 A;  1TS8 A;  4EU0 A;  1P0Z A;  3CI6 A;  4P6B A;  1GSW A;  3IHB A;  3QHY A;  3C4P A;  2BAS A;  2ZM8 A;  3QP4 A;  2J80 A;  3Q7V A;  3ZCZ A;  3TW8 A;  4CPK A;  4I3A A;  2PRF A;  3MXQ A;  3E4Q A;  1F5M A;  2Z2L B;  4JXG A;  1OME A;  4UA7 A;  4LV3 A;  5CEB A;  5TBM B;  4WEK A;  4DF6 A;  2PT7 A;  4Q0J A;  3VSK A;  5FL3 A;  1N9O A;  4D2O A;  3OCL A;  2O0Y A;  1ES2 A;  3PXP A;  4BMW A;  3DTI A;  2ZC4 B;  5FA7 A;  3GTC A;  4OPY A;  4DDS A;  4LGW A;  3A3D A;  4PM5 A;  2OAP 1;  4GCZ A;  1BSG A;  4LRY C;  3GEC A;  3MFX A;  4KZ5 A;  2R9W A;  2XFS A;  1OJG A;  3G34 A;  4CLC B;  5FAQ A;  3MZF A;  2CC1 A;  2W1R A;  3O88 A;  3HLF A;  1WYC A;  4LLO B;  3HJI A;  4JKT A;  3T4O A;  3NC8 A;  2Y2L A;  5F1G A;  2V8F A;  1ZG6 A;  2B18 A;  2VEA A;  3D9Y A;  5IS1 A;  3TE8 A;  1K55 A;  2D01 A;  1MWT A;  1XX2 A;  1MY8 A;  2AVX A;  4S2N C;  2WKE A;  4QB8 A;  3UB7 A;  2YKH A;  3E98 A;  4ZJ2 A;  3FPV A;  2JKR I;  5EOE A;  4BL3 A;  1MZU A;  4C6Y A;  2V0U A;  1JTG A;  4X56 A;  3ZG8 B;  5HFO A;  1LL5 A;  4KZ9 A;  3LID A;  3V5M A;  3H7W B;  1CI8 A;  4N92 A;  5F6A A;  4S2K A;  1L3L A;  1XGJ A;  4ZAM A;  5F5Y A;  2W3F A;  2EA9 A;  1ERO A;  3IT9 A;  1FCN A;  3UE0 A;  5FAP A;  5KIZ A;  5FEG A;  3H9W A;  4HJ3 A;  1FCO A;  1KE4 A;  1RCJ A;  2A2L A;  3HVF A;  1XXM A;  2G2W A;  3NUL A;  3MZE A;  3KX0 X;  1YSQ A;  2ZQC A;  2ZC6 B;  3LY4 A;  4P87 A;  1ALQ A;  3OZH A;  2Y2M A;  1TS0 A;  4R70 A;  4B93 A;  4ZRR A;  3HUM A;  4MMN A;  3JPU A;  2MJ6 A;  1K56 A;  3N6I A;  1W7F A;  1K6R A;  4U0T A;  3JVV A;  2FFY A;  4MCW A;  4IUH A;  1KDS A;  2V9A A;  3P01 A;  1WA9 A;  4JGP A;  3ZQ5 A;  2P9V A;  2XR0 A;  3DTM A;  1X0O A;  2BLS A;  4U3T A;  1YAX A;  5HDD A;  1DJB A;  1K4E A;  3PBN A;  4DXB A;  3W8K A;  1KVL A;  4Y0U A;  2PYR A;  1H8M A;  1LT0 A;  4OLD A;  1JTD A;  4HOI A;  2VV8 A;  2HF6 A;  5DVA A;  3UB6 A;  1AWI A;  1FQG A;  3NBL A;  4N9L A;  3T50 A;  1SKO B;  4E3K A;  3NDE A;  2O9A A;  3WRZ A;  2C6W B;  4E6X A;  3PYP A;  1S67 L;  3A0R A;  3IWI A;  2OAQ 1;  3CIT A;  5AJG A;  4LPZ A;  1NZU A;  1IKG A; 
#chains in the Genus database with same CATH homology
 3BY9 A;  3H7W A;  3IS2 B;  3EWK A;  4MN7 A;  3KSH A;  2WKQ A;  1D06 A;  5AVE A;  4CLC E;  5HL6 A;  4G3K A;  4GS9 B;  2VX8 A;  2ZOI A;  3NOP C;  2D02 A;  2HGV A;  3T4J A;  4HJ4 A;  2GZA A;  5KSH A;  2ZBB A;  3MQ0 A;  5HD3 A;  4I39 A;  4DN0 A;  2VZW A;  2XRN A;  4XT2 A;  4EW7 A;  3VV4 A;  1G6O A;  4NXG A;  4PKY A;  2KX6 A;  4UQI S;  1S66 L;  4L9G A;  3KSI A;  5K5B A;  1S1Z A;  1T18 A;  5DFX A;  1UGU A;  3MMH A;  2Y79 A;  4L9E A;  2K31 A;  4L0L A;  3TJZ C;  1W63 M;  4WLA A;  1DRM A;  5F69 A;  5EFW A;  4CQH A;  1EW0 A;  3LIC A;  1TS7 A;  3CAX A;  1XFQ A;  4WEJ A;  1N9N A;  4HP9 A;  3FC7 A;  2VKS A;  1IOU A;  1MKM A;  4BBV A;  3EQV A;  5HPF A;  1XJ6 A;  1W63 Q;  2VV7 A;  4GJ4 A;  1P97 A;  5MC7 A;  3CLO A;  2O9B A;  3LFV A;  5TBM A;  1JNU A;  5J7E A;  1KOU A;  3F1N B;  4EEP A;  2L0W A;  3LR0 A;  2HV1 A;  1LL8 A;  4NXE A;  4Q0H A;  2OWJ A;  4O0P A;  3GDI A;  1S1Y A;  1NRJ A;  2LB5 A;  5C5K A;  4BBT A;  3G6O A;  1OJ5 A;  4G3V A;  3LR3 A;  5HWT A;  1MC0 A;  2VGL M;  3ZYT A;  1S4R A;  3F1P A;  1DP8 A;  2VLG A;  5IU1 A;  3A0S A;  3S7N A;  4YWZ A;  4Y3I A;  4HHD A;  1OTA A;  3T4L A;  2H28 A;  3R4K A;  5I5L A;  3R7W A;  2I9V A;  2DMW A;  4ARZ A;  3LIF A;  4HNB A;  2LB9 A;  1V9Y A;  3VE4 A;  4WEL A;  2EWV A;  2QWS A;  3BY8 A;  2W27 A;  4Y5F A;  4BJP A;  4HH3 A;  1OTB A;  1XJ2 A;  3EOI A;  4GHI A;  2ZMV A;  4RQ9 A;  2Y8H A;  2M7V A;  4NXF A;  4JGQ A;  1ZTU A;  2JHE A;  2QHK A;  4YNR A;  3C30 A;  3S7Q A;  4ETX A;  4H6J B;  2KOI A;  4P6Z M;  4EET B;  3W2Z A;  3K3D A;  2GJ3 A;  1Y28 A;  1T1C A;  4WUJ A;  4NXB A;  1TS6 A;  2A24 A;  2VGL S;  3NHQ A;  4I5S A;  4EXO A;  2W3E A;  3T4S A;  1UWP X;  4HQA A;  3IS2 A;  1OTD A;  3OCN A;  2VV6 A;  4NEE D;  3T4T A;  4II7 A;  2VJW A;  5IT5 A;  1GSX A;  3KSG A;  3LIE A;  4EES A;  3ULF A;  2K7S A;  2JN7 A;  4QPR A;  2M1C A;  3PBS A;  1VHM A;  3BJN A;  1V9Z A;  4GS9 A;  2W0N A;  3UE6 A;  1H3Q A;  4R3A A;  5HD5 A;  3D72 A;  3IBJ A;  4EER A;  3OOV A;  5HWV A;  4R38 A;  4OOM A;  5F68 A;  2PYP A;  2KLI A;  4K08 A;  2W3G A;  2Z6C A;  4CLC D;  3NOU C;  3T4K A;  2ZOH A;  1LSV A;  2G7U A;  3FG8 A;  4GW9 A;  4PKY G;  1P9W A;  1OPX A;  5DFY A;  3V67 A;  1TD5 A;  1ZHH B;  3UME A;  3K2N A;  2KDK A;  2J3W A;  2M7U A;  3MJQ A;  1UWN X;  4FOF A;  4UEY A;  4IJG A;  3EQU A;  4P6Z S;  2JKT I;  2W1T B;  2Z6D A;  4DMZ A;  1XJ3 A;  4LRZ E;  4O8G A;  2QJ5 A;  2P04 A;  4GLQ A;  3CUE C;  1T19 A;  1TS8 A;  3LIB A;  3P7N A;  4EU0 A;  4Z1W A;  1F9I A;  1P0Z A;  1T1A A;  3CI6 A;  4I3I A;  2OOL A;  3C2W A;  1GSW A;  4DJ2 A;  2BAS A;  2CMN A;  4FSF A;  2J80 A;  4HY8 A;  4L9F A;  3F1N A;  5AVF A;  3TW8 A;  2ZMF A;  4I3A A;  3EGX C;  3MXQ A;  2OWH A;  3BQA A;  3FPW A;  3PR6 A;  3E4Q A;  1F5M A;  4MN6 A;  3F1O B;  5HDC A;  4EUV A;  4O01 A;  5G4Z A;  4WEK A;  5TBM B;  2PT7 A;  4Q0J A;  3UB8 A;  3UE3 A;  5FL3 A;  4PAU A;  1XFN A;  1N9O A;  4KQO A;  2W3D A;  3E0Y A;  3H82 B;  3OCL A;  4KUO A;  2VA0 A;  2O0Y A;  3PXP A;  1BYW A;  3VE3 A;  4YOF A;  2PHY A;  3E4O A;  4LRX C;  4BMW A;  3O5Y A;  2GX5 A;  3LI8 A;  2JKR M;  1OTE A;  2XA7 M;  2P08 A;  3BWL A;  3RTY A;  2PR6 A;  2OAP 1;  5J3W A;  4GCZ A;  3KSF A;  4LRY C;  3PBR A;  3GEC A;  1D7E A;  3CUE A;  3EGD C;  3D3O A;  3MFX A;  3HCY A;  3LYX A;  5CX7 A;  2K2N A;  1OJG A;  2W3H A;  4R6L A;  1F98 A;  5HPI A;  4HP4 A;  4CLC B;  3IBR A;  3PBT A;  2J3T C;  3MF0 A;  3NOT C;  2W1R A;  1OTI A;  4HIA A;  3HJK A;  5DKK A;  3KYZ A;  4LLO B;  3HJI A;  1N9L A;  3LR4 A;  3T4O A;  2V1B A;  2P7J A;  5DJT A;  4F3L B;  4Y2F A;  2L4R A;  1NWZ A;  2B18 A;  2VEA A;  3CWF A;  4H6J A;  3TE8 A;  5IS1 A;  3S7O A;  2GNX A;  1T1B A;  2D01 A;  4HJ6 A;  2PR5 A;  2V1A A;  3UB7 A;  2YKH A;  3E4P A;  3TRC A;  3E98 A;  2HJ9 C;  3EEA A;  3OLO A;  4BBU A;  1NLZ A;  3FPV A;  4JGR A;  3KO6 A;  2JKR I;  4WN5 A;  4ETZ A;  1MZU A;  2XA7 S;  3RFB A;  1DP9 A;  3OC2 A;  2V0U A;  2O99 A;  4IHQ A;  4EEU A;  2PD8 A;  5HDS A;  3B33 A;  5DJU A;  3LID A;  2INW A;  3H7W B;  5F6A A;  4E04 A;  5F5Y A;  2QYB A;  3PBQ A;  2W3F A;  2EA9 A;  4KUK A;  1DP6 A;  4G3W A;  2PD7 A;  1LSW A;  3C8C A;  1IFQ A;  3LR5 A;  3VOL A;  3B47 A;  4DJ3 A;  5DKL A;  5KIZ A;  4M4X A;  1YKD A;  4NKP A;  4OOL A;  3H9W A;  3JVU A;  4HJ3 A;  4XT2 B;  3T4Q A;  4I3J A;  2NUT C;  4AFI A;  2WKP A;  2A2L A;  2W1T A;  3S7P A;  1TF1 A;  3NJA A;  1LSX A;  1P9R A;  3KYQ A;  3KX0 X;  1YSQ A;  3LUQ A;  4HH2 A;  5HWW A;  4WF0 A;  4I38 A;  1TS0 A;  3ICY A;  3LI9 A;  4R70 A;  1XJ4 A;  4B9O A;  4CLC C;  1VB6 A;  3OBF A;  4B93 A;  4ZRR A;  4MMN A;  2MJ6 A;  1ODV A;  2L1M A;  3JVV A;  5LBR A;  4PHT A;  4MCW A;  2HJE A;  3MR0 A;  4IUH A;  3F1O A;  3EEH A;  2V9A A;  3P01 A;  1WA9 A;  1NLY A;  2WKR A;  1S4S A;  2IA2 A;  4Q0I A;  4JGP A;  3ZQ5 A;  1OT6 A;  3H82 A;  3A0V A;  2B02 A;  3RH8 B;  2YKF A;  3C38 A;  3K3C A;  4BWI A;  2XRO A;  1X0O A;  2FH5 A;  2R78 A;  5HDD A;  1YAX A;  2J3T D;  5HZH A;  3PBN A;  3BW6 A;  3F1P B;  2XSS A;  1G28 A;  5G4Y A;  1GSV A;  3MQQ A;  4KQD A;  3B42 A;  2PYR A;  1H8M A;  5L8M A;  1LT0 A;  2QJ7 A;  4MN5 A;  5DF9 A;  3R7W B;  4ARZ B;  2V0W A;  3PHY A;  3UB9 A;  4HOI A;  2VV8 A;  2HF6 A;  4CLC A;  3UB6 A;  3SW1 A;  3UMD A;  1YSP A;  4EQ1 A;  5J4E A;  5TJJ A;  1STZ A;  3T50 A;  4MDZ A;  3PBO A;  4GHI B;  3BQ8 A;  4F3L A;  2O9A A;  2O9C A;  2QKP A;  4UQI M;  2PDR A;  4HI4 A;  3LIA A;  3PYP A;  2FZ0 A;  5HSQ A;  3U2A A;  4JGO A;  5A8B A;  4IUK A;  1S67 L;  3A0R A;  3DBA A;  2OAQ 1;  3CIT A;  4ME4 A;  5AJG A;  1OT9 A;  2NUP C;  2EWW A;  4LPZ A;  2JKT M;  3MQO A;  4WL9 A;  2A24 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...