3FC7A

The crystal structure of a domain of htr-like protein from haloarcula marismortui atcc 43049
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
SDSPDGIVHLTTNGTILSVNPSMAGRLGADPDTLVGQQLSAVMDSEAANQRLEAGKSAVENGTATRSEDAVGGRHYHNQYIPVDSHRKSDTFQLVSRDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HTR-like protein
publication title The crystal structure of a domain of HTR-like protein from Haloarcula marismortui ATCC 43049
rcsb
source organism Haloarcula marismortui
molecule tags Transferase
total genus 27
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3fc7A00
1JNUA 2I9VA 3NHQA 3NOPC 3E4OA 2VV6A 3H82A 2L1MA 4F3LB 4KUOA 5HWTA 4HH2A 1XFQA 4I5SA 4LPZA 1KOUA 1XJ2A 4L9EA 4LRXC 1T19A 3MR0A 4KUKA 4EEUA 1OT6A 2V1AA 5J4EA 4JGPA 4HJ4A 2L4RA 4WL9A 2A24B 4EEPA 4LRZE 1XJ6A 4XT2A 3F1OA 3H7WB 2OWJA 2WKRA 3GECA 5HSQA 3BY8A 1OTAA 4GS9A 3UB9A 2QHKA 1F98A 5HD3A 4EW7A 4GHIB 3CAXA 5F5YA 1X0OA 2QJ5A 1BYWA 1P97A 1UWNX 2OWHA 3RTYA 2PR6A 4WN5A 5EFWA 3VE4A 3RH8B 1TS0A 1T1AA 2PDRA 3LUQA 4EQ1A 3MXQA 4BBVA 1WA9A 1OT9A 3K3DA 2L0WA 1GSXA 5HD5A 4R38A 2QJ7A 5DKKA 1TS8A 2Z6DA 2B02A 2ZOIA 1OTDA 1OJ5A 4H6JA 3NJAA 3D72A 5J7EA 3LIFA 3B33A 3E4QA 3A0RA 3C8CA 1N9NA 3A0SA 4HHDA 1N9OA 4DJ3A 4I39A 1XFNA 2ZBBA 5DKLA 3E4PA 4HOIA 3HJKA 3LIEA 4EERA 1LSXA 2ZOHA 2VEAA 2INWA 3UMEA 5J3WA 2CMNA 1ODVA 2BASA 4I3AA 3UB8A 1T1CA 5HDDA 3NOUC 2V9AA 4K08A 4WF0A 3LYXA 4DJ2A 4L9FA 4M4XA 3KX0X 5TBMA 2V1BA 2JHEA 3EEHA 1S4RA 2KX6A 3CWFA 3UB6A 2VV8A 5AVFA 3BY9A 2K7SA 1S4SA 4NXEA 3NOTC 5KIZA 1T18A 4EXOA 1LL8A 4HJ6A 2Z6CA 1TS7A 4R70A 3ULFA 2D01A 4LLOB 3ZQ5A 1DP6A 2P7JA 1VB6A 3F1OB 3MJQA 3H9WA 1NWZA 2PD7A 3IS2B 4MN6A 4WLAA 1V9ZA 3T50A 1MZUA 3A0VA 5AVEA 4GHIA 1GSWA 5HWWA 4HQAA 2EA9A 4I3IA 5F6AA 1XJ3A 2M1CA 4HIAA 4GW9A 4BBUA 5IS1A 1S66L 3MQOA 5IU1A 3GDIA 4WUJA 3F1NB 4R3AA 3K3CA 5F68A 3F1PB 3LICA 4EESA 2V0UA 3UE6A 5HZHA 1LT0A 1V9YA 4PKYG 1S1ZA 4JGOA 3EWKA 4H6JB 2PHYA 2W27A 5I5LA 3C2WA 3ICYA 3G6OA 2J80A 1S67L 4B9OA 1D06A 2HV1A 4HJ3A 4NXBA 4PKYA 2KDKA 3MQQA 4I3JA 4R6LA 5HDSA 3H82B 3SW1A 4F3LA 3PYPA 5DJTA 1G28A 4HP9A 3FC7A 4JGRA 5TBMB 2YKHA 1LSVA 4HI4A 2VLGA 2VV7A 1UWPX 3BWLA 4YWZA 1F9IA 2PYPA 2W0NA 1DRMA 2A24A 3VE3A 3LIAA 1OTEA 4HNBA 3OLOA 3IBRA 1TS6A 4XT2B 1LSWA 2H28A 3H7WA 4KQDA 2PR5A 4E04A 2GJ3A 2QKPA 3UMDA 4MN5A 3CLOA 1DP8A 3FG8A 4GS9B 4BBTA 4EETB 2QWSA 2WKPA 3IS2A 4HP4A 3LIBA 4JGQA 1N9LA 1DP9A 3LI9A 4NXFA 4HH3A 2YKFA 2R78A 3P7NA 5DJUA 1OTIA 3LIDA 1GSVA 1P0ZA 4L9GA 5G4ZA 4GCZA 4HY8A 2PYRA 1Y28A 1T1BA 1OJGA 3F1NA 5F69A 1S1YA 2OOLA 3VOLA 3F1PA 5A8BA 3MFXA 2D02A 1EW0A 5HDCA 3HJIA 1UGUA 1OTBA 3UB7A 2PD8A 1XJ4A 2V0WA 4LRYC 2WKQA 1D7EA 3PHYA 3LI8A 4NXGA 5HWVA 4I38A 2JN7A 4RQ9A 5G4YA
chains in the Genus database with same CATH superfamily
4OONA 3VMAA 3E98A 1JNUA 3RJUA 2ZQ7A 4KUOA 1W8YA 5IT5A 3GMWA 3UN7A 3V3RA 3IF5A 3MKEA 4RVAA 4DF6A 4I5SA 2ZL1B 4DN0A 4NK3A 1T19A 1GHMA 4EBNA 1G6OA 1TDGA 1SDEA 5J4EA 2BTFP 4R1GA 5EPHA 4JGPA 3S22A 4U0XA 4EEPA 1YLTA 4U3TA 2XROA 1AXBA 3P98A 3ZNYA 2XDMA 3UNWA 2Y59A 4CLCC 4DRTA 1OTAA 3G32A 1IKIA 3G31A 4GS9A 3UB9A 2QHKA 3QP6A 4ARZA 1F98A 2O9BA 5HD3A 3C38A 3HUNA 4IHQA 5F5YA 4OLDA 2Y2MA 3ZVTA 3GSGA 3RTYA 2PU4A 4JBFA 2RCXA 3VE4A 1W5DA 5HL1A 3V5MA 2WADA 3BYDA 3S4XA 4ZBEA 3LUQA 1K6RA 3LR3A 4BBVA 4P6ZS 4E6WA 1K6SA 1PW8A 4ESPA 3BW6A 1GSXA 2Q0OA 4H8RA 2ZQ8A 5DKKA 4LV3A 1K57C 1OTDA 5HAQA 3BFDA 4DXBA 2XH9A 4S2LA 2LB5A 1DJCA 3L7HA 3Q81A 3B33A 2B18A 1I5QA 3PBRA 3FWLA 3A0SA 1N9OA 5FAPA 4DJ3A 4I39A 3U4LP 1XFNA 1L2SA 2EWVA 2WUQA 2JKRM 3E4PA 2HPBA 2QMIA 4HOIA 1JWVA 5CGWA 5AQ9A 5HARA 1LHYA 3VP3A 4CLCA 4ZRRA 2VEAA 2INWA 3UMEA 1OMEA 4RX2A 5DF8A 4OOYA 1ODVA 5GHYA 3BQAA 2JKFA 2V9AA 4K08A 3LYXA 4DJ2A 2PRFA 3EGDC 4L9FA 2JHEA 4S2PA 2ZC5B 3CWFA 3UB6A 5FDSA 2VV8A 2ZL1A 5FATA 4OKPA 3VOYA 1ONHA 2GZAA 2K7SA 2V8FA 2Y79A 4K91A 3G2ZA 3G4PA 4LCMA 5L10A 1HLUP 3Q1FA 2O9AA 2Z6CA 2J3WA 1K57A 2W3HA 4R70A 3JVUA 3ULFA 5AJGA 5FQJA 5J8XA 4LLOB 2Y91A 2Y2JA 1HZOA 1MPLA 2BLSA 2PD7A 3KYEA 4WLAA 5HPFA 2WZXA 3UB5P 3T50A 2XFSA 4MEZA 2EWWA 1MZUA 3A0VA 5L07A 2FZ0A 1JTGA 4GNUA 5HWWA 4HQAA 1YT4A 4MLLA 4QU3A 2HP6A 2J3TC 2XD5A 1XJ3A 1YAXA 3W2ZA 3CZDA 4BJPA 3T4KA 3EEAA 5IS1A 3GVBA 1DJAA 4E3JA 5MC7A 4WZ4A 1S66L 5IU1A 1BLCA 3FV7A 3F1NB 3ITBA 2HDQA 3B42A 1W63Q 2FH5A 4JXGA 4YINA 3HLWA 4XXRA 1WYCA 4ME4A 1LT0A 2H0TA 1V9YA 3LGOA 2BG1A 4PKYG 1PI5A 2WGWB 4KZ4A 4EBPA 4II7A 1Q2QA 4MCWA 2ZD8A 5CTMA 3ICYA 2ZM0A 2JBFA 3DTEA 1D06A 2C6WB 3JPUA 4DE2A 4KG5A 3AGEA 1NYYA 4I3JA 1KVLA 4X25A 1K4FA 1E4DA 5HDSA 1A0KA 2MJ6A 1L0DA 1WE4A 5GL9A 1MBLA 3SH9A 3PYPA 4MBHA 5FI6A 1SKFA 3NDEA 4P0MA 1H8ZA 4GJ4A 3NECA 1RP5A 4LV0A 4AFIA 4JGRA 2ACGA 2YKHA 3R4KA 4OPRA 2VLGA 5CHJA 1PIOA 3A3IA 4EBLA 1BUEA 4CLCD 5F82A 4PM6A 1DRMA 3GQZA 2ZMFA 4HNBA 3OLOA 3GRJA 2IWDA 4MDZA 3H7WA 2PR5A 4E04A 4KZAA 3BFEA 1H5XA 1IFQA 2QKPA 1CF0A 4WMCA 4MN5A 4GKUA 3VSLA 2EX2A 2XD1A 4OQHA 1DP8A 3FG8A 4BBTA 4IJGA 4JXWA 3LIBA 1N9LA 4DE3A 1MXOA 3HLGA 4NXFA 4EU0A 4CLCE 3UY6A 1YM1A 3MXSA 4OP8A 3UE0A 3P7NA 5HPIA 5KSCA 4ZTKA 3PAGA 3JYIA 1S0WA 4L9GA 4QY5A 3MS6A 3PTEA 2PYRA 1FCOA 1GCEA 1MWUA 4E6XA 1MWTA 2WAEA 3F1NA 4PM5A 5TFQA 2WKHA 4N9LA 5F1GA 5F69A 5KZHA 5AQBA 3HVFA 5A8BA 3MFXA 1BLSA 4HBUA 4YFMA 2AVXA 3KSHA 4KZBA 2WGWA 4JF5A 5FAOA 4CJNA 1SKOA 2GX5A 4BL2A 3KYQA 1M40A 1PWDA 3V3SA 2KLIA 3EQUA 2WKQA 5CXWA 1L0FA 4X53A 3PHYA 3OCNA 1QMFA 2XRNA 4KENB 5JYOA 2QZ6A 1BULA 2Y8HA 5M1AA 4RYEA 1PNEA 3NHQA 3PBOA 4MN7A 4N92A 2X01A 2L1MA 3UPPA 3KSFA 1VHMA 2ZC6B 5HWTA 5D3OA 4BWIA 4A5RA 2ZMAA 3NY4A 4Z9QA 4HH2A 1KVMA 5GHXA 4GDBA 3TE8A 4LPZA 3ZGAB 2OAP1 1XJ2A 3IWQA 3MR0A 5EVEA 4EEUA 4KG6A 4OVDA 2IWCA 1LI0A 1KGGA 1Y54A 2DRWA 3CI6A 4WL9A 2A24B 2NUTC 4BD0A 2E8IA 1YLZA 1XJ6A 2B95A 3ZCZA 5FQKA 2J3TD 3F1OA 1LL9A 2WKRA 3GECA 4OPZA 4B4XA 4KG2A 1H8YA 4WELA 4Y0TA 1H0MA 3BY8A 3ITAA 4X6TA 1Z09A 4EW7A 3C4OA 3SS5A 2XK1A 4GHIB 5FEGA 5A91A 4E3MA 3TW8A 2PR6A 4WN5A 4FCFA 3T1RA 1FOFA 5HAIA 3RH8B 1TS0A 4FUWA 1YMSA 4WMCD 3P09A 3MXQA 3SOIA 1WA9A 3C4PA 1MKMA 3ZG0A 4P85A 1KGFA 2L0WA 3FKWA 1NLZA 4R38A 3SH8A 1GA0A 2H0YA 3IT9A 2Y2HA 1XP4A 2ZOIA 3HUMA 5HW3A 4DDYA 2H10A 1RGZA 3T4JA 4C3QA 4GB7A 4RA7A 1G5UA 3FPVA 2RL3A 3E4QA 3A0RA 2V1ZA 5LBRA 2ZMVA 2Q9MA 2DMWA 2VA0A 4KQRA 4B4ZA 1PI4A 4OQGA 1CQAA 2ZOHA 3IXHA 1YKDA 3CMZA 3WS4A 2JC7A 1I2WA 1G6AA 5J3WA 1D1JA 5GLDA 2FFFB 2XA7S 2H5SA 1FR1A 3VV4A 3T4OA 1YLWA 3NOUC 3D4FA 4PAUA 4BQMA 4M4XA 3KX0X 2PBYA 5TBMA 2V1BA 2W1TB 1S4RA 2KX6A 4F94A 1YSQA 3TRCA 2UWXA 4IVIA 4NETA 1JWPA 1S4SA 2XSSA 1FSWA 5EVIC 1ZG4A 5BOHA 3QNCA 1T18A 5CEBA 1LL8A 3T1SA 4IUKA 2HJEA 5CEDA 1MKIA 1PRQA 1FQGA 1TS7A 2Y2NA 5FL3A 3ZQ5A 1JVJA 5DTKA 4UQIS 3KSGA 4MBFA 1K0KA 1VB6A 2HF6A 3H9WA 1NWZA 3EOIA 3S7QA 5CX7A 3O87A 2P9VB 5GLCA 1TDLA 2ZQDA 3C7VA 4Y2FA 1XPBA 2G7UA 3CUEC 4GHIA 2EA9A 5FAQA 2M1CA 4HEFA 4R3JA 2WK0A 4HIAA 2I72A 4FH2A 4OQ0A 3ZG5A 3MQOA 1BTLA 3GDIA 4P6ZM 1P9WA 3GTCA 2OLVA 3F1PB 4WEKA 2V0UA 3UDIA 3UE6A 3TOIA 4ZDXA 3MXRA 3O3VA 3T12B 1W79A 4WYYA 2IA2A 1S1ZA 3LR0A 3EWKA 4H6JB 5EVIA 3UDXA 1RGYA 5IHVA 3ZDJA 3RXXA 3C2WA 3N8LA 1ESUA 4UA9A 3G6OA 1YSPA 1K56A 2EX8A 2VGJA 4B9OA 3QP1A 4S2NC 4HJ3A 4NXBA 3Q7ZA 3IXDA 1OPXA 4LCLA 3MQQA 3UPOA 3TG9A 4R6LA 2EX9A 4IEDA 4Q8IA 3OPLA 3BFGA 3EQVA 4WBGA 4GN2A 3VP0A 2NUPC 1BLPA 3T1QB 2DCFA 4HP9A 1E3UA 3PAEA 4OP5A 1LSVA 2W1TA 3QP2A 2FFYA 1N9BA 1KDSA 1U60A 2W0NA 4R3BA 3D3OA 3IQAA 3CHWP 1NY0A 1M6KA 1OTEA 1TS6A 4XT2B 1LSWA 3L9KA 1K38A 3OZHA 5HL6A 4HESA 4PMAA 2GJ3A 3MMHA 4XUXA 2ZM2A 4Y0OA 4S2IA 4BD1A 3SS4A 4L0LA 4JGQA 2P9VA 2HZ5A 2HJ9C 3S7OA 4S2NA 1LL5A 1J9MA 3HLDA 4S2KA 4JXVA 2OLUA 5DJUA 3VP1A 4GD6A 1OTIA 1GSVA 4KZ7A 1P0ZA 3ZG8B 3UO9A 3JVVA 3PBTA 2WYXA 2JCHA 3OPRA 4KZ9A 1NZOA 1OJGA 1S6RA 2O0YA 3KYZA 4GDNA 3M2KA 3WRZA 5EUAA 4C75A 3CPTB 3F1PA 4XUZA 4Y5FA 1XGJA 2X71A 3WRTA 3BJNA 5CECA 1PWGA 3NDGA 3FKVA 4BMWA 3IX8A 5HDCA 1VETB 1OTBA 3IX3A 4JF4A 3TJZC 2G2WA 5GLBA 3BM6A 4QWOA 2PD8A 1XJ4A 4N1HA 3N4IA 1XXMA 3HCYA 4NKPA 1CEGA 1Z6FA 3PBNA 4LGWA 4NXGA 2WAFA 2JN7A 3QP8A 5EVID 1IYPA 3NOPC 5KMWA 5L8MA 4NEED 5FQMA 4F3LB 1FCMA 1K56D 3MSHA 4UEYA 3IH8A 2CC1A 4P87A 3PR6A 1XFQA 1VEUB 1KOUA 1OT6A 3D9YA 4X1MA 2ZM8A 5TGFA 3Q7VB 5G18A 5M18A 4UAAA 1LLBA 3TSGA 4HJ4A 2EFUA 5E2EA 1ZHHB 4XT2A 1E3UD 3LY4A 4E3LA 4FD8A 3LO7A 2EXAA 1XX2A 3UPNA 2M7VA 1K4EA 5A92A 4NG2A 3Q82A 3HREA 3MFDA 2QJ5A 5HFOA 4X69A 1BYWA 2Y55A 2OWHA 5EECA 3QNBA 1CJFA 1IOUA 4FOFA 4OPYA 1SCWA 5EM1A 2PDRA 4IBXA 4EQ1A 3ZNTA 5EE8A 1OT9A 2V8CA 4N1XA 4BLMA 4KZ5A 3N6IA 4PHTA 3E0YA 5HD5A 2XLNA 3WS2A 1Q2PA 1MWRA 1TVFA 1L3LA 2W3GA 4R4SA 3LEZA 3OPPA 3CPTA 3E2KA 3FZCA 3NJAA 2P04A 4C6YA 5DVAA 3QHYA 2JKTM 1XA1A 5J7EA 3A3DA 3LIFA 3HBRA 3OOVA 3LFVA 1N9NA 1PWCA 4UA7A 1I2SA 4R0QA 5DKLA 4D60A 1ZC2A 1STZA 4QD4A 2E8JA 4GZBA 1CK3A 1KGEA 3IH9A 2HP5A 3MBZA 4ZJ2A 3HJKA 3LIEA 4EERA 1LSXA 3IF6B 1K55C 3BRMA 3G35A 2BASA 5FI2A 5HDDA 3C30A 2HDSA 2PBDP 3CJMA 3VP4A 3EEHA 1MY8A 3V50A 3S1YA 4BENA 3M6BA 1VEUA 1DJBA 3ZVWA 5AQ7A 3GR2A 1ES5A 3UE3A 5KIZA 5CHUA 1FCNA 1ZKJA 3Q7VA 4HJ6A 2EFXA 5EVLA 3WS1A 4G3KA 3NBLA 3LR4A 3W8KA 4JF6A 3BLMA 3NC8A 5M19A 2Y2LA 3IS2B 4KQOA 4MN6A 2W3FA 3Q07A 3FPWA 3IF6C 3VFHA 5HAPA 4Y7PA 4ARZB 5AVEA 1GSWA 4LFUA 2XEPA 2M7UA 4I3IA 3MQ0A 4DKIA 3WS5A 4O7DA 3G2YA 4GW9A 4BBUA 1Y4OA 1K55A 2O9CA 4PM9A 3OCLA 4R3AA 1ES4A 3SZTA 3DTMA 4YOFA 1ERQA 1YLYA 2DNSA 5F68A 4EUZA 2P74A 4EESA 5U47A 3S7NA 2WGVA 4ETXA 2R9WA 5HZHA 4S2MA 4GOGA 3SS3A 2VGLM 1IYOA 4JGOA 5I94A 2W27A 1ES2A 5I5LA 2OV5A 4JPMA 2J80A 1S67L 4D2OA 4BL3A 2Q9NA 5JYPA 2VGKA 1CI8A 3CG5A 1C3BA 3HL9A 5CHMA 4LENA 2KDKA 4RX3A 4EUVA 3BEBA 3W4PA 4OOLA 3UE1A 3MZEA 1RCJA 3H82B 5CERA 1W7FA 3IF6A 5CGXA 4LV1A 2XQZA 3ZHHA 2HP9A 1TD5A 1BSGA 2XA7M 5FASA 2ZJ9A 4HI4A 2VK3A 4PM8A 3VOZA 2VV7A 3ZG9B 1UWPX 2J9PA 5TJJA 4X68A 1K54C 4OOMA 1F9IA 4YWZA 2PYPA 3K2NA 4K0XA 3A3JA 3WWXA 2PU2A 2A24A 2EX6A 2K2NA 3OBFA 1W8QA 3IBRA 1IELA 3NIAA 3HLCA 5K5BA 4MMNA 3MF0A 3IXBA 2JKRI 4UQIM 1NJ4A 1EWZA 3IS2A 3C5AA 3LI9A 1CEFA 3C7UA 2PT7A 4IBRA 4HBTA 4HH3A 1BZAA 3BLSA 1ALQA 2R78A 5CTNA 3T1XA 3LIDA 4JKTA 1SDNA 2Y2QA 4HY8A 1H8MA 4OH0A 3A3FA 4ZJ1A 3SH7A 3FYZA 1T1BA 2C5WB 3RXWA 3IHAA 5TR7A 4O8GA 3V67A 1W63M 2OOLA 3VOLA 3BQ8A 4MBKA 5A93A 3IWIA 1EW0A 1K54A 2ZQAA 3HJIA 1UGUA 3GV9A 3O88A 1AWIA 3LEQA 3UB7A 2OSUA 2V0WA 3DWKA 1PW1A 1ESIA 4LRYC 1ACFA 1D7EA 1NRFA 3LI8A 3V39A 3KSIA 2XGNA 2Y4AA 5HWVA 3DTKA 4PM7A 3BFFA 4I38A 1IEMA 2ZC3B 3AGFA 2LB9A 3T4TA 1XGIA 5G4YA 1YPRA 3CUEA 1N4OA 2I9VA 2ZC7A 2A49A 3E4OA 5EM0A 5CRFA 4M3KA 2VV6A 4DE1A 3H82A 4IVKA 5FA7A 2WGIA 5FSRA 3BFCA 5CGSA 1KE4A 4FTXA 2IWBA 4L9EA 4LRXC 2Y2PA 5F1FA 4KUKA 5E2GA 4E3OA 3IHBA 4EQIA 1O07A 2V1AA 2J9OA 2L4RA 4LRZE 5FEFA 4Y3IA 5FQQA 4Q0IA 2Y2IA 3H7WB 2OWJA 4O0PA 1NRJA 2O99A 5HSQA 1FSYA 2Z2LB 2QPNA 2ZQCA 2Y2GA 2JKGA 3NCKA 4S2JA 3CAXA 3N8RA 4JXSA 1X0OA 4QB8A 1P97A 1UWNX 3HLFA 4WEJA 4EWFA 4ZAMA 4K0WA 2J7VA 5EFWA 1H3QA 4X1LA 4UA6A 3IBJA 3LY3A 1T1AA 3KO6A 3DTIA 5C5KA 2A3UA 5EOOA 3K3DA 2J8YA 3A3EA 1HVBA 2ZLYA 3MKFA 3U2AA 2QJ7A 1TS8A 4U0TA 2Z6DA 2B02A 4MNRA 1OJ5A 4H6JA 3VFFA 1PFLA 1MC0A 3HUOA 3D72A 3NI9A 4KQQA 1NYMA 3C8CA 1SKOB 4HHDA 4YNRA 3DAVA 4Y17A 1NZUA 1K25A 3N8SA 2ZBBA 4B88A 2A2LA 1FIKA 3M2JA 2W1RA 2W3EA 5FI7A 3T4QA 1L0GA 2WZZA 4QJGA 4E3IA 3OC2A 1ONGA 2CMNA 4I3AA 1HTZA 1T1CA 2X02A 3UB8A 4FSFA 3DW0A 4WF0A 4DE0A 4OLGA 4KZ3A 1F5MA 1GHIA 5AVFA 3BY9A 3VSKA 4NXEA 1P9RA 2VKSA 1E25A 3DWZA 3NOTC 3B47A 2OAQ1 4R23A 1EI5A 2Z2MB 2HDRA 4E3NA 4EXOA 3ISGA 4Y0UA 1CI9A 3IWOA 2JKTI 3M6HA 3IX4A 3W4QA 2D01A 1DP6A 2WKEA 2P7JA 3F1OB 3MJQA 3R7WB 3ZG7B 3T4SA 4ZJ3A 4CPKA 3P01A 1V9ZA 4G3WA 4GD8A 2JE5A 3RFBA 3IXGA 3B3XA 4GLQA 3CITA 5FQIA 5F6AA 1SZVA 4QY6A 3OPHA 2XFTA 4N9KA 5DFXA 5E43A 1TEMA 3E2LA 2GNXA 4WUJA 4ETZA 2P08A 1XA7A 5L09A 3K3CA 5EV0A 1MWSA 3LICA 5DF7A 5E2HA 5AQAA 1LI9A 4DXCA 4Y13A 4ID4A 1YLPA 4S2OA 4IUHA 1XKZA 3O86A 4FH4A 1F2KA 4X55A 3N7WA 2PHYA 1VETA 3ZYTA 2VZWA 1BT5A 2VX8A 3O5YA 2V20A 3I7JA 4WZ5C 2W3DA 2HV1A 4CQHA 1L0EA 4PKYA 3DBAA 3HLBA 2R9XA 5DTTA 1SHVA 2Y2KA 5A90A 5DFYA 4X56A 4PPRA 3SW1A 4F3LA 2HGVA 4O01A 5DJTA 1ERMA 1IKGA 2VJWA 1QMEA 1DY6A 1G28A 3LCEA 3FC7A 5TBMB 1GA9A 3G30A 2ZC4B 2EXBA 4KZ8A 3PXPA 5DF9A 4WM9A 3LR5A 3PBSA 4QPRA 3BWLA 4EV4A 1FILA 1KDWA 5FQ9A 3MZDA 4Y15A 2B5RA 3VE3A 5E2FA 3LIAA 5F83A 3VP2A 2H28A 4KQDA 1YLJA 4KZ6A 2XF3A 5FDHA 2V2FF 3W4OA 3UMDA 3HLEA 3R7WA 4Q0JA 3CLOA 4GS9B 4EETB 1NXYA 2QWSA 2WKPA 1GHPA 2KOIA 2PAVP 3BECA 4HP4A 4WZ5A 1DP9A 5EOEA 3NULA 4G3VA 4R4RA 1ZG6A 1TF1A 2XR0A 4JLFA 2ZQ9A 5KSHA 2YKFA 1G68A 1VM1A 4DMZA 1FR6A 4P6BA 3QP4A 4QHCA 5G4ZA 4GCZA 5DTSA 1Y28A 5GLAA 3UDFA 5L2FA 3WS0A 1KE3A 1YQSA 1IYQA 3AGDA 1VQQA 1PZOA 1S1YA 2WKIA 3S7PA 4OQIA 3ZFZA 1WYBA 2HDUA 2UV0E 1PZPA 4E3KA 1BLHA 1EROA 3QP5A 4DDSA 3MZFA 2D02A 1IYSA 2G2UA 2VGLS 1J3WA 1O7EA 2Y2OA 5EVIB 1PYYA 1NLYA 1YMXA 3PBQA 4UHUA 1JWZA 5GHZA 1KE0A 1ZTUA 1JTDA 3EGXC 3T4LA 1HD8A 4OPQA 2K31A 4CLCB 4LV2A 4Q0HA 4B93A 2GDNA 5HX9A 1ES3A 4RQ9A 2QYBA 3G34A 4Z1WA
chains in the Genus database with same CATH topology
3E98A 3CUEA 1JNUA 2I9VA 3NHQA 3NOPC 3E4OA 5L8MA 2VV6A 3H82A 3PBOA 4MN7A 4NEED 2L1MA 4F3LB 3KSFA 4KUOA 5IT5A 1VHMA 4UEYA 5HWTA 4BWIA 3PR6A 4HH2A 1XFQA 4I5SA 3TE8A 4LPZA 4DN0A 1KOUA 2OAP1 1XJ2A 4L9EA 4LRXC 1T19A 3MR0A 4KUKA 4EEUA 1OT6A 2V1AA 1G6OA 5J4EA 4JGPA 4HJ4A 2L4RA 3CI6A 4WL9A 2A24B 4EEPA 1ZHHB 2NUTC 4LRZE 2XROA 1XJ6A 4Y3IA 4XT2A 4Q0IA 2J3TD 3F1OA 3H7WB 2OWJA 2WKRA 4O0PA 1NRJA 2O99A 3GECA 5HSQA 4WELA 4CLCC 3BY8A 1OTAA 2M7VA 4GS9A 3UB9A 2QHKA 4ARZA 1F98A 2O9BA 5HD3A 4EW7A 4GHIB 3C38A 3CAXA 4IHQA 5F5YA 1X0OA 2QJ5A 1BYWA 1P97A 1UWNX 2OWHA 4WEJA 3RTYA 3TW8A 2PR6A 4WN5A 1IOUA 5EFWA 4FOFA 1H3QA 3VE4A 3RH8B 3IBJA 1TS0A 1T1AA 2PDRA 3LUQA 4EQ1A 3LR3A 3MXQA 3KO6A 4BBVA 1WA9A 4P6ZS 1MKMA 5C5KA 1OT9A 3K3DA 2L0WA 3BW6A 1GSXA 4PHTA 1NLZA 3E0YA 5HD5A 4R38A 3U2AA 2QJ7A 5DKKA 1TS8A 2Z6DA 2W3GA 2B02A 2ZOIA 1OTDA 1OJ5A 4H6JA 3NJAA 2P04A 1MC0A 3D72A 3T4JA 2JKTM 2LB5A 5J7EA 3LIFA 3B33A 3FPVA 3E4QA 3OOVA 2B18A 3A0RA 3C8CA 3PBRA 3LFVA 1N9NA 3A0SA 4HHDA 1N9OA 4YNRA 5LBRA 2ZMVA 4I39A 4DJ3A 1XFNA 2ZBBA 2A2LA 2DMWA 2VA0A 5DKLA 2EWVA 1STZA 2W1RA 2JKRM 2W3EA 3E4PA 4HOIA 3T4QA 3HJKA 3LIEA 4EERA 1LSXA 2ZOHA 4CLCA 1YKDA 4ZRRA 2VEAA 2INWA 3UMEA 5J3WA 3OC2A 2CMNA 1ODVA 2XA7S 2BASA 3BQAA 4I3AA 1T1CA 3UB8A 3VV4A 4FSFA 3T4OA 5HDDA 3NOUC 3C30A 2V9AA 4K08A 4WF0A 3LYXA 4DJ2A 4PAUA 3EGDC 4L9FA 4M4XA 3KX0X 5TBMA 2V1BA 2JHEA 3EEHA 2W1TB 1S4RA 2KX6A 1F5MA 1YSQA 3CWFA 3UB6A 3TRCA 2VV8A 5AVFA 3BY9A 2GZAA 2K7SA 1S4SA 2Y79A 4NXEA 1P9RA 2VKSA 2XSSA 3NOTC 3B47A 3UE3A 5KIZA 2OAQ1 1T18A 4EXOA 1LL8A 4HJ6A 4IUKA 2HJEA 2JKTI 2O9AA 2Z6CA 2J3WA 1TS7A 4G3KA 2W3HA 4R70A 3JVUA 3LR4A 5AJGA 3ULFA 2D01A 4LLOB 5FL3A 3ZQ5A 3KSGA 1DP6A 4UQIS 2P7JA 1VB6A 3F1OB 3MJQA 2HF6A 3R7WB 3H9WA 3T4SA 1NWZA 2PD7A 3EOIA 3IS2B 3P01A 4KQOA 4MN6A 4WLAA 1V9ZA 3S7QA 5HPFA 4G3WA 5CX7A 2W3FA 3T50A 3FPWA 3RFBA 2EWWA 4ARZB 1MZUA 3A0VA 5AVEA 2FZ0A 4Y2FA 2G7UA 3CUEC 1GSWA 4GHIA 4GLQA 2M7UA 5HWWA 4HQAA 3CITA 2EA9A 4I3IA 2J3TC 3MQ0A 5F6AA 1XJ3A 2M1CA 1YAXA 4HIAA 3W2ZA 5DFXA 4BJPA 3T4KA 4GW9A 3EEAA 4BBUA 5IS1A 5MC7A 2O9CA 1S66L 3MQOA 5IU1A 2GNXA 3GDIA 4WUJA 3F1NB 2P08A 3OCLA 4R3AA 4ETZA 4YOFA 1P9WA 3B42A 3K3CA 4P6ZM 1W63Q 5F68A 2FH5A 3F1PB 3LICA 4EESA 4WEKA 2V0UA 3S7NA 3UE6A 4ME4A 4ETXA 5HZHA 1LT0A 1V9YA 4IUHA 4PKYG 2VGLM 2IA2A 1S1ZA 3LR0A 4JGOA 3EWKA 4II7A 4H6JB 2PHYA 2W27A 4MCWA 3ZYTA 2VZWA 5I5LA 3C2WA 3ICYA 3G6OA 2VX8A 3O5YA 1YSPA 2J80A 1S67L 2W3DA 4B9OA 1D06A 2HV1A 4HJ3A 4CQHA 4NXBA 1OPXA 4PKYA 2KDKA 3DBAA 3MQQA 4EUVA 4I3JA 5DFYA 4R6LA 4OOLA 5HDSA 2MJ6A 3H82B 3SW1A 4F3LA 2HGVA 4O01A 3PYPA 3EQVA 5DJTA 1TD5A 2XA7M 2VJWA 4GJ4A 2NUPC 4AFIA 1G28A 4HP9A 3FC7A 4JGRA 5TBMB 2YKHA 1LSVA 2W1TA 3R4KA 4HI4A 2VLGA 2VV7A 3PXPA 5DF9A 1UWPX 5TJJA 3LR5A 3PBSA 4QPRA 3BWLA 4OOMA 4YWZA 1F9IA 4CLCD 2PYPA 3K2NA 2W0NA 3D3OA 1DRMA 2K2NA 2A24A 2ZMFA 3VE3A 3LIAA 1OTEA 4HNBA 3OLOA 3OBFA 3IBRA 1TS6A 4XT2B 1LSWA 2H28A 5HL6A 4MDZA 3H7WA 4KQDA 2PR5A 4E04A 5K5BA 2GJ3A 1IFQA 2QKPA 4MMNA 3MF0A 3UMDA 2JKRI 3MMHA 4MN5A 4UQIM 3R7WA 4Q0JA 3CLOA 1DP8A 3FG8A 4GS9B 4BBTA 4EETB 4IJGA 2QWSA 2WKPA 2KOIA 3IS2A 4HP4A 4L0LA 3LIBA 4JGQA 1N9LA 1DP9A 3LI9A 2HJ9C 3S7OA 4G3VA 1TF1A 4NXFA 4EU0A 2PT7A 4CLCE 4HH3A 5KSHA 2YKFA 2R78A 3P7NA 5DJUA 4DMZA 5HPIA 1OTIA 3LIDA 1GSVA 1P0ZA 4L9GA 5G4ZA 3JVVA 3PBTA 4GCZA 4HY8A 1H8MA 2PYRA 1Y28A 1T1BA 1OJGA 3F1NA 2O0YA 3KYZA 5F69A 4O8GA 1S1YA 3S7PA 1W63M 3V67A 2OOLA 3VOLA 3F1PA 4Y5FA 5A8BA 3MFXA 3KSHA 3BJNA 3BQ8A 2D02A 2VGLS 4BMWA 1EW0A 5HDCA 3HJIA 1UGUA 1OTBA 1NLYA 3TJZC 3PBQA 2GX5A 3KYQA 3UB7A 1ZTUA 2PD8A 1XJ4A 2V0WA 2KLIA 3EGXC 4LRYC 3T4LA 3EQUA 2WKQA 1D7EA 3PHYA 3HCYA 4NKPA 3LI8A 3OCNA 3PBNA 3KSIA 4NXGA 2XRNA 2K31A 4CLCB 5HWVA 4I38A 2JN7A 4Q0HA 4B93A 2LB9A 3T4TA 2Y8HA 4RQ9A 2QYBA 5G4YA 4Z1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNU A;  2I9V A;  3NHQ A;  3NOP C;  3E4O A;  2VV6 A;  3H82 A;  2L1M A;  4F3L B;  4KUO A;  5HWT A;  4HH2 A;  1XFQ A;  4I5S A;  4LPZ A;  1KOU A;  1XJ2 A;  4L9E A;  4LRX C;  1T19 A;  3MR0 A;  4KUK A;  4EEU A;  1OT6 A;  2V1A A;  5J4E A;  4JGP A;  4HJ4 A;  2L4R A;  4WL9 A;  2A24 B;  4EEP A;  4LRZ E;  1XJ6 A;  4XT2 A;  3F1O A;  3H7W B;  2OWJ A;  2WKR A;  3GEC A;  5HSQ A;  3BY8 A;  1OTA A;  4GS9 A;  3UB9 A;  2QHK A;  1F98 A;  5HD3 A;  4EW7 A;  4GHI B;  3CAX A;  5F5Y A;  1X0O A;  2QJ5 A;  1BYW A;  1P97 A;  1UWN X;  2OWH A;  3RTY A;  2PR6 A;  4WN5 A;  5EFW A;  3VE4 A;  3RH8 B;  1TS0 A;  1T1A A;  2PDR A;  3LUQ A;  4EQ1 A;  3MXQ A;  4BBV A;  1WA9 A;  1OT9 A;  3K3D A;  2L0W A;  1GSX A;  5HD5 A;  4R38 A;  2QJ7 A;  5DKK A;  1TS8 A;  2Z6D A;  2B02 A;  2ZOI A;  1OTD A;  1OJ5 A;  4H6J A;  3NJA A;  3D72 A;  5J7E A;  3LIF A;  3B33 A;  3E4Q A;  3A0R A;  3C8C A;  1N9N A;  3A0S A;  4HHD A;  1N9O A;  4DJ3 A;  4I39 A;  1XFN A;  2ZBB A;  5DKL A;  3E4P A;  4HOI A;  3HJK A;  3LIE A;  4EER A;  1LSX A;  2ZOH A;  2VEA A;  2INW A;  3UME A;  5J3W A;  2CMN A;  1ODV A;  2BAS A;  4I3A A;  3UB8 A;  1T1C A;  5HDD A;  3NOU C;  2V9A A;  4K08 A;  4WF0 A;  3LYX A;  4DJ2 A;  4L9F A;  4M4X A;  3KX0 X;  5TBM A;  2V1B A;  2JHE A;  3EEH A;  1S4R A;  2KX6 A;  3CWF A;  3UB6 A;  2VV8 A;  5AVF A;  3BY9 A;  2K7S A;  1S4S A;  4NXE A;  3NOT C;  5KIZ A;  1T18 A;  4EXO A;  1LL8 A;  4HJ6 A;  2Z6C A;  1TS7 A;  4R70 A;  3ULF A;  2D01 A;  4LLO B;  3ZQ5 A;  1DP6 A;  2P7J A;  1VB6 A;  3F1O B;  3MJQ A;  3H9W A;  1NWZ A;  2PD7 A;  3IS2 B;  4MN6 A;  4WLA A;  1V9Z A;  3T50 A;  1MZU A;  3A0V A;  5AVE A;  4GHI A;  1GSW A;  5HWW A;  4HQA A;  2EA9 A;  4I3I A;  5F6A A;  1XJ3 A;  2M1C A;  4HIA A;  4GW9 A;  4BBU A;  5IS1 A;  1S66 L;  3MQO A;  5IU1 A;  3GDI A;  4WUJ A;  3F1N B;  4R3A A;  3K3C A;  5F68 A;  3F1P B;  3LIC A;  4EES A;  2V0U A;  3UE6 A;  5HZH A;  1LT0 A;  1V9Y A;  4PKY G;  1S1Z A;  4JGO A;  3EWK A;  4H6J B;  2PHY A;  2W27 A;  5I5L A;  3C2W A;  3ICY A;  3G6O A;  2J80 A;  1S67 L;  4B9O A;  1D06 A;  2HV1 A;  4HJ3 A;  4NXB A;  4PKY A;  2KDK A;  3MQQ A;  4I3J A;  4R6L A;  5HDS A;  3H82 B;  3SW1 A;  4F3L A;  3PYP A;  5DJT A;  1G28 A;  4HP9 A;  3FC7 A;  4JGR A;  5TBM B;  2YKH A;  1LSV A;  4HI4 A;  2VLG A;  2VV7 A;  1UWP X;  3BWL A;  4YWZ A;  1F9I A;  2PYP A;  2W0N A;  1DRM A;  2A24 A;  3VE3 A;  3LIA A;  1OTE A;  4HNB A;  3OLO A;  3IBR A;  1TS6 A;  4XT2 B;  1LSW A;  2H28 A;  3H7W A;  4KQD A;  2PR5 A;  4E04 A;  2GJ3 A;  2QKP A;  3UMD A;  4MN5 A;  3CLO A;  1DP8 A;  3FG8 A;  4GS9 B;  4BBT A;  4EET B;  2QWS A;  2WKP A;  3IS2 A;  4HP4 A;  3LIB A;  4JGQ A;  1N9L A;  1DP9 A;  3LI9 A;  4NXF A;  4HH3 A;  2YKF A;  2R78 A;  3P7N A;  5DJU A;  1OTI A;  3LID A;  1GSV A;  1P0Z A;  4L9G A;  5G4Z A;  4GCZ A;  4HY8 A;  2PYR A;  1Y28 A;  1T1B A;  1OJG A;  3F1N A;  5F69 A;  1S1Y A;  2OOL A;  3VOL A;  3F1P A;  5A8B A;  3MFX A;  2D02 A;  1EW0 A;  5HDC A;  3HJI A;  1UGU A;  1OTB A;  3UB7 A;  2PD8 A;  1XJ4 A;  2V0W A;  4LRY C;  2WKQ A;  1D7E A;  3PHY A;  3LI8 A;  4NXG A;  5HWV A;  4I38 A;  2JN7 A;  4RQ9 A;  5G4Y A; 
#chains in the Genus database with same CATH topology
 4OON A;  3VMA A;  3E98 A;  1JNU A;  3RJU A;  2ZQ7 A;  4KUO A;  1W8Y A;  5IT5 A;  3GMW A;  3UN7 A;  3V3R A;  3IF5 A;  3MKE A;  4RVA A;  4DF6 A;  4I5S A;  2ZL1 B;  4DN0 A;  4NK3 A;  1T19 A;  1GHM A;  4EBN A;  1G6O A;  1TDG A;  1SDE A;  5J4E A;  2BTF P;  4R1G A;  5EPH A;  4JGP A;  3S22 A;  4U0X A;  4EEP A;  1YLT A;  4U3T A;  2XRO A;  1AXB A;  3P98 A;  3ZNY A;  2XDM A;  3UNW A;  2Y59 A;  4CLC C;  4DRT A;  1OTA A;  3G32 A;  1IKI A;  3G31 A;  4GS9 A;  3UB9 A;  2QHK A;  3QP6 A;  4ARZ A;  1F98 A;  2O9B A;  5HD3 A;  3C38 A;  3HUN A;  4IHQ A;  5F5Y A;  4OLD A;  2Y2M A;  3ZVT A;  3GSG A;  3RTY A;  2PU4 A;  4JBF A;  2RCX A;  3VE4 A;  1W5D A;  5HL1 A;  3V5M A;  2WAD A;  3BYD A;  3S4X A;  4ZBE A;  3LUQ A;  1K6R A;  3LR3 A;  4BBV A;  4P6Z S;  4E6W A;  1K6S A;  1PW8 A;  4ESP A;  3BW6 A;  1GSX A;  2Q0O A;  4H8R A;  2ZQ8 A;  5DKK A;  4LV3 A;  1K57 C;  1OTD A;  5HAQ A;  3BFD A;  4DXB A;  2XH9 A;  4S2L A;  2LB5 A;  1DJC A;  3L7H A;  3Q81 A;  3B33 A;  2B18 A;  1I5Q A;  3PBR A;  3FWL A;  3A0S A;  1N9O A;  5FAP A;  4DJ3 A;  4I39 A;  3U4L P;  1XFN A;  1L2S A;  2EWV A;  2WUQ A;  2JKR M;  3E4P A;  2HPB A;  2QMI A;  4HOI A;  1JWV A;  5CGW A;  5AQ9 A;  5HAR A;  1LHY A;  3VP3 A;  4CLC A;  4ZRR A;  2VEA A;  2INW A;  3UME A;  1OME A;  4RX2 A;  5DF8 A;  4OOY A;  1ODV A;  5GHY A;  3BQA A;  2JKF A;  2V9A A;  4K08 A;  3LYX A;  4DJ2 A;  2PRF A;  3EGD C;  4L9F A;  2JHE A;  4S2P A;  2ZC5 B;  3CWF A;  3UB6 A;  5FDS A;  2VV8 A;  2ZL1 A;  5FAT A;  4OKP A;  3VOY A;  1ONH A;  2GZA A;  2K7S A;  2V8F A;  2Y79 A;  4K91 A;  3G2Z A;  3G4P A;  4LCM A;  5L10 A;  1HLU P;  3Q1F A;  2O9A A;  2Z6C A;  2J3W A;  1K57 A;  2W3H A;  4R70 A;  3JVU A;  3ULF A;  5AJG A;  5FQJ A;  5J8X A;  4LLO B;  2Y91 A;  2Y2J A;  1HZO A;  1MPL A;  2BLS A;  2PD7 A;  3KYE A;  4WLA A;  5HPF A;  2WZX A;  3UB5 P;  3T50 A;  2XFS A;  4MEZ A;  2EWW A;  1MZU A;  3A0V A;  5L07 A;  2FZ0 A;  1JTG A;  4GNU A;  5HWW A;  4HQA A;  1YT4 A;  4MLL A;  4QU3 A;  2HP6 A;  2J3T C;  2XD5 A;  1XJ3 A;  1YAX A;  3W2Z A;  3CZD A;  4BJP A;  3T4K A;  3EEA A;  5IS1 A;  3GVB A;  1DJA A;  4E3J A;  5MC7 A;  4WZ4 A;  1S66 L;  5IU1 A;  1BLC A;  3FV7 A;  3F1N B;  3ITB A;  2HDQ A;  3B42 A;  1W63 Q;  2FH5 A;  4JXG A;  4YIN A;  3HLW A;  4XXR A;  1WYC A;  4ME4 A;  1LT0 A;  2H0T A;  1V9Y A;  3LGO A;  2BG1 A;  4PKY G;  1PI5 A;  2WGW B;  4KZ4 A;  4EBP A;  4II7 A;  1Q2Q A;  4MCW A;  2ZD8 A;  5CTM A;  3ICY A;  2ZM0 A;  2JBF A;  3DTE A;  1D06 A;  2C6W B;  3JPU A;  4DE2 A;  4KG5 A;  3AGE A;  1NYY A;  4I3J A;  1KVL A;  4X25 A;  1K4F A;  1E4D A;  5HDS A;  1A0K A;  2MJ6 A;  1L0D A;  1WE4 A;  5GL9 A;  1MBL A;  3SH9 A;  3PYP A;  4MBH A;  5FI6 A;  1SKF A;  3NDE A;  4P0M A;  1H8Z A;  4GJ4 A;  3NEC A;  1RP5 A;  4LV0 A;  4AFI A;  4JGR A;  2ACG A;  2YKH A;  3R4K A;  4OPR A;  2VLG A;  5CHJ A;  1PIO A;  3A3I A;  4EBL A;  1BUE A;  4CLC D;  5F82 A;  4PM6 A;  1DRM A;  3GQZ A;  2ZMF A;  4HNB A;  3OLO A;  3GRJ A;  2IWD A;  4MDZ A;  3H7W A;  2PR5 A;  4E04 A;  4KZA A;  3BFE A;  1H5X A;  1IFQ A;  2QKP A;  1CF0 A;  4WMC A;  4MN5 A;  4GKU A;  3VSL A;  2EX2 A;  2XD1 A;  4OQH A;  1DP8 A;  3FG8 A;  4BBT A;  4IJG A;  4JXW A;  3LIB A;  1N9L A;  4DE3 A;  1MXO A;  3HLG A;  4NXF A;  4EU0 A;  4CLC E;  3UY6 A;  1YM1 A;  3MXS A;  4OP8 A;  3UE0 A;  3P7N A;  5HPI A;  5KSC A;  4ZTK A;  3PAG A;  3JYI A;  1S0W A;  4L9G A;  4QY5 A;  3MS6 A;  3PTE A;  2PYR A;  1FCO A;  1GCE A;  1MWU A;  4E6X A;  1MWT A;  2WAE A;  3F1N A;  4PM5 A;  5TFQ A;  2WKH A;  4N9L A;  5F1G A;  5F69 A;  5KZH A;  5AQB A;  3HVF A;  5A8B A;  3MFX A;  1BLS A;  4HBU A;  4YFM A;  2AVX A;  3KSH A;  4KZB A;  2WGW A;  4JF5 A;  5FAO A;  4CJN A;  1SKO A;  2GX5 A;  4BL2 A;  3KYQ A;  1M40 A;  1PWD A;  3V3S A;  2KLI A;  3EQU A;  2WKQ A;  5CXW A;  1L0F A;  4X53 A;  3PHY A;  3OCN A;  1QMF A;  2XRN A;  4KEN B;  5JYO A;  2QZ6 A;  1BUL A;  2Y8H A;  5M1A A;  4RYE A;  1PNE A;  3NHQ A;  3PBO A;  4MN7 A;  4N92 A;  2X01 A;  2L1M A;  3UPP A;  3KSF A;  1VHM A;  2ZC6 B;  5HWT A;  5D3O A;  4BWI A;  4A5R A;  2ZMA A;  3NY4 A;  4Z9Q A;  4HH2 A;  1KVM A;  5GHX A;  4GDB A;  3TE8 A;  4LPZ A;  3ZGA B;  2OAP 1;  1XJ2 A;  3IWQ A;  3MR0 A;  5EVE A;  4EEU A;  4KG6 A;  4OVD A;  2IWC A;  1LI0 A;  1KGG A;  1Y54 A;  2DRW A;  3CI6 A;  4WL9 A;  2A24 B;  2NUT C;  4BD0 A;  2E8I A;  1YLZ A;  1XJ6 A;  2B95 A;  3ZCZ A;  5FQK A;  2J3T D;  3F1O A;  1LL9 A;  2WKR A;  3GEC A;  4OPZ A;  4B4X A;  4KG2 A;  1H8Y A;  4WEL A;  4Y0T A;  1H0M A;  3BY8 A;  3ITA A;  4X6T A;  1Z09 A;  4EW7 A;  3C4O A;  3SS5 A;  2XK1 A;  4GHI B;  5FEG A;  5A91 A;  4E3M A;  3TW8 A;  2PR6 A;  4WN5 A;  4FCF A;  3T1R A;  1FOF A;  5HAI A;  3RH8 B;  1TS0 A;  4FUW A;  1YMS A;  4WMC D;  3P09 A;  3MXQ A;  3SOI A;  1WA9 A;  3C4P A;  1MKM A;  3ZG0 A;  4P85 A;  1KGF A;  2L0W A;  3FKW A;  1NLZ A;  4R38 A;  3SH8 A;  1GA0 A;  2H0Y A;  3IT9 A;  2Y2H A;  1XP4 A;  2ZOI A;  3HUM A;  5HW3 A;  4DDY A;  2H10 A;  1RGZ A;  3T4J A;  4C3Q A;  4GB7 A;  4RA7 A;  1G5U A;  3FPV A;  2RL3 A;  3E4Q A;  3A0R A;  2V1Z A;  5LBR A;  2ZMV A;  2Q9M A;  2DMW A;  2VA0 A;  4KQR A;  4B4Z A;  1PI4 A;  4OQG A;  1CQA A;  2ZOH A;  3IXH A;  1YKD A;  3CMZ A;  3WS4 A;  2JC7 A;  1I2W A;  1G6A A;  5J3W A;  1D1J A;  5GLD A;  2FFF B;  2XA7 S;  2H5S A;  1FR1 A;  3VV4 A;  3T4O A;  1YLW A;  3NOU C;  3D4F A;  4PAU A;  4BQM A;  4M4X A;  3KX0 X;  2PBY A;  5TBM A;  2V1B A;  2W1T B;  1S4R A;  2KX6 A;  4F94 A;  1YSQ A;  3TRC A;  2UWX A;  4IVI A;  4NET A;  1JWP A;  1S4S A;  2XSS A;  1FSW A;  5EVI C;  1ZG4 A;  5BOH A;  3QNC A;  1T18 A;  5CEB A;  1LL8 A;  3T1S A;  4IUK A;  2HJE A;  5CED A;  1MKI A;  1PRQ A;  1FQG A;  1TS7 A;  2Y2N A;  5FL3 A;  3ZQ5 A;  1JVJ A;  5DTK A;  4UQI S;  3KSG A;  4MBF A;  1K0K A;  1VB6 A;  2HF6 A;  3H9W A;  1NWZ A;  3EOI A;  3S7Q A;  5CX7 A;  3O87 A;  2P9V B;  5GLC A;  1TDL A;  2ZQD A;  3C7V A;  4Y2F A;  1XPB A;  2G7U A;  3CUE C;  4GHI A;  2EA9 A;  5FAQ A;  2M1C A;  4HEF A;  4R3J A;  2WK0 A;  4HIA A;  2I72 A;  4FH2 A;  4OQ0 A;  3ZG5 A;  3MQO A;  1BTL A;  3GDI A;  4P6Z M;  1P9W A;  3GTC A;  2OLV A;  3F1P B;  4WEK A;  2V0U A;  3UDI A;  3UE6 A;  3TOI A;  4ZDX A;  3MXR A;  3O3V A;  3T12 B;  1W79 A;  4WYY A;  2IA2 A;  1S1Z A;  3LR0 A;  3EWK A;  4H6J B;  5EVI A;  3UDX A;  1RGY A;  5IHV A;  3ZDJ A;  3RXX A;  3C2W A;  3N8L A;  1ESU A;  4UA9 A;  3G6O A;  1YSP A;  1K56 A;  2EX8 A;  2VGJ A;  4B9O A;  3QP1 A;  4S2N C;  4HJ3 A;  4NXB A;  3Q7Z A;  3IXD A;  1OPX A;  4LCL A;  3MQQ A;  3UPO A;  3TG9 A;  4R6L A;  2EX9 A;  4IED A;  4Q8I A;  3OPL A;  3BFG A;  3EQV A;  4WBG A;  4GN2 A;  3VP0 A;  2NUP C;  1BLP A;  3T1Q B;  2DCF A;  4HP9 A;  1E3U A;  3PAE A;  4OP5 A;  1LSV A;  2W1T A;  3QP2 A;  2FFY A;  1N9B A;  1KDS A;  1U60 A;  2W0N A;  4R3B A;  3D3O A;  3IQA A;  3CHW P;  1NY0 A;  1M6K A;  1OTE A;  1TS6 A;  4XT2 B;  1LSW A;  3L9K A;  1K38 A;  3OZH A;  5HL6 A;  4HES A;  4PMA A;  2GJ3 A;  3MMH A;  4XUX A;  2ZM2 A;  4Y0O A;  4S2I A;  4BD1 A;  3SS4 A;  4L0L A;  4JGQ A;  2P9V A;  2HZ5 A;  2HJ9 C;  3S7O A;  4S2N A;  1LL5 A;  1J9M A;  3HLD A;  4S2K A;  4JXV A;  2OLU A;  5DJU A;  3VP1 A;  4GD6 A;  1OTI A;  1GSV A;  4KZ7 A;  1P0Z A;  3ZG8 B;  3UO9 A;  3JVV A;  3PBT A;  2WYX A;  2JCH A;  3OPR A;  4KZ9 A;  1NZO A;  1OJG A;  1S6R A;  2O0Y A;  3KYZ A;  4GDN A;  3M2K A;  3WRZ A;  5EUA A;  4C75 A;  3CPT B;  3F1P A;  4XUZ A;  4Y5F A;  1XGJ A;  2X71 A;  3WRT A;  3BJN A;  5CEC A;  1PWG A;  3NDG A;  3FKV A;  4BMW A;  3IX8 A;  5HDC A;  1VET B;  1OTB A;  3IX3 A;  4JF4 A;  3TJZ C;  2G2W A;  5GLB A;  3BM6 A;  4QWO A;  2PD8 A;  1XJ4 A;  4N1H A;  3N4I A;  1XXM A;  3HCY A;  4NKP A;  1CEG A;  1Z6F A;  3PBN A;  4LGW A;  4NXG A;  2WAF A;  2JN7 A;  3QP8 A;  5EVI D;  1IYP A;  3NOP C;  5KMW A;  5L8M A;  4NEE D;  5FQM A;  4F3L B;  1FCM A;  1K56 D;  3MSH A;  4UEY A;  3IH8 A;  2CC1 A;  4P87 A;  3PR6 A;  1XFQ A;  1VEU B;  1KOU A;  1OT6 A;  3D9Y A;  4X1M A;  2ZM8 A;  5TGF A;  3Q7V B;  5G18 A;  5M18 A;  4UAA A;  1LLB A;  3TSG A;  4HJ4 A;  2EFU A;  5E2E A;  1ZHH B;  4XT2 A;  1E3U D;  3LY4 A;  4E3L A;  4FD8 A;  3LO7 A;  2EXA A;  1XX2 A;  3UPN A;  2M7V A;  1K4E A;  5A92 A;  4NG2 A;  3Q82 A;  3HRE A;  3MFD A;  2QJ5 A;  5HFO A;  4X69 A;  1BYW A;  2Y55 A;  2OWH A;  5EEC A;  3QNB A;  1CJF A;  1IOU A;  4FOF A;  4OPY A;  1SCW A;  5EM1 A;  2PDR A;  4IBX A;  4EQ1 A;  3ZNT A;  5EE8 A;  1OT9 A;  2V8C A;  4N1X A;  4BLM A;  4KZ5 A;  3N6I A;  4PHT A;  3E0Y A;  5HD5 A;  2XLN A;  3WS2 A;  1Q2P A;  1MWR A;  1TVF A;  1L3L A;  2W3G A;  4R4S A;  3LEZ A;  3OPP A;  3CPT A;  3E2K A;  3FZC A;  3NJA A;  2P04 A;  4C6Y A;  5DVA A;  3QHY A;  2JKT M;  1XA1 A;  5J7E A;  3A3D A;  3LIF A;  3HBR A;  3OOV A;  3LFV A;  1N9N A;  1PWC A;  4UA7 A;  1I2S A;  4R0Q A;  5DKL A;  4D60 A;  1ZC2 A;  1STZ A;  4QD4 A;  2E8J A;  4GZB A;  1CK3 A;  1KGE A;  3IH9 A;  2HP5 A;  3MBZ A;  4ZJ2 A;  3HJK A;  3LIE A;  4EER A;  1LSX A;  3IF6 B;  1K55 C;  3BRM A;  3G35 A;  2BAS A;  5FI2 A;  5HDD A;  3C30 A;  2HDS A;  2PBD P;  3CJM A;  3VP4 A;  3EEH A;  1MY8 A;  3V50 A;  3S1Y A;  4BEN A;  3M6B A;  1VEU A;  1DJB A;  3ZVW A;  5AQ7 A;  3GR2 A;  1ES5 A;  3UE3 A;  5KIZ A;  5CHU A;  1FCN A;  1ZKJ A;  3Q7V A;  4HJ6 A;  2EFX A;  5EVL A;  3WS1 A;  4G3K A;  3NBL A;  3LR4 A;  3W8K A;  4JF6 A;  3BLM A;  3NC8 A;  5M19 A;  2Y2L A;  3IS2 B;  4KQO A;  4MN6 A;  2W3F A;  3Q07 A;  3FPW A;  3IF6 C;  3VFH A;  5HAP A;  4Y7P A;  4ARZ B;  5AVE A;  1GSW A;  4LFU A;  2XEP A;  2M7U A;  4I3I A;  3MQ0 A;  4DKI A;  3WS5 A;  4O7D A;  3G2Y A;  4GW9 A;  4BBU A;  1Y4O A;  1K55 A;  2O9C A;  4PM9 A;  3OCL A;  4R3A A;  1ES4 A;  3SZT A;  3DTM A;  4YOF A;  1ERQ A;  1YLY A;  2DNS A;  5F68 A;  4EUZ A;  2P74 A;  4EES A;  5U47 A;  3S7N A;  2WGV A;  4ETX A;  2R9W A;  5HZH A;  4S2M A;  4GOG A;  3SS3 A;  2VGL M;  1IYO A;  4JGO A;  5I94 A;  2W27 A;  1ES2 A;  5I5L A;  2OV5 A;  4JPM A;  2J80 A;  1S67 L;  4D2O A;  4BL3 A;  2Q9N A;  5JYP A;  2VGK A;  1CI8 A;  3CG5 A;  1C3B A;  3HL9 A;  5CHM A;  4LEN A;  2KDK A;  4RX3 A;  4EUV A;  3BEB A;  3W4P A;  4OOL A;  3UE1 A;  3MZE A;  1RCJ A;  3H82 B;  5CER A;  1W7F A;  3IF6 A;  5CGX A;  4LV1 A;  2XQZ A;  3ZHH A;  2HP9 A;  1TD5 A;  1BSG A;  2XA7 M;  5FAS A;  2ZJ9 A;  4HI4 A;  2VK3 A;  4PM8 A;  3VOZ A;  2VV7 A;  3ZG9 B;  1UWP X;  2J9P A;  5TJJ A;  4X68 A;  1K54 C;  4OOM A;  1F9I A;  4YWZ A;  2PYP A;  3K2N A;  4K0X A;  3A3J A;  3WWX A;  2PU2 A;  2A24 A;  2EX6 A;  2K2N A;  3OBF A;  1W8Q A;  3IBR A;  1IEL A;  3NIA A;  3HLC A;  5K5B A;  4MMN A;  3MF0 A;  3IXB A;  2JKR I;  4UQI M;  1NJ4 A;  1EWZ A;  3IS2 A;  3C5A A;  3LI9 A;  1CEF A;  3C7U A;  2PT7 A;  4IBR A;  4HBT A;  4HH3 A;  1BZA A;  3BLS A;  1ALQ A;  2R78 A;  5CTN A;  3T1X A;  3LID A;  4JKT A;  1SDN A;  2Y2Q A;  4HY8 A;  1H8M A;  4OH0 A;  3A3F A;  4ZJ1 A;  3SH7 A;  3FYZ A;  1T1B A;  2C5W B;  3RXW A;  3IHA A;  5TR7 A;  4O8G A;  3V67 A;  1W63 M;  2OOL A;  3VOL A;  3BQ8 A;  4MBK A;  5A93 A;  3IWI A;  1EW0 A;  1K54 A;  2ZQA A;  3HJI A;  1UGU A;  3GV9 A;  3O88 A;  1AWI A;  3LEQ A;  3UB7 A;  2OSU A;  2V0W A;  3DWK A;  1PW1 A;  1ESI A;  4LRY C;  1ACF A;  1D7E A;  1NRF A;  3LI8 A;  3V39 A;  3KSI A;  2XGN A;  2Y4A A;  5HWV A;  3DTK A;  4PM7 A;  3BFF A;  4I38 A;  1IEM A;  2ZC3 B;  3AGF A;  2LB9 A;  3T4T A;  1XGI A;  5G4Y A;  1YPR A;  3CUE A;  1N4O A;  2I9V A;  2ZC7 A;  2A49 A;  3E4O A;  5EM0 A;  5CRF A;  4M3K A;  2VV6 A;  4DE1 A;  3H82 A;  4IVK A;  5FA7 A;  2WGI A;  5FSR A;  3BFC A;  5CGS A;  1KE4 A;  4FTX A;  2IWB A;  4L9E A;  4LRX C;  2Y2P A;  5F1F A;  4KUK A;  5E2G A;  4E3O A;  3IHB A;  4EQI A;  1O07 A;  2V1A A;  2J9O A;  2L4R A;  4LRZ E;  5FEF A;  4Y3I A;  5FQQ A;  4Q0I A;  2Y2I A;  3H7W B;  2OWJ A;  4O0P A;  1NRJ A;  2O99 A;  5HSQ A;  1FSY A;  2Z2L B;  2QPN A;  2ZQC A;  2Y2G A;  2JKG A;  3NCK A;  4S2J A;  3CAX A;  3N8R A;  4JXS A;  1X0O A;  4QB8 A;  1P97 A;  1UWN X;  3HLF A;  4WEJ A;  4EWF A;  4ZAM A;  4K0W A;  2J7V A;  5EFW A;  1H3Q A;  4X1L A;  4UA6 A;  3IBJ A;  3LY3 A;  1T1A A;  3KO6 A;  3DTI A;  5C5K A;  2A3U A;  5EOO A;  3K3D A;  2J8Y A;  3A3E A;  1HVB A;  2ZLY A;  3MKF A;  3U2A A;  2QJ7 A;  1TS8 A;  4U0T A;  2Z6D A;  2B02 A;  4MNR A;  1OJ5 A;  4H6J A;  3VFF A;  1PFL A;  1MC0 A;  3HUO A;  3D72 A;  3NI9 A;  4KQQ A;  1NYM A;  3C8C A;  1SKO B;  4HHD A;  4YNR A;  3DAV A;  4Y17 A;  1NZU A;  1K25 A;  3N8S A;  2ZBB A;  4B88 A;  2A2L A;  1FIK A;  3M2J A;  2W1R A;  2W3E A;  5FI7 A;  3T4Q A;  1L0G A;  2WZZ A;  4QJG A;  4E3I A;  3OC2 A;  1ONG A;  2CMN A;  4I3A A;  1HTZ A;  1T1C A;  2X02 A;  3UB8 A;  4FSF A;  3DW0 A;  4WF0 A;  4DE0 A;  4OLG A;  4KZ3 A;  1F5M A;  1GHI A;  5AVF A;  3BY9 A;  3VSK A;  4NXE A;  1P9R A;  2VKS A;  1E25 A;  3DWZ A;  3NOT C;  3B47 A;  2OAQ 1;  4R23 A;  1EI5 A;  2Z2M B;  2HDR A;  4E3N A;  4EXO A;  3ISG A;  4Y0U A;  1CI9 A;  3IWO A;  2JKT I;  3M6H A;  3IX4 A;  3W4Q A;  2D01 A;  1DP6 A;  2WKE A;  2P7J A;  3F1O B;  3MJQ A;  3R7W B;  3ZG7 B;  3T4S A;  4ZJ3 A;  4CPK A;  3P01 A;  1V9Z A;  4G3W A;  4GD8 A;  2JE5 A;  3RFB A;  3IXG A;  3B3X A;  4GLQ A;  3CIT A;  5FQI A;  5F6A A;  1SZV A;  4QY6 A;  3OPH A;  2XFT A;  4N9K A;  5DFX A;  5E43 A;  1TEM A;  3E2L A;  2GNX A;  4WUJ A;  4ETZ A;  2P08 A;  1XA7 A;  5L09 A;  3K3C A;  5EV0 A;  1MWS A;  3LIC A;  5DF7 A;  5E2H A;  5AQA A;  1LI9 A;  4DXC A;  4Y13 A;  4ID4 A;  1YLP A;  4S2O A;  4IUH A;  1XKZ A;  3O86 A;  4FH4 A;  1F2K A;  4X55 A;  3N7W A;  2PHY A;  1VET A;  3ZYT A;  2VZW A;  1BT5 A;  2VX8 A;  3O5Y A;  2V20 A;  3I7J A;  4WZ5 C;  2W3D A;  2HV1 A;  4CQH A;  1L0E A;  4PKY A;  3DBA A;  3HLB A;  2R9X A;  5DTT A;  1SHV A;  2Y2K A;  5A90 A;  5DFY A;  4X56 A;  4PPR A;  3SW1 A;  4F3L A;  2HGV A;  4O01 A;  5DJT A;  1ERM A;  1IKG A;  2VJW A;  1QME A;  1DY6 A;  1G28 A;  3LCE A;  3FC7 A;  5TBM B;  1GA9 A;  3G30 A;  2ZC4 B;  2EXB A;  4KZ8 A;  3PXP A;  5DF9 A;  4WM9 A;  3LR5 A;  3PBS A;  4QPR A;  3BWL A;  4EV4 A;  1FIL A;  1KDW A;  5FQ9 A;  3MZD A;  4Y15 A;  2B5R A;  3VE3 A;  5E2F A;  3LIA A;  5F83 A;  3VP2 A;  2H28 A;  4KQD A;  1YLJ A;  4KZ6 A;  2XF3 A;  5FDH A;  2V2F F;  3W4O A;  3UMD A;  3HLE A;  3R7W A;  4Q0J A;  3CLO A;  4GS9 B;  4EET B;  1NXY A;  2QWS A;  2WKP A;  1GHP A;  2KOI A;  2PAV P;  3BEC A;  4HP4 A;  4WZ5 A;  1DP9 A;  5EOE A;  3NUL A;  4G3V A;  4R4R A;  1ZG6 A;  1TF1 A;  2XR0 A;  4JLF A;  2ZQ9 A;  5KSH A;  2YKF A;  1G68 A;  1VM1 A;  4DMZ A;  1FR6 A;  4P6B A;  3QP4 A;  4QHC A;  5G4Z A;  4GCZ A;  5DTS A;  1Y28 A;  5GLA A;  3UDF A;  5L2F A;  3WS0 A;  1KE3 A;  1YQS A;  1IYQ A;  3AGD A;  1VQQ A;  1PZO A;  1S1Y A;  2WKI A;  3S7P A;  4OQI A;  3ZFZ A;  1WYB A;  2HDU A;  2UV0 E;  1PZP A;  4E3K A;  1BLH A;  1ERO A;  3QP5 A;  4DDS A;  3MZF A;  2D02 A;  1IYS A;  2G2U A;  2VGL S;  1J3W A;  1O7E A;  2Y2O A;  5EVI B;  1PYY A;  1NLY A;  1YMX A;  3PBQ A;  4UHU A;  1JWZ A;  5GHZ A;  1KE0 A;  1ZTU A;  1JTD A;  3EGX C;  3T4L A;  1HD8 A;  4OPQ A;  2K31 A;  4CLC B;  4LV2 A;  4Q0H A;  4B93 A;  2GDN A;  5HX9 A;  1ES3 A;  4RQ9 A;  2QYB A;  3G34 A;  4Z1W A; 
#chains in the Genus database with same CATH homology
 3E98 A;  3CUE A;  1JNU A;  2I9V A;  3NHQ A;  3NOP C;  3E4O A;  5L8M A;  2VV6 A;  3H82 A;  3PBO A;  4MN7 A;  4NEE D;  2L1M A;  4F3L B;  3KSF A;  4KUO A;  5IT5 A;  1VHM A;  4UEY A;  5HWT A;  4BWI A;  3PR6 A;  4HH2 A;  1XFQ A;  4I5S A;  3TE8 A;  4LPZ A;  4DN0 A;  1KOU A;  2OAP 1;  1XJ2 A;  4L9E A;  4LRX C;  1T19 A;  3MR0 A;  4KUK A;  4EEU A;  1OT6 A;  2V1A A;  1G6O A;  5J4E A;  4JGP A;  4HJ4 A;  2L4R A;  3CI6 A;  4WL9 A;  2A24 B;  4EEP A;  1ZHH B;  2NUT C;  4LRZ E;  2XRO A;  1XJ6 A;  4Y3I A;  4XT2 A;  4Q0I A;  2J3T D;  3F1O A;  3H7W B;  2OWJ A;  2WKR A;  4O0P A;  1NRJ A;  2O99 A;  3GEC A;  5HSQ A;  4WEL A;  4CLC C;  3BY8 A;  1OTA A;  2M7V A;  4GS9 A;  3UB9 A;  2QHK A;  4ARZ A;  1F98 A;  2O9B A;  5HD3 A;  4EW7 A;  4GHI B;  3C38 A;  3CAX A;  4IHQ A;  5F5Y A;  1X0O A;  2QJ5 A;  1BYW A;  1P97 A;  1UWN X;  2OWH A;  4WEJ A;  3RTY A;  3TW8 A;  2PR6 A;  4WN5 A;  1IOU A;  5EFW A;  4FOF A;  1H3Q A;  3VE4 A;  3RH8 B;  3IBJ A;  1TS0 A;  1T1A A;  2PDR A;  3LUQ A;  4EQ1 A;  3LR3 A;  3MXQ A;  3KO6 A;  4BBV A;  1WA9 A;  4P6Z S;  1MKM A;  5C5K A;  1OT9 A;  3K3D A;  2L0W A;  3BW6 A;  1GSX A;  4PHT A;  1NLZ A;  3E0Y A;  5HD5 A;  4R38 A;  3U2A A;  2QJ7 A;  5DKK A;  1TS8 A;  2Z6D A;  2W3G A;  2B02 A;  2ZOI A;  1OTD A;  1OJ5 A;  4H6J A;  3NJA A;  2P04 A;  1MC0 A;  3D72 A;  3T4J A;  2JKT M;  2LB5 A;  5J7E A;  3LIF A;  3B33 A;  3FPV A;  3E4Q A;  3OOV A;  2B18 A;  3A0R A;  3C8C A;  3PBR A;  3LFV A;  1N9N A;  3A0S A;  4HHD A;  1N9O A;  4YNR A;  5LBR A;  2ZMV A;  4I39 A;  4DJ3 A;  1XFN A;  2ZBB A;  2A2L A;  2DMW A;  2VA0 A;  5DKL A;  2EWV A;  1STZ A;  2W1R A;  2JKR M;  2W3E A;  3E4P A;  4HOI A;  3T4Q A;  3HJK A;  3LIE A;  4EER A;  1LSX A;  2ZOH A;  4CLC A;  1YKD A;  4ZRR A;  2VEA A;  2INW A;  3UME A;  5J3W A;  3OC2 A;  2CMN A;  1ODV A;  2XA7 S;  2BAS A;  3BQA A;  4I3A A;  1T1C A;  3UB8 A;  3VV4 A;  4FSF A;  3T4O A;  5HDD A;  3NOU C;  3C30 A;  2V9A A;  4K08 A;  4WF0 A;  3LYX A;  4DJ2 A;  4PAU A;  3EGD C;  4L9F A;  4M4X A;  3KX0 X;  5TBM A;  2V1B A;  2JHE A;  3EEH A;  2W1T B;  1S4R A;  2KX6 A;  1F5M A;  1YSQ A;  3CWF A;  3UB6 A;  3TRC A;  2VV8 A;  5AVF A;  3BY9 A;  2GZA A;  2K7S A;  1S4S A;  2Y79 A;  4NXE A;  1P9R A;  2VKS A;  2XSS A;  3NOT C;  3B47 A;  3UE3 A;  5KIZ A;  2OAQ 1;  1T18 A;  4EXO A;  1LL8 A;  4HJ6 A;  4IUK A;  2HJE A;  2JKT I;  2O9A A;  2Z6C A;  2J3W A;  1TS7 A;  4G3K A;  2W3H A;  4R70 A;  3JVU A;  3LR4 A;  5AJG A;  3ULF A;  2D01 A;  4LLO B;  5FL3 A;  3ZQ5 A;  3KSG A;  1DP6 A;  4UQI S;  2P7J A;  1VB6 A;  3F1O B;  3MJQ A;  2HF6 A;  3R7W B;  3H9W A;  3T4S A;  1NWZ A;  2PD7 A;  3EOI A;  3IS2 B;  3P01 A;  4KQO A;  4MN6 A;  4WLA A;  1V9Z A;  3S7Q A;  5HPF A;  4G3W A;  5CX7 A;  2W3F A;  3T50 A;  3FPW A;  3RFB A;  2EWW A;  4ARZ B;  1MZU A;  3A0V A;  5AVE A;  2FZ0 A;  4Y2F A;  2G7U A;  3CUE C;  1GSW A;  4GHI A;  4GLQ A;  2M7U A;  5HWW A;  4HQA A;  3CIT A;  2EA9 A;  4I3I A;  2J3T C;  3MQ0 A;  5F6A A;  1XJ3 A;  2M1C A;  1YAX A;  4HIA A;  3W2Z A;  5DFX A;  4BJP A;  3T4K A;  4GW9 A;  3EEA A;  4BBU A;  5IS1 A;  5MC7 A;  2O9C A;  1S66 L;  3MQO A;  5IU1 A;  2GNX A;  3GDI A;  4WUJ A;  3F1N B;  2P08 A;  3OCL A;  4R3A A;  4ETZ A;  4YOF A;  1P9W A;  3B42 A;  3K3C A;  4P6Z M;  1W63 Q;  5F68 A;  2FH5 A;  3F1P B;  3LIC A;  4EES A;  4WEK A;  2V0U A;  3S7N A;  3UE6 A;  4ME4 A;  4ETX A;  5HZH A;  1LT0 A;  1V9Y A;  4IUH A;  4PKY G;  2VGL M;  2IA2 A;  1S1Z A;  3LR0 A;  4JGO A;  3EWK A;  4II7 A;  4H6J B;  2PHY A;  2W27 A;  4MCW A;  3ZYT A;  2VZW A;  5I5L A;  3C2W A;  3ICY A;  3G6O A;  2VX8 A;  3O5Y A;  1YSP A;  2J80 A;  1S67 L;  2W3D A;  4B9O A;  1D06 A;  2HV1 A;  4HJ3 A;  4CQH A;  4NXB A;  1OPX A;  4PKY A;  2KDK A;  3DBA A;  3MQQ A;  4EUV A;  4I3J A;  5DFY A;  4R6L A;  4OOL A;  5HDS A;  2MJ6 A;  3H82 B;  3SW1 A;  4F3L A;  2HGV A;  4O01 A;  3PYP A;  3EQV A;  5DJT A;  1TD5 A;  2XA7 M;  2VJW A;  4GJ4 A;  2NUP C;  4AFI A;  1G28 A;  4HP9 A;  3FC7 A;  4JGR A;  5TBM B;  2YKH A;  1LSV A;  2W1T A;  3R4K A;  4HI4 A;  2VLG A;  2VV7 A;  3PXP A;  5DF9 A;  1UWP X;  5TJJ A;  3LR5 A;  3PBS A;  4QPR A;  3BWL A;  4OOM A;  4YWZ A;  1F9I A;  4CLC D;  2PYP A;  3K2N A;  2W0N A;  3D3O A;  1DRM A;  2K2N A;  2A24 A;  2ZMF A;  3VE3 A;  3LIA A;  1OTE A;  4HNB A;  3OLO A;  3OBF A;  3IBR A;  1TS6 A;  4XT2 B;  1LSW A;  2H28 A;  5HL6 A;  4MDZ A;  3H7W A;  4KQD A;  2PR5 A;  4E04 A;  5K5B A;  2GJ3 A;  1IFQ A;  2QKP A;  4MMN A;  3MF0 A;  3UMD A;  2JKR I;  3MMH A;  4MN5 A;  4UQI M;  3R7W A;  4Q0J A;  3CLO A;  1DP8 A;  3FG8 A;  4GS9 B;  4BBT A;  4EET B;  4IJG A;  2QWS A;  2WKP A;  2KOI A;  3IS2 A;  4HP4 A;  4L0L A;  3LIB A;  4JGQ A;  1N9L A;  1DP9 A;  3LI9 A;  2HJ9 C;  3S7O A;  4G3V A;  1TF1 A;  4NXF A;  4EU0 A;  2PT7 A;  4CLC E;  4HH3 A;  5KSH A;  2YKF A;  2R78 A;  3P7N A;  5DJU A;  4DMZ A;  5HPI A;  1OTI A;  3LID A;  1GSV A;  1P0Z A;  4L9G A;  5G4Z A;  3JVV A;  3PBT A;  4GCZ A;  4HY8 A;  1H8M A;  2PYR A;  1Y28 A;  1T1B A;  1OJG A;  3F1N A;  2O0Y A;  3KYZ A;  5F69 A;  4O8G A;  1S1Y A;  3S7P A;  1W63 M;  3V67 A;  2OOL A;  3VOL A;  3F1P A;  4Y5F A;  5A8B A;  3MFX A;  3KSH A;  3BJN A;  3BQ8 A;  2D02 A;  2VGL S;  4BMW A;  1EW0 A;  5HDC A;  3HJI A;  1UGU A;  1OTB A;  1NLY A;  3TJZ C;  3PBQ A;  2GX5 A;  3KYQ A;  3UB7 A;  1ZTU A;  2PD8 A;  1XJ4 A;  2V0W A;  2KLI A;  3EGX C;  4LRY C;  3T4L A;  3EQU A;  2WKQ A;  1D7E A;  3PHY A;  3HCY A;  4NKP A;  3LI8 A;  3OCN A;  3PBN A;  3KSI A;  4NXG A;  2XRN A;  2K31 A;  4CLC B;  5HWV A;  4I38 A;  2JN7 A;  4Q0H A;  4B93 A;  2LB9 A;  3T4T A;  2Y8H A;  4RQ9 A;  2QYB A;  5G4Y A;  4Z1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...