3FC7A

The crystal structure of a domain of htr-like protein from haloarcula marismortui atcc 43049
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
b'SDSPDGIVHLTTNGTILSVNPSMAGRLGADPDTLVGQQLSAVMDSEAANQRLEAGKSAVENGTATRSEDAVGGRHYHNQYIPVDSHRKSDTFQLVSRDIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HTR-like protein
molecule tags Transferase
source organism Haloarcula marismortui
publication title The crystal structure of a domain of HTR-like protein from Haloarcula marismortui ATCC 43049
rcsb
total genus 27
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3fc7A00
1KOUA 4PKYA 4BBTA 2J80A 3UMEA 4BBUA 5HSQA 1S4RA 1JNUA 1S1YA 2QJ5A 3NOTC 4HI4A 5F69A 4GS9B 4LRYC 3RH8B 4WUJA 1UWPX 4I3JA 2QHKA 4L9GA 5HWWA 2OWJA 5KIZA 1T1AA 1XJ6A 4L9EA 2CMNA 4LPZA 3UB8A 3A0SA 3UE6A 5DKKA 2JN7A 2JHEA 2H28A 2V0WA 3KX0X 1UWNX 2K7SA 3F1NA 1T18A 3HJKA 3P7NA 2GJ3A 3MQOA 2PHYA 3EWKA 1P97A 3LI8A 4LRXC 1T1CA 3F1NB 4L9FA 3OLOA 5I5LA 2M1CA 4I3IA 5HDSA 1GSXA 3F1PA 4R70A 3C2WA 3D72A 4HJ6A 2Z6CA 5HDCA 3F1OA 1D7EA 1UGUA 4MN6A 3NOUC 3E4PA 4KUOA 1LT0A 4HH3A 3RTYA 2VV8A 3ZQ5A 1OTAA 4WF0A 5HWVA 1X0OA 3IS2A 3PYPA 5TBMA 3UMDA 3A0VA 1GSWA 3H7WB 5A8BA 2PR6A 1WA9A 2WKRA 3H82A 4DJ3A 2VEAA 2YKFA 2KX6A 1N9NA 3LIBA 3K3DA 5HD5A 1OT6A 2EA9A 5HDDA 3H9WA 1XFNA 2WKPA 3T50A 1EW0A 5DJUA 4H6JA 3VE4A 4EEPA 3MR0A 5G4YA 3UB9A 3FG8A 3BY8A 2A24A 3UB7A 4BBVA 2VLGA 2ZOIA 2W0NA 3CAXA 2I9VA 4B9OA 3MXQA 1OTIA 1XJ4A 2V1BA 1D06A 1T19A 3VOLA 3VE3A 5G4ZA 2V1AA 1LSVA 3LI9A 3NOPC 4XT2B 2D01A 4EQ1A 4EXOA 1F98A 2WKQA 4XT2A 4YWZA 1OT9A 1TS7A 4HOIA 3PHYA 2B02A 1XJ3A 5HZHA 1TS6A 2OOLA 5J7EA 1LSWA 3NJAA 5HWTA 2PDRA 3LIFA 3BWLA 5DJTA 2D02A 1S67L 2QKPA 1F9IA 2L0WA 3A0RA 1MZUA 2Z6DA 4GS9A 4KUKA 2PYRA 5HD3A 4E04A 4F3LB 1S4SA 1VB6A 2P7JA 3MQQA 2BASA 4GCZA 4JGOA 3HJIA 4PKYG 5F6AA 1S66L 4F3LA 3LYXA 5DKLA 3GDIA 1DP8A 4LRZE 3E4OA 3LIDA 4HH2A 5IS1A 4WL9A 2PR5A 2ZOHA 3F1PB 3IBRA 4GHIB 2VV6A 3NHQA 2QWSA 3F1OB 3C8CA 3E4QA 1V9YA 1OTBA 2HV1A 4GHIA 1LL8A 2QJ7A 3MFXA 4JGRA 4K08A 5TBMB 5F5YA 3ICYA 4I38A 5F68A 3CLOA 4GW9A 1N9LA 1TS8A 4I39A 2V9AA 4JGQA 4WLAA 1TS0A 1V9ZA 2V0UA 4NXGA 3MJQA 4R6LA 1G28A 2L4RA 3H82B 1XJ2A 4HJ3A 5J4EA 3LUQA 2INWA 3IS2B 4R3AA 4WN5A 4NXBA 4EESA 3LICA 1DRMA 4JGPA 4I3AA 4HY8A 4NXEA 3ULFA 4EETB 1OTDA 2VV7A 1DP6A 4NXFA 4RQ9A 4EEUA 1XFQA 2KDKA 3EEHA 3BY9A 4MN5A 2A24B 3LIAA 1ODVA 1OJGA 2OWHA 1Y28A 2PYPA 3K3CA 2R78A 4HP4A 5EFWA 5AVFA 1LSXA 1S1ZA 2PD7A 4H6JB 4LLOB 3B33A 4HP9A 1T1BA 5IU1A 4HJ4A 4R38A 1DP9A 4HIAA 3G6OA 1P0ZA 5J3WA 3SW1A 4HQAA 3FC7A 5AVEA 4KQDA 2W27A 3CWFA 2PD8A 1GSVA 1NWZA 4HNBA 1N9OA 4EERA 4I5SA 4EW7A 2YKHA 1OTEA 3H7WA 1BYWA 2ZBBA 4M4XA 4HHDA 3UB6A 2L1MA 4DJ2A 3GECA 1OJ5A 3LIEA
chains in the Genus database with same CATH superfamily
4R1GA 4EBPA 3PAGA 5EVEA 5HAQA 4CPKA 2AVXA 1NXYA 3IH9A 3V3SA 2XH9A 5EOEA 3F1PA 2XD5A 3GRJA 4D2OA 1D7EA 3LR5A 2FFFB 4PM5A 1YLZA 1GA9A 1K38A 5A8BA 4PPRA 4UQIS 1W8QA 3BW6A 3T50A 3KSHA 3T1RA 4R0QA 4ESPA 5A93A 3WS2A 2HDQA 5FSRA 2ZL1B 2WZXA 2HP5A 2WKQA 3O3VA 1OT9A 4BQMA 3N8LA 4KZ3A 2UV0E 3B47A 5GHZA 4EU0A 3BECA 3MQQA 4C6YA 3BFCA 2Y2NA 3D4FA 4S2KA 3O5YA 4JPMA 2O0YA 1KDSA 4ZDXA 2PBDP 1YMXA 3P98A 4EEUA 4LV1A 3C38A 4R4RA 3HUNA 1KGEA 2Q9MA 3Q7VB 4UQIM 2PD8A 2A2LA 3TE8A 3LFVA 4HOIA 1FIKA 2J8YA 4EQIA 1S1YA 4KZ7A 3M6HA 3G34A 4WUJA 4I3JA 4C75A 3ZYTA 5AQ7A 3SH8A 4L9EA 4H8RA 3W8KA 1XP4A 1PWDA 3MBZA 3ZFZA 3N4IA 4Y15A 3F1NA 3EQVA 4P6ZM 4LV3A 2GNXA 3EGDC 4E3LA 5GLCA 3E4PA 1PW1A 1HLUP 5EOOA 1N4OA 2VGLS 4EBLA 2X71A 2XRNA 1MBLA 1OT6A 3H9WA 4WEKA 1K4FA 3BY8A 2VLGA 1K6RA 1E3UD 2V1BA 3VOLA 1S0WA 3FV7A 3PXPA 2ZQ7A 2QZ6A 4Q0HA 4XUZA 4ETZA 3NULA 4XT2B 5HPIA 3HLEA 3PBRA 2XA7M 4WELA 3P09A 3T4OA 3IXDA 4WZ4A 4FH4A 3CG5A 4F3LB 4N9KA 3O88A 1S66L 5DKLA 4DKIA 4KQOA 1C3BA 3WS4A 3C8CA 2HDSA 2DMWA 3DTKA 5DTKA 2DNSA 3MJQA 2L4RA 2ZC3B 3AGDA 5EPHA 3T4JA 4O8GA 3VSLA 5A90A 3DTMA 5KSCA 2EWWA 5IU1A 3MXRA 1OPXA 4IBRA 1BYWA 3V50A 4ARZA 3MS6A 2XGNA 4XXRA 4LENA 3CMZA 5DF7A 4MDZA 3N7WA 2QHKA 3W4OA 1LHYA 1K55A 1YSPA 4BENA 2K7SA 1T18A 3P7NA 5I5LA 4I3IA 3VE3A 3D72A 3CITA 3LR3A 1JTDA 2GDNA 3NOUC 4OLDA 2Z2LB 4KUOA 3MF0A 5EVIC 1ES5A 5FAOA 1X0OA 4QHCA 1PWGA 3K3DA 4P85A 2WKPA 3VE4A 5L2FA 3FG8A 2CC1A 1XJ4A 4O0PA 2KLIA 4WZ5A 3E2KA 5E2HA 3UNWA 3UPNA 5CHMA 1DJCA 1CQAA 3CUEC 4MNRA 4S2NC 1LSWA 4E3OA 3LGOA 5CTNA 3NJAA 1TDGA 2C6WB 1L0EA 3BWLA 3RXXA 1HZOA 4GS9A 1MWUA 1IOUA 2P7JA 1IKGA 3JVUA 3GDIA 3E4OA 5HARA 5MC7A 2QWSA 3E4QA 2VZWA 1FCNA 3C7UA 4QB8A 3ZNYA 5IT5A 4B4XA 1E3UA 1W63M 1G28A 3IS2B 1I2WA 4AFIA 2WAFA 4OLGA 1ACFA 4LCMA 2M7VA 3EEHA 1PIOA 2DRWA 1IYSA 4OPRA 1LL9A 1S1ZA 5AQ9A 4NK3A 5CGSA 2ZLYA 3IXGA 3SZTA 5AVEA 2VGKA 4FTXA 4JBFA 1VETA 2YKHA 1OTEA 3A3DA 3CPTB 3KSFA 2XROA 4QU3A 2J80A 3A3FA 2Y2OA 5EECA 3TJZC 4L9GA 4FSFA 3HLCA 1RGZA 4ZJ2A 2EX6A 2GJ3A 3FPVA 3VOYA 4DJ2A 4DE2A 2WGWB 3L7HA 4LGWA 1KGGA 1YT4A 3R7WA 2Y2HA 3T12B 2Y2GA 4RVAA 2ZD8A 5DFYA 1HVBA 5FI6A 3QP4A 3HLWA 1ESIA 1ZC2A 1MXOA 4FOFA 1PYYA 5A92A 3LR0A 4OQ0A 4R23A 4QPRA 3VP4A 5HWTA 1Y54A 3IX3A 2L0WA 4X68A 1SZVA 2O99A 2Z6DA 4BL2A 3NCKA 3BEBA 4JGOA 1U60A 1ES2A 2EWVA 5FDHA 3Q07A 3VP0A 2KOIA 1JTGA 4HH2A 1CF0A 4GHIB 3ICYA 4X56A 1MKIA 4GDBA 2Z2MB 3OPLA 1FCOA 4DMZA 1JWZA 4I3AA 4GLQA 4QD4A 3GQZA 3ULFA 1Y28A 3KYQA 4HP9A 4S2PA 3S1YA 4FUWA 2LB5A 4HQAA 4ID4A 4OOYA 4GZBA 4KZBA 1VEUB 4M4XA 4HHDA 1PNEA 2JKRM 1LLBA 1JNUA 5F69A 5EM1A 3SS3A 5CERA 4OQHA 4GN2A 3V39A 1P97A 1WE4A 5HSQA 2P08A 1I2SA 2Z6CA 2XFSA 1GHMA 5HWVA 3ZNTA 2ZQ8A 3A3IA 1PZOA 2M7UA 1L3LA 4ZJ1A 1H8MA 4LV2A 4WYYA 1Z6FA 2JC7A 4IBXA 3BRMA 5G4ZA 1M40A 3SS4A 4PM8A 1NYYA 4ZBEA 1W5DA 1PFLA 4N1HA 3JYIA 2JKTI 1E4DA 1VB6A 3LYXA 2HPBA 1W7FA 2XSSA 3BYDA 4DN0A 4U0TA 3MKFA 3KYZA 4L0LA 1TS0A 4MEZA 4PM7A 4WN5A 4X1LA 1IYPA 3ZG7B 4U0XA 4NXEA 2J9OA 1J9MA 4RQ9A 2OWHA 3SW1A 4GD6A 3HLGA 1G6AA 4HIAA 1H5XA 1QMFA 2EFXA 1ERMA 1ALQA 2WADA 1W8YA 4EW7A 4G3WA 2ZBBA 3LIEA 3AGFA 3QP8A 5FASA 2E8IA 3WS5A 3ISGA 3MSHA 5DTSA 1FSWA 3KYEA 2HJEA 2ZQDA 5EFWA 1KE4A 4HJ6A 4GKUA 4MN6A 2EXBA 4CJNA 2FH5A 3GMWA 2XFTA 1GSWA 1GA0A 1ZHHB 4YOFA 2Y2QA 2W3DA 1BZAA 1XA7A 1YPRA 4X53A 2QMIA 3HL9A 2JKGA 3MR0A 3E98A 4GNUA 5L8MA 5FDSA 5F1GA 2ZMFA 5EVLA 1VM1A 1F98A 1G6OA 5FEGA 5KSHA 3UDXA 5EUAA 1NJ4A 2V8CA 4E6WA 2B02A 3HUOA 3G2ZA 3GVBA 3OPHA 4Y0TA 5JYPA 2Y79A 1S4SA 3QP5A 5F6AA 3G35A 3G32A 3HUMA 3VFFA 4DE0A 5CEDA 1IELA 2W1TB 3IBRA 3T1SA 2QJ7A 4F94A 5F5YA 2IA2A 4KQRA 4N92A 3TSGA 3LICA 5F83A 5TFQA 1VQQA 3BJNA 4MMNA 5JYOA 3UB6A 1T1BA 2VKSA 4R38A 1ZG4A 2WGVA 4KENB 1NZOA 4UA9A 4DE1A 1IYOA 3S7OA 5GLBA 3VP1A 3HLDA 4X55A 1K56D 1JWVA 3NOTC 4GS9B 3FWLA 3CUEA 5FAPA 4PAUA 2IWCA 3OLOA 2HDRA 4R70A 1UGUA 3GSGA 2V8FA 3PBQA 3ZQ5A 1YLPA 4OONA 2OLVA 1EWZA 3JVVA 4EEPA 1ZTUA 3SS5A 4GOGA 5DVAA 4BBVA 2QPNA 2Y55A 2JKRI 2ZC4B 1D06A 4PHTA 5AQBA 1L0DA 1FR1A 2WYXA 1FCMA 2K31A 3E2LA 3A0RA 1ES3A 1YLYA 2W3HA 2A49A 5FQMA 3MKEA 1BTLA 4EWFA 1IYQA 2K2NA 4K08A 3BFFA 3WS1A 4I38A 5F68A 1PWCA 4QWOA 4UA6A 4OP8A 2INWA 1SCWA 3SH7A 4HY8A 4EETB 3LY3A 3BY9A 4CLCA 4Y17A 3GV9A 3K3CA 4DDSA 1LSXA 4BBTA 2HP9A 4BJPA 1DP9A 3IF5A 3CWFA 1TEMA 4E3MA 2XF3A 2MJ6A 1CK3A 1GCEA 5HL6A 4KZ6A 1S6RA 3DBAA 4KZAA 3MZDA 2BTFP 2FZ0A 3Q81A 1T1AA 2CMNA 4CLCD 2JN7A 4S2MA 2H28A 1UWNX 3PBNA 5D3OA 4EV4A 4WBGA 2WUQA 4ETXA 3PR6A 2W3FA 4WF0A 5M1AA 1RP5A 4YNRA 1WA9A 4IHQA 3IH8A 5FA7A 3UE0A 1K25A 1BLSA 4NKPA 1K57C 1EW0A 3UB7A 3VV4A 4OPZA 2VX8A 3MXQA 2IWBA 1TF1A 3C30A 4Y0UA 3VP2A 1YMSA 3OCLA 4YWZA 1WYBA 4KZ4A 4WMCA 1TS6A 5J7EA 3IWQA 5DJTA 3CZDA 4P6ZS 2P74A 3HJIA 4MLLA 2H0TA 4ZJ3A 4Q8IA 5GHXA 4KZ8A 4S2LA 2VV6A 1Q2QA 3IXBA 2XK1A 2J7VA 3IQAA 1N9LA 1V9ZA 2XLNA 3H82B 3EEAA 4PMAA 4Q0JA 2KDKA 5TJJA 3M2KA 1JVJA 5E43A 2PD7A 5KMWA 4II7A 1XKZA 3FC7A 5K5BA 2W27A 2W3EA 4HNBA 5A91A 3CPTA 4RA7A 3VP3A 4JLFA 4GJ4A 2X02A 1K57A 3EOIA 5KIZA 3GTCA 2PBYA 4EQ1A 3HJKA 1YLTA 1YKDA 4LRXC 3WRTA 1MY8A 2JCHA 3S7PA 3DAVA 2XD1A 4NETA 3UE1A 2VV8A 1ONGA 1YM1A 1MPLA 4DJ3A 4K0XA 2JE5A 2YKFA 3S7QA 1Q2PA 5G4YA 5FEFA 4MN7A 4OOMA 2ZOIA 2J3WA 4KG5A 5M19A 4B9OA 2JBFA 4G3KA 1T19A 2J3TD 3T4TA 2ZC5B 2H5SA 2ZL1A 3IX8A 2J9PA 1E25A 2P9VA 3OPPA 3HREA 1S67L 2XEPA 1LI0A 1SDEA 4DDYA 3GR2A 1TDLA 4Y5FA 5J8XA 1L2SA 2XA7S 3UB5P 5U47A 3BLMA 4JXGA 5FATA 2ZOHA 3BM6A 5GLAA 1OTBA 2HV1A 3DTIA 2EX2A 3LEZA 4JXSA 4NXGA 3JPUA 3ZG0A 4OQIA 5EVIB 1CEGA 3U2AA 5DTTA 3SH9A 1CEFA 4JGPA 3WS0A 4KG2A 3DWZA 4IVKA 1OTDA 4CLCB 5HAPA 5CHJA 5L07A 1Y4OA 1OJGA 1H0MA 4LLOB 2VGLM 3HCYA 5FQIA 3C4PA 1L0GA 1NWZA 4EERA 4N9LA 2VK3A 3A0VA 3H7WB 4EUZA 3W4QA 3OZHA 2QJ5A 4HI4A 4UHUA 5E2FA 5HWWA 4UEYA 3V5MA 1SKFA 2WZZA 5CECA 2V0WA 4A5RA 1IKIA 3C2WA 5HDCA 2PT7A 2XQZA 2Y91A 4HH3A 5DF8A 5CX7A 3ITAA 3HLFA 4DE3A 3IX4A 2ZMAA 3MZEA 1N9NA 1K6SA 2EA9A 3IHBA 2VA0A 1I5QA 2A24A 3ZVWA 2JKTM 2W0NA 2I9VA 3KSGA 1XXMA 3UE3A 4K0WA 2WKIA 1PRQA 2OOLA 3HLBA 5CEBA 3LIFA 5CXWA 3NECA 1N9BA 4F3LA 1BULA 3N8RA 4OVDA 3UPOA 4X25A 1V9YA 4JXVA 4JGQA 1TS8A 4MBKA 2V9AA 5FQKA 4WLAA 3VFHA 3M2JA 2O9BA 4Y7PA 4JXWA 5AJGA 4MBHA 1DP6A 1XFQA 3D3OA 4JF5A 2A24B 1F2KA 5E2EA 3B33A 1AXBA 3BFGA 3G6OA 3B3XA 3UDFA 4PM9A 1FILA 2L1MA 2QYBA 1KVMA 3ZGAB 4EUVA 1UWPX 2Y2LA 4ZAMA 1CI8A 3MZFA 1ESUA 2PHYA 4E6XA 4DXCA 1LT0A 1PZPA 3IS2A 4JF6A 3R7WB 2I72A 2PR6A 1RCJA 3VOZA 2ZQAA 5HD5A 5FQQA 5HDDA 3CI6A 1RGYA 2PU4A 1LL5A 4GDNA 3CAXA 2WKHA 2R9WA 5L10A 2E8JA 1DJAA 1NLYA 1OTIA 3LCEA 3PBSA 4QY6A 1KGFA 3LO7A 1DJBA 1KE0A 3NY4A 3R4KA 3G4PA 3DWKA 3OBFA 4KUKA 2C5WB 4BLMA 4DF6A 2BASA 1SDNA 2UWXA 2Y8HA 3OC2A 2PR5A 3TOIA 3F1OB 2W1TA 1G68A 3QNCA 4RX2A 3BFEA 5LBRA 5EVIA 2ZMVA 5C5KA 4FD8A 2GZAA 5IHVA 4IUKA 1MWSA 4NXFA 5E2GA 1YQSA 3QHYA 2Y2KA 3NC8A 1NRJA 2ACGA 1GSVA 4KZ5A 3PTEA 2Y4AA 2ZM0A 3KSIA 4CQHA 3H7WA 1ZG6A 4RX3A 3TG9A 3GECA 3NDEA 2NUPC 4PKYA 4BBUA 4OQGA 3RH8B 4N1XA 5DFXA 5BOHA 5EE8A 1BLPA 1AWIA 3UE6A 1H8ZA 4KZ9A 4M3KA 3LI8A 1NLZA 4L9FA 1NZUA 1KE3A 3RTYA 4Z1WA 4HBTA 2WKRA 5F1FA 1CI9A 3PBOA 1H8YA 3UO9A 1XFNA 3TRCA 4KG6A 2ZQ9A 2ZQCA 2ZC7A 3A3EA 3ZVTA 2ZJ9A 4OH0A 4Y2FA 4BD1A 3MMHA 3N8SA 1PI4A 4GB7A 4Y3IA 1XA1A 1FSYA 5L09A 2BG1A 3SOIA 4XT2A 1FOFA 3PHYA 1BLHA 3HBRA 4R4SA 4P0MA 2PDRA 2QKPA 1XGJA 3UN7A 3RFBA 4E04A 5HD3A 3K2NA 2PAVP 3OOVA 4C3QA 3LIDA 5IS1A 2B5RA 2B95A 3V3RA 3BLSA 4B88A 3O86A 3CLOA 2GX5A 4P87A 1FQGA 5FI2A 3EGXC 3T1XA 3WWXA 5AVFA 4HP4A 2G2UA 1A0KA 4E3IA 3P01A 3Q7VA 2J3TC 4BMWA 4X6TA 4E3NA 5CTMA 5HX9A 3MXSA 4UA7A 4Q0IA 1OJ5A 1HTZA 1KOUA 3IF6A 4WMCD 4ARZB 1S4RA 1TD5A 4Z9QA 4Y13A 4Y0OA 1PI5A 1TVFA 3A0SA 5DKKA 1ERQA 3MQOA 4OPQA 3F1NB 2WGWA 3AGEA 2WAEA 2Y2IA 4JKTA 5GL9A 3C7VA 4P6BA 4FCFA 4E3KA 1OTAA 4R3BA 3PYPA 3UMDA 2VEAA 3LEQA 3T4SA 3LIBA 1G5UA 1IEMA 2BLSA 4D60A 5EV0A 5F82A 3UB9A 5GLDA 2P04A 4JF4A 2ZC6B 1WYCA 2Q9NA 2LB9A 4CLCE 4NG2A 2JKFA 2V1AA 4IVIA 5FI7A 4EBNA 2VJWA 1LSVA 3NOPC 3FKVA 5CGXA 1TS7A 4OP5A 3WRZA 5I94A 5HZHA 2O9AA 3G30A 2O9CA 4OPYA 3G2YA 3Q82A 3C5AA 2PYRA 2NUTC 5HPFA 4GCZA 2DCFA 4LRZE 1MWTA 2Y2JA 1MKMA 3ZG8B 1LL8A 3OPRA 4JGRA 4OKPA 3IXHA 3VMAA 2V0UA 5HL1A 4R6LA 4UAAA 4R3AA 4NXBA 4GD8A 1DRMA 3A3JA 4S2JA 4DRTA 3CHWP 4MN5A 4EXOA 5FQJA 4BD0A 4H6JB 5FL3A 3RXWA 3IBJA 4CLCC 1CJFA 2HZ5A 5CGWA 3QP2A 4XUXA 3UMEA 1K56A 2ZM2A 4E3JA 1JWPA 1O07A 2EXAA 2EX8A 3Q7ZA 2R9XA 4RYEA 4FH2A 2HGVA 3KX0X 1SHVA 2Y59A 3EWKA 2EX9A 3F1OA 1EI5A 2XR0A 3DTEA 3H82A 1YAXA 2Y2PA 1Z09A 4WZ5C 5DJUA 4H6JA 1XGIA 3QNBA 3ZCZA 3EQUA 1ONHA 5HAIA 3UY6A 3TW8A 3LR4A 4S2OA 1VETB 3M6BA 4G3VA 2RCXA 2W1RA 1K54C 3QP6A 4X1MA 2IWDA 3V67A 1H3QA 2PRFA 3RJUA 1P9WA 1DP8A 3PBTA 3F1PB 3T4LA 4GHIA 3S4XA 3T1QB 2RL3A 4YINA 3KO6A 1NRFA 3T4KA 3E0YA 5DF9A 5J4EA 3LUQA 4IEDA 2Q0OA 3DW0A 5CRFA 1XX2A 2ZM8A 3MFDA 1BUEA 3NIAA 2VV7A 5HDSA 3FPWA 1LI9A 3S22A 1MC0A 5HFOA 2HDUA 4IUHA 2XDMA 4U3TA 2G2WA 2W3GA 3IF6C 4I5SA 2PU2A 2WKEA 4MCWA 2EFUA 4NEED 1W79A 1F5MA 2V1ZA 3IWIA 2OWJA 4LPZA 3UDIA 4ZRRA 3IHAA 1HD8A 2JHEA 1BSGA 3U4LP 4ZTKA 2V20A 4O7DA 1STZA 2WK0A 1BT5A 1L0FA 2KX6A 5HW3A 4HBUA 1DY6A 1YLWA 2HJ9C 3C4OA 3CJMA 1W63Q 3I7JA 2Y2MA 1ZKJA 4S2NA 5FQ9A 4OOLA 3BQAA 1XJ3A 4R3JA 1XPBA 2X01A 1F9IA 1IFQA 4HESA 5FAQA 2HF6A 3PAEA 1K0KA 1QMEA 3NBLA 4WL9A 5G18A 3NHQA 3IWOA 5TBMB 3MFXA 4BWIA 1ES4A 3S7NA 3HVFA 2OV5A 2VGJA 4I39A 3FKWA 4WM9A 1GHPA 1XJ2A 4HJ3A 3N6IA 3NDGA 5GHYA 2G7UA 4EESA 1PW8A 4MBFA 1KDWA 1YSQA 1KVLA 4HJ4A 1P0ZA 3Q1FA 4KQDA 4ME4A 1VEUA 4LFUA 1N9OA 2FFYA 1YLJA 5EM0A 2P9VB 1EROA 3FYZA 3G31A 1K4EA 1SKOA 4LRYC 1GHIA 1XJ6A 3UB8A 5EVID 3LY4A 3NI9A 1M6KA 4PM6A 2WGIA 3FZCA 5AQAA 3ZG5A 3D9YA 5TBMA 4QJGA 1T1CA 2M1CA 2OAP1 1GSXA 3MQ0A 3ZDJA 1D1JA 5CHUA 1K54A 2OAQ1 4LCLA 3OCNA 1VHMA 2B18A 2OLUA 4WEJA 3VSKA 3W2ZA 5TR7A 4S2IA 4DXBA 3ZG9B 3LI9A 1K55C 2D01A 5KZHA 3IF6B 4X69A 1SKOB 3O87A 2D02A 1NYMA 1MWRA 3UPPA 1MZUA 1O7EA 4BL3A 1NY0A 2H0YA 2V2FF 4PKYG 4B93A 3QP1A 3ZHHA 1FR6A 4KQQA 3IT9A 1BLCA 4GW9A 5TGFA 4IJGA 3BFDA 4LV0A 3BQ8A 3B42A 2A3UA 3L9KA 1J3WA 2H10A 2OSUA 3LIAA 1ODVA 2PYPA 1OMEA 2R78A 2HP6A 3ITBA 4YFMA 5J3WA 5M18A 3W4PA 4QY5A 1P9RA 4K91A 3T4QA 4B4ZA 4HEFA 4O01A
chains in the Genus database with same CATH topology
1KOUA 4GJ4A 2JKRM 4ARZB 1S4RA 1JNUA 1TD5A 5F69A 3EOIA 5KIZA 3A0SA 5DKKA 4EQ1A 3HJKA 3MQOA 1YKDA 4LRXC 1P97A 3F1NB 3S7PA 3F1PA 5HSQA 2P08A 2Z6CA 1D7EA 3LR5A 2VV8A 1OTAA 5HWVA 3PYPA 3UMDA 5A8BA 4DJ3A 2VEAA 2YKFA 4UQIS 2M7UA 3S7QA 3T4SA 3LIBA 1H8MA 3BW6A 3T50A 3KSHA 5G4YA 3UB9A 4MN7A 4OOMA 2P04A 2ZOIA 2J3WA 4B9OA 2LB9A 4CLCE 4G3KA 1T19A 5G4ZA 2J3TD 2V1AA 3T4TA 2VJWA 1LSVA 3NOPC 2WKQA 1OT9A 1TS7A 5HZHA 2O9AA 2O9CA 3B47A 1S67L 2JKTI 2PYRA 1VB6A 2NUTC 4EU0A 3MQQA 5HPFA 4GCZA 4Y5FA 2XA7S 3LYXA 4LRZE 2ZOHA 2XSSA 1MKMA 1OTBA 2HV1A 3O5YA 1LL8A 4DN0A 4JGRA 2O0YA 3KYZA 4L0LA 1TS0A 2V0UA 4NXGA 4R6LA 3U2AA 4R3AA 4WN5A 4NXBA 1DRMA 4JGPA 4NXEA 4CLCB 1OTDA 4RQ9A 4EEUA 4MN5A 2OWHA 1OJGA 3C38A 4EXOA 3SW1A 4LLOB 4H6JB 5FL3A 4HIAA 2VGLM 3HCYA 3IBJA 4UQIM 2PD8A 2A2LA 1NWZA 4CLCC 3TE8A 4EERA 4EW7A 3LFVA 4G3WA 2ZBBA 3A0VA 3H7WB 3LIEA 4HOIA 3UMEA 2QJ5A 1S1YA 4HI4A 5HWWA 4WUJA 4I3JA 4UEYA 3ZYTA 4L9EA 2HGVA 2V0WA 3KX0X 2HJEA 3F1NA 3EQVA 5EFWA 4P6ZM 3EWKA 2GNXA 3EGDC 5HDCA 3C2WA 4HJ6A 2PT7A 3F1OA 4MN6A 3E4PA 2FH5A 4HH3A 2VGLS 5CX7A 1GSWA 1ZHHB 3H82A 4YOFA 2XRNA 2W3DA 1YAXA 1N9NA 1OT6A 2EA9A 2VA0A 3H9WA 4WEKA 5DJUA 4H6JA 3MR0A 3BY8A 2A24A 3E98A 3EQUA 2VLGA 2JKTM 2W0NA 5L8MA 2I9VA 3TW8A 3KSGA 2V1BA 3LR4A 2ZMFA 3VOLA 3PXPA 3UE3A 4Q0HA 5HPIA 4ETZA 4XT2B 1F98A 1G6OA 4G3VA 5KSHA 3PBRA 2B02A 2W1RA 2XA7M 4WELA 2OOLA 3T4OA 3LIFA 2Y79A 4F3LB 1S4SA 3V67A 5F6AA 1H3QA 4F3LA 1S66L 5DKLA 1P9WA 1DP8A 3PBTA 4KQOA 3F1PB 2W1TB 3IBRA 3C8CA 3T4LA 1V9YA 2DMWA 4GHIA 2QJ7A 3KO6A 5F5YA 4JGQA 1TS8A 3T4KA 2V9AA 4WLAA 3E0YA 2IA2A 3MJQA 2O9BA 2L4RA 5DF9A 5J4EA 3LUQA 3LICA 5AJGA 2VV7A 3T4JA 1DP6A 3BJNA 4MMNA 1XFQA 3D3OA 4O8GA 2A24B 5HDSA 3FPWA 3UB6A 2EWWA 3B33A 5IU1A 1MC0A 1T1BA 2VKSA 4R38A 3G6OA 4IUHA 1OPXA 3S7OA 2W3GA 4I5SA 1BYWA 2L1MA 4MCWA 4ARZA 2QYBA 4NEED 1F5MA 3NOTC 4MDZA 4EUVA 4GS9B 1UWPX 2QHKA 2OWJA 4LPZA 3CUEA 4PAUA 4ZRRA 1YSPA 2JHEA 2K7SA 1T18A 3P7NA 2PHYA 5I5LA 3OLOA 4I3IA 3VE3A 4R70A 3D72A 3CITA 3LR3A 1UGUA 3NOUC 4KUOA 1LT0A 3MF0A 3ZQ5A 3PBQA 1X0OA 3IS2A 1STZA 3R7WB 2PR6A 2KX6A 3K3DA 5HD5A 5HDDA 3JVVA 3CI6A 2HJ9C 2WKPA 4EEPA 1ZTUA 3VE4A 3FG8A 4BBVA 3CAXA 2JKRI 1NLYA 1OTIA 1XJ4A 1W63Q 3PBSA 4O0PA 2KLIA 1D06A 4PHTA 4OOLA 3BQAA 4O01A 3R4KA 3CUEC 1XJ3A 3OBFA 1LSWA 3NJAA 2K31A 3BWLA 1F9IA 1IFQA 3A0RA 4KUKA 4GS9A 1IOUA 2W3HA 2P7JA 2HF6A 2BASA 3JVUA 3GDIA 2Y8HA 3E4OA 3OC2A 4WL9A 2PR5A 3NHQA 5MC7A 2QWSA 2K2NA 3E4QA 3F1OB 4K08A 5TBMB 2VZWA 2W1TA 3MFXA 4BWIA 3S7NA 4I38A 5F68A 4I39A 5IT5A 5LBRA 1W63M 1G28A 1XJ2A 2ZMVA 4HJ3A 5C5KA 2G7UA 2GZAA 2INWA 3IS2B 4EESA 4AFIA 4HY8A 4IUKA 4EETB 4NXFA 1YSQA 2M7VA 3EEHA 3BY9A 4CLCA 3K3CA 1LSXA 1S1ZA 4BBTA 4HJ4A 4BJPA 1DP9A 1P0ZA 5AVEA 4KQDA 3CWFA 1NRJA 4ME4A 1GSVA 1N9OA 3KSIA 4CQHA 2MJ6A 1OTEA 2YKHA 3H7WA 5HL6A 3GECA 3KSFA 2XROA 2NUPC 4PKYA 2J80A 3DBAA 4BBUA 3RH8B 3TJZC 4LRYC 5DFXA 4L9GA 2FZ0A 1T1AA 1XJ6A 2CMNA 3UB8A 4CLCD 4FSFA 3UE6A 2JN7A 2H28A 1UWNX 2GJ3A 5TBMA 3LI8A 3PBNA 1NLZA 1T1CA 3FPVA 4L9FA 2M1CA 2OAP1 1GSXA 4DJ2A 3MQ0A 3RTYA 4ETXA 4Z1WA 3R7WA 3PR6A 2W3FA 4WF0A 2OAQ1 4YNRA 2WKRA 1WA9A 4IHQA 5DFYA 3OCNA 1VHMA 2B18A 3PBOA 4NKPA 1XFNA 3TRCA 1EW0A 3UB7A 3VV4A 4WEJA 2VX8A 3MXQA 4Y2FA 3W2ZA 4FOFA 3MMHA 1TF1A 3LR0A 3C30A 4Y3IA 3LI9A 2D01A 3OCLA 4XT2A 4YWZA 3PHYA 4QPRA 1TS6A 5J7EA 5HWTA 2PDRA 5DJTA 2D02A 2QKPA 2L0WA 3RFBA 1MZUA 2O99A 2Z6DA 4E04A 5HD3A 3K2NA 4JGOA 4P6ZS 4PKYG 2EWVA 3HJIA 3OOVA 4B93A 2KOIA 3LIDA 4HH2A 5IS1A 4GHIB 2VV6A 3ICYA 3CLOA 4GW9A 1N9LA 2GX5A 4IJGA 1V9ZA 3H82B 3EEAA 3BQ8A 4Q0JA 3B42A 4DMZA 3EGXC 4I3AA 4GLQA 2KDKA 5TJJA 3ULFA 3LIAA 1ODVA 5AVFA 2PYPA 1Y28A 4HP4A 2R78A 3KYQA 2PD7A 3P01A 4HP9A 2J3TC 4II7A 4BMWA 5J3WA 2LB5A 4HQAA 3FC7A 5K5BA 2W27A 2W3EA 1P9RA 4HNBA 3T4QA 4M4XA 4HHDA 4Q0IA 1OJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KOU A;  4PKY A;  4BBT A;  2J80 A;  3UME A;  4BBU A;  5HSQ A;  1S4R A;  1JNU A;  1S1Y A;  2QJ5 A;  3NOT C;  4HI4 A;  5F69 A;  4GS9 B;  4LRY C;  3RH8 B;  4WUJ A;  1UWP X;  4I3J A;  2QHK A;  4L9G A;  5HWW A;  2OWJ A;  5KIZ A;  1T1A A;  1XJ6 A;  4L9E A;  2CMN A;  4LPZ A;  3UB8 A;  3A0S A;  3UE6 A;  5DKK A;  2JN7 A;  2JHE A;  2H28 A;  2V0W A;  3KX0 X;  1UWN X;  2K7S A;  3F1N A;  1T18 A;  3HJK A;  3P7N A;  2GJ3 A;  3MQO A;  2PHY A;  3EWK A;  1P97 A;  3LI8 A;  4LRX C;  1T1C A;  3F1N B;  4L9F A;  3OLO A;  5I5L A;  2M1C A;  4I3I A;  5HDS A;  1GSX A;  3F1P A;  4R70 A;  3C2W A;  3D72 A;  4HJ6 A;  2Z6C A;  5HDC A;  3F1O A;  1D7E A;  1UGU A;  4MN6 A;  3NOU C;  3E4P A;  4KUO A;  1LT0 A;  4HH3 A;  3RTY A;  2VV8 A;  3ZQ5 A;  1OTA A;  4WF0 A;  5HWV A;  1X0O A;  3IS2 A;  3PYP A;  5TBM A;  3UMD A;  3A0V A;  1GSW A;  3H7W B;  5A8B A;  2PR6 A;  1WA9 A;  2WKR A;  3H82 A;  4DJ3 A;  2VEA A;  2YKF A;  2KX6 A;  1N9N A;  3LIB A;  3K3D A;  5HD5 A;  1OT6 A;  2EA9 A;  5HDD A;  3H9W A;  1XFN A;  2WKP A;  3T50 A;  1EW0 A;  5DJU A;  4H6J A;  3VE4 A;  4EEP A;  3MR0 A;  5G4Y A;  3UB9 A;  3FG8 A;  3BY8 A;  2A24 A;  3UB7 A;  4BBV A;  2VLG A;  2ZOI A;  2W0N A;  3CAX A;  2I9V A;  4B9O A;  3MXQ A;  1OTI A;  1XJ4 A;  2V1B A;  1D06 A;  1T19 A;  3VOL A;  3VE3 A;  5G4Z A;  2V1A A;  1LSV A;  3LI9 A;  3NOP C;  4XT2 B;  2D01 A;  4EQ1 A;  4EXO A;  1F98 A;  2WKQ A;  4XT2 A;  4YWZ A;  1OT9 A;  1TS7 A;  4HOI A;  3PHY A;  2B02 A;  1XJ3 A;  5HZH A;  1TS6 A;  2OOL A;  5J7E A;  1LSW A;  3NJA A;  5HWT A;  2PDR A;  3LIF A;  3BWL A;  5DJT A;  2D02 A;  1S67 L;  2QKP A;  1F9I A;  2L0W A;  3A0R A;  1MZU A;  2Z6D A;  4GS9 A;  4KUK A;  2PYR A;  5HD3 A;  4E04 A;  4F3L B;  1S4S A;  1VB6 A;  2P7J A;  3MQQ A;  2BAS A;  4GCZ A;  4JGO A;  3HJI A;  4PKY G;  5F6A A;  1S66 L;  4F3L A;  3LYX A;  5DKL A;  3GDI A;  1DP8 A;  4LRZ E;  3E4O A;  3LID A;  4HH2 A;  5IS1 A;  4WL9 A;  2PR5 A;  2ZOH A;  3F1P B;  3IBR A;  4GHI B;  2VV6 A;  3NHQ A;  2QWS A;  3F1O B;  3C8C A;  3E4Q A;  1V9Y A;  1OTB A;  2HV1 A;  4GHI A;  1LL8 A;  2QJ7 A;  3MFX A;  4JGR A;  4K08 A;  5TBM B;  5F5Y A;  3ICY A;  4I38 A;  5F68 A;  3CLO A;  4GW9 A;  1N9L A;  1TS8 A;  4I39 A;  2V9A A;  4JGQ A;  4WLA A;  1TS0 A;  1V9Z A;  2V0U A;  4NXG A;  3MJQ A;  4R6L A;  1G28 A;  2L4R A;  3H82 B;  1XJ2 A;  4HJ3 A;  5J4E A;  3LUQ A;  2INW A;  3IS2 B;  4R3A A;  4WN5 A;  4NXB A;  4EES A;  3LIC A;  1DRM A;  4JGP A;  4I3A A;  4HY8 A;  4NXE A;  3ULF A;  4EET B;  1OTD A;  2VV7 A;  1DP6 A;  4NXF A;  4RQ9 A;  4EEU A;  1XFQ A;  2KDK A;  3EEH A;  3BY9 A;  4MN5 A;  2A24 B;  3LIA A;  1ODV A;  1OJG A;  2OWH A;  1Y28 A;  2PYP A;  3K3C A;  2R78 A;  4HP4 A;  5EFW A;  5AVF A;  1LSX A;  1S1Z A;  2PD7 A;  4H6J B;  4LLO B;  3B33 A;  4HP9 A;  1T1B A;  5IU1 A;  4HJ4 A;  4R38 A;  1DP9 A;  4HIA A;  3G6O A;  1P0Z A;  5J3W A;  3SW1 A;  4HQA A;  3FC7 A;  5AVE A;  4KQD A;  2W27 A;  3CWF A;  2PD8 A;  1GSV A;  1NWZ A;  4HNB A;  1N9O A;  4EER A;  4I5S A;  4EW7 A;  2YKH A;  1OTE A;  3H7W A;  1BYW A;  2ZBB A;  4M4X A;  4HHD A;  3UB6 A;  2L1M A;  4DJ2 A;  3GEC A;  1OJ5 A;  3LIE A; 
#chains in the Genus database with same CATH topology
 4R1G A;  4EBP A;  3PAG A;  5EVE A;  5HAQ A;  4CPK A;  2AVX A;  1NXY A;  3IH9 A;  3V3S A;  2XH9 A;  5EOE A;  3F1P A;  2XD5 A;  3GRJ A;  4D2O A;  1D7E A;  3LR5 A;  2FFF B;  4PM5 A;  1YLZ A;  1GA9 A;  1K38 A;  5A8B A;  4PPR A;  4UQI S;  1W8Q A;  3BW6 A;  3T50 A;  3KSH A;  3T1R A;  4R0Q A;  4ESP A;  5A93 A;  3WS2 A;  2HDQ A;  5FSR A;  2ZL1 B;  2WZX A;  2HP5 A;  2WKQ A;  3O3V A;  1OT9 A;  4BQM A;  3N8L A;  4KZ3 A;  2UV0 E;  3B47 A;  5GHZ A;  4EU0 A;  3BEC A;  3MQQ A;  4C6Y A;  3BFC A;  2Y2N A;  3D4F A;  4S2K A;  3O5Y A;  4JPM A;  2O0Y A;  1KDS A;  4ZDX A;  2PBD P;  1YMX A;  3P98 A;  4EEU A;  4LV1 A;  3C38 A;  4R4R A;  3HUN A;  1KGE A;  2Q9M A;  3Q7V B;  4UQI M;  2PD8 A;  2A2L A;  3TE8 A;  3LFV A;  4HOI A;  1FIK A;  2J8Y A;  4EQI A;  1S1Y A;  4KZ7 A;  3M6H A;  3G34 A;  4WUJ A;  4I3J A;  4C75 A;  3ZYT A;  5AQ7 A;  3SH8 A;  4L9E A;  4H8R A;  3W8K A;  1XP4 A;  1PWD A;  3MBZ A;  3ZFZ A;  3N4I A;  4Y15 A;  3F1N A;  3EQV A;  4P6Z M;  4LV3 A;  2GNX A;  3EGD C;  4E3L A;  5GLC A;  3E4P A;  1PW1 A;  1HLU P;  5EOO A;  1N4O A;  2VGL S;  4EBL A;  2X71 A;  2XRN A;  1MBL A;  1OT6 A;  3H9W A;  4WEK A;  1K4F A;  3BY8 A;  2VLG A;  1K6R A;  1E3U D;  2V1B A;  3VOL A;  1S0W A;  3FV7 A;  3PXP A;  2ZQ7 A;  2QZ6 A;  4Q0H A;  4XUZ A;  4ETZ A;  3NUL A;  4XT2 B;  5HPI A;  3HLE A;  3PBR A;  2XA7 M;  4WEL A;  3P09 A;  3T4O A;  3IXD A;  4WZ4 A;  4FH4 A;  3CG5 A;  4F3L B;  4N9K A;  3O88 A;  1S66 L;  5DKL A;  4DKI A;  4KQO A;  1C3B A;  3WS4 A;  3C8C A;  2HDS A;  2DMW A;  3DTK A;  5DTK A;  2DNS A;  3MJQ A;  2L4R A;  2ZC3 B;  3AGD A;  5EPH A;  3T4J A;  4O8G A;  3VSL A;  5A90 A;  3DTM A;  5KSC A;  2EWW A;  5IU1 A;  3MXR A;  1OPX A;  4IBR A;  1BYW A;  3V50 A;  4ARZ A;  3MS6 A;  2XGN A;  4XXR A;  4LEN A;  3CMZ A;  5DF7 A;  4MDZ A;  3N7W A;  2QHK A;  3W4O A;  1LHY A;  1K55 A;  1YSP A;  4BEN A;  2K7S A;  1T18 A;  3P7N A;  5I5L A;  4I3I A;  3VE3 A;  3D72 A;  3CIT A;  3LR3 A;  1JTD A;  2GDN A;  3NOU C;  4OLD A;  2Z2L B;  4KUO A;  3MF0 A;  5EVI C;  1ES5 A;  5FAO A;  1X0O A;  4QHC A;  1PWG A;  3K3D A;  4P85 A;  2WKP A;  3VE4 A;  5L2F A;  3FG8 A;  2CC1 A;  1XJ4 A;  4O0P A;  2KLI A;  4WZ5 A;  3E2K A;  5E2H A;  3UNW A;  3UPN A;  5CHM A;  1DJC A;  1CQA A;  3CUE C;  4MNR A;  4S2N C;  1LSW A;  4E3O A;  3LGO A;  5CTN A;  3NJA A;  1TDG A;  2C6W B;  1L0E A;  3BWL A;  3RXX A;  1HZO A;  4GS9 A;  1MWU A;  1IOU A;  2P7J A;  1IKG A;  3JVU A;  3GDI A;  3E4O A;  5HAR A;  5MC7 A;  2QWS A;  3E4Q A;  2VZW A;  1FCN A;  3C7U A;  4QB8 A;  3ZNY A;  5IT5 A;  4B4X A;  1E3U A;  1W63 M;  1G28 A;  3IS2 B;  1I2W A;  4AFI A;  2WAF A;  4OLG A;  1ACF A;  4LCM A;  2M7V A;  3EEH A;  1PIO A;  2DRW A;  1IYS A;  4OPR A;  1LL9 A;  1S1Z A;  5AQ9 A;  4NK3 A;  5CGS A;  2ZLY A;  3IXG A;  3SZT A;  5AVE A;  2VGK A;  4FTX A;  4JBF A;  1VET A;  2YKH A;  1OTE A;  3A3D A;  3CPT B;  3KSF A;  2XRO A;  4QU3 A;  2J80 A;  3A3F A;  2Y2O A;  5EEC A;  3TJZ C;  4L9G A;  4FSF A;  3HLC A;  1RGZ A;  4ZJ2 A;  2EX6 A;  2GJ3 A;  3FPV A;  3VOY A;  4DJ2 A;  4DE2 A;  2WGW B;  3L7H A;  4LGW A;  1KGG A;  1YT4 A;  3R7W A;  2Y2H A;  3T12 B;  2Y2G A;  4RVA A;  2ZD8 A;  5DFY A;  1HVB A;  5FI6 A;  3QP4 A;  3HLW A;  1ESI A;  1ZC2 A;  1MXO A;  4FOF A;  1PYY A;  5A92 A;  3LR0 A;  4OQ0 A;  4R23 A;  4QPR A;  3VP4 A;  5HWT A;  1Y54 A;  3IX3 A;  2L0W A;  4X68 A;  1SZV A;  2O99 A;  2Z6D A;  4BL2 A;  3NCK A;  3BEB A;  4JGO A;  1U60 A;  1ES2 A;  2EWV A;  5FDH A;  3Q07 A;  3VP0 A;  2KOI A;  1JTG A;  4HH2 A;  1CF0 A;  4GHI B;  3ICY A;  4X56 A;  1MKI A;  4GDB A;  2Z2M B;  3OPL A;  1FCO A;  4DMZ A;  1JWZ A;  4I3A A;  4GLQ A;  4QD4 A;  3GQZ A;  3ULF A;  1Y28 A;  3KYQ A;  4HP9 A;  4S2P A;  3S1Y A;  4FUW A;  2LB5 A;  4HQA A;  4ID4 A;  4OOY A;  4GZB A;  4KZB A;  1VEU B;  4M4X A;  4HHD A;  1PNE A;  2JKR M;  1LLB A;  1JNU A;  5F69 A;  5EM1 A;  3SS3 A;  5CER A;  4OQH A;  4GN2 A;  3V39 A;  1P97 A;  1WE4 A;  5HSQ A;  2P08 A;  1I2S A;  2Z6C A;  2XFS A;  1GHM A;  5HWV A;  3ZNT A;  2ZQ8 A;  3A3I A;  1PZO A;  2M7U A;  1L3L A;  4ZJ1 A;  1H8M A;  4LV2 A;  4WYY A;  1Z6F A;  2JC7 A;  4IBX A;  3BRM A;  5G4Z A;  1M40 A;  3SS4 A;  4PM8 A;  1NYY A;  4ZBE A;  1W5D A;  1PFL A;  4N1H A;  3JYI A;  2JKT I;  1E4D A;  1VB6 A;  3LYX A;  2HPB A;  1W7F A;  2XSS A;  3BYD A;  4DN0 A;  4U0T A;  3MKF A;  3KYZ A;  4L0L A;  1TS0 A;  4MEZ A;  4PM7 A;  4WN5 A;  4X1L A;  1IYP A;  3ZG7 B;  4U0X A;  4NXE A;  2J9O A;  1J9M A;  4RQ9 A;  2OWH A;  3SW1 A;  4GD6 A;  3HLG A;  1G6A A;  4HIA A;  1H5X A;  1QMF A;  2EFX A;  1ERM A;  1ALQ A;  2WAD A;  1W8Y A;  4EW7 A;  4G3W A;  2ZBB A;  3LIE A;  3AGF A;  3QP8 A;  5FAS A;  2E8I A;  3WS5 A;  3ISG A;  3MSH A;  5DTS A;  1FSW A;  3KYE A;  2HJE A;  2ZQD A;  5EFW A;  1KE4 A;  4HJ6 A;  4GKU A;  4MN6 A;  2EXB A;  4CJN A;  2FH5 A;  3GMW A;  2XFT A;  1GSW A;  1GA0 A;  1ZHH B;  4YOF A;  2Y2Q A;  2W3D A;  1BZA A;  1XA7 A;  1YPR A;  4X53 A;  2QMI A;  3HL9 A;  2JKG A;  3MR0 A;  3E98 A;  4GNU A;  5L8M A;  5FDS A;  5F1G A;  2ZMF A;  5EVL A;  1VM1 A;  1F98 A;  1G6O A;  5FEG A;  5KSH A;  3UDX A;  5EUA A;  1NJ4 A;  2V8C A;  4E6W A;  2B02 A;  3HUO A;  3G2Z A;  3GVB A;  3OPH A;  4Y0T A;  5JYP A;  2Y79 A;  1S4S A;  3QP5 A;  5F6A A;  3G35 A;  3G32 A;  3HUM A;  3VFF A;  4DE0 A;  5CED A;  1IEL A;  2W1T B;  3IBR A;  3T1S A;  2QJ7 A;  4F94 A;  5F5Y A;  2IA2 A;  4KQR A;  4N92 A;  3TSG A;  3LIC A;  5F83 A;  5TFQ A;  1VQQ A;  3BJN A;  4MMN A;  5JYO A;  3UB6 A;  1T1B A;  2VKS A;  4R38 A;  1ZG4 A;  2WGV A;  4KEN B;  1NZO A;  4UA9 A;  4DE1 A;  1IYO A;  3S7O A;  5GLB A;  3VP1 A;  3HLD A;  4X55 A;  1K56 D;  1JWV A;  3NOT C;  4GS9 B;  3FWL A;  3CUE A;  5FAP A;  4PAU A;  2IWC A;  3OLO A;  2HDR A;  4R70 A;  1UGU A;  3GSG A;  2V8F A;  3PBQ A;  3ZQ5 A;  1YLP A;  4OON A;  2OLV A;  1EWZ A;  3JVV A;  4EEP A;  1ZTU A;  3SS5 A;  4GOG A;  5DVA A;  4BBV A;  2QPN A;  2Y55 A;  2JKR I;  2ZC4 B;  1D06 A;  4PHT A;  5AQB A;  1L0D A;  1FR1 A;  2WYX A;  1FCM A;  2K31 A;  3E2L A;  3A0R A;  1ES3 A;  1YLY A;  2W3H A;  2A49 A;  5FQM A;  3MKE A;  1BTL A;  4EWF A;  1IYQ A;  2K2N A;  4K08 A;  3BFF A;  3WS1 A;  4I38 A;  5F68 A;  1PWC A;  4QWO A;  4UA6 A;  4OP8 A;  2INW A;  1SCW A;  3SH7 A;  4HY8 A;  4EET B;  3LY3 A;  3BY9 A;  4CLC A;  4Y17 A;  3GV9 A;  3K3C A;  4DDS A;  1LSX A;  4BBT A;  2HP9 A;  4BJP A;  1DP9 A;  3IF5 A;  3CWF A;  1TEM A;  4E3M A;  2XF3 A;  2MJ6 A;  1CK3 A;  1GCE A;  5HL6 A;  4KZ6 A;  1S6R A;  3DBA A;  4KZA A;  3MZD A;  2BTF P;  2FZ0 A;  3Q81 A;  1T1A A;  2CMN A;  4CLC D;  2JN7 A;  4S2M A;  2H28 A;  1UWN X;  3PBN A;  5D3O A;  4EV4 A;  4WBG A;  2WUQ A;  4ETX A;  3PR6 A;  2W3F A;  4WF0 A;  5M1A A;  1RP5 A;  4YNR A;  1WA9 A;  4IHQ A;  3IH8 A;  5FA7 A;  3UE0 A;  1K25 A;  1BLS A;  4NKP A;  1K57 C;  1EW0 A;  3UB7 A;  3VV4 A;  4OPZ A;  2VX8 A;  3MXQ A;  2IWB A;  1TF1 A;  3C30 A;  4Y0U A;  3VP2 A;  1YMS A;  3OCL A;  4YWZ A;  1WYB A;  4KZ4 A;  4WMC A;  1TS6 A;  5J7E A;  3IWQ A;  5DJT A;  3CZD A;  4P6Z S;  2P74 A;  3HJI A;  4MLL A;  2H0T A;  4ZJ3 A;  4Q8I A;  5GHX A;  4KZ8 A;  4S2L A;  2VV6 A;  1Q2Q A;  3IXB A;  2XK1 A;  2J7V A;  3IQA A;  1N9L A;  1V9Z A;  2XLN A;  3H82 B;  3EEA A;  4PMA A;  4Q0J A;  2KDK A;  5TJJ A;  3M2K A;  1JVJ A;  5E43 A;  2PD7 A;  5KMW A;  4II7 A;  1XKZ A;  3FC7 A;  5K5B A;  2W27 A;  2W3E A;  4HNB A;  5A91 A;  3CPT A;  4RA7 A;  3VP3 A;  4JLF A;  4GJ4 A;  2X02 A;  1K57 A;  3EOI A;  5KIZ A;  3GTC A;  2PBY A;  4EQ1 A;  3HJK A;  1YLT A;  1YKD A;  4LRX C;  3WRT A;  1MY8 A;  2JCH A;  3S7P A;  3DAV A;  2XD1 A;  4NET A;  3UE1 A;  2VV8 A;  1ONG A;  1YM1 A;  1MPL A;  4DJ3 A;  4K0X A;  2JE5 A;  2YKF A;  3S7Q A;  1Q2P A;  5G4Y A;  5FEF A;  4MN7 A;  4OOM A;  2ZOI A;  2J3W A;  4KG5 A;  5M19 A;  4B9O A;  2JBF A;  4G3K A;  1T19 A;  2J3T D;  3T4T A;  2ZC5 B;  2H5S A;  2ZL1 A;  3IX8 A;  2J9P A;  1E25 A;  2P9V A;  3OPP A;  3HRE A;  1S67 L;  2XEP A;  1LI0 A;  1SDE A;  4DDY A;  3GR2 A;  1TDL A;  4Y5F A;  5J8X A;  1L2S A;  2XA7 S;  3UB5 P;  5U47 A;  3BLM A;  4JXG A;  5FAT A;  2ZOH A;  3BM6 A;  5GLA A;  1OTB A;  2HV1 A;  3DTI A;  2EX2 A;  3LEZ A;  4JXS A;  4NXG A;  3JPU A;  3ZG0 A;  4OQI A;  5EVI B;  1CEG A;  3U2A A;  5DTT A;  3SH9 A;  1CEF A;  4JGP A;  3WS0 A;  4KG2 A;  3DWZ A;  4IVK A;  1OTD A;  4CLC B;  5HAP A;  5CHJ A;  5L07 A;  1Y4O A;  1OJG A;  1H0M A;  4LLO B;  2VGL M;  3HCY A;  5FQI A;  3C4P A;  1L0G A;  1NWZ A;  4EER A;  4N9L A;  2VK3 A;  3A0V A;  3H7W B;  4EUZ A;  3W4Q A;  3OZH A;  2QJ5 A;  4HI4 A;  4UHU A;  5E2F A;  5HWW A;  4UEY A;  3V5M A;  1SKF A;  2WZZ A;  5CEC A;  2V0W A;  4A5R A;  1IKI A;  3C2W A;  5HDC A;  2PT7 A;  2XQZ A;  2Y91 A;  4HH3 A;  5DF8 A;  5CX7 A;  3ITA A;  3HLF A;  4DE3 A;  3IX4 A;  2ZMA A;  3MZE A;  1N9N A;  1K6S A;  2EA9 A;  3IHB A;  2VA0 A;  1I5Q A;  2A24 A;  3ZVW A;  2JKT M;  2W0N A;  2I9V A;  3KSG A;  1XXM A;  3UE3 A;  4K0W A;  2WKI A;  1PRQ A;  2OOL A;  3HLB A;  5CEB A;  3LIF A;  5CXW A;  3NEC A;  1N9B A;  4F3L A;  1BUL A;  3N8R A;  4OVD A;  3UPO A;  4X25 A;  1V9Y A;  4JXV A;  4JGQ A;  1TS8 A;  4MBK A;  2V9A A;  5FQK A;  4WLA A;  3VFH A;  3M2J A;  2O9B A;  4Y7P A;  4JXW A;  5AJG A;  4MBH A;  1DP6 A;  1XFQ A;  3D3O A;  4JF5 A;  2A24 B;  1F2K A;  5E2E A;  3B33 A;  1AXB A;  3BFG A;  3G6O A;  3B3X A;  3UDF A;  4PM9 A;  1FIL A;  2L1M A;  2QYB A;  1KVM A;  3ZGA B;  4EUV A;  1UWP X;  2Y2L A;  4ZAM A;  1CI8 A;  3MZF A;  1ESU A;  2PHY A;  4E6X A;  4DXC A;  1LT0 A;  1PZP A;  3IS2 A;  4JF6 A;  3R7W B;  2I72 A;  2PR6 A;  1RCJ A;  3VOZ A;  2ZQA A;  5HD5 A;  5FQQ A;  5HDD A;  3CI6 A;  1RGY A;  2PU4 A;  1LL5 A;  4GDN A;  3CAX A;  2WKH A;  2R9W A;  5L10 A;  2E8J A;  1DJA A;  1NLY A;  1OTI A;  3LCE A;  3PBS A;  4QY6 A;  1KGF A;  3LO7 A;  1DJB A;  1KE0 A;  3NY4 A;  3R4K A;  3G4P A;  3DWK A;  3OBF A;  4KUK A;  2C5W B;  4BLM A;  4DF6 A;  2BAS A;  1SDN A;  2UWX A;  2Y8H A;  3OC2 A;  2PR5 A;  3TOI A;  3F1O B;  2W1T A;  1G68 A;  3QNC A;  4RX2 A;  3BFE A;  5LBR A;  5EVI A;  2ZMV A;  5C5K A;  4FD8 A;  2GZA A;  5IHV A;  4IUK A;  1MWS A;  4NXF A;  5E2G A;  1YQS A;  3QHY A;  2Y2K A;  3NC8 A;  1NRJ A;  2ACG A;  1GSV A;  4KZ5 A;  3PTE A;  2Y4A A;  2ZM0 A;  3KSI A;  4CQH A;  3H7W A;  1ZG6 A;  4RX3 A;  3TG9 A;  3GEC A;  3NDE A;  2NUP C;  4PKY A;  4BBU A;  4OQG A;  3RH8 B;  4N1X A;  5DFX A;  5BOH A;  5EE8 A;  1BLP A;  1AWI A;  3UE6 A;  1H8Z A;  4KZ9 A;  4M3K A;  3LI8 A;  1NLZ A;  4L9F A;  1NZU A;  1KE3 A;  3RTY A;  4Z1W A;  4HBT A;  2WKR A;  5F1F A;  1CI9 A;  3PBO A;  1H8Y A;  3UO9 A;  1XFN A;  3TRC A;  4KG6 A;  2ZQ9 A;  2ZQC A;  2ZC7 A;  3A3E A;  3ZVT A;  2ZJ9 A;  4OH0 A;  4Y2F A;  4BD1 A;  3MMH A;  3N8S A;  1PI4 A;  4GB7 A;  4Y3I A;  1XA1 A;  1FSY A;  5L09 A;  2BG1 A;  3SOI A;  4XT2 A;  1FOF A;  3PHY A;  1BLH A;  3HBR A;  4R4S A;  4P0M A;  2PDR A;  2QKP A;  1XGJ A;  3UN7 A;  3RFB A;  4E04 A;  5HD3 A;  3K2N A;  2PAV P;  3OOV A;  4C3Q A;  3LID A;  5IS1 A;  2B5R A;  2B95 A;  3V3R A;  3BLS A;  4B88 A;  3O86 A;  3CLO A;  2GX5 A;  4P87 A;  1FQG A;  5FI2 A;  3EGX C;  3T1X A;  3WWX A;  5AVF A;  4HP4 A;  2G2U A;  1A0K A;  4E3I A;  3P01 A;  3Q7V A;  2J3T C;  4BMW A;  4X6T A;  4E3N A;  5CTM A;  5HX9 A;  3MXS A;  4UA7 A;  4Q0I A;  1OJ5 A;  1HTZ A;  1KOU A;  3IF6 A;  4WMC D;  4ARZ B;  1S4R A;  1TD5 A;  4Z9Q A;  4Y13 A;  4Y0O A;  1PI5 A;  1TVF A;  3A0S A;  5DKK A;  1ERQ A;  3MQO A;  4OPQ A;  3F1N B;  2WGW A;  3AGE A;  2WAE A;  2Y2I A;  4JKT A;  5GL9 A;  3C7V A;  4P6B A;  4FCF A;  4E3K A;  1OTA A;  4R3B A;  3PYP A;  3UMD A;  2VEA A;  3LEQ A;  3T4S A;  3LIB A;  1G5U A;  1IEM A;  2BLS A;  4D60 A;  5EV0 A;  5F82 A;  3UB9 A;  5GLD A;  2P04 A;  4JF4 A;  2ZC6 B;  1WYC A;  2Q9N A;  2LB9 A;  4CLC E;  4NG2 A;  2JKF A;  2V1A A;  4IVI A;  5FI7 A;  4EBN A;  2VJW A;  1LSV A;  3NOP C;  3FKV A;  5CGX A;  1TS7 A;  4OP5 A;  3WRZ A;  5I94 A;  5HZH A;  2O9A A;  3G30 A;  2O9C A;  4OPY A;  3G2Y A;  3Q82 A;  3C5A A;  2PYR A;  2NUT C;  5HPF A;  4GCZ A;  2DCF A;  4LRZ E;  1MWT A;  2Y2J A;  1MKM A;  3ZG8 B;  1LL8 A;  3OPR A;  4JGR A;  4OKP A;  3IXH A;  3VMA A;  2V0U A;  5HL1 A;  4R6L A;  4UAA A;  4R3A A;  4NXB A;  4GD8 A;  1DRM A;  3A3J A;  4S2J A;  4DRT A;  3CHW P;  4MN5 A;  4EXO A;  5FQJ A;  4BD0 A;  4H6J B;  5FL3 A;  3RXW A;  3IBJ A;  4CLC C;  1CJF A;  2HZ5 A;  5CGW A;  3QP2 A;  4XUX A;  3UME A;  1K56 A;  2ZM2 A;  4E3J A;  1JWP A;  1O07 A;  2EXA A;  2EX8 A;  3Q7Z A;  2R9X A;  4RYE A;  4FH2 A;  2HGV A;  3KX0 X;  1SHV A;  2Y59 A;  3EWK A;  2EX9 A;  3F1O A;  1EI5 A;  2XR0 A;  3DTE A;  3H82 A;  1YAX A;  2Y2P A;  1Z09 A;  4WZ5 C;  5DJU A;  4H6J A;  1XGI A;  3QNB A;  3ZCZ A;  3EQU A;  1ONH A;  5HAI A;  3UY6 A;  3TW8 A;  3LR4 A;  4S2O A;  1VET B;  3M6B A;  4G3V A;  2RCX A;  2W1R A;  1K54 C;  3QP6 A;  4X1M A;  2IWD A;  3V67 A;  1H3Q A;  2PRF A;  3RJU A;  1P9W A;  1DP8 A;  3PBT A;  3F1P B;  3T4L A;  4GHI A;  3S4X A;  3T1Q B;  2RL3 A;  4YIN A;  3KO6 A;  1NRF A;  3T4K A;  3E0Y A;  5DF9 A;  5J4E A;  3LUQ A;  4IED A;  2Q0O A;  3DW0 A;  5CRF A;  1XX2 A;  2ZM8 A;  3MFD A;  1BUE A;  3NIA A;  2VV7 A;  5HDS A;  3FPW A;  1LI9 A;  3S22 A;  1MC0 A;  5HFO A;  2HDU A;  4IUH A;  2XDM A;  4U3T A;  2G2W A;  2W3G A;  3IF6 C;  4I5S A;  2PU2 A;  2WKE A;  4MCW A;  2EFU A;  4NEE D;  1W79 A;  1F5M A;  2V1Z A;  3IWI A;  2OWJ A;  4LPZ A;  3UDI A;  4ZRR A;  3IHA A;  1HD8 A;  2JHE A;  1BSG A;  3U4L P;  4ZTK A;  2V20 A;  4O7D A;  1STZ A;  2WK0 A;  1BT5 A;  1L0F A;  2KX6 A;  5HW3 A;  4HBU A;  1DY6 A;  1YLW A;  2HJ9 C;  3C4O A;  3CJM A;  1W63 Q;  3I7J A;  2Y2M A;  1ZKJ A;  4S2N A;  5FQ9 A;  4OOL A;  3BQA A;  1XJ3 A;  4R3J A;  1XPB A;  2X01 A;  1F9I A;  1IFQ A;  4HES A;  5FAQ A;  2HF6 A;  3PAE A;  1K0K A;  1QME A;  3NBL A;  4WL9 A;  5G18 A;  3NHQ A;  3IWO A;  5TBM B;  3MFX A;  4BWI A;  1ES4 A;  3S7N A;  3HVF A;  2OV5 A;  2VGJ A;  4I39 A;  3FKW A;  4WM9 A;  1GHP A;  1XJ2 A;  4HJ3 A;  3N6I A;  3NDG A;  5GHY A;  2G7U A;  4EES A;  1PW8 A;  4MBF A;  1KDW A;  1YSQ A;  1KVL A;  4HJ4 A;  1P0Z A;  3Q1F A;  4KQD A;  4ME4 A;  1VEU A;  4LFU A;  1N9O A;  2FFY A;  1YLJ A;  5EM0 A;  2P9V B;  1ERO A;  3FYZ A;  3G31 A;  1K4E A;  1SKO A;  4LRY C;  1GHI A;  1XJ6 A;  3UB8 A;  5EVI D;  3LY4 A;  3NI9 A;  1M6K A;  4PM6 A;  2WGI A;  3FZC A;  5AQA A;  3ZG5 A;  3D9Y A;  5TBM A;  4QJG A;  1T1C A;  2M1C A;  2OAP 1;  1GSX A;  3MQ0 A;  3ZDJ A;  1D1J A;  5CHU A;  1K54 A;  2OAQ 1;  4LCL A;  3OCN A;  1VHM A;  2B18 A;  2OLU A;  4WEJ A;  3VSK A;  3W2Z A;  5TR7 A;  4S2I A;  4DXB A;  3ZG9 B;  3LI9 A;  1K55 C;  2D01 A;  5KZH A;  3IF6 B;  4X69 A;  1SKO B;  3O87 A;  2D02 A;  1NYM A;  1MWR A;  3UPP A;  1MZU A;  1O7E A;  4BL3 A;  1NY0 A;  2H0Y A;  2V2F F;  4PKY G;  4B93 A;  3QP1 A;  3ZHH A;  1FR6 A;  4KQQ A;  3IT9 A;  1BLC A;  4GW9 A;  5TGF A;  4IJG A;  3BFD A;  4LV0 A;  3BQ8 A;  3B42 A;  2A3U A;  3L9K A;  1J3W A;  2H10 A;  2OSU A;  3LIA A;  1ODV A;  2PYP A;  1OME A;  2R78 A;  2HP6 A;  3ITB A;  4YFM A;  5J3W A;  5M18 A;  3W4P A;  4QY5 A;  1P9R A;  4K91 A;  3T4Q A;  4B4Z A;  4HEF A;  4O01 A; 
#chains in the Genus database with same CATH homology
 1KOU A;  4GJ4 A;  2JKR M;  4ARZ B;  1S4R A;  1JNU A;  1TD5 A;  5F69 A;  3EOI A;  5KIZ A;  3A0S A;  5DKK A;  4EQ1 A;  3HJK A;  3MQO A;  1YKD A;  4LRX C;  1P97 A;  3F1N B;  3S7P A;  3F1P A;  5HSQ A;  2P08 A;  2Z6C A;  1D7E A;  3LR5 A;  2VV8 A;  1OTA A;  5HWV A;  3PYP A;  3UMD A;  5A8B A;  4DJ3 A;  2VEA A;  2YKF A;  4UQI S;  2M7U A;  3S7Q A;  3T4S A;  3LIB A;  1H8M A;  3BW6 A;  3T50 A;  3KSH A;  5G4Y A;  3UB9 A;  4MN7 A;  4OOM A;  2P04 A;  2ZOI A;  2J3W A;  4B9O A;  2LB9 A;  4CLC E;  4G3K A;  1T19 A;  5G4Z A;  2J3T D;  2V1A A;  3T4T A;  2VJW A;  1LSV A;  3NOP C;  2WKQ A;  1OT9 A;  1TS7 A;  5HZH A;  2O9A A;  2O9C A;  3B47 A;  1S67 L;  2JKT I;  2PYR A;  1VB6 A;  2NUT C;  4EU0 A;  3MQQ A;  5HPF A;  4GCZ A;  4Y5F A;  2XA7 S;  3LYX A;  4LRZ E;  2ZOH A;  2XSS A;  1MKM A;  1OTB A;  2HV1 A;  3O5Y A;  1LL8 A;  4DN0 A;  4JGR A;  2O0Y A;  3KYZ A;  4L0L A;  1TS0 A;  2V0U A;  4NXG A;  4R6L A;  3U2A A;  4R3A A;  4WN5 A;  4NXB A;  1DRM A;  4JGP A;  4NXE A;  4CLC B;  1OTD A;  4RQ9 A;  4EEU A;  4MN5 A;  2OWH A;  1OJG A;  3C38 A;  4EXO A;  3SW1 A;  4LLO B;  4H6J B;  5FL3 A;  4HIA A;  2VGL M;  3HCY A;  3IBJ A;  4UQI M;  2PD8 A;  2A2L A;  1NWZ A;  4CLC C;  3TE8 A;  4EER A;  4EW7 A;  3LFV A;  4G3W A;  2ZBB A;  3A0V A;  3H7W B;  3LIE A;  4HOI A;  3UME A;  2QJ5 A;  1S1Y A;  4HI4 A;  5HWW A;  4WUJ A;  4I3J A;  4UEY A;  3ZYT A;  4L9E A;  2HGV A;  2V0W A;  3KX0 X;  2HJE A;  3F1N A;  3EQV A;  5EFW A;  4P6Z M;  3EWK A;  2GNX A;  3EGD C;  5HDC A;  3C2W A;  4HJ6 A;  2PT7 A;  3F1O A;  4MN6 A;  3E4P A;  2FH5 A;  4HH3 A;  2VGL S;  5CX7 A;  1GSW A;  1ZHH B;  3H82 A;  4YOF A;  2XRN A;  2W3D A;  1YAX A;  1N9N A;  1OT6 A;  2EA9 A;  2VA0 A;  3H9W A;  4WEK A;  5DJU A;  4H6J A;  3MR0 A;  3BY8 A;  2A24 A;  3E98 A;  3EQU A;  2VLG A;  2JKT M;  2W0N A;  5L8M A;  2I9V A;  3TW8 A;  3KSG A;  2V1B A;  3LR4 A;  2ZMF A;  3VOL A;  3PXP A;  3UE3 A;  4Q0H A;  5HPI A;  4ETZ A;  4XT2 B;  1F98 A;  1G6O A;  4G3V A;  5KSH A;  3PBR A;  2B02 A;  2W1R A;  2XA7 M;  4WEL A;  2OOL A;  3T4O A;  3LIF A;  2Y79 A;  4F3L B;  1S4S A;  3V67 A;  5F6A A;  1H3Q A;  4F3L A;  1S66 L;  5DKL A;  1P9W A;  1DP8 A;  3PBT A;  4KQO A;  3F1P B;  2W1T B;  3IBR A;  3C8C A;  3T4L A;  1V9Y A;  2DMW A;  4GHI A;  2QJ7 A;  3KO6 A;  5F5Y A;  4JGQ A;  1TS8 A;  3T4K A;  2V9A A;  4WLA A;  3E0Y A;  2IA2 A;  3MJQ A;  2O9B A;  2L4R A;  5DF9 A;  5J4E A;  3LUQ A;  3LIC A;  5AJG A;  2VV7 A;  3T4J A;  1DP6 A;  3BJN A;  4MMN A;  1XFQ A;  3D3O A;  4O8G A;  2A24 B;  5HDS A;  3FPW A;  3UB6 A;  2EWW A;  3B33 A;  5IU1 A;  1MC0 A;  1T1B A;  2VKS A;  4R38 A;  3G6O A;  4IUH A;  1OPX A;  3S7O A;  2W3G A;  4I5S A;  1BYW A;  2L1M A;  4MCW A;  4ARZ A;  2QYB A;  4NEE D;  1F5M A;  3NOT C;  4MDZ A;  4EUV A;  4GS9 B;  1UWP X;  2QHK A;  2OWJ A;  4LPZ A;  3CUE A;  4PAU A;  4ZRR A;  1YSP A;  2JHE A;  2K7S A;  1T18 A;  3P7N A;  2PHY A;  5I5L A;  3OLO A;  4I3I A;  3VE3 A;  4R70 A;  3D72 A;  3CIT A;  3LR3 A;  1UGU A;  3NOU C;  4KUO A;  1LT0 A;  3MF0 A;  3ZQ5 A;  3PBQ A;  1X0O A;  3IS2 A;  1STZ A;  3R7W B;  2PR6 A;  2KX6 A;  3K3D A;  5HD5 A;  5HDD A;  3JVV A;  3CI6 A;  2HJ9 C;  2WKP A;  4EEP A;  1ZTU A;  3VE4 A;  3FG8 A;  4BBV A;  3CAX A;  2JKR I;  1NLY A;  1OTI A;  1XJ4 A;  1W63 Q;  3PBS A;  4O0P A;  2KLI A;  1D06 A;  4PHT A;  4OOL A;  3BQA A;  4O01 A;  3R4K A;  3CUE C;  1XJ3 A;  3OBF A;  1LSW A;  3NJA A;  2K31 A;  3BWL A;  1F9I A;  1IFQ A;  3A0R A;  4KUK A;  4GS9 A;  1IOU A;  2W3H A;  2P7J A;  2HF6 A;  2BAS A;  3JVU A;  3GDI A;  2Y8H A;  3E4O A;  3OC2 A;  4WL9 A;  2PR5 A;  3NHQ A;  5MC7 A;  2QWS A;  2K2N A;  3E4Q A;  3F1O B;  4K08 A;  5TBM B;  2VZW A;  2W1T A;  3MFX A;  4BWI A;  3S7N A;  4I38 A;  5F68 A;  4I39 A;  5IT5 A;  5LBR A;  1W63 M;  1G28 A;  1XJ2 A;  2ZMV A;  4HJ3 A;  5C5K A;  2G7U A;  2GZA A;  2INW A;  3IS2 B;  4EES A;  4AFI A;  4HY8 A;  4IUK A;  4EET B;  4NXF A;  1YSQ A;  2M7V A;  3EEH A;  3BY9 A;  4CLC A;  3K3C A;  1LSX A;  1S1Z A;  4BBT A;  4HJ4 A;  4BJP A;  1DP9 A;  1P0Z A;  5AVE A;  4KQD A;  3CWF A;  1NRJ A;  4ME4 A;  1GSV A;  1N9O A;  3KSI A;  4CQH A;  2MJ6 A;  1OTE A;  2YKH A;  3H7W A;  5HL6 A;  3GEC A;  3KSF A;  2XRO A;  2NUP C;  4PKY A;  2J80 A;  3DBA A;  4BBU A;  3RH8 B;  3TJZ C;  4LRY C;  5DFX A;  4L9G A;  2FZ0 A;  1T1A A;  1XJ6 A;  2CMN A;  3UB8 A;  4CLC D;  4FSF A;  3UE6 A;  2JN7 A;  2H28 A;  1UWN X;  2GJ3 A;  5TBM A;  3LI8 A;  3PBN A;  1NLZ A;  1T1C A;  3FPV A;  4L9F A;  2M1C A;  2OAP 1;  1GSX A;  4DJ2 A;  3MQ0 A;  3RTY A;  4ETX A;  4Z1W A;  3R7W A;  3PR6 A;  2W3F A;  4WF0 A;  2OAQ 1;  4YNR A;  2WKR A;  1WA9 A;  4IHQ A;  5DFY A;  3OCN A;  1VHM A;  2B18 A;  3PBO A;  4NKP A;  1XFN A;  3TRC A;  1EW0 A;  3UB7 A;  3VV4 A;  4WEJ A;  2VX8 A;  3MXQ A;  4Y2F A;  3W2Z A;  4FOF A;  3MMH A;  1TF1 A;  3LR0 A;  3C30 A;  4Y3I A;  3LI9 A;  2D01 A;  3OCL A;  4XT2 A;  4YWZ A;  3PHY A;  4QPR A;  1TS6 A;  5J7E A;  5HWT A;  2PDR A;  5DJT A;  2D02 A;  2QKP A;  2L0W A;  3RFB A;  1MZU A;  2O99 A;  2Z6D A;  4E04 A;  5HD3 A;  3K2N A;  4JGO A;  4P6Z S;  4PKY G;  2EWV A;  3HJI A;  3OOV A;  4B93 A;  2KOI A;  3LID A;  4HH2 A;  5IS1 A;  4GHI B;  2VV6 A;  3ICY A;  3CLO A;  4GW9 A;  1N9L A;  2GX5 A;  4IJG A;  1V9Z A;  3H82 B;  3EEA A;  3BQ8 A;  4Q0J A;  3B42 A;  4DMZ A;  3EGX C;  4I3A A;  4GLQ A;  2KDK A;  5TJJ A;  3ULF A;  3LIA A;  1ODV A;  5AVF A;  2PYP A;  1Y28 A;  4HP4 A;  2R78 A;  3KYQ A;  2PD7 A;  3P01 A;  4HP9 A;  2J3T C;  4II7 A;  4BMW A;  5J3W A;  2LB5 A;  4HQA A;  3FC7 A;  5K5B A;  2W27 A;  2W3E A;  1P9R A;  4HNB A;  3T4Q A;  4M4X A;  4HHD A;  4Q0I A;  1OJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...