2M1CA

Haddock structure of gtyybt pas homodimer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
113
structure length
113
Chain Sequence
RGSHMRSLHKELQQYISNLSYRVKKVSEEALMQMPIGILLLDEEDKIEWSNRFLAACFKEQTLIGRSLAELSEPLAAFVKKGKTDEEIIELNGKQLKVIVHRHERLLYFFDVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the PAS Domain of a Thermophilic YybT Protein Homolog Reveals a Potential Ligand-binding Site.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans
molecule tags Hydrolase
molecule keywords DHH subfamily 1 protein
total genus 19
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2m1cA00
1OTBA 4K08A 4JGOA 5DKLA 3UB7A 2M1CA 3EEHA 4H6JB 4HQAA 4WN5A 1TS6A 1S66L 4LPZA 4JGRA 3LI9A 2PYPA 4F3LB 3NHQA 1P97A 4LRYC 3PYPA 3SW1A 5IS1A 3E4OA 3BY8A 3H7WA 4PKYG 4HP9A 1TS8A 4NXFA 4RQ9A 3UMEA 4EETB 4GW9A 1V9YA 4EERA 1ODVA 3GDIA 3KX0X 2PYRA 4NXEA 5HSQA 5TBMB 2PDRA 4HJ6A 2V0WA 2VLGA 2ZBBA 1UWPX 4L9GA 1XFQA 3UE6A 2CMNA 4PKYA 3UB9A 1S1YA 4BBVA 2L4RA 3CWFA 3F1PA 1D06A 5I5LA 1V9ZA 3F1NA 2ZOIA 1GSVA 4JGQA 3RH8B 4EEPA 2A24A 2QKPA 4GS9B 1GSWA 1LSVA 3E4PA 1MZUA 1P0ZA 3IBRA 4I3AA 3F1OB 3H82A 4WL9A 4HOIA 4WLAA 5EFWA 3A0SA 2Z6CA 3VE3A 2ZOHA 2QHKA 3MJQA 3F1OA 4EW7A 2I9VA 4F3LA 2P7JA 4HJ3A 2A24B 2PR5A 3IS2A 3NOTC 2K7SA 5HD3A 2L1MA 5KIZA 4I3JA 1XJ2A 3H9WA 2HV1A 4BBUA 5J7EA 3LI8A 5F69A 2V0UA 5HD5A 2QJ5A 2V1BA 1OT6A 2PD7A 2PD8A 3BWLA 3LIAA 3LIBA 3MQQA 1T19A 1N9LA 2YKFA 3K3DA 4GHIA 4I39A 4L9EA 1DP8A 4KUKA 5G4YA 1UGUA 1DRMA 5HWTA 2V1AA 1LT0A 1DP9A 4GHIB 3RTYA 3K3CA 1T1CA 5AVFA 3E4QA 1OTAA 4YWZA 3A0VA 5TBMA 1X0OA 2D02A 2WKQA 2GJ3A 4KQDA 1UWNX 1T1AA 5F5YA 1F9IA 3IS2B 3MR0A 1T18A 5HZHA 2VV6A 2H28A 4HY8A 1KOUA 2B02A 4WUJA 3B33A 4R70A 1N9OA 2L0WA 4I3IA 1OJ5A 1VB6A 2VEAA 3ZQ5A 3H82B 5DKKA 5J3WA 3C8CA 4B9OA 4EXOA 1Y28A 2JN7A 1LSXA 3ICYA 2OOLA 2WKPA 3NOPC 3CLOA 3LYXA 1OJGA 2D01A 4EQ1A 1S1ZA 4I5SA 3NOUC 2KDKA 1S4RA 3PHYA 2VV8A 1N9NA 1GSXA 4EEUA 5HDSA 4HH2A 1XJ6A 3F1PB 2OWHA 4R38A 5HWVA 2WKRA 3NJAA 4JGPA 4WF0A 4DJ2A 2J80A 5A8BA 5G4ZA 1XJ3A 2INWA 1DP6A 1NWZA 3G6OA 3HJKA 3CAXA 5DJUA 2W27A 4M4XA 2V9AA 2R78A 4XT2A 5DJTA 3ULFA 4BBTA 1EW0A 2YKHA 2W0NA 3MXQA 2BASA 4NXGA 5F6AA 5HWWA 1OT9A 4R3AA 2QJ7A 5IU1A 1XJ4A 3EWKA 3H7WB 1S4SA 3LIDA 2EA9A 2JHEA 1OTEA 3OLOA 4HHDA 4HP4A 4LLOB 1JNUA 4LRXC 4HH3A 1TS7A 5AVEA 1T1BA 3A0RA 4L9FA 3GECA 3FG8A 4HJ4A 4MN5A 3F1NB 4H6JA 4EESA 1D7EA 1S67L 1TS0A 2Z6DA 3FC7A 4R6LA 3T50A 4GCZA 4NXBA 3UB8A 1F98A 3C2WA 2KX6A 2PHYA 3MFXA 4E04A 3HJIA 1XFNA 3LIEA 3VOLA 5J4EA 3LUQA 3LIFA 2OWJA 2PR6A 3MQOA 2QWSA 3LICA 4HIAA 1OTDA 3D72A 1WA9A 4XT2B 1LL8A 3UMDA 3UB6A 1BYWA 4GS9A 3P7NA 3BY9A 5HDCA 5F68A 4DJ3A 1G28A 1OTIA 4KUOA 3VE4A 4LRZE 4I38A 4HNBA 4HI4A 4MN6A 1LSWA 5HDDA 2VV7A
chains in the Genus database with same CATH superfamily
4D60A 1CQAA 4H6JB 3ZG0A 5TGFA 3GV9A 1YLJA 3BY8A 3MZFA 4O01A 4OLDA 5EVIB 5CGSA 3IQAA 1VHMA 4NEED 5DVAA 4EERA 4EQIA 4A5RA 2XRNA 4NXEA 1RP5A 3BFCA 2Y2QA 4S2JA 2ZQ8A 5KSHA 2GNXA 3DTKA 3LR5A 4WL9A 4FD8A 5E2GA 3UY6A 1LHYA 4IVIA 3EEAA 3FZCA 2KOIA 3BFGA 2PD7A 2PD8A 3LIAA 2PBDP 5G4YA 1ES3A 2V1AA 4E3JA 4Y7PA 3K3CA 3EQVA 3C4PA 2WKQA 5F5YA 5FQKA 4OOMA 3IS2B 3MR0A 1FSYA 2HPBA 5GLBA 4GLQA 5HSQA 3CLOA 3D4FA 5KMWA 4NG2A 2A2LA 4R38A 1ES2A 3TE8A 2OAQ1 2QPNA 3C7UA 4NXGA 1GHPA 5HWWA 2LB9A 1OTEA 3A0RA 2IA2A 2J3TC 2X71A 5HAQA 4Q0HA 4HIAA 4R0QA 1L0FA 1LL8A 4HI4A 3CUEA 5M19A 4JGOA 5LBRA 3UPOA 3FWLA 1XXMA 4F3LB 3OZHA 1VETA 2Y2GA 3H7WA 5GLAA 2K2NA 1J9MA 2O9BA 1K0KA 5A90A 5F1GA 4U0XA 3GDIA 3ZG8B 3BQAA 3IX3A 4BD0A 2CC1A 3T4TA 3KYQA 4E6WA 2A24A 3N8LA 3SS4A 2ZC4B 4QU3A 3VE3A 1CI8A 4G3VA 4WEKA 3H9WA 5EM1A 1T19A 4KQRA 4XUXA 4GZBA 3UE0A 3BECA 1KVMA 2ZC3B 3ZVTA 4YINA 4KG6A 4ZJ3A 3IXBA 5HARA 3V5MA 3MBZA 4DKIA 4B9OA 3GMWA 1BULA 1S0WA 3NJAA 2VKSA 3NIAA 3G30A 4ZJ2A 5E2EA 5TR7A 3LEZA 5CEBA 4HP4A 2OLUA 1TDLA 1NXYA 1VETB 5HX9A 2P9VA 3GECA 4HBTA 4X56A 3O86A 3ITBA 3VOYA 3HJIA 3LUQA 3U4LP 3HLGA 4E3MA 4LV1A 1H8YA 1PWDA 5GL9A 5EOOA 3VE4A 5IT5A 3AGFA 1LSWA 2VV7A 1S66L 1SZVA 3T1XA 3A3IA 3RXWA 2G2UA 3ZVWA 5FQQA 3LY3A 3LGOA 1S1YA 1GHIA 4Y17A 2WKEA 1XPBA 3RH8B 1FR6A 4I3AA 1NLYA 1IELA 5CERA 1K55A 2BTFP 3U2AA 1XKZA 2A24B 2QJ5A 4GHIA 1DP8A 4JXWA 2JBFA 3M2JA 5AQBA 4KZ9A 2O0YA 3Q81A 5TBMA 3IH9A 5BOHA 4QHCA 5HAPA 4PMAA 2Y2NA 3G2ZA 2JN7A 3ICYA 1OJGA 3MXSA 5FATA 1YSPA 1XX2A 1HLUP 2WKRA 5HWVA 3V39A 2ZQDA 2O9AA 4KG5A 3HJKA 3A3DA 4Y2FA 1FR1A 5CTMA 3WS2A 2VGKA 3NCKA 1PFLA 1OT9A 3T1SA 2QJ7A 1XJ4A 5CGXA 4PM7A 2ZQ7A 4DDYA 1ONHA 3BYDA 1T1BA 3Q7ZA 1W63M 1CEGA 3OPPA 1CI9A 2Z2LB 3C2WA 1NY0A 1MC0A 1PRQA 4MDZA 2ZMVA 1OTDA 3T4LA 4R4SA 4HNBA 4WMCA 5DKLA 3LFVA 1TS6A 2OSUA 5D3OA 1BLCA 3OCNA 4P6BA 2WAEA 4G3KA 3UMEA 3PBTA 1V9YA 1P9RA 3T12B 1WE4A 4F94A 1QMEA 1G6AA 2Y2JA 5CECA 5A93A 3QNCA 2HDUA 3IT9A 4GS9B 1K4EA 4N1XA 5DTKA 1E3UA 2EWVA 3OPRA 4XXRA 3WS4A 1JTDA 2ZOHA 2XROA 5A92A 4E3NA 4IHQA 3NOTC 4R3JA 2V0UA 3VSLA 3MQQA 1YMSA 4I39A 3UE3A 2YKFA 4JF4A 3WRTA 5J8XA 1H8ZA 1LT0A 4KQDA 3GRJA 1BSGA 1K57A 2V1ZA 2H0TA 3T4KA 4GD6A 5GHXA 2HP6A 1LSXA 5HL6A 2J3WA 3MZDA 3PHYA 3KO6A 4JBFA 3R7WB 4X53A 2Y91A 2PT7A 4CLCB 5EV0A 1K54C 2MJ6A 4UA7A 3BW6A 4DE1A 3UDIA 1PI5A 5CTNA 1C3BA 4LCMA 3R4KA 4UAAA 5L8MA 2Y2IA 4JPMA 5EVLA 3HCYA 4PPRA 2EXBA 4BWIA 1ESUA 5FEGA 3LI9A 4OPRA 1H0MA 1MY8A 1W8YA 4DXCA 4FSFA 4NXFA 4OPYA 3KX0X 4EBNA 2C6WB 4OH0A 4GDNA 2V8FA 5GLDA 5HPIA 1DJBA 1GSVA 5FAPA 2JC7A 4R23A 5CXWA 1IEMA 2HDQA 3W4PA 4IBRA 3CJMA 2P7JA 5FAOA 3LR4A 1L0EA 3IS2A 4I3JA 2IWBA 1XJ2A 4KZ7A 3BWLA 2V1BA 3LIBA 5EFWA 4QPRA 4R6LA 1GHMA 4BD1A 4LENA 4II7A 4KG2A 2P74A 3HL9A 5I94A 4Y13A 1Q2PA 2PU4A 4HY8A 1KOUA 4WUJA 3BQ8A 3ZQ5A 1BTLA 3C8CA 3QP1A 2XDMA 2FFYA 5FAQA 2J80A 4C75A 2XFSA 5DJUA 3SS5A 3A3JA 3SH7A 2UWXA 3QP2A 4BL2A 4HESA 2XA7S 4LLOB 4OOLA 3UPNA 3T4QA 4HJ4A 4S2KA 4P85A 2XH9A 4E04A 1KGGA 1MWUA 2DNSA 5FI7A 2JKFA 4DJ3A 2Y2PA 2HF6A 1Z09A 5MC7A 3NDEA 4OQGA 3IWIA 4X69A 3O88A 4LFUA 5HAIA 1ODVA 2VJWA 1KE4A 2XK1A 3O5YA 2XD5A 2ZQ9A 4PKYA 1TEMA 3JVVA 3PBOA 4CLCE 2Y2HA 1AWIA 4MLLA 1NYMA 2W3DA 4EU0A 2PR5A 5KZHA 3DBAA 5F69A 3UPPA 1SKFA 4P6ZM 3K3DA 5AVFA 4YWZA 1NZOA 3TW8A 1PI4A 5DF8A 3DTEA 4DXBA 4IEDA 4FUWA 1Q2QA 3O3VA 5HZHA 2B95A 3N4IA 3B33A 1N9OA 2DRWA 1PW8A 1PWGA 5FSRA 4LV2A 3N7WA 3HUOA 4HH2A 2ZM0A 4WF0A 1K6RA 3PBQA 3TSGA 2NUTC 2R9XA 1YLPA 2R78A 1GA9A 1CK3A 1IYPA 4IUHA 5IU1A 4JXGA 1SKOB 4IUKA 5L09A 3OLOA 3DAVA 1TS7A 3OBFA 3VMAA 2G7UA 2HDRA 3FV7A 4EESA 3IBJA 3IX4A 2ZM8A 2PHYA 5FDSA 2EX6A 1YM1A 2PR6A 2W3EA 3S22A 3PR6A 5HDCA 2XR0A 2V20A 2ZMFA 4JKTA 1E4DA 1ZG6A 4HQAA 5AJGA 3PYPA 2GX5A 3BRMA 3NY4A 4BLMA 2KLIA 5DF9A 2W1TB 3IF6B 2PDRA 4GNUA 4L9GA 3R7WA 4BBVA 4HEFA 3LCEA 1W63Q 4WZ4A 4WEJA 1P0ZA 3WS5A 2Y4AA 1PZPA 4EBPA 4S2LA 4E3KA 2L1MA 4N9KA 4YNRA 1CJFA 4ZDXA 4UA9A 1YT4A 4O0PA 3BFDA 2GDNA 1DJCA 3OPLA 1J3WA 4EXOA 4B4XA 3ZHHA 4NKPA 4UEYA 1LI0A 2QZ6A 4OP5A 3Q07A 5HDSA 4ARZB 5A8BA 1BLHA 3LO7A 1KDSA 3IF6A 2W27A 2P04A 3ZDJA 1EW0A 5F6AA 3PAEA 4R3AA 3EWKA 4ME4A 3HLWA 1D1JA 2PU2A 3SZTA 3ITAA 2EFUA 3V50A 3FG8A 2VA0A 4QY5A 3B42A 3TG9A 3T50A 2NUPC 1E3UD 2Y79A 5DTSA 3KSFA 3MFXA 5AQAA 3LIEA 5J4EA 1VEUB 3LICA 2O99A 2ZD8A 3UB6A 4I38A 2WUQA 3ZG9B 3MXRA 3UB7A 3V3RA 1YLZA 4RX2A 3B3XA 4S2IA 4PKYG 4HP9A 1TS8A 1XGJA 1W5DA 4L0LA 3G32A 4LCLA 2A3UA 2G2WA 4Y15A 4WLAA 4S2NC 4ID4A 4LV0A 2OLVA 3MJQA 4HJ3A 1UGUA 4KQOA 5HWTA 4JXVA 5G18A 4NETA 4UQIS 4G3WA 2ZQCA 1PZOA 3AGEA 2EWWA 1HVBA 4E3IA 2A49A 1N4OA 5J3WA 2WADA 4PM5A 3CPTA 2J9PA 4EEUA 2J9OA 3T4OA 4M4XA 5DTTA 3S7NA 1ZTUA 2W0NA 3GTCA 3PBNA 1M40A 2EX8A 3LIDA 2EXAA 5FL3A 3WRZA 4WZ5C 4GCZA 4GN2A 1JTGA 3E98A 2Y59A 4CLCA 2QWSA 2HP9A 1K4FA 3B47A 1G28A 4KUOA 3P01A 2RCXA 3OPHA 1KE0A 5HFOA 3KSIA 1SDEA 4AFIA 2ZL1B 5DF7A 5E2FA 5CHMA 2PBYA 4NK3A 3MKFA 4BMWA 3DW0A 3HLCA 3D3OA 4KZBA 1NRFA 4EETB 3VFHA 2M7VA 3N8RA 2PYRA 5TJJA 4RVAA 2ZBBA 2LB5A 1L0DA 3TRCA 5L10A 5A91A 3VFFA 1QMFA 5I5LA 3ZNYA 4JGQA 4OQ0A 4RX3A 2PRFA 3G31A 5EVIA 3NULA 4KZAA 1HTZA 2FZ0A 4DE2A 5FQ9A 1Y4OA 1K54A 3LI8A 3S7PA 4DN0A 4UQIM 4CJNA 3CHWP 4L9EA 2M7UA 2ZC7A 4MNRA 2Z2MB 2D02A 3EQUA 4X55A 1OMEA 4Z1WA 3BLSA 1T18A 5E2HA 4JF6A 1PIOA 4KQQA 3LYXA 5EVIC 3CUEC 2HZ5A 4PHTA 4WM9A 1XJ6A 2OWHA 1F5MA 4FH4A 1IFQA 1DP6A 1LL9A 1XJ3A 2INWA 3FKWA 1NYYA 2V9AA 3L9KA 3CG5A 4WELA 4KZ8A 3H7WB 2RL3A 1O07A 1H3QA 3UB5P 1K25A 4LV3A 1TS0A 1NRJA 3CITA 3QP8A 4E3OA 5FQMA 2WGVA 1JWPA 2IWCA 3D72A 3KSGA 3KYEA 2WGWA 3BY9A 3UDXA 2EFXA 4LRZE 1H8MA 4R3BA 3DTIA 3HVFA 1MKMA 4ZJ1A 4EV4A 5M18A 3W4QA 1HD8A 2W3GA 4LPZA 5JYPA 1AXBA 3HUNA 4N9LA 5TFQA 4RQ9A 4GW9A 3VP1A 4E3LA 2WAFA 4ARZA 1XFQA 3UB9A 3PTEA 3SOIA 1LL5A 2BLSA 1V9ZA 4RYEA 4EEPA 2H10A 3HLBA 2QKPA 5GLCA 3IHBA 2OV5A 3E2LA 3A3FA 4DE0A 4Y3IA 3G2YA 3IH8A 2FFFB 2XGNA 2J3TD 1N9LA 4YFMA 2ZQAA 3QP5A 4KUKA 2VK3A 3MMHA 5DFXA 1TVFA 4FTXA 3UDFA 5CEDA 1XA1A 2ACGA 2P08A 3A0VA 3PXPA 2GZAA 4HBUA 4LGWA 4IBXA 3HLFA 3HBRA 3VP3A 1VB6A 3BM6A 3BLMA 5FI2A 2ZMAA 3NOPC 4Q8IA 3MSHA 1S4RA 3UO9A 2QMIA 3O87A 1NLZA 4MBFA 3ZFZA 4B93A 4O7DA 1IKIA 3GR2A 4EUZA 1XGIA 3S7QA 3HUMA 4L9FA 5FEFA 1I2WA 4KZ3A 3C5AA 2Z6DA 4B4ZA 3NECA 4Q0JA 2KX6A 4OPQA 1XFNA 3VOLA 4Y0TA 2OWJA 3MQOA 1BLPA 1ZKJA 2J8YA 4B88A 1L2SA 4P6ZS 4K08A 5JYOA 2PYPA 1P97A 3SW1A 3EOIA 1KVLA 2VGLM 3W2ZA 4PM9A 1ZC2A 5AQ7A 5HPFA 5TBMB 3ZCZA 4HJ6A 4EWFA 4CQHA 2L4RA 5L2FA 3F1PA 3SH8A 1YMXA 4ETXA 2J7VA 3IBRA 3F1OB 4X6TA 4EBLA 2JKRI 3VP0A 5CHUA 1IOUA 3ZG5A 5GHZA 5HD5A 1FOFA 3V67A 3IHAA 4QY6A 4GHIB 3E4QA 4ZRRA 2UV0E 3N6IA 4IJGA 2B02A 5CHJA 2XD1A 2XA7M 2KDKA 1K56A 4S2NA 1K57C 1M6KA 1K55C 1EWZA 3FYZA 4JGPA 4U3TA 4GB7A 3G6OA 5DJTA 4K91A 5IHVA 1YSQA 1KDWA 2EA9A 3OCLA 3QP6A 4C6YA 1O7EA 2ZL1A 2WZZA 2BG1A 4MCWA 1K56D 4CPKA 1WA9A 3UMDA 4E6XA 1ACFA 5U47A 3MZEA 5EECA 1IYOA 1L0GA 2M1CA 4WN5A 5DFYA 3Q7VB 1WYBA 4LRYC 1FQGA 4JLFA 4OKPA 1BT5A 4IVKA 1LI9A 3MKEA 3K2NA 3E0YA 1VQQA 4Y0OA 2X02A 2VLGA 4GJ4A 1N9BA 1A0KA 4DF6A 3GSGA 1DJAA 1LSVA 1PNEA 3GQZA 4OPZA 3QHYA 1YAXA 3M6HA 1G5UA 4N1HA 3HREA 4DRTA 2Y8HA 5FQJA 1YLWA 3RJUA 1DP9A 3C30A 4CLCD 1I2SA 1JVJA 4GD8A 4ESPA 1IKGA 3ZGAB 1TDGA 3ZYTA 3EGDC 1YQSA 5FA7A 2L0WA 1S6RA 2E8JA 3VV4A 5AQ9A 1CF0A 3TJZC 3IF5A 4OVDA 1SCWA 1ES4A 2B5RA 1S4SA 3NI9A 5AVEA 3AGDA 2HJEA 4FOFA 4X1MA 3F1NB 2E8IA 1SHVA 1S67L 2Y55A 4NXBA 2C5WB 5EM0A 3LR3A 2AVXA 3WS0A 4EUVA 3G4PA 1Y54A 1BUEA 3IWOA 3PAGA 3P7NA 3BFEA 3WS1A 4Q0IA 2DCFA 5HDDA 4GKUA 5F83A 5FI6A 3MF0A 2HGVA 4QJGA 3E4OA 1I5QA 2VX8A 4DMZA 4Z9QA 3G34A 1NJ4A 3QNBA 3BFFA 2XSSA 4QWOA 3CI6A 3UE6A 1FCNA 4OONA 2VGJA 4D2OA 2EX2A 5EPHA 2ZOIA 3E4PA 3DWKA 1MZUA 4HOIA 2ZJ9A 2QHKA 3C4OA 4EW7A 5CGWA 4F3LA 1YKDA 2VZWA 1HZOA 2JCHA 1CEFA 2W3FA 1BZAA 3C7VA 1OT6A 4X25A 1FILA 5CRFA 1JWZA 4S2OA 1IYQA 4N92A 1PYYA 4FH2A 4OOYA 3NC8A 1F9IA 3CMZA 5EE8A 3W4OA 1K38A 3KYZA 1PW1A 1KGEA 3H82B 3IF6C 1XP4A 3HLDA 2OOLA 4I5SA 1N9NA 1GSXA 3LEQA 3OOVA 2H5SA 5EUAA 5G4ZA 1NWZA 4BBTA 2BASA 3JPUA 3A3EA 3IX8A 1MWSA 3MS6A 4KZ6A 2V8CA 1JWVA 3IXDA 4ZAMA 1FSWA 3FC7A 4MBHA 4KZ4A 1F98A 1NZUA 2K31A 4P87A 1BYWA 1OTIA 2ZC5B 5HL1A 2HP5A 1FIKA 3RFBA 4ZBEA 4DE3A 4ETZA 1ESIA 3NHQA 1F2KA 2WGIA 2Y2OA 2WKHA 5C5KA 1VM1A 1Z6FA 2V0WA 2CMNA 3T4JA 3CWFA 1D06A 5EVID 2ZM2A 3HLEA 1W7FA 3S1YA 2Z6CA 2JKTI 2HV1A 1TD5A 2Q9MA 4JF5A 4JGRA 3IXGA 3QP4A 1EI5A 3VOZA 3RTYA 5L07A 1T1CA 1L3LA 2GJ3A 2FH5A 5EVEA 2WK0A 3N8SA 3VSKA 4BENA 2DMWA 2I72A 2H28A 4OP8A 2XLNA 3Q7VA 2VEAA 1W8QA 1MPLA 5DKKA 1Y28A 2WZXA 1IYSA 4MBKA 1LLBA 3PBSA 5GHYA 3NOUC 2ZC6B 1SDNA 2Q0OA 3F1PB 1GCEA 3G35A 3JVUA 2JKRM 4DJ2A 4BL3A 3CAXA 4XT2A 3IXHA 4WZ5A 2EX9A 3MXQA 2WYXA 3DWZA 1VEUA 2JKGA 4HHDA 3UNWA 4LRXC 2HJ9C 1MBLA 4GOGA 2XEPA 4OQHA 1MWRA 4XUZA 4X1LA 4XT2B 4MN6A 3RXXA 2X01A 2Y2LA 4S2PA 3S4XA 1OTBA 3T1RA 1FCOA 4K0WA 4WYYA 4DDSA 5IS1A 2W1TA 1E25A 3MQ0A 3V3SA 5KSCA 2HDSA 1UWPX 3SH9A 2Y2KA 2XQZA 3VP4A 3T4SA 3PBRA 2WGWB 1ERQA 3CPTB 3H82A 5EOEA 3S7OA 1U60A 3A0SA 3P98A 1SKOA 3W8KA 3F1OA 4MEZA 2I9VA 2Y2MA 5HD3A 1ONGA 1STZA 5KIZA 4QD4A 4BQMA 4BBUA 3D9YA 3KSHA 4S2MA 2O9CA 3UN7A 5F82A 3LY4A 1ERMA 1MXOA 4QB8A 1UWNX 1T1AA 3IWQA 2JE5A 1YLTA 1P9WA 3LR0A 3FPVA 4I3IA 2XFTA 2P9VB 1G6OA 4EQ1A 5K5BA 3UE1A 3OC2A 1H5XA 1RGYA 2V2FF 1G68A 1ZG4A 1XA7A 3FKVA 3ULFA 2IWDA 1K6SA 3VP2A 3EGXC 4H8RA 1RCJA 4HH3A 4MN7A 4MN5A 1ALQA 5M1AA 1KGFA 2PAVP 3CZDA 3NDGA 3LIFA 4FCFA 4PAUA 1KE3A 4K0XA 4GS9A 4WMCD 5HW3A 5F68A 3TOIA 4KZ5A 5E43A 3P09A 3T1QB 3Q1FA 4OLGA 3NBLA 3EEHA 4CLCC 2VGLS 1GA0A 2H0YA 3E2KA 4P0MA 5FQIA 1FCMA 1MWTA 2Q9NA 3FPWA 1WYCA 1YPRA 3ZG7B 3I7JA 4Y5FA 5F1FA 4X68A 3F1NA 3JYIA 4O8GA 4RA7A 1GSWA 3SS3A 4YOFA 3ZNTA 4JXSA 3M6BA 4ZTKA 1TF1A 1RGZA 2K7SA 4R1GA 5FASA 1ES5A 2XF3A 5J7EA 3MFDA 3M2KA 2ZLYA 1MKIA 1DRMA 1YLYA 1BLSA 4BJPA 3L7HA 1OTAA 2WKIA 1X0OA 2QYBA 2OAP1 4MMNA 2VV6A 4R4RA 4R70A 4PM6A 1OJ5A 3BEBA 1PWCA 1ZHHB 2WKPA 4PM8A 2D01A 1S1ZA 2VV8A 4UHUA 2R9WA 1EROA 2W1RA 4Y0UA 1OPXA 2YKHA 2W3HA 3GVBA 4U0TA 4GDBA 2JHEA 1JNUA 2B18A 4WBGA 4UA6A 4H6JA 3BJNA 1W79A 5FDHA 1D7EA 4OQIA 4C3QA 3DTMA 3C38A 3UB8A 4KENB 3Q82A 4M3KA 2JKTM 5CX7A 3ISGA 3WWXA 1DY6A
chains in the Genus database with same CATH topology
3KSIA 4AFIA 3MF0A 2HGVA 3HCYA 4H6JB 4BWIA 3LI9A 4BMWA 3E4OA 3BY8A 2VX8A 4DMZA 4O01A 3D3OA 4NEED 1VHMA 4FSFA 4NXFA 4EERA 4EETB 2M7VA 3KX0X 2PYRA 2XRNA 4NXEA 5TJJA 2XSSA 2ZBBA 2LB5A 3CI6A 3UE6A 3TRCA 5KSHA 2GNXA 5HPIA 5I5LA 2ZOIA 1GSVA 3LR5A 4JGQA 3E4PA 1MZUA 4WL9A 4HOIA 2QHKA 4EW7A 3EEAA 2P7JA 4F3LA 1YKDA 3LR4A 3IS2A 2FZ0A 2VZWA 4I3JA 2KOIA 1XJ2A 2W3FA 3LI8A 3S7PA 4DN0A 3BWLA 2V1BA 1OT6A 2PD7A 2PD8A 3LIAA 3LIBA 4L9EA 4QPRA 4R6LA 4UQIM 5EFWA 5G4YA 2V1AA 2M7UA 3K3CA 3EQVA 4II7A 2D02A 2WKQA 3EQUA 5F5YA 4OOMA 1F9IA 3IS2B 4Z1WA 3MR0A 1T18A 4HY8A 1KOUA 4WUJA 3BQ8A 3KYZA 3ZQ5A 3H82B 4GLQA 3C8CA 2OOLA 5HSQA 3CLOA 3LYXA 3CUEC 4I5SA 1N9NA 1GSXA 2A2LA 4PHTA 1XJ6A 2OWHA 4R38A 3OOVA 1F5MA 2J80A 5G4ZA 1IFQA 1DP6A 1NWZA 1XJ3A 2INWA 2OAQ1 3TE8A 5DJUA 2V9AA 4BBTA 4WELA 4NXGA 2BASA 5HWWA 3H7WB 2LB9A 1OTEA 2XA7S 4LLOB 4OOLA 1H3QA 3A0RA 3T4QA 4HJ4A 2IA2A 2J3TC 1TS0A 3FC7A 1NRJA 1F98A 3CITA 4Q0HA 4E04A 2K31A 4HIAA 3D72A 3KSGA 1LL8A 1BYWA 3BY9A 4DJ3A 1OTIA 4LRZE 1H8MA 4HI4A 3CUEA 3RFBA 2HF6A 4JGOA 1MKMA 5LBRA 2W3GA 4LPZA 4ETZA 5MC7A 4F3LB 3NHQA 3H7WA 2K2NA 4RQ9A 2O9BA 4GW9A 5C5KA 1ODVA 3GDIA 3BQAA 2VJWA 2V0WA 4ARZA 1XFQA 2CMNA 3O5YA 4PKYA 3UB9A 3T4JA 3JVVA 3CWFA 3PBOA 1D06A 1V9ZA 3T4TA 4CLCE 3KYQA 4EEPA 2A24A 2QKPA 2Z6CA 3VE3A 4Y3IA 2W3DA 2JKTI 4EU0A 2PR5A 4G3VA 4WEKA 3DBAA 3H9WA 2HV1A 1TD5A 5F69A 4JGRA 4P6ZM 2J3TD 1T19A 1N9LA 3K3DA 4KUKA 5DFXA 3MMHA 3RTYA 1T1CA 5AVFA 2P08A 4YWZA 3A0VA 3PXPA 3TW8A 2GJ3A 2FH5A 2GZAA 5HZHA 2DMWA 2H28A 3B33A 1N9OA 2VEAA 1VB6A 5DKKA 4B9OA 1Y28A 3NOPC 3PBSA 3NOUC 1S4RA 4HH2A 3F1PB 3NJAA 3JVUA 2VKSA 2JKRM 4WF0A 4DJ2A 1NLZA 3CAXA 4B93A 3PBQA 4XT2A 2NUTC 2R78A 3MXQA 4IUHA 5IU1A 4IUKA 4HHDA 3OLOA 4HP4A 4LRXC 3S7QA 1TS7A 3OBFA 2HJ9C 2G7UA 4L9FA 3GECA 4EESA 3IBJA 2Z6DA 4Q0JA 2KX6A 2PHYA 3HJIA 1XFNA 3VOLA 3LUQA 2OWJA 2PR6A 2W3EA 3MQOA 4XT2B 3PR6A 5HDCA 3VE4A 4MN6A 5IT5A 1LSWA 2VV7A 2ZMFA 4P6ZS 1OTBA 4K08A 4HQAA 1S66L 5AJGA 2PYPA 1P97A 3PYPA 3SW1A 3EOIA 5IS1A 2VGLM 2W1TA 2GX5A 3MQ0A 2KLIA 5DF9A 3W2ZA 2W1TB 5HPFA 5TBMB 2PDRA 4HJ6A 1UWPX 4L9GA 3R7WA 4BBVA 1S1YA 4CQHA 2L4RA 3F1PA 1W63Q 3RH8B 3T4SA 4ETXA 3PBRA 4WEJA 1P0ZA 3IBRA 4I3AA 3F1OB 3H82A 1NLYA 3S7OA 3A0SA 3U2AA 3F1OA 2I9VA 2JKRI 2A24B 5HD3A 1STZA 2L1MA 5KIZA 4YNRA 1IOUA 4BBUA 5HD5A 2QJ5A 4GHIA 3KSHA 3V67A 1DP8A 4O0PA 2O9CA 4GHIB 3E4QA 4ZRRA 2O0YA 5TBMA 1UWNX 1T1AA 1P9WA 4IJGA 3LR0A 2B02A 3FPVA 4I3IA 4EXOA 1G6OA 2JN7A 3ICYA 4EQ1A 5K5BA 1OJGA 4NKPA 2XA7M 4UEYA 2KDKA 3OC2A 1YSPA 5HDSA 4ARZB 5HWVA 2WKRA 4JGPA 5A8BA 2O9AA 3HJKA 4Y2FA 3G6OA 2W27A 5DJTA 3ULFA 2P04A 1EW0A 5F6AA 1OT9A 1YSQA 4R3AA 2QJ7A 1XJ4A 3EWKA 3EGXC 4ME4A 2EA9A 4HH3A 3OCLA 1T1BA 4MN7A 1W63M 2VA0A 3FG8A 4MN5A 3B42A 3T50A 2NUPC 2Y79A 3C2WA 3KSFA 3MFXA 3LIEA 4MCWA 1MC0A 5J4EA 3LIFA 4MDZA 3LICA 2O99A 1OTDA 2ZMVA 1WA9A 4PAUA 3T4LA 3UMDA 3UB6A 4GS9A 5F68A 4I38A 4HNBA 5DKLA 3UB7A 2M1CA 3EEHA 4WN5A 5DFYA 2VGLS 3LFVA 4CLCC 1TS6A 3OCNA 4LRYC 4G3KA 4PKYG 3K2NA 4HP9A 1TS8A 3FPWA 3UMEA 3PBTA 1V9YA 3E0YA 1P9RA 4L0LA 2VLGA 4Y5FA 4GJ4A 3F1NA 4GS9B 4O8GA 1GSWA 1LSVA 4WLAA 4YOFA 2EWVA 2ZOHA 3MJQA 2XROA 4HJ3A 1YAXA 1TF1A 3NOTC 4IHQA 2K7SA 5J7EA 2V0UA 2Y8HA 3MQQA 4I39A 3UE3A 2YKFA 1UGUA 4KQOA 1DRMA 5HWTA 1LT0A 1DP9A 3C30A 4UQIS 4BJPA 4CLCD 4G3WA 1OTAA 1X0OA 4KQDA 2QYBA 2OAP1 2EWWA 3ZYTA 3EGDC 4MMNA 2VV6A 3T4KA 4R70A 2L0WA 1OJ5A 5J3WA 1ZHHB 1LSXA 2WKPA 5HL6A 2J3WA 2D01A 1S1ZA 3VV4A 4EEUA 3PHYA 3KO6A 2VV8A 3R7WB 3TJZC 2W1RA 3T4OA 2PT7A 4M4XA 3S7NA 4CLCB 1OPXA 1ZTUA 2YKHA 2W0NA 3PBNA 2W3HA 1S4SA 3LIDA 2JHEA 5FL3A 1JNUA 5AVEA 2HJEA 2B18A 4FOFA 2MJ6A 3F1NB 4H6JA 3BJNA 1D7EA 1S67L 4GCZA 4NXBA 3C38A 3UB8A 3LR3A 3BW6A 3E98A 4EUVA 4CLCA 2QWSA 2JKTM 3R4KA 5CX7A 3B47A 3P7NA 5L8MA 1G28A 4KUOA 4Q0IA 3P01A 5HDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTB A;  4K08 A;  4JGO A;  5DKL A;  3UB7 A;  2M1C A;  3EEH A;  4H6J B;  4HQA A;  4WN5 A;  1TS6 A;  1S66 L;  4LPZ A;  4JGR A;  3LI9 A;  2PYP A;  4F3L B;  3NHQ A;  1P97 A;  4LRY C;  3PYP A;  3SW1 A;  5IS1 A;  3E4O A;  3BY8 A;  3H7W A;  4PKY G;  4HP9 A;  1TS8 A;  4NXF A;  4RQ9 A;  3UME A;  4EET B;  4GW9 A;  1V9Y A;  4EER A;  1ODV A;  3GDI A;  3KX0 X;  2PYR A;  4NXE A;  5HSQ A;  5TBM B;  2PDR A;  4HJ6 A;  2V0W A;  2VLG A;  2ZBB A;  1UWP X;  4L9G A;  1XFQ A;  3UE6 A;  2CMN A;  4PKY A;  3UB9 A;  1S1Y A;  4BBV A;  2L4R A;  3CWF A;  3F1P A;  1D06 A;  5I5L A;  1V9Z A;  3F1N A;  2ZOI A;  1GSV A;  4JGQ A;  3RH8 B;  4EEP A;  2A24 A;  2QKP A;  4GS9 B;  1GSW A;  1LSV A;  3E4P A;  1MZU A;  1P0Z A;  3IBR A;  4I3A A;  3F1O B;  3H82 A;  4WL9 A;  4HOI A;  4WLA A;  5EFW A;  3A0S A;  2Z6C A;  3VE3 A;  2ZOH A;  2QHK A;  3MJQ A;  3F1O A;  4EW7 A;  2I9V A;  4F3L A;  2P7J A;  4HJ3 A;  2A24 B;  2PR5 A;  3IS2 A;  3NOT C;  2K7S A;  5HD3 A;  2L1M A;  5KIZ A;  4I3J A;  1XJ2 A;  3H9W A;  2HV1 A;  4BBU A;  5J7E A;  3LI8 A;  5F69 A;  2V0U A;  5HD5 A;  2QJ5 A;  2V1B A;  1OT6 A;  2PD7 A;  2PD8 A;  3BWL A;  3LIA A;  3LIB A;  3MQQ A;  1T19 A;  1N9L A;  2YKF A;  3K3D A;  4GHI A;  4I39 A;  4L9E A;  1DP8 A;  4KUK A;  5G4Y A;  1UGU A;  1DRM A;  5HWT A;  2V1A A;  1LT0 A;  1DP9 A;  4GHI B;  3RTY A;  3K3C A;  1T1C A;  5AVF A;  3E4Q A;  1OTA A;  4YWZ A;  3A0V A;  5TBM A;  1X0O A;  2D02 A;  2WKQ A;  2GJ3 A;  4KQD A;  1UWN X;  1T1A A;  5F5Y A;  1F9I A;  3IS2 B;  3MR0 A;  1T18 A;  5HZH A;  2VV6 A;  2H28 A;  4HY8 A;  1KOU A;  2B02 A;  4WUJ A;  3B33 A;  4R70 A;  1N9O A;  2L0W A;  4I3I A;  1OJ5 A;  1VB6 A;  2VEA A;  3ZQ5 A;  3H82 B;  5DKK A;  5J3W A;  3C8C A;  4B9O A;  4EXO A;  1Y28 A;  2JN7 A;  1LSX A;  3ICY A;  2OOL A;  2WKP A;  3NOP C;  3CLO A;  3LYX A;  1OJG A;  2D01 A;  4EQ1 A;  1S1Z A;  4I5S A;  3NOU C;  2KDK A;  1S4R A;  3PHY A;  2VV8 A;  1N9N A;  1GSX A;  4EEU A;  5HDS A;  4HH2 A;  1XJ6 A;  3F1P B;  2OWH A;  4R38 A;  5HWV A;  2WKR A;  3NJA A;  4JGP A;  4WF0 A;  4DJ2 A;  2J80 A;  5A8B A;  5G4Z A;  1XJ3 A;  2INW A;  1DP6 A;  1NWZ A;  3G6O A;  3HJK A;  3CAX A;  5DJU A;  2W27 A;  4M4X A;  2V9A A;  2R78 A;  4XT2 A;  5DJT A;  3ULF A;  4BBT A;  1EW0 A;  2YKH A;  2W0N A;  3MXQ A;  2BAS A;  4NXG A;  5F6A A;  5HWW A;  1OT9 A;  4R3A A;  2QJ7 A;  5IU1 A;  1XJ4 A;  3EWK A;  3H7W B;  1S4S A;  3LID A;  2EA9 A;  2JHE A;  1OTE A;  3OLO A;  4HHD A;  4HP4 A;  4LLO B;  1JNU A;  4LRX C;  4HH3 A;  1TS7 A;  5AVE A;  1T1B A;  3A0R A;  4L9F A;  3GEC A;  3FG8 A;  4HJ4 A;  4MN5 A;  3F1N B;  4H6J A;  4EES A;  1D7E A;  1S67 L;  1TS0 A;  2Z6D A;  3FC7 A;  4R6L A;  3T50 A;  4GCZ A;  4NXB A;  3UB8 A;  1F98 A;  3C2W A;  2KX6 A;  2PHY A;  3MFX A;  4E04 A;  3HJI A;  1XFN A;  3LIE A;  3VOL A;  5J4E A;  3LUQ A;  3LIF A;  2OWJ A;  2PR6 A;  3MQO A;  2QWS A;  3LIC A;  4HIA A;  1OTD A;  3D72 A;  1WA9 A;  4XT2 B;  1LL8 A;  3UMD A;  3UB6 A;  1BYW A;  4GS9 A;  3P7N A;  3BY9 A;  5HDC A;  5F68 A;  4DJ3 A;  1G28 A;  1OTI A;  4KUO A;  3VE4 A;  4LRZ E;  4I38 A;  4HNB A;  4HI4 A;  4MN6 A;  1LSW A;  5HDD A;  2VV7 A; 
#chains in the Genus database with same CATH topology
 4D60 A;  1CQA A;  4H6J B;  3ZG0 A;  5TGF A;  3GV9 A;  1YLJ A;  3BY8 A;  3MZF A;  4O01 A;  4OLD A;  5EVI B;  5CGS A;  3IQA A;  1VHM A;  4NEE D;  5DVA A;  4EER A;  4EQI A;  4A5R A;  2XRN A;  4NXE A;  1RP5 A;  3BFC A;  2Y2Q A;  4S2J A;  2ZQ8 A;  5KSH A;  2GNX A;  3DTK A;  3LR5 A;  4WL9 A;  4FD8 A;  5E2G A;  3UY6 A;  1LHY A;  4IVI A;  3EEA A;  3FZC A;  2KOI A;  3BFG A;  2PD7 A;  2PD8 A;  3LIA A;  2PBD P;  5G4Y A;  1ES3 A;  2V1A A;  4E3J A;  4Y7P A;  3K3C A;  3EQV A;  3C4P A;  2WKQ A;  5F5Y A;  5FQK A;  4OOM A;  3IS2 B;  3MR0 A;  1FSY A;  2HPB A;  5GLB A;  4GLQ A;  5HSQ A;  3CLO A;  3D4F A;  5KMW A;  4NG2 A;  2A2L A;  4R38 A;  1ES2 A;  3TE8 A;  2OAQ 1;  2QPN A;  3C7U A;  4NXG A;  1GHP A;  5HWW A;  2LB9 A;  1OTE A;  3A0R A;  2IA2 A;  2J3T C;  2X71 A;  5HAQ A;  4Q0H A;  4HIA A;  4R0Q A;  1L0F A;  1LL8 A;  4HI4 A;  3CUE A;  5M19 A;  4JGO A;  5LBR A;  3UPO A;  3FWL A;  1XXM A;  4F3L B;  3OZH A;  1VET A;  2Y2G A;  3H7W A;  5GLA A;  2K2N A;  1J9M A;  2O9B A;  1K0K A;  5A90 A;  5F1G A;  4U0X A;  3GDI A;  3ZG8 B;  3BQA A;  3IX3 A;  4BD0 A;  2CC1 A;  3T4T A;  3KYQ A;  4E6W A;  2A24 A;  3N8L A;  3SS4 A;  2ZC4 B;  4QU3 A;  3VE3 A;  1CI8 A;  4G3V A;  4WEK A;  3H9W A;  5EM1 A;  1T19 A;  4KQR A;  4XUX A;  4GZB A;  3UE0 A;  3BEC A;  1KVM A;  2ZC3 B;  3ZVT A;  4YIN A;  4KG6 A;  4ZJ3 A;  3IXB A;  5HAR A;  3V5M A;  3MBZ A;  4DKI A;  4B9O A;  3GMW A;  1BUL A;  1S0W A;  3NJA A;  2VKS A;  3NIA A;  3G30 A;  4ZJ2 A;  5E2E A;  5TR7 A;  3LEZ A;  5CEB A;  4HP4 A;  2OLU A;  1TDL A;  1NXY A;  1VET B;  5HX9 A;  2P9V A;  3GEC A;  4HBT A;  4X56 A;  3O86 A;  3ITB A;  3VOY A;  3HJI A;  3LUQ A;  3U4L P;  3HLG A;  4E3M A;  4LV1 A;  1H8Y A;  1PWD A;  5GL9 A;  5EOO A;  3VE4 A;  5IT5 A;  3AGF A;  1LSW A;  2VV7 A;  1S66 L;  1SZV A;  3T1X A;  3A3I A;  3RXW A;  2G2U A;  3ZVW A;  5FQQ A;  3LY3 A;  3LGO A;  1S1Y A;  1GHI A;  4Y17 A;  2WKE A;  1XPB A;  3RH8 B;  1FR6 A;  4I3A A;  1NLY A;  1IEL A;  5CER A;  1K55 A;  2BTF P;  3U2A A;  1XKZ A;  2A24 B;  2QJ5 A;  4GHI A;  1DP8 A;  4JXW A;  2JBF A;  3M2J A;  5AQB A;  4KZ9 A;  2O0Y A;  3Q81 A;  5TBM A;  3IH9 A;  5BOH A;  4QHC A;  5HAP A;  4PMA A;  2Y2N A;  3G2Z A;  2JN7 A;  3ICY A;  1OJG A;  3MXS A;  5FAT A;  1YSP A;  1XX2 A;  1HLU P;  2WKR A;  5HWV A;  3V39 A;  2ZQD A;  2O9A A;  4KG5 A;  3HJK A;  3A3D A;  4Y2F A;  1FR1 A;  5CTM A;  3WS2 A;  2VGK A;  3NCK A;  1PFL A;  1OT9 A;  3T1S A;  2QJ7 A;  1XJ4 A;  5CGX A;  4PM7 A;  2ZQ7 A;  4DDY A;  1ONH A;  3BYD A;  1T1B A;  3Q7Z A;  1W63 M;  1CEG A;  3OPP A;  1CI9 A;  2Z2L B;  3C2W A;  1NY0 A;  1MC0 A;  1PRQ A;  4MDZ A;  2ZMV A;  1OTD A;  3T4L A;  4R4S A;  4HNB A;  4WMC A;  5DKL A;  3LFV A;  1TS6 A;  2OSU A;  5D3O A;  1BLC A;  3OCN A;  4P6B A;  2WAE A;  4G3K A;  3UME A;  3PBT A;  1V9Y A;  1P9R A;  3T12 B;  1WE4 A;  4F94 A;  1QME A;  1G6A A;  2Y2J A;  5CEC A;  5A93 A;  3QNC A;  2HDU A;  3IT9 A;  4GS9 B;  1K4E A;  4N1X A;  5DTK A;  1E3U A;  2EWV A;  3OPR A;  4XXR A;  3WS4 A;  1JTD A;  2ZOH A;  2XRO A;  5A92 A;  4E3N A;  4IHQ A;  3NOT C;  4R3J A;  2V0U A;  3VSL A;  3MQQ A;  1YMS A;  4I39 A;  3UE3 A;  2YKF A;  4JF4 A;  3WRT A;  5J8X A;  1H8Z A;  1LT0 A;  4KQD A;  3GRJ A;  1BSG A;  1K57 A;  2V1Z A;  2H0T A;  3T4K A;  4GD6 A;  5GHX A;  2HP6 A;  1LSX A;  5HL6 A;  2J3W A;  3MZD A;  3PHY A;  3KO6 A;  4JBF A;  3R7W B;  4X53 A;  2Y91 A;  2PT7 A;  4CLC B;  5EV0 A;  1K54 C;  2MJ6 A;  4UA7 A;  3BW6 A;  4DE1 A;  3UDI A;  1PI5 A;  5CTN A;  1C3B A;  4LCM A;  3R4K A;  4UAA A;  5L8M A;  2Y2I A;  4JPM A;  5EVL A;  3HCY A;  4PPR A;  2EXB A;  4BWI A;  1ESU A;  5FEG A;  3LI9 A;  4OPR A;  1H0M A;  1MY8 A;  1W8Y A;  4DXC A;  4FSF A;  4NXF A;  4OPY A;  3KX0 X;  4EBN A;  2C6W B;  4OH0 A;  4GDN A;  2V8F A;  5GLD A;  5HPI A;  1DJB A;  1GSV A;  5FAP A;  2JC7 A;  4R23 A;  5CXW A;  1IEM A;  2HDQ A;  3W4P A;  4IBR A;  3CJM A;  2P7J A;  5FAO A;  3LR4 A;  1L0E A;  3IS2 A;  4I3J A;  2IWB A;  1XJ2 A;  4KZ7 A;  3BWL A;  2V1B A;  3LIB A;  5EFW A;  4QPR A;  4R6L A;  1GHM A;  4BD1 A;  4LEN A;  4II7 A;  4KG2 A;  2P74 A;  3HL9 A;  5I94 A;  4Y13 A;  1Q2P A;  2PU4 A;  4HY8 A;  1KOU A;  4WUJ A;  3BQ8 A;  3ZQ5 A;  1BTL A;  3C8C A;  3QP1 A;  2XDM A;  2FFY A;  5FAQ A;  2J80 A;  4C75 A;  2XFS A;  5DJU A;  3SS5 A;  3A3J A;  3SH7 A;  2UWX A;  3QP2 A;  4BL2 A;  4HES A;  2XA7 S;  4LLO B;  4OOL A;  3UPN A;  3T4Q A;  4HJ4 A;  4S2K A;  4P85 A;  2XH9 A;  4E04 A;  1KGG A;  1MWU A;  2DNS A;  5FI7 A;  2JKF A;  4DJ3 A;  2Y2P A;  2HF6 A;  1Z09 A;  5MC7 A;  3NDE A;  4OQG A;  3IWI A;  4X69 A;  3O88 A;  4LFU A;  5HAI A;  1ODV A;  2VJW A;  1KE4 A;  2XK1 A;  3O5Y A;  2XD5 A;  2ZQ9 A;  4PKY A;  1TEM A;  3JVV A;  3PBO A;  4CLC E;  2Y2H A;  1AWI A;  4MLL A;  1NYM A;  2W3D A;  4EU0 A;  2PR5 A;  5KZH A;  3DBA A;  5F69 A;  3UPP A;  1SKF A;  4P6Z M;  3K3D A;  5AVF A;  4YWZ A;  1NZO A;  3TW8 A;  1PI4 A;  5DF8 A;  3DTE A;  4DXB A;  4IED A;  4FUW A;  1Q2Q A;  3O3V A;  5HZH A;  2B95 A;  3N4I A;  3B33 A;  1N9O A;  2DRW A;  1PW8 A;  1PWG A;  5FSR A;  4LV2 A;  3N7W A;  3HUO A;  4HH2 A;  2ZM0 A;  4WF0 A;  1K6R A;  3PBQ A;  3TSG A;  2NUT C;  2R9X A;  1YLP A;  2R78 A;  1GA9 A;  1CK3 A;  1IYP A;  4IUH A;  5IU1 A;  4JXG A;  1SKO B;  4IUK A;  5L09 A;  3OLO A;  3DAV A;  1TS7 A;  3OBF A;  3VMA A;  2G7U A;  2HDR A;  3FV7 A;  4EES A;  3IBJ A;  3IX4 A;  2ZM8 A;  2PHY A;  5FDS A;  2EX6 A;  1YM1 A;  2PR6 A;  2W3E A;  3S22 A;  3PR6 A;  5HDC A;  2XR0 A;  2V20 A;  2ZMF A;  4JKT A;  1E4D A;  1ZG6 A;  4HQA A;  5AJG A;  3PYP A;  2GX5 A;  3BRM A;  3NY4 A;  4BLM A;  2KLI A;  5DF9 A;  2W1T B;  3IF6 B;  2PDR A;  4GNU A;  4L9G A;  3R7W A;  4BBV A;  4HEF A;  3LCE A;  1W63 Q;  4WZ4 A;  4WEJ A;  1P0Z A;  3WS5 A;  2Y4A A;  1PZP A;  4EBP A;  4S2L A;  4E3K A;  2L1M A;  4N9K A;  4YNR A;  1CJF A;  4ZDX A;  4UA9 A;  1YT4 A;  4O0P A;  3BFD A;  2GDN A;  1DJC A;  3OPL A;  1J3W A;  4EXO A;  4B4X A;  3ZHH A;  4NKP A;  4UEY A;  1LI0 A;  2QZ6 A;  4OP5 A;  3Q07 A;  5HDS A;  4ARZ B;  5A8B A;  1BLH A;  3LO7 A;  1KDS A;  3IF6 A;  2W27 A;  2P04 A;  3ZDJ A;  1EW0 A;  5F6A A;  3PAE A;  4R3A A;  3EWK A;  4ME4 A;  3HLW A;  1D1J A;  2PU2 A;  3SZT A;  3ITA A;  2EFU A;  3V50 A;  3FG8 A;  2VA0 A;  4QY5 A;  3B42 A;  3TG9 A;  3T50 A;  2NUP C;  1E3U D;  2Y79 A;  5DTS A;  3KSF A;  3MFX A;  5AQA A;  3LIE A;  5J4E A;  1VEU B;  3LIC A;  2O99 A;  2ZD8 A;  3UB6 A;  4I38 A;  2WUQ A;  3ZG9 B;  3MXR A;  3UB7 A;  3V3R A;  1YLZ A;  4RX2 A;  3B3X A;  4S2I A;  4PKY G;  4HP9 A;  1TS8 A;  1XGJ A;  1W5D A;  4L0L A;  3G32 A;  4LCL A;  2A3U A;  2G2W A;  4Y15 A;  4WLA A;  4S2N C;  4ID4 A;  4LV0 A;  2OLV A;  3MJQ A;  4HJ3 A;  1UGU A;  4KQO A;  5HWT A;  4JXV A;  5G18 A;  4NET A;  4UQI S;  4G3W A;  2ZQC A;  1PZO A;  3AGE A;  2EWW A;  1HVB A;  4E3I A;  2A49 A;  1N4O A;  5J3W A;  2WAD A;  4PM5 A;  3CPT A;  2J9P A;  4EEU A;  2J9O A;  3T4O A;  4M4X A;  5DTT A;  3S7N A;  1ZTU A;  2W0N A;  3GTC A;  3PBN A;  1M40 A;  2EX8 A;  3LID A;  2EXA A;  5FL3 A;  3WRZ A;  4WZ5 C;  4GCZ A;  4GN2 A;  1JTG A;  3E98 A;  2Y59 A;  4CLC A;  2QWS A;  2HP9 A;  1K4F A;  3B47 A;  1G28 A;  4KUO A;  3P01 A;  2RCX A;  3OPH A;  1KE0 A;  5HFO A;  3KSI A;  1SDE A;  4AFI A;  2ZL1 B;  5DF7 A;  5E2F A;  5CHM A;  2PBY A;  4NK3 A;  3MKF A;  4BMW A;  3DW0 A;  3HLC A;  3D3O A;  4KZB A;  1NRF A;  4EET B;  3VFH A;  2M7V A;  3N8R A;  2PYR A;  5TJJ A;  4RVA A;  2ZBB A;  2LB5 A;  1L0D A;  3TRC A;  5L10 A;  5A91 A;  3VFF A;  1QMF A;  5I5L A;  3ZNY A;  4JGQ A;  4OQ0 A;  4RX3 A;  2PRF A;  3G31 A;  5EVI A;  3NUL A;  4KZA A;  1HTZ A;  2FZ0 A;  4DE2 A;  5FQ9 A;  1Y4O A;  1K54 A;  3LI8 A;  3S7P A;  4DN0 A;  4UQI M;  4CJN A;  3CHW P;  4L9E A;  2M7U A;  2ZC7 A;  4MNR A;  2Z2M B;  2D02 A;  3EQU A;  4X55 A;  1OME A;  4Z1W A;  3BLS A;  1T18 A;  5E2H A;  4JF6 A;  1PIO A;  4KQQ A;  3LYX A;  5EVI C;  3CUE C;  2HZ5 A;  4PHT A;  4WM9 A;  1XJ6 A;  2OWH A;  1F5M A;  4FH4 A;  1IFQ A;  1DP6 A;  1LL9 A;  1XJ3 A;  2INW A;  3FKW A;  1NYY A;  2V9A A;  3L9K A;  3CG5 A;  4WEL A;  4KZ8 A;  3H7W B;  2RL3 A;  1O07 A;  1H3Q A;  3UB5 P;  1K25 A;  4LV3 A;  1TS0 A;  1NRJ A;  3CIT A;  3QP8 A;  4E3O A;  5FQM A;  2WGV A;  1JWP A;  2IWC A;  3D72 A;  3KSG A;  3KYE A;  2WGW A;  3BY9 A;  3UDX A;  2EFX A;  4LRZ E;  1H8M A;  4R3B A;  3DTI A;  3HVF A;  1MKM A;  4ZJ1 A;  4EV4 A;  5M18 A;  3W4Q A;  1HD8 A;  2W3G A;  4LPZ A;  5JYP A;  1AXB A;  3HUN A;  4N9L A;  5TFQ A;  4RQ9 A;  4GW9 A;  3VP1 A;  4E3L A;  2WAF A;  4ARZ A;  1XFQ A;  3UB9 A;  3PTE A;  3SOI A;  1LL5 A;  2BLS A;  1V9Z A;  4RYE A;  4EEP A;  2H10 A;  3HLB A;  2QKP A;  5GLC A;  3IHB A;  2OV5 A;  3E2L A;  3A3F A;  4DE0 A;  4Y3I A;  3G2Y A;  3IH8 A;  2FFF B;  2XGN A;  2J3T D;  1N9L A;  4YFM A;  2ZQA A;  3QP5 A;  4KUK A;  2VK3 A;  3MMH A;  5DFX A;  1TVF A;  4FTX A;  3UDF A;  5CED A;  1XA1 A;  2ACG A;  2P08 A;  3A0V A;  3PXP A;  2GZA A;  4HBU A;  4LGW A;  4IBX A;  3HLF A;  3HBR A;  3VP3 A;  1VB6 A;  3BM6 A;  3BLM A;  5FI2 A;  2ZMA A;  3NOP C;  4Q8I A;  3MSH A;  1S4R A;  3UO9 A;  2QMI A;  3O87 A;  1NLZ A;  4MBF A;  3ZFZ A;  4B93 A;  4O7D A;  1IKI A;  3GR2 A;  4EUZ A;  1XGI A;  3S7Q A;  3HUM A;  4L9F A;  5FEF A;  1I2W A;  4KZ3 A;  3C5A A;  2Z6D A;  4B4Z A;  3NEC A;  4Q0J A;  2KX6 A;  4OPQ A;  1XFN A;  3VOL A;  4Y0T A;  2OWJ A;  3MQO A;  1BLP A;  1ZKJ A;  2J8Y A;  4B88 A;  1L2S A;  4P6Z S;  4K08 A;  5JYO A;  2PYP A;  1P97 A;  3SW1 A;  3EOI A;  1KVL A;  2VGL M;  3W2Z A;  4PM9 A;  1ZC2 A;  5AQ7 A;  5HPF A;  5TBM B;  3ZCZ A;  4HJ6 A;  4EWF A;  4CQH A;  2L4R A;  5L2F A;  3F1P A;  3SH8 A;  1YMX A;  4ETX A;  2J7V A;  3IBR A;  3F1O B;  4X6T A;  4EBL A;  2JKR I;  3VP0 A;  5CHU A;  1IOU A;  3ZG5 A;  5GHZ A;  5HD5 A;  1FOF A;  3V67 A;  3IHA A;  4QY6 A;  4GHI B;  3E4Q A;  4ZRR A;  2UV0 E;  3N6I A;  4IJG A;  2B02 A;  5CHJ A;  2XD1 A;  2XA7 M;  2KDK A;  1K56 A;  4S2N A;  1K57 C;  1M6K A;  1K55 C;  1EWZ A;  3FYZ A;  4JGP A;  4U3T A;  4GB7 A;  3G6O A;  5DJT A;  4K91 A;  5IHV A;  1YSQ A;  1KDW A;  2EA9 A;  3OCL A;  3QP6 A;  4C6Y A;  1O7E A;  2ZL1 A;  2WZZ A;  2BG1 A;  4MCW A;  1K56 D;  4CPK A;  1WA9 A;  3UMD A;  4E6X A;  1ACF A;  5U47 A;  3MZE A;  5EEC A;  1IYO A;  1L0G A;  2M1C A;  4WN5 A;  5DFY A;  3Q7V B;  1WYB A;  4LRY C;  1FQG A;  4JLF A;  4OKP A;  1BT5 A;  4IVK A;  1LI9 A;  3MKE A;  3K2N A;  3E0Y A;  1VQQ A;  4Y0O A;  2X02 A;  2VLG A;  4GJ4 A;  1N9B A;  1A0K A;  4DF6 A;  3GSG A;  1DJA A;  1LSV A;  1PNE A;  3GQZ A;  4OPZ A;  3QHY A;  1YAX A;  3M6H A;  1G5U A;  4N1H A;  3HRE A;  4DRT A;  2Y8H A;  5FQJ A;  1YLW A;  3RJU A;  1DP9 A;  3C30 A;  4CLC D;  1I2S A;  1JVJ A;  4GD8 A;  4ESP A;  1IKG A;  3ZGA B;  1TDG A;  3ZYT A;  3EGD C;  1YQS A;  5FA7 A;  2L0W A;  1S6R A;  2E8J A;  3VV4 A;  5AQ9 A;  1CF0 A;  3TJZ C;  3IF5 A;  4OVD A;  1SCW A;  1ES4 A;  2B5R A;  1S4S A;  3NI9 A;  5AVE A;  3AGD A;  2HJE A;  4FOF A;  4X1M A;  3F1N B;  2E8I A;  1SHV A;  1S67 L;  2Y55 A;  4NXB A;  2C5W B;  5EM0 A;  3LR3 A;  2AVX A;  3WS0 A;  4EUV A;  3G4P A;  1Y54 A;  1BUE A;  3IWO A;  3PAG A;  3P7N A;  3BFE A;  3WS1 A;  4Q0I A;  2DCF A;  5HDD A;  4GKU A;  5F83 A;  5FI6 A;  3MF0 A;  2HGV A;  4QJG A;  3E4O A;  1I5Q A;  2VX8 A;  4DMZ A;  4Z9Q A;  3G34 A;  1NJ4 A;  3QNB A;  3BFF A;  2XSS A;  4QWO A;  3CI6 A;  3UE6 A;  1FCN A;  4OON A;  2VGJ A;  4D2O A;  2EX2 A;  5EPH A;  2ZOI A;  3E4P A;  3DWK A;  1MZU A;  4HOI A;  2ZJ9 A;  2QHK A;  3C4O A;  4EW7 A;  5CGW A;  4F3L A;  1YKD A;  2VZW A;  1HZO A;  2JCH A;  1CEF A;  2W3F A;  1BZA A;  3C7V A;  1OT6 A;  4X25 A;  1FIL A;  5CRF A;  1JWZ A;  4S2O A;  1IYQ A;  4N92 A;  1PYY A;  4FH2 A;  4OOY A;  3NC8 A;  1F9I A;  3CMZ A;  5EE8 A;  3W4O A;  1K38 A;  3KYZ A;  1PW1 A;  1KGE A;  3H82 B;  3IF6 C;  1XP4 A;  3HLD A;  2OOL A;  4I5S A;  1N9N A;  1GSX A;  3LEQ A;  3OOV A;  2H5S A;  5EUA A;  5G4Z A;  1NWZ A;  4BBT A;  2BAS A;  3JPU A;  3A3E A;  3IX8 A;  1MWS A;  3MS6 A;  4KZ6 A;  2V8C A;  1JWV A;  3IXD A;  4ZAM A;  1FSW A;  3FC7 A;  4MBH A;  4KZ4 A;  1F98 A;  1NZU A;  2K31 A;  4P87 A;  1BYW A;  1OTI A;  2ZC5 B;  5HL1 A;  2HP5 A;  1FIK A;  3RFB A;  4ZBE A;  4DE3 A;  4ETZ A;  1ESI A;  3NHQ A;  1F2K A;  2WGI A;  2Y2O A;  2WKH A;  5C5K A;  1VM1 A;  1Z6F A;  2V0W A;  2CMN A;  3T4J A;  3CWF A;  1D06 A;  5EVI D;  2ZM2 A;  3HLE A;  1W7F A;  3S1Y A;  2Z6C A;  2JKT I;  2HV1 A;  1TD5 A;  2Q9M A;  4JF5 A;  4JGR A;  3IXG A;  3QP4 A;  1EI5 A;  3VOZ A;  3RTY A;  5L07 A;  1T1C A;  1L3L A;  2GJ3 A;  2FH5 A;  5EVE A;  2WK0 A;  3N8S A;  3VSK A;  4BEN A;  2DMW A;  2I72 A;  2H28 A;  4OP8 A;  2XLN A;  3Q7V A;  2VEA A;  1W8Q A;  1MPL A;  5DKK A;  1Y28 A;  2WZX A;  1IYS A;  4MBK A;  1LLB A;  3PBS A;  5GHY A;  3NOU C;  2ZC6 B;  1SDN A;  2Q0O A;  3F1P B;  1GCE A;  3G35 A;  3JVU A;  2JKR M;  4DJ2 A;  4BL3 A;  3CAX A;  4XT2 A;  3IXH A;  4WZ5 A;  2EX9 A;  3MXQ A;  2WYX A;  3DWZ A;  1VEU A;  2JKG A;  4HHD A;  3UNW A;  4LRX C;  2HJ9 C;  1MBL A;  4GOG A;  2XEP A;  4OQH A;  1MWR A;  4XUZ A;  4X1L A;  4XT2 B;  4MN6 A;  3RXX A;  2X01 A;  2Y2L A;  4S2P A;  3S4X A;  1OTB A;  3T1R A;  1FCO A;  4K0W A;  4WYY A;  4DDS A;  5IS1 A;  2W1T A;  1E25 A;  3MQ0 A;  3V3S A;  5KSC A;  2HDS A;  1UWP X;  3SH9 A;  2Y2K A;  2XQZ A;  3VP4 A;  3T4S A;  3PBR A;  2WGW B;  1ERQ A;  3CPT B;  3H82 A;  5EOE A;  3S7O A;  1U60 A;  3A0S A;  3P98 A;  1SKO A;  3W8K A;  3F1O A;  4MEZ A;  2I9V A;  2Y2M A;  5HD3 A;  1ONG A;  1STZ A;  5KIZ A;  4QD4 A;  4BQM A;  4BBU A;  3D9Y A;  3KSH A;  4S2M A;  2O9C A;  3UN7 A;  5F82 A;  3LY4 A;  1ERM A;  1MXO A;  4QB8 A;  1UWN X;  1T1A A;  3IWQ A;  2JE5 A;  1YLT A;  1P9W A;  3LR0 A;  3FPV A;  4I3I A;  2XFT A;  2P9V B;  1G6O A;  4EQ1 A;  5K5B A;  3UE1 A;  3OC2 A;  1H5X A;  1RGY A;  2V2F F;  1G68 A;  1ZG4 A;  1XA7 A;  3FKV A;  3ULF A;  2IWD A;  1K6S A;  3VP2 A;  3EGX C;  4H8R A;  1RCJ A;  4HH3 A;  4MN7 A;  4MN5 A;  1ALQ A;  5M1A A;  1KGF A;  2PAV P;  3CZD A;  3NDG A;  3LIF A;  4FCF A;  4PAU A;  1KE3 A;  4K0X A;  4GS9 A;  4WMC D;  5HW3 A;  5F68 A;  3TOI A;  4KZ5 A;  5E43 A;  3P09 A;  3T1Q B;  3Q1F A;  4OLG A;  3NBL A;  3EEH A;  4CLC C;  2VGL S;  1GA0 A;  2H0Y A;  3E2K A;  4P0M A;  5FQI A;  1FCM A;  1MWT A;  2Q9N A;  3FPW A;  1WYC A;  1YPR A;  3ZG7 B;  3I7J A;  4Y5F A;  5F1F A;  4X68 A;  3F1N A;  3JYI A;  4O8G A;  4RA7 A;  1GSW A;  3SS3 A;  4YOF A;  3ZNT A;  4JXS A;  3M6B A;  4ZTK A;  1TF1 A;  1RGZ A;  2K7S A;  4R1G A;  5FAS A;  1ES5 A;  2XF3 A;  5J7E A;  3MFD A;  3M2K A;  2ZLY A;  1MKI A;  1DRM A;  1YLY A;  1BLS A;  4BJP A;  3L7H A;  1OTA A;  2WKI A;  1X0O A;  2QYB A;  2OAP 1;  4MMN A;  2VV6 A;  4R4R A;  4R70 A;  4PM6 A;  1OJ5 A;  3BEB A;  1PWC A;  1ZHH B;  2WKP A;  4PM8 A;  2D01 A;  1S1Z A;  2VV8 A;  4UHU A;  2R9W A;  1ERO A;  2W1R A;  4Y0U A;  1OPX A;  2YKH A;  2W3H A;  3GVB A;  4U0T A;  4GDB A;  2JHE A;  1JNU A;  2B18 A;  4WBG A;  4UA6 A;  4H6J A;  3BJN A;  1W79 A;  5FDH A;  1D7E A;  4OQI A;  4C3Q A;  3DTM A;  3C38 A;  3UB8 A;  4KEN B;  3Q82 A;  4M3K A;  2JKT M;  5CX7 A;  3ISG A;  3WWX A;  1DY6 A; 
#chains in the Genus database with same CATH homology
 3KSI A;  4AFI A;  3MF0 A;  2HGV A;  3HCY A;  4H6J B;  4BWI A;  3LI9 A;  4BMW A;  3E4O A;  3BY8 A;  2VX8 A;  4DMZ A;  4O01 A;  3D3O A;  4NEE D;  1VHM A;  4FSF A;  4NXF A;  4EER A;  4EET B;  2M7V A;  3KX0 X;  2PYR A;  2XRN A;  4NXE A;  5TJJ A;  2XSS A;  2ZBB A;  2LB5 A;  3CI6 A;  3UE6 A;  3TRC A;  5KSH A;  2GNX A;  5HPI A;  5I5L A;  2ZOI A;  1GSV A;  3LR5 A;  4JGQ A;  3E4P A;  1MZU A;  4WL9 A;  4HOI A;  2QHK A;  4EW7 A;  3EEA A;  2P7J A;  4F3L A;  1YKD A;  3LR4 A;  3IS2 A;  2FZ0 A;  2VZW A;  4I3J A;  2KOI A;  1XJ2 A;  2W3F A;  3LI8 A;  3S7P A;  4DN0 A;  3BWL A;  2V1B A;  1OT6 A;  2PD7 A;  2PD8 A;  3LIA A;  3LIB A;  4L9E A;  4QPR A;  4R6L A;  4UQI M;  5EFW A;  5G4Y A;  2V1A A;  2M7U A;  3K3C A;  3EQV A;  4II7 A;  2D02 A;  2WKQ A;  3EQU A;  5F5Y A;  4OOM A;  1F9I A;  3IS2 B;  4Z1W A;  3MR0 A;  1T18 A;  4HY8 A;  1KOU A;  4WUJ A;  3BQ8 A;  3KYZ A;  3ZQ5 A;  3H82 B;  4GLQ A;  3C8C A;  2OOL A;  5HSQ A;  3CLO A;  3LYX A;  3CUE C;  4I5S A;  1N9N A;  1GSX A;  2A2L A;  4PHT A;  1XJ6 A;  2OWH A;  4R38 A;  3OOV A;  1F5M A;  2J80 A;  5G4Z A;  1IFQ A;  1DP6 A;  1NWZ A;  1XJ3 A;  2INW A;  2OAQ 1;  3TE8 A;  5DJU A;  2V9A A;  4BBT A;  4WEL A;  4NXG A;  2BAS A;  5HWW A;  3H7W B;  2LB9 A;  1OTE A;  2XA7 S;  4LLO B;  4OOL A;  1H3Q A;  3A0R A;  3T4Q A;  4HJ4 A;  2IA2 A;  2J3T C;  1TS0 A;  3FC7 A;  1NRJ A;  1F98 A;  3CIT A;  4Q0H A;  4E04 A;  2K31 A;  4HIA A;  3D72 A;  3KSG A;  1LL8 A;  1BYW A;  3BY9 A;  4DJ3 A;  1OTI A;  4LRZ E;  1H8M A;  4HI4 A;  3CUE A;  3RFB A;  2HF6 A;  4JGO A;  1MKM A;  5LBR A;  2W3G A;  4LPZ A;  4ETZ A;  5MC7 A;  4F3L B;  3NHQ A;  3H7W A;  2K2N A;  4RQ9 A;  2O9B A;  4GW9 A;  5C5K A;  1ODV A;  3GDI A;  3BQA A;  2VJW A;  2V0W A;  4ARZ A;  1XFQ A;  2CMN A;  3O5Y A;  4PKY A;  3UB9 A;  3T4J A;  3JVV A;  3CWF A;  3PBO A;  1D06 A;  1V9Z A;  3T4T A;  4CLC E;  3KYQ A;  4EEP A;  2A24 A;  2QKP A;  2Z6C A;  3VE3 A;  4Y3I A;  2W3D A;  2JKT I;  4EU0 A;  2PR5 A;  4G3V A;  4WEK A;  3DBA A;  3H9W A;  2HV1 A;  1TD5 A;  5F69 A;  4JGR A;  4P6Z M;  2J3T D;  1T19 A;  1N9L A;  3K3D A;  4KUK A;  5DFX A;  3MMH A;  3RTY A;  1T1C A;  5AVF A;  2P08 A;  4YWZ A;  3A0V A;  3PXP A;  3TW8 A;  2GJ3 A;  2FH5 A;  2GZA A;  5HZH A;  2DMW A;  2H28 A;  3B33 A;  1N9O A;  2VEA A;  1VB6 A;  5DKK A;  4B9O A;  1Y28 A;  3NOP C;  3PBS A;  3NOU C;  1S4R A;  4HH2 A;  3F1P B;  3NJA A;  3JVU A;  2VKS A;  2JKR M;  4WF0 A;  4DJ2 A;  1NLZ A;  3CAX A;  4B93 A;  3PBQ A;  4XT2 A;  2NUT C;  2R78 A;  3MXQ A;  4IUH A;  5IU1 A;  4IUK A;  4HHD A;  3OLO A;  4HP4 A;  4LRX C;  3S7Q A;  1TS7 A;  3OBF A;  2HJ9 C;  2G7U A;  4L9F A;  3GEC A;  4EES A;  3IBJ A;  2Z6D A;  4Q0J A;  2KX6 A;  2PHY A;  3HJI A;  1XFN A;  3VOL A;  3LUQ A;  2OWJ A;  2PR6 A;  2W3E A;  3MQO A;  4XT2 B;  3PR6 A;  5HDC A;  3VE4 A;  4MN6 A;  5IT5 A;  1LSW A;  2VV7 A;  2ZMF A;  4P6Z S;  1OTB A;  4K08 A;  4HQA A;  1S66 L;  5AJG A;  2PYP A;  1P97 A;  3PYP A;  3SW1 A;  3EOI A;  5IS1 A;  2VGL M;  2W1T A;  2GX5 A;  3MQ0 A;  2KLI A;  5DF9 A;  3W2Z A;  2W1T B;  5HPF A;  5TBM B;  2PDR A;  4HJ6 A;  1UWP X;  4L9G A;  3R7W A;  4BBV A;  1S1Y A;  4CQH A;  2L4R A;  3F1P A;  1W63 Q;  3RH8 B;  3T4S A;  4ETX A;  3PBR A;  4WEJ A;  1P0Z A;  3IBR A;  4I3A A;  3F1O B;  3H82 A;  1NLY A;  3S7O A;  3A0S A;  3U2A A;  3F1O A;  2I9V A;  2JKR I;  2A24 B;  5HD3 A;  1STZ A;  2L1M A;  5KIZ A;  4YNR A;  1IOU A;  4BBU A;  5HD5 A;  2QJ5 A;  4GHI A;  3KSH A;  3V67 A;  1DP8 A;  4O0P A;  2O9C A;  4GHI B;  3E4Q A;  4ZRR A;  2O0Y A;  5TBM A;  1UWN X;  1T1A A;  1P9W A;  4IJG A;  3LR0 A;  2B02 A;  3FPV A;  4I3I A;  4EXO A;  1G6O A;  2JN7 A;  3ICY A;  4EQ1 A;  5K5B A;  1OJG A;  4NKP A;  2XA7 M;  4UEY A;  2KDK A;  3OC2 A;  1YSP A;  5HDS A;  4ARZ B;  5HWV A;  2WKR A;  4JGP A;  5A8B A;  2O9A A;  3HJK A;  4Y2F A;  3G6O A;  2W27 A;  5DJT A;  3ULF A;  2P04 A;  1EW0 A;  5F6A A;  1OT9 A;  1YSQ A;  4R3A A;  2QJ7 A;  1XJ4 A;  3EWK A;  3EGX C;  4ME4 A;  2EA9 A;  4HH3 A;  3OCL A;  1T1B A;  4MN7 A;  1W63 M;  2VA0 A;  3FG8 A;  4MN5 A;  3B42 A;  3T50 A;  2NUP C;  2Y79 A;  3C2W A;  3KSF A;  3MFX A;  3LIE A;  4MCW A;  1MC0 A;  5J4E A;  3LIF A;  4MDZ A;  3LIC A;  2O99 A;  1OTD A;  2ZMV A;  1WA9 A;  4PAU A;  3T4L A;  3UMD A;  3UB6 A;  4GS9 A;  5F68 A;  4I38 A;  4HNB A;  5DKL A;  3UB7 A;  2M1C A;  3EEH A;  4WN5 A;  5DFY A;  2VGL S;  3LFV A;  4CLC C;  1TS6 A;  3OCN A;  4LRY C;  4G3K A;  4PKY G;  3K2N A;  4HP9 A;  1TS8 A;  3FPW A;  3UME A;  3PBT A;  1V9Y A;  3E0Y A;  1P9R A;  4L0L A;  2VLG A;  4Y5F A;  4GJ4 A;  3F1N A;  4GS9 B;  4O8G A;  1GSW A;  1LSV A;  4WLA A;  4YOF A;  2EWV A;  2ZOH A;  3MJQ A;  2XRO A;  4HJ3 A;  1YAX A;  1TF1 A;  3NOT C;  4IHQ A;  2K7S A;  5J7E A;  2V0U A;  2Y8H A;  3MQQ A;  4I39 A;  3UE3 A;  2YKF A;  1UGU A;  4KQO A;  1DRM A;  5HWT A;  1LT0 A;  1DP9 A;  3C30 A;  4UQI S;  4BJP A;  4CLC D;  4G3W A;  1OTA A;  1X0O A;  4KQD A;  2QYB A;  2OAP 1;  2EWW A;  3ZYT A;  3EGD C;  4MMN A;  2VV6 A;  3T4K A;  4R70 A;  2L0W A;  1OJ5 A;  5J3W A;  1ZHH B;  1LSX A;  2WKP A;  5HL6 A;  2J3W A;  2D01 A;  1S1Z A;  3VV4 A;  4EEU A;  3PHY A;  3KO6 A;  2VV8 A;  3R7W B;  3TJZ C;  2W1R A;  3T4O A;  2PT7 A;  4M4X A;  3S7N A;  4CLC B;  1OPX A;  1ZTU A;  2YKH A;  2W0N A;  3PBN A;  2W3H A;  1S4S A;  3LID A;  2JHE A;  5FL3 A;  1JNU A;  5AVE A;  2HJE A;  2B18 A;  4FOF A;  2MJ6 A;  3F1N B;  4H6J A;  3BJN A;  1D7E A;  1S67 L;  4GCZ A;  4NXB A;  3C38 A;  3UB8 A;  3LR3 A;  3BW6 A;  3E98 A;  4EUV A;  4CLC A;  2QWS A;  2JKT M;  3R4K A;  5CX7 A;  3B47 A;  3P7N A;  5L8M A;  1G28 A;  4KUO A;  4Q0I A;  3P01 A;  5HDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...