3CITA

Crystal structure of the gaf domain of a putative sensor histidine kinase from pseudomonas syringae pv. tomato
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
155
Chain Sequence
b'NAYRQSQSRAARLRLLVDTGQELIQLPPEAMRKCVLQRACAFVAMDHGLLLEWGNGVQTTARHGSKERLSTLETTADPLAIGPQWLERPGTHLPCVLLLPLRGADEGSFGTLVLANSVAISAPDGEDIESLQLLATLLAAHLENNRLLEALVARD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase
publication title Crystal structure of the GAF domain of a putative sensor histidine kinase from Pseudomonas syringae pv. tomato
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Transferase
total genus 46
structure length 155
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3citA00
2IA2A 1ZTUA 2K31A 4MN7A 3CI6A 5HSQA 4MCWA 3CITA 1TF1A 3R4KA 3S7PA 3OBFA 4LRZE 3C2WA 3DBAA 3MF0A 4QPRA 3EEAA 3S7OA 2XRNA 4RQ9A 3NOTC 4EU0A 2B18A 4Y3IA 2W3GA 3BJNA 3G6OA 2VEAA 3OOVA 4ZRRA 4O01A 3IBRA 4Q0HA 3IBJA 3O5YA 4FOFA 4PAUA 3KO6A 3MMHA 3W2ZA 3VV4A 2Y8HA 4E04A 1F5MA 3HCYA 4Z1WA 2KOIA 4CQHA 5HL6A 2W1TB 5C5KA 4GW9A 3KSIA 4G3VA 4IUKA 4G3WA 2W3EA 4EUVA 1YSQA 5DFXA 2VKSA 2ZMFA 5HPFA 2K2NA 2M7UA 4IUHA 2QYBA 3S7QA 4Q0JA 3KSFA 4R70A 4LRXC 4YNRA 1STZA 3KSGA 3D3OA 3KSHA 5HPIA 2HGVA 3LFVA 2GX5A 1MKMA 4GLQA 2Y79A 4O0PA 4Q0IA 5L8MA 2VZWA 4Y5FA 5TJJA 2VJWA 1MC0A 4YOFA 4BWIA 4DMZA 3K2NA 3TRCA 2OOLA 2O99A 5AJGA 3E98A 4ETXA 4MDZA 2KLIA 4LRYC 5I5LA 2O0YA 3NHQA 3RFBA 2O9BA 4Y2FA 4MMNA 3E0YA 5DFYA 3NOUC 1TD5A 2W3DA 3ZQ5A 2W1TA 1YKDA 4O8GA 2O9AA 3S7NA 2W3HA 2W3FA 2M7VA 3NOPC 1VHMA 4ETZA 5K5BA 2G7UA 4G3KA 1YSPA 2LB5A 4ME4A 2XROA 2LB9A 4DN0A 4IJGA 2W1RA 2O9CA 4R6LA 2XSSA 5LBRA 3MQ0A
chains in the Genus database with same CATH superfamily
3MZDA 3MFXA 4X6TA 2EXAA 3S7PA 1K0KA 3DBAA 1NXYA 1SHVA 3GMWA 3NBLA 1O7EA 3BRMA 4LV0A 5FA7A 4OQIA 1OTEA 5DVAA 5KZHA 1ZG4A 3PR6A 3CUEA 1HLUP 4GW9A 1XGIA 1PW8A 2EWWA 3ZNTA 4B9OA 2JKTM 4CLCA 1OJGA 1E25A 2M7UA 5CHUA 1K38A 2P9VA 4WMCA 1KE4A 5FAOA 3ZNYA 1MBLA 1TDLA 4QWOA 3SH8A 2ZLYA 3A3FA 4OP5A 4X1MA 5AVFA 4HH3A 3T1RA 2XGNA 4ZJ3A 4LV2A 3E0YA 1M6KA 4LV1A 2R9WA 3KX0X 1LI0A 3VFFA 3KYZA 1LL8A 1X0OA 1HD8A 3NC8A 4XUZA 1TS7A 2FFFB 1SDNA 2Y2KA 3Q7VB 1OPXA 3F1NA 3OCNA 1W79A 1NZUA 2PU2A 1K56A 3H82B 5FDHA 2XR0A 4R4RA 5DF7A 3M2KA 4GD6A 3T4KA 2X01A 5CTMA 5GL9A 3MF0A 3PTEA 3MQQA 3HREA 2VLGA 4NKPA 3OOVA 3O5YA 4FUWA 5G4ZA 3TOIA 3VV4A 2DRWA 1OTBA 1FCNA 1P9WA 1YLJA 2E8IA 4OVDA 4IEDA 1FSWA 4G3WA 4BD1A 4X53A 3PBNA 2Y2LA 1D06A 5AQ9A 3D72A 3MJQA 3CZDA 3ZVTA 3LY3A 5M1AA 3OPRA 4MLLA 3SZTA 3LIFA 2BLSA 4NXGA 3G31A 4UQIM 1BZAA 4Q8IA 3LEZA 3GQZA 5GLAA 3EQUA 1K57A 2H5SA 2XEPA 4YOFA 2PD8A 2UWXA 5FAPA 4B4XA 5AJGA 5CRFA 3P01A 1PFLA 3IXHA 4WEJA 3FV7A 2ZQ9A 4OLDA 1NYMA 1BSGA 3HLFA 1XGJA 3GRJA 2PDRA 5J7EA 1CF0A 3Q07A 3Q7ZA 2Y2MA 3E4OA 3TW8A 1YLWA 3NOPC 1S6RA 2Y2OA 4X69A 1OMEA 4S2IA 2LB9A 1G6OA 2ZL1A 5FQMA 2XSSA 4UA7A 3H7WA 4DF6A 3C30A 3U4LP 1CEGA 4E3OA 2VA0A 3DWZA 1NWZA 1DP8A 4KZAA 3VFHA 3DWKA 5J3WA 1TF1A 4MBFA 3WS2A 2A24A 2WKEA 3IF6B 5FASA 4R3JA 3S1YA 4EU0A 2KX6A 2W3GA 3ICYA 1L0EA 2QZ6A 3BQ8A 4K0WA 1YLTA 1T1AA 4KQRA 4O01A 1K6SA 1GA9A 4FOFA 4P87A 5DF9A 5HL6A 1VETB 1VEUA 3MKEA 3CUEC 1LLBA 2FZ0A 1ERMA 4K0XA 4DE2A 2RCXA 5EV0A 4R70A 3R7WA 1L2SA 2I9VA 4HESA 4CLCC 2L4RA 3LR5A 5E2EA 3UB7A 3ZG9B 2ZM8A 3EGXC 2HGVA 1MY8A 1MKMA 4I39A 2Y79A 3B47A 2ZOIA 2HPBA 4Y5FA 4F3LB 1FOFA 2V8CA 4WF0A 3MBZA 1K6RA 1FILA 1K4FA 4Y0TA 3G32A 1W63M 3OPLA 3RFBA 2L0WA 3LGOA 4QU3A 4R23A 1Q2QA 3RXWA 2XK1A 2HZ5A 1TS8A 5KSCA 3UPPA 3UE6A 4F94A 1FR6A 4WEKA 4GD8A 2JN7A 5DTTA 1Y4OA 2ZOHA 2MJ6A 1SZVA 3MS6A 2L1MA 3UDIA 4IJGA 3HJKA 1CQAA 2Y59A 2WKRA 5F83A 1N9BA 3FZCA 4NK3A 4PHTA 4L9FA 5F1GA 3OZHA 3SW1A 1VQQA 1XKZA 4NXBA 2VEAA 1XJ3A 4R4SA 5F5YA 1I2SA 2HDRA 2JKGA 4OQGA 3BFCA 5GLDA 2X02A 3PBOA 1F9IA 3VMAA 1BT5A 3W8KA 3KSIA 3ZG7B 2FH5A 2VV8A 1KGEA 4WELA 3OPHA 3TJZC 2YKHA 4MN5A 3QNBA 3CAXA 3WRZA 3DTEA 1XFQA 1TEMA 1TS0A 3UPOA 1U60A 5KIZA 4JGOA 3TRCA 3G4PA 3V67A 3UDFA 2KLIA 4KZ3A 1C3BA 4OPRA 1K57C 3QP4A 3PHYA 3CWFA 3IXDA 3N8LA 3HUMA 3FWLA 2EX2A 1N9OA 3LO7A 2HF6A 1H8ZA 4MN6A 3HLEA 4ETZA 4ID4A 2G7UA 4DDYA 3KYEA 4N9LA 2IWDA 1LSWA 4QHCA 4N9KA 4KZ8A 5CGWA 2IA2A 4MN7A 1RGYA 3FC7A 2JKRI 2J9OA 4Z9QA 3UB9A 3PAEA 1LL5A 1Y28A 2WUQA 5TBMB 1FR1A 2K7SA 5GHYA 3E2KA 4E3IA 3WS5A 5F82A 1ZG6A 4PPRA 3QNCA 2A3UA 1EI5A 2WAFA 4JGRA 1K25A 3CG5A 4PAUA 4LFUA 4E04A 3NDEA 3L7HA 1LT0A 2RL3A 4EBLA 1N9NA 1IKGA 2ZMFA 4EBPA 4HHDA 5KMWA 1GSWA 4IUHA 2WK0A 3VP0A 4UQIS 5EECA 3IT9A 1MKIA 2PR5A 4S2MA 1F2KA 4OQHA 4OH0A 4PM8A 3UNWA 5AQ7A 1G6AA 2PU4A 1G28A 1CK3A 4OQ0A 2V0UA 3SOIA 4OOMA 2HP9A 1ESUA 4D2OA 3B42A 4MBKA 3O88A 4ZDXA 5GLBA 5EOEA 4MMNA 2WGVA 4EBNA 3NI9A 2VV6A 2Y2IA 4CJNA 4DE1A 4DXCA 2A2LA 2W3DA 2PAVP 4S2LA 1PZOA 2W3HA 1BUEA 1GHPA 3OLOA 4IHQA 3BECA 3UMEA 3ZCZA 1CEFA 3F1PA 2PBYA 2WKHA 3VOZA 3ZGAB 4OP8A 5FDSA 2P9VB 2H0YA 1BULA 1H3QA 5HW3A 1W8YA 5HSQA 5JYPA 3G35A 4DJ2A 4LRZE 4EWFA 3S7OA 1W5DA 2EX8A 1E3UA 3G30A 4S2JA 2J3TC 4EETB 3N4IA 1ZC2A 4KZ9A 2J3WA 2CMNA 5FQ9A 2V1AA 5U47A 3LICA 5FI6A 2JKTI 3LI9A 1E3UD 4LGWA 2Y91A 5E2GA 1T1BA 2VKSA 3IWOA 1K56D 2K2NA 1L0FA 4P6BA 1WE4A 2JBFA 1IYPA 3EQVA 4P85A 3IHBA 3HBRA 3HLWA 1GA0A 3JYIA 4E3KA 4NG2A 2B5RA 4ARZA 4GHIA 5F69A 3RTYA 4GB7A 4ZJ2A 3NJAA 4WL9A 3Q1FA 1LSXA 3BFFA 4KQDA 3MR0A 3GVBA 4FH4A 4Y2FA 3T50A 4JXWA 2EX6A 1MZUA 4ZAMA 5DFYA 4CLCD 3DW0A 2HJ9C 1HTZA 1SDEA 4DXBA 2BG1A 4WMCD 2XROA 2J7VA 3MZFA 1OT9A 4N1HA 1IKIA 4HJ6A 2XD1A 4UEYA 4R6LA 3M6BA 2OWJA 3BYDA 3NIAA 5EM0A 2ZC7A 3FPWA 1DRMA 1O07A 3R4KA 3ITBA 3OBFA 3C2WA 3IS2A 3PBTA 1D7EA 4GDNA 4UHUA 3HUNA 4RX2A 4WZ5A 2WKQA 3JVVA 5CHJA 1IEMA 4Q0HA 1PYYA 2Y4AA 3NULA 1EROA 1H8MA 3IXGA 4PM9A 4OKPA 5FEGA 3T1XA 4C6YA 1HZOA 3V5MA 3SH7A 1ACFA 4NEED 4GCZA 4HI4A 5HZHA 4K91A 3N7WA 5HFOA 4WM9A 4CPKA 3WS4A 3LR3A 3B3XA 1K4EA 4EQIA 3HLCA 3IX4A 4IVIA 1MC0A 2Z6DA 2O99A 3AGEA 4MDZA 3G2ZA 4EXOA 1YLPA 1MWUA 5MC7A 4OPQA 2D02A 4KZ5A 3PBSA 4EESA 4U3TA 1TDGA 3TG9A 1G5UA 5CEBA 1VEUB 1XX2A 4PM6A 4ME4A 2E8JA 5AQBA 2HV1A 1W7FA 2W1RA 1GSVA 3R7WB 3UY6A 5DF8A 4NXFA 2DNSA 5DTKA 3QP1A 2J80A 3CITA 3PYPA 4QB8A 4KQQA 3JVUA 4LCMA 3EWKA 4X56A 4HY8A 4Y0OA 3Q7VA 2P04A 3T4TA 3QHYA 5HAQA 4DE0A 3EGDC 4KG2A 5A93A 2VV7A 2ZC4B 3VP2A 4HEFA 2Y8HA 1F5MA 2QJ5A 2Y55A 4XT2A 4X68A 4B88A 1HVBA 5C5KA 4I3JA 3UB6A 2QJ7A 3N8SA 1L0DA 3CJMA 1ALQA 4EERA 3S7QA 4R38A 1G68A 5E43A 4HJ4A 4YNRA 4B4ZA 1ES3A 2WKPA 4DDSA 1STZA 1PWDA 2ZQ7A 1GHMA 2C5WB 3WRTA 5A92A 1DJBA 2OOLA 4ETXA 3ZG5A 4JF6A 4WBGA 2Y2GA 4HQAA 4E6WA 3Q82A 4EUZA 5EFWA 5TFQA 3T4LA 4OOYA 1OTAA 4OONA 2W3FA 3ZG0A 2M7VA 4BL3A 4KZ4A 3CMZA 5CX7A 1GSXA 1MXOA 3ZDJA 1RP5A 2Y2HA 2JHEA 3BFGA 3MFDA 2V1ZA 4OLGA 1JTDA 1H5XA 2YKFA 2V0WA 1PWCA 5EVIA 3UE1A 4GS9A 4MCWA 5EPHA 1S1YA 2Z2MB 4FH2A 2JC7A 1PRQA 2R9XA 4LENA 4E6XA 3P7NA 3NOTC 3IX8A 2XDMA 5E2FA 3V39A 5EVID 4PKYG 3G6OA 3BFDA 3IBJA 1K55A 4WZ5C 3V3SA 3MQOA 1BTLA 1PI4A 4R3AA 4IUKA 3DTKA 2P7JA 5KSHA 2PYPA 3WWXA 5L2FA 3M6HA 4LRXC 3QP6A 2J3TD 1Z6FA 2H0TA 2B95A 3GECA 4KG6A 4GLQA 1OTIA 2J8YA 1VETA 4E3LA 5TJJA 1IFQA 1LL9A 3F1OB 3DTMA 4E3MA 3IH9A 4BWIA 3E4PA 2ZQ8A 3T4QA 2O0YA 2JKFA 5HAIA 1BLSA 5EE8A 2I72A 3T4JA 3HJIA 1KGGA 2XFSA 2H10A 1NZOA 5HWWA 3NOUC 1SKOA 3GSGA 3QP2A 4AFIA 4XUXA 4G3KA 2WGWB 1NLZA 3W4QA 4KUKA 2EFXA 4DRTA 3S4XA 1ESIA 5DKKA 3GR2A 2XLNA 4KZBA 1VM1A 2DMWA 1JWPA 3CI6A 3VOLA 4BBTA 4UAAA 3A3EA 3IX3A 4FSFA 5HWVA 3V50A 4QPRA 5FQKA 5EM1A 5FQJA 2V1BA 2ZQAA 3VE4A 4CLCE 4FD8A 1UGUA 2J9PA 2GDNA 2Y2NA 3IF5A 3W4PA 5M19A 4QJGA 1XJ2A 4LV3A 1AWIA 3T12B 4OPZA 1OJ5A 3DTIA 3F1PB 1H8YA 3SH9A 4JPMA 3UB5P 5BOHA 1T19A 3TE8A 3D3OA 4JXGA 5HPIA 4HBTA 1XA7A 4O0PA 1NRJA 5GHZA 5L8MA 2M1CA 2WKIA 5EVEA 4GOGA 4IVKA 2Z2LB 3IXBA 1K54A 3W4OA 3N6IA 2O9BA 4GNUA 4BD0A 4BQMA 1ERQA 2W27A 4DE3A 3O87A 3D9YA 1TD5A 4QY6A 2HDQA 1XP4A 2W1TA 3ISGA 4BBVA 3HL9A 1NY0A 5HD3A 5HAPA 1YSPA 2LB5A 2ZJ9A 3EEHA 4JGQA 4LPZA 1S66L 2O9CA 3C5AA 1DJAA 4R3BA 2OLUA 1EWZA 4JGPA 1BLCA 4JBFA 2JCHA 1I5QA 1N9LA 4ARZB 2V20A 5EVIC 1S67L 4S2PA 4CLCB 3BFEA 4H6JA 1JTGA 1XJ6A 3T1SA 5L10A 3SS3A 3A3IA 4S2NA 3MMHA 3FKWA 4GJ4A 3K3CA 4BJPA 3LIDA 1K55C 2KOIA 4CQHA 5G18A 4BLMA 2GZAA 1D1JA 5TBMA 5DFXA 3VP3A 3C7VA 2WGIA 4FCFA 3JPUA 3KSFA 3UN7A 2ZC3B 1XPBA 4R1GA 3WS1A 4C3QA 4PM5A 5IU1A 3IS2B 4L9GA 2NUPC 4X55A 4LRYC 5FATA 2OAP1 3F1NB 2EWVA 2XA7S 3ULFA 2B02A 4JLFA 3A0RA 1JWVA 1DP6A 2V8FA 3CPTA 1SCWA 2QWSA 3RXXA 2Q9MA 5FEFA 4O8GA 4PM7A 3BY9A 1I2WA 5AQAA 3ITAA 3MKFA 1S0WA 4DN0A 3LIAA 2OAQ1 4Y13A 3MQ0A 4GN2A 2P08A 1LSVA 1XJ4A 2ZQCA 4RYEA 3C8CA 2Q0OA 2ZBBA 1QMEA 2C6WB 3BY8A 3LR0A 3LCEA 1P9RA 2Q9NA 1A0KA 4ZRRA 3IBRA 2OLVA 1SKFA 2ACGA 1V9ZA 3S22A 3ZVWA 3BEBA 3BW6A 1GCEA 1L0GA 3K3DA 4JF5A 1QMFA 5CECA 1LHYA 4Z1WA 2ZMVA 2GNXA 2A49A 1V9YA 1EW0A 1BLHA 2X71A 3MZEA 4EUVA 3P09A 3UE0A 2ZC6B 4S2KA 4Q0JA 5F6AA 2NUTC 4LCLA 3NY4A 4HIAA 5IHVA 1KGFA 3AGFA 5CEDA 1IYOA 3A0VA 5HDCA 5DJUA 4WZ4A 2HDUA 4JXVA 5FAQA 3FYZA 2VZWA 4LLOB 2OV5A 2VJWA 3VP4A 4EQ1A 3K2NA 2P74A 3D4FA 4R0QA 3IWIA 2HP6A 3SS4A 1DJCA 3OPPA 3UE3A 3IWQA 2ZL1B 3T1QB 2ZD8A 1PNEA 1K54C 3H7WB 4P6ZM 1ONGA 2GJ3A 2INWA 4I3AA 1TS6A 5IS1A 5EUAA 1FSYA 1YKDA 3LUQA 4XT2B 2O9AA 4Y0UA 2A24B 1VHMA 1UWPX 2QMIA 5DKLA 1ES2A 4U0XA 1XA1A 3UDXA 1TVFA 1NLYA 2ZQDA 3GDIA 4UA9A 4P0MA 1M40A 2K31A 2ZM0A 3I7JA 4HOIA 2PBDP 3VSKA 5TGFA 1F98A 2Y2JA 1CJFA 5G4YA 1Z09A 1P97A 3EEAA 4IBRA 5DJTA 3LIBA 3LI8A 4QD4A 2V9AA 2VK3A 3BLSA 2HP5A 4MEZA 3L9KA 4QY5A 2XD5A 3QP8A 5EVLA 1PWGA 1XFNA 2R78A 3G34A 1YPRA 2CC1A 3KYQA 4S2NC 1T1CA 3LY4A 2W3EA 1YSQA 2QPNA 3ZHHA 2D01A 2QYBA 3C4OA 1N4OA 2VGKA 5JYOA 3H82A 3NECA 1GHIA 3VP1A 3A3DA 3KSHA 1MPLA 2GX5A 3C4PA 3HVFA 5EVIB 4GS9B 4S2OA 3EOIA 3OC2A 2VGLM 4D60A 4EEUA 3FPVA 3MSHA 4ZBEA 1P0ZA 5DTSA 4DMZA 2EXBA 3E98A 2H28A 4GKUA 3M2JA 5HWTA 2QHKA 1E4DA 5A90A 3O3VA 1BLPA 2PD7A 2WZZA 1YMSA 4HJ3A 5FL3A 2VX8A 2HDSA 2V2FF 2W0NA 4A5RA 4Y17A 3LYXA 2QKPA 4BBUA 2EA9A 4X1LA 3OCLA 3VSLA 2XA7M 3HLGA 5EOOA 1KDWA 4HP4A 1VB6A 4Y15A 3T4SA 2AVXA 1T18A 2PHYA 2Y2PA 4Y3IA 5CTNA 3BJNA 4N1XA 2IWCA 1NYYA 1XXMA 5GHXA 2WADA 5HARA 1H0MA 3N8RA 1KE0A 4HNBA 3TSGA 5L07A 3QP5A 1SKOB 4RA7A 4OPYA 2FFYA 4KENB 1FCMA 5HPFA 2BASA 1IOUA 5FSRA 5CGXA 4YFMA 2BTFP 2WZXA 3BQAA 2XH9A 5CGSA 3FKVA 3CHWP 4MNRA 5A8BA 1S4SA 3V3RA 1KE3A 4JKTA 3B33A 4XXRA 1KDSA 1YLZA 5CERA 4NXEA 4U0TA 2EX9A 3IF6A 2PRFA 3ZG8B 1PIOA 3AGDA 3VOYA 4NETA 4DKIA 1FCOA 2VGJA 3VE3A 5J8XA 4RVAA 2HJEA 3E4QA 1KOUA 3HUOA 2G2WA 1YQSA 1KVMA 1BYWA 1ZKJA 5IT5A 4BL2A 4M3KA 4I5SA 3S7NA 1WA9A 3MXQA 5D3OA 5K5BA 1S4RA 2ZC5B 4I3IA 2WAEA 4WYYA 5F68A 1RGZA 5M18A 2PT7A 5CXWA 1JVJA 4WN5A 2KDKA 2ZM2A 2Y2QA 5FQIA 3ZFZA 3Q81A 5CHMA 4ESPA 1ZTUA 3BM6A 3E2LA 4E3JA 1PI5A 1OT6A 4YWZA 3C7UA 4F3LA 4E3NA 1JWZA 3IHAA 4RQ9A 4GDBA 4JXSA 2XF3A 1YM1A 2B18A 3GV9A 3RH8B 1ONHA 3MXRA 3RJUA 4EEPA 4C75A 5I94A 3PBRA 2XQZA 1FQGA 3CLOA 3W2ZA 4PKYA 4EW7A 4WLAA 3HCYA 2W1TB 1ZHHB 1MWSA 5HX9A 1J3WA 2G2UA 4BENA 4M4XA 2UV0E 1MWRA 4DJ3A 1IYSA 4FTXA 3O86A 4PMAA 5HDSA 2XFTA 5L09A 5AVEA 4II7A 3A0SA 3LFVA 3PBQA 4K08A 3PXPA 4GZBA 5A91A 2OSUA 3IQAA 4UA6A 3MXSA 4RX3A 1W63Q 1ES4A 3BWLA 1NRFA 1WYBA 5J4EA 2ZMAA 4KZ7A 4H6JB 1OTDA 5I5LA 4KQOA 1KVLA 4P6ZS 1MWTA 3P98A 3LR4A 5HL1A 1S1ZA 1LI9A 3ZQ5A 4HH2A 4EV4A 3F1OA 3H9WA 4KUOA 3LIEA 1UWNX 4I38A 5F1FA 4KG5A 5LBRA 3U2AA 4O7DA 1YT4A 3FG8A 3WS0A 1CI9A 3HLDA 3DAVA 3T4OA 5HDDA 4N92A 1AXBA 2XRNA 4L0LA 1WYCA 2WGWA 3PAGA 5TR7A 1ODVA 2JE5A 2JKRM 2PR6A 3ZYTA 2OWHA 3UO9A 2WYXA 4OOLA 1CI8A 3A3JA 3KO6A 4B93A 3LEQA 3HLBA 4H8RA 3CPTB 1PZPA 1Q2PA 5FI7A 3UPNA 3UB8A 4G3VA 4GHIB 3NCKA 2PYRA 4HBUA 1IELA 1NJ4A 1DY6A 4YINA 4MBHA 5FI2A 4KZ6A 1L3LA 2Z6CA 3SS5A 4WUJA 1YMXA 4L9EA 5HD5A 1IYQA 2VGLS 3KSGA 4ZTKA 1YLYA 4IBXA 1RCJA 4Q0IA 2IWBA 4X25A 3GTCA 1Y54A 3BLMA 3IF6C 3UMDA 5E2HA 4HP9A 3NHQA 4ZJ1A 1FIKA 2DCFA 4BMWA 2EFUA 3C38A 1ES5A 1DP9A 3G2YA 1PW1A 3IH8A 1YAXA 3NDGA 1J9MA 1W8QA 5FQQA 5GLCA 4JF4A 4Y7PA 1JNUA
chains in the Genus database with same CATH topology
3MFXA 2IA2A 2K31A 2YKFA 2V0WA 4MN7A 4HOIA 4GS9A 4MCWA 1F98A 3FC7A 1S1YA 2JKRI 3S7PA 5G4YA 3DBAA 3UB9A 3P7NA 1P97A 3EEAA 1Y28A 3NOTC 5DJTA 3LIBA 3LI8A 5TBMB 2K7SA 2V9AA 4PKYG 3G6OA 3IBJA 1OTEA 4JGRA 4PAUA 3MQOA 3PR6A 4E04A 3CUEA 1XFNA 2R78A 1LT0A 3KYQA 4GW9A 4R3AA 1T1CA 4IUKA 1N9NA 2EWWA 2W3EA 1YSQA 4B9OA 2JKTM 2ZMFA 4CLCA 4HHDA 1OJGA 1GSWA 2M7UA 2D01A 2P7JA 2QYBA 4IUHA 5KSHA 2PYPA 4LRXC 3H82A 4UQIS 2PR5A 2J3TD 3KSHA 2GX5A 3GECA 4GLQA 4GS9B 1OTIA 3EOIA 3OC2A 2VGLM 4EEUA 3FPVA 5TJJA 1G28A 1IFQA 2V0UA 3F1OB 1P0ZA 4BWIA 5AVFA 3E4PA 4OOMA 4DMZA 4HH3A 3E98A 2H28A 3B42A 5HWTA 3T4QA 2O0YA 2QHKA 3T4JA 4MMNA 3E0YA 3HJIA 3KX0X 2VV6A 5HWWA 3NOUC 2PD7A 2A2LA 2W3DA 3KYZA 4HJ3A 1LL8A 5FL3A 1X0OA 2W3HA 2VX8A 3OLOA 4AFIA 4IHQA 1TS7A 3UMEA 4G3KA 3F1PA 2W0NA 1NLZA 1OPXA 3F1NA 3OCNA 4KUKA 3LYXA 2QKPA 4BBUA 3H82B 2EA9A 5DKKA 3OCLA 1H3QA 2DMWA 3CI6A 5HSQA 3VOLA 4BBTA 2XA7M 4FSFA 5HWVA 3T4KA 4DJ2A 4HP4A 4LRZE 1VB6A 3MF0A 4QPRA 3T4SA 3S7OA 3MQQA 1T18A 2PHYA 2V1BA 4Y3IA 2VLGA 3VE4A 3BJNA 4NKPA 2J3TC 4EETB 3OOVA 4CLCE 3O5YA 1UGUA 2J3WA 2CMNA 2V1AA 3LICA 4HNBA 5G4ZA 3VV4A 2JKTI 3LI9A 1OTBA 1P9WA 1XJ2A 4G3WA 3PBNA 1T1BA 2VKSA 1D06A 3D72A 5HPFA 3MJQA 1OJ5A 3F1PB 2K2NA 2BASA 1IOUA 3BQAA 3EQVA 5A8BA 1S4SA 3LIFA 1T19A 3TE8A 3D3OA 5HPIA 4NXGA 4UQIM 3B33A 4O0PA 4ARZA 1NRJA 4NXEA 4GHIA 5F69A 5L8MA 3EQUA 2M1CA 3RTYA 4YOFA 2PD8A 3NJAA 5AJGA 3P01A 4WL9A 1LSXA 4WEJA 4KQDA 3MR0A 3VE3A 2O9BA 2HJEA 4Y2FA 3T50A 3E4QA 1KOUA 1MZUA 2W27A 5DFYA 1TD5A 2PDRA 1BYWA 5J7EA 5IT5A 4CLCD 2W1TA 2HJ9C 3E4OA 4I5SA 3S7NA 3TW8A 4BBVA 3NOPC 1WA9A 3MXQA 5HD3A 5K5BA 1S4RA 1YSPA 2LB5A 3EEHA 4I3IA 4JGQA 2XROA 5F68A 2LB9A 2PT7A 1OT9A 1G6OA 4HJ6A 4LPZA 4WN5A 1S66L 4UEYA 2O9CA 2KDKA 4R6LA 2OWJA 2XSSA 3H7WA 1ZTUA 3C30A 2VA0A 3FPWA 1DRMA 1NWZA 1DP8A 4JGPA 5J3WA 1OT6A 4YWZA 1TF1A 1N9LA 4ARZB 4F3LA 3R4KA 3OBFA 2A24A 3C2WA 3IS2A 3PBTA 1D7EA 1S67L 4RQ9A 4EU0A 2B18A 2KX6A 2W3GA 3ICYA 3RH8B 2WKQA 4CLCB 4H6JA 3JVVA 3BQ8A 1XJ6A 4EEPA 1T1AA 3PBRA 4O01A 4Q0HA 3CLOA 4FOFA 3MMHA 3W2ZA 4PKYA 4EW7A 4GJ4A 4WLAA 3K3CA 3HCYA 4BJPA 3LIDA 2KOIA 5DF9A 4CQHA 5HL6A 2W1TB 1ZHHB 1H8MA 2GZAA 3CUEC 2FZ0A 4M4XA 5TBMA 5DFXA 4DJ3A 4NEED 4GCZA 4HI4A 5HZHA 3KSFA 4R70A 3R7WA 5HDSA 2I9VA 4CLCC 2L4RA 3LR5A 3UB7A 5AVEA 3EGXC 4II7A 2HGVA 3LR3A 3A0SA 3LFVA 3PBQA 1MKMA 4K08A 4I39A 2Y79A 3B47A 3PXPA 2ZOIA 4Y5FA 4F3LB 5IU1A 4WF0A 3IS2B 4L9GA 1MC0A 2NUPC 1W63Q 3BWLA 2Z6DA 2O99A 5J4EA 4MDZA 4LRYC 4H6JB 1W63M 2OAP1 1OTDA 5I5LA 3F1NB 2EWVA 4KQOA 3RFBA 4P6ZS 4EXOA 2XA7S 3ULFA 2L0WA 5MC7A 2B02A 3A0RA 3LR4A 1TS8A 1DP6A 2D02A 1S1ZA 2QWSA 3UE6A 3PBSA 4EESA 3ZQ5A 4HH2A 4O8GA 3F1OA 4WEKA 3BY9A 3H9WA 2JN7A 4KUOA 3LIEA 2ZOHA 2MJ6A 1UWNX 4ME4A 2L1MA 4I38A 4DN0A 3LIAA 4IJGA 2HV1A 3HJKA 2W1RA 1GSVA 2OAQ1 3R7WB 5LBRA 3MQ0A 3U2AA 3FG8A 4NXFA 2P08A 1LSVA 2WKRA 1XJ4A 2J80A 3T4OA 3C8CA 3CITA 4PHTA 4L9FA 5HDDA 3PYPA 2ZBBA 3JVUA 2XRNA 3BY8A 4L0LA 3EWKA 3LR0A 1P9RA 3SW1A 4HY8A 2P04A 1ODVA 3T4TA 2JKRM 2PR6A 4NXBA 3EGDC 2VEAA 4ZRRA 3ZYTA 3IBRA 2OWHA 4OOLA 2VV7A 1V9ZA 1XJ3A 3BW6A 4B93A 3KO6A 3K3DA 5F5YA 2Y8HA 1F5MA 2QJ5A 4XT2A 3PBOA 2ZMVA 1F9IA 2GNXA 1V9YA 4Z1WA 5C5KA 1EW0A 3UB8A 4I3JA 3KSIA 4G3VA 4GHIB 3UB6A 2FH5A 2QJ7A 2VV8A 4EUVA 2PYRA 4EERA 3S7QA 4Q0JA 4R38A 2NUTC 4WELA 5F6AA 2Z6CA 4HJ4A 4HIAA 4YNRA 3TJZC 2YKHA 4WUJA 2WKPA 4L9EA 4MN5A 5HD5A 1STZA 3A0VA 3CAXA 5HDCA 2VGLS 5DJUA 3KSGA 1XFQA 4Q0IA 1TS0A 2VZWA 4LLOB 2VJWA 5KIZA 4EQ1A 4JGOA 3K2NA 3TRCA 2OOLA 3V67A 4ETXA 3UMDA 2KLIA 4HQAA 4HP9A 3NHQA 3UE3A 3PHYA 3CWFA 5EFWA 3T4LA 3H7WB 4P6ZM 4BMWA 2GJ3A 2INWA 3C38A 4I3AA 1OTAA 1TS6A 5IS1A 1YKDA 3LUQA 4XT2B 2O9AA 1N9OA 2W3FA 2M7VA 1DP9A 2HF6A 2A24B 1VHMA 4MN6A 5CX7A 4ETZA 1UWPX 5DKLA 1GSXA 2G7UA 1YAXA 2JHEA 1NLYA 1LSWA 3GDIA 1JNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IA2 A;  1ZTU A;  2K31 A;  4MN7 A;  3CI6 A;  5HSQ A;  4MCW A;  3CIT A;  1TF1 A;  3R4K A;  3S7P A;  3OBF A;  4LRZ E;  3C2W A;  3DBA A;  3MF0 A;  4QPR A;  3EEA A;  3S7O A;  2XRN A;  4RQ9 A;  3NOT C;  4EU0 A;  2B18 A;  4Y3I A;  2W3G A;  3BJN A;  3G6O A;  2VEA A;  3OOV A;  4ZRR A;  4O01 A;  3IBR A;  4Q0H A;  3IBJ A;  3O5Y A;  4FOF A;  4PAU A;  3KO6 A;  3MMH A;  3W2Z A;  3VV4 A;  2Y8H A;  4E04 A;  1F5M A;  3HCY A;  4Z1W A;  2KOI A;  4CQH A;  5HL6 A;  2W1T B;  5C5K A;  4GW9 A;  3KSI A;  4G3V A;  4IUK A;  4G3W A;  2W3E A;  4EUV A;  1YSQ A;  5DFX A;  2VKS A;  2ZMF A;  5HPF A;  2K2N A;  2M7U A;  4IUH A;  2QYB A;  3S7Q A;  4Q0J A;  3KSF A;  4R70 A;  4LRX C;  4YNR A;  1STZ A;  3KSG A;  3D3O A;  3KSH A;  5HPI A;  2HGV A;  3LFV A;  2GX5 A;  1MKM A;  4GLQ A;  2Y79 A;  4O0P A;  4Q0I A;  5L8M A;  2VZW A;  4Y5F A;  5TJJ A;  2VJW A;  1MC0 A;  4YOF A;  4BWI A;  4DMZ A;  3K2N A;  3TRC A;  2OOL A;  2O99 A;  5AJG A;  3E98 A;  4ETX A;  4MDZ A;  2KLI A;  4LRY C;  5I5L A;  2O0Y A;  3NHQ A;  3RFB A;  2O9B A;  4Y2F A;  4MMN A;  3E0Y A;  5DFY A;  3NOU C;  1TD5 A;  2W3D A;  3ZQ5 A;  2W1T A;  1YKD A;  4O8G A;  2O9A A;  3S7N A;  2W3H A;  2W3F A;  2M7V A;  3NOP C;  1VHM A;  4ETZ A;  5K5B A;  2G7U A;  4G3K A;  1YSP A;  2LB5 A;  4ME4 A;  2XRO A;  2LB9 A;  4DN0 A;  4IJG A;  2W1R A;  2O9C A;  4R6L A;  2XSS A;  5LBR A;  3MQ0 A; 
#chains in the Genus database with same CATH topology
 3MZD A;  3MFX A;  4X6T A;  2EXA A;  3S7P A;  1K0K A;  3DBA A;  1NXY A;  1SHV A;  3GMW A;  3NBL A;  1O7E A;  3BRM A;  4LV0 A;  5FA7 A;  4OQI A;  1OTE A;  5DVA A;  5KZH A;  1ZG4 A;  3PR6 A;  3CUE A;  1HLU P;  4GW9 A;  1XGI A;  1PW8 A;  2EWW A;  3ZNT A;  4B9O A;  2JKT M;  4CLC A;  1OJG A;  1E25 A;  2M7U A;  5CHU A;  1K38 A;  2P9V A;  4WMC A;  1KE4 A;  5FAO A;  3ZNY A;  1MBL A;  1TDL A;  4QWO A;  3SH8 A;  2ZLY A;  3A3F A;  4OP5 A;  4X1M A;  5AVF A;  4HH3 A;  3T1R A;  2XGN A;  4ZJ3 A;  4LV2 A;  3E0Y A;  1M6K A;  4LV1 A;  2R9W A;  3KX0 X;  1LI0 A;  3VFF A;  3KYZ A;  1LL8 A;  1X0O A;  1HD8 A;  3NC8 A;  4XUZ A;  1TS7 A;  2FFF B;  1SDN A;  2Y2K A;  3Q7V B;  1OPX A;  3F1N A;  3OCN A;  1W79 A;  1NZU A;  2PU2 A;  1K56 A;  3H82 B;  5FDH A;  2XR0 A;  4R4R A;  5DF7 A;  3M2K A;  4GD6 A;  3T4K A;  2X01 A;  5CTM A;  5GL9 A;  3MF0 A;  3PTE A;  3MQQ A;  3HRE A;  2VLG A;  4NKP A;  3OOV A;  3O5Y A;  4FUW A;  5G4Z A;  3TOI A;  3VV4 A;  2DRW A;  1OTB A;  1FCN A;  1P9W A;  1YLJ A;  2E8I A;  4OVD A;  4IED A;  1FSW A;  4G3W A;  4BD1 A;  4X53 A;  3PBN A;  2Y2L A;  1D06 A;  5AQ9 A;  3D72 A;  3MJQ A;  3CZD A;  3ZVT A;  3LY3 A;  5M1A A;  3OPR A;  4MLL A;  3SZT A;  3LIF A;  2BLS A;  4NXG A;  3G31 A;  4UQI M;  1BZA A;  4Q8I A;  3LEZ A;  3GQZ A;  5GLA A;  3EQU A;  1K57 A;  2H5S A;  2XEP A;  4YOF A;  2PD8 A;  2UWX A;  5FAP A;  4B4X A;  5AJG A;  5CRF A;  3P01 A;  1PFL A;  3IXH A;  4WEJ A;  3FV7 A;  2ZQ9 A;  4OLD A;  1NYM A;  1BSG A;  3HLF A;  1XGJ A;  3GRJ A;  2PDR A;  5J7E A;  1CF0 A;  3Q07 A;  3Q7Z A;  2Y2M A;  3E4O A;  3TW8 A;  1YLW A;  3NOP C;  1S6R A;  2Y2O A;  4X69 A;  1OME A;  4S2I A;  2LB9 A;  1G6O A;  2ZL1 A;  5FQM A;  2XSS A;  4UA7 A;  3H7W A;  4DF6 A;  3C30 A;  3U4L P;  1CEG A;  4E3O A;  2VA0 A;  3DWZ A;  1NWZ A;  1DP8 A;  4KZA A;  3VFH A;  3DWK A;  5J3W A;  1TF1 A;  4MBF A;  3WS2 A;  2A24 A;  2WKE A;  3IF6 B;  5FAS A;  4R3J A;  3S1Y A;  4EU0 A;  2KX6 A;  2W3G A;  3ICY A;  1L0E A;  2QZ6 A;  3BQ8 A;  4K0W A;  1YLT A;  1T1A A;  4KQR A;  4O01 A;  1K6S A;  1GA9 A;  4FOF A;  4P87 A;  5DF9 A;  5HL6 A;  1VET B;  1VEU A;  3MKE A;  3CUE C;  1LLB A;  2FZ0 A;  1ERM A;  4K0X A;  4DE2 A;  2RCX A;  5EV0 A;  4R70 A;  3R7W A;  1L2S A;  2I9V A;  4HES A;  4CLC C;  2L4R A;  3LR5 A;  5E2E A;  3UB7 A;  3ZG9 B;  2ZM8 A;  3EGX C;  2HGV A;  1MY8 A;  1MKM A;  4I39 A;  2Y79 A;  3B47 A;  2ZOI A;  2HPB A;  4Y5F A;  4F3L B;  1FOF A;  2V8C A;  4WF0 A;  3MBZ A;  1K6R A;  1FIL A;  1K4F A;  4Y0T A;  3G32 A;  1W63 M;  3OPL A;  3RFB A;  2L0W A;  3LGO A;  4QU3 A;  4R23 A;  1Q2Q A;  3RXW A;  2XK1 A;  2HZ5 A;  1TS8 A;  5KSC A;  3UPP A;  3UE6 A;  4F94 A;  1FR6 A;  4WEK A;  4GD8 A;  2JN7 A;  5DTT A;  1Y4O A;  2ZOH A;  2MJ6 A;  1SZV A;  3MS6 A;  2L1M A;  3UDI A;  4IJG A;  3HJK A;  1CQA A;  2Y59 A;  2WKR A;  5F83 A;  1N9B A;  3FZC A;  4NK3 A;  4PHT A;  4L9F A;  5F1G A;  3OZH A;  3SW1 A;  1VQQ A;  1XKZ A;  4NXB A;  2VEA A;  1XJ3 A;  4R4S A;  5F5Y A;  1I2S A;  2HDR A;  2JKG A;  4OQG A;  3BFC A;  5GLD A;  2X02 A;  3PBO A;  1F9I A;  3VMA A;  1BT5 A;  3W8K A;  3KSI A;  3ZG7 B;  2FH5 A;  2VV8 A;  1KGE A;  4WEL A;  3OPH A;  3TJZ C;  2YKH A;  4MN5 A;  3QNB A;  3CAX A;  3WRZ A;  3DTE A;  1XFQ A;  1TEM A;  1TS0 A;  3UPO A;  1U60 A;  5KIZ A;  4JGO A;  3TRC A;  3G4P A;  3V67 A;  3UDF A;  2KLI A;  4KZ3 A;  1C3B A;  4OPR A;  1K57 C;  3QP4 A;  3PHY A;  3CWF A;  3IXD A;  3N8L A;  3HUM A;  3FWL A;  2EX2 A;  1N9O A;  3LO7 A;  2HF6 A;  1H8Z A;  4MN6 A;  3HLE A;  4ETZ A;  4ID4 A;  2G7U A;  4DDY A;  3KYE A;  4N9L A;  2IWD A;  1LSW A;  4QHC A;  4N9K A;  4KZ8 A;  5CGW A;  2IA2 A;  4MN7 A;  1RGY A;  3FC7 A;  2JKR I;  2J9O A;  4Z9Q A;  3UB9 A;  3PAE A;  1LL5 A;  1Y28 A;  2WUQ A;  5TBM B;  1FR1 A;  2K7S A;  5GHY A;  3E2K A;  4E3I A;  3WS5 A;  5F82 A;  1ZG6 A;  4PPR A;  3QNC A;  2A3U A;  1EI5 A;  2WAF A;  4JGR A;  1K25 A;  3CG5 A;  4PAU A;  4LFU A;  4E04 A;  3NDE A;  3L7H A;  1LT0 A;  2RL3 A;  4EBL A;  1N9N A;  1IKG A;  2ZMF A;  4EBP A;  4HHD A;  5KMW A;  1GSW A;  4IUH A;  2WK0 A;  3VP0 A;  4UQI S;  5EEC A;  3IT9 A;  1MKI A;  2PR5 A;  4S2M A;  1F2K A;  4OQH A;  4OH0 A;  4PM8 A;  3UNW A;  5AQ7 A;  1G6A A;  2PU4 A;  1G28 A;  1CK3 A;  4OQ0 A;  2V0U A;  3SOI A;  4OOM A;  2HP9 A;  1ESU A;  4D2O A;  3B42 A;  4MBK A;  3O88 A;  4ZDX A;  5GLB A;  5EOE A;  4MMN A;  2WGV A;  4EBN A;  3NI9 A;  2VV6 A;  2Y2I A;  4CJN A;  4DE1 A;  4DXC A;  2A2L A;  2W3D A;  2PAV P;  4S2L A;  1PZO A;  2W3H A;  1BUE A;  1GHP A;  3OLO A;  4IHQ A;  3BEC A;  3UME A;  3ZCZ A;  1CEF A;  3F1P A;  2PBY A;  2WKH A;  3VOZ A;  3ZGA B;  4OP8 A;  5FDS A;  2P9V B;  2H0Y A;  1BUL A;  1H3Q A;  5HW3 A;  1W8Y A;  5HSQ A;  5JYP A;  3G35 A;  4DJ2 A;  4LRZ E;  4EWF A;  3S7O A;  1W5D A;  2EX8 A;  1E3U A;  3G30 A;  4S2J A;  2J3T C;  4EET B;  3N4I A;  1ZC2 A;  4KZ9 A;  2J3W A;  2CMN A;  5FQ9 A;  2V1A A;  5U47 A;  3LIC A;  5FI6 A;  2JKT I;  3LI9 A;  1E3U D;  4LGW A;  2Y91 A;  5E2G A;  1T1B A;  2VKS A;  3IWO A;  1K56 D;  2K2N A;  1L0F A;  4P6B A;  1WE4 A;  2JBF A;  1IYP A;  3EQV A;  4P85 A;  3IHB A;  3HBR A;  3HLW A;  1GA0 A;  3JYI A;  4E3K A;  4NG2 A;  2B5R A;  4ARZ A;  4GHI A;  5F69 A;  3RTY A;  4GB7 A;  4ZJ2 A;  3NJA A;  4WL9 A;  3Q1F A;  1LSX A;  3BFF A;  4KQD A;  3MR0 A;  3GVB A;  4FH4 A;  4Y2F A;  3T50 A;  4JXW A;  2EX6 A;  1MZU A;  4ZAM A;  5DFY A;  4CLC D;  3DW0 A;  2HJ9 C;  1HTZ A;  1SDE A;  4DXB A;  2BG1 A;  4WMC D;  2XRO A;  2J7V A;  3MZF A;  1OT9 A;  4N1H A;  1IKI A;  4HJ6 A;  2XD1 A;  4UEY A;  4R6L A;  3M6B A;  2OWJ A;  3BYD A;  3NIA A;  5EM0 A;  2ZC7 A;  3FPW A;  1DRM A;  1O07 A;  3R4K A;  3ITB A;  3OBF A;  3C2W A;  3IS2 A;  3PBT A;  1D7E A;  4GDN A;  4UHU A;  3HUN A;  4RX2 A;  4WZ5 A;  2WKQ A;  3JVV A;  5CHJ A;  1IEM A;  4Q0H A;  1PYY A;  2Y4A A;  3NUL A;  1ERO A;  1H8M A;  3IXG A;  4PM9 A;  4OKP A;  5FEG A;  3T1X A;  4C6Y A;  1HZO A;  3V5M A;  3SH7 A;  1ACF A;  4NEE D;  4GCZ A;  4HI4 A;  5HZH A;  4K91 A;  3N7W A;  5HFO A;  4WM9 A;  4CPK A;  3WS4 A;  3LR3 A;  3B3X A;  1K4E A;  4EQI A;  3HLC A;  3IX4 A;  4IVI A;  1MC0 A;  2Z6D A;  2O99 A;  3AGE A;  4MDZ A;  3G2Z A;  4EXO A;  1YLP A;  1MWU A;  5MC7 A;  4OPQ A;  2D02 A;  4KZ5 A;  3PBS A;  4EES A;  4U3T A;  1TDG A;  3TG9 A;  1G5U A;  5CEB A;  1VEU B;  1XX2 A;  4PM6 A;  4ME4 A;  2E8J A;  5AQB A;  2HV1 A;  1W7F A;  2W1R A;  1GSV A;  3R7W B;  3UY6 A;  5DF8 A;  4NXF A;  2DNS A;  5DTK A;  3QP1 A;  2J80 A;  3CIT A;  3PYP A;  4QB8 A;  4KQQ A;  3JVU A;  4LCM A;  3EWK A;  4X56 A;  4HY8 A;  4Y0O A;  3Q7V A;  2P04 A;  3T4T A;  3QHY A;  5HAQ A;  4DE0 A;  3EGD C;  4KG2 A;  5A93 A;  2VV7 A;  2ZC4 B;  3VP2 A;  4HEF A;  2Y8H A;  1F5M A;  2QJ5 A;  2Y55 A;  4XT2 A;  4X68 A;  4B88 A;  1HVB A;  5C5K A;  4I3J A;  3UB6 A;  2QJ7 A;  3N8S A;  1L0D A;  3CJM A;  1ALQ A;  4EER A;  3S7Q A;  4R38 A;  1G68 A;  5E43 A;  4HJ4 A;  4YNR A;  4B4Z A;  1ES3 A;  2WKP A;  4DDS A;  1STZ A;  1PWD A;  2ZQ7 A;  1GHM A;  2C5W B;  3WRT A;  5A92 A;  1DJB A;  2OOL A;  4ETX A;  3ZG5 A;  4JF6 A;  4WBG A;  2Y2G A;  4HQA A;  4E6W A;  3Q82 A;  4EUZ A;  5EFW A;  5TFQ A;  3T4L A;  4OOY A;  1OTA A;  4OON A;  2W3F A;  3ZG0 A;  2M7V A;  4BL3 A;  4KZ4 A;  3CMZ A;  5CX7 A;  1GSX A;  1MXO A;  3ZDJ A;  1RP5 A;  2Y2H A;  2JHE A;  3BFG A;  3MFD A;  2V1Z A;  4OLG A;  1JTD A;  1H5X A;  2YKF A;  2V0W A;  1PWC A;  5EVI A;  3UE1 A;  4GS9 A;  4MCW A;  5EPH A;  1S1Y A;  2Z2M B;  4FH2 A;  2JC7 A;  1PRQ A;  2R9X A;  4LEN A;  4E6X A;  3P7N A;  3NOT C;  3IX8 A;  2XDM A;  5E2F A;  3V39 A;  5EVI D;  4PKY G;  3G6O A;  3BFD A;  3IBJ A;  1K55 A;  4WZ5 C;  3V3S A;  3MQO A;  1BTL A;  1PI4 A;  4R3A A;  4IUK A;  3DTK A;  2P7J A;  5KSH A;  2PYP A;  3WWX A;  5L2F A;  3M6H A;  4LRX C;  3QP6 A;  2J3T D;  1Z6F A;  2H0T A;  2B95 A;  3GEC A;  4KG6 A;  4GLQ A;  1OTI A;  2J8Y A;  1VET A;  4E3L A;  5TJJ A;  1IFQ A;  1LL9 A;  3F1O B;  3DTM A;  4E3M A;  3IH9 A;  4BWI A;  3E4P A;  2ZQ8 A;  3T4Q A;  2O0Y A;  2JKF A;  5HAI A;  1BLS A;  5EE8 A;  2I72 A;  3T4J A;  3HJI A;  1KGG A;  2XFS A;  2H10 A;  1NZO A;  5HWW A;  3NOU C;  1SKO A;  3GSG A;  3QP2 A;  4AFI A;  4XUX A;  4G3K A;  2WGW B;  1NLZ A;  3W4Q A;  4KUK A;  2EFX A;  4DRT A;  3S4X A;  1ESI A;  5DKK A;  3GR2 A;  2XLN A;  4KZB A;  1VM1 A;  2DMW A;  1JWP A;  3CI6 A;  3VOL A;  4BBT A;  4UAA A;  3A3E A;  3IX3 A;  4FSF A;  5HWV A;  3V50 A;  4QPR A;  5FQK A;  5EM1 A;  5FQJ A;  2V1B A;  2ZQA A;  3VE4 A;  4CLC E;  4FD8 A;  1UGU A;  2J9P A;  2GDN A;  2Y2N A;  3IF5 A;  3W4P A;  5M19 A;  4QJG A;  1XJ2 A;  4LV3 A;  1AWI A;  3T12 B;  4OPZ A;  1OJ5 A;  3DTI A;  3F1P B;  1H8Y A;  3SH9 A;  4JPM A;  3UB5 P;  5BOH A;  1T19 A;  3TE8 A;  3D3O A;  4JXG A;  5HPI A;  4HBT A;  1XA7 A;  4O0P A;  1NRJ A;  5GHZ A;  5L8M A;  2M1C A;  2WKI A;  5EVE A;  4GOG A;  4IVK A;  2Z2L B;  3IXB A;  1K54 A;  3W4O A;  3N6I A;  2O9B A;  4GNU A;  4BD0 A;  4BQM A;  1ERQ A;  2W27 A;  4DE3 A;  3O87 A;  3D9Y A;  1TD5 A;  4QY6 A;  2HDQ A;  1XP4 A;  2W1T A;  3ISG A;  4BBV A;  3HL9 A;  1NY0 A;  5HD3 A;  5HAP A;  1YSP A;  2LB5 A;  2ZJ9 A;  3EEH A;  4JGQ A;  4LPZ A;  1S66 L;  2O9C A;  3C5A A;  1DJA A;  4R3B A;  2OLU A;  1EWZ A;  4JGP A;  1BLC A;  4JBF A;  2JCH A;  1I5Q A;  1N9L A;  4ARZ B;  2V20 A;  5EVI C;  1S67 L;  4S2P A;  4CLC B;  3BFE A;  4H6J A;  1JTG A;  1XJ6 A;  3T1S A;  5L10 A;  3SS3 A;  3A3I A;  4S2N A;  3MMH A;  3FKW A;  4GJ4 A;  3K3C A;  4BJP A;  3LID A;  1K55 C;  2KOI A;  4CQH A;  5G18 A;  4BLM A;  2GZA A;  1D1J A;  5TBM A;  5DFX A;  3VP3 A;  3C7V A;  2WGI A;  4FCF A;  3JPU A;  3KSF A;  3UN7 A;  2ZC3 B;  1XPB A;  4R1G A;  3WS1 A;  4C3Q A;  4PM5 A;  5IU1 A;  3IS2 B;  4L9G A;  2NUP C;  4X55 A;  4LRY C;  5FAT A;  2OAP 1;  3F1N B;  2EWV A;  2XA7 S;  3ULF A;  2B02 A;  4JLF A;  3A0R A;  1JWV A;  1DP6 A;  2V8F A;  3CPT A;  1SCW A;  2QWS A;  3RXX A;  2Q9M A;  5FEF A;  4O8G A;  4PM7 A;  3BY9 A;  1I2W A;  5AQA A;  3ITA A;  3MKF A;  1S0W A;  4DN0 A;  3LIA A;  2OAQ 1;  4Y13 A;  3MQ0 A;  4GN2 A;  2P08 A;  1LSV A;  1XJ4 A;  2ZQC A;  4RYE A;  3C8C A;  2Q0O A;  2ZBB A;  1QME A;  2C6W B;  3BY8 A;  3LR0 A;  3LCE A;  1P9R A;  2Q9N A;  1A0K A;  4ZRR A;  3IBR A;  2OLV A;  1SKF A;  2ACG A;  1V9Z A;  3S22 A;  3ZVW A;  3BEB A;  3BW6 A;  1GCE A;  1L0G A;  3K3D A;  4JF5 A;  1QMF A;  5CEC A;  1LHY A;  4Z1W A;  2ZMV A;  2GNX A;  2A49 A;  1V9Y A;  1EW0 A;  1BLH A;  2X71 A;  3MZE A;  4EUV A;  3P09 A;  3UE0 A;  2ZC6 B;  4S2K A;  4Q0J A;  5F6A A;  2NUT C;  4LCL A;  3NY4 A;  4HIA A;  5IHV A;  1KGF A;  3AGF A;  5CED A;  1IYO A;  3A0V A;  5HDC A;  5DJU A;  4WZ4 A;  2HDU A;  4JXV A;  5FAQ A;  3FYZ A;  2VZW A;  4LLO B;  2OV5 A;  2VJW A;  3VP4 A;  4EQ1 A;  3K2N A;  2P74 A;  3D4F A;  4R0Q A;  3IWI A;  2HP6 A;  3SS4 A;  1DJC A;  3OPP A;  3UE3 A;  3IWQ A;  2ZL1 B;  3T1Q B;  2ZD8 A;  1PNE A;  1K54 C;  3H7W B;  4P6Z M;  1ONG A;  2GJ3 A;  2INW A;  4I3A A;  1TS6 A;  5IS1 A;  5EUA A;  1FSY A;  1YKD A;  3LUQ A;  4XT2 B;  2O9A A;  4Y0U A;  2A24 B;  1VHM A;  1UWP X;  2QMI A;  5DKL A;  1ES2 A;  4U0X A;  1XA1 A;  3UDX A;  1TVF A;  1NLY A;  2ZQD A;  3GDI A;  4UA9 A;  4P0M A;  1M40 A;  2K31 A;  2ZM0 A;  3I7J A;  4HOI A;  2PBD P;  3VSK A;  5TGF A;  1F98 A;  2Y2J A;  1CJF A;  5G4Y A;  1Z09 A;  1P97 A;  3EEA A;  4IBR A;  5DJT A;  3LIB A;  3LI8 A;  4QD4 A;  2V9A A;  2VK3 A;  3BLS A;  2HP5 A;  4MEZ A;  3L9K A;  4QY5 A;  2XD5 A;  3QP8 A;  5EVL A;  1PWG A;  1XFN A;  2R78 A;  3G34 A;  1YPR A;  2CC1 A;  3KYQ A;  4S2N C;  1T1C A;  3LY4 A;  2W3E A;  1YSQ A;  2QPN A;  3ZHH A;  2D01 A;  2QYB A;  3C4O A;  1N4O A;  2VGK A;  5JYO A;  3H82 A;  3NEC A;  1GHI A;  3VP1 A;  3A3D A;  3KSH A;  1MPL A;  2GX5 A;  3C4P A;  3HVF A;  5EVI B;  4GS9 B;  4S2O A;  3EOI A;  3OC2 A;  2VGL M;  4D60 A;  4EEU A;  3FPV A;  3MSH A;  4ZBE A;  1P0Z A;  5DTS A;  4DMZ A;  2EXB A;  3E98 A;  2H28 A;  4GKU A;  3M2J A;  5HWT A;  2QHK A;  1E4D A;  5A90 A;  3O3V A;  1BLP A;  2PD7 A;  2WZZ A;  1YMS A;  4HJ3 A;  5FL3 A;  2VX8 A;  2HDS A;  2V2F F;  2W0N A;  4A5R A;  4Y17 A;  3LYX A;  2QKP A;  4BBU A;  2EA9 A;  4X1L A;  3OCL A;  3VSL A;  2XA7 M;  3HLG A;  5EOO A;  1KDW A;  4HP4 A;  1VB6 A;  4Y15 A;  3T4S A;  2AVX A;  1T18 A;  2PHY A;  2Y2P A;  4Y3I A;  5CTN A;  3BJN A;  4N1X A;  2IWC A;  1NYY A;  1XXM A;  5GHX A;  2WAD A;  5HAR A;  1H0M A;  3N8R A;  1KE0 A;  4HNB A;  3TSG A;  5L07 A;  3QP5 A;  1SKO B;  4RA7 A;  4OPY A;  2FFY A;  4KEN B;  1FCM A;  5HPF A;  2BAS A;  1IOU A;  5FSR A;  5CGX A;  4YFM A;  2BTF P;  2WZX A;  3BQA A;  2XH9 A;  5CGS A;  3FKV A;  3CHW P;  4MNR A;  5A8B A;  1S4S A;  3V3R A;  1KE3 A;  4JKT A;  3B33 A;  4XXR A;  1KDS A;  1YLZ A;  5CER A;  4NXE A;  4U0T A;  2EX9 A;  3IF6 A;  2PRF A;  3ZG8 B;  1PIO A;  3AGD A;  3VOY A;  4NET A;  4DKI A;  1FCO A;  2VGJ A;  3VE3 A;  5J8X A;  4RVA A;  2HJE A;  3E4Q A;  1KOU A;  3HUO A;  2G2W A;  1YQS A;  1KVM A;  1BYW A;  1ZKJ A;  5IT5 A;  4BL2 A;  4M3K A;  4I5S A;  3S7N A;  1WA9 A;  3MXQ A;  5D3O A;  5K5B A;  1S4R A;  2ZC5 B;  4I3I A;  2WAE A;  4WYY A;  5F68 A;  1RGZ A;  5M18 A;  2PT7 A;  5CXW A;  1JVJ A;  4WN5 A;  2KDK A;  2ZM2 A;  2Y2Q A;  5FQI A;  3ZFZ A;  3Q81 A;  5CHM A;  4ESP A;  1ZTU A;  3BM6 A;  3E2L A;  4E3J A;  1PI5 A;  1OT6 A;  4YWZ A;  3C7U A;  4F3L A;  4E3N A;  1JWZ A;  3IHA A;  4RQ9 A;  4GDB A;  4JXS A;  2XF3 A;  1YM1 A;  2B18 A;  3GV9 A;  3RH8 B;  1ONH A;  3MXR A;  3RJU A;  4EEP A;  4C75 A;  5I94 A;  3PBR A;  2XQZ A;  1FQG A;  3CLO A;  3W2Z A;  4PKY A;  4EW7 A;  4WLA A;  3HCY A;  2W1T B;  1ZHH B;  1MWS A;  5HX9 A;  1J3W A;  2G2U A;  4BEN A;  4M4X A;  2UV0 E;  1MWR A;  4DJ3 A;  1IYS A;  4FTX A;  3O86 A;  4PMA A;  5HDS A;  2XFT A;  5L09 A;  5AVE A;  4II7 A;  3A0S A;  3LFV A;  3PBQ A;  4K08 A;  3PXP A;  4GZB A;  5A91 A;  2OSU A;  3IQA A;  4UA6 A;  3MXS A;  4RX3 A;  1W63 Q;  1ES4 A;  3BWL A;  1NRF A;  1WYB A;  5J4E A;  2ZMA A;  4KZ7 A;  4H6J B;  1OTD A;  5I5L A;  4KQO A;  1KVL A;  4P6Z S;  1MWT A;  3P98 A;  3LR4 A;  5HL1 A;  1S1Z A;  1LI9 A;  3ZQ5 A;  4HH2 A;  4EV4 A;  3F1O A;  3H9W A;  4KUO A;  3LIE A;  1UWN X;  4I38 A;  5F1F A;  4KG5 A;  5LBR A;  3U2A A;  4O7D A;  1YT4 A;  3FG8 A;  3WS0 A;  1CI9 A;  3HLD A;  3DAV A;  3T4O A;  5HDD A;  4N92 A;  1AXB A;  2XRN A;  4L0L A;  1WYC A;  2WGW A;  3PAG A;  5TR7 A;  1ODV A;  2JE5 A;  2JKR M;  2PR6 A;  3ZYT A;  2OWH A;  3UO9 A;  2WYX A;  4OOL A;  1CI8 A;  3A3J A;  3KO6 A;  4B93 A;  3LEQ A;  3HLB A;  4H8R A;  3CPT B;  1PZP A;  1Q2P A;  5FI7 A;  3UPN A;  3UB8 A;  4G3V A;  4GHI B;  3NCK A;  2PYR A;  4HBU A;  1IEL A;  1NJ4 A;  1DY6 A;  4YIN A;  4MBH A;  5FI2 A;  4KZ6 A;  1L3L A;  2Z6C A;  3SS5 A;  4WUJ A;  1YMX A;  4L9E A;  5HD5 A;  1IYQ A;  2VGL S;  3KSG A;  4ZTK A;  1YLY A;  4IBX A;  1RCJ A;  4Q0I A;  2IWB A;  4X25 A;  3GTC A;  1Y54 A;  3BLM A;  3IF6 C;  3UMD A;  5E2H A;  4HP9 A;  3NHQ A;  4ZJ1 A;  1FIK A;  2DCF A;  4BMW A;  2EFU A;  3C38 A;  1ES5 A;  1DP9 A;  3G2Y A;  1PW1 A;  3IH8 A;  1YAX A;  3NDG A;  1J9M A;  1W8Q A;  5FQQ A;  5GLC A;  4JF4 A;  4Y7P A;  1JNU A; 
#chains in the Genus database with same CATH homology
 3MFX A;  2IA2 A;  2K31 A;  2YKF A;  2V0W A;  4MN7 A;  4HOI A;  4GS9 A;  4MCW A;  1F98 A;  3FC7 A;  1S1Y A;  2JKR I;  3S7P A;  5G4Y A;  3DBA A;  3UB9 A;  3P7N A;  1P97 A;  3EEA A;  1Y28 A;  3NOT C;  5DJT A;  3LIB A;  3LI8 A;  5TBM B;  2K7S A;  2V9A A;  4PKY G;  3G6O A;  3IBJ A;  1OTE A;  4JGR A;  4PAU A;  3MQO A;  3PR6 A;  4E04 A;  3CUE A;  1XFN A;  2R78 A;  1LT0 A;  3KYQ A;  4GW9 A;  4R3A A;  1T1C A;  4IUK A;  1N9N A;  2EWW A;  2W3E A;  1YSQ A;  4B9O A;  2JKT M;  2ZMF A;  4CLC A;  4HHD A;  1OJG A;  1GSW A;  2M7U A;  2D01 A;  2P7J A;  2QYB A;  4IUH A;  5KSH A;  2PYP A;  4LRX C;  3H82 A;  4UQI S;  2PR5 A;  2J3T D;  3KSH A;  2GX5 A;  3GEC A;  4GLQ A;  4GS9 B;  1OTI A;  3EOI A;  3OC2 A;  2VGL M;  4EEU A;  3FPV A;  5TJJ A;  1G28 A;  1IFQ A;  2V0U A;  3F1O B;  1P0Z A;  4BWI A;  5AVF A;  3E4P A;  4OOM A;  4DMZ A;  4HH3 A;  3E98 A;  2H28 A;  3B42 A;  5HWT A;  3T4Q A;  2O0Y A;  2QHK A;  3T4J A;  4MMN A;  3E0Y A;  3HJI A;  3KX0 X;  2VV6 A;  5HWW A;  3NOU C;  2PD7 A;  2A2L A;  2W3D A;  3KYZ A;  4HJ3 A;  1LL8 A;  5FL3 A;  1X0O A;  2W3H A;  2VX8 A;  3OLO A;  4AFI A;  4IHQ A;  1TS7 A;  3UME A;  4G3K A;  3F1P A;  2W0N A;  1NLZ A;  1OPX A;  3F1N A;  3OCN A;  4KUK A;  3LYX A;  2QKP A;  4BBU A;  3H82 B;  2EA9 A;  5DKK A;  3OCL A;  1H3Q A;  2DMW A;  3CI6 A;  5HSQ A;  3VOL A;  4BBT A;  2XA7 M;  4FSF A;  5HWV A;  3T4K A;  4DJ2 A;  4HP4 A;  4LRZ E;  1VB6 A;  3MF0 A;  4QPR A;  3T4S A;  3S7O A;  3MQQ A;  1T18 A;  2PHY A;  2V1B A;  4Y3I A;  2VLG A;  3VE4 A;  3BJN A;  4NKP A;  2J3T C;  4EET B;  3OOV A;  4CLC E;  3O5Y A;  1UGU A;  2J3W A;  2CMN A;  2V1A A;  3LIC A;  4HNB A;  5G4Z A;  3VV4 A;  2JKT I;  3LI9 A;  1OTB A;  1P9W A;  1XJ2 A;  4G3W A;  3PBN A;  1T1B A;  2VKS A;  1D06 A;  3D72 A;  5HPF A;  3MJQ A;  1OJ5 A;  3F1P B;  2K2N A;  2BAS A;  1IOU A;  3BQA A;  3EQV A;  5A8B A;  1S4S A;  3LIF A;  1T19 A;  3TE8 A;  3D3O A;  5HPI A;  4NXG A;  4UQI M;  3B33 A;  4O0P A;  4ARZ A;  1NRJ A;  4NXE A;  4GHI A;  5F69 A;  5L8M A;  3EQU A;  2M1C A;  3RTY A;  4YOF A;  2PD8 A;  3NJA A;  5AJG A;  3P01 A;  4WL9 A;  1LSX A;  4WEJ A;  4KQD A;  3MR0 A;  3VE3 A;  2O9B A;  2HJE A;  4Y2F A;  3T50 A;  3E4Q A;  1KOU A;  1MZU A;  2W27 A;  5DFY A;  1TD5 A;  2PDR A;  1BYW A;  5J7E A;  5IT5 A;  4CLC D;  2W1T A;  2HJ9 C;  3E4O A;  4I5S A;  3S7N A;  3TW8 A;  4BBV A;  3NOP C;  1WA9 A;  3MXQ A;  5HD3 A;  5K5B A;  1S4R A;  1YSP A;  2LB5 A;  3EEH A;  4I3I A;  4JGQ A;  2XRO A;  5F68 A;  2LB9 A;  2PT7 A;  1OT9 A;  1G6O A;  4HJ6 A;  4LPZ A;  4WN5 A;  1S66 L;  4UEY A;  2O9C A;  2KDK A;  4R6L A;  2OWJ A;  2XSS A;  3H7W A;  1ZTU A;  3C30 A;  2VA0 A;  3FPW A;  1DRM A;  1NWZ A;  1DP8 A;  4JGP A;  5J3W A;  1OT6 A;  4YWZ A;  1TF1 A;  1N9L A;  4ARZ B;  4F3L A;  3R4K A;  3OBF A;  2A24 A;  3C2W A;  3IS2 A;  3PBT A;  1D7E A;  1S67 L;  4RQ9 A;  4EU0 A;  2B18 A;  2KX6 A;  2W3G A;  3ICY A;  3RH8 B;  2WKQ A;  4CLC B;  4H6J A;  3JVV A;  3BQ8 A;  1XJ6 A;  4EEP A;  1T1A A;  3PBR A;  4O01 A;  4Q0H A;  3CLO A;  4FOF A;  3MMH A;  3W2Z A;  4PKY A;  4EW7 A;  4GJ4 A;  4WLA A;  3K3C A;  3HCY A;  4BJP A;  3LID A;  2KOI A;  5DF9 A;  4CQH A;  5HL6 A;  2W1T B;  1ZHH B;  1H8M A;  2GZA A;  3CUE C;  2FZ0 A;  4M4X A;  5TBM A;  5DFX A;  4DJ3 A;  4NEE D;  4GCZ A;  4HI4 A;  5HZH A;  3KSF A;  4R70 A;  3R7W A;  5HDS A;  2I9V A;  4CLC C;  2L4R A;  3LR5 A;  3UB7 A;  5AVE A;  3EGX C;  4II7 A;  2HGV A;  3LR3 A;  3A0S A;  3LFV A;  3PBQ A;  1MKM A;  4K08 A;  4I39 A;  2Y79 A;  3B47 A;  3PXP A;  2ZOI A;  4Y5F A;  4F3L B;  5IU1 A;  4WF0 A;  3IS2 B;  4L9G A;  1MC0 A;  2NUP C;  1W63 Q;  3BWL A;  2Z6D A;  2O99 A;  5J4E A;  4MDZ A;  4LRY C;  4H6J B;  1W63 M;  2OAP 1;  1OTD A;  5I5L A;  3F1N B;  2EWV A;  4KQO A;  3RFB A;  4P6Z S;  4EXO A;  2XA7 S;  3ULF A;  2L0W A;  5MC7 A;  2B02 A;  3A0R A;  3LR4 A;  1TS8 A;  1DP6 A;  2D02 A;  1S1Z A;  2QWS A;  3UE6 A;  3PBS A;  4EES A;  3ZQ5 A;  4HH2 A;  4O8G A;  3F1O A;  4WEK A;  3BY9 A;  3H9W A;  2JN7 A;  4KUO A;  3LIE A;  2ZOH A;  2MJ6 A;  1UWN X;  4ME4 A;  2L1M A;  4I38 A;  4DN0 A;  3LIA A;  4IJG A;  2HV1 A;  3HJK A;  2W1R A;  1GSV A;  2OAQ 1;  3R7W B;  5LBR A;  3MQ0 A;  3U2A A;  3FG8 A;  4NXF A;  2P08 A;  1LSV A;  2WKR A;  1XJ4 A;  2J80 A;  3T4O A;  3C8C A;  3CIT A;  4PHT A;  4L9F A;  5HDD A;  3PYP A;  2ZBB A;  3JVU A;  2XRN A;  3BY8 A;  4L0L A;  3EWK A;  3LR0 A;  1P9R A;  3SW1 A;  4HY8 A;  2P04 A;  1ODV A;  3T4T A;  2JKR M;  2PR6 A;  4NXB A;  3EGD C;  2VEA A;  4ZRR A;  3ZYT A;  3IBR A;  2OWH A;  4OOL A;  2VV7 A;  1V9Z A;  1XJ3 A;  3BW6 A;  4B93 A;  3KO6 A;  3K3D A;  5F5Y A;  2Y8H A;  1F5M A;  2QJ5 A;  4XT2 A;  3PBO A;  2ZMV A;  1F9I A;  2GNX A;  1V9Y A;  4Z1W A;  5C5K A;  1EW0 A;  3UB8 A;  4I3J A;  3KSI A;  4G3V A;  4GHI B;  3UB6 A;  2FH5 A;  2QJ7 A;  2VV8 A;  4EUV A;  2PYR A;  4EER A;  3S7Q A;  4Q0J A;  4R38 A;  2NUT C;  4WEL A;  5F6A A;  2Z6C A;  4HJ4 A;  4HIA A;  4YNR A;  3TJZ C;  2YKH A;  4WUJ A;  2WKP A;  4L9E A;  4MN5 A;  5HD5 A;  1STZ A;  3A0V A;  3CAX A;  5HDC A;  2VGL S;  5DJU A;  3KSG A;  1XFQ A;  4Q0I A;  1TS0 A;  2VZW A;  4LLO B;  2VJW A;  5KIZ A;  4EQ1 A;  4JGO A;  3K2N A;  3TRC A;  2OOL A;  3V67 A;  4ETX A;  3UMD A;  2KLI A;  4HQA A;  4HP9 A;  3NHQ A;  3UE3 A;  3PHY A;  3CWF A;  5EFW A;  3T4L A;  3H7W B;  4P6Z M;  4BMW A;  2GJ3 A;  2INW A;  3C38 A;  4I3A A;  1OTA A;  1TS6 A;  5IS1 A;  1YKD A;  3LUQ A;  4XT2 B;  2O9A A;  1N9O A;  2W3F A;  2M7V A;  1DP9 A;  2HF6 A;  2A24 B;  1VHM A;  4MN6 A;  5CX7 A;  4ETZ A;  1UWP X;  5DKL A;  1GSX A;  2G7U A;  1YAX A;  2JHE A;  1NLY A;  1LSW A;  3GDI A;  1JNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...