3FC7A

The crystal structure of a domain of htr-like protein from haloarcula marismortui atcc 43049
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
SDSPDGIVHLTTNGTILSVNPSMAGRLGADPDTLVGQQLSAVMDSEAANQRLEAGKSAVENGTATRSEDAVGGRHYHNQYIPVDSHRKSDTFQLVSRDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HTR-like protein
publication title The crystal structure of a domain of HTR-like protein from Haloarcula marismortui ATCC 43049
rcsb
source organism Haloarcula marismortui
molecule tags Transferase
total genus 27
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3fc7A00
3RH8B 1MZUA 4WUJA 4EEPA 3NOUC 2B02A 3E4OA 5AVFA 1EW0A 1V9ZA 1P97A 1DRMA 5AVEA 3LICA 3T50A 4L9GA 1JNUA 2R78A 3LIBA 2W27A 3NJAA 3IS2B 3RTYA 2ZOIA 5IS1A 1GSWA 2PR5A 4EETB 4RQ9A 3MXQA 2J80A 4HQAA 3ULFA 3VE3A 1LSVA 1LL8A 1T19A 1OT9A 1OTEA 2JHEA 2V0WA 3PHYA 5I5LA 1KOUA 4XT2A 3UMEA 3C2WA 4WN5A 4HJ4A 3ICYA 1S67L 3FC7A 3MJQA 4YWZA 2BASA 2PDRA 4LLOB 4DJ3A 1WA9A 4EQ1A 1DP6A 3LI8A 3H82B 1DP9A 5KIZA 3NHQA 4EERA 4F3LA 4GS9A 4BBUA 3A0VA 3H7WB 4R3AA 5DJTA 1XJ6A 2QWSA 2A24A 1S1ZA 3EEHA 1OTIA 1TS8A 3SW1A 1LSWA 3BWLA 2WKPA 3F1PA 1XJ2A 4GHIB 3MR0A 4E04A 4R6LA 4HH3A 3F1NB 4NXGA 1GSVA 1Y28A 3H9WA 5G4YA 2PD8A 1TS6A 2PYPA 5DKKA 4PKYA 5TBMA 4JGQA 3UB7A 4R38A 4M4XA 4HI4A 1T1AA 3LUQA 5HWTA 1S4RA 1OJ5A 3VOLA 2L0WA 2YKFA 3A0RA 3UB6A 1F9IA 4EW7A 4EXOA 3GECA 2VV6A 2M1CA 3IBRA 2ZOHA 3CWFA 5IU1A 5J4EA 3PYPA 1D06A 5HWWA 2V0UA 2Z6CA 4HP9A 1UGUA 3VE4A 3B33A 3OLOA 3UMDA 4H6JA 5F68A 2WKQA 4I5SA 5F5YA 3CLOA 4NXBA 5HD5A 4LPZA 5HDCA 3F1OA 3G6OA 5DJUA 2KDKA 2GJ3A 2PD7A 3E4PA 2WKRA 3BY8A 4XT2B 1G28A 3D72A 3HJIA 2I9VA 5HDSA 2D01A 4WLAA 1XFNA 1NWZA 4NXEA 1N9OA 2V9AA 1V9YA 3LIDA 2QJ5A 4HHDA 3P7NA 5F69A 4JGOA 4PKYG 2OOLA 1T18A 4F3LB 4GS9B 2CMNA 4HOIA 2QJ7A 3MQQA 4HNBA 2HV1A 2V1AA 4MN5A 5HDDA 3HJKA 2JN7A 2ZBBA 3FG8A 3UB9A 2A24B 4BBVA 3LYXA 4LRZE 3K3CA 4GCZA 1OJGA 3F1PB 1S4SA 2KX6A 5F6AA 2P7JA 4HJ6A 4NXFA 3F1NA 4EESA 1S1YA 2W0NA 4LRYC 2Z6DA 4I3IA 1F98A 4B9OA 2VV8A 5EFWA 5HSQA 1DP8A 3UE6A 4MN6A 3MFXA 4I39A 2L1MA 1UWPX 3LIEA 1XJ4A 4H6JB 1N9LA 3IS2A 1LSXA 1UWNX 3GDIA 2PR6A 4I38A 2PHYA 2PYRA 2L4RA 1VB6A 3F1OB 1ODVA 4L9FA 4KQDA 1T1CA 4WL9A 1XFQA 1S66L 4HIAA 1OTAA 4HY8A 3NOTC 5J7EA 1TS7A 1P0ZA 1BYWA 4LRXC 3K3DA 5DKLA 1X0OA 2INWA 5HZHA 4DJ2A 3A0SA 5HD3A 1LT0A 4EEUA 1T1BA 3NOPC 2OWHA 1OT6A 4HP4A 1D7EA 2H28A 2QKPA 3UB8A 1XJ3A 4WF0A 3H82A 3LIAA 3KX0X 2V1BA 1OTBA 2VV7A 1TS0A 4I3JA 4KUKA 4BBTA 1N9NA 4GW9A 3CAXA 4HH2A 3H7WA 5A8BA 3LIFA 2QHKA 4HJ3A 3LI9A 3BY9A 5HWVA 4GHIA 4L9EA 2YKHA 2K7SA 3ZQ5A 3C8CA 5G4ZA 3EWKA 5TBMB 4K08A 5J3WA 4I3AA 4KUOA 4JGRA 1GSXA 2EA9A 2OWJA 3E4QA 3MQOA 1OTDA 2VEAA 2D02A 4R70A 4JGPA 2VLGA
chains in the Genus database with same CATH superfamily
1MZUA 3IXBA 1NZOA 2ZMFA 4WUJA 4EEPA 2K31A 3NOUC 3NC8A 1EW0A 1P97A 1JWPA 2EWWA 3VP1A 2BTFP 3IWQA 5FDHA 4Y17A 2HP9A 2V1ZA 3LICA 3IWIA 1OPXA 3IF5A 3OC2A 3DW0A 4DDYA 4S2LA 2XGNA 3NJAA 4KZ3A 3IS2B 1GSWA 4Y5FA 2GX5A 1MWRA 4IBRA 4KQOA 4R0QA 4WZ4A 1PWDA 2Q9NA 2V2FF 3O88A 1WE4A 4Y3IA 4MBHA 3UE0A 3MBZA 2HGVA 5CECA 3MQ0A 4XT2A 4D2OA 4QB8A 3DTEA 1BT5A 2ZL1B 4DRTA 5KSHA 4KZ7A 3IF6C 3IXHA 3BYDA 3MJQA 4BD1A 2K2NA 4Y0TA 4OP5A 1K4EA 2PDRA 4M3KA 2XF3A 4KQRA 5DFYA 2O9BA 1H0MA 4JF6A 3B47A 4QY5A 4X6TA 1PFLA 1NYMA 3OPLA 4P6BA 4Y0OA 3EEAA 2XD1A 5E2HA 2XA7S 3WWXA 4BBUA 2KLIA 5DJTA 1Y54A 1E3UA 1EROA 3HVFA 4WZ5C 5EPHA 1PWCA 3G4PA 5CHUA 3CUEA 1YLPA 3RJUA 1Y28A 5FAOA 4IEDA 3V3RA 3ZVWA 1IKGA 4UQIM 1ES2A 4Q0JA 2Y2GA 2VK3A 5EVIC 2EXAA 1K0KA 3GTCA 4MBFA 1WYBA 2Q0OA 4OONA 4WEKA 3Q7VB 5E2EA 5HWTA 3WS5A 4RA7A 1OJ5A 5FEFA 2JKTI 2YKFA 3UB6A 5AQ9A 4C3QA 1KVLA 2M1CA 3PAEA 4GLQA 3SH8A 3CWFA 5IU1A 4QWOA 5J4EA 3PYPA 3O86A 3UDXA 1N9BA 4YFMA 4HP9A 3OLOA 1JWZA 5FQIA 4AFIA 2XD5A 4N1HA 4NK3A 3QP4A 2R9WA 4P6ZS 3RFBA 5HDCA 3HCYA 4X56A 5DJUA 1ALQA 3UE1A 5EV0A 3S7OA 4IBXA 2KDKA 3MF0A 1GHIA 2GJ3A 2PD7A 3IX8A 3UY6A 4Z1WA 2P74A 3W4QA 2G2UA 2W1TA 3BFDA 3BY8A 4E3LA 4KG6A 5F1GA 1ONHA 3CPTB 1G28A 3D72A 5HDSA 3VFHA 2Y59A 5HFOA 3ZYTA 3IHAA 3P98A 3TJZC 1V9YA 2ZM0A 4ZJ1A 3GSGA 3P7NA 2ZM2A 1IFQA 4JGOA 1S6RA 3QHYA 4ESPA 2HP6A 3OBFA 4RX3A 2CMNA 1PZPA 4Z9QA 5TFQA 3K2NA 4EU0A 1RP5A 3UE3A 5HDDA 3FG8A 2W3DA 4CLCE 3LYXA 3R4KA 4ZRRA 4GCZA 3LY3A 4P87A 1OJGA 4DF6A 2VX8A 1MBLA 1S4SA 3NIAA 5EECA 1D1JA 1J9MA 4JF4A 3M2JA 1ES3A 3KSIA 3OCNA 5F6AA 4GNUA 3N8RA 4MBKA 4QJGA 4CPKA 3HLGA 1ZC2A 2XLNA 3PBSA 1KGGA 2Y2QA 1G68A 5L09A 5A91A 3S7NA 1K54A 3IXGA 5HSQA 5EFWA 3NBLA 3R7WA 3HUMA 3ZNYA 5FA7A 4FUWA 1KE0A 4MN6A 3CUEC 3A3JA 1FQGA 3TE8A 3WS2A 4BL3A 2XFTA 3EGDC 4XXRA 1DY6A 5EM1A 3LIEA 3O87A 1K57C 1XJ4A 4OPRA 5DFXA 4DDSA 5DF9A 2WGWB 1LSXA 3T4QA 3JVUA 4L0LA 2M7UA 4EUZA 3F1OB 1TDLA 1E4DA 3C5AA 4L9FA 1W8YA 2ZD8A 4DE3A 2JKRM 3G2ZA 3MKEA 4HY8A 5A92A 1EI5A 2PBDP 5FQKA 1P0ZA 1BYWA 4EBNA 3K3DA 2JBFA 3FKWA 1X0OA 5HZHA 1Z6FA 5GHZA 1QMFA 5HD3A 5CERA 1YSPA 3MKFA 1T1BA 5FQQA 1YM1A 3PBTA 1OT6A 1D7EA 4E6WA 4HESA 5GHYA 2QKPA 3UB8A 2XROA 1PI5A 3H82A 4WF0A 3CJMA 2IWCA 3KX0X 3DTKA 5HPIA 3V39A 4WELA 2VV7A 2VJWA 1Z09A 1BLHA 4OQ0A 4E3KA 1K25A 3BFFA 4GW9A 3CAXA 3PBNA 3H7WA 3PR6A 4UHUA 4CLCA 5A8BA 3GV9A 3QP2A 1Y4OA 3LIFA 2DNSA 4XUXA 2WZZA 3BY9A 3IT9A 3NI9A 1M40A 3HLWA 4KG5A 5A90A 4GHIA 1AXBA 1W63Q 2UV0E 2Y2KA 5CEDA 1WYCA 2K7SA 3ZQ5A 3CHWP 1PWGA 1BLSA 3ZG5A 1PRQA 1GSXA 2ZC6B 4LCLA 3E4QA 2WGVA 3MQOA 4MMNA 4E6XA 4R4SA 4JGPA 2Y2LA 1AWIA 3M2KA 3ZCZA 3BLMA 5AVFA 2EFXA 2VGJA 5L8MA 1DRMA 4QU3A 5AVEA 3A3DA 1ZG4A 2RL3A 4JXGA 2XQZA 1JNUA 3IBJA 1ZKJA 2Y2JA 3RTYA 2ZOIA 3G32A 4ME4A 3B42A 1VETB 4RQ9A 1K54C 1M6KA 1KDWA 2J3WA 4E3NA 1G5UA 3G35A 3MXRA 4E3IA 1FSWA 1VEUB 2HDQA 1YLWA 2OLUA 3ZVTA 1LL8A 1T19A 2PAVP 2Y2HA 3BLSA 1CF0A 2EWVA 3NECA 1G6AA 4HJ4A 1L0EA 3QP6A 3EOIA 3ZFZA 1S67L 3UDIA 3D3OA 3L9KA 3P01A 4JF5A 2BASA 2C5WB 4PM6A 1ZG6A 1GHMA 1RCJA 1HVBA 4DJ3A 2HJ9C 2Y79A 5L10A 1IOUA 1MPLA 4IJGA 1DP6A 4CJNA 2BG1A 1LI9A 4PHTA 5BOHA 5I94A 4BENA 2W3EA 3EQVA 4WMCD 2ZC3B 4F3LA 2W3GA 3SZTA 4GS9A 4QPRA 5EVID 1CEGA 5EVIB 1G6OA 1E25A 4G3VA 1OMEA 3IXDA 4R3AA 3Q1FA 2Y2NA 5FAQA 1S1ZA 1NJ4A 2FZ0A 2H0TA 1LSWA 2WKPA 2AVXA 3TRCA 2E8JA 1XJ2A 3QP1A 2X02A 3MR0A 1PIOA 4NXGA 5FI6A 2PD8A 4DE1A 2KOIA 1TS6A 4Q8IA 5DKKA 1FIKA 3N7WA 2VGLM 4O8GA 4Y13A 3UB7A 3T1RA 5JYOA 3P09A 3T4KA 4BJPA 1T1AA 3LUQA 1F5MA 4LENA 4RVAA 1W5DA 2R9XA 2L0WA 3TW8A 3A0RA 1YT4A 1F9IA 4EW7A 1TVFA 4GKUA 2Y4AA 3FWLA 4UEYA 5FQMA 2QPNA 3I7JA 2ZOHA 3IBRA 1PYYA 5EUAA 4S2MA 3WRZA 3JVVA 5HARA 5HWWA 1H8YA 2W1RA 3NDGA 3KSFA 3VE4A 4U0TA 3UMDA 2V8CA 4GB7A 5IT5A 2UWXA 2WKQA 5CEBA 3HLCA 3S7PA 2QYBA 3D9YA 3BFGA 2Y55A 5K5BA 1YMSA 4NXBA 4LPZA 5F82A 2V8FA 1SDNA 2EX9A 4KZAA 3KYZA 3BFEA 4OOMA 2PU4A 5FL3A 3HUNA 4JXVA 4DXBA 3BRMA 4XT2B 3DWKA 1CI8A 3HL9A 1SKFA 1A0KA 4GZBA 2JKGA 5L2FA 4KENB 4WLAA 1XFNA 3IX4A 1NWZA 2WKIA 4LFUA 1NXYA 1K6RA 4A5RA 2X01A 1N9OA 2ZL1A 2ZC4B 2I72A 2V9AA 4UQIS 2XRNA 3LIDA 5M19A 5GL9A 3MZDA 2B5RA 1U60A 3PAGA 2B95A 4OOYA 3ITBA 2ZM8A 2A49A 5FQ9A 4KZ4A 1YLTA 4HOIA 3MQQA 2HV1A 2V1AA 4MN5A 3V67A 3HJKA 1E3UD 2WZXA 3K3CA 3E0YA 5D3OA 2KX6A 4B88A 4JXWA 3C38A 4X69A 1XGJA 4N9LA 5L07A 3O3VA 5GLDA 2H0YA 3LR3A 2JE5A 4IUKA 1S1YA 5DF7A 2W0NA 2H5SA 1H8ZA 3T4OA 3DTIA 1MKIA 4C75A 1VQQA 3OZHA 4OQIA 4I3IA 3E2KA 1N4OA 4XUZA 2VV8A 1DP8A 3UE6A 5HAQA 4JKTA 3MFXA 3IWOA 3AGEA 4I39A 4E3OA 4PAUA 2ZC7A 3ZHHA 1ACFA 4MEZA 2HF6A 1LL9A 4EQIA 1FCOA 5M18A 1XPBA 2JKTM 3E2LA 4OPZA 3GDIA 2PHYA 1LL5A 2PYRA 4HBTA 2L4RA 1H8MA 2ZQ7A 2HPBA 1K55A 4KQDA 1T1CA 3QNBA 2MJ6A 3VOYA 3TSGA 1FCMA 1XFQA 2XH9A 1S66L 2VA0A 1OTAA 4LV1A 2W1TB 3AGFA 1K56A 4WYYA 4ARZB 4Q0IA 2HDSA 3SOIA 1DJAA 2INWA 1C3BA 5EE8A 4DJ2A 4UA7A 4R3BA 1LT0A 4EEUA 3QNCA 2W3FA 2H28A 3NY4A 2ZLYA 1XJ3A 4GD8A 4FH2A 2V1BA 3PBOA 1XKZA 3ISGA 3T12B 4BBTA 2H10A 2OAQ1 4HH2A 1J3WA 1KGEA 1W63M 1MC0A 4YINA 3MFDA 3BM6A 4P0MA 5AJGA 3HLFA 2QHKA 2OAP1 4QHCA 3Q7ZA 4FTXA 3T4LA 3V3SA 5HWVA 2JC7A 3NCKA 5F1FA 3FYZA 1HLUP 4L9EA 4PMAA 2WKEA 2YKHA 3MMHA 3C8CA 3V5MA 3EWKA 5GLAA 5TBMB 4K08A 5J3WA 4I3AA 2EA9A 2Y2PA 1O7EA 3SS5A 2VEAA 5EOOA 2D02A 5FDSA 4X68A 4R70A 2ZQ8A 2VLGA 3UPPA 3PTEA 3S4XA 3W4OA 3R7WB 1V9ZA 1PI4A 5AQAA 1HTZA 4EUVA 4L9GA 3LGOA 5KZHA 4DXCA 2JKRI 5IS1A 1SKOB 4EETB 5DTKA 2PRFA 3CZDA 2P9VA 1LSVA 4OQHA 3IX3A 1MWSA 4ZDXA 4DMZA 1OT9A 1VM1A 2V0WA 3PHYA 1P9RA 1EWZA 5I5LA 3UPNA 3UMEA 1W79A 3EQUA 4WN5A 1RGYA 3FC7A 4NG2A 1I5QA 3QP5A 4DN0A 1SCWA 4YWZA 4PM5A 1I2SA 1L0DA 3C4OA 1WA9A 1IYSA 1KE4A 3CG5A 3H82B 4MN7A 4FSFA 2WYXA 3PBRA 1JVJA 4IVKA 3FV7A 4P85A 4G3KA 5EVEA 4O7DA 4DE0A 4FD8A 3A0VA 3H7WB 4CLCD 2QWSA 4N1XA 2A24A 5TR7A 3U2AA 5M1AA 3VSLA 4LV2A 1OTIA 1TS8A 3SW1A 1FCNA 5IHVA 3IH9A 3F1PA 1YAXA 4GHIB 4BWIA 4E04A 4R6LA 3F1NB 1GSVA 2VGKA 1W7FA 2BLSA 4OLDA 5JYPA 3H9WA 4FOFA 5G4YA 2VZWA 2PYPA 2PU2A 3BW6A 3LR5A 4GJ4A 4JGQA 2O9AA 4R38A 1KDSA 3GMWA 2XR0A 5AQBA 3B3XA 1ONGA 1MXOA 1NY0A 3VOLA 2XEPA 1FR1A 2C6WB 1MY8A 2VV6A 1LLBA 5CHJA 1I2WA 4JBFA 1ES4A 3VSKA 1BULA 2Z6CA 3UB5P 1STZA 1TEMA 2FFFB 4GDBA 4H6JA 3WRTA 1F2KA 3IQAA 3MZEA 1VHMA 5F5YA 3CLOA 4K0WA 1BUEA 3IF6A 5FSRA 3FZCA 5A93A 3FPVA 2XDMA 3IH8A 2NUTC 4X1LA 1IELA 5FI2A 2WKRA 4O0PA 5CGSA 4HEFA 3HJIA 2I9VA 2D01A 4N92A 3UNWA 4BQMA 4NXEA 2ZC5B 2VGLS 2EXBA 4E3MA 4OQGA 2J8YA 4WZ5A 1FSYA 2WUQA 2JKFA 1L3LA 4PPRA 2WK0A 1Q2PA 2J9OA 1K4FA 2OOLA 1T18A 5HW3A 1XX2A 4F3LB 4GS9B 4U3TA 3PXPA 2Z2MB 2QJ7A 3SH7A 4B4ZA 4G3WA 1CJFA 1NLYA 2JN7A 1CQAA 3BECA 4EBLA 1NZUA 4PM7A 1NYYA 4BMWA 4RX2A 2P7JA 2Q9MA 4HJ6A 4NXFA 4KZ5A 4EESA 1BZAA 2P08A 2PT7A 3Q82A 1ERQA 3G30A 1XGIA 4CLCC 4LRYC 3FKVA 2G2WA 1IKIA 2Z6DA 2LB9A 2ZMAA 3MXSA 1F98A 3MS6A 3UO9A 1IYPA 5EOEA 3LEZA 1NRFA 3CI6A 1HD8A 1CI9A 5FQJA 3T4TA 2HDRA 3W2ZA 2WAEA 4OLGA 4S2NA 1NLZA 3OOVA 3L7HA 5G18A 3T4SA 1UWPX 4LV0A 4ZBEA 1N9LA 1BLPA 3BQ8A 2Y8HA 4ETXA 1IYOA 3AGDA 3IS2A 5TJJA 2PR6A 1YQSA 4I38A 4UA6A 5FI7A 1VB6A 1KE3A 1LHYA 2B18A 3LY4A 1NRJA 5FAPA 2PBYA 2O0YA 1PW8A 4Y7PA 1DJBA 3OCLA 4WL9A 4HIAA 1H5XA 3VV4A 3ZDJA 5GHXA 3NOTC 5J7EA 4WBGA 4S2JA 3CMZA 2DMWA 3N4IA 5DKLA 5CTMA 1GCEA 2J9PA 2IWBA 3A0SA 1Q2QA 3NOPC 5CX7A 2OWHA 3OPPA 1CEFA 5HPFA 4S2OA 3N6IA 4OKPA 2X71A 3M6BA 3T1QB 4MCWA 3LIAA 1OTBA 2WADA 2XK1A 3PBQA 1TS0A 2ZMVA 3BFCA 4I3JA 5J8XA 4KUKA 1PW1A 2O9CA 1N9NA 4OPYA 1TDGA 3NULA 5GLBA 5DTSA 2FFYA 2OSUA 1S0WA 2JCHA 3LO7A 3VOZA 3LI9A 1ESIA 4OOLA 4N9KA 2GNXA 4Q0HA 5CHMA 4Y0UA 4QD4A 1MKMA 4Y2FA 4X55A 3DAVA 3S1YA 4JGRA 3Q81A 5FATA 4DKIA 1KGFA 1L2SA 1L0GA 1K57A 2Y2IA 1YLZA 2EX2A 3Q7VA 2Z2LB 4UAAA 4GOGA 3RH8B 1YLYA 1MWUA 1ZTUA 5HAIA 2B02A 3E4OA 2XA7M 3OPRA 5FEGA 4X1MA 5AQ7A 1ZHHB 1BTLA 3T50A 3DWZA 1MWTA 2R78A 3LIBA 2W27A 4C6YA 1XA7A 2VKSA 4S2PA 5TGFA 3LFVA 2PR5A 3EGXC 3MZFA 3MXQA 2J80A 4HQAA 4O01A 5F83A 3ULFA 3VE3A 4KZ8A 4CQHA 3JPUA 4S2IA 2EX8A 4GDNA 3UPOA 3HLEA 1OTEA 2JHEA 1JWVA 4S2NC 1K56D 1KOUA 3C2WA 3CPTA 1YPRA 1ES5A 3ICYA 4EBPA 3S22A 1KVMA 4JPMA 5CGXA 3ZG7B 1XXMA 5LBRA 5E43A 1BLCA 1ERMA 2HP5A 4ARZA 3OPHA 4LLOB 4HBUA 4EQ1A 3LI8A 3S7QA 3JYIA 2G7UA 2V20A 3LEQA 2LB5A 2IA2A 1DP9A 5KIZA 4UA9A 3ZGAB 4R4RA 5DTTA 3A3EA 5HL1A 3NHQA 4EERA 1H3QA 4R1GA 4P6ZM 1FR6A 1XP4A 4OH0A 4H8RA 4E3JA 1SDEA 3O5YA 4FH4A 1XJ6A 2FH5A 3G2YA 3ZG0A 3EEHA 2Y2OA 4MLLA 3GR2A 3BWLA 4B4XA 2W3HA 4S2KA 4ZAMA 4ID4A 3KSHA 4HH3A 3HLBA 5EM0A 3RXXA 2J7VA 3D4FA 3N8SA 1YKDA 3TOIA 1FOFA 4LV3A 4R3JA 2IWDA 4D60A 4PKYA 5TBMA 4M4XA 4HI4A 3DBAA 3U4LP 5CGWA 2HJEA 2GZAA 4U0XA 1S4RA 4ZTKA 4NEED 2A3UA 3RXWA 2EX6A 4EXOA 3GECA 2ZQ9A 3LCEA 5GLCA 3V50A 2Y91A 2XSSA 1RGZA 2GDNA 5DF8A 4K91A 1D06A 4OP8A 2V0UA 4WM9A 3T4JA 2OLVA 3WS1A 1CK3A 1UGUA 1JTDA 1XA1A 3B33A 1PZOA 5F68A 4I5SA 5U47A 3LR4A 5KMWA 2WGWA 2NUPC 1ESUA 5HD5A 4PM8A 3VP0A 1SKOA 2P9VB 2ZQCA 3GVBA 3F1OA 3G6OA 3BJNA 5E2GA 4B93A 1BSGA 1JTGA 1L0FA 4JXSA 4NETA 5MC7A 2DCFA 2HZ5A 3E4PA 1FILA 3SS3A 3HBRA 2P04A 2EFUA 3TG9A 4OPQA 3C30A 4BLMA 4R23A 1DJCA 2ZQDA 3VP2A 1K55C 2CC1A 3ITAA 3G31A 4X25A 2QJ5A 4HHDA 2O99A 5HX9A 1GA0A 5F69A 4MNRA 4ZJ3A 4IUHA 5C5KA 4II7A 4QY6A 5CXWA 4GN2A 4PKYG 3G34A 3MSHA 1O07A 2HDUA 2ACGA 1LI0A 4CLCB 2Y2MA 4Y15A 1IYQA 4GD6A 4HNBA 5FASA 2ZJ9A 5E2FA 4KZBA 2ZBBA 3QP8A 3UB9A 2A24B 4BBVA 3M6HA 1GA9A 4DE2A 4LRZE 3GQZA 3UN7A 3C7UA 2J3TD 3GRJA 3F1PB 1YSQA 3VFFA 2WGIA 1YMXA 4EWFA 4KZ9A 2WAFA 3N8LA 3A3FA 3WS4A 3F1NA 3CITA 3VP3A 3WS0A 2RCXA 3HLDA 2WKHA 5HL6A 3ZG9B 3C7VA 4B9OA 3Q07A 5CTNA 2XFSA 1SZVA 4KQQA 4ZJ2A 2L1MA 1TF1A 3KO6A 3NDEA 5HAPA 4K0XA 4FCFA 4H6JB 4JLFA 1TD5A 2QZ6A 3SS4A 3VP4A 1VETA 3IF6B 1UWNX 3VMAA 1YLJA 2A2LA 3KSGA 1ODVA 4YNRA 1PNEA 3BQAA 1VEUA 2DRWA 2OV5A 4IVIA 2M7VA 1TS7A 3KYQA 4IHQA 3HUOA 3SH9A 4KG2A 3T1SA 1SHVA 4LRXC 3DTMA 4ETZA 4BL2A 4LCMA 2QMIA 4PM9A 3IHBA 4KZ6A 3ZNTA 1K38A 4HP4A 4YOFA 4RYEA 4NKPA 4F94A 4X53A 2ZQAA 1QMEA 4WMCA 1GHPA 3C4PA 5EVIA 3T1XA 3KYEA 3A3IA 4MDZA 3HREA 1P9WA 3E98A 4HJ3A 5KSCA 2E8IA 1HZOA 5DVAA 3LR0A 3UDFA 4LGWA 4WEJA 1IEMA 5G4ZA 1K6SA 3FPWA 4KUOA 4BD0A 2OWJA 1W8QA 3BEBA 3W8KA 1OTDA 5CRFA 3ZG8B 3W4PA 2J3TC 5EVLA 4EV4A 4OVDA
chains in the Genus database with same CATH topology
3RH8B 1MZUA 1ZTUA 2ZMFA 4WUJA 3R7WB 4EEPA 2K31A 3NOUC 2B02A 3E4OA 2XA7M 5AVFA 1EW0A 1V9ZA 1P97A 2EWWA 4EUVA 1ZHHB 5L8MA 1DRMA 5AVEA 3LICA 1OPXA 3T50A 4L9GA 3OC2A 1JNUA 2R78A 3IBJA 3LIBA 2W27A 2VKSA 3NJAA 2JKRI 3IS2B 3RTYA 2ZOIA 5IS1A 3LFVA 3B42A 4ME4A 1GSWA 2PR5A 4Y5FA 4EETB 2GX5A 4RQ9A 3EGXC 2J3WA 4KQOA 3MXQA 2J80A 4HQAA 4O01A 3ULFA 3VE3A 1LSVA 4Y3IA 4CQHA 4DMZA 1LL8A 1T19A 2HGVA 1OT9A 1OTEA 2EWVA 2JHEA 2V0WA 3PHYA 1P9RA 3MQ0A 5I5LA 1KOUA 4XT2A 3UMEA 3C2WA 3EQUA 4WN5A 4HJ4A 3ICYA 5KSHA 3EOIA 1S67L 3D3OA 3FC7A 3MJQA 4DN0A 3P01A 5LBRA 2K2NA 4YWZA 4ARZA 2BASA 2PDRA 4LLOB 4DJ3A 2HJ9C 2Y79A 1IOUA 1WA9A 5DFYA 4IJGA 4EQ1A 1DP6A 2O9BA 3LI8A 3S7QA 2G7UA 3H82B 2LB5A 4MN7A 2IA2A 4PHTA 4FSFA 1DP9A 2W3EA 3B47A 5KIZA 3PBRA 3EQVA 3NHQA 4EERA 4G3KA 4F3LA 2W3GA 1H3QA 3EEAA 4GS9A 4QPRA 2XA7S 1G6OA 4G3VA 4P6ZM 4BBUA 3A0VA 3H7WB 4CLCD 4R3AA 2KLIA 3O5YA 5DJTA 1XJ6A 2QWSA 2FH5A 2A24A 1S1ZA 3U2AA 3EEHA 1OTIA 1TS8A 3SW1A 2FZ0A 1LSWA 3BWLA 2WKPA 3F1PA 3TRCA 1YAXA 2W3HA 1XJ2A 4GHIB 4BWIA 3MR0A 4E04A 4R6LA 3KSHA 4HH3A 3F1NB 4NXGA 1GSVA 3CUEA 1Y28A 3H9WA 4FOFA 5G4YA 2PD8A 2VZWA 1YKDA 2KOIA 1TS6A 2PYPA 5DKKA 2VGLM 3BW6A 3LR5A 4O8GA 4PKYA 4UQIM 5TBMA 4GJ4A 4JGQA 4Q0JA 3UB7A 2O9AA 4R38A 4M4XA 3T4KA 4BJPA 4HI4A 1T1AA 3DBAA 3LUQA 1F5MA 2HJEA 4WEKA 2GZAA 5HWTA 1S4RA 4NEED 1OJ5A 3VOLA 2L0WA 3TW8A 2JKTI 2YKFA 3A0RA 3UB6A 1F9IA 4EW7A 4EXOA 3GECA 2VV6A 4UEYA 2M1CA 2XSSA 4GLQA 3IBRA 2ZOHA 3CWFA 5IU1A 5J4EA 3PYPA 1D06A 3JVVA 5HWWA 2V0UA 2Z6CA 3T4JA 1STZA 2W1RA 4HP9A 1UGUA 3KSFA 3VE4A 3B33A 3OLOA 3UMDA 4AFIA 4H6JA 5F68A 5IT5A 2WKQA 4I5SA 3S7PA 2QYBA 3LR4A 1VHMA 5F5YA 3CLOA 2NUPC 5K5BA 4NXBA 5HD5A 4LPZA 3KYZA 4P6ZS 3RFBA 4OOMA 5HDCA 3F1OA 3G6OA 3BJNA 3HCYA 4B93A 5DJUA 5FL3A 3S7OA 3FPVA 2KDKA 3MF0A 5MC7A 2GJ3A 2PD7A 3E4PA 2NUTC 4Z1WA 2W1TA 2WKRA 3BY8A 4XT2B 2P04A 4O0PA 1G28A 3D72A 3HJIA 2I9VA 5HDSA 2D01A 4WLAA 1XFNA 1NWZA 3C30A 4NXEA 3ZYTA 2VGLS 1N9OA 3TJZC 2V9AA 4UQIS 1V9YA 2XRNA 3LIDA 2QJ5A 4HHDA 2O99A 3P7NA 5F69A 4IUHA 5C5KA 4II7A 1IFQA 4JGOA 4PKYG 2OOLA 1T18A 4F3LB 3OBFA 4GS9B 2CMNA 4CLCB 3PXPA 3K2NA 4HOIA 4EU0A 2QJ7A 3MQQA 4HNBA 2HV1A 3UE3A 2V1AA 4MN5A 3V67A 4G3WA 5HDDA 1NLYA 3HJKA 2JN7A 2ZBBA 3FG8A 3UB9A 2W3DA 2A24B 4CLCE 4BBVA 3LYXA 4LRZE 3K3CA 3R4KA 4ZRRA 3E0YA 4GCZA 2J3TD 3F1PB 1OJGA 2VX8A 1YSQA 1S4SA 2KX6A 3C38A 4BMWA 3KSIA 3OCNA 5F6AA 2P7JA 4HJ6A 4NXFA 3LR3A 3F1NA 4EESA 2P08A 4IUKA 3PBSA 2PT7A 1S1YA 2W0NA 3CITA 4CLCC 4LRYC 3T4OA 2Z6DA 3S7NA 2LB9A 5HL6A 4I3IA 1F98A 4B9OA 2VV8A 5EFWA 5HSQA 1DP8A 3UE6A 3R7WA 3CI6A 4MN6A 3T4TA 3MFXA 3W2ZA 3CUEC 4I39A 4PAUA 2L1MA 1TF1A 1NLZA 3OOVA 3TE8A 3EGDC 3KO6A 3T4SA 1UWPX 3LIEA 2HF6A 1XJ4A 4H6JB 1N9LA 3BQ8A 5DFXA 2Y8HA 4ETXA 5DF9A 3IS2A 1TD5A 1LSXA 5TJJA 3T4QA 2JKTM 3JVUA 4L0LA 1UWNX 3GDIA 2PR6A 2M7UA 4I38A 2A2LA 2PHYA 2PYRA 2L4RA 3KSGA 1VB6A 1H8MA 3F1OB 2B18A 1NRJA 1ODVA 2O0YA 4L9FA 4KQDA 4YNRA 1T1CA 3BQAA 3OCLA 2MJ6A 4WL9A 2JKRM 1XFQA 1S66L 2VA0A 4HIAA 1OTAA 4HY8A 2M7VA 3VV4A 3NOTC 2W1TB 5J7EA 1TS7A 3KYQA 4IHQA 1P0ZA 1BYWA 4LRXC 3K3DA 4ETZA 4ARZB 2DMWA 4Q0IA 5DKLA 1X0OA 2INWA 5HZHA 4DJ2A 3A0SA 5HD3A 1LT0A 1YSPA 4EEUA 1T1BA 3PBTA 3NOPC 5CX7A 2OWHA 1OT6A 4HP4A 4YOFA 2W3FA 5HPFA 1D7EA 4NKPA 2H28A 2QKPA 3UB8A 2XROA 1XJ3A 4WF0A 3H82A 4MCWA 3LIAA 3KX0X 2V1BA 1OTBA 5HPIA 4WELA 2VV7A 3PBQA 1TS0A 2ZMVA 3PBOA 4I3JA 2VJWA 4KUKA 4BBTA 2O9CA 1N9NA 2OAQ1 4GW9A 3CAXA 4HH2A 3PBNA 1W63M 1MC0A 3H7WA 3PR6A 4MDZA 4CLCA 1P9WA 5A8BA 3E98A 5AJGA 3LIFA 2QHKA 2OAP1 4HJ3A 3T4LA 3LI9A 3BY9A 4OOLA 2GNXA 5HWVA 4Q0HA 4GHIA 1W63Q 4L9EA 3LR0A 1MKMA 4Y2FA 4WEJA 2YKHA 2K7SA 3MMHA 3C8CA 3ZQ5A 5G4ZA 3EWKA 5TBMB 4K08A 5J3WA 3FPWA 4I3AA 4KUOA 4JGRA 1GSXA 2EA9A 2OWJA 3E4QA 3MQOA 4MMNA 1OTDA 2VEAA 2D02A 2J3TC 4R70A 4JGPA 2VLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RH8 B;  1MZU A;  4WUJ A;  4EEP A;  3NOU C;  2B02 A;  3E4O A;  5AVF A;  1EW0 A;  1V9Z A;  1P97 A;  1DRM A;  5AVE A;  3LIC A;  3T50 A;  4L9G A;  1JNU A;  2R78 A;  3LIB A;  2W27 A;  3NJA A;  3IS2 B;  3RTY A;  2ZOI A;  5IS1 A;  1GSW A;  2PR5 A;  4EET B;  4RQ9 A;  3MXQ A;  2J80 A;  4HQA A;  3ULF A;  3VE3 A;  1LSV A;  1LL8 A;  1T19 A;  1OT9 A;  1OTE A;  2JHE A;  2V0W A;  3PHY A;  5I5L A;  1KOU A;  4XT2 A;  3UME A;  3C2W A;  4WN5 A;  4HJ4 A;  3ICY A;  1S67 L;  3FC7 A;  3MJQ A;  4YWZ A;  2BAS A;  2PDR A;  4LLO B;  4DJ3 A;  1WA9 A;  4EQ1 A;  1DP6 A;  3LI8 A;  3H82 B;  1DP9 A;  5KIZ A;  3NHQ A;  4EER A;  4F3L A;  4GS9 A;  4BBU A;  3A0V A;  3H7W B;  4R3A A;  5DJT A;  1XJ6 A;  2QWS A;  2A24 A;  1S1Z A;  3EEH A;  1OTI A;  1TS8 A;  3SW1 A;  1LSW A;  3BWL A;  2WKP A;  3F1P A;  1XJ2 A;  4GHI B;  3MR0 A;  4E04 A;  4R6L A;  4HH3 A;  3F1N B;  4NXG A;  1GSV A;  1Y28 A;  3H9W A;  5G4Y A;  2PD8 A;  1TS6 A;  2PYP A;  5DKK A;  4PKY A;  5TBM A;  4JGQ A;  3UB7 A;  4R38 A;  4M4X A;  4HI4 A;  1T1A A;  3LUQ A;  5HWT A;  1S4R A;  1OJ5 A;  3VOL A;  2L0W A;  2YKF A;  3A0R A;  3UB6 A;  1F9I A;  4EW7 A;  4EXO A;  3GEC A;  2VV6 A;  2M1C A;  3IBR A;  2ZOH A;  3CWF A;  5IU1 A;  5J4E A;  3PYP A;  1D06 A;  5HWW A;  2V0U A;  2Z6C A;  4HP9 A;  1UGU A;  3VE4 A;  3B33 A;  3OLO A;  3UMD A;  4H6J A;  5F68 A;  2WKQ A;  4I5S A;  5F5Y A;  3CLO A;  4NXB A;  5HD5 A;  4LPZ A;  5HDC A;  3F1O A;  3G6O A;  5DJU A;  2KDK A;  2GJ3 A;  2PD7 A;  3E4P A;  2WKR A;  3BY8 A;  4XT2 B;  1G28 A;  3D72 A;  3HJI A;  2I9V A;  5HDS A;  2D01 A;  4WLA A;  1XFN A;  1NWZ A;  4NXE A;  1N9O A;  2V9A A;  1V9Y A;  3LID A;  2QJ5 A;  4HHD A;  3P7N A;  5F69 A;  4JGO A;  4PKY G;  2OOL A;  1T18 A;  4F3L B;  4GS9 B;  2CMN A;  4HOI A;  2QJ7 A;  3MQQ A;  4HNB A;  2HV1 A;  2V1A A;  4MN5 A;  5HDD A;  3HJK A;  2JN7 A;  2ZBB A;  3FG8 A;  3UB9 A;  2A24 B;  4BBV A;  3LYX A;  4LRZ E;  3K3C A;  4GCZ A;  1OJG A;  3F1P B;  1S4S A;  2KX6 A;  5F6A A;  2P7J A;  4HJ6 A;  4NXF A;  3F1N A;  4EES A;  1S1Y A;  2W0N A;  4LRY C;  2Z6D A;  4I3I A;  1F98 A;  4B9O A;  2VV8 A;  5EFW A;  5HSQ A;  1DP8 A;  3UE6 A;  4MN6 A;  3MFX A;  4I39 A;  2L1M A;  1UWP X;  3LIE A;  1XJ4 A;  4H6J B;  1N9L A;  3IS2 A;  1LSX A;  1UWN X;  3GDI A;  2PR6 A;  4I38 A;  2PHY A;  2PYR A;  2L4R A;  1VB6 A;  3F1O B;  1ODV A;  4L9F A;  4KQD A;  1T1C A;  4WL9 A;  1XFQ A;  1S66 L;  4HIA A;  1OTA A;  4HY8 A;  3NOT C;  5J7E A;  1TS7 A;  1P0Z A;  1BYW A;  4LRX C;  3K3D A;  5DKL A;  1X0O A;  2INW A;  5HZH A;  4DJ2 A;  3A0S A;  5HD3 A;  1LT0 A;  4EEU A;  1T1B A;  3NOP C;  2OWH A;  1OT6 A;  4HP4 A;  1D7E A;  2H28 A;  2QKP A;  3UB8 A;  1XJ3 A;  4WF0 A;  3H82 A;  3LIA A;  3KX0 X;  2V1B A;  1OTB A;  2VV7 A;  1TS0 A;  4I3J A;  4KUK A;  4BBT A;  1N9N A;  4GW9 A;  3CAX A;  4HH2 A;  3H7W A;  5A8B A;  3LIF A;  2QHK A;  4HJ3 A;  3LI9 A;  3BY9 A;  5HWV A;  4GHI A;  4L9E A;  2YKH A;  2K7S A;  3ZQ5 A;  3C8C A;  5G4Z A;  3EWK A;  5TBM B;  4K08 A;  5J3W A;  4I3A A;  4KUO A;  4JGR A;  1GSX A;  2EA9 A;  2OWJ A;  3E4Q A;  3MQO A;  1OTD A;  2VEA A;  2D02 A;  4R70 A;  4JGP A;  2VLG A; 
#chains in the Genus database with same CATH topology
 1MZU A;  3IXB A;  1NZO A;  2ZMF A;  4WUJ A;  4EEP A;  2K31 A;  3NOU C;  3NC8 A;  1EW0 A;  1P97 A;  1JWP A;  2EWW A;  3VP1 A;  2BTF P;  3IWQ A;  5FDH A;  4Y17 A;  2HP9 A;  2V1Z A;  3LIC A;  3IWI A;  1OPX A;  3IF5 A;  3OC2 A;  3DW0 A;  4DDY A;  4S2L A;  2XGN A;  3NJA A;  4KZ3 A;  3IS2 B;  1GSW A;  4Y5F A;  2GX5 A;  1MWR A;  4IBR A;  4KQO A;  4R0Q A;  4WZ4 A;  1PWD A;  2Q9N A;  2V2F F;  3O88 A;  1WE4 A;  4Y3I A;  4MBH A;  3UE0 A;  3MBZ A;  2HGV A;  5CEC A;  3MQ0 A;  4XT2 A;  4D2O A;  4QB8 A;  3DTE A;  1BT5 A;  2ZL1 B;  4DRT A;  5KSH A;  4KZ7 A;  3IF6 C;  3IXH A;  3BYD A;  3MJQ A;  4BD1 A;  2K2N A;  4Y0T A;  4OP5 A;  1K4E A;  2PDR A;  4M3K A;  2XF3 A;  4KQR A;  5DFY A;  2O9B A;  1H0M A;  4JF6 A;  3B47 A;  4QY5 A;  4X6T A;  1PFL A;  1NYM A;  3OPL A;  4P6B A;  4Y0O A;  3EEA A;  2XD1 A;  5E2H A;  2XA7 S;  3WWX A;  4BBU A;  2KLI A;  5DJT A;  1Y54 A;  1E3U A;  1ERO A;  3HVF A;  4WZ5 C;  5EPH A;  1PWC A;  3G4P A;  5CHU A;  3CUE A;  1YLP A;  3RJU A;  1Y28 A;  5FAO A;  4IED A;  3V3R A;  3ZVW A;  1IKG A;  4UQI M;  1ES2 A;  4Q0J A;  2Y2G A;  2VK3 A;  5EVI C;  2EXA A;  1K0K A;  3GTC A;  4MBF A;  1WYB A;  2Q0O A;  4OON A;  4WEK A;  3Q7V B;  5E2E A;  5HWT A;  3WS5 A;  4RA7 A;  1OJ5 A;  5FEF A;  2JKT I;  2YKF A;  3UB6 A;  5AQ9 A;  4C3Q A;  1KVL A;  2M1C A;  3PAE A;  4GLQ A;  3SH8 A;  3CWF A;  5IU1 A;  4QWO A;  5J4E A;  3PYP A;  3O86 A;  3UDX A;  1N9B A;  4YFM A;  4HP9 A;  3OLO A;  1JWZ A;  5FQI A;  4AFI A;  2XD5 A;  4N1H A;  4NK3 A;  3QP4 A;  2R9W A;  4P6Z S;  3RFB A;  5HDC A;  3HCY A;  4X56 A;  5DJU A;  1ALQ A;  3UE1 A;  5EV0 A;  3S7O A;  4IBX A;  2KDK A;  3MF0 A;  1GHI A;  2GJ3 A;  2PD7 A;  3IX8 A;  3UY6 A;  4Z1W A;  2P74 A;  3W4Q A;  2G2U A;  2W1T A;  3BFD A;  3BY8 A;  4E3L A;  4KG6 A;  5F1G A;  1ONH A;  3CPT B;  1G28 A;  3D72 A;  5HDS A;  3VFH A;  2Y59 A;  5HFO A;  3ZYT A;  3IHA A;  3P98 A;  3TJZ C;  1V9Y A;  2ZM0 A;  4ZJ1 A;  3GSG A;  3P7N A;  2ZM2 A;  1IFQ A;  4JGO A;  1S6R A;  3QHY A;  4ESP A;  2HP6 A;  3OBF A;  4RX3 A;  2CMN A;  1PZP A;  4Z9Q A;  5TFQ A;  3K2N A;  4EU0 A;  1RP5 A;  3UE3 A;  5HDD A;  3FG8 A;  2W3D A;  4CLC E;  3LYX A;  3R4K A;  4ZRR A;  4GCZ A;  3LY3 A;  4P87 A;  1OJG A;  4DF6 A;  2VX8 A;  1MBL A;  1S4S A;  3NIA A;  5EEC A;  1D1J A;  1J9M A;  4JF4 A;  3M2J A;  1ES3 A;  3KSI A;  3OCN A;  5F6A A;  4GNU A;  3N8R A;  4MBK A;  4QJG A;  4CPK A;  3HLG A;  1ZC2 A;  2XLN A;  3PBS A;  1KGG A;  2Y2Q A;  1G68 A;  5L09 A;  5A91 A;  3S7N A;  1K54 A;  3IXG A;  5HSQ A;  5EFW A;  3NBL A;  3R7W A;  3HUM A;  3ZNY A;  5FA7 A;  4FUW A;  1KE0 A;  4MN6 A;  3CUE C;  3A3J A;  1FQG A;  3TE8 A;  3WS2 A;  4BL3 A;  2XFT A;  3EGD C;  4XXR A;  1DY6 A;  5EM1 A;  3LIE A;  3O87 A;  1K57 C;  1XJ4 A;  4OPR A;  5DFX A;  4DDS A;  5DF9 A;  2WGW B;  1LSX A;  3T4Q A;  3JVU A;  4L0L A;  2M7U A;  4EUZ A;  3F1O B;  1TDL A;  1E4D A;  3C5A A;  4L9F A;  1W8Y A;  2ZD8 A;  4DE3 A;  2JKR M;  3G2Z A;  3MKE A;  4HY8 A;  5A92 A;  1EI5 A;  2PBD P;  5FQK A;  1P0Z A;  1BYW A;  4EBN A;  3K3D A;  2JBF A;  3FKW A;  1X0O A;  5HZH A;  1Z6F A;  5GHZ A;  1QMF A;  5HD3 A;  5CER A;  1YSP A;  3MKF A;  1T1B A;  5FQQ A;  1YM1 A;  3PBT A;  1OT6 A;  1D7E A;  4E6W A;  4HES A;  5GHY A;  2QKP A;  3UB8 A;  2XRO A;  1PI5 A;  3H82 A;  4WF0 A;  3CJM A;  2IWC A;  3KX0 X;  3DTK A;  5HPI A;  3V39 A;  4WEL A;  2VV7 A;  2VJW A;  1Z09 A;  1BLH A;  4OQ0 A;  4E3K A;  1K25 A;  3BFF A;  4GW9 A;  3CAX A;  3PBN A;  3H7W A;  3PR6 A;  4UHU A;  4CLC A;  5A8B A;  3GV9 A;  3QP2 A;  1Y4O A;  3LIF A;  2DNS A;  4XUX A;  2WZZ A;  3BY9 A;  3IT9 A;  3NI9 A;  1M40 A;  3HLW A;  4KG5 A;  5A90 A;  4GHI A;  1AXB A;  1W63 Q;  2UV0 E;  2Y2K A;  5CED A;  1WYC A;  2K7S A;  3ZQ5 A;  3CHW P;  1PWG A;  1BLS A;  3ZG5 A;  1PRQ A;  1GSX A;  2ZC6 B;  4LCL A;  3E4Q A;  2WGV A;  3MQO A;  4MMN A;  4E6X A;  4R4S A;  4JGP A;  2Y2L A;  1AWI A;  3M2K A;  3ZCZ A;  3BLM A;  5AVF A;  2EFX A;  2VGJ A;  5L8M A;  1DRM A;  4QU3 A;  5AVE A;  3A3D A;  1ZG4 A;  2RL3 A;  4JXG A;  2XQZ A;  1JNU A;  3IBJ A;  1ZKJ A;  2Y2J A;  3RTY A;  2ZOI A;  3G32 A;  4ME4 A;  3B42 A;  1VET B;  4RQ9 A;  1K54 C;  1M6K A;  1KDW A;  2J3W A;  4E3N A;  1G5U A;  3G35 A;  3MXR A;  4E3I A;  1FSW A;  1VEU B;  2HDQ A;  1YLW A;  2OLU A;  3ZVT A;  1LL8 A;  1T19 A;  2PAV P;  2Y2H A;  3BLS A;  1CF0 A;  2EWV A;  3NEC A;  1G6A A;  4HJ4 A;  1L0E A;  3QP6 A;  3EOI A;  3ZFZ A;  1S67 L;  3UDI A;  3D3O A;  3L9K A;  3P01 A;  4JF5 A;  2BAS A;  2C5W B;  4PM6 A;  1ZG6 A;  1GHM A;  1RCJ A;  1HVB A;  4DJ3 A;  2HJ9 C;  2Y79 A;  5L10 A;  1IOU A;  1MPL A;  4IJG A;  1DP6 A;  4CJN A;  2BG1 A;  1LI9 A;  4PHT A;  5BOH A;  5I94 A;  4BEN A;  2W3E A;  3EQV A;  4WMC D;  2ZC3 B;  4F3L A;  2W3G A;  3SZT A;  4GS9 A;  4QPR A;  5EVI D;  1CEG A;  5EVI B;  1G6O A;  1E25 A;  4G3V A;  1OME A;  3IXD A;  4R3A A;  3Q1F A;  2Y2N A;  5FAQ A;  1S1Z A;  1NJ4 A;  2FZ0 A;  2H0T A;  1LSW A;  2WKP A;  2AVX A;  3TRC A;  2E8J A;  1XJ2 A;  3QP1 A;  2X02 A;  3MR0 A;  1PIO A;  4NXG A;  5FI6 A;  2PD8 A;  4DE1 A;  2KOI A;  1TS6 A;  4Q8I A;  5DKK A;  1FIK A;  3N7W A;  2VGL M;  4O8G A;  4Y13 A;  3UB7 A;  3T1R A;  5JYO A;  3P09 A;  3T4K A;  4BJP A;  1T1A A;  3LUQ A;  1F5M A;  4LEN A;  4RVA A;  1W5D A;  2R9X A;  2L0W A;  3TW8 A;  3A0R A;  1YT4 A;  1F9I A;  4EW7 A;  1TVF A;  4GKU A;  2Y4A A;  3FWL A;  4UEY A;  5FQM A;  2QPN A;  3I7J A;  2ZOH A;  3IBR A;  1PYY A;  5EUA A;  4S2M A;  3WRZ A;  3JVV A;  5HAR A;  5HWW A;  1H8Y A;  2W1R A;  3NDG A;  3KSF A;  3VE4 A;  4U0T A;  3UMD A;  2V8C A;  4GB7 A;  5IT5 A;  2UWX A;  2WKQ A;  5CEB A;  3HLC A;  3S7P A;  2QYB A;  3D9Y A;  3BFG A;  2Y55 A;  5K5B A;  1YMS A;  4NXB A;  4LPZ A;  5F82 A;  2V8F A;  1SDN A;  2EX9 A;  4KZA A;  3KYZ A;  3BFE A;  4OOM A;  2PU4 A;  5FL3 A;  3HUN A;  4JXV A;  4DXB A;  3BRM A;  4XT2 B;  3DWK A;  1CI8 A;  3HL9 A;  1SKF A;  1A0K A;  4GZB A;  2JKG A;  5L2F A;  4KEN B;  4WLA A;  1XFN A;  3IX4 A;  1NWZ A;  2WKI A;  4LFU A;  1NXY A;  1K6R A;  4A5R A;  2X01 A;  1N9O A;  2ZL1 A;  2ZC4 B;  2I72 A;  2V9A A;  4UQI S;  2XRN A;  3LID A;  5M19 A;  5GL9 A;  3MZD A;  2B5R A;  1U60 A;  3PAG A;  2B95 A;  4OOY A;  3ITB A;  2ZM8 A;  2A49 A;  5FQ9 A;  4KZ4 A;  1YLT A;  4HOI A;  3MQQ A;  2HV1 A;  2V1A A;  4MN5 A;  3V67 A;  3HJK A;  1E3U D;  2WZX A;  3K3C A;  3E0Y A;  5D3O A;  2KX6 A;  4B88 A;  4JXW A;  3C38 A;  4X69 A;  1XGJ A;  4N9L A;  5L07 A;  3O3V A;  5GLD A;  2H0Y A;  3LR3 A;  2JE5 A;  4IUK A;  1S1Y A;  5DF7 A;  2W0N A;  2H5S A;  1H8Z A;  3T4O A;  3DTI A;  1MKI A;  4C75 A;  1VQQ A;  3OZH A;  4OQI A;  4I3I A;  3E2K A;  1N4O A;  4XUZ A;  2VV8 A;  1DP8 A;  3UE6 A;  5HAQ A;  4JKT A;  3MFX A;  3IWO A;  3AGE A;  4I39 A;  4E3O A;  4PAU A;  2ZC7 A;  3ZHH A;  1ACF A;  4MEZ A;  2HF6 A;  1LL9 A;  4EQI A;  1FCO A;  5M18 A;  1XPB A;  2JKT M;  3E2L A;  4OPZ A;  3GDI A;  2PHY A;  1LL5 A;  2PYR A;  4HBT A;  2L4R A;  1H8M A;  2ZQ7 A;  2HPB A;  1K55 A;  4KQD A;  1T1C A;  3QNB A;  2MJ6 A;  3VOY A;  3TSG A;  1FCM A;  1XFQ A;  2XH9 A;  1S66 L;  2VA0 A;  1OTA A;  4LV1 A;  2W1T B;  3AGF A;  1K56 A;  4WYY A;  4ARZ B;  4Q0I A;  2HDS A;  3SOI A;  1DJA A;  2INW A;  1C3B A;  5EE8 A;  4DJ2 A;  4UA7 A;  4R3B A;  1LT0 A;  4EEU A;  3QNC A;  2W3F A;  2H28 A;  3NY4 A;  2ZLY A;  1XJ3 A;  4GD8 A;  4FH2 A;  2V1B A;  3PBO A;  1XKZ A;  3ISG A;  3T12 B;  4BBT A;  2H10 A;  2OAQ 1;  4HH2 A;  1J3W A;  1KGE A;  1W63 M;  1MC0 A;  4YIN A;  3MFD A;  3BM6 A;  4P0M A;  5AJG A;  3HLF A;  2QHK A;  2OAP 1;  4QHC A;  3Q7Z A;  4FTX A;  3T4L A;  3V3S A;  5HWV A;  2JC7 A;  3NCK A;  5F1F A;  3FYZ A;  1HLU P;  4L9E A;  4PMA A;  2WKE A;  2YKH A;  3MMH A;  3C8C A;  3V5M A;  3EWK A;  5GLA A;  5TBM B;  4K08 A;  5J3W A;  4I3A A;  2EA9 A;  2Y2P A;  1O7E A;  3SS5 A;  2VEA A;  5EOO A;  2D02 A;  5FDS A;  4X68 A;  4R70 A;  2ZQ8 A;  2VLG A;  3UPP A;  3PTE A;  3S4X A;  3W4O A;  3R7W B;  1V9Z A;  1PI4 A;  5AQA A;  1HTZ A;  4EUV A;  4L9G A;  3LGO A;  5KZH A;  4DXC A;  2JKR I;  5IS1 A;  1SKO B;  4EET B;  5DTK A;  2PRF A;  3CZD A;  2P9V A;  1LSV A;  4OQH A;  3IX3 A;  1MWS A;  4ZDX A;  4DMZ A;  1OT9 A;  1VM1 A;  2V0W A;  3PHY A;  1P9R A;  1EWZ A;  5I5L A;  3UPN A;  3UME A;  1W79 A;  3EQU A;  4WN5 A;  1RGY A;  3FC7 A;  4NG2 A;  1I5Q A;  3QP5 A;  4DN0 A;  1SCW A;  4YWZ A;  4PM5 A;  1I2S A;  1L0D A;  3C4O A;  1WA9 A;  1IYS A;  1KE4 A;  3CG5 A;  3H82 B;  4MN7 A;  4FSF A;  2WYX A;  3PBR A;  1JVJ A;  4IVK A;  3FV7 A;  4P85 A;  4G3K A;  5EVE A;  4O7D A;  4DE0 A;  4FD8 A;  3A0V A;  3H7W B;  4CLC D;  2QWS A;  4N1X A;  2A24 A;  5TR7 A;  3U2A A;  5M1A A;  3VSL A;  4LV2 A;  1OTI A;  1TS8 A;  3SW1 A;  1FCN A;  5IHV A;  3IH9 A;  3F1P A;  1YAX A;  4GHI B;  4BWI A;  4E04 A;  4R6L A;  3F1N B;  1GSV A;  2VGK A;  1W7F A;  2BLS A;  4OLD A;  5JYP A;  3H9W A;  4FOF A;  5G4Y A;  2VZW A;  2PYP A;  2PU2 A;  3BW6 A;  3LR5 A;  4GJ4 A;  4JGQ A;  2O9A A;  4R38 A;  1KDS A;  3GMW A;  2XR0 A;  5AQB A;  3B3X A;  1ONG A;  1MXO A;  1NY0 A;  3VOL A;  2XEP A;  1FR1 A;  2C6W B;  1MY8 A;  2VV6 A;  1LLB A;  5CHJ A;  1I2W A;  4JBF A;  1ES4 A;  3VSK A;  1BUL A;  2Z6C A;  3UB5 P;  1STZ A;  1TEM A;  2FFF B;  4GDB A;  4H6J A;  3WRT A;  1F2K A;  3IQA A;  3MZE A;  1VHM A;  5F5Y A;  3CLO A;  4K0W A;  1BUE A;  3IF6 A;  5FSR A;  3FZC A;  5A93 A;  3FPV A;  2XDM A;  3IH8 A;  2NUT C;  4X1L A;  1IEL A;  5FI2 A;  2WKR A;  4O0P A;  5CGS A;  4HEF A;  3HJI A;  2I9V A;  2D01 A;  4N92 A;  3UNW A;  4BQM A;  4NXE A;  2ZC5 B;  2VGL S;  2EXB A;  4E3M A;  4OQG A;  2J8Y A;  4WZ5 A;  1FSY A;  2WUQ A;  2JKF A;  1L3L A;  4PPR A;  2WK0 A;  1Q2P A;  2J9O A;  1K4F A;  2OOL A;  1T18 A;  5HW3 A;  1XX2 A;  4F3L B;  4GS9 B;  4U3T A;  3PXP A;  2Z2M B;  2QJ7 A;  3SH7 A;  4B4Z A;  4G3W A;  1CJF A;  1NLY A;  2JN7 A;  1CQA A;  3BEC A;  4EBL A;  1NZU A;  4PM7 A;  1NYY A;  4BMW A;  4RX2 A;  2P7J A;  2Q9M A;  4HJ6 A;  4NXF A;  4KZ5 A;  4EES A;  1BZA A;  2P08 A;  2PT7 A;  3Q82 A;  1ERQ A;  3G30 A;  1XGI A;  4CLC C;  4LRY C;  3FKV A;  2G2W A;  1IKI A;  2Z6D A;  2LB9 A;  2ZMA A;  3MXS A;  1F98 A;  3MS6 A;  3UO9 A;  1IYP A;  5EOE A;  3LEZ A;  1NRF A;  3CI6 A;  1HD8 A;  1CI9 A;  5FQJ A;  3T4T A;  2HDR A;  3W2Z A;  2WAE A;  4OLG A;  4S2N A;  1NLZ A;  3OOV A;  3L7H A;  5G18 A;  3T4S A;  1UWP X;  4LV0 A;  4ZBE A;  1N9L A;  1BLP A;  3BQ8 A;  2Y8H A;  4ETX A;  1IYO A;  3AGD A;  3IS2 A;  5TJJ A;  2PR6 A;  1YQS A;  4I38 A;  4UA6 A;  5FI7 A;  1VB6 A;  1KE3 A;  1LHY A;  2B18 A;  3LY4 A;  1NRJ A;  5FAP A;  2PBY A;  2O0Y A;  1PW8 A;  4Y7P A;  1DJB A;  3OCL A;  4WL9 A;  4HIA A;  1H5X A;  3VV4 A;  3ZDJ A;  5GHX A;  3NOT C;  5J7E A;  4WBG A;  4S2J A;  3CMZ A;  2DMW A;  3N4I A;  5DKL A;  5CTM A;  1GCE A;  2J9P A;  2IWB A;  3A0S A;  1Q2Q A;  3NOP C;  5CX7 A;  2OWH A;  3OPP A;  1CEF A;  5HPF A;  4S2O A;  3N6I A;  4OKP A;  2X71 A;  3M6B A;  3T1Q B;  4MCW A;  3LIA A;  1OTB A;  2WAD A;  2XK1 A;  3PBQ A;  1TS0 A;  2ZMV A;  3BFC A;  4I3J A;  5J8X A;  4KUK A;  1PW1 A;  2O9C A;  1N9N A;  4OPY A;  1TDG A;  3NUL A;  5GLB A;  5DTS A;  2FFY A;  2OSU A;  1S0W A;  2JCH A;  3LO7 A;  3VOZ A;  3LI9 A;  1ESI A;  4OOL A;  4N9K A;  2GNX A;  4Q0H A;  5CHM A;  4Y0U A;  4QD4 A;  1MKM A;  4Y2F A;  4X55 A;  3DAV A;  3S1Y A;  4JGR A;  3Q81 A;  5FAT A;  4DKI A;  1KGF A;  1L2S A;  1L0G A;  1K57 A;  2Y2I A;  1YLZ A;  2EX2 A;  3Q7V A;  2Z2L B;  4UAA A;  4GOG A;  3RH8 B;  1YLY A;  1MWU A;  1ZTU A;  5HAI A;  2B02 A;  3E4O A;  2XA7 M;  3OPR A;  5FEG A;  4X1M A;  5AQ7 A;  1ZHH B;  1BTL A;  3T50 A;  3DWZ A;  1MWT A;  2R78 A;  3LIB A;  2W27 A;  4C6Y A;  1XA7 A;  2VKS A;  4S2P A;  5TGF A;  3LFV A;  2PR5 A;  3EGX C;  3MZF A;  3MXQ A;  2J80 A;  4HQA A;  4O01 A;  5F83 A;  3ULF A;  3VE3 A;  4KZ8 A;  4CQH A;  3JPU A;  4S2I A;  2EX8 A;  4GDN A;  3UPO A;  3HLE A;  1OTE A;  2JHE A;  1JWV A;  4S2N C;  1K56 D;  1KOU A;  3C2W A;  3CPT A;  1YPR A;  1ES5 A;  3ICY A;  4EBP A;  3S22 A;  1KVM A;  4JPM A;  5CGX A;  3ZG7 B;  1XXM A;  5LBR A;  5E43 A;  1BLC A;  1ERM A;  2HP5 A;  4ARZ A;  3OPH A;  4LLO B;  4HBU A;  4EQ1 A;  3LI8 A;  3S7Q A;  3JYI A;  2G7U A;  2V20 A;  3LEQ A;  2LB5 A;  2IA2 A;  1DP9 A;  5KIZ A;  4UA9 A;  3ZGA B;  4R4R A;  5DTT A;  3A3E A;  5HL1 A;  3NHQ A;  4EER A;  1H3Q A;  4R1G A;  4P6Z M;  1FR6 A;  1XP4 A;  4OH0 A;  4H8R A;  4E3J A;  1SDE A;  3O5Y A;  4FH4 A;  1XJ6 A;  2FH5 A;  3G2Y A;  3ZG0 A;  3EEH A;  2Y2O A;  4MLL A;  3GR2 A;  3BWL A;  4B4X A;  2W3H A;  4S2K A;  4ZAM A;  4ID4 A;  3KSH A;  4HH3 A;  3HLB A;  5EM0 A;  3RXX A;  2J7V A;  3D4F A;  3N8S A;  1YKD A;  3TOI A;  1FOF A;  4LV3 A;  4R3J A;  2IWD A;  4D60 A;  4PKY A;  5TBM A;  4M4X A;  4HI4 A;  3DBA A;  3U4L P;  5CGW A;  2HJE A;  2GZA A;  4U0X A;  1S4R A;  4ZTK A;  4NEE D;  2A3U A;  3RXW A;  2EX6 A;  4EXO A;  3GEC A;  2ZQ9 A;  3LCE A;  5GLC A;  3V50 A;  2Y91 A;  2XSS A;  1RGZ A;  2GDN A;  5DF8 A;  4K91 A;  1D06 A;  4OP8 A;  2V0U A;  4WM9 A;  3T4J A;  2OLV A;  3WS1 A;  1CK3 A;  1UGU A;  1JTD A;  1XA1 A;  3B33 A;  1PZO A;  5F68 A;  4I5S A;  5U47 A;  3LR4 A;  5KMW A;  2WGW A;  2NUP C;  1ESU A;  5HD5 A;  4PM8 A;  3VP0 A;  1SKO A;  2P9V B;  2ZQC A;  3GVB A;  3F1O A;  3G6O A;  3BJN A;  5E2G A;  4B93 A;  1BSG A;  1JTG A;  1L0F A;  4JXS A;  4NET A;  5MC7 A;  2DCF A;  2HZ5 A;  3E4P A;  1FIL A;  3SS3 A;  3HBR A;  2P04 A;  2EFU A;  3TG9 A;  4OPQ A;  3C30 A;  4BLM A;  4R23 A;  1DJC A;  2ZQD A;  3VP2 A;  1K55 C;  2CC1 A;  3ITA A;  3G31 A;  4X25 A;  2QJ5 A;  4HHD A;  2O99 A;  5HX9 A;  1GA0 A;  5F69 A;  4MNR A;  4ZJ3 A;  4IUH A;  5C5K A;  4II7 A;  4QY6 A;  5CXW A;  4GN2 A;  4PKY G;  3G34 A;  3MSH A;  1O07 A;  2HDU A;  2ACG A;  1LI0 A;  4CLC B;  2Y2M A;  4Y15 A;  1IYQ A;  4GD6 A;  4HNB A;  5FAS A;  2ZJ9 A;  5E2F A;  4KZB A;  2ZBB A;  3QP8 A;  3UB9 A;  2A24 B;  4BBV A;  3M6H A;  1GA9 A;  4DE2 A;  4LRZ E;  3GQZ A;  3UN7 A;  3C7U A;  2J3T D;  3GRJ A;  3F1P B;  1YSQ A;  3VFF A;  2WGI A;  1YMX A;  4EWF A;  4KZ9 A;  2WAF A;  3N8L A;  3A3F A;  3WS4 A;  3F1N A;  3CIT A;  3VP3 A;  3WS0 A;  2RCX A;  3HLD A;  2WKH A;  5HL6 A;  3ZG9 B;  3C7V A;  4B9O A;  3Q07 A;  5CTN A;  2XFS A;  1SZV A;  4KQQ A;  4ZJ2 A;  2L1M A;  1TF1 A;  3KO6 A;  3NDE A;  5HAP A;  4K0X A;  4FCF A;  4H6J B;  4JLF A;  1TD5 A;  2QZ6 A;  3SS4 A;  3VP4 A;  1VET A;  3IF6 B;  1UWN X;  3VMA A;  1YLJ A;  2A2L A;  3KSG A;  1ODV A;  4YNR A;  1PNE A;  3BQA A;  1VEU A;  2DRW A;  2OV5 A;  4IVI A;  2M7V A;  1TS7 A;  3KYQ A;  4IHQ A;  3HUO A;  3SH9 A;  4KG2 A;  3T1S A;  1SHV A;  4LRX C;  3DTM A;  4ETZ A;  4BL2 A;  4LCM A;  2QMI A;  4PM9 A;  3IHB A;  4KZ6 A;  3ZNT A;  1K38 A;  4HP4 A;  4YOF A;  4RYE A;  4NKP A;  4F94 A;  4X53 A;  2ZQA A;  1QME A;  4WMC A;  1GHP A;  3C4P A;  5EVI A;  3T1X A;  3KYE A;  3A3I A;  4MDZ A;  3HRE A;  1P9W A;  3E98 A;  4HJ3 A;  5KSC A;  2E8I A;  1HZO A;  5DVA A;  3LR0 A;  3UDF A;  4LGW A;  4WEJ A;  1IEM A;  5G4Z A;  1K6S A;  3FPW A;  4KUO A;  4BD0 A;  2OWJ A;  1W8Q A;  3BEB A;  3W8K A;  1OTD A;  5CRF A;  3ZG8 B;  3W4P A;  2J3T C;  5EVL A;  4EV4 A;  4OVD A; 
#chains in the Genus database with same CATH homology
 3RH8 B;  1MZU A;  1ZTU A;  2ZMF A;  4WUJ A;  3R7W B;  4EEP A;  2K31 A;  3NOU C;  2B02 A;  3E4O A;  2XA7 M;  5AVF A;  1EW0 A;  1V9Z A;  1P97 A;  2EWW A;  4EUV A;  1ZHH B;  5L8M A;  1DRM A;  5AVE A;  3LIC A;  1OPX A;  3T50 A;  4L9G A;  3OC2 A;  1JNU A;  2R78 A;  3IBJ A;  3LIB A;  2W27 A;  2VKS A;  3NJA A;  2JKR I;  3IS2 B;  3RTY A;  2ZOI A;  5IS1 A;  3LFV A;  3B42 A;  4ME4 A;  1GSW A;  2PR5 A;  4Y5F A;  4EET B;  2GX5 A;  4RQ9 A;  3EGX C;  2J3W A;  4KQO A;  3MXQ A;  2J80 A;  4HQA A;  4O01 A;  3ULF A;  3VE3 A;  1LSV A;  4Y3I A;  4CQH A;  4DMZ A;  1LL8 A;  1T19 A;  2HGV A;  1OT9 A;  1OTE A;  2EWV A;  2JHE A;  2V0W A;  3PHY A;  1P9R A;  3MQ0 A;  5I5L A;  1KOU A;  4XT2 A;  3UME A;  3C2W A;  3EQU A;  4WN5 A;  4HJ4 A;  3ICY A;  5KSH A;  3EOI A;  1S67 L;  3D3O A;  3FC7 A;  3MJQ A;  4DN0 A;  3P01 A;  5LBR A;  2K2N A;  4YWZ A;  4ARZ A;  2BAS A;  2PDR A;  4LLO B;  4DJ3 A;  2HJ9 C;  2Y79 A;  1IOU A;  1WA9 A;  5DFY A;  4IJG A;  4EQ1 A;  1DP6 A;  2O9B A;  3LI8 A;  3S7Q A;  2G7U A;  3H82 B;  2LB5 A;  4MN7 A;  2IA2 A;  4PHT A;  4FSF A;  1DP9 A;  2W3E A;  3B47 A;  5KIZ A;  3PBR A;  3EQV A;  3NHQ A;  4EER A;  4G3K A;  4F3L A;  2W3G A;  1H3Q A;  3EEA A;  4GS9 A;  4QPR A;  2XA7 S;  1G6O A;  4G3V A;  4P6Z M;  4BBU A;  3A0V A;  3H7W B;  4CLC D;  4R3A A;  2KLI A;  3O5Y A;  5DJT A;  1XJ6 A;  2QWS A;  2FH5 A;  2A24 A;  1S1Z A;  3U2A A;  3EEH A;  1OTI A;  1TS8 A;  3SW1 A;  2FZ0 A;  1LSW A;  3BWL A;  2WKP A;  3F1P A;  3TRC A;  1YAX A;  2W3H A;  1XJ2 A;  4GHI B;  4BWI A;  3MR0 A;  4E04 A;  4R6L A;  3KSH A;  4HH3 A;  3F1N B;  4NXG A;  1GSV A;  3CUE A;  1Y28 A;  3H9W A;  4FOF A;  5G4Y A;  2PD8 A;  2VZW A;  1YKD A;  2KOI A;  1TS6 A;  2PYP A;  5DKK A;  2VGL M;  3BW6 A;  3LR5 A;  4O8G A;  4PKY A;  4UQI M;  5TBM A;  4GJ4 A;  4JGQ A;  4Q0J A;  3UB7 A;  2O9A A;  4R38 A;  4M4X A;  3T4K A;  4BJP A;  4HI4 A;  1T1A A;  3DBA A;  3LUQ A;  1F5M A;  2HJE A;  4WEK A;  2GZA A;  5HWT A;  1S4R A;  4NEE D;  1OJ5 A;  3VOL A;  2L0W A;  3TW8 A;  2JKT I;  2YKF A;  3A0R A;  3UB6 A;  1F9I A;  4EW7 A;  4EXO A;  3GEC A;  2VV6 A;  4UEY A;  2M1C A;  2XSS A;  4GLQ A;  3IBR A;  2ZOH A;  3CWF A;  5IU1 A;  5J4E A;  3PYP A;  1D06 A;  3JVV A;  5HWW A;  2V0U A;  2Z6C A;  3T4J A;  1STZ A;  2W1R A;  4HP9 A;  1UGU A;  3KSF A;  3VE4 A;  3B33 A;  3OLO A;  3UMD A;  4AFI A;  4H6J A;  5F68 A;  5IT5 A;  2WKQ A;  4I5S A;  3S7P A;  2QYB A;  3LR4 A;  1VHM A;  5F5Y A;  3CLO A;  2NUP C;  5K5B A;  4NXB A;  5HD5 A;  4LPZ A;  3KYZ A;  4P6Z S;  3RFB A;  4OOM A;  5HDC A;  3F1O A;  3G6O A;  3BJN A;  3HCY A;  4B93 A;  5DJU A;  5FL3 A;  3S7O A;  3FPV A;  2KDK A;  3MF0 A;  5MC7 A;  2GJ3 A;  2PD7 A;  3E4P A;  2NUT C;  4Z1W A;  2W1T A;  2WKR A;  3BY8 A;  4XT2 B;  2P04 A;  4O0P A;  1G28 A;  3D72 A;  3HJI A;  2I9V A;  5HDS A;  2D01 A;  4WLA A;  1XFN A;  1NWZ A;  3C30 A;  4NXE A;  3ZYT A;  2VGL S;  1N9O A;  3TJZ C;  2V9A A;  4UQI S;  1V9Y A;  2XRN A;  3LID A;  2QJ5 A;  4HHD A;  2O99 A;  3P7N A;  5F69 A;  4IUH A;  5C5K A;  4II7 A;  1IFQ A;  4JGO A;  4PKY G;  2OOL A;  1T18 A;  4F3L B;  3OBF A;  4GS9 B;  2CMN A;  4CLC B;  3PXP A;  3K2N A;  4HOI A;  4EU0 A;  2QJ7 A;  3MQQ A;  4HNB A;  2HV1 A;  3UE3 A;  2V1A A;  4MN5 A;  3V67 A;  4G3W A;  5HDD A;  1NLY A;  3HJK A;  2JN7 A;  2ZBB A;  3FG8 A;  3UB9 A;  2W3D A;  2A24 B;  4CLC E;  4BBV A;  3LYX A;  4LRZ E;  3K3C A;  3R4K A;  4ZRR A;  3E0Y A;  4GCZ A;  2J3T D;  3F1P B;  1OJG A;  2VX8 A;  1YSQ A;  1S4S A;  2KX6 A;  3C38 A;  4BMW A;  3KSI A;  3OCN A;  5F6A A;  2P7J A;  4HJ6 A;  4NXF A;  3LR3 A;  3F1N A;  4EES A;  2P08 A;  4IUK A;  3PBS A;  2PT7 A;  1S1Y A;  2W0N A;  3CIT A;  4CLC C;  4LRY C;  3T4O A;  2Z6D A;  3S7N A;  2LB9 A;  5HL6 A;  4I3I A;  1F98 A;  4B9O A;  2VV8 A;  5EFW A;  5HSQ A;  1DP8 A;  3UE6 A;  3R7W A;  3CI6 A;  4MN6 A;  3T4T A;  3MFX A;  3W2Z A;  3CUE C;  4I39 A;  4PAU A;  2L1M A;  1TF1 A;  1NLZ A;  3OOV A;  3TE8 A;  3EGD C;  3KO6 A;  3T4S A;  1UWP X;  3LIE A;  2HF6 A;  1XJ4 A;  4H6J B;  1N9L A;  3BQ8 A;  5DFX A;  2Y8H A;  4ETX A;  5DF9 A;  3IS2 A;  1TD5 A;  1LSX A;  5TJJ A;  3T4Q A;  2JKT M;  3JVU A;  4L0L A;  1UWN X;  3GDI A;  2PR6 A;  2M7U A;  4I38 A;  2A2L A;  2PHY A;  2PYR A;  2L4R A;  3KSG A;  1VB6 A;  1H8M A;  3F1O B;  2B18 A;  1NRJ A;  1ODV A;  2O0Y A;  4L9F A;  4KQD A;  4YNR A;  1T1C A;  3BQA A;  3OCL A;  2MJ6 A;  4WL9 A;  2JKR M;  1XFQ A;  1S66 L;  2VA0 A;  4HIA A;  1OTA A;  4HY8 A;  2M7V A;  3VV4 A;  3NOT C;  2W1T B;  5J7E A;  1TS7 A;  3KYQ A;  4IHQ A;  1P0Z A;  1BYW A;  4LRX C;  3K3D A;  4ETZ A;  4ARZ B;  2DMW A;  4Q0I A;  5DKL A;  1X0O A;  2INW A;  5HZH A;  4DJ2 A;  3A0S A;  5HD3 A;  1LT0 A;  1YSP A;  4EEU A;  1T1B A;  3PBT A;  3NOP C;  5CX7 A;  2OWH A;  1OT6 A;  4HP4 A;  4YOF A;  2W3F A;  5HPF A;  1D7E A;  4NKP A;  2H28 A;  2QKP A;  3UB8 A;  2XRO A;  1XJ3 A;  4WF0 A;  3H82 A;  4MCW A;  3LIA A;  3KX0 X;  2V1B A;  1OTB A;  5HPI A;  4WEL A;  2VV7 A;  3PBQ A;  1TS0 A;  2ZMV A;  3PBO A;  4I3J A;  2VJW A;  4KUK A;  4BBT A;  2O9C A;  1N9N A;  2OAQ 1;  4GW9 A;  3CAX A;  4HH2 A;  3PBN A;  1W63 M;  1MC0 A;  3H7W A;  3PR6 A;  4MDZ A;  4CLC A;  1P9W A;  5A8B A;  3E98 A;  5AJG A;  3LIF A;  2QHK A;  2OAP 1;  4HJ3 A;  3T4L A;  3LI9 A;  3BY9 A;  4OOL A;  2GNX A;  5HWV A;  4Q0H A;  4GHI A;  1W63 Q;  4L9E A;  3LR0 A;  1MKM A;  4Y2F A;  4WEJ A;  2YKH A;  2K7S A;  3MMH A;  3C8C A;  3ZQ5 A;  5G4Z A;  3EWK A;  5TBM B;  4K08 A;  5J3W A;  3FPW A;  4I3A A;  4KUO A;  4JGR A;  1GSX A;  2EA9 A;  2OWJ A;  3E4Q A;  3MQO A;  4MMN A;  1OTD A;  2VEA A;  2D02 A;  2J3T C;  4R70 A;  4JGP A;  2VLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...