3CITA

Crystal structure of the gaf domain of a putative sensor histidine kinase from pseudomonas syringae pv. tomato
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
155
Chain Sequence
NAYRQSQSRAARLRLLVDTGQELIQLPPEAMRKCVLQRACAFVAMDHGLLLEWGNGVQTTARHGSKERLSTLETTADPLAIGPQWLERPGTHLPCVLLLPLRGADEGSFGTLVLANSVAISAPDGEDIESLQLLATLLAAHLENNRLLEALVARD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor histidine kinase
publication title Crystal structure of the GAF domain of a putative sensor histidine kinase from Pseudomonas syringae pv. tomato
rcsb
source organism Pseudomonas syringae pv. tomato
total genus 46
structure length 155
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3citA00
4Z1WA 3S7NA 1YSQA 3NHQA 3E0YA 2W3EA 4IUHA 1YKDA 4Q0IA 3ZQ5A 2O9AA 3R4KA 4MDZA 3EEAA 3NOTC 3HCYA 2M7UA 3NOPC 1TD5A 4Q0HA 4E04A 1VHMA 2VEAA 5K5BA 3CI6A 5HL6A 1F5MA 1YSPA 4Y3IA 3D3OA 4MMNA 1MKMA 4G3VA 2ZMFA 4G3WA 4Q0JA 4CQHA 2W3HA 3KSGA 2LB5A 2B18A 4QPRA 4PAUA 3RFBA 3E98A 4O8GA 4LRYC 1TF1A 3C2WA 3NOUC 2HGVA 3TRCA 3S7QA 2W3GA 4EUVA 4EU0A 2Y8HA 3IBJA 5LBRA 3KO6A 5AJGA 2W1RA 2O0YA 3LFVA 3MF0A 5HSQA 2IA2A 3MQ0A 3CITA 5DFYA 3O5YA 2KOIA 4ZRRA 5I5LA 2VZWA 4DMZA 3MMHA 4YOFA 1ZTUA 3KSHA 2O99A 2W1TB 5HPFA 4BWIA 4MCWA 1MC0A 1STZA 5L8MA 2QYBA 3BJNA 3G6OA 4LRXC 3KSFA 3K2NA 4GW9A 4ETXA 2VKSA 4Y2FA 2W3DA 2M7VA 2GX5A 5HPIA 2W1TA 2XSSA 5DFXA 2KLIA 3IBRA 3OBFA 2LB9A 4LRZE 5C5KA 4O01A 2K2NA 4RQ9A 4FOFA 2Y79A 4R6LA 2VJWA 2G7UA 5TJJA 2XRNA 4Y5FA 3VV4A 2O9BA 4ME4A 3S7OA 3KSIA 4O0PA 3OOVA 4DN0A 3DBAA 3W2ZA 4ETZA 4MN7A 4IJGA 4R70A 3S7PA 4IUKA 4G3KA 2XROA 4YNRA 2K31A 2W3FA 2O9CA 2OOLA 4GLQA
chains in the Genus database with same CATH superfamily
2ZQAA 2D02A 2Z2MB 3T50A 5HDCA 1T1AA 3ISGA 5AVEA 1YM1A 4D60A 4HY8A 2Y2LA 3T1XA 4S2NC 3CI6A 4IVIA 1K56A 4HH2A 2HPBA 2EXBA 3WS4A 4WELA 2I9VA 4QHCA 1PFLA 4HP9A 1U60A 3LCEA 3BRMA 5M19A 1LT0A 2VLGA 1W8QA 4WMCA 3F1NA 2HGVA 1RGZA 3VP2A 2VX8A 2ZC3B 4OOMA 5M18A 3Q82A 3BQ8A 5DKLA 4KZ8A 1A0KA 4X68A 4X53A 3W4PA 2ZQCA 5GHYA 1V9YA 4BL3A 3VP1A 4EEUA 2EX8A 2JN7A 3BY9A 2ZOIA 3OLOA 3G6OA 2OLVA 4GW9A 5E2HA 5EE8A 1KE3A 4N9LA 4JGOA 2HDUA 4HJ4A 1K55A 1S67L 3SS5A 2RL3A 2W27A 5A91A 3BFDA 1DY6A 4MBHA 2Z2LB 5EVIB 4B88A 1J9MA 5G4YA 3LIAA 5DF9A 4WL9A 2XROA 4KG2A 3HLEA 2ZL1B 2ZC7A 4Y13A 2ZQDA 2HDQA 4NEED 2HJ9C 3UO9A 4Z1WA 4OOYA 1YSQA 2PAVP 2Y4AA 2YKFA 3LY4A 3VP3A 3NY4A 3EEAA 3GSGA 1CI8A 2V1ZA 2IWDA 4ARZB 3HVFA 4BQMA 4CLCC 3G2ZA 4E6XA 3WRZA 1C3BA 2JHEA 1YMSA 2A2LA 4GCZA 5CHMA 2XFTA 3LR0A 4N9KA 3EQUA 1S4SA 3UE1A 4C3QA 2ZC5B 2QKPA 3BY8A 3O5YA 4EW7A 4KZ9A 4WZ5A 3KSHA 2O99A 2RCXA 4BWIA 4YWZA 3CPTA 3DTMA 5L8MA 3TJZC 4P0MA 3K2NA 3IXGA 4Y0UA 4MEZA 2GX5A 4JF6A 1DRMA 3IWOA 4JXSA 4PM9A 4S2LA 5DJTA 5GHZA 1S1ZA 2G2UA 2Y79A 4CPKA 3AGDA 1ZKJA 1IYQA 4Y5FA 3QNBA 2QMIA 4XT2A 4JXGA 2Y2NA 5DTSA 3VFHA 4IVKA 1L0DA 1GCEA 1WE4A 3A3IA 4LCMA 4KUKA 1LLBA 3K3DA 5G4ZA 3W8KA 3Q07A 2UWXA 2HP9A 4IUHA 2WAFA 5HAQA 3MQQA 5FI6A 1SHVA 4LGWA 4GD6A 2ZM8A 5FQIA 3NOPC 3T4QA 2XLNA 5TFQA 4Y0OA 4YFMA 2VA0A 3F1NB 3RJUA 3H82B 5AVFA 1ALQA 1JVJA 3RH8B 1VM1A 5DF7A 1OJ5A 1XP4A 3JPUA 2YKHA 2X71A 3RTYA 3MFXA 2ZQ7A 4DXBA 3G31A 1RP5A 3QP1A 3VOYA 3ZHHA 4QB8A 1F2KA 4C6YA 1BLCA 4F3LA 3V39A 3LR3A 5FA7A 4LV1A 1IFQA 1FOFA 4ETXA 3A3JA 1YPRA 2J8YA 1E4DA 5KSCA 2Z6CA 4I3AA 1W63M 2WZXA 2Y2KA 4S2IA 4X56A 4R6LA 1KE4A 3OPLA 3FC7A 2Q0OA 1I2WA 1YLTA 1TS6A 5F69A 2K31A 4L9EA 3HL9A 4GLQA 1ZC2A 1P0ZA 2A24B 5FQKA 1KGEA 1FCNA 4OPYA 1TS8A 4BL2A 5HX9A 2HP5A 1I2SA 4MDZA 2I72A 4QD4A 5GLCA 4UAAA 3EGXC 4NKPA 1H5XA 2VEAA 1JWVA 2XFSA 3UB6A 5FASA 3JVVA 5GLDA 4MLLA 2E8JA 1PW1A 4CQHA 3S4XA 2WGVA 2PBDP 1YLJA 4PMAA 5AJGA 3LFVA 3OC2A 2WGIA 2ZOHA 3P7NA 4OP5A 5FAOA 3MMHA 3V3RA 1T1BA 3QP8A 2G2WA 3EQVA 3NI9A 4K0WA 5FDHA 3FPVA 4OLGA 2KDKA 3IQAA 4JXWA 3R7WA 3T4TA 3T4LA 1GA0A 1ODVA 3Q81A 5E43A 3C8CA 3ZGAB 4LRZE 1T19A 1ZG4A 4EBNA 1DJAA 4EV4A 4N1XA 4WBGA 4DKIA 1TDLA 3CUEA 4UQIM 4FOFA 1KGFA 4S2MA 1K6SA 3UPOA 3IF5A 5HAPA 3MFDA 3SH7A 4FH4A 5HWWA 5CGSA 4OQGA 1XJ4A 3FV7A 4Y17A 2WKRA 1ACFA 2QZ6A 3PR6A 3MBZA 4NG2A 1OMEA 1PNEA 2CMNA 1FR6A 2W3EA 3IWQA 1BTLA 2UV0E 1H8YA 4M3KA 2M7UA 5L2FA 1H0MA 1LL5A 5HWVA 1YLZA 3I7JA 2KX6A 2ZMAA 4JF4A 3E4OA 3JVUA 1ZG6A 5EVIA 3VFFA 1BLSA 1MKMA 3F1PB 4EXOA 1N9NA 4Y15A 4HBUA 1EWZA 2JKRM 1PRQA 3CAXA 5EOOA 4F3LB 2R9WA 1S6RA 2HV1A 3IX3A 2ZM0A 1HVBA 4KZBA 2P04A 3CITA 2V20A 1SCWA 1OTDA 1K55C 1OT9A 4DMZA 4BBTA 4BD0A 4LCLA 4NXEA 5HW3A 4KUOA 2J3TC 4MCWA 4I39A 1BUEA 4ARZA 5TGFA 1ES3A 2VKSA 1S4RA 4WEKA 1N9OA 5FL3A 4FH2A 3GECA 3UDXA 3OBFA 4HHDA 5A93A 3LIBA 3LYXA 1NLZA 4PM8A 3BFCA 3HLDA 5HZHA 3CJMA 1XA1A 4ME4A 4DDSA 1MPLA 2ZMVA 2L0WA 4QY6A 3D9YA 1PIOA 4FCFA 4S2PA 3LIDA 3S7NA 4MN5A 2J7VA 4FSFA 1YLPA 5EECA 2V0WA 2WKPA 1OPXA 5EM0A 1P9WA 1IEMA 2L1MA 4LV3A 2W0NA 3WRTA 1D06A 3HBRA 2PRFA 2JKTM 4QY5A 4ZJ2A 4D2OA 1KOUA 1VB6A 4WZ5C 3E98A 3PBSA 4UA6A 3NJAA 3TRCA 2W3GA 3MZDA 3D4FA 2C6WB 3LEZA 2W1RA 3PBNA 3ZG7B 1ONGA 4I5SA 1YMXA 4GKUA 1TVFA 5U47A 1XJ2A 3R7WB 2XD1A 3LO7A 5CXWA 4AFIA 3M6BA 3WS2A 1NYMA 3JYIA 1PWCA 1DP9A 3OPPA 4QU3A 3UMDA 2NUPC 4OQ0A 4WYYA 3H82A 1ESIA 1OT6A 2V8FA 2VGKA 3N6IA 1TEMA 4HH3A 5HDDA 1ES2A 2XSSA 1Z6FA 4GHIB 3ITAA 1GSXA 4JGQA 5TBMA 1ERMA 3Q7ZA 4R3BA 4B4XA 1WYBA 2EA9A 3NCKA 4E3IA 3GRJA 3O86A 3NC8A 4X6TA 3KSIA 4O0PA 1K56D 2PDRA 4ETZA 5L07A 1KDSA 5F68A 3SW1A 1K54A 3VMAA 2W3FA 3G35A 4S2OA 4LFUA 5F83A 4ID4A 4P87A 4WMCD 1NYYA 1PZOA 4S2JA 3UE6A 4WZ4A 3E4QA 4X1MA 2B95A 4H8RA 2WKEA 5EFWA 2OAP1 3ZNTA 1BSGA 4LV0A 3O87A 4Y7PA 3FKWA 3HREA 4WF0A 1E3UA 4XXRA 4N92A 4XUZA 3M2KA 2W3HA 1MKIA 3UDFA 2ACGA 2FZ0A 4KQRA 2Q9NA 1PWGA 4K08A 5HD5A 2K7SA 4P85A 2WKQA 3DWZA 5G18A 4EEPA 4EBPA 5F5YA 2ZC4B 3V5MA 4R0QA 1OJGA 3GDIA 3NDEA 4B4ZA 2A24A 5HSQA 1IYOA 5AQ7A 2J80A 5AQ9A 4JPMA 1I5QA 2JBFA 1RCJA 4CLCE 1STZA 5KZHA 3BJNA 1EI5A 2P7JA 5J4EA 2W3DA 2EXAA 3M2JA 2W1TA 2EX2A 3MXSA 1LSWA 3BECA 3IX8A 1S0WA 3CHWP 1BULA 1KE0A 3MQOA 3P01A 5D3OA 4K0XA 3HLGA 3LIEA 5CTNA 2VJWA 4X1LA 4M4XA 4DE3A 1W5DA 2INWA 3IXBA 4IEDA 2FFFB 3G30A 4GS9A 5J7EA 4GJ4A 2FFYA 1YQSA 3MXQA 5DKKA 4R3AA 4PM7A 3HUMA 5AQAA 1XKZA 3UB9A 4R3JA 1P9RA 4XUXA 2EWWA 1FQGA 3PYPA 2H28A 4X69A 4P6BA 3UB8A 3VOZA 5HWTA 4F94A 1KDWA 1W63Q 1DJBA 4ZTKA 1NJ4A 4UA9A 3GMWA 1GHMA 3SS4A 4OOLA 4Q0JA 3C7UA 3EGDC 4O8GA 3U4LP 3KYZA 4HIAA 3UMEA 1BYWA 3ZDJA 1K6RA 5FQJA 5EPHA 2OAQ1 1ESUA 3UE0A 4ZRRA 1S66L 1IYSA 2J9PA 3ICYA 3OZHA 4OQIA 3OPHA 2IWBA 3UPNA 3L9KA 3CUEC 5EUAA 5TBMB 2JC7A 2DCFA 3QP6A 3F1PA 1VETA 5HPIA 5HARA 4OONA 4YINA 2LB9A 4JXVA 2OSUA 3LI8A 4KZ5A 1NY0A 3ZG0A 5CEBA 1YT4A 3NIAA 3N8RA 2GDNA 1G28A 2XH9A 4JGRA 3IF6B 3UDIA 3S7PA 1CQAA 2JKGA 2VGJA 2ZLYA 3H7WB 3A3DA 1IKGA 3IXDA 2L4RA 3LI9A 3UNWA 2XD5A 2WUQA 3MR0A 5FSRA 1L0FA 1NLYA 5EVIC 2ZM2A 2PD8A 1T1CA 1CEFA 1K4EA 2BLSA 3VSLA 2Y2JA 1YKDA 3MSHA 1K57A 3IS2B 1PI4A 2WADA 1FSWA 3NOTC 4Q0HA 4E04A 5IHVA 2D01A 3V3SA 3C38A 2PR6A 3BW6A 5FAPA 2PU4A 3T1RA 2VGLM 4NXGA 3BYDA 2QWSA 3LY3A 3FKVA 4EUVA 1GHIA 3B47A 5IS1A 4MNRA 5CRFA 4DJ3A 4CLCD 3IBJA 1XJ6A 3VP4A 3F1OA 2EX9A 4WN5A 1N9LA 5DFYA 2EX6A 3W4OA 2NUTC 2W1TB 2WKIA 1OTAA 4DDYA 1S1YA 4E3NA 2QYBA 1H8ZA 3A0SA 3Q1FA 1G6OA 5DTTA 2P9VA 3P09A 2JCHA 2Y2OA 4ZJ1A 5E2EA 2VV6A 3N8SA 5KSHA 3OCNA 2BG1A 4N1HA 4GS9B 2Y2MA 3IWIA 3W4QA 3TSGA 3BLMA 2ZBBA 4Q8IA 3WS0A 2WK0A 3HUNA 2X01A 3T12B 2O9BA 1MBLA 2VGLS 3PXPA 3OOVA 4KQQA 1JNUA 3VSKA 4IJGA 2BTFP 2DNSA 4YNRA 2PBYA 3N7WA 1NXYA 5M1AA 2WKHA 4LENA 3NHQA 3HLBA 4GHIA 2ZD8A 3SS3A 5EVLA 3Q7VB 1M6KA 5EM1A 3BQAA 4WM9A 1HLUP 4L9GA 2DRWA 3DWKA 4FUWA 1GSWA 2HP6A 1YSPA 4ZJ3A 4G3VA 1EROA 1LL8A 2LB5A 4E6WA 1PZPA 1TF1A 3UY6A 4GDBA 3C5AA 5FI7A 1W8YA 4DE1A 3VP0A 4DE2A 1MWSA 3IHBA 3HLCA 4KENB 1UWPX 4DXCA 2OV5A 4KG6A 3TG9A 5FQQA 1ZHHB 3IHAA 2OWHA 2R9XA 1NWZA 1VETB 5HPFA 4OKPA 3BLSA 3QP5A 4L0LA 4II7A 1Q2PA 1CK3A 4NXFA 2M7VA 4EBLA 1XFNA 4R4RA 2JKRI 4OPRA 3UPPA 4BBVA 1SKOA 1ONHA 3UB5P 2XA7S 1NZOA 3HUOA 3WS5A 1K54C 5GL9A 4EUZA 2Y2PA 1AWIA 3CMZA 3MKFA 3S7OA 5GLBA 4ZDXA 1MZUA 2H5SA 4MN7A 4G3KA 5EVID 1KGGA 1G5UA 2E8IA 1K38A 3LUQA 3IH9A 2GZAA 3IT9A 2WYXA 4GN2A 1N9BA 1L0EA 1SKFA 2IWCA 3ZVWA 1YLWA 4HESA 1D7EA 1TD5A 3G2YA 4EQ1A 3FYZA 4PHTA 2GJ3A 2Q9MA 4X55A 1K4FA 5HL6A 4NXBA 5KIZA 5BOHA 3T1QB 4L9FA 3F1OB 4RA7A 3NDGA 3RFBA 5TR7A 3T4OA 2X02A 1CF0A 5FEFA 2HF6A 2Y55A 3MF0A 1BZAA 3G34A 3V50A 5EV0A 1L2SA 1BLHA 1H3QA 1XJ3A 2B5RA 2KOIA 3T4SA 4R38A 4PKYG 5E2FA 1PWDA 1MY8A 4PM6A 1MC0A 2P9VB 3MXRA 2JKTI 4A5RA 5FQMA 1L3LA 1L0GA 1KVLA 4X25A 3T4KA 3CWFA 4IBRA 5CGWA 5DFXA 3K3CA 1OTBA 1AXBA 2BASA 4HJ6A 4E3JA 3PBQA 1GA9A 1TS7A 2ZC6B 2VV8A 3MS6A 3ITBA 2G7UA 2XEPA 1Y28A 1ES4A 4DN0A 3BFEA 3EEHA 5GHXA 4R70A 3BM6A 1XGJA 4P6ZS 4WEJA 4RX3A 3EOIA 5IT5A 2Y2IA 5FEGA 4E3LA 5DVAA 5F6AA 3DTEA 1LSVA 4GDNA 5F1FA 2M1CA 4OVDA 4HEFA 4DE0A 1F9IA 1GHPA 1N4OA 5K5BA 5HFOA 2WGWB 3T1SA 1E25A 1T18A 3D3OA 1QMEA 3IF6A 2J9OA 4E3OA 2PHYA 4IHQA 5CTMA 4KZ6A 3WS1A 3S7QA 3HJKA 3H7WA 3C4PA 2Y8HA 3QP2A 1G6AA 5AQBA 2WZZA 3PBOA 3BWLA 2PT7A 1BLPA 1LI9A 3LICA 2XGNA 3GTCA 2EWVA 4H6JA 1ZTUA 5CHJA 2J3WA 3IS2A 2QJ7A 2V1AA 1SKOB 1BT5A 5A92A 2Y2HA 3MZFA 3MZEA 3BEBA 2A49A 3E2LA 4B9OA 2CC1A 1DP6A 3DTIA 5FI2A 1DJCA 2V8CA 3IXHA 4PPRA 2J3TD 1MWTA 4OP8A 4UEYA 4HOIA 2EFXA 1CEGA 5C5KA 3M6HA 3TW8A 4BENA 1XXMA 4O7DA 2XQZA 3BFGA 4RQ9A 3QP4A 4HBTA 3VV4A 2PYRA 1TS0A 5J3WA 3B42A 3V67A 2WAEA 1K57C 1E3UD 4JF5A 1IOUA 2P08A 1QMFA 5DJUA 2OOLA 1XFQA 2EFUA 1K0KA 4LV2A 2V1BA 3RXXA 1OTIA 3GVBA 2ZJ9A 3S1YA 2O9AA 3R4KA 3NBLA 1LSXA 1RGYA 3H9WA 4DJ2A 1UGUA 4OPQA 4MN6A 1SDEA 4BD1A 1IELA 1P97A 4UHUA 4PKYA 3KSGA 4WUJA 1Q2QA 3PBRA 1O7EA 4PAUA 3RXWA 4S2NA 3LGOA 5JYPA 2V9AA 3PHYA 5CERA 2H0YA 2O0YA 4GZBA 4CJNA 3NULA 2IA2A 3MQ0A 3VE3A 3B33A 1W79A 4R4SA 3HLWA 3VE4A 3Q7VA 5HD3A 1FILA 3O88A 5IU1A 1F98A 3ZVTA 2HZ5A 4BMWA 2V2FF 2XR0A 4DF6A 4EQIA 2QPNA 4ZBEA 2QJ5A 1ERQA 1Y4OA 2OLUA 3IX4A 4O01A 1FR1A 4MBFA 4R1GA 3G4PA 3A3EA 2XRNA 1JTGA 4EETB 4C75A 4KQOA 2Y2QA 3NECA 3P98A 5FATA 5CHUA 3T4JA 1FCMA 2JE5A 3LR4A 3LIFA 2VK3A 1LHYA 2O9CA 1FSYA 3DW0A 1VEUA 1X0OA 4WLAA 2HDRA 3SH9A 4GNUA 1IKIA 4Q0IA 2JKFA 1K25A 4RVAA 1WYCA 5E2GA 5F82A 3HCYA 3FPWA 4EWFA 5HDSA 3D72A 1VHMA 1W7FA 4FD8A 4I3JA 1F5MA 4Y3IA 3ZYTA 3SZTA 2ZMFA 4UA7A 5F1GA 3MJQA 3N8LA 3DTKA 3UE3A 5CEDA 3BFFA 4OH0A 1NRJA 3NOUC 1Z09A 4NETA 1HZOA 4H6JB 3ZG9B 4KQDA 4U3TA 3VOLA 3KO6A 4KZ3A 3ZFZA 4LLOB 4S2KA 4CLCA 4HQAA 1XGIA 4HI4A 4HJ3A 4OLDA 2V0UA 2VZWA 4YOFA 3SOIA 5FQ9A 2PU2A 3KSFA 1GSVA 3PTEA 3FG8A 3TE8A 2XK1A 1SZVA 5JYOA 4BBUA 1UWNX 5CGXA 4IBXA 5MC7A 2Y2GA 1ES5A 3CZDA 3ULFA 1EW0A 4U0XA 3AGEA 3B3XA 4DRTA 1NZUA 4RYEA 3UB7A 3W2ZA 2PR5A 3S22A 1CJFA 1MXOA 4ESPA 1KVMA 3E4PA 3ZNYA 3EWKA 5HL1A 4Y0TA 2MJ6A 2P74A 3E0YA 3QHYA 1MWRA 1IYPA 1D1JA 4BLMA 2R78A 1H8MA 3GQZA 4R23A 1M40A 3CPTB 1JWZA 2VV7A 2HJEA 4BJPA 4MMNA 5J8XA 2OWJA 4JLFA 3PAGA 4HNBA 3A0VA 3GR2A 2B18A 5L09A 4GB7A 3OPRA 3C2WA 5CX7A 3QNCA 4GD8A 2H10A 5EOEA 3KYQA 1XA7A 2XA7M 2PD7A 3G32A 4NK3A 2B02A 5I5LA 3SH8A 4XT2B 2C5WB 1PYYA 5FAQA 5DF8A 2QHKA 2WGWA 3LR5A 1JTDA 3HJIA 4FTXA 4E3KA 2FH5A 1JWPA 3KYEA 3U2AA 3IBRA 4RX2A 4QJGA 2DMWA 2K2NA 4KG5A 3IH8A 2AVXA 5TJJA 1LI0A 3N4IA 3TOIA 5I94A 3DAVA 3PBTA 1G68A 1J3WA 1VEUB 1NRFA 1WA9A 1MWUA 3L7HA 3PAEA 5HAIA 3WWXA 1XPBA 2XF3A 2HDSA 3IF6C 1LL9A 4OPZA 2ZL1A 2ZQ8A 4MBKA 4UQIS 3O3VA 3ZQ5A 4LPZA 4K91A 3C4OA 1PI5A 2A3UA 5DTKA 1HTZA 3ZG5A 1TDGA 2Y91A 3A3FA 3UN7A 5KMWA 1FIKA 4ZAMA 5CECA 4GOGA 4G3WA 4CLCB 4PM5A 3CG5A 3C30A 4QPRA 4QWOA 1XX2A 4LRYC 1FCOA 4JKTA 5A8BA 4EU0A 4Z9QA 1PW8A 3A0RA 3FZCA 5LBRA 1HD8A 3LEQA 4OQHA 3GV9A 4KZ7A 2GNXA 2ZQ9A 5EVEA 1SDNA 4EERA 3OCLA 5A90A 4LRXC 1OTEA 3ZG8B 4Y2FA 1Y54A 5L10A 4P6ZM 3KX0X 5FDSA 2H0TA 2KLIA 4JGPA 3C7VA 3CLOA 5GLAA 3E2KA 1V9ZA 2Z6DA 1YAXA 4U0TA 3MKEA 3AGFA 3FWLA 1YLYA 3HLFA 4KZ4A 4I3IA 1CI9A 1DP8A 4B93A 4KZAA 3DBAA 1O07A 2Y59A 2PYPA 1VQQA 4IUKA 3ZCZA 4HP4A 2XDMA 4E3MA 4JBFA 4I38A 4EESA
chains in the Genus database with same CATH topology
2D02A 3MR0A 2CMNA 1NLYA 3T50A 2PD8A 1T1CA 5HDCA 1T1AA 2W3EA 1YKDA 2V1BA 1OTIA 5AVEA 2O9AA 3R4KA 1LSXA 3IS2B 3H9WA 4DJ2A 3NOTC 1UGUA 2M7UA 4HY8A 4Q0HA 4E04A 4MN6A 5HWVA 2D01A 3CI6A 2KX6A 4HH2A 3E4OA 3JVUA 1P97A 3C38A 4PKYA 4WELA 2I9VA 4HP9A 1MKMA 2PR6A 3BW6A 3F1PB 3KSGA 4WUJA 3PBRA 1LT0A 2VGLM 4NXGA 4EXOA 2VLGA 4PAUA 1N9NA 2QWSA 3F1NA 2HGVA 2VX8A 2JKRM 4OOMA 4EUVA 3B47A 3CAXA 5IS1A 4F3LB 4DJ3A 3BQ8A 5DKLA 3IBJA 2HV1A 2V9AA 4CLCD 3PHYA 1XJ6A 2O0YA 3F1OA 2P04A 2IA2A 3MQ0A 3VE3A 3CITA 4WN5A 1N9LA 5DFYA 3B33A 1V9YA 1OTDA 1OT9A 4DMZA 3VE4A 4EEUA 4BBTA 2NUTC 5HD3A 4NXEA 4KUOA 2W1TB 2JN7A 1OTAA 2J3TC 4MCWA 4I39A 1S1YA 5IU1A 1F98A 2QYBA 3BY9A 4ARZA 2ZOIA 3OLOA 3G6OA 4BMWA 3A0SA 4GW9A 2VKSA 1S4RA 4WEKA 1N9OA 1G6OA 5FL3A 4JGOA 3GECA 4HJ4A 2QJ5A 3OBFA 4HHDA 3LIBA 3LYXA 1S67L 2VV6A 4O01A 1NLZA 5KSHA 3OCNA 2W27A 4GS9B 5HZHA 2XRNA 2ZBBA 4EETB 2O9BA 4ME4A 2VGLS 3PXPA 4KQOA 3OOVA 5G4YA 3LIAA 1JNUA 5DF9A 4IJGA 3T4JA 4WL9A 2ZMVA 2XROA 3LR4A 2L0WA 3LIFA 4YNRA 2O9CA 3LIDA 4NEED 2HJ9C 4Z1WA 3S7NA 1X0OA 4MN5A 1YSQA 3NHQA 4WLAA 4FSFA 2YKFA 4Q0IA 4GHIA 2V0WA 2WKPA 3BQAA 3EEAA 1OPXA 1P9WA 3HCYA 4L9GA 3FPWA 5HDSA 3D72A 4ARZB 1VHMA 1GSWA 2L1MA 4I3JA 1F5MA 1YSPA 2W0NA 4Y3IA 1D06A 4CLCC 3ZYTA 4G3VA 2ZMFA 2JKTM 3MJQA 1LL8A 2LB5A 1KOUA 1VB6A 3UE3A 3E98A 1NRJA 1TF1A 2JHEA 3NJAA 3NOUC 3PBSA 3TRCA 2W3GA 4H6JB 4KQDA 3VOLA 3KO6A 2W1RA 2A2LA 3PBNA 4GCZA 3LR0A 4I5SA 4LLOB 4CLCA 4HQAA 1UWPX 3EQUA 1S4SA 2QKPA 4HI4A 1XJ2A 1ZHHB 3BY8A 4HJ3A 3R7WB 3O5YA 4EW7A 2V0UA 2VZWA 2OWHA 4YOFA 3KSHA 1NWZA 4AFIA 2O99A 5HPFA 4BWIA 4YWZA 5L8MA 3TJZC 1DP9A 3UMDA 4L0LA 2NUPC 4II7A 3KSFA 1GSVA 3K2NA 3FG8A 3H82A 3TE8A 1OT6A 4NXFA 2M7VA 2GX5A 1XFNA 4HH3A 5HDDA 2JKRI 4BBVA 1DRMA 2XSSA 4GHIB 4BBUA 1UWNX 1GSXA 4JGQA 5TBMA 2XA7S 5MC7A 5DJTA 1S1ZA 2Y79A 2EA9A 3ULFA 1EW0A 4Y5FA 3S7OA 3KSIA 4O0PA 1MZUA 3UB7A 2PDRA 3W2ZA 4ETZA 4MN7A 4XT2A 2PR5A 5F68A 3SW1A 4G3KA 2W3FA 3E4PA 3LUQA 4KUKA 3EWKA 2GZAA 3K3DA 5G4ZA 2MJ6A 3E0YA 4IUHA 3MQQA 3UE6A 3E4QA 2R78A 1H8MA 5EFWA 1D7EA 3NOPC 1TD5A 3T4QA 2OAP1 4EQ1A 4PHTA 2GJ3A 2VA0A 3F1NB 5HL6A 4NXBA 2VV7A 3H82B 2HJEA 5AVFA 4WF0A 4BJPA 5KIZA 4MMNA 2OWJA 4L9FA 2W3HA 4HNBA 3F1OB 3A0VA 2B18A 3RH8B 2FZ0A 3RFBA 1OJ5A 3C2WA 4K08A 5HD5A 2K7SA 4EEPA 2WKQA 5CX7A 3T4OA 5F5YA 2YKHA 3RTYA 2HF6A 1OJGA 3MFXA 3GDIA 3KYQA 3MF0A 2A24A 2XA7M 2PD7A 5HSQA 4I38A 1H3QA 2J80A 1XJ3A 2B02A 2KOIA 5I5LA 3T4SA 4F3LA 4R38A 4PKYG 4XT2B 3LR3A 4CLCE 1MC0A 1IFQA 1STZA 3BJNA 2JKTI 2QHKA 2P7JA 4ETXA 3LR5A 5J4EA 2W3DA 3HJIA 2FH5A 2W1TA 3CWFA 3T4KA 5DFXA 1LSWA 3U2AA 3K3CA 3IBRA 2Z6CA 1OTBA 2DMWA 2BASA 4HJ6A 4I3AA 3PBQA 1W63M 2K2NA 1TS7A 3MQOA 2VV8A 3P01A 3LIEA 4R6LA 2VJWA 4M4XA 2G7UA 5TJJA 1Y28A 3PBTA 3FC7A 4DN0A 3EEHA 2INWA 1WA9A 4R70A 4GS9A 5J7EA 4GJ4A 4P6ZS 1TS6A 5F69A 2K31A 3MXQA 5DKKA 4R3AA 4WEJA 4L9EA 3EOIA 5IT5A 3UB9A 4GLQA 1P0ZA 1P9RA 2A24B 5F6AA 2EWWA 1LSVA 3PYPA 4UQIS 2H28A 1TS8A 2M1CA 3ZQ5A 4LPZA 4MDZA 1F9IA 3UB8A 3EGXC 4NKPA 5HWTA 2VEAA 5K5BA 3UB6A 1T18A 1W63Q 3JVVA 3D3OA 4G3WA 4OOLA 4Q0JA 4CQHA 2PHYA 4IHQA 4CLCB 3C30A 4QPRA 3EGDC 4O8GA 4LRYC 5A8BA 3S7QA 3HJKA 3H7WA 3KYZA 4HIAA 3UMEA 4EU0A 1BYWA 2Y8HA 3A0RA 5LBRA 5AJGA 3LFVA 3PBOA 3BWLA 2PT7A 2OAQ1 3OC2A 2ZOHA 2EWVA 3P7NA 4ZRRA 1S66L 2GNXA 4H6JA 3MMHA 1ZTUA 3ICYA 2J3WA 1T1BA 3IS2A 4EERA 2QJ7A 2V1AA 3EQVA 3CUEC 3FPVA 3OCLA 5TBMB 4LRXC 2KDKA 1OTEA 3R7WA 3T4TA 3T4LA 4B9OA 4Y2FA 4P6ZM 1DP6A 3KX0X 3F1PA 1ODVA 5HPIA 3C8CA 2J3TD 4UEYA 2KLIA 4HOIA 4JGPA 2LB9A 4LRZE 3CLOA 5C5KA 1T19A 3TW8A 3LI8A 1V9ZA 2Z6DA 1YAXA 3CUEA 4RQ9A 4UQIM 4FOFA 1G28A 4JGRA 4I3IA 3VV4A 2PYRA 1DP8A 5HWWA 1TS0A 4B93A 5J3WA 1XJ4A 3B42A 3DBAA 3V67A 3S7PA 2PYPA 4IUKA 2WKRA 4HP4A 3H7WB 1IOUA 2P08A 2L4RA 3PR6A 3LI9A 5DJUA 2OOLA 3LICA 1XFQA 4EESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z1W A;  3S7N A;  1YSQ A;  3NHQ A;  3E0Y A;  2W3E A;  4IUH A;  1YKD A;  4Q0I A;  3ZQ5 A;  2O9A A;  3R4K A;  4MDZ A;  3EEA A;  3NOT C;  3HCY A;  2M7U A;  3NOP C;  1TD5 A;  4Q0H A;  4E04 A;  1VHM A;  2VEA A;  5K5B A;  3CI6 A;  5HL6 A;  1F5M A;  1YSP A;  4Y3I A;  3D3O A;  4MMN A;  1MKM A;  4G3V A;  2ZMF A;  4G3W A;  4Q0J A;  4CQH A;  2W3H A;  3KSG A;  2LB5 A;  2B18 A;  4QPR A;  4PAU A;  3RFB A;  3E98 A;  4O8G A;  4LRY C;  1TF1 A;  3C2W A;  3NOU C;  2HGV A;  3TRC A;  3S7Q A;  2W3G A;  4EUV A;  4EU0 A;  2Y8H A;  3IBJ A;  5LBR A;  3KO6 A;  5AJG A;  2W1R A;  2O0Y A;  3LFV A;  3MF0 A;  5HSQ A;  2IA2 A;  3MQ0 A;  3CIT A;  5DFY A;  3O5Y A;  2KOI A;  4ZRR A;  5I5L A;  2VZW A;  4DMZ A;  3MMH A;  4YOF A;  1ZTU A;  3KSH A;  2O99 A;  2W1T B;  5HPF A;  4BWI A;  4MCW A;  1MC0 A;  1STZ A;  5L8M A;  2QYB A;  3BJN A;  3G6O A;  4LRX C;  3KSF A;  3K2N A;  4GW9 A;  4ETX A;  2VKS A;  4Y2F A;  2W3D A;  2M7V A;  2GX5 A;  5HPI A;  2W1T A;  2XSS A;  5DFX A;  2KLI A;  3IBR A;  3OBF A;  2LB9 A;  4LRZ E;  5C5K A;  4O01 A;  2K2N A;  4RQ9 A;  4FOF A;  2Y79 A;  4R6L A;  2VJW A;  2G7U A;  5TJJ A;  2XRN A;  4Y5F A;  3VV4 A;  2O9B A;  4ME4 A;  3S7O A;  3KSI A;  4O0P A;  3OOV A;  4DN0 A;  3DBA A;  3W2Z A;  4ETZ A;  4MN7 A;  4IJG A;  4R70 A;  3S7P A;  4IUK A;  4G3K A;  2XRO A;  4YNR A;  2K31 A;  2W3F A;  2O9C A;  2OOL A;  4GLQ A; 
#chains in the Genus database with same CATH topology
 2ZQA A;  2D02 A;  2Z2M B;  3T50 A;  5HDC A;  1T1A A;  3ISG A;  5AVE A;  1YM1 A;  4D60 A;  4HY8 A;  2Y2L A;  3T1X A;  4S2N C;  3CI6 A;  4IVI A;  1K56 A;  4HH2 A;  2HPB A;  2EXB A;  3WS4 A;  4WEL A;  2I9V A;  4QHC A;  1PFL A;  4HP9 A;  1U60 A;  3LCE A;  3BRM A;  5M19 A;  1LT0 A;  2VLG A;  1W8Q A;  4WMC A;  3F1N A;  2HGV A;  1RGZ A;  3VP2 A;  2VX8 A;  2ZC3 B;  4OOM A;  5M18 A;  3Q82 A;  3BQ8 A;  5DKL A;  4KZ8 A;  1A0K A;  4X68 A;  4X53 A;  3W4P A;  2ZQC A;  5GHY A;  1V9Y A;  4BL3 A;  3VP1 A;  4EEU A;  2EX8 A;  2JN7 A;  3BY9 A;  2ZOI A;  3OLO A;  3G6O A;  2OLV A;  4GW9 A;  5E2H A;  5EE8 A;  1KE3 A;  4N9L A;  4JGO A;  2HDU A;  4HJ4 A;  1K55 A;  1S67 L;  3SS5 A;  2RL3 A;  2W27 A;  5A91 A;  3BFD A;  1DY6 A;  4MBH A;  2Z2L B;  5EVI B;  4B88 A;  1J9M A;  5G4Y A;  3LIA A;  5DF9 A;  4WL9 A;  2XRO A;  4KG2 A;  3HLE A;  2ZL1 B;  2ZC7 A;  4Y13 A;  2ZQD A;  2HDQ A;  4NEE D;  2HJ9 C;  3UO9 A;  4Z1W A;  4OOY A;  1YSQ A;  2PAV P;  2Y4A A;  2YKF A;  3LY4 A;  3VP3 A;  3NY4 A;  3EEA A;  3GSG A;  1CI8 A;  2V1Z A;  2IWD A;  4ARZ B;  3HVF A;  4BQM A;  4CLC C;  3G2Z A;  4E6X A;  3WRZ A;  1C3B A;  2JHE A;  1YMS A;  2A2L A;  4GCZ A;  5CHM A;  2XFT A;  3LR0 A;  4N9K A;  3EQU A;  1S4S A;  3UE1 A;  4C3Q A;  2ZC5 B;  2QKP A;  3BY8 A;  3O5Y A;  4EW7 A;  4KZ9 A;  4WZ5 A;  3KSH A;  2O99 A;  2RCX A;  4BWI A;  4YWZ A;  3CPT A;  3DTM A;  5L8M A;  3TJZ C;  4P0M A;  3K2N A;  3IXG A;  4Y0U A;  4MEZ A;  2GX5 A;  4JF6 A;  1DRM A;  3IWO A;  4JXS A;  4PM9 A;  4S2L A;  5DJT A;  5GHZ A;  1S1Z A;  2G2U A;  2Y79 A;  4CPK A;  3AGD A;  1ZKJ A;  1IYQ A;  4Y5F A;  3QNB A;  2QMI A;  4XT2 A;  4JXG A;  2Y2N A;  5DTS A;  3VFH A;  4IVK A;  1L0D A;  1GCE A;  1WE4 A;  3A3I A;  4LCM A;  4KUK A;  1LLB A;  3K3D A;  5G4Z A;  3W8K A;  3Q07 A;  2UWX A;  2HP9 A;  4IUH A;  2WAF A;  5HAQ A;  3MQQ A;  5FI6 A;  1SHV A;  4LGW A;  4GD6 A;  2ZM8 A;  5FQI A;  3NOP C;  3T4Q A;  2XLN A;  5TFQ A;  4Y0O A;  4YFM A;  2VA0 A;  3F1N B;  3RJU A;  3H82 B;  5AVF A;  1ALQ A;  1JVJ A;  3RH8 B;  1VM1 A;  5DF7 A;  1OJ5 A;  1XP4 A;  3JPU A;  2YKH A;  2X71 A;  3RTY A;  3MFX A;  2ZQ7 A;  4DXB A;  3G31 A;  1RP5 A;  3QP1 A;  3VOY A;  3ZHH A;  4QB8 A;  1F2K A;  4C6Y A;  1BLC A;  4F3L A;  3V39 A;  3LR3 A;  5FA7 A;  4LV1 A;  1IFQ A;  1FOF A;  4ETX A;  3A3J A;  1YPR A;  2J8Y A;  1E4D A;  5KSC A;  2Z6C A;  4I3A A;  1W63 M;  2WZX A;  2Y2K A;  4S2I A;  4X56 A;  4R6L A;  1KE4 A;  3OPL A;  3FC7 A;  2Q0O A;  1I2W A;  1YLT A;  1TS6 A;  5F69 A;  2K31 A;  4L9E A;  3HL9 A;  4GLQ A;  1ZC2 A;  1P0Z A;  2A24 B;  5FQK A;  1KGE A;  1FCN A;  4OPY A;  1TS8 A;  4BL2 A;  5HX9 A;  2HP5 A;  1I2S A;  4MDZ A;  2I72 A;  4QD4 A;  5GLC A;  4UAA A;  3EGX C;  4NKP A;  1H5X A;  2VEA A;  1JWV A;  2XFS A;  3UB6 A;  5FAS A;  3JVV A;  5GLD A;  4MLL A;  2E8J A;  1PW1 A;  4CQH A;  3S4X A;  2WGV A;  2PBD P;  1YLJ A;  4PMA A;  5AJG A;  3LFV A;  3OC2 A;  2WGI A;  2ZOH A;  3P7N A;  4OP5 A;  5FAO A;  3MMH A;  3V3R A;  1T1B A;  3QP8 A;  2G2W A;  3EQV A;  3NI9 A;  4K0W A;  5FDH A;  3FPV A;  4OLG A;  2KDK A;  3IQA A;  4JXW A;  3R7W A;  3T4T A;  3T4L A;  1GA0 A;  1ODV A;  3Q81 A;  5E43 A;  3C8C A;  3ZGA B;  4LRZ E;  1T19 A;  1ZG4 A;  4EBN A;  1DJA A;  4EV4 A;  4N1X A;  4WBG A;  4DKI A;  1TDL A;  3CUE A;  4UQI M;  4FOF A;  1KGF A;  4S2M A;  1K6S A;  3UPO A;  3IF5 A;  5HAP A;  3MFD A;  3SH7 A;  4FH4 A;  5HWW A;  5CGS A;  4OQG A;  1XJ4 A;  3FV7 A;  4Y17 A;  2WKR A;  1ACF A;  2QZ6 A;  3PR6 A;  3MBZ A;  4NG2 A;  1OME A;  1PNE A;  2CMN A;  1FR6 A;  2W3E A;  3IWQ A;  1BTL A;  2UV0 E;  1H8Y A;  4M3K A;  2M7U A;  5L2F A;  1H0M A;  1LL5 A;  5HWV A;  1YLZ A;  3I7J A;  2KX6 A;  2ZMA A;  4JF4 A;  3E4O A;  3JVU A;  1ZG6 A;  5EVI A;  3VFF A;  1BLS A;  1MKM A;  3F1P B;  4EXO A;  1N9N A;  4Y15 A;  4HBU A;  1EWZ A;  2JKR M;  1PRQ A;  3CAX A;  5EOO A;  4F3L B;  2R9W A;  1S6R A;  2HV1 A;  3IX3 A;  2ZM0 A;  1HVB A;  4KZB A;  2P04 A;  3CIT A;  2V20 A;  1SCW A;  1OTD A;  1K55 C;  1OT9 A;  4DMZ A;  4BBT A;  4BD0 A;  4LCL A;  4NXE A;  5HW3 A;  4KUO A;  2J3T C;  4MCW A;  4I39 A;  1BUE A;  4ARZ A;  5TGF A;  1ES3 A;  2VKS A;  1S4R A;  4WEK A;  1N9O A;  5FL3 A;  4FH2 A;  3GEC A;  3UDX A;  3OBF A;  4HHD A;  5A93 A;  3LIB A;  3LYX A;  1NLZ A;  4PM8 A;  3BFC A;  3HLD A;  5HZH A;  3CJM A;  1XA1 A;  4ME4 A;  4DDS A;  1MPL A;  2ZMV A;  2L0W A;  4QY6 A;  3D9Y A;  1PIO A;  4FCF A;  4S2P A;  3LID A;  3S7N A;  4MN5 A;  2J7V A;  4FSF A;  1YLP A;  5EEC A;  2V0W A;  2WKP A;  1OPX A;  5EM0 A;  1P9W A;  1IEM A;  2L1M A;  4LV3 A;  2W0N A;  3WRT A;  1D06 A;  3HBR A;  2PRF A;  2JKT M;  4QY5 A;  4ZJ2 A;  4D2O A;  1KOU A;  1VB6 A;  4WZ5 C;  3E98 A;  3PBS A;  4UA6 A;  3NJA A;  3TRC A;  2W3G A;  3MZD A;  3D4F A;  2C6W B;  3LEZ A;  2W1R A;  3PBN A;  3ZG7 B;  1ONG A;  4I5S A;  1YMX A;  4GKU A;  1TVF A;  5U47 A;  1XJ2 A;  3R7W B;  2XD1 A;  3LO7 A;  5CXW A;  4AFI A;  3M6B A;  3WS2 A;  1NYM A;  3JYI A;  1PWC A;  1DP9 A;  3OPP A;  4QU3 A;  3UMD A;  2NUP C;  4OQ0 A;  4WYY A;  3H82 A;  1ESI A;  1OT6 A;  2V8F A;  2VGK A;  3N6I A;  1TEM A;  4HH3 A;  5HDD A;  1ES2 A;  2XSS A;  1Z6F A;  4GHI B;  3ITA A;  1GSX A;  4JGQ A;  5TBM A;  1ERM A;  3Q7Z A;  4R3B A;  4B4X A;  1WYB A;  2EA9 A;  3NCK A;  4E3I A;  3GRJ A;  3O86 A;  3NC8 A;  4X6T A;  3KSI A;  4O0P A;  1K56 D;  2PDR A;  4ETZ A;  5L07 A;  1KDS A;  5F68 A;  3SW1 A;  1K54 A;  3VMA A;  2W3F A;  3G35 A;  4S2O A;  4LFU A;  5F83 A;  4ID4 A;  4P87 A;  4WMC D;  1NYY A;  1PZO A;  4S2J A;  3UE6 A;  4WZ4 A;  3E4Q A;  4X1M A;  2B95 A;  4H8R A;  2WKE A;  5EFW A;  2OAP 1;  3ZNT A;  1BSG A;  4LV0 A;  3O87 A;  4Y7P A;  3FKW A;  3HRE A;  4WF0 A;  1E3U A;  4XXR A;  4N92 A;  4XUZ A;  3M2K A;  2W3H A;  1MKI A;  3UDF A;  2ACG A;  2FZ0 A;  4KQR A;  2Q9N A;  1PWG A;  4K08 A;  5HD5 A;  2K7S A;  4P85 A;  2WKQ A;  3DWZ A;  5G18 A;  4EEP A;  4EBP A;  5F5Y A;  2ZC4 B;  3V5M A;  4R0Q A;  1OJG A;  3GDI A;  3NDE A;  4B4Z A;  2A24 A;  5HSQ A;  1IYO A;  5AQ7 A;  2J80 A;  5AQ9 A;  4JPM A;  1I5Q A;  2JBF A;  1RCJ A;  4CLC E;  1STZ A;  5KZH A;  3BJN A;  1EI5 A;  2P7J A;  5J4E A;  2W3D A;  2EXA A;  3M2J A;  2W1T A;  2EX2 A;  3MXS A;  1LSW A;  3BEC A;  3IX8 A;  1S0W A;  3CHW P;  1BUL A;  1KE0 A;  3MQO A;  3P01 A;  5D3O A;  4K0X A;  3HLG A;  3LIE A;  5CTN A;  2VJW A;  4X1L A;  4M4X A;  4DE3 A;  1W5D A;  2INW A;  3IXB A;  4IED A;  2FFF B;  3G30 A;  4GS9 A;  5J7E A;  4GJ4 A;  2FFY A;  1YQS A;  3MXQ A;  5DKK A;  4R3A A;  4PM7 A;  3HUM A;  5AQA A;  1XKZ A;  3UB9 A;  4R3J A;  1P9R A;  4XUX A;  2EWW A;  1FQG A;  3PYP A;  2H28 A;  4X69 A;  4P6B A;  3UB8 A;  3VOZ A;  5HWT A;  4F94 A;  1KDW A;  1W63 Q;  1DJB A;  4ZTK A;  1NJ4 A;  4UA9 A;  3GMW A;  1GHM A;  3SS4 A;  4OOL A;  4Q0J A;  3C7U A;  3EGD C;  4O8G A;  3U4L P;  3KYZ A;  4HIA A;  3UME A;  1BYW A;  3ZDJ A;  1K6R A;  5FQJ A;  5EPH A;  2OAQ 1;  1ESU A;  3UE0 A;  4ZRR A;  1S66 L;  1IYS A;  2J9P A;  3ICY A;  3OZH A;  4OQI A;  3OPH A;  2IWB A;  3UPN A;  3L9K A;  3CUE C;  5EUA A;  5TBM B;  2JC7 A;  2DCF A;  3QP6 A;  3F1P A;  1VET A;  5HPI A;  5HAR A;  4OON A;  4YIN A;  2LB9 A;  4JXV A;  2OSU A;  3LI8 A;  4KZ5 A;  1NY0 A;  3ZG0 A;  5CEB A;  1YT4 A;  3NIA A;  3N8R A;  2GDN A;  1G28 A;  2XH9 A;  4JGR A;  3IF6 B;  3UDI A;  3S7P A;  1CQA A;  2JKG A;  2VGJ A;  2ZLY A;  3H7W B;  3A3D A;  1IKG A;  3IXD A;  2L4R A;  3LI9 A;  3UNW A;  2XD5 A;  2WUQ A;  3MR0 A;  5FSR A;  1L0F A;  1NLY A;  5EVI C;  2ZM2 A;  2PD8 A;  1T1C A;  1CEF A;  1K4E A;  2BLS A;  3VSL A;  2Y2J A;  1YKD A;  3MSH A;  1K57 A;  3IS2 B;  1PI4 A;  2WAD A;  1FSW A;  3NOT C;  4Q0H A;  4E04 A;  5IHV A;  2D01 A;  3V3S A;  3C38 A;  2PR6 A;  3BW6 A;  5FAP A;  2PU4 A;  3T1R A;  2VGL M;  4NXG A;  3BYD A;  2QWS A;  3LY3 A;  3FKV A;  4EUV A;  1GHI A;  3B47 A;  5IS1 A;  4MNR A;  5CRF A;  4DJ3 A;  4CLC D;  3IBJ A;  1XJ6 A;  3VP4 A;  3F1O A;  2EX9 A;  4WN5 A;  1N9L A;  5DFY A;  2EX6 A;  3W4O A;  2NUT C;  2W1T B;  2WKI A;  1OTA A;  4DDY A;  1S1Y A;  4E3N A;  2QYB A;  1H8Z A;  3A0S A;  3Q1F A;  1G6O A;  5DTT A;  2P9V A;  3P09 A;  2JCH A;  2Y2O A;  4ZJ1 A;  5E2E A;  2VV6 A;  3N8S A;  5KSH A;  3OCN A;  2BG1 A;  4N1H A;  4GS9 B;  2Y2M A;  3IWI A;  3W4Q A;  3TSG A;  3BLM A;  2ZBB A;  4Q8I A;  3WS0 A;  2WK0 A;  3HUN A;  2X01 A;  3T12 B;  2O9B A;  1MBL A;  2VGL S;  3PXP A;  3OOV A;  4KQQ A;  1JNU A;  3VSK A;  4IJG A;  2BTF P;  2DNS A;  4YNR A;  2PBY A;  3N7W A;  1NXY A;  5M1A A;  2WKH A;  4LEN A;  3NHQ A;  3HLB A;  4GHI A;  2ZD8 A;  3SS3 A;  5EVL A;  3Q7V B;  1M6K A;  5EM1 A;  3BQA A;  4WM9 A;  1HLU P;  4L9G A;  2DRW A;  3DWK A;  4FUW A;  1GSW A;  2HP6 A;  1YSP A;  4ZJ3 A;  4G3V A;  1ERO A;  1LL8 A;  2LB5 A;  4E6W A;  1PZP A;  1TF1 A;  3UY6 A;  4GDB A;  3C5A A;  5FI7 A;  1W8Y A;  4DE1 A;  3VP0 A;  4DE2 A;  1MWS A;  3IHB A;  3HLC A;  4KEN B;  1UWP X;  4DXC A;  2OV5 A;  4KG6 A;  3TG9 A;  5FQQ A;  1ZHH B;  3IHA A;  2OWH A;  2R9X A;  1NWZ A;  1VET B;  5HPF A;  4OKP A;  3BLS A;  3QP5 A;  4L0L A;  4II7 A;  1Q2P A;  1CK3 A;  4NXF A;  2M7V A;  4EBL A;  1XFN A;  4R4R A;  2JKR I;  4OPR A;  3UPP A;  4BBV A;  1SKO A;  1ONH A;  3UB5 P;  2XA7 S;  1NZO A;  3HUO A;  3WS5 A;  1K54 C;  5GL9 A;  4EUZ A;  2Y2P A;  1AWI A;  3CMZ A;  3MKF A;  3S7O A;  5GLB A;  4ZDX A;  1MZU A;  2H5S A;  4MN7 A;  4G3K A;  5EVI D;  1KGG A;  1G5U A;  2E8I A;  1K38 A;  3LUQ A;  3IH9 A;  2GZA A;  3IT9 A;  2WYX A;  4GN2 A;  1N9B A;  1L0E A;  1SKF A;  2IWC A;  3ZVW A;  1YLW A;  4HES A;  1D7E A;  1TD5 A;  3G2Y A;  4EQ1 A;  3FYZ A;  4PHT A;  2GJ3 A;  2Q9M A;  4X55 A;  1K4F A;  5HL6 A;  4NXB A;  5KIZ A;  5BOH A;  3T1Q B;  4L9F A;  3F1O B;  4RA7 A;  3NDG A;  3RFB A;  5TR7 A;  3T4O A;  2X02 A;  1CF0 A;  5FEF A;  2HF6 A;  2Y55 A;  3MF0 A;  1BZA A;  3G34 A;  3V50 A;  5EV0 A;  1L2S A;  1BLH A;  1H3Q A;  1XJ3 A;  2B5R A;  2KOI A;  3T4S A;  4R38 A;  4PKY G;  5E2F A;  1PWD A;  1MY8 A;  4PM6 A;  1MC0 A;  2P9V B;  3MXR A;  2JKT I;  4A5R A;  5FQM A;  1L3L A;  1L0G A;  1KVL A;  4X25 A;  3T4K A;  3CWF A;  4IBR A;  5CGW A;  5DFX A;  3K3C A;  1OTB A;  1AXB A;  2BAS A;  4HJ6 A;  4E3J A;  3PBQ A;  1GA9 A;  1TS7 A;  2ZC6 B;  2VV8 A;  3MS6 A;  3ITB A;  2G7U A;  2XEP A;  1Y28 A;  1ES4 A;  4DN0 A;  3BFE A;  3EEH A;  5GHX A;  4R70 A;  3BM6 A;  1XGJ A;  4P6Z S;  4WEJ A;  4RX3 A;  3EOI A;  5IT5 A;  2Y2I A;  5FEG A;  4E3L A;  5DVA A;  5F6A A;  3DTE A;  1LSV A;  4GDN A;  5F1F A;  2M1C A;  4OVD A;  4HEF A;  4DE0 A;  1F9I A;  1GHP A;  1N4O A;  5K5B A;  5HFO A;  2WGW B;  3T1S A;  1E25 A;  1T18 A;  3D3O A;  1QME A;  3IF6 A;  2J9O A;  4E3O A;  2PHY A;  4IHQ A;  5CTM A;  4KZ6 A;  3WS1 A;  3S7Q A;  3HJK A;  3H7W A;  3C4P A;  2Y8H A;  3QP2 A;  1G6A A;  5AQB A;  2WZZ A;  3PBO A;  3BWL A;  2PT7 A;  1BLP A;  1LI9 A;  3LIC A;  2XGN A;  3GTC A;  2EWV A;  4H6J A;  1ZTU A;  5CHJ A;  2J3W A;  3IS2 A;  2QJ7 A;  2V1A A;  1SKO B;  1BT5 A;  5A92 A;  2Y2H A;  3MZF A;  3MZE A;  3BEB A;  2A49 A;  3E2L A;  4B9O A;  2CC1 A;  1DP6 A;  3DTI A;  5FI2 A;  1DJC A;  2V8C A;  3IXH A;  4PPR A;  2J3T D;  1MWT A;  4OP8 A;  4UEY A;  4HOI A;  2EFX A;  1CEG A;  5C5K A;  3M6H A;  3TW8 A;  4BEN A;  1XXM A;  4O7D A;  2XQZ A;  3BFG A;  4RQ9 A;  3QP4 A;  4HBT A;  3VV4 A;  2PYR A;  1TS0 A;  5J3W A;  3B42 A;  3V67 A;  2WAE A;  1K57 C;  1E3U D;  4JF5 A;  1IOU A;  2P08 A;  1QMF A;  5DJU A;  2OOL A;  1XFQ A;  2EFU A;  1K0K A;  4LV2 A;  2V1B A;  3RXX A;  1OTI A;  3GVB A;  2ZJ9 A;  3S1Y A;  2O9A A;  3R4K A;  3NBL A;  1LSX A;  1RGY A;  3H9W A;  4DJ2 A;  1UGU A;  4OPQ A;  4MN6 A;  1SDE A;  4BD1 A;  1IEL A;  1P97 A;  4UHU A;  4PKY A;  3KSG A;  4WUJ A;  1Q2Q A;  3PBR A;  1O7E A;  4PAU A;  3RXW A;  4S2N A;  3LGO A;  5JYP A;  2V9A A;  3PHY A;  5CER A;  2H0Y A;  2O0Y A;  4GZB A;  4CJN A;  3NUL A;  2IA2 A;  3MQ0 A;  3VE3 A;  3B33 A;  1W79 A;  4R4S A;  3HLW A;  3VE4 A;  3Q7V A;  5HD3 A;  1FIL A;  3O88 A;  5IU1 A;  1F98 A;  3ZVT A;  2HZ5 A;  4BMW A;  2V2F F;  2XR0 A;  4DF6 A;  4EQI A;  2QPN A;  4ZBE A;  2QJ5 A;  1ERQ A;  1Y4O A;  2OLU A;  3IX4 A;  4O01 A;  1FR1 A;  4MBF A;  4R1G A;  3G4P A;  3A3E A;  2XRN A;  1JTG A;  4EET B;  4C75 A;  4KQO A;  2Y2Q A;  3NEC A;  3P98 A;  5FAT A;  5CHU A;  3T4J A;  1FCM A;  2JE5 A;  3LR4 A;  3LIF A;  2VK3 A;  1LHY A;  2O9C A;  1FSY A;  3DW0 A;  1VEU A;  1X0O A;  4WLA A;  2HDR A;  3SH9 A;  4GNU A;  1IKI A;  4Q0I A;  2JKF A;  1K25 A;  4RVA A;  1WYC A;  5E2G A;  5F82 A;  3HCY A;  3FPW A;  4EWF A;  5HDS A;  3D72 A;  1VHM A;  1W7F A;  4FD8 A;  4I3J A;  1F5M A;  4Y3I A;  3ZYT A;  3SZT A;  2ZMF A;  4UA7 A;  5F1G A;  3MJQ A;  3N8L A;  3DTK A;  3UE3 A;  5CED A;  3BFF A;  4OH0 A;  1NRJ A;  3NOU C;  1Z09 A;  4NET A;  1HZO A;  4H6J B;  3ZG9 B;  4KQD A;  4U3T A;  3VOL A;  3KO6 A;  4KZ3 A;  3ZFZ A;  4LLO B;  4S2K A;  4CLC A;  4HQA A;  1XGI A;  4HI4 A;  4HJ3 A;  4OLD A;  2V0U A;  2VZW A;  4YOF A;  3SOI A;  5FQ9 A;  2PU2 A;  3KSF A;  1GSV A;  3PTE A;  3FG8 A;  3TE8 A;  2XK1 A;  1SZV A;  5JYO A;  4BBU A;  1UWN X;  5CGX A;  4IBX A;  5MC7 A;  2Y2G A;  1ES5 A;  3CZD A;  3ULF A;  1EW0 A;  4U0X A;  3AGE A;  3B3X A;  4DRT A;  1NZU A;  4RYE A;  3UB7 A;  3W2Z A;  2PR5 A;  3S22 A;  1CJF A;  1MXO A;  4ESP A;  1KVM A;  3E4P A;  3ZNY A;  3EWK A;  5HL1 A;  4Y0T A;  2MJ6 A;  2P74 A;  3E0Y A;  3QHY A;  1MWR A;  1IYP A;  1D1J A;  4BLM A;  2R78 A;  1H8M A;  3GQZ A;  4R23 A;  1M40 A;  3CPT B;  1JWZ A;  2VV7 A;  2HJE A;  4BJP A;  4MMN A;  5J8X A;  2OWJ A;  4JLF A;  3PAG A;  4HNB A;  3A0V A;  3GR2 A;  2B18 A;  5L09 A;  4GB7 A;  3OPR A;  3C2W A;  5CX7 A;  3QNC A;  4GD8 A;  2H10 A;  5EOE A;  3KYQ A;  1XA7 A;  2XA7 M;  2PD7 A;  3G32 A;  4NK3 A;  2B02 A;  5I5L A;  3SH8 A;  4XT2 B;  2C5W B;  1PYY A;  5FAQ A;  5DF8 A;  2QHK A;  2WGW A;  3LR5 A;  1JTD A;  3HJI A;  4FTX A;  4E3K A;  2FH5 A;  1JWP A;  3KYE A;  3U2A A;  3IBR A;  4RX2 A;  4QJG A;  2DMW A;  2K2N A;  4KG5 A;  3IH8 A;  2AVX A;  5TJJ A;  1LI0 A;  3N4I A;  3TOI A;  5I94 A;  3DAV A;  3PBT A;  1G68 A;  1J3W A;  1VEU B;  1NRF A;  1WA9 A;  1MWU A;  3L7H A;  3PAE A;  5HAI A;  3WWX A;  1XPB A;  2XF3 A;  2HDS A;  3IF6 C;  1LL9 A;  4OPZ A;  2ZL1 A;  2ZQ8 A;  4MBK A;  4UQI S;  3O3V A;  3ZQ5 A;  4LPZ A;  4K91 A;  3C4O A;  1PI5 A;  2A3U A;  5DTK A;  1HTZ A;  3ZG5 A;  1TDG A;  2Y91 A;  3A3F A;  3UN7 A;  5KMW A;  1FIK A;  4ZAM A;  5CEC A;  4GOG A;  4G3W A;  4CLC B;  4PM5 A;  3CG5 A;  3C30 A;  4QPR A;  4QWO A;  1XX2 A;  4LRY C;  1FCO A;  4JKT A;  5A8B A;  4EU0 A;  4Z9Q A;  1PW8 A;  3A0R A;  3FZC A;  5LBR A;  1HD8 A;  3LEQ A;  4OQH A;  3GV9 A;  4KZ7 A;  2GNX A;  2ZQ9 A;  5EVE A;  1SDN A;  4EER A;  3OCL A;  5A90 A;  4LRX C;  1OTE A;  3ZG8 B;  4Y2F A;  1Y54 A;  5L10 A;  4P6Z M;  3KX0 X;  5FDS A;  2H0T A;  2KLI A;  4JGP A;  3C7V A;  3CLO A;  5GLA A;  3E2K A;  1V9Z A;  2Z6D A;  1YAX A;  4U0T A;  3MKE A;  3AGF A;  3FWL A;  1YLY A;  3HLF A;  4KZ4 A;  4I3I A;  1CI9 A;  1DP8 A;  4B93 A;  4KZA A;  3DBA A;  1O07 A;  2Y59 A;  2PYP A;  1VQQ A;  4IUK A;  3ZCZ A;  4HP4 A;  2XDM A;  4E3M A;  4JBF A;  4I38 A;  4EES A; 
#chains in the Genus database with same CATH homology
 2D02 A;  3MR0 A;  2CMN A;  1NLY A;  3T50 A;  2PD8 A;  1T1C A;  5HDC A;  1T1A A;  2W3E A;  1YKD A;  2V1B A;  1OTI A;  5AVE A;  2O9A A;  3R4K A;  1LSX A;  3IS2 B;  3H9W A;  4DJ2 A;  3NOT C;  1UGU A;  2M7U A;  4HY8 A;  4Q0H A;  4E04 A;  4MN6 A;  5HWV A;  2D01 A;  3CI6 A;  2KX6 A;  4HH2 A;  3E4O A;  3JVU A;  1P97 A;  3C38 A;  4PKY A;  4WEL A;  2I9V A;  4HP9 A;  1MKM A;  2PR6 A;  3BW6 A;  3F1P B;  3KSG A;  4WUJ A;  3PBR A;  1LT0 A;  2VGL M;  4NXG A;  4EXO A;  2VLG A;  4PAU A;  1N9N A;  2QWS A;  3F1N A;  2HGV A;  2VX8 A;  2JKR M;  4OOM A;  4EUV A;  3B47 A;  3CAX A;  5IS1 A;  4F3L B;  4DJ3 A;  3BQ8 A;  5DKL A;  3IBJ A;  2HV1 A;  2V9A A;  4CLC D;  3PHY A;  1XJ6 A;  2O0Y A;  3F1O A;  2P04 A;  2IA2 A;  3MQ0 A;  3VE3 A;  3CIT A;  4WN5 A;  1N9L A;  5DFY A;  3B33 A;  1V9Y A;  1OTD A;  1OT9 A;  4DMZ A;  3VE4 A;  4EEU A;  4BBT A;  2NUT C;  5HD3 A;  4NXE A;  4KUO A;  2W1T B;  2JN7 A;  1OTA A;  2J3T C;  4MCW A;  4I39 A;  1S1Y A;  5IU1 A;  1F98 A;  2QYB A;  3BY9 A;  4ARZ A;  2ZOI A;  3OLO A;  3G6O A;  4BMW A;  3A0S A;  4GW9 A;  2VKS A;  1S4R A;  4WEK A;  1N9O A;  1G6O A;  5FL3 A;  4JGO A;  3GEC A;  4HJ4 A;  2QJ5 A;  3OBF A;  4HHD A;  3LIB A;  3LYX A;  1S67 L;  2VV6 A;  4O01 A;  1NLZ A;  5KSH A;  3OCN A;  2W27 A;  4GS9 B;  5HZH A;  2XRN A;  2ZBB A;  4EET B;  2O9B A;  4ME4 A;  2VGL S;  3PXP A;  4KQO A;  3OOV A;  5G4Y A;  3LIA A;  1JNU A;  5DF9 A;  4IJG A;  3T4J A;  4WL9 A;  2ZMV A;  2XRO A;  3LR4 A;  2L0W A;  3LIF A;  4YNR A;  2O9C A;  3LID A;  4NEE D;  2HJ9 C;  4Z1W A;  3S7N A;  1X0O A;  4MN5 A;  1YSQ A;  3NHQ A;  4WLA A;  4FSF A;  2YKF A;  4Q0I A;  4GHI A;  2V0W A;  2WKP A;  3BQA A;  3EEA A;  1OPX A;  1P9W A;  3HCY A;  4L9G A;  3FPW A;  5HDS A;  3D72 A;  4ARZ B;  1VHM A;  1GSW A;  2L1M A;  4I3J A;  1F5M A;  1YSP A;  2W0N A;  4Y3I A;  1D06 A;  4CLC C;  3ZYT A;  4G3V A;  2ZMF A;  2JKT M;  3MJQ A;  1LL8 A;  2LB5 A;  1KOU A;  1VB6 A;  3UE3 A;  3E98 A;  1NRJ A;  1TF1 A;  2JHE A;  3NJA A;  3NOU C;  3PBS A;  3TRC A;  2W3G A;  4H6J B;  4KQD A;  3VOL A;  3KO6 A;  2W1R A;  2A2L A;  3PBN A;  4GCZ A;  3LR0 A;  4I5S A;  4LLO B;  4CLC A;  4HQA A;  1UWP X;  3EQU A;  1S4S A;  2QKP A;  4HI4 A;  1XJ2 A;  1ZHH B;  3BY8 A;  4HJ3 A;  3R7W B;  3O5Y A;  4EW7 A;  2V0U A;  2VZW A;  2OWH A;  4YOF A;  3KSH A;  1NWZ A;  4AFI A;  2O99 A;  5HPF A;  4BWI A;  4YWZ A;  5L8M A;  3TJZ C;  1DP9 A;  3UMD A;  4L0L A;  2NUP C;  4II7 A;  3KSF A;  1GSV A;  3K2N A;  3FG8 A;  3H82 A;  3TE8 A;  1OT6 A;  4NXF A;  2M7V A;  2GX5 A;  1XFN A;  4HH3 A;  5HDD A;  2JKR I;  4BBV A;  1DRM A;  2XSS A;  4GHI B;  4BBU A;  1UWN X;  1GSX A;  4JGQ A;  5TBM A;  2XA7 S;  5MC7 A;  5DJT A;  1S1Z A;  2Y79 A;  2EA9 A;  3ULF A;  1EW0 A;  4Y5F A;  3S7O A;  3KSI A;  4O0P A;  1MZU A;  3UB7 A;  2PDR A;  3W2Z A;  4ETZ A;  4MN7 A;  4XT2 A;  2PR5 A;  5F68 A;  3SW1 A;  4G3K A;  2W3F A;  3E4P A;  3LUQ A;  4KUK A;  3EWK A;  2GZA A;  3K3D A;  5G4Z A;  2MJ6 A;  3E0Y A;  4IUH A;  3MQQ A;  3UE6 A;  3E4Q A;  2R78 A;  1H8M A;  5EFW A;  1D7E A;  3NOP C;  1TD5 A;  3T4Q A;  2OAP 1;  4EQ1 A;  4PHT A;  2GJ3 A;  2VA0 A;  3F1N B;  5HL6 A;  4NXB A;  2VV7 A;  3H82 B;  2HJE A;  5AVF A;  4WF0 A;  4BJP A;  5KIZ A;  4MMN A;  2OWJ A;  4L9F A;  2W3H A;  4HNB A;  3F1O B;  3A0V A;  2B18 A;  3RH8 B;  2FZ0 A;  3RFB A;  1OJ5 A;  3C2W A;  4K08 A;  5HD5 A;  2K7S A;  4EEP A;  2WKQ A;  5CX7 A;  3T4O A;  5F5Y A;  2YKH A;  3RTY A;  2HF6 A;  1OJG A;  3MFX A;  3GDI A;  3KYQ A;  3MF0 A;  2A24 A;  2XA7 M;  2PD7 A;  5HSQ A;  4I38 A;  1H3Q A;  2J80 A;  1XJ3 A;  2B02 A;  2KOI A;  5I5L A;  3T4S A;  4F3L A;  4R38 A;  4PKY G;  4XT2 B;  3LR3 A;  4CLC E;  1MC0 A;  1IFQ A;  1STZ A;  3BJN A;  2JKT I;  2QHK A;  2P7J A;  4ETX A;  3LR5 A;  5J4E A;  2W3D A;  3HJI A;  2FH5 A;  2W1T A;  3CWF A;  3T4K A;  5DFX A;  1LSW A;  3U2A A;  3K3C A;  3IBR A;  2Z6C A;  1OTB A;  2DMW A;  2BAS A;  4HJ6 A;  4I3A A;  3PBQ A;  1W63 M;  2K2N A;  1TS7 A;  3MQO A;  2VV8 A;  3P01 A;  3LIE A;  4R6L A;  2VJW A;  4M4X A;  2G7U A;  5TJJ A;  1Y28 A;  3PBT A;  3FC7 A;  4DN0 A;  3EEH A;  2INW A;  1WA9 A;  4R70 A;  4GS9 A;  5J7E A;  4GJ4 A;  4P6Z S;  1TS6 A;  5F69 A;  2K31 A;  3MXQ A;  5DKK A;  4R3A A;  4WEJ A;  4L9E A;  3EOI A;  5IT5 A;  3UB9 A;  4GLQ A;  1P0Z A;  1P9R A;  2A24 B;  5F6A A;  2EWW A;  1LSV A;  3PYP A;  4UQI S;  2H28 A;  1TS8 A;  2M1C A;  3ZQ5 A;  4LPZ A;  4MDZ A;  1F9I A;  3UB8 A;  3EGX C;  4NKP A;  5HWT A;  2VEA A;  5K5B A;  3UB6 A;  1T18 A;  1W63 Q;  3JVV A;  3D3O A;  4G3W A;  4OOL A;  4Q0J A;  4CQH A;  2PHY A;  4IHQ A;  4CLC B;  3C30 A;  4QPR A;  3EGD C;  4O8G A;  4LRY C;  5A8B A;  3S7Q A;  3HJK A;  3H7W A;  3KYZ A;  4HIA A;  3UME A;  4EU0 A;  1BYW A;  2Y8H A;  3A0R A;  5LBR A;  5AJG A;  3LFV A;  3PBO A;  3BWL A;  2PT7 A;  2OAQ 1;  3OC2 A;  2ZOH A;  2EWV A;  3P7N A;  4ZRR A;  1S66 L;  2GNX A;  4H6J A;  3MMH A;  1ZTU A;  3ICY A;  2J3W A;  1T1B A;  3IS2 A;  4EER A;  2QJ7 A;  2V1A A;  3EQV A;  3CUE C;  3FPV A;  3OCL A;  5TBM B;  4LRX C;  2KDK A;  1OTE A;  3R7W A;  3T4T A;  3T4L A;  4B9O A;  4Y2F A;  4P6Z M;  1DP6 A;  3KX0 X;  3F1P A;  1ODV A;  5HPI A;  3C8C A;  2J3T D;  4UEY A;  2KLI A;  4HOI A;  4JGP A;  2LB9 A;  4LRZ E;  3CLO A;  5C5K A;  1T19 A;  3TW8 A;  3LI8 A;  1V9Z A;  2Z6D A;  1YAX A;  3CUE A;  4RQ9 A;  4UQI M;  4FOF A;  1G28 A;  4JGR A;  4I3I A;  3VV4 A;  2PYR A;  1DP8 A;  5HWW A;  1TS0 A;  4B93 A;  5J3W A;  1XJ4 A;  3B42 A;  3DBA A;  3V67 A;  3S7P A;  2PYP A;  4IUK A;  2WKR A;  4HP4 A;  3H7W B;  1IOU A;  2P08 A;  2L4R A;  3PR6 A;  3LI9 A;  5DJU A;  2OOL A;  3LIC A;  1XFQ A;  4EES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...