3CITA

Crystal structure of the gaf domain of a putative sensor histidine kinase from pseudomonas syringae pv. tomato
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
155
Chain Sequence
NAYRQSQSRAARLRLLVDTGQELIQLPPEAMRKCVLQRACAFVAMDHGLLLEWGNGVQTTARHGSKERLSTLETTADPLAIGPQWLERPGTHLPCVLLLPLRGADEGSFGTLVLANSVAISAPDGEDIESLQLLATLLAAHLENNRLLEALVARD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase
publication title Crystal structure of the GAF domain of a putative sensor histidine kinase from Pseudomonas syringae pv. tomato
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Transferase
total genus 46
structure length 155
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3citA00
2W1RA 4RQ9A 4R6LA 4Q0JA 4EU0A 4O01A 2O0YA 3S7OA 1F5MA 4MCWA 2G7UA 2Y8HA 1MC0A 3HCYA 2LB5A 4Q0HA 4FOFA 3S7QA 4DMZA 1MKMA 3LFVA 4GW9A 4YNRA 3KO6A 2XRNA 1ZTUA 2VZWA 3R4KA 3MF0A 4G3WA 4LRXC 3RFBA 3C2WA 3KSFA 3E0YA 2O9BA 2M7VA 2W3EA 2W3FA 2HGVA 2GX5A 3IBRA 3KSHA 2QYBA 4IJGA 3D3OA 5I5LA 2K31A 5L8MA 5HPIA 2VKSA 2W3HA 2O99A 3MMHA 2XROA 4PAUA 4R70A 3OBFA 5AJGA 1STZA 3S7PA 2VJWA 4ETXA 3OOVA 4MDZA 3BJNA 4QPRA 4ETZA 4DN0A 4G3KA 2W1TB 4ME4A 4ZRRA 3DBAA 3CI6A 4YOFA 4Z1WA 1TF1A 2ZMFA 4LRYC 2W1TA 2XSSA 3MQ0A 3NOPC 3K2NA 2VEAA 2Y79A 1YKDA 3EEAA 4LRZE 4Q0IA 5C5KA 5TJJA 2K2NA 3KSGA 5HPFA 3NOTC 5DFYA 2M7UA 2IA2A 1YSQA 5HSQA 3NHQA 3KSIA 3G6OA 3TRCA 3S7NA 4O8GA 3NOUC 4G3VA 2W3GA 4MMNA 3ZQ5A 4CQHA 3E98A 4GLQA 1YSPA 3O5YA 2B18A 4BWIA 4IUHA 3CITA 2LB9A 4Y2FA 2O9CA 1VHMA 4Y3IA 5K5BA 1TD5A 3VV4A 4IUKA 4MN7A 5HL6A 4O0PA 2KOIA 4Y5FA 3IBJA 2KLIA 4E04A 2W3DA 5LBRA 2OOLA 3W2ZA 4EUVA 5DFXA 2O9AA
chains in the Genus database with same CATH superfamily
2XQZA 2QPNA 1S1YA 2DRWA 3MZFA 5TFQA 5MC7A 5FI7A 1P97A 2G7UA 3SH9A 4E3NA 4E3LA 2ZMVA 3A0RA 3R7WA 4K91A 4S2KA 1K57A 4Z9QA 5EV0A 2OLVA 4CLCA 4LFUA 4IVKA 2ZC6B 1UWNX 3A3IA 1CEGA 4GOGA 2INWA 3W8KA 3HJIA 2PBYA 3ZGAB 3C5AA 3IH8A 3EWKA 4FUWA 3MXRA 1FSYA 1K55A 4LPZA 3KYZA 4B88A 2P7JA 3NECA 1IKIA 3OPPA 4GZBA 3A0SA 4I3JA 1DP9A 1LL8A 3KSGA 1ERQA 3DTKA 1XKZA 4LGWA 5A90A 5G4YA 2Z6CA 3RTYA 3HREA 3JPUA 5FQMA 2WAFA 1XA7A 5EVEA 3T4SA 5JYPA 1IELA 4X1MA 3B42A 4GLQA 5J4EA 4BD1A 2B18A 3CITA 1KVLA 4OOYA 5EVIA 1K6RA 3G35A 1ONGA 5HW3A 4I3AA 1TS7A 4Y5FA 4RA7A 2ZJ9A 4S2OA 2E8IA 1BZAA 4WUJA 3H7WB 1WA9A 2O0YA 1FILA 3S7OA 3BFCA 1XJ2A 3I7JA 3LI8A 3N7WA 4OQHA 3O86A 2HDSA 2PU4A 3KO6A 3ZG0A 1ES3A 2UWXA 4R3BA 3G4PA 1YLPA 3D4FA 1H8ZA 3Q81A 3T12B 4YINA 4WMCD 3HUNA 1S67L 5HD5A 1XXMA 1L0EA 4Q8IA 1DJCA 4ARZA 1PFLA 3LIBA 1FSWA 2HF6A 3S7PA 2Y2MA 2JN7A 1DP6A 2JKGA 1LSWA 2Y4AA 4GHIA 2JKRI 4EESA 3BLMA 3IQAA 3EEHA 5M19A 3LR0A 5TBMB 3D72A 1N9LA 3PAGA 3H82A 4PPRA 1XP4A 3EQUA 4R3JA 5CRFA 1HTZA 2HP6A 1MWSA 5A93A 1X0OA 4GN2A 1L0GA 4H6JB 2IA2A 1YSQA 3DWZA 2HZ5A 4E3OA 3G32A 1XFNA 2ZBBA 2W27A 5FAOA 1N9NA 3G6OA 3PBOA 4S2PA 4G3VA 2EA9A 1H8MA 1OPXA 3R7WB 3B3XA 4HEFA 3T50A 1AWIA 4D2OA 1FQGA 1KDSA 4KZAA 1YLYA 4CLCB 1GA9A 3OPRA 1IKGA 2KOIA 5FQKA 4QWOA 4N9KA 2X01A 1IEMA 4JXSA 2V0WA 4KQOA 3QP6A 4C3QA 3UDXA 5I94A 4L9EA 1IYSA 4X68A 2ZQDA 1XA1A 4LCLA 1MKMA 1XJ6A 1PIOA 2RL3A 4KZ3A 5F68A 5EE8A 3HVFA 3SS5A 2ZM2A 1T19A 3GMWA 4PMAA 1LL5A 4WM9A 4U0TA 5DVAA 4CPKA 2W3EA 3H9WA 2JKFA 1MWRA 4JF5A 1J3WA 2XH9A 5I5LA 2VV8A 3FV7A 3A3DA 1K25A 3M6BA 1A0KA 3IH9A 4QHCA 4GDBA 5F83A 4G3KA 4GS9A 4BBVA 5CTNA 3UE0A 1K38A 2XSSA 1BTLA 1RGZA 4OPRA 3LUQA 1OTIA 3WWXA 4QY5A 4E3MA 3Q7VA 4HI4A 4XT2A 5KIZA 5L2FA 4UQIS 4PHTA 4DF6A 2I72A 3VP0A 5CECA 4GD6A 1S66L 2Y2IA 3VOZA 4MMNA 5AQ7A 3V50A 4HBUA 1KE0A 5F82A 4BWIA 1W8QA 3ZFZA 1K4EA 5EFWA 2PRFA 5TGFA 2IWCA 2BTFP 3NULA 4FSFA 3PXPA 5LBRA 5CHMA 2L4RA 3T4OA 3IWQA 1GHPA 3PBTA 2WKPA 4L0LA 4HP9A 4ARZB 1GHMA 4UQIM 2ZM8A 3VFFA 1MC0A 2LB5A 4FOFA 1NWZA 2ZC5B 3NC8A 2WKEA 1BLPA 1HLUP 3T1SA 2EWVA 5U47A 5TR7A 4BBUA 4GHIB 3UB5P 4KUKA 4NK3A 1SDEA 1OT6A 1XX2A 3OC2A 2V8CA 1XGIA 3H82B 2XK1A 2HGVA 1LT0A 2Y2KA 3BWLA 1WE4A 1M40A 1TVFA 1YAXA 5HPIA 5GLCA 4LV0A 4PAUA 2Q0OA 4R70A 3G34A 3OBFA 2ZC3B 4HY8A 1PWGA 2OV5A 1RGYA 1ERMA 4ETZA 4OQIA 1NYMA 4JF6A 3DBAA 2OLUA 3JVVA 1K0KA 3S1YA 5J8XA 4N92A 4LRZE 2XA7S 2MJ6A 1K57C 1KGEA 3WRZA 4PKYG 5AQAA 1NY0A 2JKTI 3N6IA 4DJ3A 3IXGA 1ZG4A 4KG6A 3E4QA 5J3WA 4Y0UA 1U60A 5CGXA 2FH5A 1W8YA 1IOUA 4X56A 3CLOA 1XJ4A 4IEDA 2ZL1A 2WADA 1G28A 2RCXA 4NXFA 4MN7A 3IBJA 5FQ9A 5CTMA 2W3DA 2Q9NA 1KOUA 4F3LA 4EBPA 2EFXA 2NUTC 1H5XA 2ZC4B 3S7QA 4JXGA 5GL9A 5KSCA 4K0XA 3ZNYA 2VV7A 3MZEA 3D9YA 2GZAA 3ZG5A 4ZTKA 5F1FA 1GSXA 2V8FA 2W3FA 3SS4A 2K31A 4LV3A 4EEUA 2W3HA 4IVIA 4KZBA 2FFFB 5EVIC 2Z2LB 2V2FF 3Q7VB 4XT2B 3DTEA 4S2IA 4FH2A 3LIFA 3V5MA 4BL2A 2J80A 4E3JA 2J8YA 2Y55A 5EM0A 5CERA 4HP4A 3UN7A 3W4QA 4EBLA 1ZC2A 4WZ4A 4NXEA 1YM1A 4HNBA 4XXRA 1J9MA 2WGWA 4UA9A 1NRFA 2OWJA 2Y2JA 4UAAA 2W3GA 1ZKJA 5CXWA 2EX2A 1T1AA 5DJTA 2O9CA 4Y3IA 5K5BA 1BSGA 1SKOA 4X53A 3E4OA 4EUVA 5DFXA 2O9AA 1JWZA 2P9VA 3IXBA 3P7NA 4MEZA 4MCWA 4ZBEA 2YKHA 3VP2A 2EX6A 3BY9A 3VP4A 3OPHA 1SZVA 3E2LA 3IX4A 5EUAA 3SW1A 1H0MA 2ZC7A 1FR6A 4WEJA 3CMZA 2V20A 3G31A 2V0UA 1G5UA 1T1BA 3ISGA 4BJPA 2IWDA 1NYYA 1D7EA 2GX5A 5A92A 2ZD8A 4O7DA 4BBTA 4LLOB 2V1AA 5FL3A 3T4QA 3MQOA 4XUZA 5IS1A 3HLFA 3U4LP 2WYXA 3OOVA 4FD8A 4MNRA 1DJBA 3QNBA 4QPRA 1S4SA 4R4RA 4X6TA 4BENA 3HJKA 4DXCA 2W1TB 3GDIA 3DTIA 3MSHA 2KDKA 2ZL1B 5C5KA 5TJJA 3ZG7B 1L3LA 2XF3A 3NOTC 5DFYA 2M7UA 2PU2A 5D3OA 3HL9A 3C4OA 1NLYA 4NKPA 3ZG8B 3S7NA 3IF5A 4JGPA 4OKPA 3N8SA 3E98A 2M1CA 2A3UA 4KG5A 2EXBA 3O5YA 1IYOA 1Y28A 4BD0A 1CK3A 1VHMA 5FQJA 1TD5A 2EFUA 3ICYA 3MR0A 3NIAA 1EW0A 2WGVA 1PRQA 2GJ3A 4RQ9A 4GCZA 1P0ZA 1KE3A 3ITAA 1S1ZA 3CHWP 4R23A 2W0NA 1VM1A 3ZG9B 4A5RA 2QJ5A 4KG2A 4R3AA 1UWPX 4ID4A 1KDWA 5A8BA 3LR4A 3ZCZA 3C2WA 1G6AA 2V9AA 2ZOIA 2O9BA 1N9BA 3G30A 2QYBA 4XUXA 1NJ4A 1XPBA 3D3OA 4B4ZA 3QP8A 3UMDA 5IHVA 4UHUA 1FR1A 2EX9A 2WGWB 3QP4A 2JCHA 3FPVA 2J3TD 3PBRA 4DN0A 3AGFA 4BL3A 4DJ2A 5FQIA 5HAQA 2V1ZA 5AVEA 1BLCA 3AGEA 3QNCA 4OQGA 3FG8A 2ZLYA 1YKDA 3EEAA 1SKOB 3G2YA 5DKKA 1W79A 4JGOA 4GDNA 2R9XA 3MFDA 1L2SA 4DKIA 3MXSA 5L10A 3NDGA 3PR6A 1L0FA 4GNUA 4HJ6A 1XJ3A 5G4ZA 1CQAA 5DTTA 4CQHA 3B47A 1WYBA 5CHUA 3UB8A 3GV9A 5HFOA 3BECA 3PTEA 5F1GA 2JC7A 4E04A 2KLIA 2ZMAA 3W2ZA 4OONA 5HDCA 3FZCA 4Q0JA 2L1MA 4IBRA 1QMEA 1KGGA 2GNXA 1BUEA 5HL1A 3HCYA 3MJQA 4LCMA 4DMZA 1FOFA 2BG1A 1OJGA 4PM9A 3LFVA 1PYYA 4JGQA 5EOEA 4B9OA 3ZYTA 4UA6A 4QY6A 2VZWA 3P98A 3AGDA 3C7UA 4U3TA 3KSFA 1Q2QA 1MBLA 3GECA 3C30A 2R9WA 4EUZA 4GB7A 1ESUA 1ONHA 3A3JA 2VGKA 3CWFA 3C4PA 3ZNTA 3EQVA 1S4RA 5HWWA 1XFQA 2HDUA 1IYQA 3GTCA 3F1NA 3LR5A 4Y7PA 3WS1A 4N1HA 4YOFA 1TF1A 5FEGA 1MZUA 4I3IA 1YT4A 3MQ0A 3SS3A 4CLCD 3SH7A 4L9GA 4JPMA 1CF0A 2DMWA 3LIDA 1E25A 1E4DA 2Y2PA 1HD8A 5GHYA 2ZQ7A 4EW7A 1AXBA 1ZG6A 5AQ9A 4RX2A 2HJ9C 4B93A 1GA0A 2HP9A 4ZJ3A 3ZHHA 3T4LA 2PHYA 5EVIB 4EXOA 4HJ3A 3UDIA 1MKIA 1TS0A 3E2KA 4MBFA 4C75A 4R6LA 4DE1A 1FCOA 1PWDA 2C5WB 5FEFA 2ZOHA 1IFQA 4N1XA 4OOMA 2ZQ8A 1DRMA 4X1LA 2WKIA 4EEPA 1S0WA 1PI5A 1ZTUA 3BEBA 1K54C 1QMFA 2PD8A 1LL9A 1T18A 3F1PA 3OPLA 2C6WB 2OAQ1 4HESA 3QP2A 4IJGA 3M2KA 1KGFA 2VKSA 2O99A 2I9VA 3UB9A 3V39A 2PR5A 3BQAA 3FKWA 3OCLA 4DDYA 1STZA 3C8CA 2J9OA 1D06A 3BJNA 3IF6C 3UE6A 4KZ9A 1OT9A 2H28A 1PW8A 4IBXA 1ZHHB 5DF7A 4LRYC 4R4SA 4LENA 5A91A 4DRTA 4HH2A 4OPZA 5F6AA 5G18A 2QJ7A 2DNSA 3UPOA 3M6HA 5HPFA 2XLNA 1EI5A 3C38A 1HVBA 3LEZA 2Z2MB 5FSRA 2ZQ9A 1O7EA 4M3KA 1E3UD 3FPWA 4RYEA 2Y2LA 4WL9A 1TS6A 4P6ZS 3VOLA 1JWPA 1DP8A 1S6RA 1YSPA 4L9FA 3HLEA 5IT5A 2JBFA 3TOIA 5HL6A 1SHVA 2UV0E 3QHYA 4BLMA 3MKFA 1F98A 1PW1A 1OTEA 4EQIA 1F5MA 2GDNA 4YFMA 2HJEA 3P09A 3MS6A 1C3BA 4OP8A 4P6ZM 3BFDA 1JTGA 3F1NB 2X02A 5FAPA 1K4FA 2HDRA 3HUMA 5E43A 2H0YA 4NXGA 4F94A 5EOOA 3IWIA 3WS4A 3UO9A 5BOHA 3BFEA 4OPYA 1ESIA 5L8MA 1UGUA 2V1BA 2PT7A 3BYDA 3SH8A 1BLSA 4QU3A 1F2KA 3ZVWA 3DTMA 4KZ4A 3B33A 1G68A 4GS9B 3LY3A 2Y2OA 4P85A 1OTAA 4JKTA 2XD5A 1P9RA 1OTBA 2QWSA 3JVUA 1SCWA 4WF0A 1Z09A 4BQMA 5CGSA 3EOIA 3RXXA 3ITBA 2D02A 1I5QA 3MQQA 1IYPA 2DCFA 4JBFA 3RJUA 3KSIA 1G6OA 3CUEA 1XGJA 3KYQA 3VE4A 4WBGA 4ZJ1A 3NI9A 4YWZA 3V3SA 1WYCA 1W5DA 2Y2HA 2J7VA 1NLZA 1P9WA 2KX6A 4WMCA 3Q7ZA 4ZDXA 1SKFA 3CG5A 5GLDA 3GR2A 2HP5A 3F1PB 1V9ZA 1K54A 2D01A 4B4XA 5GLAA 2WGIA 3UDFA 3V3RA 1D1JA 2PAVP 4X55A 5F5YA 4KUOA 5GHZA 5FDSA 3MF0A 3MBZA 2WKQA 3IF6A 1VETA 3E0YA 1VB6A 4GJ4A 5DJUA 1LSXA 2VX8A 3TJZC 1Y4OA 4WYYA 3N8RA 3G2ZA 1GHIA 1EWZA 4BMWA 3FC7A 1OJ5A 2VJWA 1JWVA 4NG2A 2VGJA 3HLWA 3PBNA 4WZ5A 3BFGA 2XFSA 4HHDA 4HJ4A 3GVBA 5FATA 5EVLA 4EQ1A 3LCEA 1RCJA 3K2NA 3IX3A 1K56D 3UE1A 3ZVTA 4Q0IA 2K2NA 1H8YA 3WS2A 2L0WA 1KVMA 3CJMA 3MXQA 4KQDA 2OSUA 3JYIA 3SOIA 2WUQA 5HZHA 3UMEA 5CEBA 1YQSA 2VGLS 3OCNA 5L07A 1TS8A 3PBQA 3IS2A 2IWBA 4P0MA 1ALQA 3NBLA 3SZTA 4DE2A 3BQ8A 4IUKA 5EM1A 4EETB 1FIKA 3T4TA 2Y59A 3WS0A 4F3LB 2HV1A 3Q82A 4LV2A 3A3FA 3CPTA 3UB7A 2JE5A 1PZPA 2VGLM 2A49A 5HWVA 5DF8A 1YLZA 4MBKA 4S2MA 4DXBA 4JLFA 3K3CA 1PWCA 2Q9MA 1BT5A 3L9KA 4U0XA 1LHYA 1I2WA 2R78A 2XEPA 3U2AA 5HWTA 1OMEA 3S22A 4CJNA 2QZ6A 3VP3A 4IHQA 3IWOA 3HLGA 1O07A 4II7A 4WN5A 5FA7A 3PBSA 4UA7A 4H8RA 4E3IA 3GRJA 5HARA 2XGNA 4Z1WA 3CI6A 4QD4A 4FH4A 1MWUA 1GCEA 3LEQA 2A2LA 4EERA 3BW6A 4LV1A 3T4JA 3BM6A 1PNEA 2BASA 3WRTA 5CHJA 4HBTA 1BYWA 3WS5A 3NHQA 1YMXA 3LICA 4HQAA 3VOYA 1GSWA 4OPQA 3NOUC 2OWHA 2P08A 5DF9A 1NRJA 2VA0A 3ZQ5A 3T4KA 3TG9A 2LB9A 3CAXA 3VE3A 3T1RA 4D60A 4NETA 3UE3A 5HX9A 5KSHA 3IF6B 1VETB 5CGWA 2P9VB 5IU1A 1LSVA 2W1RA 3VSKA 3IXDA 1F9IA 4FTXA 2J3WA 1E3UA 4OQ0A 1LLBA 3IHBA 3K3DA 1SDNA 4GW9A 3EGXC 4PM5A 1ES5A 1N4OA 2EX8A 3NJAA 3DWKA 3RFBA 3UPNA 4HH3A 1GSVA 1RP5A 4DE0A 2CC1A 1DY6A 1CJFA 3VMAA 1K6SA 4MN6A 4EV4A 2X71A 2XROA 2YKFA 3UY6A 3HBRA 2J9PA 1OTDA 3LR3A 4ETXA 1JNUA 5HDDA 4OOLA 3NDEA 4ME4A 3KX0X 3IS2B 1YMSA 2E8JA 3HLCA 3NOPC 2QHKA 4GKUA 4PM6A 1MY8A 4Y0OA 2PDRA 5HD3A 4QB8A 3MZDA 3V67A 4ESPA 5HSQA 5AQBA 4P6BA 3OZHA 3OLOA 2XD1A 2AVXA 1FCNA 1EROA 2VLGA 3CPTB 4JGRA 2WZZA 3T1XA 4CLCE 3LI9A 3QP5A 5FQQA 4AFIA 4RX3A 5EECA 3P01A 4OLDA 1ES2A 5GLBA 4R38A 4EWFA 3UPPA 2G2UA 1FCMA 2ZQCA 1Q2PA 2P74A 3MFXA 2WK0A 4EU0A 4Y17A 4O01A 5CX7A 4KENB 3VP1A 3LGOA 5E2EA 4DE3A 4OVDA 4NEED 2Y8HA 1JTDA 4UEYA 3RXWA 5DTSA 3LYXA 1NZOA 5J7EA 1W63M 5KZHA 5AVFA 2WAEA 3DAVA 4N9LA 3KYEA 1PI4A 2XRNA 1ES4A 4HOIA 4G3WA 3BFFA 3CUEC 4WLAA 2FFYA 2M7VA 1Y54A 2JKRM 1YLWA 2J3TC 1W7FA 2Y91A 5KMWA 3MKEA 4E6XA 1HZOA 5AJGA 1M6KA 4JXVA 4JF4A 4KZ6A 1JVJA 4PM8A 1MXOA 2H10A 3BY8A 5EVID 2CMNA 3A0VA 1NXYA 4KQRA 1BLHA 4Y15A 3ULFA 2ACGA 4MLLA 5JYOA 4KZ5A 5FASA 1TDLA 2H5SA 4KQQA 1DJAA 5F69A 2PBDP 4OP5A 4QJGA 3TRCA 4O8GA 3LY4A 1KE4A 3N4IA 3F1OA 4S2NC 3CZDA 4IUHA 4Y2FA 4Y13A 1VEUA 2A24A 2Z6DA 4I38A 3VSLA 2B95A 3VV4A 4O0PA 2K7SA 4WZ5C 1TEMA 1K56A 1H3QA 3O3VA 2XFTA 1CEFA 2G2WA 2EWWA 1MPLA 4ZJ2A 2EXAA 3N8LA 1ACFA 4M4XA 2HDQA 4S2JA 2PR6A 4NXBA 1CI8A 2P04A 5E2HA 3R4KA 5CEDA 3O87A 1W63Q 1YLTA 4C6YA 3NY4A 4E6WA 3T1QB 4I5SA 5M1AA 2BLSA 3MMHA 3LIAA 4E3KA 1YLJA 2Y2QA 2PYPA 4CLCC 3IHAA 3FKVA 3IT9A 4GD8A 4OLGA 4ZAMA 3VFHA 2ZQAA 2W1TA 2XDMA 4P87A 5FI2A 1BULA 1ODVA 2VK3A 1V9YA 3Q1FA 2VV6A 2XA7M 1Z6FA 4I39A 1K55C 5DKLA 5FDHA 1PZOA 5L09A 3QP1A 1MWTA 5HAIA 4KZ8A 1VQQA 2WKHA 2XR0A 2PYRA 1LI0A 4WELA 5E2FA 1N9OA 3FWLA 1LI9A 1T1CA 3HLBA 3E4PA 3TE8A 2FZ0A 1YPRA 2OOLA 4X25A 4PKYA 3LO7A 4MN5A 2QMIA 2OAP1 3TSGA 4Q0HA 3LIEA 3GSGA 4YNRA 3BLSA 5GHXA 4WEKA 1TDGA 4R0QA 4K0WA 3S4XA 5EPHA 5FI6A 4LRXC 4RVAA 5M18A 3W4OA 3KSHA 3IBRA 3PAEA 3EGDC 2Y2NA 3H7WA 2NUPC 2WZXA 2PD7A 3IXHA 3RH8B 3Q07A 2B5RA 3A3EA 4HIAA 4MDZA 2JHEA 3GQZA 4R1GA 1NZUA 3UNWA 3FYZA 2B02A 2JKTM 3NCKA 3F1OB 3DW0A 3O88A 4ZRRA 2ZMFA 1CI9A 2ZM0A 3HUOA 4DDSA 1VEUB 2A24B 2VEAA 2Y79A 4S2NA 3L7HA 5HAPA 4FCFA 1I2SA 2HPBA 4EBNA 3ZDJA 5DTKA 3IX8A 4Y0TA 3BRMA 3M2JA 3PYPA 2WKRA 4S2LA 3HLDA 4KZ7A 5E2GA 4X69A 4PM7A 3W4PA 5TBMA 3C7VA 2QKPA 4OH0A 5HDSA 1L0DA 4K08A 3TW8A 5FAQA 4JXWA 2Y2GA 2H0TA 3PHYA 4MBHA 3UB6A 4H6JA
chains in the Genus database with same CATH topology
2W1RA 1KOUA 4R6LA 4F3LA 1F9IA 2NUTC 1S1YA 2ZOHA 1IFQA 5MC7A 4OOMA 1P97A 2G7UA 2J3WA 3S7QA 1DRMA 2ZMVA 3A0RA 3R7WA 3K3DA 4GW9A 3EGXC 4EEPA 3NJAA 2VV7A 4CLCA 1ZTUA 2PD8A 3RFBA 4HH3A 2GZAA 1GSVA 1UWNX 1T18A 1GSXA 3F1PA 2W3FA 2OAQ1 4IJGA 2K31A 4EEUA 4MN6A 2INWA 2VKSA 2W3HA 2O99A 2I9VA 2XROA 3UB9A 2YKFA 2PR5A 3BQAA 3OCLA 4XT2B 1STZA 3HJIA 3C8CA 1OTDA 3LR3A 4ETXA 1D06A 3EWKA 1JNUA 5HDDA 3BJNA 3UE6A 1OT9A 2H28A 4OOLA 3LIFA 1ZHHB 4ME4A 3KX0X 3IS2B 4LPZA 4LRYC 3KYZA 2P7JA 4HH2A 5F6AA 2J80A 3NOPC 2QHKA 2QJ7A 3A0SA 4I3JA 4HP4A 1DP9A 1LL8A 3KSGA 5HPFA 2PDRA 5HD3A 3V67A 3C38A 5G4YA 2Z6CA 4NXEA 3RTYA 5HSQA 4HNBA 3OLOA 2VLGA 4JGRA 3FPWA 3T4SA 2OWJA 4CLCE 4WL9A 1TS6A 3LI9A 2W3GA 4P6ZS 3VOLA 1T1AA 5DJTA 4AFIA 1DP8A 3B42A 4GLQA 1YSPA 5J4EA 2B18A 3CITA 4L9FA 2O9CA 4Y3IA 5IT5A 3P01A 5K5BA 4I3AA 4R38A 5HL6A 1TS7A 4Y5FA 3E4OA 4WUJA 4EUVA 5DFXA 2O9AA 3MFXA 4EU0A 1F98A 3P7NA 4O01A 3H7WB 1OTEA 1WA9A 5CX7A 2O0YA 3S7OA 1XJ2A 1F5MA 4MCWA 4NEED 3LI8A 2Y8HA 2YKHA 4UEYA 2HJEA 3LYXA 5J7EA 1W63M 3BY9A 4P6ZM 5AVFA 3F1NB 3SW1A 4WEJA 3KO6A 2XRNA 2V0UA 4HOIA 4G3WA 4NXGA 3CUEC 1T1BA 4WLAA 4BJPA 2M7VA 2JKRM 1D7EA 2GX5A 2J3TC 1S67L 5HD5A 4BBTA 5L8MA 1UGUA 2V1BA 4LLOB 2PT7A 2V1AA 4ARZA 5FL3A 3T4QA 3MQOA 3LIBA 5IS1A 2HF6A 5AJGA 3S7PA 2JN7A 1DP6A 1LSWA 3OOVA 3B33A 4QPRA 4GHIA 4GS9B 1S4SA 2JKRI 3HJKA 4EESA 2W1TB 3EEHA 3LR0A 1OTAA 3BY8A 3GDIA 5TBMB 3D72A 1P9RA 2CMNA 1N9LA 1OTBA 2QWSA 3A0VA 3JVUA 2KDKA 3H82A 3EQUA 3ULFA 4WF0A 5C5KA 5TJJA 3EOIA 1X0OA 3NOTC 5DFYA 2D02A 2M7UA 4H6JB 2IA2A 1YSQA 3MQQA 5F69A 1NLYA 1XFNA 2ZBBA 2W27A 3KSIA 4NKPA 1N9NA 3G6OA 3TRCA 1G6OA 3CUEA 3PBOA 3S7NA 4JGPA 4O8GA 4G3VA 2EA9A 3F1OA 3KYQA 3VE4A 1H8MA 1OPXA 3R7WB 3E98A 4YWZA 2M1CA 3O5YA 4IUHA 3T50A 1Y28A 4Y2FA 1VHMA 2A24A 2Z6DA 4I38A 4CLCB 1NLZA 1TD5A 3VV4A 1P9WA 2KX6A 4O0PA 2K7SA 2KOIA 3ICYA 1H3QA 3MR0A 2V0WA 1EW0A 3F1PB 4KQOA 2GJ3A 1V9ZA 2D01A 4RQ9A 4GCZA 2EWWA 1P0ZA 4L9EA 1S1ZA 2W0NA 1MKMA 1XJ6A 4M4XA 2QJ5A 2PR6A 5F5YA 4NXBA 4R3AA 1UWPX 5F68A 2P04A 4KUOA 5A8BA 3LR4A 3R4KA 3MF0A 1W63Q 1T19A 2WKQA 3C2WA 2V9AA 2ZOIA 3E0YA 2O9BA 1VB6A 4GJ4A 2W3EA 3H9WA 5DJUA 1LSXA 2VX8A 2QYBA 4I5SA 3D3OA 5I5LA 2VV8A 3TJZC 3MMHA 3UMDA 3LIAA 4BMWA 2PYPA 4CLCC 3FC7A 1OJ5A 2VJWA 3PBNA 4HHDA 3FPVA 2J3TD 3PBRA 4DN0A 4G3KA 4GS9A 4BBVA 4HJ4A 4DJ2A 2W1TA 4EQ1A 5AVEA 2XSSA 1ODVA 3K2NA 3LUQA 3FG8A 1YKDA 3EEAA 5DKKA 4Q0IA 1OTIA 1V9YA 2K2NA 4JGOA 2L0WA 2VV6A 2XA7M 3MXQA 4HI4A 4XT2A 3PR6A 4KQDA 4I39A 5KIZA 4UQIS 4PHTA 5HZHA 3UMEA 1S66L 4HJ6A 5DKLA 1XJ3A 2VGLS 3OCNA 5G4ZA 4MMNA 1TS8A 3PBQA 3IS2A 4CQHA 2PYRA 3B47A 4WELA 3UB8A 4BWIA 1N9OA 5EFWA 1T1CA 3BQ8A 4IUKA 4EETB 3E4PA 3TE8A 2KLIA 2FZ0A 3PXPA 4FSFA 3T4TA 4E04A 5LBRA 4F3LB 2HV1A 2OOLA 2L4RA 3W2ZA 4PKYA 3T4OA 5HDCA 4Q0JA 2L1MA 3PBTA 2WKPA 4L0LA 4HP9A 4MN5A 4ARZB 4UQIM 2GNXA 2OAP1 1MC0A 3HCYA 2LB5A 3MJQA 4Q0HA 4FOFA 3UB7A 1NWZA 4DMZA 2VGLM 3LIEA 5HWVA 1OJGA 2EWVA 3LFVA 4JGQA 4YNRA 4BBUA 4B9OA 4GHIB 4KUKA 3ZYTA 1OT6A 4WEKA 2VZWA 3OC2A 3K3CA 4LRXC 3KSFA 3H82B 2HGVA 3KSHA 3IBRA 3GECA 1LT0A 3BWLA 3C30A 3EGDC 3H7WA 1YAXA 2R78A 2NUPC 3CWFA 5HPIA 3U2AA 3EQVA 2PD7A 5HWTA 1S4RA 5HWWA 4PAUA 4R70A 1XFQA 4IHQA 3OBFA 3RH8B 4HY8A 4HIAA 4MDZA 2JHEA 4ETZA 3F1NA 4II7A 3LR5A 4WN5A 2B02A 2JKTM 3PBSA 3F1OB 4ZRRA 3DBAA 3CI6A 4YOFA 4Z1WA 1TF1A 3JVVA 2ZMFA 1MZUA 4I3IA 3MQ0A 4CLCD 2A24B 4L9GA 2VEAA 2Y79A 4LRZE 2DMWA 3LIDA 2A2LA 4EERA 2XA7S 3BW6A 2MJ6A 3T4JA 2BASA 4PKYG 1BYWA 2JKTI 4EW7A 4DJ3A 3PYPA 2WKRA 3NHQA 3LICA 3E4QA 4HQAA 1GSWA 5J3WA 2HJ9C 4B93A 3NOUC 2OWHA 2P08A 2FH5A 5DF9A 1NRJA 3T4LA 2VA0A 3ZQ5A 3T4KA 1IOUA 5TBMA 2PHYA 4EXOA 4HJ3A 2LB9A 3CLOA 2QKPA 1XJ4A 3CAXA 5HDSA 3VE3A 1G28A 4NXFA 4MN7A 4K08A 3TW8A 3IBJA 3UE3A 1TS0A 5KSHA 2W3DA 3PHYA 3UB6A 4H6JA 5IU1A 1LSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W1R A;  4RQ9 A;  4R6L A;  4Q0J A;  4EU0 A;  4O01 A;  2O0Y A;  3S7O A;  1F5M A;  4MCW A;  2G7U A;  2Y8H A;  1MC0 A;  3HCY A;  2LB5 A;  4Q0H A;  4FOF A;  3S7Q A;  4DMZ A;  1MKM A;  3LFV A;  4GW9 A;  4YNR A;  3KO6 A;  2XRN A;  1ZTU A;  2VZW A;  3R4K A;  3MF0 A;  4G3W A;  4LRX C;  3RFB A;  3C2W A;  3KSF A;  3E0Y A;  2O9B A;  2M7V A;  2W3E A;  2W3F A;  2HGV A;  2GX5 A;  3IBR A;  3KSH A;  2QYB A;  4IJG A;  3D3O A;  5I5L A;  2K31 A;  5L8M A;  5HPI A;  2VKS A;  2W3H A;  2O99 A;  3MMH A;  2XRO A;  4PAU A;  4R70 A;  3OBF A;  5AJG A;  1STZ A;  3S7P A;  2VJW A;  4ETX A;  3OOV A;  4MDZ A;  3BJN A;  4QPR A;  4ETZ A;  4DN0 A;  4G3K A;  2W1T B;  4ME4 A;  4ZRR A;  3DBA A;  3CI6 A;  4YOF A;  4Z1W A;  1TF1 A;  2ZMF A;  4LRY C;  2W1T A;  2XSS A;  3MQ0 A;  3NOP C;  3K2N A;  2VEA A;  2Y79 A;  1YKD A;  3EEA A;  4LRZ E;  4Q0I A;  5C5K A;  5TJJ A;  2K2N A;  3KSG A;  5HPF A;  3NOT C;  5DFY A;  2M7U A;  2IA2 A;  1YSQ A;  5HSQ A;  3NHQ A;  3KSI A;  3G6O A;  3TRC A;  3S7N A;  4O8G A;  3NOU C;  4G3V A;  2W3G A;  4MMN A;  3ZQ5 A;  4CQH A;  3E98 A;  4GLQ A;  1YSP A;  3O5Y A;  2B18 A;  4BWI A;  4IUH A;  3CIT A;  2LB9 A;  4Y2F A;  2O9C A;  1VHM A;  4Y3I A;  5K5B A;  1TD5 A;  3VV4 A;  4IUK A;  4MN7 A;  5HL6 A;  4O0P A;  2KOI A;  4Y5F A;  3IBJ A;  2KLI A;  4E04 A;  2W3D A;  5LBR A;  2OOL A;  3W2Z A;  4EUV A;  5DFX A;  2O9A A; 
#chains in the Genus database with same CATH topology
 2XQZ A;  2QPN A;  1S1Y A;  2DRW A;  3MZF A;  5TFQ A;  5MC7 A;  5FI7 A;  1P97 A;  2G7U A;  3SH9 A;  4E3N A;  4E3L A;  2ZMV A;  3A0R A;  3R7W A;  4K91 A;  4S2K A;  1K57 A;  4Z9Q A;  5EV0 A;  2OLV A;  4CLC A;  4LFU A;  4IVK A;  2ZC6 B;  1UWN X;  3A3I A;  1CEG A;  4GOG A;  2INW A;  3W8K A;  3HJI A;  2PBY A;  3ZGA B;  3C5A A;  3IH8 A;  3EWK A;  4FUW A;  3MXR A;  1FSY A;  1K55 A;  4LPZ A;  3KYZ A;  4B88 A;  2P7J A;  3NEC A;  1IKI A;  3OPP A;  4GZB A;  3A0S A;  4I3J A;  1DP9 A;  1LL8 A;  3KSG A;  1ERQ A;  3DTK A;  1XKZ A;  4LGW A;  5A90 A;  5G4Y A;  2Z6C A;  3RTY A;  3HRE A;  3JPU A;  5FQM A;  2WAF A;  1XA7 A;  5EVE A;  3T4S A;  5JYP A;  1IEL A;  4X1M A;  3B42 A;  4GLQ A;  5J4E A;  4BD1 A;  2B18 A;  3CIT A;  1KVL A;  4OOY A;  5EVI A;  1K6R A;  3G35 A;  1ONG A;  5HW3 A;  4I3A A;  1TS7 A;  4Y5F A;  4RA7 A;  2ZJ9 A;  4S2O A;  2E8I A;  1BZA A;  4WUJ A;  3H7W B;  1WA9 A;  2O0Y A;  1FIL A;  3S7O A;  3BFC A;  1XJ2 A;  3I7J A;  3LI8 A;  3N7W A;  4OQH A;  3O86 A;  2HDS A;  2PU4 A;  3KO6 A;  3ZG0 A;  1ES3 A;  2UWX A;  4R3B A;  3G4P A;  1YLP A;  3D4F A;  1H8Z A;  3Q81 A;  3T12 B;  4YIN A;  4WMC D;  3HUN A;  1S67 L;  5HD5 A;  1XXM A;  1L0E A;  4Q8I A;  1DJC A;  4ARZ A;  1PFL A;  3LIB A;  1FSW A;  2HF6 A;  3S7P A;  2Y2M A;  2JN7 A;  1DP6 A;  2JKG A;  1LSW A;  2Y4A A;  4GHI A;  2JKR I;  4EES A;  3BLM A;  3IQA A;  3EEH A;  5M19 A;  3LR0 A;  5TBM B;  3D72 A;  1N9L A;  3PAG A;  3H82 A;  4PPR A;  1XP4 A;  3EQU A;  4R3J A;  5CRF A;  1HTZ A;  2HP6 A;  1MWS A;  5A93 A;  1X0O A;  4GN2 A;  1L0G A;  4H6J B;  2IA2 A;  1YSQ A;  3DWZ A;  2HZ5 A;  4E3O A;  3G32 A;  1XFN A;  2ZBB A;  2W27 A;  5FAO A;  1N9N A;  3G6O A;  3PBO A;  4S2P A;  4G3V A;  2EA9 A;  1H8M A;  1OPX A;  3R7W B;  3B3X A;  4HEF A;  3T50 A;  1AWI A;  4D2O A;  1FQG A;  1KDS A;  4KZA A;  1YLY A;  4CLC B;  1GA9 A;  3OPR A;  1IKG A;  2KOI A;  5FQK A;  4QWO A;  4N9K A;  2X01 A;  1IEM A;  4JXS A;  2V0W A;  4KQO A;  3QP6 A;  4C3Q A;  3UDX A;  5I94 A;  4L9E A;  1IYS A;  4X68 A;  2ZQD A;  1XA1 A;  4LCL A;  1MKM A;  1XJ6 A;  1PIO A;  2RL3 A;  4KZ3 A;  5F68 A;  5EE8 A;  3HVF A;  3SS5 A;  2ZM2 A;  1T19 A;  3GMW A;  4PMA A;  1LL5 A;  4WM9 A;  4U0T A;  5DVA A;  4CPK A;  2W3E A;  3H9W A;  2JKF A;  1MWR A;  4JF5 A;  1J3W A;  2XH9 A;  5I5L A;  2VV8 A;  3FV7 A;  3A3D A;  1K25 A;  3M6B A;  1A0K A;  3IH9 A;  4QHC A;  4GDB A;  5F83 A;  4G3K A;  4GS9 A;  4BBV A;  5CTN A;  3UE0 A;  1K38 A;  2XSS A;  1BTL A;  1RGZ A;  4OPR A;  3LUQ A;  1OTI A;  3WWX A;  4QY5 A;  4E3M A;  3Q7V A;  4HI4 A;  4XT2 A;  5KIZ A;  5L2F A;  4UQI S;  4PHT A;  4DF6 A;  2I72 A;  3VP0 A;  5CEC A;  4GD6 A;  1S66 L;  2Y2I A;  3VOZ A;  4MMN A;  5AQ7 A;  3V50 A;  4HBU A;  1KE0 A;  5F82 A;  4BWI A;  1W8Q A;  3ZFZ A;  1K4E A;  5EFW A;  2PRF A;  5TGF A;  2IWC A;  2BTF P;  3NUL A;  4FSF A;  3PXP A;  5LBR A;  5CHM A;  2L4R A;  3T4O A;  3IWQ A;  1GHP A;  3PBT A;  2WKP A;  4L0L A;  4HP9 A;  4ARZ B;  1GHM A;  4UQI M;  2ZM8 A;  3VFF A;  1MC0 A;  2LB5 A;  4FOF A;  1NWZ A;  2ZC5 B;  3NC8 A;  2WKE A;  1BLP A;  1HLU P;  3T1S A;  2EWV A;  5U47 A;  5TR7 A;  4BBU A;  4GHI B;  3UB5 P;  4KUK A;  4NK3 A;  1SDE A;  1OT6 A;  1XX2 A;  3OC2 A;  2V8C A;  1XGI A;  3H82 B;  2XK1 A;  2HGV A;  1LT0 A;  2Y2K A;  3BWL A;  1WE4 A;  1M40 A;  1TVF A;  1YAX A;  5HPI A;  5GLC A;  4LV0 A;  4PAU A;  2Q0O A;  4R70 A;  3G34 A;  3OBF A;  2ZC3 B;  4HY8 A;  1PWG A;  2OV5 A;  1RGY A;  1ERM A;  4ETZ A;  4OQI A;  1NYM A;  4JF6 A;  3DBA A;  2OLU A;  3JVV A;  1K0K A;  3S1Y A;  5J8X A;  4N92 A;  4LRZ E;  2XA7 S;  2MJ6 A;  1K57 C;  1KGE A;  3WRZ A;  4PKY G;  5AQA A;  1NY0 A;  2JKT I;  3N6I A;  4DJ3 A;  3IXG A;  1ZG4 A;  4KG6 A;  3E4Q A;  5J3W A;  4Y0U A;  1U60 A;  5CGX A;  2FH5 A;  1W8Y A;  1IOU A;  4X56 A;  3CLO A;  1XJ4 A;  4IED A;  2ZL1 A;  2WAD A;  1G28 A;  2RCX A;  4NXF A;  4MN7 A;  3IBJ A;  5FQ9 A;  5CTM A;  2W3D A;  2Q9N A;  1KOU A;  4F3L A;  4EBP A;  2EFX A;  2NUT C;  1H5X A;  2ZC4 B;  3S7Q A;  4JXG A;  5GL9 A;  5KSC A;  4K0X A;  3ZNY A;  2VV7 A;  3MZE A;  3D9Y A;  2GZA A;  3ZG5 A;  4ZTK A;  5F1F A;  1GSX A;  2V8F A;  2W3F A;  3SS4 A;  2K31 A;  4LV3 A;  4EEU A;  2W3H A;  4IVI A;  4KZB A;  2FFF B;  5EVI C;  2Z2L B;  2V2F F;  3Q7V B;  4XT2 B;  3DTE A;  4S2I A;  4FH2 A;  3LIF A;  3V5M A;  4BL2 A;  2J80 A;  4E3J A;  2J8Y A;  2Y55 A;  5EM0 A;  5CER A;  4HP4 A;  3UN7 A;  3W4Q A;  4EBL A;  1ZC2 A;  4WZ4 A;  4NXE A;  1YM1 A;  4HNB A;  4XXR A;  1J9M A;  2WGW A;  4UA9 A;  1NRF A;  2OWJ A;  2Y2J A;  4UAA A;  2W3G A;  1ZKJ A;  5CXW A;  2EX2 A;  1T1A A;  5DJT A;  2O9C A;  4Y3I A;  5K5B A;  1BSG A;  1SKO A;  4X53 A;  3E4O A;  4EUV A;  5DFX A;  2O9A A;  1JWZ A;  2P9V A;  3IXB A;  3P7N A;  4MEZ A;  4MCW A;  4ZBE A;  2YKH A;  3VP2 A;  2EX6 A;  3BY9 A;  3VP4 A;  3OPH A;  1SZV A;  3E2L A;  3IX4 A;  5EUA A;  3SW1 A;  1H0M A;  2ZC7 A;  1FR6 A;  4WEJ A;  3CMZ A;  2V20 A;  3G31 A;  2V0U A;  1G5U A;  1T1B A;  3ISG A;  4BJP A;  2IWD A;  1NYY A;  1D7E A;  2GX5 A;  5A92 A;  2ZD8 A;  4O7D A;  4BBT A;  4LLO B;  2V1A A;  5FL3 A;  3T4Q A;  3MQO A;  4XUZ A;  5IS1 A;  3HLF A;  3U4L P;  2WYX A;  3OOV A;  4FD8 A;  4MNR A;  1DJB A;  3QNB A;  4QPR A;  1S4S A;  4R4R A;  4X6T A;  4BEN A;  3HJK A;  4DXC A;  2W1T B;  3GDI A;  3DTI A;  3MSH A;  2KDK A;  2ZL1 B;  5C5K A;  5TJJ A;  3ZG7 B;  1L3L A;  2XF3 A;  3NOT C;  5DFY A;  2M7U A;  2PU2 A;  5D3O A;  3HL9 A;  3C4O A;  1NLY A;  4NKP A;  3ZG8 B;  3S7N A;  3IF5 A;  4JGP A;  4OKP A;  3N8S A;  3E98 A;  2M1C A;  2A3U A;  4KG5 A;  2EXB A;  3O5Y A;  1IYO A;  1Y28 A;  4BD0 A;  1CK3 A;  1VHM A;  5FQJ A;  1TD5 A;  2EFU A;  3ICY A;  3MR0 A;  3NIA A;  1EW0 A;  2WGV A;  1PRQ A;  2GJ3 A;  4RQ9 A;  4GCZ A;  1P0Z A;  1KE3 A;  3ITA A;  1S1Z A;  3CHW P;  4R23 A;  2W0N A;  1VM1 A;  3ZG9 B;  4A5R A;  2QJ5 A;  4KG2 A;  4R3A A;  1UWP X;  4ID4 A;  1KDW A;  5A8B A;  3LR4 A;  3ZCZ A;  3C2W A;  1G6A A;  2V9A A;  2ZOI A;  2O9B A;  1N9B A;  3G30 A;  2QYB A;  4XUX A;  1NJ4 A;  1XPB A;  3D3O A;  4B4Z A;  3QP8 A;  3UMD A;  5IHV A;  4UHU A;  1FR1 A;  2EX9 A;  2WGW B;  3QP4 A;  2JCH A;  3FPV A;  2J3T D;  3PBR A;  4DN0 A;  3AGF A;  4BL3 A;  4DJ2 A;  5FQI A;  5HAQ A;  2V1Z A;  5AVE A;  1BLC A;  3AGE A;  3QNC A;  4OQG A;  3FG8 A;  2ZLY A;  1YKD A;  3EEA A;  1SKO B;  3G2Y A;  5DKK A;  1W79 A;  4JGO A;  4GDN A;  2R9X A;  3MFD A;  1L2S A;  4DKI A;  3MXS A;  5L10 A;  3NDG A;  3PR6 A;  1L0F A;  4GNU A;  4HJ6 A;  1XJ3 A;  5G4Z A;  1CQA A;  5DTT A;  4CQH A;  3B47 A;  1WYB A;  5CHU A;  3UB8 A;  3GV9 A;  5HFO A;  3BEC A;  3PTE A;  5F1G A;  2JC7 A;  4E04 A;  2KLI A;  2ZMA A;  3W2Z A;  4OON A;  5HDC A;  3FZC A;  4Q0J A;  2L1M A;  4IBR A;  1QME A;  1KGG A;  2GNX A;  1BUE A;  5HL1 A;  3HCY A;  3MJQ A;  4LCM A;  4DMZ A;  1FOF A;  2BG1 A;  1OJG A;  4PM9 A;  3LFV A;  1PYY A;  4JGQ A;  5EOE A;  4B9O A;  3ZYT A;  4UA6 A;  4QY6 A;  2VZW A;  3P98 A;  3AGD A;  3C7U A;  4U3T A;  3KSF A;  1Q2Q A;  1MBL A;  3GEC A;  3C30 A;  2R9W A;  4EUZ A;  4GB7 A;  1ESU A;  1ONH A;  3A3J A;  2VGK A;  3CWF A;  3C4P A;  3ZNT A;  3EQV A;  1S4R A;  5HWW A;  1XFQ A;  2HDU A;  1IYQ A;  3GTC A;  3F1N A;  3LR5 A;  4Y7P A;  3WS1 A;  4N1H A;  4YOF A;  1TF1 A;  5FEG A;  1MZU A;  4I3I A;  1YT4 A;  3MQ0 A;  3SS3 A;  4CLC D;  3SH7 A;  4L9G A;  4JPM A;  1CF0 A;  2DMW A;  3LID A;  1E25 A;  1E4D A;  2Y2P A;  1HD8 A;  5GHY A;  2ZQ7 A;  4EW7 A;  1AXB A;  1ZG6 A;  5AQ9 A;  4RX2 A;  2HJ9 C;  4B93 A;  1GA0 A;  2HP9 A;  4ZJ3 A;  3ZHH A;  3T4L A;  2PHY A;  5EVI B;  4EXO A;  4HJ3 A;  3UDI A;  1MKI A;  1TS0 A;  3E2K A;  4MBF A;  4C75 A;  4R6L A;  4DE1 A;  1FCO A;  1PWD A;  2C5W B;  5FEF A;  2ZOH A;  1IFQ A;  4N1X A;  4OOM A;  2ZQ8 A;  1DRM A;  4X1L A;  2WKI A;  4EEP A;  1S0W A;  1PI5 A;  1ZTU A;  3BEB A;  1K54 C;  1QMF A;  2PD8 A;  1LL9 A;  1T18 A;  3F1P A;  3OPL A;  2C6W B;  2OAQ 1;  4HES A;  3QP2 A;  4IJG A;  3M2K A;  1KGF A;  2VKS A;  2O99 A;  2I9V A;  3UB9 A;  3V39 A;  2PR5 A;  3BQA A;  3FKW A;  3OCL A;  4DDY A;  1STZ A;  3C8C A;  2J9O A;  1D06 A;  3BJN A;  3IF6 C;  3UE6 A;  4KZ9 A;  1OT9 A;  2H28 A;  1PW8 A;  4IBX A;  1ZHH B;  5DF7 A;  4LRY C;  4R4S A;  4LEN A;  5A91 A;  4DRT A;  4HH2 A;  4OPZ A;  5F6A A;  5G18 A;  2QJ7 A;  2DNS A;  3UPO A;  3M6H A;  5HPF A;  2XLN A;  1EI5 A;  3C38 A;  1HVB A;  3LEZ A;  2Z2M B;  5FSR A;  2ZQ9 A;  1O7E A;  4M3K A;  1E3U D;  3FPW A;  4RYE A;  2Y2L A;  4WL9 A;  1TS6 A;  4P6Z S;  3VOL A;  1JWP A;  1DP8 A;  1S6R A;  1YSP A;  4L9F A;  3HLE A;  5IT5 A;  2JBF A;  3TOI A;  5HL6 A;  1SHV A;  2UV0 E;  3QHY A;  4BLM A;  3MKF A;  1F98 A;  1PW1 A;  1OTE A;  4EQI A;  1F5M A;  2GDN A;  4YFM A;  2HJE A;  3P09 A;  3MS6 A;  1C3B A;  4OP8 A;  4P6Z M;  3BFD A;  1JTG A;  3F1N B;  2X02 A;  5FAP A;  1K4F A;  2HDR A;  3HUM A;  5E43 A;  2H0Y A;  4NXG A;  4F94 A;  5EOO A;  3IWI A;  3WS4 A;  3UO9 A;  5BOH A;  3BFE A;  4OPY A;  1ESI A;  5L8M A;  1UGU A;  2V1B A;  2PT7 A;  3BYD A;  3SH8 A;  1BLS A;  4QU3 A;  1F2K A;  3ZVW A;  3DTM A;  4KZ4 A;  3B33 A;  1G68 A;  4GS9 B;  3LY3 A;  2Y2O A;  4P85 A;  1OTA A;  4JKT A;  2XD5 A;  1P9R A;  1OTB A;  2QWS A;  3JVU A;  1SCW A;  4WF0 A;  1Z09 A;  4BQM A;  5CGS A;  3EOI A;  3RXX A;  3ITB A;  2D02 A;  1I5Q A;  3MQQ A;  1IYP A;  2DCF A;  4JBF A;  3RJU A;  3KSI A;  1G6O A;  3CUE A;  1XGJ A;  3KYQ A;  3VE4 A;  4WBG A;  4ZJ1 A;  3NI9 A;  4YWZ A;  3V3S A;  1WYC A;  1W5D A;  2Y2H A;  2J7V A;  1NLZ A;  1P9W A;  2KX6 A;  4WMC A;  3Q7Z A;  4ZDX A;  1SKF A;  3CG5 A;  5GLD A;  3GR2 A;  2HP5 A;  3F1P B;  1V9Z A;  1K54 A;  2D01 A;  4B4X A;  5GLA A;  2WGI A;  3UDF A;  3V3R A;  1D1J A;  2PAV P;  4X55 A;  5F5Y A;  4KUO A;  5GHZ A;  5FDS A;  3MF0 A;  3MBZ A;  2WKQ A;  3IF6 A;  1VET A;  3E0Y A;  1VB6 A;  4GJ4 A;  5DJU A;  1LSX A;  2VX8 A;  3TJZ C;  1Y4O A;  4WYY A;  3N8R A;  3G2Z A;  1GHI A;  1EWZ A;  4BMW A;  3FC7 A;  1OJ5 A;  2VJW A;  1JWV A;  4NG2 A;  2VGJ A;  3HLW A;  3PBN A;  4WZ5 A;  3BFG A;  2XFS A;  4HHD A;  4HJ4 A;  3GVB A;  5FAT A;  5EVL A;  4EQ1 A;  3LCE A;  1RCJ A;  3K2N A;  3IX3 A;  1K56 D;  3UE1 A;  3ZVT A;  4Q0I A;  2K2N A;  1H8Y A;  3WS2 A;  2L0W A;  1KVM A;  3CJM A;  3MXQ A;  4KQD A;  2OSU A;  3JYI A;  3SOI A;  2WUQ A;  5HZH A;  3UME A;  5CEB A;  1YQS A;  2VGL S;  3OCN A;  5L07 A;  1TS8 A;  3PBQ A;  3IS2 A;  2IWB A;  4P0M A;  1ALQ A;  3NBL A;  3SZT A;  4DE2 A;  3BQ8 A;  4IUK A;  5EM1 A;  4EET B;  1FIK A;  3T4T A;  2Y59 A;  3WS0 A;  4F3L B;  2HV1 A;  3Q82 A;  4LV2 A;  3A3F A;  3CPT A;  3UB7 A;  2JE5 A;  1PZP A;  2VGL M;  2A49 A;  5HWV A;  5DF8 A;  1YLZ A;  4MBK A;  4S2M A;  4DXB A;  4JLF A;  3K3C A;  1PWC A;  2Q9M A;  1BT5 A;  3L9K A;  4U0X A;  1LHY A;  1I2W A;  2R78 A;  2XEP A;  3U2A A;  5HWT A;  1OME A;  3S22 A;  4CJN A;  2QZ6 A;  3VP3 A;  4IHQ A;  3IWO A;  3HLG A;  1O07 A;  4II7 A;  4WN5 A;  5FA7 A;  3PBS A;  4UA7 A;  4H8R A;  4E3I A;  3GRJ A;  5HAR A;  2XGN A;  4Z1W A;  3CI6 A;  4QD4 A;  4FH4 A;  1MWU A;  1GCE A;  3LEQ A;  2A2L A;  4EER A;  3BW6 A;  4LV1 A;  3T4J A;  3BM6 A;  1PNE A;  2BAS A;  3WRT A;  5CHJ A;  4HBT A;  1BYW A;  3WS5 A;  3NHQ A;  1YMX A;  3LIC A;  4HQA A;  3VOY A;  1GSW A;  4OPQ A;  3NOU C;  2OWH A;  2P08 A;  5DF9 A;  1NRJ A;  2VA0 A;  3ZQ5 A;  3T4K A;  3TG9 A;  2LB9 A;  3CAX A;  3VE3 A;  3T1R A;  4D60 A;  4NET A;  3UE3 A;  5HX9 A;  5KSH A;  3IF6 B;  1VET B;  5CGW A;  2P9V B;  5IU1 A;  1LSV A;  2W1R A;  3VSK A;  3IXD A;  1F9I A;  4FTX A;  2J3W A;  1E3U A;  4OQ0 A;  1LLB A;  3IHB A;  3K3D A;  1SDN A;  4GW9 A;  3EGX C;  4PM5 A;  1ES5 A;  1N4O A;  2EX8 A;  3NJA A;  3DWK A;  3RFB A;  3UPN A;  4HH3 A;  1GSV A;  1RP5 A;  4DE0 A;  2CC1 A;  1DY6 A;  1CJF A;  3VMA A;  1K6S A;  4MN6 A;  4EV4 A;  2X71 A;  2XRO A;  2YKF A;  3UY6 A;  3HBR A;  2J9P A;  1OTD A;  3LR3 A;  4ETX A;  1JNU A;  5HDD A;  4OOL A;  3NDE A;  4ME4 A;  3KX0 X;  3IS2 B;  1YMS A;  2E8J A;  3HLC A;  3NOP C;  2QHK A;  4GKU A;  4PM6 A;  1MY8 A;  4Y0O A;  2PDR A;  5HD3 A;  4QB8 A;  3MZD A;  3V67 A;  4ESP A;  5HSQ A;  5AQB A;  4P6B A;  3OZH A;  3OLO A;  2XD1 A;  2AVX A;  1FCN A;  1ERO A;  2VLG A;  3CPT B;  4JGR A;  2WZZ A;  3T1X A;  4CLC E;  3LI9 A;  3QP5 A;  5FQQ A;  4AFI A;  4RX3 A;  5EEC A;  3P01 A;  4OLD A;  1ES2 A;  5GLB A;  4R38 A;  4EWF A;  3UPP A;  2G2U A;  1FCM A;  2ZQC A;  1Q2P A;  2P74 A;  3MFX A;  2WK0 A;  4EU0 A;  4Y17 A;  4O01 A;  5CX7 A;  4KEN B;  3VP1 A;  3LGO A;  5E2E A;  4DE3 A;  4OVD A;  4NEE D;  2Y8H A;  1JTD A;  4UEY A;  3RXW A;  5DTS A;  3LYX A;  1NZO A;  5J7E A;  1W63 M;  5KZH A;  5AVF A;  2WAE A;  3DAV A;  4N9L A;  3KYE A;  1PI4 A;  2XRN A;  1ES4 A;  4HOI A;  4G3W A;  3BFF A;  3CUE C;  4WLA A;  2FFY A;  2M7V A;  1Y54 A;  2JKR M;  1YLW A;  2J3T C;  1W7F A;  2Y91 A;  5KMW A;  3MKE A;  4E6X A;  1HZO A;  5AJG A;  1M6K A;  4JXV A;  4JF4 A;  4KZ6 A;  1JVJ A;  4PM8 A;  1MXO A;  2H10 A;  3BY8 A;  5EVI D;  2CMN A;  3A0V A;  1NXY A;  4KQR A;  1BLH A;  4Y15 A;  3ULF A;  2ACG A;  4MLL A;  5JYO A;  4KZ5 A;  5FAS A;  1TDL A;  2H5S A;  4KQQ A;  1DJA A;  5F69 A;  2PBD P;  4OP5 A;  4QJG A;  3TRC A;  4O8G A;  3LY4 A;  1KE4 A;  3N4I A;  3F1O A;  4S2N C;  3CZD A;  4IUH A;  4Y2F A;  4Y13 A;  1VEU A;  2A24 A;  2Z6D A;  4I38 A;  3VSL A;  2B95 A;  3VV4 A;  4O0P A;  2K7S A;  4WZ5 C;  1TEM A;  1K56 A;  1H3Q A;  3O3V A;  2XFT A;  1CEF A;  2G2W A;  2EWW A;  1MPL A;  4ZJ2 A;  2EXA A;  3N8L A;  1ACF A;  4M4X A;  2HDQ A;  4S2J A;  2PR6 A;  4NXB A;  1CI8 A;  2P04 A;  5E2H A;  3R4K A;  5CED A;  3O87 A;  1W63 Q;  1YLT A;  4C6Y A;  3NY4 A;  4E6W A;  3T1Q B;  4I5S A;  5M1A A;  2BLS A;  3MMH A;  3LIA A;  4E3K A;  1YLJ A;  2Y2Q A;  2PYP A;  4CLC C;  3IHA A;  3FKV A;  3IT9 A;  4GD8 A;  4OLG A;  4ZAM A;  3VFH A;  2ZQA A;  2W1T A;  2XDM A;  4P87 A;  5FI2 A;  1BUL A;  1ODV A;  2VK3 A;  1V9Y A;  3Q1F A;  2VV6 A;  2XA7 M;  1Z6F A;  4I39 A;  1K55 C;  5DKL A;  5FDH A;  1PZO A;  5L09 A;  3QP1 A;  1MWT A;  5HAI A;  4KZ8 A;  1VQQ A;  2WKH A;  2XR0 A;  2PYR A;  1LI0 A;  4WEL A;  5E2F A;  1N9O A;  3FWL A;  1LI9 A;  1T1C A;  3HLB A;  3E4P A;  3TE8 A;  2FZ0 A;  1YPR A;  2OOL A;  4X25 A;  4PKY A;  3LO7 A;  4MN5 A;  2QMI A;  2OAP 1;  3TSG A;  4Q0H A;  3LIE A;  3GSG A;  4YNR A;  3BLS A;  5GHX A;  4WEK A;  1TDG A;  4R0Q A;  4K0W A;  3S4X A;  5EPH A;  5FI6 A;  4LRX C;  4RVA A;  5M18 A;  3W4O A;  3KSH A;  3IBR A;  3PAE A;  3EGD C;  2Y2N A;  3H7W A;  2NUP C;  2WZX A;  2PD7 A;  3IXH A;  3RH8 B;  3Q07 A;  2B5R A;  3A3E A;  4HIA A;  4MDZ A;  2JHE A;  3GQZ A;  4R1G A;  1NZU A;  3UNW A;  3FYZ A;  2B02 A;  2JKT M;  3NCK A;  3F1O B;  3DW0 A;  3O88 A;  4ZRR A;  2ZMF A;  1CI9 A;  2ZM0 A;  3HUO A;  4DDS A;  1VEU B;  2A24 B;  2VEA A;  2Y79 A;  4S2N A;  3L7H A;  5HAP A;  4FCF A;  1I2S A;  2HPB A;  4EBN A;  3ZDJ A;  5DTK A;  3IX8 A;  4Y0T A;  3BRM A;  3M2J A;  3PYP A;  2WKR A;  4S2L A;  3HLD A;  4KZ7 A;  5E2G A;  4X69 A;  4PM7 A;  3W4P A;  5TBM A;  3C7V A;  2QKP A;  4OH0 A;  5HDS A;  1L0D A;  4K08 A;  3TW8 A;  5FAQ A;  4JXW A;  2Y2G A;  2H0T A;  3PHY A;  4MBH A;  3UB6 A;  4H6J A; 
#chains in the Genus database with same CATH homology
 2W1R A;  1KOU A;  4R6L A;  4F3L A;  1F9I A;  2NUT C;  1S1Y A;  2ZOH A;  1IFQ A;  5MC7 A;  4OOM A;  1P97 A;  2G7U A;  2J3W A;  3S7Q A;  1DRM A;  2ZMV A;  3A0R A;  3R7W A;  3K3D A;  4GW9 A;  3EGX C;  4EEP A;  3NJA A;  2VV7 A;  4CLC A;  1ZTU A;  2PD8 A;  3RFB A;  4HH3 A;  2GZA A;  1GSV A;  1UWN X;  1T18 A;  1GSX A;  3F1P A;  2W3F A;  2OAQ 1;  4IJG A;  2K31 A;  4EEU A;  4MN6 A;  2INW A;  2VKS A;  2W3H A;  2O99 A;  2I9V A;  2XRO A;  3UB9 A;  2YKF A;  2PR5 A;  3BQA A;  3OCL A;  4XT2 B;  1STZ A;  3HJI A;  3C8C A;  1OTD A;  3LR3 A;  4ETX A;  1D06 A;  3EWK A;  1JNU A;  5HDD A;  3BJN A;  3UE6 A;  1OT9 A;  2H28 A;  4OOL A;  3LIF A;  1ZHH B;  4ME4 A;  3KX0 X;  3IS2 B;  4LPZ A;  4LRY C;  3KYZ A;  2P7J A;  4HH2 A;  5F6A A;  2J80 A;  3NOP C;  2QHK A;  2QJ7 A;  3A0S A;  4I3J A;  4HP4 A;  1DP9 A;  1LL8 A;  3KSG A;  5HPF A;  2PDR A;  5HD3 A;  3V67 A;  3C38 A;  5G4Y A;  2Z6C A;  4NXE A;  3RTY A;  5HSQ A;  4HNB A;  3OLO A;  2VLG A;  4JGR A;  3FPW A;  3T4S A;  2OWJ A;  4CLC E;  4WL9 A;  1TS6 A;  3LI9 A;  2W3G A;  4P6Z S;  3VOL A;  1T1A A;  5DJT A;  4AFI A;  1DP8 A;  3B42 A;  4GLQ A;  1YSP A;  5J4E A;  2B18 A;  3CIT A;  4L9F A;  2O9C A;  4Y3I A;  5IT5 A;  3P01 A;  5K5B A;  4I3A A;  4R38 A;  5HL6 A;  1TS7 A;  4Y5F A;  3E4O A;  4WUJ A;  4EUV A;  5DFX A;  2O9A A;  3MFX A;  4EU0 A;  1F98 A;  3P7N A;  4O01 A;  3H7W B;  1OTE A;  1WA9 A;  5CX7 A;  2O0Y A;  3S7O A;  1XJ2 A;  1F5M A;  4MCW A;  4NEE D;  3LI8 A;  2Y8H A;  2YKH A;  4UEY A;  2HJE A;  3LYX A;  5J7E A;  1W63 M;  3BY9 A;  4P6Z M;  5AVF A;  3F1N B;  3SW1 A;  4WEJ A;  3KO6 A;  2XRN A;  2V0U A;  4HOI A;  4G3W A;  4NXG A;  3CUE C;  1T1B A;  4WLA A;  4BJP A;  2M7V A;  2JKR M;  1D7E A;  2GX5 A;  2J3T C;  1S67 L;  5HD5 A;  4BBT A;  5L8M A;  1UGU A;  2V1B A;  4LLO B;  2PT7 A;  2V1A A;  4ARZ A;  5FL3 A;  3T4Q A;  3MQO A;  3LIB A;  5IS1 A;  2HF6 A;  5AJG A;  3S7P A;  2JN7 A;  1DP6 A;  1LSW A;  3OOV A;  3B33 A;  4QPR A;  4GHI A;  4GS9 B;  1S4S A;  2JKR I;  3HJK A;  4EES A;  2W1T B;  3EEH A;  3LR0 A;  1OTA A;  3BY8 A;  3GDI A;  5TBM B;  3D72 A;  1P9R A;  2CMN A;  1N9L A;  1OTB A;  2QWS A;  3A0V A;  3JVU A;  2KDK A;  3H82 A;  3EQU A;  3ULF A;  4WF0 A;  5C5K A;  5TJJ A;  3EOI A;  1X0O A;  3NOT C;  5DFY A;  2D02 A;  2M7U A;  4H6J B;  2IA2 A;  1YSQ A;  3MQQ A;  5F69 A;  1NLY A;  1XFN A;  2ZBB A;  2W27 A;  3KSI A;  4NKP A;  1N9N A;  3G6O A;  3TRC A;  1G6O A;  3CUE A;  3PBO A;  3S7N A;  4JGP A;  4O8G A;  4G3V A;  2EA9 A;  3F1O A;  3KYQ A;  3VE4 A;  1H8M A;  1OPX A;  3R7W B;  3E98 A;  4YWZ A;  2M1C A;  3O5Y A;  4IUH A;  3T50 A;  1Y28 A;  4Y2F A;  1VHM A;  2A24 A;  2Z6D A;  4I38 A;  4CLC B;  1NLZ A;  1TD5 A;  3VV4 A;  1P9W A;  2KX6 A;  4O0P A;  2K7S A;  2KOI A;  3ICY A;  1H3Q A;  3MR0 A;  2V0W A;  1EW0 A;  3F1P B;  4KQO A;  2GJ3 A;  1V9Z A;  2D01 A;  4RQ9 A;  4GCZ A;  2EWW A;  1P0Z A;  4L9E A;  1S1Z A;  2W0N A;  1MKM A;  1XJ6 A;  4M4X A;  2QJ5 A;  2PR6 A;  5F5Y A;  4NXB A;  4R3A A;  1UWP X;  5F68 A;  2P04 A;  4KUO A;  5A8B A;  3LR4 A;  3R4K A;  3MF0 A;  1W63 Q;  1T19 A;  2WKQ A;  3C2W A;  2V9A A;  2ZOI A;  3E0Y A;  2O9B A;  1VB6 A;  4GJ4 A;  2W3E A;  3H9W A;  5DJU A;  1LSX A;  2VX8 A;  2QYB A;  4I5S A;  3D3O A;  5I5L A;  2VV8 A;  3TJZ C;  3MMH A;  3UMD A;  3LIA A;  4BMW A;  2PYP A;  4CLC C;  3FC7 A;  1OJ5 A;  2VJW A;  3PBN A;  4HHD A;  3FPV A;  2J3T D;  3PBR A;  4DN0 A;  4G3K A;  4GS9 A;  4BBV A;  4HJ4 A;  4DJ2 A;  2W1T A;  4EQ1 A;  5AVE A;  2XSS A;  1ODV A;  3K2N A;  3LUQ A;  3FG8 A;  1YKD A;  3EEA A;  5DKK A;  4Q0I A;  1OTI A;  1V9Y A;  2K2N A;  4JGO A;  2L0W A;  2VV6 A;  2XA7 M;  3MXQ A;  4HI4 A;  4XT2 A;  3PR6 A;  4KQD A;  4I39 A;  5KIZ A;  4UQI S;  4PHT A;  5HZH A;  3UME A;  1S66 L;  4HJ6 A;  5DKL A;  1XJ3 A;  2VGL S;  3OCN A;  5G4Z A;  4MMN A;  1TS8 A;  3PBQ A;  3IS2 A;  4CQH A;  2PYR A;  3B47 A;  4WEL A;  3UB8 A;  4BWI A;  1N9O A;  5EFW A;  1T1C A;  3BQ8 A;  4IUK A;  4EET B;  3E4P A;  3TE8 A;  2KLI A;  2FZ0 A;  3PXP A;  4FSF A;  3T4T A;  4E04 A;  5LBR A;  4F3L B;  2HV1 A;  2OOL A;  2L4R A;  3W2Z A;  4PKY A;  3T4O A;  5HDC A;  4Q0J A;  2L1M A;  3PBT A;  2WKP A;  4L0L A;  4HP9 A;  4MN5 A;  4ARZ B;  4UQI M;  2GNX A;  2OAP 1;  1MC0 A;  3HCY A;  2LB5 A;  3MJQ A;  4Q0H A;  4FOF A;  3UB7 A;  1NWZ A;  4DMZ A;  2VGL M;  3LIE A;  5HWV A;  1OJG A;  2EWV A;  3LFV A;  4JGQ A;  4YNR A;  4BBU A;  4B9O A;  4GHI B;  4KUK A;  3ZYT A;  1OT6 A;  4WEK A;  2VZW A;  3OC2 A;  3K3C A;  4LRX C;  3KSF A;  3H82 B;  2HGV A;  3KSH A;  3IBR A;  3GEC A;  1LT0 A;  3BWL A;  3C30 A;  3EGD C;  3H7W A;  1YAX A;  2R78 A;  2NUP C;  3CWF A;  5HPI A;  3U2A A;  3EQV A;  2PD7 A;  5HWT A;  1S4R A;  5HWW A;  4PAU A;  4R70 A;  1XFQ A;  4IHQ A;  3OBF A;  3RH8 B;  4HY8 A;  4HIA A;  4MDZ A;  2JHE A;  4ETZ A;  3F1N A;  4II7 A;  3LR5 A;  4WN5 A;  2B02 A;  2JKT M;  3PBS A;  3F1O B;  4ZRR A;  3DBA A;  3CI6 A;  4YOF A;  4Z1W A;  1TF1 A;  3JVV A;  2ZMF A;  1MZU A;  4I3I A;  3MQ0 A;  4CLC D;  2A24 B;  4L9G A;  2VEA A;  2Y79 A;  4LRZ E;  2DMW A;  3LID A;  2A2L A;  4EER A;  2XA7 S;  3BW6 A;  2MJ6 A;  3T4J A;  2BAS A;  4PKY G;  1BYW A;  2JKT I;  4EW7 A;  4DJ3 A;  3PYP A;  2WKR A;  3NHQ A;  3LIC A;  3E4Q A;  4HQA A;  1GSW A;  5J3W A;  2HJ9 C;  4B93 A;  3NOU C;  2OWH A;  2P08 A;  2FH5 A;  5DF9 A;  1NRJ A;  3T4L A;  2VA0 A;  3ZQ5 A;  3T4K A;  1IOU A;  5TBM A;  2PHY A;  4EXO A;  4HJ3 A;  2LB9 A;  3CLO A;  2QKP A;  1XJ4 A;  3CAX A;  5HDS A;  3VE3 A;  1G28 A;  4NXF A;  4MN7 A;  4K08 A;  3TW8 A;  3IBJ A;  3UE3 A;  1TS0 A;  5KSH A;  2W3D A;  3PHY A;  3UB6 A;  4H6J A;  5IU1 A;  1LSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...