3FC7A

The crystal structure of a domain of htr-like protein from haloarcula marismortui atcc 43049
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
SDSPDGIVHLTTNGTILSVNPSMAGRLGADPDTLVGQQLSAVMDSEAANQRLEAGKSAVENGTATRSEDAVGGRHYHNQYIPVDSHRKSDTFQLVSRDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords HTR-like protein
publication title The crystal structure of a domain of HTR-like protein from Haloarcula marismortui ATCC 43049
rcsb
source organism Haloarcula marismortui
total genus 27
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3fc7A00
5G4YA 5HD5A 2YKFA 2YKHA 3UB9A 2JN7A 1MZUA 4WUJA 4GW9A 2CMNA 1TS0A 4NXBA 4HHDA 1F9IA 4HIAA 2QHKA 4WL9A 5HWVA 1P97A 1DP9A 3GDIA 4HJ3A 2A24A 4LRZE 2OWJA 3H7WA 5DKLA 1OJGA 5J7EA 4HP9A 2R78A 2JHEA 4HP4A 3UMEA 4R3AA 3F1OA 3PHYA 1GSXA 3A0RA 3CLOA 5G4ZA 1N9LA 3LIDA 3IS2A 2KDKA 2PD7A 1XFNA 2A24B 5AVFA 4NXEA 5HSQA 3RTYA 1V9YA 1LSVA 4RQ9A 4I38A 1BYWA 3MFXA 4JGOA 4EEUA 3C8CA 1P0ZA 2V1BA 1Y28A 3F1OB 3H82A 3UE6A 3D72A 1KOUA 3F1NA 4JGPA 4EW7A 4EERA 2ZOHA 3IS2B 4KQDA 2D02A 1S67L 1OJ5A 4L9EA 2Z6CA 3SW1A 2QKPA 3VE4A 3E4PA 2D01A 3H82B 5F68A 1JNUA 3F1NB 3NOTC 4L9GA 3K3DA 2M1CA 3VOLA 3MR0A 3ZQ5A 1XJ2A 1T1AA 2QJ5A 1EW0A 4PKYG 3F1PA 2PR6A 4LPZA 2KX6A 4JGRA 4KUOA 3NHQA 5F69A 2K7SA 1D7EA 2PDRA 3LIBA 4BBTA 5J3WA 2VV7A 2Z6DA 4HH2A 3A0SA 3B33A 1DP6A 4EETB 1D06A 1LSXA 3T50A 2WKRA 1OTBA 4R6LA 4R70A 2WKQA 2OOLA 1WA9A 1UWNX 2PYPA 3A0VA 3BY9A 1OTEA 4MN5A 1VB6A 2PHYA 3F1PB 5HDDA 4M4XA 2QJ7A 5A8BA 4HJ4A 2W27A 2W0NA 2PD8A 1S1ZA 4HY8A 3BWLA 4JGQA 4MN6A 5TBMB 3RH8B 4NXGA 3LUQA 4I3IA 1N9OA 1S4SA 4L9FA 4HOIA 1S4RA 1X0OA 5HZHA 5J4EA 2VV6A 4EXOA 3NOUC 1UGUA 2PR5A 3NJAA 1TS7A 2PYRA 3UB7A 1LT0A 2V9AA 4F3LA 4GCZA 4DJ3A 1XJ4A 4R38A 4HQAA 5DJTA 1OTIA 2ZOIA 3CWFA 4WF0A 4WN5A 5DJUA 4HNBA 4H6JA 3EEHA 3UB8A 4EQ1A 1T1BA 4I5SA 1GSVA 5HDCA 3G6OA 2GJ3A 2V0UA 1F98A 4NXFA 4E04A 3FG8A 2OWHA 3IBRA 3LI9A 4F3LB 3FC7A 5HD3A 5EFWA 1T18A 4HJ6A 2WKPA 1UWPX 3ICYA 2QWSA 3LYXA 3E4OA 2L0WA 4H6JB 5KIZA 3K3CA 3PYPA 2H28A 4LRXC 1XJ6A 3LIEA 1XFQA 3EWKA 2J80A 4DJ2A 3HJIA 1DRMA 5TBMA 3ULFA 3HJKA 2B02A 1ODVA 4I3JA 3H9WA 4HI4A 3UMDA 1DP8A 2BASA 1LSWA 4B9OA 1G28A 3C2WA 2V0WA 5IU1A 3E4QA 5DKKA 5HWTA 5F5YA 4K08A 1OT9A 3VE3A 1OT6A 1NWZA 2HV1A 5AVEA 3LI8A 3MJQA 2V1AA 4YWZA 1XJ3A 4I3AA 2P7JA 3LIAA 3LICA 3OLOA 1T19A 2EA9A 1TS6A 5IS1A 3H7WB 3BY8A 5F6AA 1T1CA 3CAXA 1OTAA 4HH3A 2I9VA 4LRYC 3KX0X 4KUKA 3LIFA 2L1MA 1S1YA 1N9NA 4BBVA 4XT2A 4GS9A 5I5LA 4GHIA 3MQQA 4EEPA 4I39A 4LLOB 1LL8A 3MXQA 3MQOA 4PKYA 4BBUA 5HDSA 2VEAA 2VLGA 3NOPC 3UB6A 3GECA 3P7NA 4EESA 5HWWA 2L4RA 2ZBBA 2VV8A 1OTDA 1GSWA 4WLAA 1V9ZA 1TS8A 4XT2B 4GS9B 1S66L 4GHIB 2INWA
chains in the Genus database with same CATH superfamily
2YKHA 2Y2QA 4WUJA 3OZHA 2ZC4B 4FCFA 2Y4AA 1TS0A 1WYBA 5KSCA 4U0XA 1KVLA 2QHKA 5CHJA 1VEUA 1LI0A 1SKFA 1P97A 2HPBA 4DE0A 4Y3IA 4ZJ2A 4O01A 3FYZA 5J7EA 3KSFA 3GVBA 1CQAA 1PRQA 4BL3A 2P04A 5FA7A 3MXSA 5CGXA 3C5AA 4HP4A 4IUKA 2P08A 3VOYA 3PHYA 3E0YA 3HLEA 1NYYA 3O3VA 5EV0A 3A3EA 3O88A 3S1YA 3IS2A 1VEUB 1XFNA 1K0KA 2LB9A 2VGLS 2ZQ7A 2ZMVA 5AVFA 2G2WA 3RTYA 3IF6C 3JYIA 5FI6A 5FEFA 4I38A 4WBGA 1L0GA 4JGOA 1AXBA 2JCHA 2PAVP 3E2LA 4EEUA 1IKIA 4XXRA 2XD5A 2JKRM 3B42A 3MF0A 3NC8A 1KGEA 3VFFA 5FI7A 2EX8A 4E3JA 4EW7A 3PAEA 4Q8IA 3IS2B 3Q81A 2JKTM 4Y15A 2Y2IA 4FH4A 2Q9MA 2V1ZA 4EV4A 1K57C 2HJEA 3M2JA 1YT4A 1JWPA 4LCLA 5L2FA 4KZ9A 1P9WA 1XJ2A 2K2NA 1K56A 4Q0HA 1EW0A 1MWSA 2VX8A 3HLDA 5CRFA 4CLCA 2XRNA 4KUOA 1LHYA 3CJMA 4BBTA 3DWKA 3KYZA 2WGIA 3JVUA 3B33A 1DP6A 2H5SA 4LGWA 4E6WA 3A3IA 3T50A 3IHBA 1NZOA 2B5RA 4NKPA 4BENA 4OVDA 1MKIA 2FFFB 3UDIA 4R1GA 2XFSA 3S7QA 4KZ6A 3FPVA 2EX2A 3ZFZA 4X1MA 4M4XA 3S4XA 5A8BA 4EBNA 4OPRA 3HUMA 1ERMA 3OPHA 5FDSA 4CLCB 3ZG0A 2WKEA 4S2KA 4BJPA 5HPFA 5CX7A 4JF4A 4RVAA 5TBMB 3RH8B 4PM8A 4UQIM 2H0YA 4I3IA 1ERQA 3W4PA 4JXVA 3T4SA 1JTGA 4A5RA 5HZHA 2ZJ9A 3NY4A 3V67A 5AQAA 4R4SA 4MCWA 1M6KA 4R3BA 1UGUA 2V8CA 1TS7A 3UB7A 3EOIA 4S2MA 4CJNA 4F3LA 2KLIA 4DJ3A 5BOHA 5CERA 4LV3A 1PNEA 4WMCA 4GDBA 2QMIA 2VGJA 2RL3A 4X68A 4GLQA 2VJWA 2H10A 4EQ1A 3N8LA 2XQZA 1YSPA 3PBQA 4XUXA 1T1BA 3QP1A 4RX2A 1ES4A 3ZGAB 2WUQA 1J9MA 1YLWA 3C4OA 3LY4A 4Y7PA 3BLMA 2GJ3A 2V0UA 1Y54A 3OCNA 3T1XA 3T4KA 3CMZA 2WYXA 1XX2A 1MPLA 1K56D 4F3LB 4X69A 3G2ZA 1LL9A 3G35A 1T18A 4X6TA 4OPYA 1UWPX 3LYXA 2QWSA 4CLCD 3E4OA 5GL9A 3BFFA 2X02A 4Y0TA 1HLUP 4LENA 3QP2A 3LEQA 3EWKA 1KDSA 1ES5A 5KSHA 2J3TC 2OAP1 1BZAA 3HJIA 3ULFA 3HJKA 4OKPA 1ODVA 5TGFA 1Z09A 5L10A 3VP0A 1WE4A 3P09A 3D9YA 2ZC5B 1STZA 5A92A 4GKUA 1DP8A 2GZAA 5FAQA 3QP6A 3E4QA 2EXBA 5DKKA 1K55A 3UO9A 2PBDP 1ACFA 2VA0A 1OT6A 1NWZA 4DXCA 1G5UA 3VSKA 3HLBA 1XGJA 5CTNA 2P7JA 4YINA 1AWIA 3ZG7B 4P87A 4QY5A 5IS1A 1TS6A 3WS5A 1NZUA 4OLDA 4ZRRA 1PWGA 2HDSA 2OV5A 1HZOA 1OTAA 4WMCD 2Y8HA 3D4FA 2A2LA 3HLFA 2W3FA 3UPNA 1IELA 2HJ9C 1S1YA 3M6HA 1HVBA 3T1SA 3N4IA 3P01A 3SZTA 2EWWA 4KZ3A 5J8XA 4MBKA 4XT2A 5CGWA 5I5LA 4B88A 5GLDA 3HBRA 4EEPA 1TEMA 1NRFA 3OOVA 2E8IA 4BBUA 3T4JA 1TF1A 5E2EA 3P7NA 2E8JA 4Q0JA 2O9BA 2WAFA 2VZWA 3T4OA 2Y2MA 4P6BA 2A49A 1KGGA 4UEYA 1V9ZA 3FKWA 4XT2B 3IWIA 3VV4A 4JBFA 3G32A 5G4YA 5HD5A 5MC7A 1MZUA 3SS3A 4GW9A 5CEBA 3IXDA 5EVIA 3CUEC 2ZQCA 4NXBA 3PTEA 5C5KA 5HWVA 4KZ5A 1W8YA 1DP9A 3DTIA 5EOOA 2VKSA 5M19A 4LRZE 4FH2A 3HUNA 3CITA 1PFLA 3MMHA 5FQKA 1K25A 3VP1A 1W79A 4HP9A 2JHEA 4HBTA 5L07A 3KO6A 3F1OA 2J9OA 1YMSA 3IWQA 3Q07A 1RGZA 1GSXA 5EVIB 5FQ9A 5G4ZA 3IXBA 5AQ9A 1I5QA 1L0DA 3G31A 5EPHA 2PD7A 5IT5A 1TDLA 3IT9A 4IJGA 5HSQA 3PBNA 4RX3A 1NY0A 2Z2LB 4RQ9A 2UWXA 4PAUA 3C7VA 3LY3A 1TDGA 1L2SA 3PR6A 3MFXA 4LV1A 2XSSA 3LO7A 3C8CA 1P0ZA 2V1BA 5CEDA 1Y28A 2V2FF 3T1RA 1O7EA 2UV0E 3DBAA 3F1OB 1PZOA 3H82A 4F94A 1KOUA 2W3HA 4ETXA 5LBRA 4EERA 3C30A 4OOYA 4KQDA 1ZG6A 1ZKJA 3SH8A 2BG1A 1CEGA 5D3OA 1OMEA 2Y91A 5CECA 1OJ5A 1YLZA 1CJFA 3P98A 2ZC3B 4G3WA 2OLUA 4MBFA 4LV0A 3NULA 1O07A 1XXMA 3I7JA 1KE0A 3VE4A 3E4PA 4QPRA 1GCEA 2D01A 3H82B 5F68A 1JNUA 3T1QB 4S2NC 4NG2A 4NEED 3G34A 5FL3A 1MKMA 1L0FA 2DMWA 3MR0A 5EVID 3WS4A 4JPMA 4EUZA 1G6OA 3F1PA 3SS5A 2EX6A 4MEZA 4N1XA 2KX6A 4JGRA 1RCJA 5CHMA 4LV2A 3DWZA 5JYPA 2PDRA 4FUWA 3C4PA 2HGVA 3K2NA 3MBZA 1E3UA 5J3WA 4D60A 3IF5A 2VV7A 4X25A 4B4XA 2VGKA 1F5MA 3OC2A 3TJZC 1D06A 1LSXA 3G30A 4R70A 4ARZA 2M7UA 4KG6A 1EWZA 3A0VA 2PHYA 3F1PB 3TW8A 1JWVA 4E3KA 5EE8A 5KZHA 4OQIA 4HY8A 3EEAA 3LR0A 4ZAMA 4JGQA 1IOUA 1P9RA 4ZDXA 1GA9A 5EVEA 3LUQA 4L9FA 1YPRA 3RFBA 2CC1A 5L8MA 1X0OA 2NUTC 2HP5A 4R3JA 2HZ5A 4E3IA 4ARZB 3WS2A 1IYQA 4OQHA 2ZQAA 2PYRA 3RXXA 3GRJA 3MQ0A 2JBFA 1LT0A 2Q9NA 4GCZA 4R38A 4KZBA 4HQAA 1OTIA 3WRTA 3AGEA 4BQMA 4KG2A 5FQMA 2HDQA 3FWLA 1YM1A 3ZG8B 4GD8A 5AQ7A 2OAQ1 3ZHHA 2VK3A 4I5SA 4WZ5A 3BFDA 1MWUA 3TRCA 1NRJA 4R0QA 3BW6A 1KGFA 5TR7A 4JXSA 4DDSA 1VETA 1M40A 1IYSA 3IBRA 3BJNA 1KE4A 2ACGA 4IVKA 5HD3A 5EFWA 3ZCZA 1GHIA 3QNCA 5DTKA 3PBRA 3KSHA 2WKPA 2MJ6A 2L0WA 4KENB 5KIZA 4IBXA 4R4RA 1H8ZA 3K3CA 1OPXA 1XJ6A 3SS4A 1E3UD 3LIEA 4FD8A 3IWOA 1FCNA 4KZAA 1H3QA 1DRMA 2QYBA 3PBOA 5EUAA 5TBMA 3MZDA 4I3JA 3H9WA 2O9CA 1DY6A 4X55A 1VETB 4RYEA 4OPZA 1K6RA 3MKEA 4G3VA 2BASA 4BD0A 1BSGA 2V0WA 3OCLA 3S7NA 2W3GA 2IWCA 4KG5A 1FSWA 5HWTA 3VMAA 1FR1A 3BQAA 5FQQA 5F5YA 1OT9A 3VE3A 3ZDJA 3ZNTA 3LI8A 1LL5A 3AGFA 2ZC6B 3GMWA 3HLGA 3LIAA 1CK3A 2EFXA 2EA9A 3V50A 3H7WB 1K54C 2WKIA 3BY8A 3CAXA 4DF6A 3Q7VA 4HH3A 3S7OA 4KUKA 3LIFA 3CZDA 4QY6A 2A3UA 2ZQ8A 3NCKA 3E2KA 3UY6A 1N9BA 1N9NA 4E3LA 3CHWP 4E6XA 2Q0OA 3V5MA 5HAPA 4E3OA 4BBVA 4EUVA 3MQQA 4N92A 1XA1A 3MXQA 1IEMA 1ZTUA 3MQOA 1N4OA 1BLHA 4N1HA 4QHCA 3Q82A 3C7UA 5GHZA 2VEAA 4DE3A 2VLGA 3UB6A 3ZVWA 3Q7VB 5FQJA 2LB5A 3BEBA 3QHYA 3KYEA 5HAQA 2VV8A 1OTDA 4DKIA 1QMEA 2HDUA 1GSWA 5F1FA 2XF3A 4WLAA 5IHVA 4Y2FA 3B47A 2INWA 4P6ZS 4GOGA 4OP8A 2Y2JA 2JN7A 4QU3A 2EWVA 4O0PA 3T4TA 4BWIA 1YKDA 5GHYA 1PW1A 1F9IA 4EQIA 3GSGA 3IX3A 4HJ3A 2A24A 2OWJA 4JF6A 2O9AA 4U0TA 1OJGA 3JVVA 3QNBA 4E3NA 4DMZA 2R78A 4ZJ1A 3Q7ZA 2P9VB 2VGLM 3N7WA 1LI9A 3KYQA 1BLSA 2NUPC 3PAGA 1S0WA 1PWDA 1PWCA 3HREA 4IEDA 4QB8A 4AFIA 1YLJA 1N9LA 3SOIA 3LIDA 2Y2KA 1YAXA 1WYCA 5GLBA 4OOLA 2A24B 4U3TA 2O99A 4II7A 2DRWA 4NXEA 4GB7A 5F1GA 1LSVA 5HFOA 1DJCA 1BYWA 1YLTA 5A91A 3D3OA 3NBLA 3UE6A 3D72A 4JXWA 3BM6A 2PBYA 1XA7A 3WS0A 1ALQA 2HDRA 1HD8A 4IVIA 5FAOA 4GNUA 2ZOHA 3IHAA 3MZFA 4S2JA 2D02A 3HUOA 3ISGA 1MY8A 1S67L 1H0MA 4YNRA 3EGXC 5AJGA 4Y0OA 3IF6B 3V39A 4Y17A 1K57A 2Z6CA 1ESIA 1LLBA 4DXBA 1J3WA 1YQSA 3QP8A 1YSQA 3LR4A 5DVAA 4CQHA 2M1CA 3VOLA 4ZTKA 4EBLA 2Y2GA 2PR6A 5TFQA 4CLCC 4LPZA 1NYMA 5EOEA 3VSLA 2K7SA 1D7EA 4WEKA 5GLAA 4X1LA 4OQGA 1ONGA 5M1AA 5M18A 3ZNYA 3A0SA 2EX9A 3GV9A 4YOFA 4QWOA 2XH9A 2WKQA 2OOLA 2PT7A 1WA9A 1G6AA 1DJAA 3IX4A 3BY9A 5FQIA 3NIAA 2QJ7A 1MXOA 5K5BA 4KZ4A 4UHUA 4UAAA 2W27A 2W0NA 1E25A 1BLCA 3R7WA 1S1ZA 4BL2A 2ZQDA 3BWLA 2IWDA 3LCEA 3CI6A 4GJ4A 1XGIA 2H0TA 1KE3A 1JTDA 4MMNA 2QPNA 1N9OA 3BECA 3PBSA 4PM7A 4Y0UA 1S4SA 3FZCA 2GX5A 2VV6A 4MDZA 5FEGA 3Q1FA 5HL6A 3AGDA 2AVXA 2PR5A 3NJAA 4DE1A 3VFHA 4H8RA 3T12B 4PPRA 2V9AA 3W4QA 2J3WA 3QP4A 2V8FA 2WKHA 2WK0A 5DJTA 5E2GA 2W1TA 2ZOIA 3R7WB 3T4LA 3TSGA 1FCMA 4HNBA 4H6JA 2Y79A 2BTFP 1IYOA 3EEHA 3VP2A 5DF7A 2ZD8A 1SDNA 4BD1A 1SHVA 3MS6A 3OBFA 1IFQA 3A3DA 5L09A 1F98A 4NXFA 4E04A 1FQGA 5EM0A 2OWHA 4DE2A 2P74A 4EU0A 3LI9A 3FC7A 1CI9A 1KVMA 1PIOA 3U2AA 3CPTA 2W1TB 3UNWA 3ICYA 5HL1A 2GNXA 2WAEA 3SH9A 1L3LA 4H6JB 3LFVA 3PYPA 2H28A 1RP5A 1SCWA 3LR5A 1XFQA 5DF8A 2ZMFA 4DJ2A 4B4ZA 3UPOA 4HESA 4IHQA 2Z2MB 4K91A 3BQ8A 2HF6A 4GZBA 4CPKA 1SZVA 3UE3A 4R23A 4WYYA 4IBRA 3HCYA 2HP6A 4OLGA 3OPPA 1LSWA 4B9OA 5U47A 3CPTB 2JKFA 2R9WA 1D1JA 1K55C 4Z1WA 1Z6FA 2ZLYA 1G68A 4G3KA 5F82A 4S2OA 4M3KA 2Y59A 4S2PA 2XLNA 4KQQA 4BLMA 3UDXA 5HARA 1GHPA 4GD6A 5GLCA 3S7PA 3UB5P 3KSIA 3NI9A 2XDMA 1XJ3A 1C3BA 2G2UA 4PM5A 4NETA 2FZ0A 1F2KA 1I2WA 4KQRA 4ETZA 3C38A 2WGVA 5DTSA 2I9VA 4LRYC 2EXAA 3OPRA 1YLYA 4JXGA 2O0YA 2FH5A 3IH9A 4Z9QA 1I2SA 4WEJA 3GR2A 3DW0A 3KSGA 2FFYA 1U60A 3NECA 4XUZA 4DRTA 4I39A 4LLOB 1TD5A 3NDGA 3RXWA 2JKGA 1K4FA 2C5WB 1BTLA 4X53A 5KMWA 1IKGA 3FPWA 5HDSA 5A90A 2OSUA 4PMAA 3NOPC 1VQQA 4K0WA 5HWWA 3OPLA 2L4RA 5AQBA 3IXHA 2XROA 3DTMA 1TVFA 5G18A 5EM1A 1XKZA 3UE0A 3T4QA 2PU4A 4UA6A 2WZZA 1W63M 1S66L 2J3TD 1PYYA 2X71A 2YKFA 3JPUA 1W5DA 3UB9A 4LFUA 1Q2QA 1L0EA 5EVIC 1S6RA 1ZC2A 2XA7S 4Y13A 3GTCA 2CMNA 1FOFA 2ZMAA 4HHDA 3CUEA 1VHMA 1PI5A 3VP3A 4C6YA 4HIAA 3BYDA 5FAPA 4WL9A 1K38A 3GDIA 2Y2OA 1ONHA 3H7WA 1K6SA 1ESUA 5DKLA 4LCMA 2XEPA 3G2YA 4PM9A 4KZ8A 1FIKA 1BT5A 4QJGA 4PHTA 3DTKA 3M6BA 2W1RA 2XK1A 4ESPA 2ZM2A 1FILA 4R3AA 3L9KA 3UMEA 2J7VA 4EBPA 4ME4A 3A0RA 3CLOA 5GHXA 3N6IA 4P85A 5FI2A 2WADA 2Y2HA 2KDKA 4HBUA 5E2FA 1H8YA 3PXPA 1EROA 1V9YA 5FASA 3O87A 3ZG5A 3LEZA 2PU2A 3NDEA 4UA7A 1ES2A 3CG5A 3GQZA 1PZPA 1W63Q 2DNSA 2Y2PA 2BLSA 3LR3A 4ID4A 2K31A 3MZEA 2HP9A 4MBHA 3A3FA 4JKTA 5E2HA 3IQAA 4EWFA 3W8KA 1MBLA 1Q2PA 3O86A 3EQVA 3F1NA 1KDWA 4JGPA 2EFUA 4WZ4A 3TG9A 2WGWA 2ZC7A 2B95A 4S2IA 2XGNA 2Y2LA 4QD4A 1A0KA 2R9XA 3LGOA 4L9EA 3SW1A 2QKPA 1SDEA 4ZBEA 3FV7A 2P9VA 2I72A 3F1NB 4WM9A 3NOTC 4L9GA 4WELA 4S2NA 3K3DA 4CLCE 1ZHHB 3ZQ5A 1T1AA 2QJ5A 4PKYG 2W3EA 1ZG4A 2B18A 2WGWB 2XR0A 3NHQA 2J9PA 5F69A 5DFXA 2Y2NA 3BFEA 3LIBA 5DFYA 1YMXA 2JKRI 1H8MA 3IXGA 3UN7A 4B93A 4OP5A 2Z6DA 4JF5A 3WWXA 4HH2A 4OQ0A 5CTMA 4N9KA 1MC0A 4EETB 4BMWA 2WKRA 4OPQA 1OTBA 3G4PA 1YLPA 4R6LA 1IYPA 4HEFA 3R4KA 2JKTI 4P0MA 4PM6A 1UWNX 2PYPA 5EECA 1NLZA 1OTEA 4MN5A 3RJUA 1VB6A 1JVJA 5HDDA 4S2LA 5FDHA 1HTZA 4HJ4A 1EI5A 4MN7A 4D2OA 3MKFA 3TE8A 3ITBA 2PD8A 5F83A 4KQOA 4Y5FA 4MLLA 4MN6A 4NXGA 3S22A 1XPBA 4UA9A 3EQUA 3IF6A 2JE5A 4HOIA 1S4RA 4Q0IA 3PBTA 5J4EA 4DDYA 1JWZA 4EXOA 5A93A 2PRFA 3VOZA 3NOUC 1H5XA 2V20A 1Y4OA 1E4DA 1XJ4A 2XFTA 5JYOA 3VP4A 1BLPA 3SH7A 3CWFA 4L0LA 4WF0A 2ZM8A 4WN5A 2RCXA 5DJUA 1QMFA 2OLVA 4JLFA 3L7HA 4MNRA 3UB8A 4K0XA 3E98A 4WZ5C 4YFMA 3IBJA 3IX8A 3MSHA 3MXRA 1GSVA 2IA2A 5HDCA 4OOMA 3G6OA 1FSYA 5CHUA 3U4LP 3FG8A 5TJJA 3HL9A 5I94A 4FOFA 2XD1A 2XA7M 1FR6A 4HJ6A 3B3XA 2ZQ9A 4O7DA 3DAVA 4OH0A 4FSFA 5CXWA 4LRXC 5E43A 2J80A 3V3RA 3A3JA 5HX9A 2GDNA 3IH8A 2B02A 2IWBA 1SKOA 2ZM0A 1FCOA 3ZVTA 1PW8A 4HI4A 1NXYA 3QP5A 1MWTA 2W3DA 5FSRA 3UMDA 1MWRA 1G28A 2JC7A 3C2WA 1CF0A 3V3SA 3N8RA 5IU1A 4N9LA 5HPIA 2J8YA 2KOIA 2DCFA 4K08A 5HW3A 4GN2A 2HV1A 4O8GA 5AVEA 1BULA 1RGYA 4E3MA 1SKOB 3MJQA 1K4EA 4X56A 2V1AA 3WS1A 4YWZA 1BUEA 4C3QA 1VM1A 4I3AA 1W8QA 3LICA 3OLOA 3W4OA 3BFCA 3WRZA 1T19A 3UPPA 4C75A 5F6AA 1PI4A 1K54A 4OONA 1T1CA 4UQIS 3BLSA 1NLYA 1DJBA 3KX0X 4IUHA 1XP4A 2L1MA 2WZXA 3FKVA 3W2ZA 1CEFA 3HLCA 4RA7A 5DTTA 2ZL1A 3EGDC 4KZ7A 1NJ4A 2Y55A 3O5YA 4GS9A 3UE1A 4GHIA 3M2KA 1GA0A 3HLWA 3HVFA 1LL8A 1GHMA 2M7VA 5EVLA 4FTXA 3MFDA 5CGSA 5DF9A 4ZJ3A 2C6WB 4GDNA 3DTEA 2QZ6A 4PKYA 3BRMA 1W7FA 3N8SA 3ZG9B 1ES3A 4P6ZM 2G7UA 3GECA 3TOIA 4EESA 4DN0A 3ZYTA 4NK3A 1CI8A 5FATA 3UDFA 2ZBBA 2X01A 5HAIA 3ITAA 2ZL1B 1TS8A 4GS9B 4GHIB 3BFGA
chains in the Genus database with same CATH topology
4P6ZS 5G4YA 5HD5A 2YKFA 2YKHA 5MC7A 3UB9A 2JN7A 1MZUA 4WUJA 2XA7S 2EWVA 4GW9A 4O0PA 3T4TA 4BWIA 2CMNA 3CUEC 1TS0A 1YKDA 4NXBA 4HHDA 3CUEA 1VHMA 1F9IA 4HIAA 2QHKA 5C5KA 4WL9A 5HWVA 1P97A 1DP9A 3GDIA 4HJ3A 2A24A 2VKSA 4Y3IA 4LRZE 2OWJA 3H7WA 2O9AA 3CITA 4O01A 5DKLA 1OJGA 3MMHA 3JVVA 5J7EA 3KSFA 4DMZA 4HP9A 2R78A 4PHTA 2JHEA 2VGLM 2P04A 3KYQA 2W1RA 2NUPC 4HP4A 4IUKA 3UMEA 4R3AA 2P08A 3KO6A 3F1OA 3PHYA 3E0YA 1GSXA 4ME4A 3A0RA 3CLOA 5G4ZA 4AFIA 1N9LA 3LIDA 1YAXA 3IS2A 2KDKA 2PD7A 1XFNA 2LB9A 2VGLS 5IT5A 4OOLA 2A24B 2O99A 2ZMVA 3PXPA 4IJGA 4II7A 4NXEA 5AVFA 5HSQA 3RTYA 1V9YA 3PBNA 1LSVA 4RQ9A 4I38A 4PAUA 1BYWA 3PR6A 3MFXA 2XSSA 1W63Q 4JGOA 3D3OA 4EEUA 3C8CA 3LR3A 1P0ZA 2V1BA 2K31A 2JKRM 1Y28A 3B42A 3MF0A 3DBAA 3F1OB 3H82A 3UE6A 3D72A 1KOUA 2W3HA 3EQVA 3F1NA 4ETXA 5LBRA 4JGPA 4EW7A 4EERA 3C30A 2ZOHA 3IS2B 4KQDA 2JKTM 2D02A 1S67L 4YNRA 3EGXC 5AJGA 1OJ5A 4G3WA 4L9EA 2Z6CA 3SW1A 2QKPA 3VE4A 3E4PA 2HJEA 4QPRA 2D01A 3H82B 5F68A 1JNUA 3F1NB 1YSQA 4NEED 3NOTC 4L9GA 4WELA 5FL3A 3K3DA 3LR4A 4CQHA 4CLCE 1MKMA 1ZHHB 2DMWA 2M1CA 3MR0A 1P9WA 3VOLA 3ZQ5A 1XJ2A 2K2NA 4Q0HA 1T1AA 2QJ5A 1EW0A 1G6OA 2VX8A 3F1PA 2PR6A 4PKYG 4CLCC 2W3EA 4LPZA 2KX6A 2B18A 4JGRA 4CLCA 2XRNA 4KUOA 3NHQA 5F69A 5DFXA 2K7SA 1D7EA 2PDRA 3LIBA 4WEKA 4BBTA 5DFYA 2HGVA 3K2NA 2JKRI 1H8MA 5J3WA 4B93A 2VV7A 3KYZA 2Z6DA 3JVUA 4HH2A 3A0SA 1F5MA 3OC2A 3B33A 4YOFA 3TJZC 1DP6A 1MC0A 4EETB 1D06A 1LSXA 3T50A 4BMWA 2WKRA 1OTBA 4NKPA 4R6LA 4R70A 4ARZA 2WKQA 3R4KA 2JKTI 2M7UA 2OOLA 2PT7A 1WA9A 1UWNX 2PYPA 3S7QA 1NLZA 3A0VA 3BY9A 1OTEA 4MN5A 3FPVA 1VB6A 2PHYA 3F1PB 5HDDA 4M4XA 3TW8A 2QJ7A 5A8BA 5K5BA 4HJ4A 4CLCB 2W27A 2W0NA 4MN7A 3TE8A 2PD8A 3R7WA 4BJPA 1S1ZA 5HPFA 4KQOA 4HY8A 3EEAA 3LR0A 4Y5FA 3BWLA 4JGQA 5CX7A 1IOUA 1P9RA 4MN6A 5TBMB 3RH8B 3CI6A 4NXGA 3LUQA 4GJ4A 4UQIM 4I3IA 3EQUA 4MMNA 3PBSA 1N9OA 1S4SA 4L9FA 4HOIA 1S4RA 3RFBA 3T4SA 5L8MA 1X0OA 4Q0IA 5HZHA 3PBTA 2NUTC 5J4EA 2GX5A 3V67A 2VV6A 4MDZA 4EXOA 4MCWA 4ARZB 3NOUC 5HL6A 1UGUA 2PR5A 3NJAA 1TS7A 2PYRA 3UB7A 3MQ0A 1LT0A 3EOIA 2V9AA 4F3LA 2KLIA 2J3WA 4GCZA 4DJ3A 1XJ4A 4R38A 4HQAA 5DJTA 1OTIA 2W1TA 2ZOIA 3R7WB 3CWFA 4L0LA 4WF0A 3T4LA 4WN5A 5DJUA 4HNBA 4H6JA 2Y79A 3EEHA 4GLQA 3UB8A 2VJWA 4EQ1A 3E98A 1YSPA 3PBQA 2OAQ1 1T1BA 3IBJA 4I5SA 1GSVA 2IA2A 5HDCA 3TRCA 4OOMA 1NRJA 3G6OA 2GJ3A 3OBFA 2V0UA 3BW6A 1IFQA 3OCNA 3T4KA 1F98A 4NXFA 4E04A 3FG8A 2OWHA 3IBRA 3BJNA 5TJJA 4EU0A 3LI9A 4F3LB 4FOFA 3FC7A 5HD3A 5EFWA 2XA7M 3U2AA 1T18A 3PBRA 2W1TB 4HJ6A 3KSHA 2WKPA 1UWPX 3ICYA 2QWSA 3LYXA 4CLCD 3E4OA 2GNXA 2MJ6A 2L0WA 4H6JB 5KIZA 3LFVA 3K3CA 3PYPA 1OPXA 4FSFA 2H28A 4LRXC 1XJ6A 3LIEA 3LR5A 1XFQA 3EWKA 2J80A 2ZMFA 4DJ2A 5KSHA 2J3TC 1H3QA 2OAP1 3HJIA 1DRMA 2QYBA 3PBOA 5TBMA 4IHQA 3ULFA 3HJKA 2B02A 1ODVA 3BQ8A 4I3JA 3H9WA 2O9CA 2HF6A 3UE3A 4HI4A 3HCYA 2W3DA 3UMDA 1STZA 1DP8A 4G3VA 2BASA 1LSWA 2GZAA 4B9OA 1G28A 3C2WA 2V0WA 3OCLA 3S7NA 2W3GA 5IU1A 5HPIA 3E4QA 5DKKA 5HWTA 4Z1WA 4G3KA 3BQAA 2KOIA 5F5YA 2VA0A 4K08A 1OT9A 3VE3A 1OT6A 1NWZA 2HV1A 4O8GA 5AVEA 3LI8A 3MJQA 3S7PA 2V1AA 3KSIA 4YWZA 1XJ3A 4I3AA 2FZ0A 2P7JA 3LIAA 3LICA 3OLOA 1T19A 2EA9A 1TS6A 5IS1A 3H7WB 3BY8A 4ETZA 3C38A 4ZRRA 5F6AA 1T1CA 3CAXA 1OTAA 2Y8HA 4UQIS 4HH3A 2A2LA 2I9VA 1NLYA 3S7OA 4LRYC 3KX0X 4KUKA 3LIFA 4IUHA 2W3FA 2L1MA 2HJ9C 1S1YA 3W2ZA 1N9NA 2O0YA 3P01A 2FH5A 3EGDC 2EWWA 4WEJA 4BBVA 3KSGA 4XT2A 3O5YA 4GS9A 5I5LA 4GHIA 4EUVA 3MQQA 4EEPA 4I39A 3OOVA 1LL8A 4LLOB 1TD5A 2M7VA 3MXQA 1ZTUA 3MQOA 5DF9A 4PKYA 4BBUA 3FPWA 5HDSA 2VEAA 2VLGA 3T4JA 1TF1A 3NOPC 4P6ZM 2G7UA 3UB6A 3GECA 3P7NA 4Q0JA 4EESA 2L4RA 5HWWA 2O9BA 4DN0A 3ZYTA 2XROA 2LB5A 2VZWA 3T4OA 2ZBBA 2VV8A 1OTDA 3T4QA 1GSWA 4WLAA 4UEYA 1V9ZA 1TS8A 4Y2FA 4XT2B 1W63M 4GS9B 1S66L 3VV4A 4GHIB 3B47A 2J3TD 2INWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4Y A;  5HD5 A;  2YKF A;  2YKH A;  3UB9 A;  2JN7 A;  1MZU A;  4WUJ A;  4GW9 A;  2CMN A;  1TS0 A;  4NXB A;  4HHD A;  1F9I A;  4HIA A;  2QHK A;  4WL9 A;  5HWV A;  1P97 A;  1DP9 A;  3GDI A;  4HJ3 A;  2A24 A;  4LRZ E;  2OWJ A;  3H7W A;  5DKL A;  1OJG A;  5J7E A;  4HP9 A;  2R78 A;  2JHE A;  4HP4 A;  3UME A;  4R3A A;  3F1O A;  3PHY A;  1GSX A;  3A0R A;  3CLO A;  5G4Z A;  1N9L A;  3LID A;  3IS2 A;  2KDK A;  2PD7 A;  1XFN A;  2A24 B;  5AVF A;  4NXE A;  5HSQ A;  3RTY A;  1V9Y A;  1LSV A;  4RQ9 A;  4I38 A;  1BYW A;  3MFX A;  4JGO A;  4EEU A;  3C8C A;  1P0Z A;  2V1B A;  1Y28 A;  3F1O B;  3H82 A;  3UE6 A;  3D72 A;  1KOU A;  3F1N A;  4JGP A;  4EW7 A;  4EER A;  2ZOH A;  3IS2 B;  4KQD A;  2D02 A;  1S67 L;  1OJ5 A;  4L9E A;  2Z6C A;  3SW1 A;  2QKP A;  3VE4 A;  3E4P A;  2D01 A;  3H82 B;  5F68 A;  1JNU A;  3F1N B;  3NOT C;  4L9G A;  3K3D A;  2M1C A;  3VOL A;  3MR0 A;  3ZQ5 A;  1XJ2 A;  1T1A A;  2QJ5 A;  1EW0 A;  4PKY G;  3F1P A;  2PR6 A;  4LPZ A;  2KX6 A;  4JGR A;  4KUO A;  3NHQ A;  5F69 A;  2K7S A;  1D7E A;  2PDR A;  3LIB A;  4BBT A;  5J3W A;  2VV7 A;  2Z6D A;  4HH2 A;  3A0S A;  3B33 A;  1DP6 A;  4EET B;  1D06 A;  1LSX A;  3T50 A;  2WKR A;  1OTB A;  4R6L A;  4R70 A;  2WKQ A;  2OOL A;  1WA9 A;  1UWN X;  2PYP A;  3A0V A;  3BY9 A;  1OTE A;  4MN5 A;  1VB6 A;  2PHY A;  3F1P B;  5HDD A;  4M4X A;  2QJ7 A;  5A8B A;  4HJ4 A;  2W27 A;  2W0N A;  2PD8 A;  1S1Z A;  4HY8 A;  3BWL A;  4JGQ A;  4MN6 A;  5TBM B;  3RH8 B;  4NXG A;  3LUQ A;  4I3I A;  1N9O A;  1S4S A;  4L9F A;  4HOI A;  1S4R A;  1X0O A;  5HZH A;  5J4E A;  2VV6 A;  4EXO A;  3NOU C;  1UGU A;  2PR5 A;  3NJA A;  1TS7 A;  2PYR A;  3UB7 A;  1LT0 A;  2V9A A;  4F3L A;  4GCZ A;  4DJ3 A;  1XJ4 A;  4R38 A;  4HQA A;  5DJT A;  1OTI A;  2ZOI A;  3CWF A;  4WF0 A;  4WN5 A;  5DJU A;  4HNB A;  4H6J A;  3EEH A;  3UB8 A;  4EQ1 A;  1T1B A;  4I5S A;  1GSV A;  5HDC A;  3G6O A;  2GJ3 A;  2V0U A;  1F98 A;  4NXF A;  4E04 A;  3FG8 A;  2OWH A;  3IBR A;  3LI9 A;  4F3L B;  3FC7 A;  5HD3 A;  5EFW A;  1T18 A;  4HJ6 A;  2WKP A;  1UWP X;  3ICY A;  2QWS A;  3LYX A;  3E4O A;  2L0W A;  4H6J B;  5KIZ A;  3K3C A;  3PYP A;  2H28 A;  4LRX C;  1XJ6 A;  3LIE A;  1XFQ A;  3EWK A;  2J80 A;  4DJ2 A;  3HJI A;  1DRM A;  5TBM A;  3ULF A;  3HJK A;  2B02 A;  1ODV A;  4I3J A;  3H9W A;  4HI4 A;  3UMD A;  1DP8 A;  2BAS A;  1LSW A;  4B9O A;  1G28 A;  3C2W A;  2V0W A;  5IU1 A;  3E4Q A;  5DKK A;  5HWT A;  5F5Y A;  4K08 A;  1OT9 A;  3VE3 A;  1OT6 A;  1NWZ A;  2HV1 A;  5AVE A;  3LI8 A;  3MJQ A;  2V1A A;  4YWZ A;  1XJ3 A;  4I3A A;  2P7J A;  3LIA A;  3LIC A;  3OLO A;  1T19 A;  2EA9 A;  1TS6 A;  5IS1 A;  3H7W B;  3BY8 A;  5F6A A;  1T1C A;  3CAX A;  1OTA A;  4HH3 A;  2I9V A;  4LRY C;  3KX0 X;  4KUK A;  3LIF A;  2L1M A;  1S1Y A;  1N9N A;  4BBV A;  4XT2 A;  4GS9 A;  5I5L A;  4GHI A;  3MQQ A;  4EEP A;  4I39 A;  4LLO B;  1LL8 A;  3MXQ A;  3MQO A;  4PKY A;  4BBU A;  5HDS A;  2VEA A;  2VLG A;  3NOP C;  3UB6 A;  3GEC A;  3P7N A;  4EES A;  5HWW A;  2L4R A;  2ZBB A;  2VV8 A;  1OTD A;  1GSW A;  4WLA A;  1V9Z A;  1TS8 A;  4XT2 B;  4GS9 B;  1S66 L;  4GHI B;  2INW A; 
#chains in the Genus database with same CATH topology
 2YKH A;  2Y2Q A;  4WUJ A;  3OZH A;  2ZC4 B;  4FCF A;  2Y4A A;  1TS0 A;  1WYB A;  5KSC A;  4U0X A;  1KVL A;  2QHK A;  5CHJ A;  1VEU A;  1LI0 A;  1SKF A;  1P97 A;  2HPB A;  4DE0 A;  4Y3I A;  4ZJ2 A;  4O01 A;  3FYZ A;  5J7E A;  3KSF A;  3GVB A;  1CQA A;  1PRQ A;  4BL3 A;  2P04 A;  5FA7 A;  3MXS A;  5CGX A;  3C5A A;  4HP4 A;  4IUK A;  2P08 A;  3VOY A;  3PHY A;  3E0Y A;  3HLE A;  1NYY A;  3O3V A;  5EV0 A;  3A3E A;  3O88 A;  3S1Y A;  3IS2 A;  1VEU B;  1XFN A;  1K0K A;  2LB9 A;  2VGL S;  2ZQ7 A;  2ZMV A;  5AVF A;  2G2W A;  3RTY A;  3IF6 C;  3JYI A;  5FI6 A;  5FEF A;  4I38 A;  4WBG A;  1L0G A;  4JGO A;  1AXB A;  2JCH A;  2PAV P;  3E2L A;  4EEU A;  1IKI A;  4XXR A;  2XD5 A;  2JKR M;  3B42 A;  3MF0 A;  3NC8 A;  1KGE A;  3VFF A;  5FI7 A;  2EX8 A;  4E3J A;  4EW7 A;  3PAE A;  4Q8I A;  3IS2 B;  3Q81 A;  2JKT M;  4Y15 A;  2Y2I A;  4FH4 A;  2Q9M A;  2V1Z A;  4EV4 A;  1K57 C;  2HJE A;  3M2J A;  1YT4 A;  1JWP A;  4LCL A;  5L2F A;  4KZ9 A;  1P9W A;  1XJ2 A;  2K2N A;  1K56 A;  4Q0H A;  1EW0 A;  1MWS A;  2VX8 A;  3HLD A;  5CRF A;  4CLC A;  2XRN A;  4KUO A;  1LHY A;  3CJM A;  4BBT A;  3DWK A;  3KYZ A;  2WGI A;  3JVU A;  3B33 A;  1DP6 A;  2H5S A;  4LGW A;  4E6W A;  3A3I A;  3T50 A;  3IHB A;  1NZO A;  2B5R A;  4NKP A;  4BEN A;  4OVD A;  1MKI A;  2FFF B;  3UDI A;  4R1G A;  2XFS A;  3S7Q A;  4KZ6 A;  3FPV A;  2EX2 A;  3ZFZ A;  4X1M A;  4M4X A;  3S4X A;  5A8B A;  4EBN A;  4OPR A;  3HUM A;  1ERM A;  3OPH A;  5FDS A;  4CLC B;  3ZG0 A;  2WKE A;  4S2K A;  4BJP A;  5HPF A;  5CX7 A;  4JF4 A;  4RVA A;  5TBM B;  3RH8 B;  4PM8 A;  4UQI M;  2H0Y A;  4I3I A;  1ERQ A;  3W4P A;  4JXV A;  3T4S A;  1JTG A;  4A5R A;  5HZH A;  2ZJ9 A;  3NY4 A;  3V67 A;  5AQA A;  4R4S A;  4MCW A;  1M6K A;  4R3B A;  1UGU A;  2V8C A;  1TS7 A;  3UB7 A;  3EOI A;  4S2M A;  4CJN A;  4F3L A;  2KLI A;  4DJ3 A;  5BOH A;  5CER A;  4LV3 A;  1PNE A;  4WMC A;  4GDB A;  2QMI A;  2VGJ A;  2RL3 A;  4X68 A;  4GLQ A;  2VJW A;  2H10 A;  4EQ1 A;  3N8L A;  2XQZ A;  1YSP A;  3PBQ A;  4XUX A;  1T1B A;  3QP1 A;  4RX2 A;  1ES4 A;  3ZGA B;  2WUQ A;  1J9M A;  1YLW A;  3C4O A;  3LY4 A;  4Y7P A;  3BLM A;  2GJ3 A;  2V0U A;  1Y54 A;  3OCN A;  3T1X A;  3T4K A;  3CMZ A;  2WYX A;  1XX2 A;  1MPL A;  1K56 D;  4F3L B;  4X69 A;  3G2Z A;  1LL9 A;  3G35 A;  1T18 A;  4X6T A;  4OPY A;  1UWP X;  3LYX A;  2QWS A;  4CLC D;  3E4O A;  5GL9 A;  3BFF A;  2X02 A;  4Y0T A;  1HLU P;  4LEN A;  3QP2 A;  3LEQ A;  3EWK A;  1KDS A;  1ES5 A;  5KSH A;  2J3T C;  2OAP 1;  1BZA A;  3HJI A;  3ULF A;  3HJK A;  4OKP A;  1ODV A;  5TGF A;  1Z09 A;  5L10 A;  3VP0 A;  1WE4 A;  3P09 A;  3D9Y A;  2ZC5 B;  1STZ A;  5A92 A;  4GKU A;  1DP8 A;  2GZA A;  5FAQ A;  3QP6 A;  3E4Q A;  2EXB A;  5DKK A;  1K55 A;  3UO9 A;  2PBD P;  1ACF A;  2VA0 A;  1OT6 A;  1NWZ A;  4DXC A;  1G5U A;  3VSK A;  3HLB A;  1XGJ A;  5CTN A;  2P7J A;  4YIN A;  1AWI A;  3ZG7 B;  4P87 A;  4QY5 A;  5IS1 A;  1TS6 A;  3WS5 A;  1NZU A;  4OLD A;  4ZRR A;  1PWG A;  2HDS A;  2OV5 A;  1HZO A;  1OTA A;  4WMC D;  2Y8H A;  3D4F A;  2A2L A;  3HLF A;  2W3F A;  3UPN A;  1IEL A;  2HJ9 C;  1S1Y A;  3M6H A;  1HVB A;  3T1S A;  3N4I A;  3P01 A;  3SZT A;  2EWW A;  4KZ3 A;  5J8X A;  4MBK A;  4XT2 A;  5CGW A;  5I5L A;  4B88 A;  5GLD A;  3HBR A;  4EEP A;  1TEM A;  1NRF A;  3OOV A;  2E8I A;  4BBU A;  3T4J A;  1TF1 A;  5E2E A;  3P7N A;  2E8J A;  4Q0J A;  2O9B A;  2WAF A;  2VZW A;  3T4O A;  2Y2M A;  4P6B A;  2A49 A;  1KGG A;  4UEY A;  1V9Z A;  3FKW A;  4XT2 B;  3IWI A;  3VV4 A;  4JBF A;  3G32 A;  5G4Y A;  5HD5 A;  5MC7 A;  1MZU A;  3SS3 A;  4GW9 A;  5CEB A;  3IXD A;  5EVI A;  3CUE C;  2ZQC A;  4NXB A;  3PTE A;  5C5K A;  5HWV A;  4KZ5 A;  1W8Y A;  1DP9 A;  3DTI A;  5EOO A;  2VKS A;  5M19 A;  4LRZ E;  4FH2 A;  3HUN A;  3CIT A;  1PFL A;  3MMH A;  5FQK A;  1K25 A;  3VP1 A;  1W79 A;  4HP9 A;  2JHE A;  4HBT A;  5L07 A;  3KO6 A;  3F1O A;  2J9O A;  1YMS A;  3IWQ A;  3Q07 A;  1RGZ A;  1GSX A;  5EVI B;  5FQ9 A;  5G4Z A;  3IXB A;  5AQ9 A;  1I5Q A;  1L0D A;  3G31 A;  5EPH A;  2PD7 A;  5IT5 A;  1TDL A;  3IT9 A;  4IJG A;  5HSQ A;  3PBN A;  4RX3 A;  1NY0 A;  2Z2L B;  4RQ9 A;  2UWX A;  4PAU A;  3C7V A;  3LY3 A;  1TDG A;  1L2S A;  3PR6 A;  3MFX A;  4LV1 A;  2XSS A;  3LO7 A;  3C8C A;  1P0Z A;  2V1B A;  5CED A;  1Y28 A;  2V2F F;  3T1R A;  1O7E A;  2UV0 E;  3DBA A;  3F1O B;  1PZO A;  3H82 A;  4F94 A;  1KOU A;  2W3H A;  4ETX A;  5LBR A;  4EER A;  3C30 A;  4OOY A;  4KQD A;  1ZG6 A;  1ZKJ A;  3SH8 A;  2BG1 A;  1CEG A;  5D3O A;  1OME A;  2Y91 A;  5CEC A;  1OJ5 A;  1YLZ A;  1CJF A;  3P98 A;  2ZC3 B;  4G3W A;  2OLU A;  4MBF A;  4LV0 A;  3NUL A;  1O07 A;  1XXM A;  3I7J A;  1KE0 A;  3VE4 A;  3E4P A;  4QPR A;  1GCE A;  2D01 A;  3H82 B;  5F68 A;  1JNU A;  3T1Q B;  4S2N C;  4NG2 A;  4NEE D;  3G34 A;  5FL3 A;  1MKM A;  1L0F A;  2DMW A;  3MR0 A;  5EVI D;  3WS4 A;  4JPM A;  4EUZ A;  1G6O A;  3F1P A;  3SS5 A;  2EX6 A;  4MEZ A;  4N1X A;  2KX6 A;  4JGR A;  1RCJ A;  5CHM A;  4LV2 A;  3DWZ A;  5JYP A;  2PDR A;  4FUW A;  3C4P A;  2HGV A;  3K2N A;  3MBZ A;  1E3U A;  5J3W A;  4D60 A;  3IF5 A;  2VV7 A;  4X25 A;  4B4X A;  2VGK A;  1F5M A;  3OC2 A;  3TJZ C;  1D06 A;  1LSX A;  3G30 A;  4R70 A;  4ARZ A;  2M7U A;  4KG6 A;  1EWZ A;  3A0V A;  2PHY A;  3F1P B;  3TW8 A;  1JWV A;  4E3K A;  5EE8 A;  5KZH A;  4OQI A;  4HY8 A;  3EEA A;  3LR0 A;  4ZAM A;  4JGQ A;  1IOU A;  1P9R A;  4ZDX A;  1GA9 A;  5EVE A;  3LUQ A;  4L9F A;  1YPR A;  3RFB A;  2CC1 A;  5L8M A;  1X0O A;  2NUT C;  2HP5 A;  4R3J A;  2HZ5 A;  4E3I A;  4ARZ B;  3WS2 A;  1IYQ A;  4OQH A;  2ZQA A;  2PYR A;  3RXX A;  3GRJ A;  3MQ0 A;  2JBF A;  1LT0 A;  2Q9N A;  4GCZ A;  4R38 A;  4KZB A;  4HQA A;  1OTI A;  3WRT A;  3AGE A;  4BQM A;  4KG2 A;  5FQM A;  2HDQ A;  3FWL A;  1YM1 A;  3ZG8 B;  4GD8 A;  5AQ7 A;  2OAQ 1;  3ZHH A;  2VK3 A;  4I5S A;  4WZ5 A;  3BFD A;  1MWU A;  3TRC A;  1NRJ A;  4R0Q A;  3BW6 A;  1KGF A;  5TR7 A;  4JXS A;  4DDS A;  1VET A;  1M40 A;  1IYS A;  3IBR A;  3BJN A;  1KE4 A;  2ACG A;  4IVK A;  5HD3 A;  5EFW A;  3ZCZ A;  1GHI A;  3QNC A;  5DTK A;  3PBR A;  3KSH A;  2WKP A;  2MJ6 A;  2L0W A;  4KEN B;  5KIZ A;  4IBX A;  4R4R A;  1H8Z A;  3K3C A;  1OPX A;  1XJ6 A;  3SS4 A;  1E3U D;  3LIE A;  4FD8 A;  3IWO A;  1FCN A;  4KZA A;  1H3Q A;  1DRM A;  2QYB A;  3PBO A;  5EUA A;  5TBM A;  3MZD A;  4I3J A;  3H9W A;  2O9C A;  1DY6 A;  4X55 A;  1VET B;  4RYE A;  4OPZ A;  1K6R A;  3MKE A;  4G3V A;  2BAS A;  4BD0 A;  1BSG A;  2V0W A;  3OCL A;  3S7N A;  2W3G A;  2IWC A;  4KG5 A;  1FSW A;  5HWT A;  3VMA A;  1FR1 A;  3BQA A;  5FQQ A;  5F5Y A;  1OT9 A;  3VE3 A;  3ZDJ A;  3ZNT A;  3LI8 A;  1LL5 A;  3AGF A;  2ZC6 B;  3GMW A;  3HLG A;  3LIA A;  1CK3 A;  2EFX A;  2EA9 A;  3V50 A;  3H7W B;  1K54 C;  2WKI A;  3BY8 A;  3CAX A;  4DF6 A;  3Q7V A;  4HH3 A;  3S7O A;  4KUK A;  3LIF A;  3CZD A;  4QY6 A;  2A3U A;  2ZQ8 A;  3NCK A;  3E2K A;  3UY6 A;  1N9B A;  1N9N A;  4E3L A;  3CHW P;  4E6X A;  2Q0O A;  3V5M A;  5HAP A;  4E3O A;  4BBV A;  4EUV A;  3MQQ A;  4N92 A;  1XA1 A;  3MXQ A;  1IEM A;  1ZTU A;  3MQO A;  1N4O A;  1BLH A;  4N1H A;  4QHC A;  3Q82 A;  3C7U A;  5GHZ A;  2VEA A;  4DE3 A;  2VLG A;  3UB6 A;  3ZVW A;  3Q7V B;  5FQJ A;  2LB5 A;  3BEB A;  3QHY A;  3KYE A;  5HAQ A;  2VV8 A;  1OTD A;  4DKI A;  1QME A;  2HDU A;  1GSW A;  5F1F A;  2XF3 A;  4WLA A;  5IHV A;  4Y2F A;  3B47 A;  2INW A;  4P6Z S;  4GOG A;  4OP8 A;  2Y2J A;  2JN7 A;  4QU3 A;  2EWV A;  4O0P A;  3T4T A;  4BWI A;  1YKD A;  5GHY A;  1PW1 A;  1F9I A;  4EQI A;  3GSG A;  3IX3 A;  4HJ3 A;  2A24 A;  2OWJ A;  4JF6 A;  2O9A A;  4U0T A;  1OJG A;  3JVV A;  3QNB A;  4E3N A;  4DMZ A;  2R78 A;  4ZJ1 A;  3Q7Z A;  2P9V B;  2VGL M;  3N7W A;  1LI9 A;  3KYQ A;  1BLS A;  2NUP C;  3PAG A;  1S0W A;  1PWD A;  1PWC A;  3HRE A;  4IED A;  4QB8 A;  4AFI A;  1YLJ A;  1N9L A;  3SOI A;  3LID A;  2Y2K A;  1YAX A;  1WYC A;  5GLB A;  4OOL A;  2A24 B;  4U3T A;  2O99 A;  4II7 A;  2DRW A;  4NXE A;  4GB7 A;  5F1G A;  1LSV A;  5HFO A;  1DJC A;  1BYW A;  1YLT A;  5A91 A;  3D3O A;  3NBL A;  3UE6 A;  3D72 A;  4JXW A;  3BM6 A;  2PBY A;  1XA7 A;  3WS0 A;  1ALQ A;  2HDR A;  1HD8 A;  4IVI A;  5FAO A;  4GNU A;  2ZOH A;  3IHA A;  3MZF A;  4S2J A;  2D02 A;  3HUO A;  3ISG A;  1MY8 A;  1S67 L;  1H0M A;  4YNR A;  3EGX C;  5AJG A;  4Y0O A;  3IF6 B;  3V39 A;  4Y17 A;  1K57 A;  2Z6C A;  1ESI A;  1LLB A;  4DXB A;  1J3W A;  1YQS A;  3QP8 A;  1YSQ A;  3LR4 A;  5DVA A;  4CQH A;  2M1C A;  3VOL A;  4ZTK A;  4EBL A;  2Y2G A;  2PR6 A;  5TFQ A;  4CLC C;  4LPZ A;  1NYM A;  5EOE A;  3VSL A;  2K7S A;  1D7E A;  4WEK A;  5GLA A;  4X1L A;  4OQG A;  1ONG A;  5M1A A;  5M18 A;  3ZNY A;  3A0S A;  2EX9 A;  3GV9 A;  4YOF A;  4QWO A;  2XH9 A;  2WKQ A;  2OOL A;  2PT7 A;  1WA9 A;  1G6A A;  1DJA A;  3IX4 A;  3BY9 A;  5FQI A;  3NIA A;  2QJ7 A;  1MXO A;  5K5B A;  4KZ4 A;  4UHU A;  4UAA A;  2W27 A;  2W0N A;  1E25 A;  1BLC A;  3R7W A;  1S1Z A;  4BL2 A;  2ZQD A;  3BWL A;  2IWD A;  3LCE A;  3CI6 A;  4GJ4 A;  1XGI A;  2H0T A;  1KE3 A;  1JTD A;  4MMN A;  2QPN A;  1N9O A;  3BEC A;  3PBS A;  4PM7 A;  4Y0U A;  1S4S A;  3FZC A;  2GX5 A;  2VV6 A;  4MDZ A;  5FEG A;  3Q1F A;  5HL6 A;  3AGD A;  2AVX A;  2PR5 A;  3NJA A;  4DE1 A;  3VFH A;  4H8R A;  3T12 B;  4PPR A;  2V9A A;  3W4Q A;  2J3W A;  3QP4 A;  2V8F A;  2WKH A;  2WK0 A;  5DJT A;  5E2G A;  2W1T A;  2ZOI A;  3R7W B;  3T4L A;  3TSG A;  1FCM A;  4HNB A;  4H6J A;  2Y79 A;  2BTF P;  1IYO A;  3EEH A;  3VP2 A;  5DF7 A;  2ZD8 A;  1SDN A;  4BD1 A;  1SHV A;  3MS6 A;  3OBF A;  1IFQ A;  3A3D A;  5L09 A;  1F98 A;  4NXF A;  4E04 A;  1FQG A;  5EM0 A;  2OWH A;  4DE2 A;  2P74 A;  4EU0 A;  3LI9 A;  3FC7 A;  1CI9 A;  1KVM A;  1PIO A;  3U2A A;  3CPT A;  2W1T B;  3UNW A;  3ICY A;  5HL1 A;  2GNX A;  2WAE A;  3SH9 A;  1L3L A;  4H6J B;  3LFV A;  3PYP A;  2H28 A;  1RP5 A;  1SCW A;  3LR5 A;  1XFQ A;  5DF8 A;  2ZMF A;  4DJ2 A;  4B4Z A;  3UPO A;  4HES A;  4IHQ A;  2Z2M B;  4K91 A;  3BQ8 A;  2HF6 A;  4GZB A;  4CPK A;  1SZV A;  3UE3 A;  4R23 A;  4WYY A;  4IBR A;  3HCY A;  2HP6 A;  4OLG A;  3OPP A;  1LSW A;  4B9O A;  5U47 A;  3CPT B;  2JKF A;  2R9W A;  1D1J A;  1K55 C;  4Z1W A;  1Z6F A;  2ZLY A;  1G68 A;  4G3K A;  5F82 A;  4S2O A;  4M3K A;  2Y59 A;  4S2P A;  2XLN A;  4KQQ A;  4BLM A;  3UDX A;  5HAR A;  1GHP A;  4GD6 A;  5GLC A;  3S7P A;  3UB5 P;  3KSI A;  3NI9 A;  2XDM A;  1XJ3 A;  1C3B A;  2G2U A;  4PM5 A;  4NET A;  2FZ0 A;  1F2K A;  1I2W A;  4KQR A;  4ETZ A;  3C38 A;  2WGV A;  5DTS A;  2I9V A;  4LRY C;  2EXA A;  3OPR A;  1YLY A;  4JXG A;  2O0Y A;  2FH5 A;  3IH9 A;  4Z9Q A;  1I2S A;  4WEJ A;  3GR2 A;  3DW0 A;  3KSG A;  2FFY A;  1U60 A;  3NEC A;  4XUZ A;  4DRT A;  4I39 A;  4LLO B;  1TD5 A;  3NDG A;  3RXW A;  2JKG A;  1K4F A;  2C5W B;  1BTL A;  4X53 A;  5KMW A;  1IKG A;  3FPW A;  5HDS A;  5A90 A;  2OSU A;  4PMA A;  3NOP C;  1VQQ A;  4K0W A;  5HWW A;  3OPL A;  2L4R A;  5AQB A;  3IXH A;  2XRO A;  3DTM A;  1TVF A;  5G18 A;  5EM1 A;  1XKZ A;  3UE0 A;  3T4Q A;  2PU4 A;  4UA6 A;  2WZZ A;  1W63 M;  1S66 L;  2J3T D;  1PYY A;  2X71 A;  2YKF A;  3JPU A;  1W5D A;  3UB9 A;  4LFU A;  1Q2Q A;  1L0E A;  5EVI C;  1S6R A;  1ZC2 A;  2XA7 S;  4Y13 A;  3GTC A;  2CMN A;  1FOF A;  2ZMA A;  4HHD A;  3CUE A;  1VHM A;  1PI5 A;  3VP3 A;  4C6Y A;  4HIA A;  3BYD A;  5FAP A;  4WL9 A;  1K38 A;  3GDI A;  2Y2O A;  1ONH A;  3H7W A;  1K6S A;  1ESU A;  5DKL A;  4LCM A;  2XEP A;  3G2Y A;  4PM9 A;  4KZ8 A;  1FIK A;  1BT5 A;  4QJG A;  4PHT A;  3DTK A;  3M6B A;  2W1R A;  2XK1 A;  4ESP A;  2ZM2 A;  1FIL A;  4R3A A;  3L9K A;  3UME A;  2J7V A;  4EBP A;  4ME4 A;  3A0R A;  3CLO A;  5GHX A;  3N6I A;  4P85 A;  5FI2 A;  2WAD A;  2Y2H A;  2KDK A;  4HBU A;  5E2F A;  1H8Y A;  3PXP A;  1ERO A;  1V9Y A;  5FAS A;  3O87 A;  3ZG5 A;  3LEZ A;  2PU2 A;  3NDE A;  4UA7 A;  1ES2 A;  3CG5 A;  3GQZ A;  1PZP A;  1W63 Q;  2DNS A;  2Y2P A;  2BLS A;  3LR3 A;  4ID4 A;  2K31 A;  3MZE A;  2HP9 A;  4MBH A;  3A3F A;  4JKT A;  5E2H A;  3IQA A;  4EWF A;  3W8K A;  1MBL A;  1Q2P A;  3O86 A;  3EQV A;  3F1N A;  1KDW A;  4JGP A;  2EFU A;  4WZ4 A;  3TG9 A;  2WGW A;  2ZC7 A;  2B95 A;  4S2I A;  2XGN A;  2Y2L A;  4QD4 A;  1A0K A;  2R9X A;  3LGO A;  4L9E A;  3SW1 A;  2QKP A;  1SDE A;  4ZBE A;  3FV7 A;  2P9V A;  2I72 A;  3F1N B;  4WM9 A;  3NOT C;  4L9G A;  4WEL A;  4S2N A;  3K3D A;  4CLC E;  1ZHH B;  3ZQ5 A;  1T1A A;  2QJ5 A;  4PKY G;  2W3E A;  1ZG4 A;  2B18 A;  2WGW B;  2XR0 A;  3NHQ A;  2J9P A;  5F69 A;  5DFX A;  2Y2N A;  3BFE A;  3LIB A;  5DFY A;  1YMX A;  2JKR I;  1H8M A;  3IXG A;  3UN7 A;  4B93 A;  4OP5 A;  2Z6D A;  4JF5 A;  3WWX A;  4HH2 A;  4OQ0 A;  5CTM A;  4N9K A;  1MC0 A;  4EET B;  4BMW A;  2WKR A;  4OPQ A;  1OTB A;  3G4P A;  1YLP A;  4R6L A;  1IYP A;  4HEF A;  3R4K A;  2JKT I;  4P0M A;  4PM6 A;  1UWN X;  2PYP A;  5EEC A;  1NLZ A;  1OTE A;  4MN5 A;  3RJU A;  1VB6 A;  1JVJ A;  5HDD A;  4S2L A;  5FDH A;  1HTZ A;  4HJ4 A;  1EI5 A;  4MN7 A;  4D2O A;  3MKF A;  3TE8 A;  3ITB A;  2PD8 A;  5F83 A;  4KQO A;  4Y5F A;  4MLL A;  4MN6 A;  4NXG A;  3S22 A;  1XPB A;  4UA9 A;  3EQU A;  3IF6 A;  2JE5 A;  4HOI A;  1S4R A;  4Q0I A;  3PBT A;  5J4E A;  4DDY A;  1JWZ A;  4EXO A;  5A93 A;  2PRF A;  3VOZ A;  3NOU C;  1H5X A;  2V20 A;  1Y4O A;  1E4D A;  1XJ4 A;  2XFT A;  5JYO A;  3VP4 A;  1BLP A;  3SH7 A;  3CWF A;  4L0L A;  4WF0 A;  2ZM8 A;  4WN5 A;  2RCX A;  5DJU A;  1QMF A;  2OLV A;  4JLF A;  3L7H A;  4MNR A;  3UB8 A;  4K0X A;  3E98 A;  4WZ5 C;  4YFM A;  3IBJ A;  3IX8 A;  3MSH A;  3MXR A;  1GSV A;  2IA2 A;  5HDC A;  4OOM A;  3G6O A;  1FSY A;  5CHU A;  3U4L P;  3FG8 A;  5TJJ A;  3HL9 A;  5I94 A;  4FOF A;  2XD1 A;  2XA7 M;  1FR6 A;  4HJ6 A;  3B3X A;  2ZQ9 A;  4O7D A;  3DAV A;  4OH0 A;  4FSF A;  5CXW A;  4LRX C;  5E43 A;  2J80 A;  3V3R A;  3A3J A;  5HX9 A;  2GDN A;  3IH8 A;  2B02 A;  2IWB A;  1SKO A;  2ZM0 A;  1FCO A;  3ZVT A;  1PW8 A;  4HI4 A;  1NXY A;  3QP5 A;  1MWT A;  2W3D A;  5FSR A;  3UMD A;  1MWR A;  1G28 A;  2JC7 A;  3C2W A;  1CF0 A;  3V3S A;  3N8R A;  5IU1 A;  4N9L A;  5HPI A;  2J8Y A;  2KOI A;  2DCF A;  4K08 A;  5HW3 A;  4GN2 A;  2HV1 A;  4O8G A;  5AVE A;  1BUL A;  1RGY A;  4E3M A;  1SKO B;  3MJQ A;  1K4E A;  4X56 A;  2V1A A;  3WS1 A;  4YWZ A;  1BUE A;  4C3Q A;  1VM1 A;  4I3A A;  1W8Q A;  3LIC A;  3OLO A;  3W4O A;  3BFC A;  3WRZ A;  1T19 A;  3UPP A;  4C75 A;  5F6A A;  1PI4 A;  1K54 A;  4OON A;  1T1C A;  4UQI S;  3BLS A;  1NLY A;  1DJB A;  3KX0 X;  4IUH A;  1XP4 A;  2L1M A;  2WZX A;  3FKV A;  3W2Z A;  1CEF A;  3HLC A;  4RA7 A;  5DTT A;  2ZL1 A;  3EGD C;  4KZ7 A;  1NJ4 A;  2Y55 A;  3O5Y A;  4GS9 A;  3UE1 A;  4GHI A;  3M2K A;  1GA0 A;  3HLW A;  3HVF A;  1LL8 A;  1GHM A;  2M7V A;  5EVL A;  4FTX A;  3MFD A;  5CGS A;  5DF9 A;  4ZJ3 A;  2C6W B;  4GDN A;  3DTE A;  2QZ6 A;  4PKY A;  3BRM A;  1W7F A;  3N8S A;  3ZG9 B;  1ES3 A;  4P6Z M;  2G7U A;  3GEC A;  3TOI A;  4EES A;  4DN0 A;  3ZYT A;  4NK3 A;  1CI8 A;  5FAT A;  3UDF A;  2ZBB A;  2X01 A;  5HAI A;  3ITA A;  2ZL1 B;  1TS8 A;  4GS9 B;  4GHI B;  3BFG A; 
#chains in the Genus database with same CATH homology
 4P6Z S;  5G4Y A;  5HD5 A;  2YKF A;  2YKH A;  5MC7 A;  3UB9 A;  2JN7 A;  1MZU A;  4WUJ A;  2XA7 S;  2EWV A;  4GW9 A;  4O0P A;  3T4T A;  4BWI A;  2CMN A;  3CUE C;  1TS0 A;  1YKD A;  4NXB A;  4HHD A;  3CUE A;  1VHM A;  1F9I A;  4HIA A;  2QHK A;  5C5K A;  4WL9 A;  5HWV A;  1P97 A;  1DP9 A;  3GDI A;  4HJ3 A;  2A24 A;  2VKS A;  4Y3I A;  4LRZ E;  2OWJ A;  3H7W A;  2O9A A;  3CIT A;  4O01 A;  5DKL A;  1OJG A;  3MMH A;  3JVV A;  5J7E A;  3KSF A;  4DMZ A;  4HP9 A;  2R78 A;  4PHT A;  2JHE A;  2VGL M;  2P04 A;  3KYQ A;  2W1R A;  2NUP C;  4HP4 A;  4IUK A;  3UME A;  4R3A A;  2P08 A;  3KO6 A;  3F1O A;  3PHY A;  3E0Y A;  1GSX A;  4ME4 A;  3A0R A;  3CLO A;  5G4Z A;  4AFI A;  1N9L A;  3LID A;  1YAX A;  3IS2 A;  2KDK A;  2PD7 A;  1XFN A;  2LB9 A;  2VGL S;  5IT5 A;  4OOL A;  2A24 B;  2O99 A;  2ZMV A;  3PXP A;  4IJG A;  4II7 A;  4NXE A;  5AVF A;  5HSQ A;  3RTY A;  1V9Y A;  3PBN A;  1LSV A;  4RQ9 A;  4I38 A;  4PAU A;  1BYW A;  3PR6 A;  3MFX A;  2XSS A;  1W63 Q;  4JGO A;  3D3O A;  4EEU A;  3C8C A;  3LR3 A;  1P0Z A;  2V1B A;  2K31 A;  2JKR M;  1Y28 A;  3B42 A;  3MF0 A;  3DBA A;  3F1O B;  3H82 A;  3UE6 A;  3D72 A;  1KOU A;  2W3H A;  3EQV A;  3F1N A;  4ETX A;  5LBR A;  4JGP A;  4EW7 A;  4EER A;  3C30 A;  2ZOH A;  3IS2 B;  4KQD A;  2JKT M;  2D02 A;  1S67 L;  4YNR A;  3EGX C;  5AJG A;  1OJ5 A;  4G3W A;  4L9E A;  2Z6C A;  3SW1 A;  2QKP A;  3VE4 A;  3E4P A;  2HJE A;  4QPR A;  2D01 A;  3H82 B;  5F68 A;  1JNU A;  3F1N B;  1YSQ A;  4NEE D;  3NOT C;  4L9G A;  4WEL A;  5FL3 A;  3K3D A;  3LR4 A;  4CQH A;  4CLC E;  1MKM A;  1ZHH B;  2DMW A;  2M1C A;  3MR0 A;  1P9W A;  3VOL A;  3ZQ5 A;  1XJ2 A;  2K2N A;  4Q0H A;  1T1A A;  2QJ5 A;  1EW0 A;  1G6O A;  2VX8 A;  3F1P A;  2PR6 A;  4PKY G;  4CLC C;  2W3E A;  4LPZ A;  2KX6 A;  2B18 A;  4JGR A;  4CLC A;  2XRN A;  4KUO A;  3NHQ A;  5F69 A;  5DFX A;  2K7S A;  1D7E A;  2PDR A;  3LIB A;  4WEK A;  4BBT A;  5DFY A;  2HGV A;  3K2N A;  2JKR I;  1H8M A;  5J3W A;  4B93 A;  2VV7 A;  3KYZ A;  2Z6D A;  3JVU A;  4HH2 A;  3A0S A;  1F5M A;  3OC2 A;  3B33 A;  4YOF A;  3TJZ C;  1DP6 A;  1MC0 A;  4EET B;  1D06 A;  1LSX A;  3T50 A;  4BMW A;  2WKR A;  1OTB A;  4NKP A;  4R6L A;  4R70 A;  4ARZ A;  2WKQ A;  3R4K A;  2JKT I;  2M7U A;  2OOL A;  2PT7 A;  1WA9 A;  1UWN X;  2PYP A;  3S7Q A;  1NLZ A;  3A0V A;  3BY9 A;  1OTE A;  4MN5 A;  3FPV A;  1VB6 A;  2PHY A;  3F1P B;  5HDD A;  4M4X A;  3TW8 A;  2QJ7 A;  5A8B A;  5K5B A;  4HJ4 A;  4CLC B;  2W27 A;  2W0N A;  4MN7 A;  3TE8 A;  2PD8 A;  3R7W A;  4BJP A;  1S1Z A;  5HPF A;  4KQO A;  4HY8 A;  3EEA A;  3LR0 A;  4Y5F A;  3BWL A;  4JGQ A;  5CX7 A;  1IOU A;  1P9R A;  4MN6 A;  5TBM B;  3RH8 B;  3CI6 A;  4NXG A;  3LUQ A;  4GJ4 A;  4UQI M;  4I3I A;  3EQU A;  4MMN A;  3PBS A;  1N9O A;  1S4S A;  4L9F A;  4HOI A;  1S4R A;  3RFB A;  3T4S A;  5L8M A;  1X0O A;  4Q0I A;  5HZH A;  3PBT A;  2NUT C;  5J4E A;  2GX5 A;  3V67 A;  2VV6 A;  4MDZ A;  4EXO A;  4MCW A;  4ARZ B;  3NOU C;  5HL6 A;  1UGU A;  2PR5 A;  3NJA A;  1TS7 A;  2PYR A;  3UB7 A;  3MQ0 A;  1LT0 A;  3EOI A;  2V9A A;  4F3L A;  2KLI A;  2J3W A;  4GCZ A;  4DJ3 A;  1XJ4 A;  4R38 A;  4HQA A;  5DJT A;  1OTI A;  2W1T A;  2ZOI A;  3R7W B;  3CWF A;  4L0L A;  4WF0 A;  3T4L A;  4WN5 A;  5DJU A;  4HNB A;  4H6J A;  2Y79 A;  3EEH A;  4GLQ A;  3UB8 A;  2VJW A;  4EQ1 A;  3E98 A;  1YSP A;  3PBQ A;  2OAQ 1;  1T1B A;  3IBJ A;  4I5S A;  1GSV A;  2IA2 A;  5HDC A;  3TRC A;  4OOM A;  1NRJ A;  3G6O A;  2GJ3 A;  3OBF A;  2V0U A;  3BW6 A;  1IFQ A;  3OCN A;  3T4K A;  1F98 A;  4NXF A;  4E04 A;  3FG8 A;  2OWH A;  3IBR A;  3BJN A;  5TJJ A;  4EU0 A;  3LI9 A;  4F3L B;  4FOF A;  3FC7 A;  5HD3 A;  5EFW A;  2XA7 M;  3U2A A;  1T18 A;  3PBR A;  2W1T B;  4HJ6 A;  3KSH A;  2WKP A;  1UWP X;  3ICY A;  2QWS A;  3LYX A;  4CLC D;  3E4O A;  2GNX A;  2MJ6 A;  2L0W A;  4H6J B;  5KIZ A;  3LFV A;  3K3C A;  3PYP A;  1OPX A;  4FSF A;  2H28 A;  4LRX C;  1XJ6 A;  3LIE A;  3LR5 A;  1XFQ A;  3EWK A;  2J80 A;  2ZMF A;  4DJ2 A;  5KSH A;  2J3T C;  1H3Q A;  2OAP 1;  3HJI A;  1DRM A;  2QYB A;  3PBO A;  5TBM A;  4IHQ A;  3ULF A;  3HJK A;  2B02 A;  1ODV A;  3BQ8 A;  4I3J A;  3H9W A;  2O9C A;  2HF6 A;  3UE3 A;  4HI4 A;  3HCY A;  2W3D A;  3UMD A;  1STZ A;  1DP8 A;  4G3V A;  2BAS A;  1LSW A;  2GZA A;  4B9O A;  1G28 A;  3C2W A;  2V0W A;  3OCL A;  3S7N A;  2W3G A;  5IU1 A;  5HPI A;  3E4Q A;  5DKK A;  5HWT A;  4Z1W A;  4G3K A;  3BQA A;  2KOI A;  5F5Y A;  2VA0 A;  4K08 A;  1OT9 A;  3VE3 A;  1OT6 A;  1NWZ A;  2HV1 A;  4O8G A;  5AVE A;  3LI8 A;  3MJQ A;  3S7P A;  2V1A A;  3KSI A;  4YWZ A;  1XJ3 A;  4I3A A;  2FZ0 A;  2P7J A;  3LIA A;  3LIC A;  3OLO A;  1T19 A;  2EA9 A;  1TS6 A;  5IS1 A;  3H7W B;  3BY8 A;  4ETZ A;  3C38 A;  4ZRR A;  5F6A A;  1T1C A;  3CAX A;  1OTA A;  2Y8H A;  4UQI S;  4HH3 A;  2A2L A;  2I9V A;  1NLY A;  3S7O A;  4LRY C;  3KX0 X;  4KUK A;  3LIF A;  4IUH A;  2W3F A;  2L1M A;  2HJ9 C;  1S1Y A;  3W2Z A;  1N9N A;  2O0Y A;  3P01 A;  2FH5 A;  3EGD C;  2EWW A;  4WEJ A;  4BBV A;  3KSG A;  4XT2 A;  3O5Y A;  4GS9 A;  5I5L A;  4GHI A;  4EUV A;  3MQQ A;  4EEP A;  4I39 A;  3OOV A;  1LL8 A;  4LLO B;  1TD5 A;  2M7V A;  3MXQ A;  1ZTU A;  3MQO A;  5DF9 A;  4PKY A;  4BBU A;  3FPW A;  5HDS A;  2VEA A;  2VLG A;  3T4J A;  1TF1 A;  3NOP C;  4P6Z M;  2G7U A;  3UB6 A;  3GEC A;  3P7N A;  4Q0J A;  4EES A;  2L4R A;  5HWW A;  2O9B A;  4DN0 A;  3ZYT A;  2XRO A;  2LB5 A;  2VZW A;  3T4O A;  2ZBB A;  2VV8 A;  1OTD A;  3T4Q A;  1GSW A;  4WLA A;  4UEY A;  1V9Z A;  1TS8 A;  4Y2F A;  4XT2 B;  1W63 M;  4GS9 B;  1S66 L;  3VV4 A;  4GHI B;  3B47 A;  2J3T D;  2INW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...