4HP9A

Crystal structure of the n-terminal truncated pas domain from the herg potassium channel
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
119
Chain Sequence
TFLDTIIRKFQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium voltage-gated channel subfamily H member 2
publication title Structural properties of PAS domains from the KCNH potassium channels
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 31
structure length 119
sequence length 121
ec nomenclature
pdb deposition date 2012-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hp9A00
4HH3A 2PR6A 1T18A 4WN5A 3BY8A 4EW7A 5TBMB 2ZOHA 4HOIA 1NWZA 1T1CA 2BASA 5A8BA 3C8CA 5G4YA 4BBTA 3F1PB 1D06A 5G4ZA 2ZBBA 1T19A 4R38A 1LSXA 4LRZE 3ULFA 4HJ4A 3UB8A 2QWSA 3ZQ5A 4HP4A 5HWWA 1KOUA 3NOPC 2WKPA 2R78A 1XJ3A 1XFNA 2V1BA 3IS2B 3GDIA 3GECA 4WLAA 3A0SA 4GCZA 4R70A 4WL9A 3H7WB 4DJ2A 4LRXC 2QJ5A 1DP6A 5HWVA 1GSWA 4L9GA 1P0ZA 4GHIB 1N9LA 1DP8A 5DKLA 1OTEA 4JGQA 1TS0A 4EEUA 2J80A 3RTYA 1OTDA 1XJ4A 3LIFA 1BYWA 2GJ3A 2V1AA 3LUQA 3PHYA 4EERA 1UGUA 4GHIA 3F1NB 3IBRA 4I3AA 1OTAA 3NOTC 4HNBA 3MFXA 2KX6A 1GSVA 4NXGA 3ICYA 4WUJA 1S4SA 4PKYA 2VLGA 3NJAA 1OTBA 2VV6A 3OLOA 1MZUA 1OJGA 5DJUA 3HJKA 1V9ZA 2HV1A 4HY8A 3LI8A 3F1NA 3P7NA 4MN5A 4HJ3A 2QJ7A 5J3WA 2I9VA 2PD7A 3MXQA 2PYRA 2W27A 4YWZA 4XT2B 5I5LA 1LL8A 1EW0A 5F69A 3EEHA 4I3IA 3NOUC 3UMEA 3LIAA 4BBUA 2B02A 3SW1A 4KUKA 1V9YA 2A24A 3D72A 5DKKA 4HI4A 4GW9A 1DP9A 2CMNA 5EFWA 1Y28A 1ODVA 4XT2A 1D7EA 4HHDA 4JGRA 4HIAA 2Z6DA 1TS7A 4H6JB 4NXFA 3LYXA 3E4QA 3EWKA 3UMDA 2OOLA 4EETB 5J7EA 4HJ6A 3RH8B 1T1BA 3KX0X 1JNUA 1DRMA 1XFQA 4RQ9A 4LPZA 4MN6A 4NXBA 5HZHA 1F98A 3MR0A 3K3DA 4I3JA 1TS8A 4E04A 4I38A 2EA9A 2OWHA 4H6JA 5HDDA 2KDKA 2L4RA 5HDCA 5IS1A 3UB7A 1GSXA 4F3LB 3T50A 4GS9B 2L0WA 1TS6A 3A0VA 1LSVA 1VB6A 4EEPA 3FG8A 1UWPX 3HJIA 2PYPA 4R6LA 2M1CA 3CAXA 1XJ2A 3G6OA 3BY9A 4F3LA 5AVEA 3MJQA 4EXOA 2A24B 5F6AA 3BWLA 3A0RA 4GS9A 3H9WA 1S4RA 3F1OB 2W0NA 5AVFA 3VOLA 2QHKA 1S1ZA 1N9NA 5HWTA 5KIZA 4JGPA 3MQQA 4K08A 3UB9A 2V0WA 2PD8A 3B33A 3H82A 2Z6CA 4EESA 3LIBA 3VE4A 3LICA 1G28A 3F1OA 4DJ3A 4R3AA 5HDSA 2ZOIA 2L1MA 2VV7A 1X0OA 1S1YA 5TBMA 1T1AA 2P7JA 1XJ6A 1OT6A 4NXEA 3E4PA 2D01A 2YKHA 2PR5A 3MQOA 3UB6A 1LSWA 4LLOB 5DJTA 2WKRA 5HD5A 2D02A 3F1PA 4JGOA 2VEAA 2V0UA 1WA9A 2JN7A 4HP9A 2OWJA 4PKYG 2H28A 5HSQA 2INWA 3C2WA 4HQAA 1LT0A 3LI9A 3LIDA 4WF0A 5IU1A 2K7SA 3PYPA 3VE3A 5F5YA 4I5SA 2PHYA 2V9AA 3FC7A 1P97A 2YKFA 1S67L 4I39A 1F9IA 3IS2A 4LRYC 3H7WA 1UWNX 4EQ1A 3NHQA 2QKPA 3K3CA 1S66L 1OJ5A 1OT9A 4KUOA 4M4XA 5HD3A 1OTIA 5F68A 2JHEA 3CWFA 2WKQA 2PDRA 4HH2A 3H82B 3LIEA 3E4OA 4B9OA 4L9FA 3UE6A 1N9OA 2VV8A 4KQDA 4L9EA 5J4EA 4BBVA 3CLOA
chains in the Genus database with same CATH superfamily
1BLHA 3BY8A 2E8IA 1W79A 1BLPA 1LLBA 2BASA 2E8JA 1FCMA 4KZ8A 5G4YA 4FOFA 2VGJA 3LEZA 4ARZA 4WZ4A 3F1PB 2Y55A 5L10A 2QMIA 3PAEA 4RX3A 4X69A 1ZC2A 1NZUA 2HP6A 3EQVA 4KZ7A 5G4ZA 1L0EA 1NYMA 1T19A 3CPTB 3C7UA 4R3JA 3ULFA 1RGZA 1JWZA 4E3OA 3AGEA 3Q7VB 3ZQ5A 4HP4A 4E6XA 3ISGA 5K5BA 2GDNA 1NLZA 5FI6A 3T1SA 4IUHA 3T4OA 2WKPA 1XFNA 2W3EA 2Y2QA 3TOIA 5IHVA 4Y13A 3IS2B 5EVIB 2J3TC 3GECA 1ES5A 2EX6A 3T1XA 4WLAA 1MWSA 4EV4A 3A0SA 2DCFA 5AQAA 4JXGA 4D60A 2C5WB 3BFDA 2PU2A 3CPTA 1FR1A 5HAQA 4FSFA 4LRXC 5BOHA 4Y15A 4B88A 4UAAA 2QJ5A 4DN0A 4HEFA 4L9GA 5AQ9A 2WGWB 3VFFA 1P0ZA 3CITA 3UNWA 4S2PA 5DKLA 2HF6A 2WZXA 1OTEA 3HCYA 2P04A 2HDUA 4OOYA 2DNSA 2J80A 5EVIA 2ZD8A 1K55C 2ZM0A 3LCEA 1OTDA 4PM9A 4MBKA 1M40A 3IXDA 1XJ4A 3LIFA 3ZG5A 1WE4A 2WAEA 2XRNA 1G5UA 4FCFA 2Z2LB 5CTMA 3PHYA 3QP1A 3IX4A 4I3AA 1AXBA 5DF9A 1VM1A 3IT9A 1OTAA 4KENB 3IF6B 4RX2A 1CQAA 3T1RA 1MY8A 1VETB 4OPQA 2VLGA 4BL2A 3NJAA 2ZQ9A 3ZNYA 2M7UA 2VV6A 1MZUA 3W8KA 1OJGA 5EM1A 5DJUA 5DTSA 3UPOA 2WK0A 1L3LA 1MKIA 4MN5A 4PAUA 3CHWP 3VP1A 4CLCC 2JKRM 3IF6A 4WBGA 3VP0A 5JYOA 4OONA 1VETA 2PYRA 2GX5A 4RVAA 5FQQA 3IHBA 4FUWA 1ES2A 1N9BA 4GKUA 5FQIA 1QMEA 5FATA 5U47A 4JF6A 4LV2A 5DKKA 3FPWA 3QP8A 1CJFA 3V5MA 5KSCA 2CMNA 2O0YA 4GD8A 3RXWA 4OOLA 1Y28A 3UO9A 1ODVA 2Y8HA 1D7EA 1ERQA 3PBOA 1FCNA 5L09A 4MBFA 4BLMA 3ZFZA 4LFUA 1CF0A 3E4QA 3IWIA 3DBAA 5EUAA 3T4SA 3EWKA 4DDSA 3UMDA 3EQUA 4U0XA 2ZLYA 5CECA 4E3KA 2GNXA 3NCKA 4LPZA 1XP4A 4MN6A 2J3WA 5HZHA 3LR5A 4E04A 4Z9QA 3N6IA 4Y0TA 3R7WB 4OP8A 1I2SA 1IYOA 1E25A 3NECA 4X53A 4IEDA 3S7QA 2ZQCA 2W3FA 2RCXA 3V50A 2HPBA 2Q9MA 4QB8A 2Y2NA 3T50A 4DE3A 2L0WA 2H5SA 1PIOA 3A0VA 3T12B 3PBNA 4B4ZA 5F1GA 4S2KA 3FG8A 3WS0A 4ETZA 4UA6A 3R7WA 1CI8A 1GA9A 4R6LA 1EROA 4OOMA 3C4PA 4E3IA 1XJ2A 3G6OA 2WUQA 3MJQA 1WYCA 2IWCA 2XR0A 4EXOA 3A0RA 1P9RA 2Y79A 1S4RA 4KZ9A 4E3LA 3VOLA 3KSGA 2QHKA 4N1HA 5CHMA 3WRTA 1YLZA 5TJJA 1ERMA 3EEAA 1W5DA 3UB9A 5CHJA 4EBPA 3BLMA 1YLTA 3B33A 3CI6A 1MPLA 1G6OA 3V39A 4GDNA 4DJ3A 1I2WA 2NUTC 4PM8A 2G2UA 2ZOIA 2L1MA 4QWOA 1MBLA 4GN2A 3SS4A 4IVIA 2QPNA 1S1YA 3W4OA 4PMAA 4OLGA 2P7JA 2UWXA 4MN7A 1OT6A 5FAPA 4NXEA 3E4PA 2YKHA 3CUEC 4QY5A 4B4XA 3BEBA 3O3VA 2D02A 1ESUA 3GVBA 4JGOA 3AGDA 3G30A 4P6BA 4HP9A 4X1LA 3IQAA 2OWJA 3MBZA 4PKYG 2CC1A 4N9KA 3LIDA 2K7SA 1YLYA 4LENA 4I5SA 1KE0A 4CQHA 1DY6A 3ZNTA 3BFEA 1YSPA 1P97A 2HDSA 4HBTA 4MDZA 3N8SA 5GLDA 3W4PA 4BD0A 1G68A 1TD5A 3TW8A 4GJ4A 4LRYC 1PWCA 3ZHHA 1W63M 5FDSA 2QKPA 3KYEA 5EOEA 1D1JA 1GHIA 2VJWA 3WS2A 4O7DA 3MS6A 4JBFA 3LFVA 1YLPA 2EX9A 5FQJA 3M6HA 4M4XA 5HD3A 2WZZA 3HL9A 2V20A 5F68A 3DTEA 2JHEA 3SOIA 2PDRA 5FEGA 2EX8A 2EWVA 2VGLS 2HJ9C 4KQDA 5J4EA 3JVVA 2A49A 5FQMA 4WN5A 1F2KA 1Z09A 3MZDA 1T1CA 1LHYA 4S2NC 4ETXA 1G6AA 5A8BA 4ZBEA 2ZQ8A 2Y2MA 4O01A 2P9VA 1LL5A 2ZBBA 1NRJA 2IA2A 4GD6A 5DF8A 1J3WA 2VK3A 5E2HA 3BQ8A 1ZKJA 4X56A 3N4IA 2H0TA 3S22A 1PI4A 1KVLA 2W3GA 2QWSA 3A3IA 1VHMA 2FH5A 4YNRA 2GZAA 1ES3A 2HP9A 4KZ4A 4EU0A 3MZEA 1IOUA 3PXPA 4NG2A 2H0YA 4QHCA 2HGVA 2HJEA 2ZMAA 3O88A 1BSGA 4R70A 3TG9A 1LL9A 1PWGA 3TE8A 4DJ2A 5DTTA 4KQRA 2C6WB 2JKRI 1FQGA 4X1MA 4GHIB 3VP3A 3KYZA 1H8MA 1XA7A 2Z2MB 2OLUA 2VX8A 1A0KA 3GSGA 3CMZA 4RYEA 4PM6A 3RTYA 3Q7ZA 4ZJ3A 4HESA 3EGXC 5FEFA 1Y54A 1W7FA 4Y5FA 2X01A 2V1AA 3KSHA 3LUQA 4EERA 2VGLM 3OPHA 2EXBA 3QP5A 2XA7S 4GHIA 3IBRA 4MLLA 2ZQ7A 2H10A 4LV1A 3C7VA 3V3RA 4YFMA 4HNBA 1K54C 1L0FA 4DRTA 4ARZB 3ICYA 4WUJA 4S2OA 3B3XA 2JKGA 4WYYA 2J3TD 4PM5A 1PW8A 3G34A 5D3OA 3T4KA 5CEBA 3S4XA 3OLOA 2JKTM 3Q1FA 2B5RA 2UV0E 5EPHA 4PPRA 1W8QA 2HV1A 3QHYA 3P01A 1MXOA 3Q81A 1TDGA 2QJ7A 3GQZA 3HLCA 3G4PA 1HLUP 1IYQA 4XT2B 3IBJA 2A3UA 2ZC7A 4I3IA 2ZC3B 3UMEA 5FQ9A 2B02A 5KSHA 3SW1A 4GLQA 1K6RA 4WEKA 4GOGA 4B93A 3NDEA 1V9YA 5A91A 5HARA 4S2LA 3UN7A 1I5QA 3WS5A 5DF7A 4OPRA 3FV7A 3LY4A 4S2IA 4ZDXA 2FZ0A 1SHVA 4XT2A 3B42A 3MMHA 4JGRA 3LO7A 4K0XA 1TS7A 4NXFA 2PRFA 3W2ZA 3GR2A 3K2NA 4QU3A 5F82A 4EETB 2J9PA 5FAOA 3RH8B 3KX0X 1JNUA 1XFQA 4LCLA 1PW1A 3UDIA 5FL3A 4CLCD 1F98A 3NIAA 4I3JA 3LGOA 5DTKA 2G7UA 2Y2GA 2XQZA 2OSUA 2WKHA 2A2LA 5HDDA 4N1XA 4X25A 4Q8IA 2Y59A 4NK3A 5M1AA 2QYBA 1BTLA 3UB7A 3BJNA 4F3LB 2ZQDA 4DKIA 3IWOA 4ZAMA 2R9WA 4GS9B 1TVFA 3RFBA 4EQIA 3C5AA 5I94A 1VB6A 2QZ6A 3MXRA 4XXRA 4ZJ1A 4L0LA 2M1CA 2FFYA 4CJNA 4NKPA 3CAXA 3UE0A 3PAGA 1STZA 3MFDA 5FSRA 4F3LA 5AVEA 1Q2QA 4OVDA 4WZ5C 1XKZA 4GS9A 3H9WA 5GL9A 5GHXA 4E3MA 5AQBA 5AVFA 3IF5A 5HW3A 2OLVA 1N9NA 3OPLA 3MQQA 4FD8A 1RGYA 4K08A 5FI7A 3SS5A 5E2GA 2O9CA 4JPMA 4GNUA 2PD8A 4Y7PA 1K55A 3H82A 5A93A 5DFYA 2VA0A 2M7VA 3KO6A 3VE4A 3IHAA 1S0WA 3HBRA 3W4QA 4R3AA 5HDSA 2RL3A 3HUMA 3HLWA 3BQAA 2XD1A 1X0OA 4OLDA 4OPYA 3ZYTA 3VSLA 1YPRA 5TBMA 1T1AA 4CLCB 1FILA 2D01A 3ZG7B 3MQOA 3UB6A 5DJTA 4LLOB 1TDLA 2LB9A 2VEAA 2BLSA 2J7VA 2H28A 5HSQA 3C2WA 4S2MA 3SH7A 3LI9A 4UHUA 1KDSA 3HREA 3VOZA 1KDWA 2JC7A 2XDMA 4KG6A 4WZ5A 3TRCA 2PHYA 4CLCA 2EFXA 3BLSA 3ZVWA 1HD8A 4I39A 4Y0OA 1SZVA 2O99A 3O87A 4FTXA 4XUZA 1F9IA 4KQQA 4ZRRA 3ZCZA 2DRWA 4DF6A 1MKMA 2VGKA 5FQKA 3H7WA 1UWNX 3NHQA 4DXCA 1PNEA 5MC7A 2IWBA 1PI5A 4KUOA 4BJPA 3WS1A 5EVEA 1H8ZA 2DMWA 1VEUA 2PBDP 3A3JA 1DJCA 1NJ4A 2Y4AA 4HH2A 1GHPA 3N8LA 2KLIA 5HX9A 4JLFA 3GTCA 1PWDA 5EV0A 4WM9A 4B9OA 1E4DA 3NI9A 4L9FA 3UE6A 3DTIA 1N9OA 1RP5A 3UE3A 3ZG0A 3KSFA 4L9EA 3MKFA 5GLCA 1H8YA 1YKDA 3A3EA 2XSSA 4EW7A 1U60A 4H8RA 3LY3A 3SH8A 2ZOHA 4HOIA 3HLGA 4NETA 2ZMFA 4EUVA 2PT7A 3M2KA 5C5KA 4OQ0A 3R4KA 2ZM8A 1D06A 5E2FA 4OKPA 3NC8A 4R38A 3G2ZA 1LSXA 1BULA 2Y2IA 1SKOA 4Y3IA 4LRZE 3PTEA 2ZL1A 3M6BA 3RXXA 1E3UD 5HWWA 5TFQA 3MSHA 4GB7A 2PAVP 3NOPC 4KZBA 5CGXA 1NY0A 2LB5A 5CHUA 3GDIA 1YAXA 2JKTI 4OPZA 3Q82A 5GLAA 2OAP1 1JWVA 4GCZA 4R23A 4WL9A 2BTFP 2EWWA 2R9XA 3U2AA 3EOIA 5GHZA 3FPVA 3N8RA 1N9LA 5A92A 4M3KA 2OV5A 4JGQA 3BECA 1Y4OA 5KZHA 2BG1A 2JKFA 1TEMA 4KG5A 1ZTUA 3IH9A 2FFFB 3O86A 4LGWA 4IHQA 3QNCA 1QMFA 2HDRA 2B18A 4UQIS 2Y2JA 4Y0UA 1BYWA 2HZ5A 5M19A 3T4LA 5TR7A 1UGUA 3C38A 4QY6A 1K57C 4BWIA 1YLJA 1BT5A 3PBQA 5CEDA 4NEED 3T4QA 4WEJA 2KX6A 3GMWA 4IBRA 4NXGA 2P9VB 1JTDA 1ACFA 1OTBA 3CUEA 4X55A 2ZC5B 1GCEA 3HJKA 1HTZA 3SZTA 4HY8A 3P7NA 5TGFA 3VMAA 3G2YA 3VSKA 4JF5A 2I9VA 3ZG9B 2K31A 2W27A 4YWZA 4CLCE 5FASA 3IXGA 3E2LA 5I5LA 5L07A 1LL8A 1SDNA 1EW0A 5F69A 3EEHA 1F5MA 1JWPA 3GV9A 3CG5A 1DJBA 3HUNA 1ZHHB 2HP5A 3DWKA 3JYIA 1K56D 2A24A 3D72A 3T1QB 1GHMA 4HI4A 1DP9A 3UE1A 1K4FA 1E3UA 2G2WA 1WYBA 2Z6DA 3IX3A 1BLCA 4H6JB 3ZGAB 4FH4A 4IUKA 3LYXA 3MKEA 3QNBA 1KE3A 3MZFA 2XROA 3IH8A 2OOLA 3FKWA 4G3KA 3VV4A 2Y2LA 4HJ6A 1T1BA 2Y91A 4GDBA 3UDFA 1DRMA 4RQ9A 3MF0A 4NXBA 2ACGA 3OCNA 4R3BA 3V67A 3FKVA 4IJGA 4I38A 4BENA 3GRJA 2OWHA 1YQSA 2W3DA 4H6JA 2KDKA 2XGNA 4S2NA 4JXVA 4JXSA 5HDCA 3VP2A 4BL3A 4E3JA 5IS1A 4UEYA 1GSXA 2EXAA 3IX8A 1P9WA 5J8XA 4ESPA 2PU4A 4WMCD 4MCWA 2Q9NA 5CGSA 1TS6A 4U0TA 1W63Q 2Q0OA 5EE8A 4EEPA 1L0DA 2PYPA 3T4JA 3TSGA 3D4FA 4N9LA 1IKGA 3FYZA 1HVBA 3LR3A 3FWLA 3BY9A 5FDHA 1NLYA 3T4TA 2IWDA 3SS3A 1H3QA 5M18A 4JXWA 2W0NA 1PFLA 1DJAA 4P0MA 5FA7A 4OH0A 5EVIC 4DXBA 1FSWA 5HWTA 5CERA 5KIZA 1JVJA 3A3FA 3OCLA 2ZC6B 1EI5A 2V0WA 1EWZA 3QP4A 3A3DA 4II7A 1TF1A 2Z6CA 3LIBA 2Y2KA 4P6ZS 4Q0JA 4JKTA 5G18A 1IYPA 1H0MA 2K2NA 4S2JA 1K56A 3UPPA 3DTKA 5FAQA 1K54A 5HAPA 3L9KA 5A90A 3MXSA 2PR5A 1LSWA 3F1PA 3UDXA 2V0UA 3ZG8B 4XUXA 3NY4A 1ALQA 2ZQAA 2XA7M 1LT0A 4QD4A 2KOIA 4BMWA 3IF6C 4WF0A 5IU1A 2J9OA 3NBLA 1NRFA 3VE3A 5F5YA 3Q7VA 2XF3A 2V9AA 4DMZA 4DDYA 5E2EA 1CEGA 2YKFA 1KGGA 1FSYA 3D9YA 2XFSA 3IS2A 2X02A 4R4RA 4Z1WA 1W8YA 2WKEA 4BD1A 3LEQA 4EQ1A 4O0PA 1OJ5A 1OT9A 3IXBA 4IBXA 2WGWA 2WKIA 4WMCA 4MMNA 4EBNA 1K4EA 2XH9A 2W1TB 1RCJA 3H82B 1MWTA 3G31A 3S7NA 1IFQA 3E4OA 4OQHA 4LV0A 1SDEA 1NYYA 5HL1A 2XEPA 2VV8A 4BBVA 4P6ZM 3CLOA 5GHYA 4HH3A 1K25A 2PR6A 3WRZA 1T18A 2JBFA 3AGFA 5TBMB 3JVUA 2W1RA 1NWZA 4YOFA 5CGWA 2HDQA 2W1TA 1Z6FA 3C8CA 1BZAA 3HVFA 5DVAA 5EM0A 4BBTA 5L2FA 4DE0A 1SKFA 2P08A 1IKIA 4MBHA 4Q0HA 1XPBA 1PZPA 3MQ0A 4HJ4A 3M2JA 3EGDC 1FIKA 3QP2A 3UB8A 1J9MA 3RJUA 5EECA 1ZG4A 3BW6A 4KQOA 2NUPC 1KOUA 1N4OA 4IVKA 2R78A 4QJGA 1XJ3A 2V1BA 4X68A 4PM7A 3BFFA 4AFIA 4E3NA 3H7WB 1OMEA 3LR4A 1DP6A 5HWVA 2WGVA 1GSWA 3ITBA 3V3SA 4LCMA 2X71A 3P09A 3P98A 1VEUB 3L7HA 1DP8A 3DW0A 2ZJ9A 3E2KA 1ZG6A 1TS0A 2B95A 4EEUA 3OOVA 4DE2A 4ID4A 4YINA 2Y2PA 4F94A 2GJ3A 3E0YA 5LBRA 2AVXA 3OZHA 5IT5A 1OPXA 3F1NB 3BFGA 5DFXA 2WYXA 1GA0A 1Q2PA 1YM1A 5HFOA 3NOTC 1O7EA 3MFXA 2MJ6A 1GSVA 3I7JA 4C6YA 1S4SA 5FI2A 4PKYA 1VQQA 3DAVA 5GLBA 5KMWA 2WGIA 3VFHA 4P85A 1SKOB 3QP6A 2XK1A 5HL6A 1ONHA 1CI9A 5HPIA 3IWQA 4KZ5A 1V9ZA 2EX2A 2ZL1B 3LI8A 3OBFA 4RA7A 3F1NA 1O07A 1LI0A 4HJ3A 4GZBA 5AJGA 2V1ZA 1IEMA 5J3WA 4R1GA 2V2FF 3PBSA 3UPNA 2PD7A 2Y2HA 3DWZA 3MXQA 5L8MA 3PBRA 1NXYA 1YMXA 3NOUC 3LIAA 4BBUA 3WWXA 4E6WA 4KUKA 2ZMVA 3NDGA 1L2SA 3BRMA 5HPFA 4CPKA 4GW9A 1K38A 4HBUA 5EFWA 1JTGA 3IXHA 1XA1A 4R0QA 5EVLA 1YMSA 4HHDA 4HIAA 2WAFA 1KGFA 2OAQ1 4Y2FA 4KZAA 3C4OA 4EBLA 1M6KA 5J7EA 4U3TA 1YT4A 4C75A 1IELA 4K0WA 4ZJ2A 3CZDA 4ME4A 3C30A 2VZWA 1KE4A 3MR0A 3O5YA 3K3DA 4G3WA 4KZ3A 4QPRA 1TS8A 4UA7A 4OQIA 4PHTA 5HAIA 5E43A 2EA9A 2L4RA 2I72A 4G3VA 3VOYA 3ZDJA 1XGIA 1K0KA 1FOFA 4DE1A 1CK3A 1PZOA 1BUEA 3ITAA 1LSVA 4LV3A 1ESIA 3HLDA 1UWPX 1L0GA 1AWIA 3HJIA 1PRQA 2ZM2A 2VKSA 3KYQA 4UA9A 4KZ6A 3D3OA 3S7PA 2O9AA 4FH2A 3OC2A 2A24B 4A5RA 5F6AA 1BLSA 3ZVTA 1HZOA 3BWLA 3S7OA 1SCWA 4JF4A 1FR6A 3F1OB 1C3BA 3HLFA 5AQ7A 5CTNA 1S1ZA 2JE5A 1PYYA 1YSQA 4JGPA 1MWUA 4EUZA 3HLBA 3BYDA 2EFUA 1LI9A 4EESA 3E98A 1K6SA 2V8FA 3LICA 2Y2OA 1G28A 3F1OA 3CJMA 4O8GA 1NZOA 1KVMA 4EWFA 1H5XA 4Y17A 1CEFA 2WADA 3S1YA 1XXMA 2VV7A 5CRFA 4OQGA 1K57A 2ZC4B 3PR6A 1MWRA 4R4SA 4MNRA 5CXWA 1XJ6A 1XX2A 1FCOA 3HLEA 1S6RA 4UQIM 2W3HA 5HD5A 2WKRA 3SH9A 3G32A 1WA9A 2JN7A 1XGJA 2V8CA 2INWA 4HQAA 4Q0IA 2O9BA 3UY6A 3Q07A 4OP5A 4N92A 3U4LP 3PYPA 3VP4A 3TJZC 5EVID 1ONGA 3FC7A 3DTMA 1IYSA 4KG2A 3B47A 1S67L 4P87A 3HUOA 2P74A 3FZCA 3OPPA 3WS4A 4K91A 5CX7A 2J8YA 5F1FA 3K3CA 1S66L 3UB5P 3N7WA 3OPRA 2XLNA 4D2OA 5JYPA 5F83A 1OTIA 4C3QA 3PBTA 4BQMA 3CWFA 3JPUA 3LR0A 2WKQA 3NULA 1YLWA 2PBYA 3BFCA 3KSIA 5EOOA 1KGEA 2XD5A 3LIEA 3G35A 4WELA 4X6TA 2JCHA 2XFTA 3BM6A 1ES4A 4ZTKA 1MC0A 4MEZA
chains in the Genus database with same CATH topology
4HH3A 2PR6A 1T18A 1YKDA 4WN5A 2XSSA 3BY8A 4EW7A 5TBMB 2ZOHA 3JVUA 2W1RA 4HOIA 1NWZA 1T1CA 4YOFA 2BASA 2W1TA 4ETXA 2ZMFA 4EUVA 3C8CA 5A8BA 2PT7A 5G4YA 4FOFA 4ARZA 5C5KA 4BBTA 3F1PB 4O01A 3R4KA 1D06A 5G4ZA 2P08A 3EQVA 2ZBBA 1NRJA 4Q0HA 1T19A 2IA2A 4R38A 1LSXA 4Y3IA 3MQ0A 4LRZE 3ULFA 3BQ8A 4HJ4A 3EGDC 2W3GA 3UB8A 2QWSA 3ZQ5A 4HP4A 5K5BA 1VHMA 1NLZA 2FH5A 3BW6A 4KQOA 4YNRA 5HWWA 2GZAA 2NUPC 1KOUA 3NOPC 4IUHA 3T4OA 4EU0A 2WKPA 2R78A 1IOUA 1XJ3A 3PXPA 1XFNA 2V1BA 2W3EA 3IS2B 2J3TC 2LB5A 3GDIA 1YAXA 2HGVA 3GECA 4AFIA 2JKTI 4WLAA 2HJEA 3A0SA 2OAP1 4GCZA 4R70A 4WL9A 3H7WB 2EWWA 3TE8A 4DJ2A 4FSFA 4LRXC 3U2AA 3EOIA 3LR4A 2QJ5A 1DP6A 5HWVA 1GSWA 4DN0A 4L9GA 3FPVA 1P0ZA 2JKRI 3CITA 4GHIB 1N9LA 3KYZA 1DP8A 1H8MA 5DKLA 2HF6A 1OTEA 2VX8A 4JGQA 1TS0A 3HCYA 4EEUA 2P04A 2J80A 3RTYA 3OOVA 1ZTUA 3EGXC 1OTDA 4IHQA 2B18A 1XJ4A 4UQIS 4Y5FA 3LIFA 1BYWA 2XRNA 3T4LA 2GJ3A 2V1AA 3E0YA 3KSHA 3LUQA 3PHYA 4EERA 2VGLM 5LBRA 2XA7S 1UGUA 3C38A 4GHIA 4BWIA 1OPXA 3F1NB 3IBRA 4I3AA 5IT5A 5DFXA 5DF9A 3PBQA 4NEED 1OTAA 3T4QA 3NOTC 4HNBA 4WEJA 3MFXA 2MJ6A 2KX6A 1GSVA 4ARZB 4NXGA 3ICYA 4WUJA 1S4SA 4PKYA 2VLGA 3NJAA 2J3TD 2M7UA 3T4KA 1OTBA 2VV6A 3OLOA 2JKTM 3CUEA 5HL6A 5HPIA 1MZUA 1OJGA 5DJUA 3HJKA 1V9ZA 2HV1A 4HY8A 3LI8A 3OBFA 3F1NA 3P7NA 3P01A 4MN5A 4HJ3A 4PAUA 4CLCC 5AJGA 2JKRM 2QJ7A 5J3WA 3PBSA 2I9VA 2PD7A 2K31A 3MXQA 2PYRA 2W27A 4YWZA 2GX5A 4XT2B 5L8MA 4CLCE 3IBJA 5I5LA 1LL8A 3PBRA 1EW0A 5F69A 3EEHA 4I3IA 1F5MA 3NOUC 3UMEA 3LIAA 4BBUA 2B02A 5KSHA 3SW1A 4GLQA 1ZHHB 4WEKA 4B93A 4KUKA 2ZMVA 1V9YA 2A24A 3D72A 5DKKA 5HPFA 3FPWA 4HI4A 4GW9A 1DP9A 2CMNA 2O0YA 2FZ0A 4OOLA 5EFWA 1Y28A 1ODVA 4XT2A 2Y8HA 3B42A 1D7EA 3MMHA 3PBOA 4HHDA 4JGRA 4HIAA 2Z6DA 1TS7A 4H6JB 4NXFA 4IUKA 3LYXA 3E4QA 3DBAA 2OAQ1 3EWKA 3T4SA 4Y2FA 3EQUA 3UMDA 3W2ZA 3K2NA 2XROA 2OOLA 4EETB 4G3KA 5J7EA 3VV4A 4HJ6A 3RH8B 1T1BA 3KX0X 2GNXA 1JNUA 1DRMA 1XFQA 4RQ9A 4LPZA 5FL3A 4ME4A 3MF0A 2J3WA 4MN6A 4NXBA 4CLCD 3C30A 2VZWA 5HZHA 1F98A 3MR0A 3LR5A 3O5YA 3OCNA 3K3DA 4G3WA 4I3JA 4QPRA 1TS8A 2G7UA 4IJGA 3V67A 4E04A 4I38A 4PHTA 2EA9A 3R7WB 2A2LA 2OWHA 4H6JA 2W3DA 5HDDA 2KDKA 2L4RA 5HDCA 4G3VA 2QYBA 5IS1A 3S7QA 2W3FA 3UB7A 3BJNA 4UEYA 1GSXA 4F3LB 1P9WA 4MCWA 3T50A 4GS9B 2L0WA 1TS6A 3RFBA 3A0VA 3PBNA 1LSVA 1W63Q 1VB6A 4EEPA 3FG8A 1UWPX 4ETZA 3R7WA 3HJIA 2PYPA 2VKSA 4L0LA 3T4JA 4R6LA 2M1CA 3KYQA 4OOMA 3D3OA 4NKPA 3CAXA 3S7PA 2O9AA 3LR3A 1STZA 1XJ2A 3G6OA 3BY9A 4F3LA 5AVEA 3MJQA 1NLYA 3OC2A 4EXOA 2A24B 3T4TA 5F6AA 3BWLA 3A0RA 4GS9A 1P9RA 3S7OA 3H9WA 2Y79A 1S4RA 3F1OB 1H3QA 2W0NA 5AVFA 3VOLA 3KSGA 2QHKA 1S1ZA 1N9NA 5HWTA 5KIZA 1YSQA 4JGPA 5TJJA 3MQQA 3OCLA 4K08A 3EEAA 2O9CA 3UB9A 2V0WA 2PD8A 4II7A 3B33A 1TF1A 3H82A 2Z6CA 3CI6A 5DFYA 2VA0A 4EESA 1G6OA 3LIBA 3E98A 2M7VA 3KO6A 3VE4A 3LICA 4P6ZS 1G28A 4Q0JA 3F1OA 2K2NA 4O8GA 4DJ3A 2NUTC 4R3AA 5HDSA 2ZOIA 2L1MA 2VV7A 3BQAA 1X0OA 3PR6A 3ZYTA 1S1YA 5TBMA 1T1AA 4CLCB 2P7JA 1XJ6A 4MN7A 1OT6A 4NXEA 3E4PA 2D01A 2YKHA 2PR5A 3MQOA 4UQIM 3CUEC 3UB6A 1LSWA 2W3HA 4LLOB 2WKRA 5DJTA 5HD5A 2LB9A 2D02A 3F1PA 4JGOA 2VEAA 2V0UA 1WA9A 2JN7A 4HP9A 2OWJA 4PKYG 2H28A 5HSQA 2INWA 3C2WA 4HQAA 2XA7M 1LT0A 4Q0IA 3LI9A 2O9BA 2KOIA 3LIDA 4BMWA 4WF0A 5IU1A 2K7SA 3PYPA 3TJZC 3VE3A 5F5YA 4I5SA 3TRCA 2PHYA 4CQHA 2V9AA 4DMZA 4CLCA 3FC7A 1YSPA 1P97A 2YKFA 3B47A 4MDZA 1S67L 4I39A 2O99A 1F9IA 4ZRRA 3IS2A 1MKMA 4Z1WA 5CX7A 1TD5A 3TW8A 4GJ4A 4LRYC 3H7WA 1UWNX 4O0PA 4EQ1A 3NHQA 1W63M 2QKPA 5MC7A 3K3CA 1S66L 2VJWA 1OJ5A 1OT9A 4KUOA 4BJPA 3LFVA 4M4XA 4MMNA 2DMWA 5HD3A 1OTIA 5F68A 3PBTA 2JHEA 3CWFA 2W1TB 3LR0A 2WKQA 2PDRA 4HH2A 3H82B 2KLIA 3KSIA 3S7NA 1IFQA 2EWVA 3LIEA 3E4OA 4B9OA 4WELA 4L9FA 3UE6A 2VGLS 1N9OA 2HJ9C 2VV8A 4KQDA 3UE3A 3KSFA 3JVVA 4L9EA 4BBVA 5J4EA 4P6ZM 1MC0A 3CLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HH3 A;  2PR6 A;  1T18 A;  4WN5 A;  3BY8 A;  4EW7 A;  5TBM B;  2ZOH A;  4HOI A;  1NWZ A;  1T1C A;  2BAS A;  5A8B A;  3C8C A;  5G4Y A;  4BBT A;  3F1P B;  1D06 A;  5G4Z A;  2ZBB A;  1T19 A;  4R38 A;  1LSX A;  4LRZ E;  3ULF A;  4HJ4 A;  3UB8 A;  2QWS A;  3ZQ5 A;  4HP4 A;  5HWW A;  1KOU A;  3NOP C;  2WKP A;  2R78 A;  1XJ3 A;  1XFN A;  2V1B A;  3IS2 B;  3GDI A;  3GEC A;  4WLA A;  3A0S A;  4GCZ A;  4R70 A;  4WL9 A;  3H7W B;  4DJ2 A;  4LRX C;  2QJ5 A;  1DP6 A;  5HWV A;  1GSW A;  4L9G A;  1P0Z A;  4GHI B;  1N9L A;  1DP8 A;  5DKL A;  1OTE A;  4JGQ A;  1TS0 A;  4EEU A;  2J80 A;  3RTY A;  1OTD A;  1XJ4 A;  3LIF A;  1BYW A;  2GJ3 A;  2V1A A;  3LUQ A;  3PHY A;  4EER A;  1UGU A;  4GHI A;  3F1N B;  3IBR A;  4I3A A;  1OTA A;  3NOT C;  4HNB A;  3MFX A;  2KX6 A;  1GSV A;  4NXG A;  3ICY A;  4WUJ A;  1S4S A;  4PKY A;  2VLG A;  3NJA A;  1OTB A;  2VV6 A;  3OLO A;  1MZU A;  1OJG A;  5DJU A;  3HJK A;  1V9Z A;  2HV1 A;  4HY8 A;  3LI8 A;  3F1N A;  3P7N A;  4MN5 A;  4HJ3 A;  2QJ7 A;  5J3W A;  2I9V A;  2PD7 A;  3MXQ A;  2PYR A;  2W27 A;  4YWZ A;  4XT2 B;  5I5L A;  1LL8 A;  1EW0 A;  5F69 A;  3EEH A;  4I3I A;  3NOU C;  3UME A;  3LIA A;  4BBU A;  2B02 A;  3SW1 A;  4KUK A;  1V9Y A;  2A24 A;  3D72 A;  5DKK A;  4HI4 A;  4GW9 A;  1DP9 A;  2CMN A;  5EFW A;  1Y28 A;  1ODV A;  4XT2 A;  1D7E A;  4HHD A;  4JGR A;  4HIA A;  2Z6D A;  1TS7 A;  4H6J B;  4NXF A;  3LYX A;  3E4Q A;  3EWK A;  3UMD A;  2OOL A;  4EET B;  5J7E A;  4HJ6 A;  3RH8 B;  1T1B A;  3KX0 X;  1JNU A;  1DRM A;  1XFQ A;  4RQ9 A;  4LPZ A;  4MN6 A;  4NXB A;  5HZH A;  1F98 A;  3MR0 A;  3K3D A;  4I3J A;  1TS8 A;  4E04 A;  4I38 A;  2EA9 A;  2OWH A;  4H6J A;  5HDD A;  2KDK A;  2L4R A;  5HDC A;  5IS1 A;  3UB7 A;  1GSX A;  4F3L B;  3T50 A;  4GS9 B;  2L0W A;  1TS6 A;  3A0V A;  1LSV A;  1VB6 A;  4EEP A;  3FG8 A;  1UWP X;  3HJI A;  2PYP A;  4R6L A;  2M1C A;  3CAX A;  1XJ2 A;  3G6O A;  3BY9 A;  4F3L A;  5AVE A;  3MJQ A;  4EXO A;  2A24 B;  5F6A A;  3BWL A;  3A0R A;  4GS9 A;  3H9W A;  1S4R A;  3F1O B;  2W0N A;  5AVF A;  3VOL A;  2QHK A;  1S1Z A;  1N9N A;  5HWT A;  5KIZ A;  4JGP A;  3MQQ A;  4K08 A;  3UB9 A;  2V0W A;  2PD8 A;  3B33 A;  3H82 A;  2Z6C A;  4EES A;  3LIB A;  3VE4 A;  3LIC A;  1G28 A;  3F1O A;  4DJ3 A;  4R3A A;  5HDS A;  2ZOI A;  2L1M A;  2VV7 A;  1X0O A;  1S1Y A;  5TBM A;  1T1A A;  2P7J A;  1XJ6 A;  1OT6 A;  4NXE A;  3E4P A;  2D01 A;  2YKH A;  2PR5 A;  3MQO A;  3UB6 A;  1LSW A;  4LLO B;  5DJT A;  2WKR A;  5HD5 A;  2D02 A;  3F1P A;  4JGO A;  2VEA A;  2V0U A;  1WA9 A;  2JN7 A;  4HP9 A;  2OWJ A;  4PKY G;  2H28 A;  5HSQ A;  2INW A;  3C2W A;  4HQA A;  1LT0 A;  3LI9 A;  3LID A;  4WF0 A;  5IU1 A;  2K7S A;  3PYP A;  3VE3 A;  5F5Y A;  4I5S A;  2PHY A;  2V9A A;  3FC7 A;  1P97 A;  2YKF A;  1S67 L;  4I39 A;  1F9I A;  3IS2 A;  4LRY C;  3H7W A;  1UWN X;  4EQ1 A;  3NHQ A;  2QKP A;  3K3C A;  1S66 L;  1OJ5 A;  1OT9 A;  4KUO A;  4M4X A;  5HD3 A;  1OTI A;  5F68 A;  2JHE A;  3CWF A;  2WKQ A;  2PDR A;  4HH2 A;  3H82 B;  3LIE A;  3E4O A;  4B9O A;  4L9F A;  3UE6 A;  1N9O A;  2VV8 A;  4KQD A;  4L9E A;  5J4E A;  4BBV A;  3CLO A; 
#chains in the Genus database with same CATH topology
 1BLH A;  3BY8 A;  2E8I A;  1W79 A;  1BLP A;  1LLB A;  2BAS A;  2E8J A;  1FCM A;  4KZ8 A;  5G4Y A;  4FOF A;  2VGJ A;  3LEZ A;  4ARZ A;  4WZ4 A;  3F1P B;  2Y55 A;  5L10 A;  2QMI A;  3PAE A;  4RX3 A;  4X69 A;  1ZC2 A;  1NZU A;  2HP6 A;  3EQV A;  4KZ7 A;  5G4Z A;  1L0E A;  1NYM A;  1T19 A;  3CPT B;  3C7U A;  4R3J A;  3ULF A;  1RGZ A;  1JWZ A;  4E3O A;  3AGE A;  3Q7V B;  3ZQ5 A;  4HP4 A;  4E6X A;  3ISG A;  5K5B A;  2GDN A;  1NLZ A;  5FI6 A;  3T1S A;  4IUH A;  3T4O A;  2WKP A;  1XFN A;  2W3E A;  2Y2Q A;  3TOI A;  5IHV A;  4Y13 A;  3IS2 B;  5EVI B;  2J3T C;  3GEC A;  1ES5 A;  2EX6 A;  3T1X A;  4WLA A;  1MWS A;  4EV4 A;  3A0S A;  2DCF A;  5AQA A;  4JXG A;  4D60 A;  2C5W B;  3BFD A;  2PU2 A;  3CPT A;  1FR1 A;  5HAQ A;  4FSF A;  4LRX C;  5BOH A;  4Y15 A;  4B88 A;  4UAA A;  2QJ5 A;  4DN0 A;  4HEF A;  4L9G A;  5AQ9 A;  2WGW B;  3VFF A;  1P0Z A;  3CIT A;  3UNW A;  4S2P A;  5DKL A;  2HF6 A;  2WZX A;  1OTE A;  3HCY A;  2P04 A;  2HDU A;  4OOY A;  2DNS A;  2J80 A;  5EVI A;  2ZD8 A;  1K55 C;  2ZM0 A;  3LCE A;  1OTD A;  4PM9 A;  4MBK A;  1M40 A;  3IXD A;  1XJ4 A;  3LIF A;  3ZG5 A;  1WE4 A;  2WAE A;  2XRN A;  1G5U A;  4FCF A;  2Z2L B;  5CTM A;  3PHY A;  3QP1 A;  3IX4 A;  4I3A A;  1AXB A;  5DF9 A;  1VM1 A;  3IT9 A;  1OTA A;  4KEN B;  3IF6 B;  4RX2 A;  1CQA A;  3T1R A;  1MY8 A;  1VET B;  4OPQ A;  2VLG A;  4BL2 A;  3NJA A;  2ZQ9 A;  3ZNY A;  2M7U A;  2VV6 A;  1MZU A;  3W8K A;  1OJG A;  5EM1 A;  5DJU A;  5DTS A;  3UPO A;  2WK0 A;  1L3L A;  1MKI A;  4MN5 A;  4PAU A;  3CHW P;  3VP1 A;  4CLC C;  2JKR M;  3IF6 A;  4WBG A;  3VP0 A;  5JYO A;  4OON A;  1VET A;  2PYR A;  2GX5 A;  4RVA A;  5FQQ A;  3IHB A;  4FUW A;  1ES2 A;  1N9B A;  4GKU A;  5FQI A;  1QME A;  5FAT A;  5U47 A;  4JF6 A;  4LV2 A;  5DKK A;  3FPW A;  3QP8 A;  1CJF A;  3V5M A;  5KSC A;  2CMN A;  2O0Y A;  4GD8 A;  3RXW A;  4OOL A;  1Y28 A;  3UO9 A;  1ODV A;  2Y8H A;  1D7E A;  1ERQ A;  3PBO A;  1FCN A;  5L09 A;  4MBF A;  4BLM A;  3ZFZ A;  4LFU A;  1CF0 A;  3E4Q A;  3IWI A;  3DBA A;  5EUA A;  3T4S A;  3EWK A;  4DDS A;  3UMD A;  3EQU A;  4U0X A;  2ZLY A;  5CEC A;  4E3K A;  2GNX A;  3NCK A;  4LPZ A;  1XP4 A;  4MN6 A;  2J3W A;  5HZH A;  3LR5 A;  4E04 A;  4Z9Q A;  3N6I A;  4Y0T A;  3R7W B;  4OP8 A;  1I2S A;  1IYO A;  1E25 A;  3NEC A;  4X53 A;  4IED A;  3S7Q A;  2ZQC A;  2W3F A;  2RCX A;  3V50 A;  2HPB A;  2Q9M A;  4QB8 A;  2Y2N A;  3T50 A;  4DE3 A;  2L0W A;  2H5S A;  1PIO A;  3A0V A;  3T12 B;  3PBN A;  4B4Z A;  5F1G A;  4S2K A;  3FG8 A;  3WS0 A;  4ETZ A;  4UA6 A;  3R7W A;  1CI8 A;  1GA9 A;  4R6L A;  1ERO A;  4OOM A;  3C4P A;  4E3I A;  1XJ2 A;  3G6O A;  2WUQ A;  3MJQ A;  1WYC A;  2IWC A;  2XR0 A;  4EXO A;  3A0R A;  1P9R A;  2Y79 A;  1S4R A;  4KZ9 A;  4E3L A;  3VOL A;  3KSG A;  2QHK A;  4N1H A;  5CHM A;  3WRT A;  1YLZ A;  5TJJ A;  1ERM A;  3EEA A;  1W5D A;  3UB9 A;  5CHJ A;  4EBP A;  3BLM A;  1YLT A;  3B33 A;  3CI6 A;  1MPL A;  1G6O A;  3V39 A;  4GDN A;  4DJ3 A;  1I2W A;  2NUT C;  4PM8 A;  2G2U A;  2ZOI A;  2L1M A;  4QWO A;  1MBL A;  4GN2 A;  3SS4 A;  4IVI A;  2QPN A;  1S1Y A;  3W4O A;  4PMA A;  4OLG A;  2P7J A;  2UWX A;  4MN7 A;  1OT6 A;  5FAP A;  4NXE A;  3E4P A;  2YKH A;  3CUE C;  4QY5 A;  4B4X A;  3BEB A;  3O3V A;  2D02 A;  1ESU A;  3GVB A;  4JGO A;  3AGD A;  3G30 A;  4P6B A;  4HP9 A;  4X1L A;  3IQA A;  2OWJ A;  3MBZ A;  4PKY G;  2CC1 A;  4N9K A;  3LID A;  2K7S A;  1YLY A;  4LEN A;  4I5S A;  1KE0 A;  4CQH A;  1DY6 A;  3ZNT A;  3BFE A;  1YSP A;  1P97 A;  2HDS A;  4HBT A;  4MDZ A;  3N8S A;  5GLD A;  3W4P A;  4BD0 A;  1G68 A;  1TD5 A;  3TW8 A;  4GJ4 A;  4LRY C;  1PWC A;  3ZHH A;  1W63 M;  5FDS A;  2QKP A;  3KYE A;  5EOE A;  1D1J A;  1GHI A;  2VJW A;  3WS2 A;  4O7D A;  3MS6 A;  4JBF A;  3LFV A;  1YLP A;  2EX9 A;  5FQJ A;  3M6H A;  4M4X A;  5HD3 A;  2WZZ A;  3HL9 A;  2V20 A;  5F68 A;  3DTE A;  2JHE A;  3SOI A;  2PDR A;  5FEG A;  2EX8 A;  2EWV A;  2VGL S;  2HJ9 C;  4KQD A;  5J4E A;  3JVV A;  2A49 A;  5FQM A;  4WN5 A;  1F2K A;  1Z09 A;  3MZD A;  1T1C A;  1LHY A;  4S2N C;  4ETX A;  1G6A A;  5A8B A;  4ZBE A;  2ZQ8 A;  2Y2M A;  4O01 A;  2P9V A;  1LL5 A;  2ZBB A;  1NRJ A;  2IA2 A;  4GD6 A;  5DF8 A;  1J3W A;  2VK3 A;  5E2H A;  3BQ8 A;  1ZKJ A;  4X56 A;  3N4I A;  2H0T A;  3S22 A;  1PI4 A;  1KVL A;  2W3G A;  2QWS A;  3A3I A;  1VHM A;  2FH5 A;  4YNR A;  2GZA A;  1ES3 A;  2HP9 A;  4KZ4 A;  4EU0 A;  3MZE A;  1IOU A;  3PXP A;  4NG2 A;  2H0Y A;  4QHC A;  2HGV A;  2HJE A;  2ZMA A;  3O88 A;  1BSG A;  4R70 A;  3TG9 A;  1LL9 A;  1PWG A;  3TE8 A;  4DJ2 A;  5DTT A;  4KQR A;  2C6W B;  2JKR I;  1FQG A;  4X1M A;  4GHI B;  3VP3 A;  3KYZ A;  1H8M A;  1XA7 A;  2Z2M B;  2OLU A;  2VX8 A;  1A0K A;  3GSG A;  3CMZ A;  4RYE A;  4PM6 A;  3RTY A;  3Q7Z A;  4ZJ3 A;  4HES A;  3EGX C;  5FEF A;  1Y54 A;  1W7F A;  4Y5F A;  2X01 A;  2V1A A;  3KSH A;  3LUQ A;  4EER A;  2VGL M;  3OPH A;  2EXB A;  3QP5 A;  2XA7 S;  4GHI A;  3IBR A;  4MLL A;  2ZQ7 A;  2H10 A;  4LV1 A;  3C7V A;  3V3R A;  4YFM A;  4HNB A;  1K54 C;  1L0F A;  4DRT A;  4ARZ B;  3ICY A;  4WUJ A;  4S2O A;  3B3X A;  2JKG A;  4WYY A;  2J3T D;  4PM5 A;  1PW8 A;  3G34 A;  5D3O A;  3T4K A;  5CEB A;  3S4X A;  3OLO A;  2JKT M;  3Q1F A;  2B5R A;  2UV0 E;  5EPH A;  4PPR A;  1W8Q A;  2HV1 A;  3QHY A;  3P01 A;  1MXO A;  3Q81 A;  1TDG A;  2QJ7 A;  3GQZ A;  3HLC A;  3G4P A;  1HLU P;  1IYQ A;  4XT2 B;  3IBJ A;  2A3U A;  2ZC7 A;  4I3I A;  2ZC3 B;  3UME A;  5FQ9 A;  2B02 A;  5KSH A;  3SW1 A;  4GLQ A;  1K6R A;  4WEK A;  4GOG A;  4B93 A;  3NDE A;  1V9Y A;  5A91 A;  5HAR A;  4S2L A;  3UN7 A;  1I5Q A;  3WS5 A;  5DF7 A;  4OPR A;  3FV7 A;  3LY4 A;  4S2I A;  4ZDX A;  2FZ0 A;  1SHV A;  4XT2 A;  3B42 A;  3MMH A;  4JGR A;  3LO7 A;  4K0X A;  1TS7 A;  4NXF A;  2PRF A;  3W2Z A;  3GR2 A;  3K2N A;  4QU3 A;  5F82 A;  4EET B;  2J9P A;  5FAO A;  3RH8 B;  3KX0 X;  1JNU A;  1XFQ A;  4LCL A;  1PW1 A;  3UDI A;  5FL3 A;  4CLC D;  1F98 A;  3NIA A;  4I3J A;  3LGO A;  5DTK A;  2G7U A;  2Y2G A;  2XQZ A;  2OSU A;  2WKH A;  2A2L A;  5HDD A;  4N1X A;  4X25 A;  4Q8I A;  2Y59 A;  4NK3 A;  5M1A A;  2QYB A;  1BTL A;  3UB7 A;  3BJN A;  4F3L B;  2ZQD A;  4DKI A;  3IWO A;  4ZAM A;  2R9W A;  4GS9 B;  1TVF A;  3RFB A;  4EQI A;  3C5A A;  5I94 A;  1VB6 A;  2QZ6 A;  3MXR A;  4XXR A;  4ZJ1 A;  4L0L A;  2M1C A;  2FFY A;  4CJN A;  4NKP A;  3CAX A;  3UE0 A;  3PAG A;  1STZ A;  3MFD A;  5FSR A;  4F3L A;  5AVE A;  1Q2Q A;  4OVD A;  4WZ5 C;  1XKZ A;  4GS9 A;  3H9W A;  5GL9 A;  5GHX A;  4E3M A;  5AQB A;  5AVF A;  3IF5 A;  5HW3 A;  2OLV A;  1N9N A;  3OPL A;  3MQQ A;  4FD8 A;  1RGY A;  4K08 A;  5FI7 A;  3SS5 A;  5E2G A;  2O9C A;  4JPM A;  4GNU A;  2PD8 A;  4Y7P A;  1K55 A;  3H82 A;  5A93 A;  5DFY A;  2VA0 A;  2M7V A;  3KO6 A;  3VE4 A;  3IHA A;  1S0W A;  3HBR A;  3W4Q A;  4R3A A;  5HDS A;  2RL3 A;  3HUM A;  3HLW A;  3BQA A;  2XD1 A;  1X0O A;  4OLD A;  4OPY A;  3ZYT A;  3VSL A;  1YPR A;  5TBM A;  1T1A A;  4CLC B;  1FIL A;  2D01 A;  3ZG7 B;  3MQO A;  3UB6 A;  5DJT A;  4LLO B;  1TDL A;  2LB9 A;  2VEA A;  2BLS A;  2J7V A;  2H28 A;  5HSQ A;  3C2W A;  4S2M A;  3SH7 A;  3LI9 A;  4UHU A;  1KDS A;  3HRE A;  3VOZ A;  1KDW A;  2JC7 A;  2XDM A;  4KG6 A;  4WZ5 A;  3TRC A;  2PHY A;  4CLC A;  2EFX A;  3BLS A;  3ZVW A;  1HD8 A;  4I39 A;  4Y0O A;  1SZV A;  2O99 A;  3O87 A;  4FTX A;  4XUZ A;  1F9I A;  4KQQ A;  4ZRR A;  3ZCZ A;  2DRW A;  4DF6 A;  1MKM A;  2VGK A;  5FQK A;  3H7W A;  1UWN X;  3NHQ A;  4DXC A;  1PNE A;  5MC7 A;  2IWB A;  1PI5 A;  4KUO A;  4BJP A;  3WS1 A;  5EVE A;  1H8Z A;  2DMW A;  1VEU A;  2PBD P;  3A3J A;  1DJC A;  1NJ4 A;  2Y4A A;  4HH2 A;  1GHP A;  3N8L A;  2KLI A;  5HX9 A;  4JLF A;  3GTC A;  1PWD A;  5EV0 A;  4WM9 A;  4B9O A;  1E4D A;  3NI9 A;  4L9F A;  3UE6 A;  3DTI A;  1N9O A;  1RP5 A;  3UE3 A;  3ZG0 A;  3KSF A;  4L9E A;  3MKF A;  5GLC A;  1H8Y A;  1YKD A;  3A3E A;  2XSS A;  4EW7 A;  1U60 A;  4H8R A;  3LY3 A;  3SH8 A;  2ZOH A;  4HOI A;  3HLG A;  4NET A;  2ZMF A;  4EUV A;  2PT7 A;  3M2K A;  5C5K A;  4OQ0 A;  3R4K A;  2ZM8 A;  1D06 A;  5E2F A;  4OKP A;  3NC8 A;  4R38 A;  3G2Z A;  1LSX A;  1BUL A;  2Y2I A;  1SKO A;  4Y3I A;  4LRZ E;  3PTE A;  2ZL1 A;  3M6B A;  3RXX A;  1E3U D;  5HWW A;  5TFQ A;  3MSH A;  4GB7 A;  2PAV P;  3NOP C;  4KZB A;  5CGX A;  1NY0 A;  2LB5 A;  5CHU A;  3GDI A;  1YAX A;  2JKT I;  4OPZ A;  3Q82 A;  5GLA A;  2OAP 1;  1JWV A;  4GCZ A;  4R23 A;  4WL9 A;  2BTF P;  2EWW A;  2R9X A;  3U2A A;  3EOI A;  5GHZ A;  3FPV A;  3N8R A;  1N9L A;  5A92 A;  4M3K A;  2OV5 A;  4JGQ A;  3BEC A;  1Y4O A;  5KZH A;  2BG1 A;  2JKF A;  1TEM A;  4KG5 A;  1ZTU A;  3IH9 A;  2FFF B;  3O86 A;  4LGW A;  4IHQ A;  3QNC A;  1QMF A;  2HDR A;  2B18 A;  4UQI S;  2Y2J A;  4Y0U A;  1BYW A;  2HZ5 A;  5M19 A;  3T4L A;  5TR7 A;  1UGU A;  3C38 A;  4QY6 A;  1K57 C;  4BWI A;  1YLJ A;  1BT5 A;  3PBQ A;  5CED A;  4NEE D;  3T4Q A;  4WEJ A;  2KX6 A;  3GMW A;  4IBR A;  4NXG A;  2P9V B;  1JTD A;  1ACF A;  1OTB A;  3CUE A;  4X55 A;  2ZC5 B;  1GCE A;  3HJK A;  1HTZ A;  3SZT A;  4HY8 A;  3P7N A;  5TGF A;  3VMA A;  3G2Y A;  3VSK A;  4JF5 A;  2I9V A;  3ZG9 B;  2K31 A;  2W27 A;  4YWZ A;  4CLC E;  5FAS A;  3IXG A;  3E2L A;  5I5L A;  5L07 A;  1LL8 A;  1SDN A;  1EW0 A;  5F69 A;  3EEH A;  1F5M A;  1JWP A;  3GV9 A;  3CG5 A;  1DJB A;  3HUN A;  1ZHH B;  2HP5 A;  3DWK A;  3JYI A;  1K56 D;  2A24 A;  3D72 A;  3T1Q B;  1GHM A;  4HI4 A;  1DP9 A;  3UE1 A;  1K4F A;  1E3U A;  2G2W A;  1WYB A;  2Z6D A;  3IX3 A;  1BLC A;  4H6J B;  3ZGA B;  4FH4 A;  4IUK A;  3LYX A;  3MKE A;  3QNB A;  1KE3 A;  3MZF A;  2XRO A;  3IH8 A;  2OOL A;  3FKW A;  4G3K A;  3VV4 A;  2Y2L A;  4HJ6 A;  1T1B A;  2Y91 A;  4GDB A;  3UDF A;  1DRM A;  4RQ9 A;  3MF0 A;  4NXB A;  2ACG A;  3OCN A;  4R3B A;  3V67 A;  3FKV A;  4IJG A;  4I38 A;  4BEN A;  3GRJ A;  2OWH A;  1YQS A;  2W3D A;  4H6J A;  2KDK A;  2XGN A;  4S2N A;  4JXV A;  4JXS A;  5HDC A;  3VP2 A;  4BL3 A;  4E3J A;  5IS1 A;  4UEY A;  1GSX A;  2EXA A;  3IX8 A;  1P9W A;  5J8X A;  4ESP A;  2PU4 A;  4WMC D;  4MCW A;  2Q9N A;  5CGS A;  1TS6 A;  4U0T A;  1W63 Q;  2Q0O A;  5EE8 A;  4EEP A;  1L0D A;  2PYP A;  3T4J A;  3TSG A;  3D4F A;  4N9L A;  1IKG A;  3FYZ A;  1HVB A;  3LR3 A;  3FWL A;  3BY9 A;  5FDH A;  1NLY A;  3T4T A;  2IWD A;  3SS3 A;  1H3Q A;  5M18 A;  4JXW A;  2W0N A;  1PFL A;  1DJA A;  4P0M A;  5FA7 A;  4OH0 A;  5EVI C;  4DXB A;  1FSW A;  5HWT A;  5CER A;  5KIZ A;  1JVJ A;  3A3F A;  3OCL A;  2ZC6 B;  1EI5 A;  2V0W A;  1EWZ A;  3QP4 A;  3A3D A;  4II7 A;  1TF1 A;  2Z6C A;  3LIB A;  2Y2K A;  4P6Z S;  4Q0J A;  4JKT A;  5G18 A;  1IYP A;  1H0M A;  2K2N A;  4S2J A;  1K56 A;  3UPP A;  3DTK A;  5FAQ A;  1K54 A;  5HAP A;  3L9K A;  5A90 A;  3MXS A;  2PR5 A;  1LSW A;  3F1P A;  3UDX A;  2V0U A;  3ZG8 B;  4XUX A;  3NY4 A;  1ALQ A;  2ZQA A;  2XA7 M;  1LT0 A;  4QD4 A;  2KOI A;  4BMW A;  3IF6 C;  4WF0 A;  5IU1 A;  2J9O A;  3NBL A;  1NRF A;  3VE3 A;  5F5Y A;  3Q7V A;  2XF3 A;  2V9A A;  4DMZ A;  4DDY A;  5E2E A;  1CEG A;  2YKF A;  1KGG A;  1FSY A;  3D9Y A;  2XFS A;  3IS2 A;  2X02 A;  4R4R A;  4Z1W A;  1W8Y A;  2WKE A;  4BD1 A;  3LEQ A;  4EQ1 A;  4O0P A;  1OJ5 A;  1OT9 A;  3IXB A;  4IBX A;  2WGW A;  2WKI A;  4WMC A;  4MMN A;  4EBN A;  1K4E A;  2XH9 A;  2W1T B;  1RCJ A;  3H82 B;  1MWT A;  3G31 A;  3S7N A;  1IFQ A;  3E4O A;  4OQH A;  4LV0 A;  1SDE A;  1NYY A;  5HL1 A;  2XEP A;  2VV8 A;  4BBV A;  4P6Z M;  3CLO A;  5GHY A;  4HH3 A;  1K25 A;  2PR6 A;  3WRZ A;  1T18 A;  2JBF A;  3AGF A;  5TBM B;  3JVU A;  2W1R A;  1NWZ A;  4YOF A;  5CGW A;  2HDQ A;  2W1T A;  1Z6F A;  3C8C A;  1BZA A;  3HVF A;  5DVA A;  5EM0 A;  4BBT A;  5L2F A;  4DE0 A;  1SKF A;  2P08 A;  1IKI A;  4MBH A;  4Q0H A;  1XPB A;  1PZP A;  3MQ0 A;  4HJ4 A;  3M2J A;  3EGD C;  1FIK A;  3QP2 A;  3UB8 A;  1J9M A;  3RJU A;  5EEC A;  1ZG4 A;  3BW6 A;  4KQO A;  2NUP C;  1KOU A;  1N4O A;  4IVK A;  2R78 A;  4QJG A;  1XJ3 A;  2V1B A;  4X68 A;  4PM7 A;  3BFF A;  4AFI A;  4E3N A;  3H7W B;  1OME A;  3LR4 A;  1DP6 A;  5HWV A;  2WGV A;  1GSW A;  3ITB A;  3V3S A;  4LCM A;  2X71 A;  3P09 A;  3P98 A;  1VEU B;  3L7H A;  1DP8 A;  3DW0 A;  2ZJ9 A;  3E2K A;  1ZG6 A;  1TS0 A;  2B95 A;  4EEU A;  3OOV A;  4DE2 A;  4ID4 A;  4YIN A;  2Y2P A;  4F94 A;  2GJ3 A;  3E0Y A;  5LBR A;  2AVX A;  3OZH A;  5IT5 A;  1OPX A;  3F1N B;  3BFG A;  5DFX A;  2WYX A;  1GA0 A;  1Q2P A;  1YM1 A;  5HFO A;  3NOT C;  1O7E A;  3MFX A;  2MJ6 A;  1GSV A;  3I7J A;  4C6Y A;  1S4S A;  5FI2 A;  4PKY A;  1VQQ A;  3DAV A;  5GLB A;  5KMW A;  2WGI A;  3VFH A;  4P85 A;  1SKO B;  3QP6 A;  2XK1 A;  5HL6 A;  1ONH A;  1CI9 A;  5HPI A;  3IWQ A;  4KZ5 A;  1V9Z A;  2EX2 A;  2ZL1 B;  3LI8 A;  3OBF A;  4RA7 A;  3F1N A;  1O07 A;  1LI0 A;  4HJ3 A;  4GZB A;  5AJG A;  2V1Z A;  1IEM A;  5J3W A;  4R1G A;  2V2F F;  3PBS A;  3UPN A;  2PD7 A;  2Y2H A;  3DWZ A;  3MXQ A;  5L8M A;  3PBR A;  1NXY A;  1YMX A;  3NOU C;  3LIA A;  4BBU A;  3WWX A;  4E6W A;  4KUK A;  2ZMV A;  3NDG A;  1L2S A;  3BRM A;  5HPF A;  4CPK A;  4GW9 A;  1K38 A;  4HBU A;  5EFW A;  1JTG A;  3IXH A;  1XA1 A;  4R0Q A;  5EVL A;  1YMS A;  4HHD A;  4HIA A;  2WAF A;  1KGF A;  2OAQ 1;  4Y2F A;  4KZA A;  3C4O A;  4EBL A;  1M6K A;  5J7E A;  4U3T A;  1YT4 A;  4C75 A;  1IEL A;  4K0W A;  4ZJ2 A;  3CZD A;  4ME4 A;  3C30 A;  2VZW A;  1KE4 A;  3MR0 A;  3O5Y A;  3K3D A;  4G3W A;  4KZ3 A;  4QPR A;  1TS8 A;  4UA7 A;  4OQI A;  4PHT A;  5HAI A;  5E43 A;  2EA9 A;  2L4R A;  2I72 A;  4G3V A;  3VOY A;  3ZDJ A;  1XGI A;  1K0K A;  1FOF A;  4DE1 A;  1CK3 A;  1PZO A;  1BUE A;  3ITA A;  1LSV A;  4LV3 A;  1ESI A;  3HLD A;  1UWP X;  1L0G A;  1AWI A;  3HJI A;  1PRQ A;  2ZM2 A;  2VKS A;  3KYQ A;  4UA9 A;  4KZ6 A;  3D3O A;  3S7P A;  2O9A A;  4FH2 A;  3OC2 A;  2A24 B;  4A5R A;  5F6A A;  1BLS A;  3ZVT A;  1HZO A;  3BWL A;  3S7O A;  1SCW A;  4JF4 A;  1FR6 A;  3F1O B;  1C3B A;  3HLF A;  5AQ7 A;  5CTN A;  1S1Z A;  2JE5 A;  1PYY A;  1YSQ A;  4JGP A;  1MWU A;  4EUZ A;  3HLB A;  3BYD A;  2EFU A;  1LI9 A;  4EES A;  3E98 A;  1K6S A;  2V8F A;  3LIC A;  2Y2O A;  1G28 A;  3F1O A;  3CJM A;  4O8G A;  1NZO A;  1KVM A;  4EWF A;  1H5X A;  4Y17 A;  1CEF A;  2WAD A;  3S1Y A;  1XXM A;  2VV7 A;  5CRF A;  4OQG A;  1K57 A;  2ZC4 B;  3PR6 A;  1MWR A;  4R4S A;  4MNR A;  5CXW A;  1XJ6 A;  1XX2 A;  1FCO A;  3HLE A;  1S6R A;  4UQI M;  2W3H A;  5HD5 A;  2WKR A;  3SH9 A;  3G32 A;  1WA9 A;  2JN7 A;  1XGJ A;  2V8C A;  2INW A;  4HQA A;  4Q0I A;  2O9B A;  3UY6 A;  3Q07 A;  4OP5 A;  4N92 A;  3U4L P;  3PYP A;  3VP4 A;  3TJZ C;  5EVI D;  1ONG A;  3FC7 A;  3DTM A;  1IYS A;  4KG2 A;  3B47 A;  1S67 L;  4P87 A;  3HUO A;  2P74 A;  3FZC A;  3OPP A;  3WS4 A;  4K91 A;  5CX7 A;  2J8Y A;  5F1F A;  3K3C A;  1S66 L;  3UB5 P;  3N7W A;  3OPR A;  2XLN A;  4D2O A;  5JYP A;  5F83 A;  1OTI A;  4C3Q A;  3PBT A;  4BQM A;  3CWF A;  3JPU A;  3LR0 A;  2WKQ A;  3NUL A;  1YLW A;  2PBY A;  3BFC A;  3KSI A;  5EOO A;  1KGE A;  2XD5 A;  3LIE A;  3G35 A;  4WEL A;  4X6T A;  2JCH A;  2XFT A;  3BM6 A;  1ES4 A;  4ZTK A;  1MC0 A;  4MEZ A; 
#chains in the Genus database with same CATH homology
 4HH3 A;  2PR6 A;  1T18 A;  1YKD A;  4WN5 A;  2XSS A;  3BY8 A;  4EW7 A;  5TBM B;  2ZOH A;  3JVU A;  2W1R A;  4HOI A;  1NWZ A;  1T1C A;  4YOF A;  2BAS A;  2W1T A;  4ETX A;  2ZMF A;  4EUV A;  3C8C A;  5A8B A;  2PT7 A;  5G4Y A;  4FOF A;  4ARZ A;  5C5K A;  4BBT A;  3F1P B;  4O01 A;  3R4K A;  1D06 A;  5G4Z A;  2P08 A;  3EQV A;  2ZBB A;  1NRJ A;  4Q0H A;  1T19 A;  2IA2 A;  4R38 A;  1LSX A;  4Y3I A;  3MQ0 A;  4LRZ E;  3ULF A;  3BQ8 A;  4HJ4 A;  3EGD C;  2W3G A;  3UB8 A;  2QWS A;  3ZQ5 A;  4HP4 A;  5K5B A;  1VHM A;  1NLZ A;  2FH5 A;  3BW6 A;  4KQO A;  4YNR A;  5HWW A;  2GZA A;  2NUP C;  1KOU A;  3NOP C;  4IUH A;  3T4O A;  4EU0 A;  2WKP A;  2R78 A;  1IOU A;  1XJ3 A;  3PXP A;  1XFN A;  2V1B A;  2W3E A;  3IS2 B;  2J3T C;  2LB5 A;  3GDI A;  1YAX A;  2HGV A;  3GEC A;  4AFI A;  2JKT I;  4WLA A;  2HJE A;  3A0S A;  2OAP 1;  4GCZ A;  4R70 A;  4WL9 A;  3H7W B;  2EWW A;  3TE8 A;  4DJ2 A;  4FSF A;  4LRX C;  3U2A A;  3EOI A;  3LR4 A;  2QJ5 A;  1DP6 A;  5HWV A;  1GSW A;  4DN0 A;  4L9G A;  3FPV A;  1P0Z A;  2JKR I;  3CIT A;  4GHI B;  1N9L A;  3KYZ A;  1DP8 A;  1H8M A;  5DKL A;  2HF6 A;  1OTE A;  2VX8 A;  4JGQ A;  1TS0 A;  3HCY A;  4EEU A;  2P04 A;  2J80 A;  3RTY A;  3OOV A;  1ZTU A;  3EGX C;  1OTD A;  4IHQ A;  2B18 A;  1XJ4 A;  4UQI S;  4Y5F A;  3LIF A;  1BYW A;  2XRN A;  3T4L A;  2GJ3 A;  2V1A A;  3E0Y A;  3KSH A;  3LUQ A;  3PHY A;  4EER A;  2VGL M;  5LBR A;  2XA7 S;  1UGU A;  3C38 A;  4GHI A;  4BWI A;  1OPX A;  3F1N B;  3IBR A;  4I3A A;  5IT5 A;  5DFX A;  5DF9 A;  3PBQ A;  4NEE D;  1OTA A;  3T4Q A;  3NOT C;  4HNB A;  4WEJ A;  3MFX A;  2MJ6 A;  2KX6 A;  1GSV A;  4ARZ B;  4NXG A;  3ICY A;  4WUJ A;  1S4S A;  4PKY A;  2VLG A;  3NJA A;  2J3T D;  2M7U A;  3T4K A;  1OTB A;  2VV6 A;  3OLO A;  2JKT M;  3CUE A;  5HL6 A;  5HPI A;  1MZU A;  1OJG A;  5DJU A;  3HJK A;  1V9Z A;  2HV1 A;  4HY8 A;  3LI8 A;  3OBF A;  3F1N A;  3P7N A;  3P01 A;  4MN5 A;  4HJ3 A;  4PAU A;  4CLC C;  5AJG A;  2JKR M;  2QJ7 A;  5J3W A;  3PBS A;  2I9V A;  2PD7 A;  2K31 A;  3MXQ A;  2PYR A;  2W27 A;  4YWZ A;  2GX5 A;  4XT2 B;  5L8M A;  4CLC E;  3IBJ A;  5I5L A;  1LL8 A;  3PBR A;  1EW0 A;  5F69 A;  3EEH A;  4I3I A;  1F5M A;  3NOU C;  3UME A;  3LIA A;  4BBU A;  2B02 A;  5KSH A;  3SW1 A;  4GLQ A;  1ZHH B;  4WEK A;  4B93 A;  4KUK A;  2ZMV A;  1V9Y A;  2A24 A;  3D72 A;  5DKK A;  5HPF A;  3FPW A;  4HI4 A;  4GW9 A;  1DP9 A;  2CMN A;  2O0Y A;  2FZ0 A;  4OOL A;  5EFW A;  1Y28 A;  1ODV A;  4XT2 A;  2Y8H A;  3B42 A;  1D7E A;  3MMH A;  3PBO A;  4HHD A;  4JGR A;  4HIA A;  2Z6D A;  1TS7 A;  4H6J B;  4NXF A;  4IUK A;  3LYX A;  3E4Q A;  3DBA A;  2OAQ 1;  3EWK A;  3T4S A;  4Y2F A;  3EQU A;  3UMD A;  3W2Z A;  3K2N A;  2XRO A;  2OOL A;  4EET B;  4G3K A;  5J7E A;  3VV4 A;  4HJ6 A;  3RH8 B;  1T1B A;  3KX0 X;  2GNX A;  1JNU A;  1DRM A;  1XFQ A;  4RQ9 A;  4LPZ A;  5FL3 A;  4ME4 A;  3MF0 A;  2J3W A;  4MN6 A;  4NXB A;  4CLC D;  3C30 A;  2VZW A;  5HZH A;  1F98 A;  3MR0 A;  3LR5 A;  3O5Y A;  3OCN A;  3K3D A;  4G3W A;  4I3J A;  4QPR A;  1TS8 A;  2G7U A;  4IJG A;  3V67 A;  4E04 A;  4I38 A;  4PHT A;  2EA9 A;  3R7W B;  2A2L A;  2OWH A;  4H6J A;  2W3D A;  5HDD A;  2KDK A;  2L4R A;  5HDC A;  4G3V A;  2QYB A;  5IS1 A;  3S7Q A;  2W3F A;  3UB7 A;  3BJN A;  4UEY A;  1GSX A;  4F3L B;  1P9W A;  4MCW A;  3T50 A;  4GS9 B;  2L0W A;  1TS6 A;  3RFB A;  3A0V A;  3PBN A;  1LSV A;  1W63 Q;  1VB6 A;  4EEP A;  3FG8 A;  1UWP X;  4ETZ A;  3R7W A;  3HJI A;  2PYP A;  2VKS A;  4L0L A;  3T4J A;  4R6L A;  2M1C A;  3KYQ A;  4OOM A;  3D3O A;  4NKP A;  3CAX A;  3S7P A;  2O9A A;  3LR3 A;  1STZ A;  1XJ2 A;  3G6O A;  3BY9 A;  4F3L A;  5AVE A;  3MJQ A;  1NLY A;  3OC2 A;  4EXO A;  2A24 B;  3T4T A;  5F6A A;  3BWL A;  3A0R A;  4GS9 A;  1P9R A;  3S7O A;  3H9W A;  2Y79 A;  1S4R A;  3F1O B;  1H3Q A;  2W0N A;  5AVF A;  3VOL A;  3KSG A;  2QHK A;  1S1Z A;  1N9N A;  5HWT A;  5KIZ A;  1YSQ A;  4JGP A;  5TJJ A;  3MQQ A;  3OCL A;  4K08 A;  3EEA A;  2O9C A;  3UB9 A;  2V0W A;  2PD8 A;  4II7 A;  3B33 A;  1TF1 A;  3H82 A;  2Z6C A;  3CI6 A;  5DFY A;  2VA0 A;  4EES A;  1G6O A;  3LIB A;  3E98 A;  2M7V A;  3KO6 A;  3VE4 A;  3LIC A;  4P6Z S;  1G28 A;  4Q0J A;  3F1O A;  2K2N A;  4O8G A;  4DJ3 A;  2NUT C;  4R3A A;  5HDS A;  2ZOI A;  2L1M A;  2VV7 A;  3BQA A;  1X0O A;  3PR6 A;  3ZYT A;  1S1Y A;  5TBM A;  1T1A A;  4CLC B;  2P7J A;  1XJ6 A;  4MN7 A;  1OT6 A;  4NXE A;  3E4P A;  2D01 A;  2YKH A;  2PR5 A;  3MQO A;  4UQI M;  3CUE C;  3UB6 A;  1LSW A;  2W3H A;  4LLO B;  2WKR A;  5DJT A;  5HD5 A;  2LB9 A;  2D02 A;  3F1P A;  4JGO A;  2VEA A;  2V0U A;  1WA9 A;  2JN7 A;  4HP9 A;  2OWJ A;  4PKY G;  2H28 A;  5HSQ A;  2INW A;  3C2W A;  4HQA A;  2XA7 M;  1LT0 A;  4Q0I A;  3LI9 A;  2O9B A;  2KOI A;  3LID A;  4BMW A;  4WF0 A;  5IU1 A;  2K7S A;  3PYP A;  3TJZ C;  3VE3 A;  5F5Y A;  4I5S A;  3TRC A;  2PHY A;  4CQH A;  2V9A A;  4DMZ A;  4CLC A;  3FC7 A;  1YSP A;  1P97 A;  2YKF A;  3B47 A;  4MDZ A;  1S67 L;  4I39 A;  2O99 A;  1F9I A;  4ZRR A;  3IS2 A;  1MKM A;  4Z1W A;  5CX7 A;  1TD5 A;  3TW8 A;  4GJ4 A;  4LRY C;  3H7W A;  1UWN X;  4O0P A;  4EQ1 A;  3NHQ A;  1W63 M;  2QKP A;  5MC7 A;  3K3C A;  1S66 L;  2VJW A;  1OJ5 A;  1OT9 A;  4KUO A;  4BJP A;  3LFV A;  4M4X A;  4MMN A;  2DMW A;  5HD3 A;  1OTI A;  5F68 A;  3PBT A;  2JHE A;  3CWF A;  2W1T B;  3LR0 A;  2WKQ A;  2PDR A;  4HH2 A;  3H82 B;  2KLI A;  3KSI A;  3S7N A;  1IFQ A;  2EWV A;  3LIE A;  3E4O A;  4B9O A;  4WEL A;  4L9F A;  3UE6 A;  2VGL S;  1N9O A;  2HJ9 C;  2VV8 A;  4KQD A;  3UE3 A;  3KSF A;  3JVV A;  4L9E A;  4BBV A;  5J4E A;  4P6Z M;  1MC0 A;  3CLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...