2M1CA

Haddock structure of gtyybt pas homodimer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
113
structure length
113
Chain Sequence
RGSHMRSLHKELQQYISNLSYRVKKVSEEALMQMPIGILLLDEEDKIEWSNRFLAACFKEQTLIGRSLAELSEPLAAFVKKGKTDEEIIELNGKQLKVIVHRHERLLYFFDVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords DHH subfamily 1 protein
publication title Solution Structure of the PAS Domain of a Thermophilic YybT Protein Homolog Reveals a Potential Ligand-binding Site.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans
total genus 19
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2m1cA00
5G4ZA 3K3CA 1S1ZA 2OWJA 4HJ4A 5EFWA 3BY8A 3E4OA 4WUJA 3F1PA 3HJIA 3MR0A 4GHIA 4I39A 2A24B 1TS8A 2Z6DA 5IU1A 5HDCA 3A0SA 3F1OA 1KOUA 2QWSA 3HJKA 5HD5A 2PR6A 3OLOA 2W27A 4JGPA 1T18A 5HZHA 3F1NA 1TS0A 1OT6A 2PD7A 1P0ZA 3IS2B 2VV8A 1GSWA 5TBMA 1TS6A 5HWVA 4H6JA 3ZQ5A 1LSXA 3CLOA 2OOLA 5J7EA 3NOTC 4HP4A 4LRYC 3ULFA 2PYPA 4JGQA 1OJGA 4B9OA 5J4EA 4GS9B 4WLAA 2W0NA 4GW9A 4HJ3A 3H82B 1V9YA 3PYPA 2KX6A 4R3AA 4R6LA 5I5LA 1OTDA 3ICYA 2M1CA 3IS2A 3LYXA 1DRMA 2YKHA 4MN5A 4R38A 5F69A 3SW1A 5AVFA 4M4XA 1ODVA 3GDIA 4EEUA 1F9IA 5KIZA 4LRZE 5F6AA 4PKYA 3UB6A 4DJ2A 1P97A 3VOLA 1UWNX 4GS9A 4HNBA 3MFXA 3T50A 2PD8A 4HI4A 3E4QA 1XFNA 3NOUC 5HD3A 1OJ5A 2ZBBA 3H82A 4L9GA 4EERA 4JGRA 2QKPA 4WF0A 5HSQA 4KUKA 2PR5A 2QHKA 1F98A 4DJ3A 2HV1A 3UE6A 2JHEA 3PHYA 1D7EA 3KX0X 3H7WB 4I5SA 2D01A 2GJ3A 4GCZA 1LT0A 2J80A 1V9ZA 2VV7A 3P7NA 1OTAA 1OTIA 5A8BA 4KQDA 3LIEA 3LIBA 1G28A 3UB8A 4HP9A 1MZUA 1S4RA 5DKLA 1NWZA 2V1BA 4NXFA 3C2WA 3D72A 2A24A 4NXBA 4L9FA 3UB7A 1EW0A 1XJ3A 2QJ5A 3H7WA 4NXGA 4EETB 1DP6A 1GSXA 2V1AA 2EA9A 4YWZA 1T1BA 1T19A 2D02A 1S1YA 3LI9A 3E4PA 4HOIA 4HQAA 3MXQA 2WKRA 3LUQA 4XT2B 2P7JA 5HWTA 1VB6A 3BWLA 1N9LA 1S66L 3UB9A 2BASA 4LLOB 4BBTA 5J3WA 2L1MA 1BYWA 1XJ6A 3MJQA 2L0WA 4MN6A 3H9WA 3LICA 4KUOA 1LSVA 4HIAA 1N9OA 2INWA 3BY9A 3VE3A 4L9EA 2B02A 5DKKA 3MQQA 4I3IA 3CWFA 5HWWA 1OTEA 2PHYA 1TS7A 3F1NB 1XJ2A 3GECA 4LPZA 4EEPA 4XT2A 3A0RA 3K3DA 3IBRA 4R70A 5TBMB 3C8CA 4BBVA 1T1CA 2VLGA 3LIFA 1X0OA 3B33A 2WKPA 1UGUA 4H6JB 2PDRA 2QJ7A 5HDDA 1GSVA 1UWPX 4LRXC 4WL9A 3FG8A 2V0WA 3A0VA 2I9VA 4HH2A 1T1AA 2KDKA 5AVEA 3RH8B 1N9NA 3MQOA 2Z6CA 1S4SA 2H28A 1Y28A 4PKYG 1LL8A 3LI8A 1LSWA 4BBUA 4WN5A 4EQ1A 3NJAA 1DP9A 3UMDA 4EXOA 4I3JA 2R78A 1WA9A 2VV6A 2YKFA 2PYRA 1OT9A 2L4RA 3EWKA 3RTYA 2V9AA 5F5YA 2WKQA 4F3LB 4JGOA 5F68A 3UMEA 4I3AA 3LIDA 3NHQA 5DJUA 5DJTA 1S67L 2JN7A 5G4YA 2CMNA 3LIAA 2VEAA 5HDSA 4HJ6A 4RQ9A 3VE4A 2V0UA 3NOPC 1XFQA 1JNUA 3F1PB 1DP8A 4K08A 4GHIB 4EESA 4HH3A 4E04A 1D06A 5IS1A 3FC7A 2OWHA 3EEHA 3F1OB 2ZOHA 4HHDA 1XJ4A 4I38A 4HY8A 4F3LA 3G6OA 3CAXA 4EW7A 2K7SA 4NXEA 1OTBA 2ZOIA
chains in the Genus database with same CATH superfamily
5F83A 5G4ZA 4LCMA 2OWJA 5DVAA 2ZMAA 2JKFA 1QMEA 3E4OA 5EECA 4ME4A 4YINA 3HJIA 3VFFA 2M7VA 4GHIA 1GA0A 4Y0TA 1CI8A 5IU1A 1DJCA 2VKSA 1KOUA 2XF3A 5C5KA 5EE8A 1ZTUA 2O99A 4HESA 4ZBEA 1CEFA 1K57C 3BW6A 3OLOA 3G32A 4S2LA 1NZUA 5KMWA 3PAGA 5AQBA 1PWGA 3KSGA 3WRTA 1JTDA 4E3MA 3VOZA 5TBMA 2ZM2A 4CPKA 2ZL1B 4O0PA 3MXSA 3BRMA 4H6JA 3WS1A 1AWIA 1LSXA 4FUWA 1ES4A 4LRYC 3W4QA 4Z1WA 1FIKA 2W3DA 2K31A 2ZQ8A 3LR3A 2A3UA 3DAVA 3EQVA 4M3KA 4GW9A 4BL2A 1LLBA 3EGXC 1FILA 4R3AA 2XH9A 3ICYA 3IS2A 2VGJA 1DRMA 2ACGA 1FR1A 3R7WA 2LB5A 1SKOA 2ZMFA 4ETXA 4L0LA 3QHYA 2ZQAA 2MJ6A 4G3VA 2XD1A 4DJ2A 1PRQA 4GS9A 5EVLA 2WADA 3E4QA 4Y3IA 1LI0A 1OJ5A 3IHBA 5CGWA 4L9GA 4EERA 4UHUA 2ZQDA 4NEED 1ES2A 5HSQA 4S2IA 1M6KA 2QHKA 4WBGA 1RGZA 1F98A 1KGEA 2EFUA 2WYXA 3UE6A 1ERMA 3KX0X 4QWOA 4Y5FA 4P6ZM 1FCOA 1LT0A 2J80A 1V9ZA 2VV7A 3GTCA 5CECA 2AVXA 4GDBA 3PBOA 2J9PA 3S4XA 3LIEA 2JKGA 3GQZA 5A91A 4R1GA 2PAVP 2HDRA 1YLZA 4HP9A 5HPIA 3CUEA 5HL1A 4Y15A 1NWZA 3C4OA 4NXFA 1TDGA 5DFYA 1YMSA 4L9FA 2Y8HA 4NXBA 3UB7A 4KZ6A 3D9YA 4S2OA 1MY8A 1DP6A 2XEPA 3V5MA 5FQKA 5M18A 1E25A 1H5XA 3VP0A 3N8LA 2D02A 3BLSA 4MLLA 3UPPA 1S0WA 1S1YA 3W8KA 3DW0A 1FSYA 1EWZA 3GR2A 3OPRA 4HQAA 3HLGA 1H8MA 3W4OA 3DWKA 2HZ5A 2W1RA 4OVDA 4ZAMA 5FDHA 1N9LA 3Q7VB 2C6WB 1Z09A 3UB9A 1ACFA 1H8YA 3OPPA 4IHQA 4CLCB 5J3WA 4OP5A 1BYWA 1XJ6A 2ZQ9A 3LICA 4UQIM 2H0YA 1K55C 3GRJA 4YNRA 1ZC2A 3O87A 3Q81A 3SZTA 1LSVA 1LHYA 2VZWA 5DTKA 2VA0A 3HLCA 2Y2GA 1XXMA 4L9EA 3MQQA 4I3IA 3GVBA 3FKVA 4PM7A 1DJBA 4FD8A 3KYZA 2NUTC 2Y2QA 1MBLA 3M2JA 4XT2A 4MMNA 4MNRA 3K3DA 1PW8A 3MZEA 4R70A 5TBMB 4IUHA 1YLJA 3NIAA 2VLGA 3LY3A 5TGFA 1HZOA 4H6JB 4PM6A 2Y2KA 4P6ZS 3FPWA 4F94A 4WELA 2EXBA 5HDDA 2J7VA 1I2WA 1VM1A 4ZJ1A 4LRXC 2RCXA 2DRWA 3VP1A 5EVIA 3VP3A 2XA7M 2B95A 2ZC7A 2WKIA 3P98A 4EBLA 4CLCC 5L2FA 2Z6CA 3CPTA 4DDSA 5GHXA 4E6XA 4JF6A 1JVJA 4BBUA 3TE8A 3TSGA 4EWFA 4DXBA 1DP9A 1IYSA 4I3JA 2R78A 3ZGAB 3HLFA 1WYBA 4R0QA 2YKFA 1OT9A 2CC1A 4JPMA 5LBRA 3EWKA 1W8QA 5KSCA 3ZDJA 1XP4A 3NCKA 4PAUA 3D4FA 1XA7A 5F68A 1KDSA 3UMEA 4I3AA 5FEFA 3KSIA 1S67L 1YLYA 5FAQA 3A3DA 3P01A 4OPQA 2A2LA 1MXOA 1W63M 4YOFA 4LV2A 4RQ9A 1O7EA 5L07A 3ZNTA 4QY5A 3N7WA 1XFQA 1JNUA 2ZLYA 4Y2FA 2BG1A 3FPVA 5FSRA 4MBFA 3IHAA 3T12B 3FC7A 2OWHA 3EEHA 3V50A 3F1OB 4OPZA 3BFCA 4O01A 2HDQA 4X6TA 4F3LA 3T1QB 3CI6A 4QD4A 4QY6A 2BLSA 4P0MA 3VMAA 4QB8A 3I7JA 4LCLA 1XA1A 2EFXA 1NJ4A 3HLBA 1KVMA 3W4PA 1DY6A 3T4LA 1K4FA 3VOYA 1W7FA 4E3JA 1S1ZA 2WAFA 4IJGA 4IVKA 4WUJA 4MCWA 3V3RA 3MR0A 3IX3A 2Z6DA 2XLNA 2WKHA 1I2SA 5CTMA 3G2ZA 2OLVA 5HD5A 2W27A 4KQRA 3AGFA 1SCWA 1T18A 2Q0OA 3E2KA 3F1NA 2ZC6B 3BFGA 2P9VA 1GSWA 3QP5A 3T4JA 2OAP1 4S2NA 2V1ZA 3UE3A 3ZQ5A 3NOTC 2KLIA 5GLDA 2EWWA 2PYPA 4JGQA 5J4EA 4BWIA 4DF6A 2ZD8A 1VETA 3HUMA 1Z6FA 4DE1A 3PBRA 1L3LA 2RL3A 4RX2A 2KX6A 3OOVA 2JBFA 2XRNA 5FQ9A 4Y0OA 1JWVA 4GD6A 2M1CA 1OMEA 1XGJA 3LYXA 4C6YA 4EQIA 5F69A 3SW1A 3S7PA 4Q0JA 4UA9A 2WK0A 5KIZA 4PKYA 2B5RA 3UB6A 2P04A 2X02A 3FWLA 3HLDA 4HNBA 3MFXA 4JKTA 4YFMA 1CK3A 3IH9A 3FV7A 1YT4A 4KZ9A 5HD3A 2ZBBA 4HEFA 3H82A 4LV0A 4X1LA 1CJFA 5D3OA 4UA7A 2PRFA 5AJGA 3IQAA 2XFSA 2PR5A 3DTEA 3MBZA 1O07A 1IYOA 5CEDA 3VP4A 2HV1A 2IWCA 3T4QA 4Z9QA 1SDEA 3ZFZA 4FH2A 4I5SA 4FOFA 3ZG9B 2O9CA 1MPLA 2J3TD 1E4DA 4CJNA 1OTAA 1PI5A 5CHMA 4Q0IA 3IX4A 1LL5A 3HLEA 4EUZA 5EM0A 3OZHA 2B18A 3CJMA 3TG9A 4U0TA 5F82A 1MZUA 1G6OA 4IBRA 3LEZA 5KSHA 3MXRA 2P74A 3C2WA 3BQAA 1BSGA 2Y79A 3LEQA 5A93A 2W3GA 4P87A 3H7WA 4NXGA 5GHZA 4EETB 3U2AA 4KZ5A 4WM9A 4YWZA 3HCYA 1SHVA 2A49A 3UE1A 1ZG6A 1MWSA 4S2KA 1K25A 5L10A 4X1MA 4RYEA 5J8XA 1IELA 3Q82A 3E98A 4ZJ3A 1BTLA 2HGVA 1XKZA 1YMXA 2P7JA 2IA2A 1YSQA 1KGGA 1L0FA 1NYYA 4LLOB 1K56D 3BJNA 4BBTA 3ITAA 2XROA 2HJEA 3HVFA 4DE0A 3Q1FA 2PBDP 3H9WA 3BECA 1KE4A 3ZVTA 4DKIA 3B42A 1FQGA 1KE0A 1K56A 1N9OA 1VHMA 1HTZA 3VE3A 4JF5A 5HWWA 3MKFA 3ZCZA 4E3NA 1TS7A 4N9LA 4WZ4A 3F1NB 3MF0A 4B4XA 4IUKA 2P9VB 2BTFP 4DRTA 1BLSA 1RP5A 3DTKA 2VGLM 1XX2A 1T1CA 4PHTA 1TDLA 3LIFA 3TJZC 5CRFA 4EBNA 3B33A 4E6WA 1GSVA 2JC7A 3EGDC 4K91A 4LGWA 3C4PA 3LR0A 3NECA 1PI4A 4PPRA 4U3TA 5FQJA 3G34A 1T1AA 3UPOA 5AVEA 3LO7A 2XSSA 1N9NA 3JVVA 2DCFA 2EXAA 3MQOA 3HBRA 2HP6A 1L0GA 4KENB 1Y28A 4JLFA 2E8JA 5EPHA 3BFFA 1BUEA 4ID4A 1LSWA 1N4OA 3NJAA 1VEUA 2ZC4B 3UMDA 3QNCA 4EXOA 2VV6A 3Q7ZA 3Q07A 1RGYA 2Z2MB 3P09A 2PYRA 5HFOA 3RTYA 1ALQA 5L09A 2V9AA 1L0DA 3MS6A 1IYQA 3OC2A 3UY6A 4BQMA 2WGVA 3G35A 4JGOA 4OP8A 1YAXA 1XPBA 4CLCE 2OSUA 1BLPA 3C30A 2CMNA 1L0EA 2HDUA 4S2NC 1Q2PA 3KYQA 1PWDA 2VEAA 4NETA 3ITBA 3IF6A 1K4EA 4WYYA 1ES5A 2X01A 2P08A 3N4IA 1DP8A 3A3JA 4JBFA 4GHIB 4K08A 4KG6A 2H5SA 3WS2A 5IS1A 4R23A 3NY4A 4JXGA 1FSWA 2ZOHA 1J3WA 1NYMA 1XJ4A 2K2NA 2V8FA 3CAXA 3QP8A 2XD5A 3ZG5A 3CITA 1PYYA 2VX8A 5CHUA 4R3BA 1CQAA 2Q9MA 5DF9A 3N8SA 1KVLA 4HJ4A 5EFWA 3LGOA 1K57A 2QZ6A 2VGLS 5EVID 1L2SA 2HP5A 2V8CA 3F1PA 2WZZA 2QYBA 3GMWA 4I39A 5I94A 4X56A 3A0SA 2QWSA 2DMWA 2R9XA 2XK1A 4GJ4A 1IKIA 1JWPA 2HF6A 3NBLA 1CF0A 4JGPA 1J9MA 5FI6A 4NG2A 5GLAA 3VP2A 1FR6A 3SS5A 2PD7A 2HJ9C 2XGNA 3IS2B 1HD8A 3PBNA 4K0WA 2XDMA 5FI7A 3R7WB 4D60A 2ZQCA 5CERA 3LCEA 3B3XA 2VV8A 3AGDA 1A0KA 4B93A 3ZHHA 1SKOB 4GN2A 1TS6A 4R4SA 1SKFA 1FCMA 2Y2IA 3IWQA 3MQ0A 3IXGA 3VSKA 3CLOA 2OOLA 1H3QA 5TJJA 2Y59A 1C3BA 3FYZA 1NZOA 4EUVA 1PNEA 4GS9B 4WLAA 2J3TC 3W2ZA 3T1RA 3LY4A 4E3LA 3V39A 2UV0E 2HP9A 2W0NA 4HJ3A 3SH8A 4CQHA 1MWTA 4XXRA 1MWRA 2EWVA 3M6HA 3PYPA 4EU0A 4R4RA 4R6LA 4O7DA 5I5LA 1D1JA 1OTDA 1YKDA 2H0TA 5FI2A 1MWUA 2YKHA 3QP6A 2W1TA 1MKMA 3T4OA 4BD0A 5AVFA 2ZL1A 5DTTA 1BLHA 5GLBA 1G68A 3IF5A 1F9IA 5F6AA 4WMCA 4E3OA 2Y2PA 2XR0A 3NDEA 3VOLA 2JCHA 3PR6A 3K2NA 1UWNX 5FQIA 5FQMA 3KYEA 2PD8A 4OQ0A 3T50A 2EX6A 1G6AA 3G4PA 3A3FA 3O88A 1Y4OA 2V2FF 3QNBA 2J3WA 2Y2JA 2GZAA 5CHJA 4JGRA 3LR4A 2QKPA 4WF0A 3OCLA 1MKIA 5E43A 1EI5A 3KSHA 4GD8A 1H0MA 5EM1A 1E3UD 1F2KA 2VGKA 1OPXA 3PHYA 1D7EA 4Y0UA 4BENA 3WS0A 4B4ZA 1GA9A 3LR5A 4XUZA 4GCZA 4OPRA 1H8ZA 3ZG8B 4LENA 4OLGA 2C5WB 1E3UA 1FOFA 4UA6A 3P7NA 1OTIA 4Q0HA 2WUQA 3OPLA 5TFQA 4OPYA 4KZ8A 4KQDA 5EV0A 4DE2A 5HARA 4OOYA 3T1SA 1QMFA 4KQOA 2PU4A 3RJUA 1IOUA 3DBAA 4GB7A 1SZVA 2J9OA 4OH0A 3UDXA 2V1BA 3SH9A 2KOIA 3NI9A 5HAQA 2A24A 4BD1A 3NC8A 1EW0A 1XJ3A 4B88A 1YSPA 1GSXA 4BMWA 4IBXA 2GX5A 1T19A 4WZ5A 3CUEC 4GKUA 3HUOA 4JXWA 1YPRA 5FATA 2V20A 1AXBA 4PM5A 3LI9A 2DNSA 2ZM0A 3E4PA 3NDGA 3HREA 4H8RA 4HOIA 4S2PA 2JKRM 2WGWA 1BT5A 3LUQA 1K55A 1ONHA 5K5BA 4XT2B 2Y55A 3DTIA 1VB6A 1PWCA 3ISGA 1S66L 4FCFA 2EX9A 2BASA 2W3FA 2Y2HA 1TD5A 2EX2A 5TR7A 3TOIA 3FKWA 3UN7A 2L1MA 4PMAA 4MN6A 4ZTKA 4KUOA 3C7UA 3N8RA 5EVIB 1PZPA 4Q8IA 4DN0A 3CPTB 2EX8A 4CLCD 3EOIA 2JE5A 3O3VA 1XJ2A 4EEPA 1NRFA 1HLUP 5EVEA 3T4TA 3Q7VA 4BBVA 1ESIA 2X71A 2VK3A 5FASA 1X0OA 2W3EA 4CLCA 2PDRA 3A3IA 1NLZA 1STZA 5GL9A 2OLUA 3WRZA 4GOGA 2PT7A 4ESPA 4WL9A 1ZG4A 1SDNA 3BYDA 4HH2A 4QU3A 4KZBA 3WS5A 4FSFA 4Y13A 4LFUA 1CEGA 2HDSA 4GNUA 3D3OA 2OAQ1 3IWOA 3S7OA 3PXPA 2H28A 4PKYG 3LI8A 1W63Q 1IYPA 1GHMA 4MN7A 2Y91A 2FFFB 4EQ1A 2GNXA 2H10A 4N9KA 3S1YA 4KZAA 2W1TB 3L7HA 5EVIC 4DDYA 4JF4A 3ZNYA 2L4RA 4DE3A 4ZRRA 2QPNA 4F3LB 4PM8A 1K6SA 2HPBA 3VFHA 2I72A 1YQSA 2WAEA 3CHWP 3LIDA 3TW8A 5DJUA 5DJTA 3C5AA 2OV5A 5CXWA 1CI9A 3QP4A 4MBHA 5A92A 4U0XA 3IX8A 3MSHA 3ZG0A 5IHVA 1GHIA 3EQUA 1PW1A 3MFDA 4LV3A 2V0UA 3GV9A 4BL3A 1IEMA 3NOPC 4E3KA 3ZVWA 4O8GA 4G3WA 4OQGA 4N1HA 1D06A 3QP2A 5DTSA 3WWXA 3SS4A 2WZXA 2VJWA 2E8IA 3M2KA 1N9BA 3L9KA 5U47A 3NULA 4HHDA 3MZDA 4I38A 5CGXA 1NRJA 4MBKA 4HY8A 1NY0A 1DJAA 5FEGA 4EW7A 3BM6A 3UB5P 3T1XA 4UEYA 4X68A 2UWXA 2XFTA 5FDSA 3V3SA 2G2WA 4NXEA 5M19A 3IXHA 1OTBA 2O9AA 2Z2LB 4X55A 4ZJ2A 3K3CA 3JYIA 1WE4A 3BY8A 4RX3A 3AGEA 2A24B 1TS8A 5FL3A 5HDCA 3F1OA 4GZBA 2G2UA 2ZJ9A 1LL9A 3HJKA 4LV1A 1VETB 2PR6A 3VV4A 1PZOA 1K54A 1GHPA 4EBPA 5HZHA 1G5UA 5FA7A 1TS0A 1OT6A 1ERQA 1P0ZA 4ARZA 2WGWB 5A90A 2XQZA 3PTEA 3UPNA 1TVFA 4DMZA 2ZC5B 4OONA 3C38A 4GLQA 2FZ0A 2O9BA 4BJPA 3MMHA 4X69A 5HWVA 2GDNA 3FZCA 3O5YA 5F1GA 5J7EA 4HP4A 1BULA 4IVIA 3SOIA 5GHYA 3ULFA 3HUNA 1OJGA 4B9OA 4PM9A 5AQAA 4FH4A 4OOMA 4A5RA 3CG5A 4ETZA 4C75A 4Y17A 3T4KA 3A3EA 3H82B 2FFYA 3ZG7B 4E3IA 4II7A 1V9YA 3IXDA 3HL9A 3S7QA 3OBFA 3S22A 3BQ8A 4MN5A 4R38A 3UNWA 3DTMA 4M4XA 1ODVA 4WZ5C 3GDIA 4EEUA 1S6RA 4LRZE 2LB9A 5IT5A 1P97A 2ZQ7A 2Q9NA 3KSFA 4KQQA 3JVUA 1PFLA 4HI4A 4S2MA 1XFNA 3NOUC 4G3KA 5FAOA 3JPUA 4KG2A 1WYCA 4JXVA 1EROA 1K0KA 3PBSA 3UE0A 3V67A 4KUKA 3S7NA 1ZKJA 5HX9A 5MC7A 3RXWA 1YLTA 5CEBA 4WEJA 4DJ3A 1KE3A 5HPFA 2JHEA 4AFIA 5EUAA 4QPRA 3H7WB 1P9RA 4QJGA 2D01A 2GJ3A 3PBQA 3IWIA 1HVBA 5BOHA 3EEAA 3TRCA 3UO9A 3E2LA 4OOLA 5GLCA 1ONGA 2PU2A 3PBTA 3DWZA 3UDIA 5A8BA 2Y2NA 1I5QA 2WKEA 4BLMA 3R4KA 4JXSA 4Y7PA 3ZYTA 1YLWA 3LIBA 1G28A 4N1XA 3UB8A 1S4RA 5DKLA 1XGIA 2M7UA 4KZ4A 2Y2LA 1PIOA 3D72A 3IH8A 1M40A 2QJ5A 2V1AA 5HW3A 2EA9A 2JKRI 1IFQA 3O86A 1T1BA 4FTXA 1YLPA 4QHCA 2J8YA 4GDNA 2Y2MA 5FQQA 1GCEA 4NKPA 4OKPA 2JKTI 4NK3A 3B47A 4WMCD 3MXQA 3GSGA 4ZDXA 1W5DA 2IWDA 1BZAA 5DFXA 2WKRA 4OQHA 1NLYA 3OCNA 5E2EA 1ES3A 4X53A 5HWTA 5KZHA 1IKGA 3BWLA 5EOEA 1ZHHB 5CGSA 4RA7A 1JWZA 3G30A 3KO6A 3MJQA 5F1FA 2Y2OA 2L0WA 1BLCA 3G2YA 4XUXA 4UQIS 1KGFA 3PAEA 3SH7A 4S2JA 4MEZA 4KZ7A 4C3QA 3OPHA 4HIAA 1KDWA 2INWA 5HAIA 3BY9A 2B02A 5E2FA 5DKKA 3CWFA 1OTEA 2PHYA 1NXYA 2Y4AA 3BFEA 4IEDA 4D2OA 3U4LP 3N6IA 1F5MA 4K0XA 3GECA 4LPZA 4ARZB 2IWBA 5DF8A 3A0RA 1VEUB 3MKEA 1W79A 3IBRA 5DF7A 4RVAA 3C8CA 1U60A 2G7UA 2WKPA 1UGUA 2QJ7A 1VQQA 3QP1A 2ZMVA 1UWPX 2NUPC 3FG8A 2V0WA 3IXBA 3A0VA 2I9VA 2KDKA 1K6RA 3RH8B 2PBYA 2FH5A 1ESUA 4OLDA 3M6BA 1S4SA 1TEMA 2XA7S 1LL8A 3IF6B 1W8YA 4P85A 4WN5A 4R3JA 3BLMA 1K38A 5FAPA 1MC0A 1WA9A 1RCJA 3RFBA 3T4SA 3BEBA 5L8MA 2W3HA 1K54C 5JYOA 5F5YA 1Q2QA 2WKQA 5E2HA 3MZFA 4OQIA 3BFDA 3G31A 4HBUA 3C7VA 5HL6A 3SS3A 1FCNA 3NHQA 2JN7A 5G4YA 2O0YA 3LIAA 2JKTM 5EOOA 5AQ9A 4EV4A 3CMZA 1JTGA 3UDFA 5HDSA 5CTNA 4HJ6A 3VE4A 2ZM8A 4X25A 4UAAA 2WGIA 3IBJA 2QMIA 3E0YA 4KG5A 1P9WA 3F1PB 4EESA 4HBTA 4HH3A 4E04A 3CZDA 5G18A 2R9WA 2ZC3B 5HAPA 1Y54A 1TF1A 5AQ7A 3RXXA 3VSLA 3G6OA 3WS4A 3HLWA 3IF6C 5JYPA 4MDZA 1LI9A 2K7SA 5E2GA 4P6BA 4WEKA 5CX7A 3LFVA 5M1AA 4DXCA 2ZOIA 4KZ3A 1YM1A 4N92A 3IT9A
chains in the Genus database with same CATH topology
5G4ZA 5DF9A 3K3CA 1S1ZA 2OWJA 4HJ4A 5EFWA 3BY8A 2VGLS 3E4OA 4IJGA 4WUJA 4ME4A 3F1PA 4MCWA 3HJIA 2QYBA 3MR0A 2M7VA 4GHIA 4I39A 2A24B 1TS8A 5FL3A 2Z6DA 5IU1A 5HDCA 3A0SA 3F1OA 2VKSA 1KOUA 2QWSA 2DMWA 5C5KA 1ZTUA 2O99A 3HJKA 5HD5A 2PR6A 4GJ4A 3BW6A 3OLOA 2HF6A 3VV4A 2W27A 4JGPA 1T18A 5HZHA 3F1NA 3KSGA 1TS0A 1OT6A 2PD7A 2HJ9C 1P0ZA 4ARZA 3IS2B 3PBNA 3R7WB 4DMZA 3C38A 4GLQA 2FZ0A 2O9BA 1GSWA 2VV8A 4BJPA 3T4JA 4B93A 2OAP1 5TBMA 3MMHA 1TS6A 4O0PA 3UE3A 3MQ0A 5HWVA 4H6JA 3ZQ5A 1LSXA 3CLOA 3O5YA 2OOLA 1H3QA 5J7EA 3NOTC 2KLIA 5TJJA 4HP4A 4LRYC 3ULFA 2EWWA 4EUVA 2PYPA 4Z1WA 2W3DA 4JGQA 1OJGA 2K31A 4B9OA 4GS9B 5J4EA 4WLAA 4BWIA 2J3TC 3W2ZA 3LR3A 4OOMA 4ETZA 3EQVA 2W0NA 4GW9A 4HJ3A 3T4KA 3H82B 4CQHA 4II7A 3PBRA 2EWVA 1V9YA 3EGXC 3PYPA 4EU0A 2KX6A 4R3AA 3OOVA 4R6LA 3S7QA 5I5LA 2XRNA 3OBFA 1OTDA 1YKDA 3ICYA 2M1CA 3IS2A 3LYXA 1DRMA 2YKHA 3BQ8A 4MN5A 4R38A 3R7WA 5F69A 2W1TA 1MKMA 3SW1A 2LB5A 3S7PA 3T4OA 5AVFA 2ZMFA 4M4XA 4ETXA 1ODVA 4Q0JA 4L0LA 3GDIA 4EEUA 1F9IA 5KIZA 4LRZE 5F6AA 2MJ6A 4G3VA 2LB9A 4PKYA 5IT5A 3UB6A 4DJ2A 1P97A 3VOLA 3KSFA 3PR6A 3K2NA 1UWNX 2P04A 3JVUA 4GS9A 4HNBA 3MFXA 3T50A 2PD8A 4HI4A 3E4QA 4Y3IA 1XFNA 3NOUC 4G3KA 2J3WA 5HD3A 1OJ5A 2ZBBA 2GZAA 3H82A 4L9GA 4EERA 4JGRA 3LR4A 2QKPA 5AJGA 4NEED 3PBSA 4WF0A 3V67A 5HSQA 4KUKA 3S7NA 3OCLA 2PR5A 2QHKA 5MC7A 1F98A 4WEJA 4DJ3A 3KSHA 2HV1A 3UE6A 5HPFA 3T4QA 2JHEA 1OPXA 4AFIA 3PHYA 1D7EA 4QPRA 3KX0X 3H7WB 1P9RA 4I5SA 4FOFA 4Y5FA 2O9CA 2D01A 2GJ3A 3PBQA 4P6ZM 2J3TD 3LR5A 3EEAA 3TRCA 4GCZA 1LT0A 2J80A 4OOLA 1V9ZA 2VV7A 3PBTA 3PBOA 3P7NA 1OTAA 1OTIA 4Q0HA 5A8BA 4Q0IA 4KQDA 3LIEA 3R4KA 3ZYTA 3LIBA 4KQOA 1G28A 2B18A 1IOUA 3UB8A 5HPIA 4HP9A 3CUEA 1MZUA 1G6OA 1S4RA 5DKLA 3DBAA 2M7UA 5KSHA 1NWZA 2V1BA 2KOIA 3C2WA 3BQAA 3D72A 4NXFA 2A24A 5DFYA 2Y79A 4NXBA 2Y8HA 4L9FA 3UB7A 2W3GA 1EW0A 1XJ3A 2QJ5A 3H7WA 1YSPA 4NXGA 4EETB 1DP6A 1GSXA 2V1AA 3U2AA 4BMWA 2EA9A 2JKRI 4YWZA 1IFQA 2GX5A 3HCYA 1T1BA 1T19A 3CUEC 2D02A 1S1YA 4NKPA 2JKTI 3LI9A 3E4PA 3B47A 4HOIA 4HQAA 2JKRM 1H8MA 3MXQA 3E98A 5DFXA 2WKRA 3LUQA 1NLYA 2W1RA 3OCNA 2HGVA 5K5BA 4XT2B 2P7JA 5HWTA 2IA2A 1VB6A 3BWLA 1YSQA 1N9LA 1S66L 3UB9A 2BASA 2W3FA 1TD5A 1ZHHB 4LLOB 4IHQA 3BJNA 4CLCB 4BBTA 5J3WA 2L1MA 3KO6A 1BYWA 1XJ6A 2HJEA 3MJQA 2XROA 2L0WA 4MN6A 3H9WA 3LICA 4UQIM 4YNRA 4KUOA 4UQIS 3B42A 1LSVA 2VZWA 4HIAA 1N9OA 1VHMA 2INWA 3BY9A 2VA0A 3VE3A 4DN0A 4L9EA 2B02A 5DKKA 3MQQA 4I3IA 3CWFA 5HWWA 1OTEA 2PHYA 1TS7A 3F1NB 4CLCD 3EOIA 3KYZA 2NUTC 1F5MA 3MF0A 4IUKA 1XJ2A 3GECA 4LPZA 4ARZB 4EEPA 4XT2A 4MMNA 3A0RA 3K3DA 3T4TA 3IBRA 2VGLM 4R70A 5TBMB 3C8CA 4IUHA 4BBVA 1T1CA 4PHTA 2VLGA 3LIFA 3TJZC 2G7UA 1X0OA 3B33A 2WKPA 1UGUA 2W3EA 4H6JB 2PDRA 4CLCA 2QJ7A 4P6ZS 3FPWA 2ZMVA 4WELA 1GSVA 1NLZA 1STZA 5HDDA 1UWPX 3EGDC 2NUPC 3LR0A 2PT7A 4LRXC 4WL9A 3FG8A 2V0WA 3A0VA 2I9VA 4HH2A 4FSFA 1T1AA 2KDKA 5AVEA 3RH8B 2XA7M 3D3OA 2FH5A 2OAQ1 2XSSA 1N9NA 3JVVA 3MQOA 3S7OA 4CLCC 2Z6CA 1S4SA 3PXPA 2H28A 1Y28A 2XA7S 4PKYG 1LL8A 3LI8A 1W63Q 1LSWA 4BBUA 4MN7A 4WN5A 3TE8A 2GNXA 4EQ1A 3NJAA 1DP9A 3UMDA 2W1TB 4EXOA 1MC0A 4I3JA 2R78A 1WA9A 3RFBA 2VV6A 3T4SA 2YKFA 2PYRA 1OT9A 5L8MA 5LBRA 2L4RA 2W3HA 3EWKA 3RTYA 2V9AA 4ZRRA 5F5YA 4PAUA 2WKQA 4F3LB 3OC2A 4JGOA 5HL6A 5F68A 3UMEA 1YAXA 4I3AA 3LIDA 3KSIA 3NHQA 3TW8A 5DJUA 4CLCE 5DJTA 1S67L 2JN7A 3C30A 5G4YA 2O0YA 2CMNA 3P01A 3LIAA 2JKTM 2A2LA 3KYQA 1W63M 4YOFA 2VEAA 5HDSA 4HJ6A 4RQ9A 3EQUA 3VE4A 2V0UA 3NOPC 3IBJA 3E0YA 1XFQA 2P08A 1JNUA 1P9WA 3F1PB 4O8GA 1DP8A 4Y2FA 4K08A 3FPVA 4GHIB 4EESA 4HH3A 4G3WA 4E04A 1D06A 5IS1A 3FC7A 2OWHA 3EEHA 2VJWA 3F1OB 2ZOHA 4O01A 4HHDA 1XJ4A 1TF1A 2K2NA 4I38A 1NRJA 4HY8A 4F3LA 3G6OA 3CAXA 4EW7A 3CI6A 4UEYA 4MDZA 3CITA 2K7SA 2VX8A 4WEKA 5CX7A 3LFVA 4NXEA 3T4LA 1OTBA 2O9AA 2ZOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4Z A;  3K3C A;  1S1Z A;  2OWJ A;  4HJ4 A;  5EFW A;  3BY8 A;  3E4O A;  4WUJ A;  3F1P A;  3HJI A;  3MR0 A;  4GHI A;  4I39 A;  2A24 B;  1TS8 A;  2Z6D A;  5IU1 A;  5HDC A;  3A0S A;  3F1O A;  1KOU A;  2QWS A;  3HJK A;  5HD5 A;  2PR6 A;  3OLO A;  2W27 A;  4JGP A;  1T18 A;  5HZH A;  3F1N A;  1TS0 A;  1OT6 A;  2PD7 A;  1P0Z A;  3IS2 B;  2VV8 A;  1GSW A;  5TBM A;  1TS6 A;  5HWV A;  4H6J A;  3ZQ5 A;  1LSX A;  3CLO A;  2OOL A;  5J7E A;  3NOT C;  4HP4 A;  4LRY C;  3ULF A;  2PYP A;  4JGQ A;  1OJG A;  4B9O A;  5J4E A;  4GS9 B;  4WLA A;  2W0N A;  4GW9 A;  4HJ3 A;  3H82 B;  1V9Y A;  3PYP A;  2KX6 A;  4R3A A;  4R6L A;  5I5L A;  1OTD A;  3ICY A;  2M1C A;  3IS2 A;  3LYX A;  1DRM A;  2YKH A;  4MN5 A;  4R38 A;  5F69 A;  3SW1 A;  5AVF A;  4M4X A;  1ODV A;  3GDI A;  4EEU A;  1F9I A;  5KIZ A;  4LRZ E;  5F6A A;  4PKY A;  3UB6 A;  4DJ2 A;  1P97 A;  3VOL A;  1UWN X;  4GS9 A;  4HNB A;  3MFX A;  3T50 A;  2PD8 A;  4HI4 A;  3E4Q A;  1XFN A;  3NOU C;  5HD3 A;  1OJ5 A;  2ZBB A;  3H82 A;  4L9G A;  4EER A;  4JGR A;  2QKP A;  4WF0 A;  5HSQ A;  4KUK A;  2PR5 A;  2QHK A;  1F98 A;  4DJ3 A;  2HV1 A;  3UE6 A;  2JHE A;  3PHY A;  1D7E A;  3KX0 X;  3H7W B;  4I5S A;  2D01 A;  2GJ3 A;  4GCZ A;  1LT0 A;  2J80 A;  1V9Z A;  2VV7 A;  3P7N A;  1OTA A;  1OTI A;  5A8B A;  4KQD A;  3LIE A;  3LIB A;  1G28 A;  3UB8 A;  4HP9 A;  1MZU A;  1S4R A;  5DKL A;  1NWZ A;  2V1B A;  4NXF A;  3C2W A;  3D72 A;  2A24 A;  4NXB A;  4L9F A;  3UB7 A;  1EW0 A;  1XJ3 A;  2QJ5 A;  3H7W A;  4NXG A;  4EET B;  1DP6 A;  1GSX A;  2V1A A;  2EA9 A;  4YWZ A;  1T1B A;  1T19 A;  2D02 A;  1S1Y A;  3LI9 A;  3E4P A;  4HOI A;  4HQA A;  3MXQ A;  2WKR A;  3LUQ A;  4XT2 B;  2P7J A;  5HWT A;  1VB6 A;  3BWL A;  1N9L A;  1S66 L;  3UB9 A;  2BAS A;  4LLO B;  4BBT A;  5J3W A;  2L1M A;  1BYW A;  1XJ6 A;  3MJQ A;  2L0W A;  4MN6 A;  3H9W A;  3LIC A;  4KUO A;  1LSV A;  4HIA A;  1N9O A;  2INW A;  3BY9 A;  3VE3 A;  4L9E A;  2B02 A;  5DKK A;  3MQQ A;  4I3I A;  3CWF A;  5HWW A;  1OTE A;  2PHY A;  1TS7 A;  3F1N B;  1XJ2 A;  3GEC A;  4LPZ A;  4EEP A;  4XT2 A;  3A0R A;  3K3D A;  3IBR A;  4R70 A;  5TBM B;  3C8C A;  4BBV A;  1T1C A;  2VLG A;  3LIF A;  1X0O A;  3B33 A;  2WKP A;  1UGU A;  4H6J B;  2PDR A;  2QJ7 A;  5HDD A;  1GSV A;  1UWP X;  4LRX C;  4WL9 A;  3FG8 A;  2V0W A;  3A0V A;  2I9V A;  4HH2 A;  1T1A A;  2KDK A;  5AVE A;  3RH8 B;  1N9N A;  3MQO A;  2Z6C A;  1S4S A;  2H28 A;  1Y28 A;  4PKY G;  1LL8 A;  3LI8 A;  1LSW A;  4BBU A;  4WN5 A;  4EQ1 A;  3NJA A;  1DP9 A;  3UMD A;  4EXO A;  4I3J A;  2R78 A;  1WA9 A;  2VV6 A;  2YKF A;  2PYR A;  1OT9 A;  2L4R A;  3EWK A;  3RTY A;  2V9A A;  5F5Y A;  2WKQ A;  4F3L B;  4JGO A;  5F68 A;  3UME A;  4I3A A;  3LID A;  3NHQ A;  5DJU A;  5DJT A;  1S67 L;  2JN7 A;  5G4Y A;  2CMN A;  3LIA A;  2VEA A;  5HDS A;  4HJ6 A;  4RQ9 A;  3VE4 A;  2V0U A;  3NOP C;  1XFQ A;  1JNU A;  3F1P B;  1DP8 A;  4K08 A;  4GHI B;  4EES A;  4HH3 A;  4E04 A;  1D06 A;  5IS1 A;  3FC7 A;  2OWH A;  3EEH A;  3F1O B;  2ZOH A;  4HHD A;  1XJ4 A;  4I38 A;  4HY8 A;  4F3L A;  3G6O A;  3CAX A;  4EW7 A;  2K7S A;  4NXE A;  1OTB A;  2ZOI A; 
#chains in the Genus database with same CATH topology
 5F83 A;  5G4Z A;  4LCM A;  2OWJ A;  5DVA A;  2ZMA A;  2JKF A;  1QME A;  3E4O A;  5EEC A;  4ME4 A;  4YIN A;  3HJI A;  3VFF A;  2M7V A;  4GHI A;  1GA0 A;  4Y0T A;  1CI8 A;  5IU1 A;  1DJC A;  2VKS A;  1KOU A;  2XF3 A;  5C5K A;  5EE8 A;  1ZTU A;  2O99 A;  4HES A;  4ZBE A;  1CEF A;  1K57 C;  3BW6 A;  3OLO A;  3G32 A;  4S2L A;  1NZU A;  5KMW A;  3PAG A;  5AQB A;  1PWG A;  3KSG A;  3WRT A;  1JTD A;  4E3M A;  3VOZ A;  5TBM A;  2ZM2 A;  4CPK A;  2ZL1 B;  4O0P A;  3MXS A;  3BRM A;  4H6J A;  3WS1 A;  1AWI A;  1LSX A;  4FUW A;  1ES4 A;  4LRY C;  3W4Q A;  4Z1W A;  1FIK A;  2W3D A;  2K31 A;  2ZQ8 A;  3LR3 A;  2A3U A;  3DAV A;  3EQV A;  4M3K A;  4GW9 A;  4BL2 A;  1LLB A;  3EGX C;  1FIL A;  4R3A A;  2XH9 A;  3ICY A;  3IS2 A;  2VGJ A;  1DRM A;  2ACG A;  1FR1 A;  3R7W A;  2LB5 A;  1SKO A;  2ZMF A;  4ETX A;  4L0L A;  3QHY A;  2ZQA A;  2MJ6 A;  4G3V A;  2XD1 A;  4DJ2 A;  1PRQ A;  4GS9 A;  5EVL A;  2WAD A;  3E4Q A;  4Y3I A;  1LI0 A;  1OJ5 A;  3IHB A;  5CGW A;  4L9G A;  4EER A;  4UHU A;  2ZQD A;  4NEE D;  1ES2 A;  5HSQ A;  4S2I A;  1M6K A;  2QHK A;  4WBG A;  1RGZ A;  1F98 A;  1KGE A;  2EFU A;  2WYX A;  3UE6 A;  1ERM A;  3KX0 X;  4QWO A;  4Y5F A;  4P6Z M;  1FCO A;  1LT0 A;  2J80 A;  1V9Z A;  2VV7 A;  3GTC A;  5CEC A;  2AVX A;  4GDB A;  3PBO A;  2J9P A;  3S4X A;  3LIE A;  2JKG A;  3GQZ A;  5A91 A;  4R1G A;  2PAV P;  2HDR A;  1YLZ A;  4HP9 A;  5HPI A;  3CUE A;  5HL1 A;  4Y15 A;  1NWZ A;  3C4O A;  4NXF A;  1TDG A;  5DFY A;  1YMS A;  4L9F A;  2Y8H A;  4NXB A;  3UB7 A;  4KZ6 A;  3D9Y A;  4S2O A;  1MY8 A;  1DP6 A;  2XEP A;  3V5M A;  5FQK A;  5M18 A;  1E25 A;  1H5X A;  3VP0 A;  3N8L A;  2D02 A;  3BLS A;  4MLL A;  3UPP A;  1S0W A;  1S1Y A;  3W8K A;  3DW0 A;  1FSY A;  1EWZ A;  3GR2 A;  3OPR A;  4HQA A;  3HLG A;  1H8M A;  3W4O A;  3DWK A;  2HZ5 A;  2W1R A;  4OVD A;  4ZAM A;  5FDH A;  1N9L A;  3Q7V B;  2C6W B;  1Z09 A;  3UB9 A;  1ACF A;  1H8Y A;  3OPP A;  4IHQ A;  4CLC B;  5J3W A;  4OP5 A;  1BYW A;  1XJ6 A;  2ZQ9 A;  3LIC A;  4UQI M;  2H0Y A;  1K55 C;  3GRJ A;  4YNR A;  1ZC2 A;  3O87 A;  3Q81 A;  3SZT A;  1LSV A;  1LHY A;  2VZW A;  5DTK A;  2VA0 A;  3HLC A;  2Y2G A;  1XXM A;  4L9E A;  3MQQ A;  4I3I A;  3GVB A;  3FKV A;  4PM7 A;  1DJB A;  4FD8 A;  3KYZ A;  2NUT C;  2Y2Q A;  1MBL A;  3M2J A;  4XT2 A;  4MMN A;  4MNR A;  3K3D A;  1PW8 A;  3MZE A;  4R70 A;  5TBM B;  4IUH A;  1YLJ A;  3NIA A;  2VLG A;  3LY3 A;  5TGF A;  1HZO A;  4H6J B;  4PM6 A;  2Y2K A;  4P6Z S;  3FPW A;  4F94 A;  4WEL A;  2EXB A;  5HDD A;  2J7V A;  1I2W A;  1VM1 A;  4ZJ1 A;  4LRX C;  2RCX A;  2DRW A;  3VP1 A;  5EVI A;  3VP3 A;  2XA7 M;  2B95 A;  2ZC7 A;  2WKI A;  3P98 A;  4EBL A;  4CLC C;  5L2F A;  2Z6C A;  3CPT A;  4DDS A;  5GHX A;  4E6X A;  4JF6 A;  1JVJ A;  4BBU A;  3TE8 A;  3TSG A;  4EWF A;  4DXB A;  1DP9 A;  1IYS A;  4I3J A;  2R78 A;  3ZGA B;  3HLF A;  1WYB A;  4R0Q A;  2YKF A;  1OT9 A;  2CC1 A;  4JPM A;  5LBR A;  3EWK A;  1W8Q A;  5KSC A;  3ZDJ A;  1XP4 A;  3NCK A;  4PAU A;  3D4F A;  1XA7 A;  5F68 A;  1KDS A;  3UME A;  4I3A A;  5FEF A;  3KSI A;  1S67 L;  1YLY A;  5FAQ A;  3A3D A;  3P01 A;  4OPQ A;  2A2L A;  1MXO A;  1W63 M;  4YOF A;  4LV2 A;  4RQ9 A;  1O7E A;  5L07 A;  3ZNT A;  4QY5 A;  3N7W A;  1XFQ A;  1JNU A;  2ZLY A;  4Y2F A;  2BG1 A;  3FPV A;  5FSR A;  4MBF A;  3IHA A;  3T12 B;  3FC7 A;  2OWH A;  3EEH A;  3V50 A;  3F1O B;  4OPZ A;  3BFC A;  4O01 A;  2HDQ A;  4X6T A;  4F3L A;  3T1Q B;  3CI6 A;  4QD4 A;  4QY6 A;  2BLS A;  4P0M A;  3VMA A;  4QB8 A;  3I7J A;  4LCL A;  1XA1 A;  2EFX A;  1NJ4 A;  3HLB A;  1KVM A;  3W4P A;  1DY6 A;  3T4L A;  1K4F A;  3VOY A;  1W7F A;  4E3J A;  1S1Z A;  2WAF A;  4IJG A;  4IVK A;  4WUJ A;  4MCW A;  3V3R A;  3MR0 A;  3IX3 A;  2Z6D A;  2XLN A;  2WKH A;  1I2S A;  5CTM A;  3G2Z A;  2OLV A;  5HD5 A;  2W27 A;  4KQR A;  3AGF A;  1SCW A;  1T18 A;  2Q0O A;  3E2K A;  3F1N A;  2ZC6 B;  3BFG A;  2P9V A;  1GSW A;  3QP5 A;  3T4J A;  2OAP 1;  4S2N A;  2V1Z A;  3UE3 A;  3ZQ5 A;  3NOT C;  2KLI A;  5GLD A;  2EWW A;  2PYP A;  4JGQ A;  5J4E A;  4BWI A;  4DF6 A;  2ZD8 A;  1VET A;  3HUM A;  1Z6F A;  4DE1 A;  3PBR A;  1L3L A;  2RL3 A;  4RX2 A;  2KX6 A;  3OOV A;  2JBF A;  2XRN A;  5FQ9 A;  4Y0O A;  1JWV A;  4GD6 A;  2M1C A;  1OME A;  1XGJ A;  3LYX A;  4C6Y A;  4EQI A;  5F69 A;  3SW1 A;  3S7P A;  4Q0J A;  4UA9 A;  2WK0 A;  5KIZ A;  4PKY A;  2B5R A;  3UB6 A;  2P04 A;  2X02 A;  3FWL A;  3HLD A;  4HNB A;  3MFX A;  4JKT A;  4YFM A;  1CK3 A;  3IH9 A;  3FV7 A;  1YT4 A;  4KZ9 A;  5HD3 A;  2ZBB A;  4HEF A;  3H82 A;  4LV0 A;  4X1L A;  1CJF A;  5D3O A;  4UA7 A;  2PRF A;  5AJG A;  3IQA A;  2XFS A;  2PR5 A;  3DTE A;  3MBZ A;  1O07 A;  1IYO A;  5CED A;  3VP4 A;  2HV1 A;  2IWC A;  3T4Q A;  4Z9Q A;  1SDE A;  3ZFZ A;  4FH2 A;  4I5S A;  4FOF A;  3ZG9 B;  2O9C A;  1MPL A;  2J3T D;  1E4D A;  4CJN A;  1OTA A;  1PI5 A;  5CHM A;  4Q0I A;  3IX4 A;  1LL5 A;  3HLE A;  4EUZ A;  5EM0 A;  3OZH A;  2B18 A;  3CJM A;  3TG9 A;  4U0T A;  5F82 A;  1MZU A;  1G6O A;  4IBR A;  3LEZ A;  5KSH A;  3MXR A;  2P74 A;  3C2W A;  3BQA A;  1BSG A;  2Y79 A;  3LEQ A;  5A93 A;  2W3G A;  4P87 A;  3H7W A;  4NXG A;  5GHZ A;  4EET B;  3U2A A;  4KZ5 A;  4WM9 A;  4YWZ A;  3HCY A;  1SHV A;  2A49 A;  3UE1 A;  1ZG6 A;  1MWS A;  4S2K A;  1K25 A;  5L10 A;  4X1M A;  4RYE A;  5J8X A;  1IEL A;  3Q82 A;  3E98 A;  4ZJ3 A;  1BTL A;  2HGV A;  1XKZ A;  1YMX A;  2P7J A;  2IA2 A;  1YSQ A;  1KGG A;  1L0F A;  1NYY A;  4LLO B;  1K56 D;  3BJN A;  4BBT A;  3ITA A;  2XRO A;  2HJE A;  3HVF A;  4DE0 A;  3Q1F A;  2PBD P;  3H9W A;  3BEC A;  1KE4 A;  3ZVT A;  4DKI A;  3B42 A;  1FQG A;  1KE0 A;  1K56 A;  1N9O A;  1VHM A;  1HTZ A;  3VE3 A;  4JF5 A;  5HWW A;  3MKF A;  3ZCZ A;  4E3N A;  1TS7 A;  4N9L A;  4WZ4 A;  3F1N B;  3MF0 A;  4B4X A;  4IUK A;  2P9V B;  2BTF P;  4DRT A;  1BLS A;  1RP5 A;  3DTK A;  2VGL M;  1XX2 A;  1T1C A;  4PHT A;  1TDL A;  3LIF A;  3TJZ C;  5CRF A;  4EBN A;  3B33 A;  4E6W A;  1GSV A;  2JC7 A;  3EGD C;  4K91 A;  4LGW A;  3C4P A;  3LR0 A;  3NEC A;  1PI4 A;  4PPR A;  4U3T A;  5FQJ A;  3G34 A;  1T1A A;  3UPO A;  5AVE A;  3LO7 A;  2XSS A;  1N9N A;  3JVV A;  2DCF A;  2EXA A;  3MQO A;  3HBR A;  2HP6 A;  1L0G A;  4KEN B;  1Y28 A;  4JLF A;  2E8J A;  5EPH A;  3BFF A;  1BUE A;  4ID4 A;  1LSW A;  1N4O A;  3NJA A;  1VEU A;  2ZC4 B;  3UMD A;  3QNC A;  4EXO A;  2VV6 A;  3Q7Z A;  3Q07 A;  1RGY A;  2Z2M B;  3P09 A;  2PYR A;  5HFO A;  3RTY A;  1ALQ A;  5L09 A;  2V9A A;  1L0D A;  3MS6 A;  1IYQ A;  3OC2 A;  3UY6 A;  4BQM A;  2WGV A;  3G35 A;  4JGO A;  4OP8 A;  1YAX A;  1XPB A;  4CLC E;  2OSU A;  1BLP A;  3C30 A;  2CMN A;  1L0E A;  2HDU A;  4S2N C;  1Q2P A;  3KYQ A;  1PWD A;  2VEA A;  4NET A;  3ITB A;  3IF6 A;  1K4E A;  4WYY A;  1ES5 A;  2X01 A;  2P08 A;  3N4I A;  1DP8 A;  3A3J A;  4JBF A;  4GHI B;  4K08 A;  4KG6 A;  2H5S A;  3WS2 A;  5IS1 A;  4R23 A;  3NY4 A;  4JXG A;  1FSW A;  2ZOH A;  1J3W A;  1NYM A;  1XJ4 A;  2K2N A;  2V8F A;  3CAX A;  3QP8 A;  2XD5 A;  3ZG5 A;  3CIT A;  1PYY A;  2VX8 A;  5CHU A;  4R3B A;  1CQA A;  2Q9M A;  5DF9 A;  3N8S A;  1KVL A;  4HJ4 A;  5EFW A;  3LGO A;  1K57 A;  2QZ6 A;  2VGL S;  5EVI D;  1L2S A;  2HP5 A;  2V8C A;  3F1P A;  2WZZ A;  2QYB A;  3GMW A;  4I39 A;  5I94 A;  4X56 A;  3A0S A;  2QWS A;  2DMW A;  2R9X A;  2XK1 A;  4GJ4 A;  1IKI A;  1JWP A;  2HF6 A;  3NBL A;  1CF0 A;  4JGP A;  1J9M A;  5FI6 A;  4NG2 A;  5GLA A;  3VP2 A;  1FR6 A;  3SS5 A;  2PD7 A;  2HJ9 C;  2XGN A;  3IS2 B;  1HD8 A;  3PBN A;  4K0W A;  2XDM A;  5FI7 A;  3R7W B;  4D60 A;  2ZQC A;  5CER A;  3LCE A;  3B3X A;  2VV8 A;  3AGD A;  1A0K A;  4B93 A;  3ZHH A;  1SKO B;  4GN2 A;  1TS6 A;  4R4S A;  1SKF A;  1FCM A;  2Y2I A;  3IWQ A;  3MQ0 A;  3IXG A;  3VSK A;  3CLO A;  2OOL A;  1H3Q A;  5TJJ A;  2Y59 A;  1C3B A;  3FYZ A;  1NZO A;  4EUV A;  1PNE A;  4GS9 B;  4WLA A;  2J3T C;  3W2Z A;  3T1R A;  3LY4 A;  4E3L A;  3V39 A;  2UV0 E;  2HP9 A;  2W0N A;  4HJ3 A;  3SH8 A;  4CQH A;  1MWT A;  4XXR A;  1MWR A;  2EWV A;  3M6H A;  3PYP A;  4EU0 A;  4R4R A;  4R6L A;  4O7D A;  5I5L A;  1D1J A;  1OTD A;  1YKD A;  2H0T A;  5FI2 A;  1MWU A;  2YKH A;  3QP6 A;  2W1T A;  1MKM A;  3T4O A;  4BD0 A;  5AVF A;  2ZL1 A;  5DTT A;  1BLH A;  5GLB A;  1G68 A;  3IF5 A;  1F9I A;  5F6A A;  4WMC A;  4E3O A;  2Y2P A;  2XR0 A;  3NDE A;  3VOL A;  2JCH A;  3PR6 A;  3K2N A;  1UWN X;  5FQI A;  5FQM A;  3KYE A;  2PD8 A;  4OQ0 A;  3T50 A;  2EX6 A;  1G6A A;  3G4P A;  3A3F A;  3O88 A;  1Y4O A;  2V2F F;  3QNB A;  2J3W A;  2Y2J A;  2GZA A;  5CHJ A;  4JGR A;  3LR4 A;  2QKP A;  4WF0 A;  3OCL A;  1MKI A;  5E43 A;  1EI5 A;  3KSH A;  4GD8 A;  1H0M A;  5EM1 A;  1E3U D;  1F2K A;  2VGK A;  1OPX A;  3PHY A;  1D7E A;  4Y0U A;  4BEN A;  3WS0 A;  4B4Z A;  1GA9 A;  3LR5 A;  4XUZ A;  4GCZ A;  4OPR A;  1H8Z A;  3ZG8 B;  4LEN A;  4OLG A;  2C5W B;  1E3U A;  1FOF A;  4UA6 A;  3P7N A;  1OTI A;  4Q0H A;  2WUQ A;  3OPL A;  5TFQ A;  4OPY A;  4KZ8 A;  4KQD A;  5EV0 A;  4DE2 A;  5HAR A;  4OOY A;  3T1S A;  1QMF A;  4KQO A;  2PU4 A;  3RJU A;  1IOU A;  3DBA A;  4GB7 A;  1SZV A;  2J9O A;  4OH0 A;  3UDX A;  2V1B A;  3SH9 A;  2KOI A;  3NI9 A;  5HAQ A;  2A24 A;  4BD1 A;  3NC8 A;  1EW0 A;  1XJ3 A;  4B88 A;  1YSP A;  1GSX A;  4BMW A;  4IBX A;  2GX5 A;  1T19 A;  4WZ5 A;  3CUE C;  4GKU A;  3HUO A;  4JXW A;  1YPR A;  5FAT A;  2V20 A;  1AXB A;  4PM5 A;  3LI9 A;  2DNS A;  2ZM0 A;  3E4P A;  3NDG A;  3HRE A;  4H8R A;  4HOI A;  4S2P A;  2JKR M;  2WGW A;  1BT5 A;  3LUQ A;  1K55 A;  1ONH A;  5K5B A;  4XT2 B;  2Y55 A;  3DTI A;  1VB6 A;  1PWC A;  3ISG A;  1S66 L;  4FCF A;  2EX9 A;  2BAS A;  2W3F A;  2Y2H A;  1TD5 A;  2EX2 A;  5TR7 A;  3TOI A;  3FKW A;  3UN7 A;  2L1M A;  4PMA A;  4MN6 A;  4ZTK A;  4KUO A;  3C7U A;  3N8R A;  5EVI B;  1PZP A;  4Q8I A;  4DN0 A;  3CPT B;  2EX8 A;  4CLC D;  3EOI A;  2JE5 A;  3O3V A;  1XJ2 A;  4EEP A;  1NRF A;  1HLU P;  5EVE A;  3T4T A;  3Q7V A;  4BBV A;  1ESI A;  2X71 A;  2VK3 A;  5FAS A;  1X0O A;  2W3E A;  4CLC A;  2PDR A;  3A3I A;  1NLZ A;  1STZ A;  5GL9 A;  2OLU A;  3WRZ A;  4GOG A;  2PT7 A;  4ESP A;  4WL9 A;  1ZG4 A;  1SDN A;  3BYD A;  4HH2 A;  4QU3 A;  4KZB A;  3WS5 A;  4FSF A;  4Y13 A;  4LFU A;  1CEG A;  2HDS A;  4GNU A;  3D3O A;  2OAQ 1;  3IWO A;  3S7O A;  3PXP A;  2H28 A;  4PKY G;  3LI8 A;  1W63 Q;  1IYP A;  1GHM A;  4MN7 A;  2Y91 A;  2FFF B;  4EQ1 A;  2GNX A;  2H10 A;  4N9K A;  3S1Y A;  4KZA A;  2W1T B;  3L7H A;  5EVI C;  4DDY A;  4JF4 A;  3ZNY A;  2L4R A;  4DE3 A;  4ZRR A;  2QPN A;  4F3L B;  4PM8 A;  1K6S A;  2HPB A;  3VFH A;  2I72 A;  1YQS A;  2WAE A;  3CHW P;  3LID A;  3TW8 A;  5DJU A;  5DJT A;  3C5A A;  2OV5 A;  5CXW A;  1CI9 A;  3QP4 A;  4MBH A;  5A92 A;  4U0X A;  3IX8 A;  3MSH A;  3ZG0 A;  5IHV A;  1GHI A;  3EQU A;  1PW1 A;  3MFD A;  4LV3 A;  2V0U A;  3GV9 A;  4BL3 A;  1IEM A;  3NOP C;  4E3K A;  3ZVW A;  4O8G A;  4G3W A;  4OQG A;  4N1H A;  1D06 A;  3QP2 A;  5DTS A;  3WWX A;  3SS4 A;  2WZX A;  2VJW A;  2E8I A;  3M2K A;  1N9B A;  3L9K A;  5U47 A;  3NUL A;  4HHD A;  3MZD A;  4I38 A;  5CGX A;  1NRJ A;  4MBK A;  4HY8 A;  1NY0 A;  1DJA A;  5FEG A;  4EW7 A;  3BM6 A;  3UB5 P;  3T1X A;  4UEY A;  4X68 A;  2UWX A;  2XFT A;  5FDS A;  3V3S A;  2G2W A;  4NXE A;  5M19 A;  3IXH A;  1OTB A;  2O9A A;  2Z2L B;  4X55 A;  4ZJ2 A;  3K3C A;  3JYI A;  1WE4 A;  3BY8 A;  4RX3 A;  3AGE A;  2A24 B;  1TS8 A;  5FL3 A;  5HDC A;  3F1O A;  4GZB A;  2G2U A;  2ZJ9 A;  1LL9 A;  3HJK A;  4LV1 A;  1VET B;  2PR6 A;  3VV4 A;  1PZO A;  1K54 A;  1GHP A;  4EBP A;  5HZH A;  1G5U A;  5FA7 A;  1TS0 A;  1OT6 A;  1ERQ A;  1P0Z A;  4ARZ A;  2WGW B;  5A90 A;  2XQZ A;  3PTE A;  3UPN A;  1TVF A;  4DMZ A;  2ZC5 B;  4OON A;  3C38 A;  4GLQ A;  2FZ0 A;  2O9B A;  4BJP A;  3MMH A;  4X69 A;  5HWV A;  2GDN A;  3FZC A;  3O5Y A;  5F1G A;  5J7E A;  4HP4 A;  1BUL A;  4IVI A;  3SOI A;  5GHY A;  3ULF A;  3HUN A;  1OJG A;  4B9O A;  4PM9 A;  5AQA A;  4FH4 A;  4OOM A;  4A5R A;  3CG5 A;  4ETZ A;  4C75 A;  4Y17 A;  3T4K A;  3A3E A;  3H82 B;  2FFY A;  3ZG7 B;  4E3I A;  4II7 A;  1V9Y A;  3IXD A;  3HL9 A;  3S7Q A;  3OBF A;  3S22 A;  3BQ8 A;  4MN5 A;  4R38 A;  3UNW A;  3DTM A;  4M4X A;  1ODV A;  4WZ5 C;  3GDI A;  4EEU A;  1S6R A;  4LRZ E;  2LB9 A;  5IT5 A;  1P97 A;  2ZQ7 A;  2Q9N A;  3KSF A;  4KQQ A;  3JVU A;  1PFL A;  4HI4 A;  4S2M A;  1XFN A;  3NOU C;  4G3K A;  5FAO A;  3JPU A;  4KG2 A;  1WYC A;  4JXV A;  1ERO A;  1K0K A;  3PBS A;  3UE0 A;  3V67 A;  4KUK A;  3S7N A;  1ZKJ A;  5HX9 A;  5MC7 A;  3RXW A;  1YLT A;  5CEB A;  4WEJ A;  4DJ3 A;  1KE3 A;  5HPF A;  2JHE A;  4AFI A;  5EUA A;  4QPR A;  3H7W B;  1P9R A;  4QJG A;  2D01 A;  2GJ3 A;  3PBQ A;  3IWI A;  1HVB A;  5BOH A;  3EEA A;  3TRC A;  3UO9 A;  3E2L A;  4OOL A;  5GLC A;  1ONG A;  2PU2 A;  3PBT A;  3DWZ A;  3UDI A;  5A8B A;  2Y2N A;  1I5Q A;  2WKE A;  4BLM A;  3R4K A;  4JXS A;  4Y7P A;  3ZYT A;  1YLW A;  3LIB A;  1G28 A;  4N1X A;  3UB8 A;  1S4R A;  5DKL A;  1XGI A;  2M7U A;  4KZ4 A;  2Y2L A;  1PIO A;  3D72 A;  3IH8 A;  1M40 A;  2QJ5 A;  2V1A A;  5HW3 A;  2EA9 A;  2JKR I;  1IFQ A;  3O86 A;  1T1B A;  4FTX A;  1YLP A;  4QHC A;  2J8Y A;  4GDN A;  2Y2M A;  5FQQ A;  1GCE A;  4NKP A;  4OKP A;  2JKT I;  4NK3 A;  3B47 A;  4WMC D;  3MXQ A;  3GSG A;  4ZDX A;  1W5D A;  2IWD A;  1BZA A;  5DFX A;  2WKR A;  4OQH A;  1NLY A;  3OCN A;  5E2E A;  1ES3 A;  4X53 A;  5HWT A;  5KZH A;  1IKG A;  3BWL A;  5EOE A;  1ZHH B;  5CGS A;  4RA7 A;  1JWZ A;  3G30 A;  3KO6 A;  3MJQ A;  5F1F A;  2Y2O A;  2L0W A;  1BLC A;  3G2Y A;  4XUX A;  4UQI S;  1KGF A;  3PAE A;  3SH7 A;  4S2J A;  4MEZ A;  4KZ7 A;  4C3Q A;  3OPH A;  4HIA A;  1KDW A;  2INW A;  5HAI A;  3BY9 A;  2B02 A;  5E2F A;  5DKK A;  3CWF A;  1OTE A;  2PHY A;  1NXY A;  2Y4A A;  3BFE A;  4IED A;  4D2O A;  3U4L P;  3N6I A;  1F5M A;  4K0X A;  3GEC A;  4LPZ A;  4ARZ B;  2IWB A;  5DF8 A;  3A0R A;  1VEU B;  3MKE A;  1W79 A;  3IBR A;  5DF7 A;  4RVA A;  3C8C A;  1U60 A;  2G7U A;  2WKP A;  1UGU A;  2QJ7 A;  1VQQ A;  3QP1 A;  2ZMV A;  1UWP X;  2NUP C;  3FG8 A;  2V0W A;  3IXB A;  3A0V A;  2I9V A;  2KDK A;  1K6R A;  3RH8 B;  2PBY A;  2FH5 A;  1ESU A;  4OLD A;  3M6B A;  1S4S A;  1TEM A;  2XA7 S;  1LL8 A;  3IF6 B;  1W8Y A;  4P85 A;  4WN5 A;  4R3J A;  3BLM A;  1K38 A;  5FAP A;  1MC0 A;  1WA9 A;  1RCJ A;  3RFB A;  3T4S A;  3BEB A;  5L8M A;  2W3H A;  1K54 C;  5JYO A;  5F5Y A;  1Q2Q A;  2WKQ A;  5E2H A;  3MZF A;  4OQI A;  3BFD A;  3G31 A;  4HBU A;  3C7V A;  5HL6 A;  3SS3 A;  1FCN A;  3NHQ A;  2JN7 A;  5G4Y A;  2O0Y A;  3LIA A;  2JKT M;  5EOO A;  5AQ9 A;  4EV4 A;  3CMZ A;  1JTG A;  3UDF A;  5HDS A;  5CTN A;  4HJ6 A;  3VE4 A;  2ZM8 A;  4X25 A;  4UAA A;  2WGI A;  3IBJ A;  2QMI A;  3E0Y A;  4KG5 A;  1P9W A;  3F1P B;  4EES A;  4HBT A;  4HH3 A;  4E04 A;  3CZD A;  5G18 A;  2R9W A;  2ZC3 B;  5HAP A;  1Y54 A;  1TF1 A;  5AQ7 A;  3RXX A;  3VSL A;  3G6O A;  3WS4 A;  3HLW A;  3IF6 C;  5JYP A;  4MDZ A;  1LI9 A;  2K7S A;  5E2G A;  4P6B A;  4WEK A;  5CX7 A;  3LFV A;  5M1A A;  4DXC A;  2ZOI A;  4KZ3 A;  1YM1 A;  4N92 A;  3IT9 A; 
#chains in the Genus database with same CATH homology
 5G4Z A;  5DF9 A;  3K3C A;  1S1Z A;  2OWJ A;  4HJ4 A;  5EFW A;  3BY8 A;  2VGL S;  3E4O A;  4IJG A;  4WUJ A;  4ME4 A;  3F1P A;  4MCW A;  3HJI A;  2QYB A;  3MR0 A;  2M7V A;  4GHI A;  4I39 A;  2A24 B;  1TS8 A;  5FL3 A;  2Z6D A;  5IU1 A;  5HDC A;  3A0S A;  3F1O A;  2VKS A;  1KOU A;  2QWS A;  2DMW A;  5C5K A;  1ZTU A;  2O99 A;  3HJK A;  5HD5 A;  2PR6 A;  4GJ4 A;  3BW6 A;  3OLO A;  2HF6 A;  3VV4 A;  2W27 A;  4JGP A;  1T18 A;  5HZH A;  3F1N A;  3KSG A;  1TS0 A;  1OT6 A;  2PD7 A;  2HJ9 C;  1P0Z A;  4ARZ A;  3IS2 B;  3PBN A;  3R7W B;  4DMZ A;  3C38 A;  4GLQ A;  2FZ0 A;  2O9B A;  1GSW A;  2VV8 A;  4BJP A;  3T4J A;  4B93 A;  2OAP 1;  5TBM A;  3MMH A;  1TS6 A;  4O0P A;  3UE3 A;  3MQ0 A;  5HWV A;  4H6J A;  3ZQ5 A;  1LSX A;  3CLO A;  3O5Y A;  2OOL A;  1H3Q A;  5J7E A;  3NOT C;  2KLI A;  5TJJ A;  4HP4 A;  4LRY C;  3ULF A;  2EWW A;  4EUV A;  2PYP A;  4Z1W A;  2W3D A;  4JGQ A;  1OJG A;  2K31 A;  4B9O A;  4GS9 B;  5J4E A;  4WLA A;  4BWI A;  2J3T C;  3W2Z A;  3LR3 A;  4OOM A;  4ETZ A;  3EQV A;  2W0N A;  4GW9 A;  4HJ3 A;  3T4K A;  3H82 B;  4CQH A;  4II7 A;  3PBR A;  2EWV A;  1V9Y A;  3EGX C;  3PYP A;  4EU0 A;  2KX6 A;  4R3A A;  3OOV A;  4R6L A;  3S7Q A;  5I5L A;  2XRN A;  3OBF A;  1OTD A;  1YKD A;  3ICY A;  2M1C A;  3IS2 A;  3LYX A;  1DRM A;  2YKH A;  3BQ8 A;  4MN5 A;  4R38 A;  3R7W A;  5F69 A;  2W1T A;  1MKM A;  3SW1 A;  2LB5 A;  3S7P A;  3T4O A;  5AVF A;  2ZMF A;  4M4X A;  4ETX A;  1ODV A;  4Q0J A;  4L0L A;  3GDI A;  4EEU A;  1F9I A;  5KIZ A;  4LRZ E;  5F6A A;  2MJ6 A;  4G3V A;  2LB9 A;  4PKY A;  5IT5 A;  3UB6 A;  4DJ2 A;  1P97 A;  3VOL A;  3KSF A;  3PR6 A;  3K2N A;  1UWN X;  2P04 A;  3JVU A;  4GS9 A;  4HNB A;  3MFX A;  3T50 A;  2PD8 A;  4HI4 A;  3E4Q A;  4Y3I A;  1XFN A;  3NOU C;  4G3K A;  2J3W A;  5HD3 A;  1OJ5 A;  2ZBB A;  2GZA A;  3H82 A;  4L9G A;  4EER A;  4JGR A;  3LR4 A;  2QKP A;  5AJG A;  4NEE D;  3PBS A;  4WF0 A;  3V67 A;  5HSQ A;  4KUK A;  3S7N A;  3OCL A;  2PR5 A;  2QHK A;  5MC7 A;  1F98 A;  4WEJ A;  4DJ3 A;  3KSH A;  2HV1 A;  3UE6 A;  5HPF A;  3T4Q A;  2JHE A;  1OPX A;  4AFI A;  3PHY A;  1D7E A;  4QPR A;  3KX0 X;  3H7W B;  1P9R A;  4I5S A;  4FOF A;  4Y5F A;  2O9C A;  2D01 A;  2GJ3 A;  3PBQ A;  4P6Z M;  2J3T D;  3LR5 A;  3EEA A;  3TRC A;  4GCZ A;  1LT0 A;  2J80 A;  4OOL A;  1V9Z A;  2VV7 A;  3PBT A;  3PBO A;  3P7N A;  1OTA A;  1OTI A;  4Q0H A;  5A8B A;  4Q0I A;  4KQD A;  3LIE A;  3R4K A;  3ZYT A;  3LIB A;  4KQO A;  1G28 A;  2B18 A;  1IOU A;  3UB8 A;  5HPI A;  4HP9 A;  3CUE A;  1MZU A;  1G6O A;  1S4R A;  5DKL A;  3DBA A;  2M7U A;  5KSH A;  1NWZ A;  2V1B A;  2KOI A;  3C2W A;  3BQA A;  3D72 A;  4NXF A;  2A24 A;  5DFY A;  2Y79 A;  4NXB A;  2Y8H A;  4L9F A;  3UB7 A;  2W3G A;  1EW0 A;  1XJ3 A;  2QJ5 A;  3H7W A;  1YSP A;  4NXG A;  4EET B;  1DP6 A;  1GSX A;  2V1A A;  3U2A A;  4BMW A;  2EA9 A;  2JKR I;  4YWZ A;  1IFQ A;  2GX5 A;  3HCY A;  1T1B A;  1T19 A;  3CUE C;  2D02 A;  1S1Y A;  4NKP A;  2JKT I;  3LI9 A;  3E4P A;  3B47 A;  4HOI A;  4HQA A;  2JKR M;  1H8M A;  3MXQ A;  3E98 A;  5DFX A;  2WKR A;  3LUQ A;  1NLY A;  2W1R A;  3OCN A;  2HGV A;  5K5B A;  4XT2 B;  2P7J A;  5HWT A;  2IA2 A;  1VB6 A;  3BWL A;  1YSQ A;  1N9L A;  1S66 L;  3UB9 A;  2BAS A;  2W3F A;  1TD5 A;  1ZHH B;  4LLO B;  4IHQ A;  3BJN A;  4CLC B;  4BBT A;  5J3W A;  2L1M A;  3KO6 A;  1BYW A;  1XJ6 A;  2HJE A;  3MJQ A;  2XRO A;  2L0W A;  4MN6 A;  3H9W A;  3LIC A;  4UQI M;  4YNR A;  4KUO A;  4UQI S;  3B42 A;  1LSV A;  2VZW A;  4HIA A;  1N9O A;  1VHM A;  2INW A;  3BY9 A;  2VA0 A;  3VE3 A;  4DN0 A;  4L9E A;  2B02 A;  5DKK A;  3MQQ A;  4I3I A;  3CWF A;  5HWW A;  1OTE A;  2PHY A;  1TS7 A;  3F1N B;  4CLC D;  3EOI A;  3KYZ A;  2NUT C;  1F5M A;  3MF0 A;  4IUK A;  1XJ2 A;  3GEC A;  4LPZ A;  4ARZ B;  4EEP A;  4XT2 A;  4MMN A;  3A0R A;  3K3D A;  3T4T A;  3IBR A;  2VGL M;  4R70 A;  5TBM B;  3C8C A;  4IUH A;  4BBV A;  1T1C A;  4PHT A;  2VLG A;  3LIF A;  3TJZ C;  2G7U A;  1X0O A;  3B33 A;  2WKP A;  1UGU A;  2W3E A;  4H6J B;  2PDR A;  4CLC A;  2QJ7 A;  4P6Z S;  3FPW A;  2ZMV A;  4WEL A;  1GSV A;  1NLZ A;  1STZ A;  5HDD A;  1UWP X;  3EGD C;  2NUP C;  3LR0 A;  2PT7 A;  4LRX C;  4WL9 A;  3FG8 A;  2V0W A;  3A0V A;  2I9V A;  4HH2 A;  4FSF A;  1T1A A;  2KDK A;  5AVE A;  3RH8 B;  2XA7 M;  3D3O A;  2FH5 A;  2OAQ 1;  2XSS A;  1N9N A;  3JVV A;  3MQO A;  3S7O A;  4CLC C;  2Z6C A;  1S4S A;  3PXP A;  2H28 A;  1Y28 A;  2XA7 S;  4PKY G;  1LL8 A;  3LI8 A;  1W63 Q;  1LSW A;  4BBU A;  4MN7 A;  4WN5 A;  3TE8 A;  2GNX A;  4EQ1 A;  3NJA A;  1DP9 A;  3UMD A;  2W1T B;  4EXO A;  1MC0 A;  4I3J A;  2R78 A;  1WA9 A;  3RFB A;  2VV6 A;  3T4S A;  2YKF A;  2PYR A;  1OT9 A;  5L8M A;  5LBR A;  2L4R A;  2W3H A;  3EWK A;  3RTY A;  2V9A A;  4ZRR A;  5F5Y A;  4PAU A;  2WKQ A;  4F3L B;  3OC2 A;  4JGO A;  5HL6 A;  5F68 A;  3UME A;  1YAX A;  4I3A A;  3LID A;  3KSI A;  3NHQ A;  3TW8 A;  5DJU A;  4CLC E;  5DJT A;  1S67 L;  2JN7 A;  3C30 A;  5G4Y A;  2O0Y A;  2CMN A;  3P01 A;  3LIA A;  2JKT M;  2A2L A;  3KYQ A;  1W63 M;  4YOF A;  2VEA A;  5HDS A;  4HJ6 A;  4RQ9 A;  3EQU A;  3VE4 A;  2V0U A;  3NOP C;  3IBJ A;  3E0Y A;  1XFQ A;  2P08 A;  1JNU A;  1P9W A;  3F1P B;  4O8G A;  1DP8 A;  4Y2F A;  4K08 A;  3FPV A;  4GHI B;  4EES A;  4HH3 A;  4G3W A;  4E04 A;  1D06 A;  5IS1 A;  3FC7 A;  2OWH A;  3EEH A;  2VJW A;  3F1O B;  2ZOH A;  4O01 A;  4HHD A;  1XJ4 A;  1TF1 A;  2K2N A;  4I38 A;  1NRJ A;  4HY8 A;  4F3L A;  3G6O A;  3CAX A;  4EW7 A;  3CI6 A;  4UEY A;  4MDZ A;  3CIT A;  2K7S A;  2VX8 A;  4WEK A;  5CX7 A;  3LFV A;  4NXE A;  3T4L A;  1OTB A;  2O9A A;  2ZOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...