3CITA

Crystal structure of the gaf domain of a putative sensor histidine kinase from pseudomonas syringae pv. tomato
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
155
Chain Sequence
NAYRQSQSRAARLRLLVDTGQELIQLPPEAMRKCVLQRACAFVAMDHGLLLEWGNGVQTTARHGSKERLSTLETTADPLAIGPQWLERPGTHLPCVLLLPLRGADEGSFGTLVLANSVAISAPDGEDIESLQLLATLLAAHLENNRLLEALVARD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the GAF domain of a putative sensor histidine kinase from Pseudomonas syringae pv. tomato
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Transferase
molecule keywords Sensor histidine kinase
total genus 46
structure length 155
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3citA00
4LRZE 2O99A 3OOVA 4PAUA 1MKMA 3KSIA 2O9AA 3ZQ5A 4YOFA 4LRXC 4DMZA 4YNRA 4G3VA 3IBRA 2K31A 4GLQA 4Q0JA 5AJGA 3CI6A 3EEAA 2M7UA 3HCYA 2O9CA 4RQ9A 3NOPC 5LBRA 4Y5FA 3R4KA 5HL6A 5DFYA 5TJJA 5HSQA 4IUKA 5HPFA 3E98A 4GW9A 4R70A 3CITA 2VJWA 3IBJA 4IJGA 3S7PA 2ZMFA 5L8MA 2Y79A 3D3OA 2W1RA 5I5LA 1VHMA 3S7OA 2W3DA 4CQHA 1MC0A 3BJNA 3KO6A 2IA2A 2M7VA 4Q0IA 2QYBA 4ME4A 3S7NA 2K2NA 5DFXA 1F5MA 4G3WA 4IUHA 4MCWA 1ZTUA 2KOIA 3NOUC 1TF1A 2HGVA 2XROA 2O9BA 2VKSA 4EU0A 4FOFA 3MF0A 3K2NA 1YSQA 2OOLA 3O5YA 2B18A 1TD5A 3KSHA 4ETZA 5C5KA 4QPRA 2Y8HA 4O0PA 3RFBA 2XRNA 2VZWA 4O8GA 2W3HA 1YKDA 2O0YA 2W3GA 3KSGA 3W2ZA 4Y3IA 4ETXA 3G6OA 2W1TB 2LB9A 1STZA 3LFVA 4LRYC 3MQ0A 4Z1WA 2W3EA 5HPIA 2LB5A 3E0YA 1YSPA 2KLIA 4MN7A 3TRCA 3NOTC 4E04A 5K5BA 4G3KA 4Q0HA 4MMNA 4O01A 2GX5A 4BWIA 3NHQA 4DN0A 2G7UA 4Y2FA 3C2WA 2VEAA 2W1TA 4ZRRA 3OBFA 3DBAA 3MMHA 4MDZA 3VV4A 4R6LA 4EUVA 3KSFA 2W3FA 2XSSA 3S7QA
chains in the Genus database with same CATH superfamily
4LRZE 4DXBA 4DJ2A 2VLGA 3LIFA 1XKZA 3EEHA 4YNRA 2ACGA 5FATA 2K31A 1JTGA 3HUNA 3WWXA 3NOPC 5TGFA 3CAXA 3KYZA 3FWLA 4YINA 1LL5A 2V1BA 2VX8A 3N4IA 2D02A 2PR6A 2VJWA 1PYYA 4HOIA 1NY0A 3D3OA 2L0WA 1KOUA 2XEPA 2EX9A 4JKTA 4GB7A 1H5XA 4OPQA 2L1MA 1N9LA 3LR3A 3T50A 3EGXC 4ZJ1A 4LCMA 3I7JA 1LL9A 4EW7A 1GSXA 2OLVA 2ZOHA 3BLSA 4L9EA 4JBFA 1YLTA 1KVLA 4BQMA 4I3JA 3M2JA 1K55C 1SKFA 2B18A 2JKGA 5CX7A 4CLCD 2V1ZA 1HD8A 2A24A 4NKPA 3MS6A 4HIAA 1AXBA 2PYPA 4X68A 3PAGA 4ETXA 3BFGA 3FPVA 2BLSA 2XLNA 2LB9A 2Y2NA 3U2AA 2V0UA 5FQQA 4FD8A 3W4OA 1BUEA 1XJ2A 5A91A 3ZCZA 2QJ5A 3ZFZA 5FL3A 4Q0HA 3UNWA 3GRJA 1PZPA 3NHQA 1K25A 3HLDA 4I5SA 1GSWA 3ULFA 3VSKA 3LIAA 1KGGA 4JXVA 4U3TA 2P08A 1O07A 3PBTA 4P85A 2VGLM 2Y2MA 4WMCD 2R9XA 3SZTA 2IWBA 1PWCA 1XGJA 4GS9A 1KGFA 2B02A 4HP4A 1BYWA 3N8LA 4QJGA 2DCFA 4YFMA 3LIEA 2QWSA 3LI9A 3IBJA 4FUWA 5HWTA 4Y7PA 3EQUA 5DTTA 2J9PA 3TJZC 1NZOA 2KX6A 3G35A 3MQOA 3UE3A 1AWIA 3W8KA 1S6RA 2K2NA 2W0NA 1ESIA 2PT7A 1FIKA 3IXGA 3VP2A 1BLPA 3WS0A 1IELA 2YKHA 4KZ7A 5HZHA 4WZ4A 3UY6A 1ZG6A 2J3TC 1O7EA 3D72A 4K91A 2Y91A 2HJEA 3S1YA 3LR0A 2P04A 4JF6A 4BBVA 1PW1A 3KSHA 3W4QA 3Q82A 3HUOA 5I94A 4GZBA 2R78A 1ES2A 1K56D 3T1RA 4OONA 4IEDA 1STZA 2L4RA 3KYQA 1YAXA 3PXPA 2LB5A 2M1CA 3E0YA 5EVLA 3IF6A 4G3KA 2PDRA 3NI9A 1SDNA 2BG1A 3GDIA 3F1OA 4OPZA 2HDQA 5FI7A 4P0MA 2P74A 3CHWP 4PPRA 2BTFP 1DP8A 4KZ6A 4NG2A 3EQVA 3IHBA 2HP9A 4B93A 1DJAA 2X71A 3CUEC 1PWGA 1Y54A 3OCLA 5EVID 4QB8A 5CEDA 3UPNA 3HUMA 4DE2A 3DTMA 4DDSA 5HSQA 2PBYA 3CWFA 3IS2A 5M19A 4II7A 3CG5A 4HH3A 5EVIA 2W1RA 1MC0A 4LCLA 5F68A 3UB5P 3HLGA 4KZ3A 1YPRA 5L07A 1IYQA 1FR6A 5HD5A 3P09A 2CC1A 5BOHA 4OOLA 2WAFA 4UA9A 5IU1A 3IF5A 1DY6A 2XF3A 3IWQA 5HFOA 2H10A 2VGLS 4KQQA 4XT2A 3DWZA 3LO7A 4KUOA 3O5YA 4HP9A 3RJUA 4RVAA 5HL1A 4HQAA 1NRJA 4ZJ2A 3FV7A 4PM8A 2HZ5A 2FH5A 2BASA 2ZM2A 5E2GA 4DE0A 1T1AA 5EOOA 3C4OA 3G4PA 2YKFA 2ZQ7A 4UA7A 3LFVA 4WUJA 2QZ6A 3BLMA 2FFYA 1XA7A 3CUEA 4MN6A 1E3UD 4OPRA 4S2IA 4ZJ3A 3LGOA 1BSGA 1OT6A 2Y2OA 1N9OA 2AVXA 2XFSA 1TS0A 4X56A 3V67A 1OJ5A 3IXDA 3C8CA 3DBAA 5EM0A 4PM9A 2P7JA 2JKRM 4D2OA 3OOVA 3IX3A 3T4TA 4YOFA 3LY4A 1P9WA 1XJ3A 3P7NA 3QHYA 5F69A 1IYSA 1DRMA 1MZUA 4HESA 5DFYA 3OPHA 1ERMA 1NXYA 2ZMFA 4IBXA 5FASA 1S4SA 3MZFA 4JGQA 2UV0E 4BL3A 4UA6A 1M6KA 3H7WA 3PBQA 1ZTUA 1KE0A 1XFNA 4KZAA 2VK3A 1TF1A 3LCEA 3HL9A 3V3RA 3ISGA 1KE4A 3Q7VB 4GOGA 2OOLA 4LV1A 1PW8A 3LEQA 2VGKA 1S1ZA 2OWHA 4O8GA 3PR6A 1UGUA 2W3GA 1MKIA 3UE1A 4Y3IA 1OTEA 5EVEA 4GS9B 3DAVA 4RA7A 5MC7A 2Y2IA 2ZJ9A 4OLDA 5FEFA 1L3LA 2P9VB 5A92A 5CHJA 1IYOA 2GDNA 3F1NA 3UE6A 1YSPA 2C6WB 4E3OA 2VV7A 3VP4A 3BQAA 5K5BA 1L0EA 3MKEA 4BWIA 4L0LA 3WRZA 3C38A 5KIZA 5J8XA 2WGWB 5FEGA 4O7DA 4HJ3A 4C6YA 3E2KA 5FQ9A 4E6XA 1SCWA 1ONGA 3ZQ5A 2Z6CA 1PRQA 1NZUA 3IBRA 5CTNA 4KENB 2FFFB 3H82B 4KQDA 1ACFA 4ID4A 2NUPC 4S2MA 5HAPA 4R70A 3WS2A 2XQZA 3HLBA 3HLFA 5IT5A 5U47A 3KO6A 3SH8A 3IT9A 4IBRA 2EWVA 3LEZA 2PHYA 2IWCA 2KOIA 3T4QA 1MWTA 1BLHA 3GTCA 3UMEA 2CMNA 2VV8A 4WEKA 3T1XA 5TBMA 3UPPA 3C5AA 3UDXA 1N9BA 4E3NA 5G4YA 4WZ5C 4PKYG 5F1GA 5HDDA 2Y2PA 5C5KA 4EV4A 2WUQA 2PU2A 3DW0A 1S67L 2VZWA 3TOIA 3C7VA 2JCHA 2H5SA 1T1CA 1PIOA 2Y2KA 3K3DA 4HY8A 1KDWA 4R38A 5GLDA 1K56A 4E04A 2PR5A 5L2FA 3UE0A 4DN0A 1GA9A 2VEAA 3MMHA 3BM6A 4R6LA 3QP4A 2XD5A 1FILA 3NJAA 1H8ZA 4UAAA 1DP6A 4WL9A 5KSCA 3N8SA 4FCFA 4OLGA 5CGWA 4BD1A 4DMZA 3EEAA 5HL6A 3TSGA 4RX2A 4KG5A 2JN7A 4QU3A 3ZGAB 4KZ4A 4LV0A 2ZQ8A 4OQ0A 4GD6A 4B88A 1XX2A 3ZHHA 3PBNA 5CERA 2IA2A 3C30A 4ZDXA 3LICA 4E3LA 5E2HA 3IH8A 3NY4A 4U0XA 3ZG0A 3WS4A 4EQIA 3CPTA 4OH0A 3VP0A 3C4PA 3MJQA 2D01A 3G32A 1CF0A 4JGOA 4X53A 1W63M 1PI5A 2ZC4B 3FPWA 4R23A 5A8BA 2VGJA 3GR2A 5J7EA 3UDIA 5EVIB 3AGFA 5FA7A 3PYPA 1MXOA 4Y15A 1G5UA 4IHQA 3A0VA 5AVEA 4EETB 4H6JB 4WM9A 2QHKA 4H8RA 3TW8A 4E3MA 2ZQDA 1PNEA 4Z1WA 3GSGA 2Q0OA 2WK0A 2Y59A 2PU4A 4KZ5A 5FDSA 4MMNA 3F1NB 2GX5A 1ZKJA 5FI2A 4KQOA 1FSYA 2WZXA 4OQGA 5CTMA 1JWZA 2H0TA 2OSUA 2O99A 2HPBA 4WYYA 3ZDJA 2PAVP 1T19A 1IYPA 4S2NA 4Y13A 1CI9A 4B9OA 3CMZA 2EX6A 3M6BA 1K4FA 3PBRA 4X69A 3R4KA 2ZMAA 3DTIA 2HP6A 4MN5A 4OQIA 2H28A 3O86A 4HBUA 4PM7A 3T4SA 4B4XA 4N9LA 2Y79A 3ZG7B 3S7OA 3BJNA 2ZC7A 3Q1FA 4Q0IA 2WKQA 3V3SA 1XP4A 3OLOA 2JKTM 3LIDA 2ZBBA 5KMWA 1BTLA 5AQBA 3IX4A 4E3IA 1MPLA 3QP8A 4P6ZS 4NXBA 2WGWA 4DE1A 2HF6A 4EBPA 3K2NA 3VOZA 3SS3A 1EROA 3G2ZA 1TDLA 3Q7ZA 1TD5A 3IHAA 1MWRA 4LV3A 4QPRA 5HWVA 4KG2A 2XGNA 3A3EA 3BFDA 4KZ8A 4U0TA 1FR1A 4MBHA 2O0YA 3W2ZA 3QP6A 5HX9A 3HREA 2HJ9C 3R7WB 2V8CA 2WZZA 1K0KA 3E2LA 4EQ1A 2W3EA 1XGIA 3EOIA 3VP3A 3A3JA 4S2NC 4PMAA 3BECA 2ZLYA 1LT0A 3P01A 3C2WA 5CEBA 4ZRRA 1PZOA 1W8QA 4BBTA 1XFQA 5DF8A 2XSSA 3EWKA 4H6JA 1P9RA 1HVBA 3ZYTA 4S2OA 3KSIA 3MXRA 3N7WA 4G3VA 5EFWA 1JWVA 4WF0A 3LUQA 4GLQA 3UB8A 3Q07A 5HD3A 4WMCA 4KZ9A 5AQ9A 4GHIB 2HV1A 4GCZA 2B95A 2WGVA 1PI4A 4A5RA 4S2PA 4GW9A 1K54C 1WYCA 1LSWA 1M40A 4P87A 1WA9A 3C7UA 4FH4A 2Y2QA 4MLLA 3VP1A 4NK3A 4BENA 3L7HA 3IWIA 4ZBEA 1Z6FA 5DTKA 1MBLA 3ITBA 4JGRA 2WADA 3NOUC 3SOIA 3VOYA 1VETB 1G6AA 4NXEA 2PD7A 3IF6C 3QP2A 4JF4A 4KG6A 3HLCA 2J7VA 1LHYA 5F5YA 3SS5A 5HWWA 2DRWA 1TDGA 3RFBA 4N1XA 2P9VA 2XRNA 3WRTA 1ALQA 2A3UA 4KUKA 4M4XA 5HW3A 1NRFA 2ZC3B 4K0WA 4QY6A 5CRFA 2GNXA 1H3QA 3F1PB 4E3KA 2KLIA 3NC8A 3B33A 4LPZA 4E6WA 2ZM0A 1N9NA 4EERA 1K54A 5EM1A 4E3JA 1MWUA 3LIBA 5HAIA 3ZG5A 5J3WA 1IKGA 4I3IA 5FAPA 4GNUA 4N92A 4S2LA 5A90A 2Y4AA 5DJTA 5E2EA 2X02A 3F1PA 5M1AA 3A3FA 4Q0JA 3DTEA 2M7UA 2WYXA 1YMXA 5AQ7A 1BLCA 2UWXA 2Z2LB 2J8YA 3RXWA 3H7WB 3UB7A 4RYEA 4MNRA 4UQIS 5FI6A 1VHMA 1BLSA 5FSRA 2RL3A 4R3BA 3G30A 3OPLA 1XJ6A 3V50A 4F94A 1OMEA 4JPMA 4LGWA 1K57A 1ZHHB 5DJUA 1W79A 3IXBA 4HH2A 1X0OA 4ZAMA 1Y28A 1Q2QA 4Q8IA 3ZG9B 5HAQA 3KYEA 1V9YA 5KSHA 1ODVA 5FQKA 5GLCA 1W8YA 5HDCA 1S66L 3AGEA 3JPUA 2V20A 3MXSA 1HTZA 2J3TD 1ZG4A 1OTDA 3H9WA 1IKIA 1YLYA 3IH9A 3SS4A 3E4PA 3QP1A 3S4XA 4LLOB 1QMFA 1YLPA 4WBGA 1E4DA 2V9AA 3BFCA 2OAP1 2XA7M 3FG8A 4BL2A 1QMEA 3TG9A 4AFIA 2G7UA 3VV4A 5E2FA 3SW1A 2V1AA 1WYBA 4WN5A 5L10A 1TS8A 2QPNA 4BLMA 4LRXC 4XUZA 4DJ3A 3MKFA 3V39A 4WELA 4XT2B 1Y4OA 4QD4A 2A49A 1P97A 3M6HA 4Y0UA 2V8FA 1Z09A 5EECA 5FAQA 1GCEA 1K55A 5I5LA 4MBFA 5GLBA 5GHXA 5GLAA 1FQGA 4HBTA 2ZOIA 5GHZA 2EFXA 2QJ7A 4EBNA 3BY9A 5EVIC 1S1YA 5CHMA 2WKIA 1RGZA 1JTDA 3HJKA 4UEYA 3V5MA 4OVDA 1A0KA 3ICYA 3RXXA 4ETZA 3VFFA 3A0RA 4UHUA 4EESA 3MFXA 4OPYA 3UPOA 4HI4A 2DNSA 1F2KA 3IX8A 4Y0TA 2Z2MB 4LRYC 4R4RA 1XA1A 4JF5A 3P98A 4BMWA 1ESUA 1TEMA 1VQQA 5FAOA 2VV6A 4JXGA 2GZAA 3RH8B 3PHYA 4JXSA 5DF7A 3ZNYA 1H8YA 2X01A 4EUVA 2RCXA 3NECA 2WKEA 1VEUA 5TR7A 3BY8A 4LFUA 1MKMA 3UB9A 2G2UA 4YWZA 4L9FA 2Q9NA 4DE3A 3QP5A 3FKWA 5FQIA 4LENA 4CJNA 5D3OA 4FTXA 4Y5FA 4FSFA 1VETA 2JC7A 2Q9MA 2INWA 4M3KA 4X55A 4DXCA 3MQQA 3BFEA 3VE4A 4IJGA 1L0DA 3A3IA 4WZ5A 5TFQA 1S4RA 1ONHA 4ME4A 4EUZA 4JGPA 3LR5A 3MFDA 3GQZA 1CEGA 1LI9A 1EI5A 4I38A 4GHIA 2WKRA 2WKPA 3MF0A 1C3BA 1D06A 3G31A 4CPKA 4PM6A 1CI8A 3IWOA 4HNBA 5AQAA 3RTYA 1L0FA 2Y8HA 1E25A 4Y0OA 2PD8A 2DMWA 2R9WA 3LI8A 4ESPA 2OV5A 3NDGA 1RGYA 1S0WA 1CQAA 2I72A 3MZDA 3BEBA 1J9MA 3OPPA 4I39A 2QKPA 5EE8A 1YQSA 3R7WA 1LI0A 3IQAA 4S2JA 4PKYA 5FQJA 1SKOB 2JKFA 4N1HA 1NYMA 2EXBA 1CEFA 3JVUA 3HJIA 1K38A 3CPTB 4X1MA 1I2WA 4Z9QA 3CI6A 2ZC5B 2JBFA 5IS1A 1K6SA 5CGSA 2ZL1B 5HPFA 2A2LA 4C75A 4P6ZM 3CITA 3ITAA 3OCNA 2OAQ1 4CQHA 2HDSA 3S22A 4NETA 4DDYA 4P6BA 3GECA 2QYBA 1KDSA 1YT4A 2PBDP 3PAEA 3WS1A 2XFTA 3G2YA 4IUHA 4DF6A 3T12B 5KZHA 3KX0X 2PRFA 1BZAA 2XROA 2O9BA 1OPXA 1BT5A 3VFHA 1G6OA 2H0YA 1HLUP 3QNBA 2JE5A 3DTKA 1SDEA 1ES3A 1I5QA 3VOLA 4CLCA 2JHEA 2WGIA 2EFUA 3MZEA 3G34A 1U60A 1I2SA 1MWSA 4D60A 3L9KA 4X1LA 1K6RA 4MDZA 5DTSA 3MR0A 1RCJA 4MBKA 4K08A 3W4PA 4IVKA 1GSVA 2OWJA 1LLBA 2J3WA 3U4LP 1FOFA 5F1FA 5AVFA 4ARZB 3BQ8A 3OPRA 1LL8A 5FQMA 3HCYA 3BW6A 2O9CA 4RQ9A 1FCMA 5LBRA 3QNCA 1J3WA 1YLJA 3PBOA 3A3DA 3GVBA 4RX3A 4IUKA 4WEJA 2ZD8A 1GHIA 3MSHA 2QMIA 5F6AA 2GJ3A 3S7PA 3TE8A 3BWLA 4GD8A 4GKUA 4X25A 1MY8A 3FYZA 2Y2JA 3ZVTA 1CK3A 1RP5A 2HDUA 5A93A 2M7VA 4QY5A 1P0ZA 3FC7A 3HLWA 5JYPA 3HLEA 3T4KA 1SZVA 1G68A 3E4QA 3PTEA 2JKRI 1FCNA 2VKSA 1NLYA 2HP5A 1GHPA 1H8MA 4GJ4A 1K4EA 3UDFA 1YSQA 3PBSA 1V9ZA 1XJ4A 1G28A 1FSWA 1IEMA 2MJ6A 1W63Q 4F3LA 3KSGA 3G6OA 4EWFA 2IWDA 2A24B 5G18A 5G4ZA 2XD1A 3T1QB 1VM1A 2G2WA 4NXFA 5F82A 5EOEA 3OBFA 4OP8A 4CLCB 3UN7A 2W3FA 3S7QA 4JLFA 4R1GA 4HEFA 3JYIA 5CGXA 5DKKA 4EEPA 1KE3A 1IFQA 2EX8A 5IHVA 3O3VA 4X6TA 4DRTA 3SH7A 3ZG8B 4CLCE 1L0GA 2FZ0A 5DVAA 4DKIA 1Q2PA 3A0SA 1YMSA 3S7NA 1LSXA 3BFFA 3HVFA 1YM1A 2HGVA 5GHYA 1UWPX 4EU0A 2XDMA 3B42A 1F9IA 3FZCA 4FOFA 5GL9A 5DKLA 3UO9A 1YLZA 2Y2HA 1ZC2A 4ARZA 2EX2A 3M2KA 2I9VA 1W5DA 2Y2GA 4KQRA 1XPBA 1OTAA 2W3HA 3EGDC 4R3JA 4EBLA 1NLZA 3ZNTA 4OP5A 2XA7S 4F3LB 3T4LA 3E4OA 1GHMA 5EV0A 3CLOA 2W27A 3OZHA 1DJBA 4MN7A 3TRCA 1BULA 1T1BA 1NYYA 4QWOA 4O01A 4BD0A 3MBZA 2ZQCA 4Y2FA 2ZQ9A 5EUAA 3NCKA 2Y2LA 5CXWA 1UWNX 1ERQA 1SHVA 1CJFA 2EXAA 3GV9A 5AJGA 4OOMA 3BRMA 4GN2A 1PWDA 3Q7VA 4IVIA 1JVJA 5TJJA 5L09A 1ES5A 2J80A 4K0XA 4KZBA 1JNUA 4FH2A 3LY3A 2W3DA 3CJMA 3NULA 4I3AA 3ZVWA 5HDSA 4UQIM 4S2KA 3T1SA 1EWZA 2ZMVA 3IXHA 3O87A 2ZC6B 1OTBA 3NIAA 4R0QA 3NDEA 4G3WA 1OT9A 1TS6A 4MCWA 4N9KA 1HZOA 2WKHA 4Y17A 5CECA 3N6IA 4OQHA 1W7FA 2VA0A 3O88A 2ZL1A 4WLAA 2XR0A 1DJCA 3F1OB 2V2FF 1EW0A 1LSVA 1YLWA 4XUXA 4LV2A 2WAEA 4O0PA 1E3UA 2HDRA 4C3QA 3UMDA 3OC2A 1YKDA 3MXQA 4R4SA 4R3AA 2J9OA 2W1TB 4PHTA 3WS5A 1D1JA 1OJGA 2XK1A 4XXRA 3MQ0A 2ZQAA 2E8JA 3JVVA 5TBMB 1SKOA 5J4EA 3LYXA 1PFLA 5FDHA 2C5WB 2EA9A 2V0WA 3NBLA 5EPHA 4PAUA 2K7SA 2O9AA 3VMAA 3VE3A 5DF9A 3GMWA 4BBUA 5E43A 4NEED 3SH9A 4OKPA 4B4ZA 3D9YA 2KDKA 1FCOA 1KVMA 2NUTC 3E98A 2B5RA 2PYRA 3T4OA 5F83A 5L8MA 2JKTI 5HARA 1DP9A 1OTIA 3AGDA 4OOYA 4EXOA 3H82A 1F98A 1NWZA 5CHUA 3B47A 5DFXA 4QHCA 1F5MA 1WE4A 4CLCC 4ZTKA 1GA0A 2XH9A 1K57C 2E8IA 2Y55A 4HJ6A 3VSLA 3N8RA 1IOUA 4HJ4A 1TVFA 3IS2B 4L9GA 4EEUA 1VEUB 2Z6DA 1XXMA 3DWKA 1VB6A 2OLUA 5JYOA 1JWPA 1H0MA 3IF6B 5HPIA 1TS7A 3BYDA 1N4OA 3B3XA 1T18A 1L2SA 3UB6A 3NOTC 4GDBA 4GDNA 2EWWA 3LR4A 3K3CA 3Q81A 4BJPA 3FKVA 3T4JA 1NJ4A 4NXGA 2W1TA 1ES4A 3D4FA 2ZM8A 4PM5A 4MEZA 3KSFA 3CZDA 4HHDA 4JXWA 1D7EA 5M18A 1KGEA 3HBRA
chains in the Genus database with same CATH topology
4LRZE 4K08A 4DJ2A 1GSVA 2VLGA 3LIFA 2OWJA 2J3WA 3EEHA 3ZQ5A 5DJTA 4YNRA 2Z6CA 5AVFA 3IBRA 4ARZB 3BQ8A 3F1PA 2K31A 4Q0JA 1LL8A 2M7UA 3HCYA 3BW6A 2O9CA 4RQ9A 3H82B 3NOPC 4KQDA 5LBRA 3CAXA 3KYZA 3PBOA 2NUPC 4IUKA 4WEJA 2VX8A 2V1BA 3H7WB 4R70A 3UB7A 2D02A 2PR6A 5F6AA 2VJWA 2GJ3A 3S7PA 4HOIA 3TE8A 3BWLA 3D3OA 4UQIS 2L0WA 1VHMA 1KOUA 5IT5A 3KO6A 2M7VA 1XJ6A 1ZHHB 1P0ZA 2L1MA 5DJUA 3FC7A 1N9LA 3LR3A 4HH2A 1X0OA 3T50A 2EWVA 3EGXC 1Y28A 2PHYA 2KOIA 3T4QA 3T4KA 3UMEA 1V9YA 5KSHA 1ODVA 3E4QA 2CMNA 2VV8A 2JKRI 4EW7A 2VKSA 1NLYA 1GSXA 2ZOHA 4L9EA 1H8MA 4WEKA 4GJ4A 1YSQA 4I3JA 5TBMA 5HDCA 1S66L 5G4YA 2B18A 3PBSA 4PKYG 5HDDA 5C5KA 1V9ZA 1XJ4A 5CX7A 4CLCD 1G28A 2MJ6A 1S67L 2A24A 2J3TD 2VZWA 1W63Q 4F3LA 4NKPA 3KSGA 1OTDA 4HIAA 3H9WA 2PYPA 4ETXA 3FPVA 3G6OA 1T1CA 2LB9A 3U2AA 2V0UA 3K3DA 2A24B 3E4PA 4HY8A 5G4ZA 4LLOB 1XJ2A 2QJ5A 4R38A 2V9AA 5FL3A 4E04A 4Q0HA 2OAP1 2XA7M 2PR5A 3FG8A 4NXFA 3NHQA 4DN0A 4I5SA 4AFIA 2G7UA 2VEAA 1GSWA 3VV4A 3OBFA 3MMHA 3SW1A 4CLCB 2V1AA 4R6LA 3ULFA 2W3FA 3NJAA 3LIAA 4WN5A 3S7QA 1TS8A 1DP6A 4WL9A 4LRXC 2P08A 4DMZA 3PBTA 2VGLM 4DJ3A 5DKKA 4EEPA 3EEAA 1IFQA 4WELA 4XT2B 4GS9A 5HL6A 2B02A 4HP4A 1BYWA 1P97A 3LIEA 2JN7A 2QWSA 4CLCE 3LI9A 2FZ0A 3IBJA 5HWTA 3EQUA 5I5LA 3TJZC 2KX6A 3PBNA 3MQOA 3UE3A 2IA2A 3C30A 3A0SA 3LICA 3S7NA 2ZOIA 2K2NA 1LSXA 2W0NA 2PT7A 2QJ7A 3MJQA 3BY9A 2D01A 2YKHA 2HGVA 1S1YA 4JGOA 1W63M 1UWPX 5HZHA 3HJKA 4EU0A 4UEYA 3B42A 1F9IA 4FOFA 2J3TC 4HJ3A 3FPWA 5A8BA 5DKLA 3D72A 2HJEA 3LR0A 3ICYA 2P04A 4BBVA 5J7EA 3KSHA 4ARZA 4ETZA 3A0RA 2I9VA 3PYPA 4EESA 3MFXA 2R78A 4IHQA 3A0VA 1OTAA 2W3HA 4HI4A 5AVEA 4EETB 4H6JB 3EGDC 2QHKA 3TW8A 1NLZA 1STZA 2L4RA 2XA7S 3KYQA 4F3LB 1YAXA 3T4LA 4LRYC 3E4OA 3PXPA 4Z1WA 3CLOA 2LB5A 2M1CA 2W27A 3E0YA 4BMWA 4MN7A 3TRCA 2VV6A 4G3KA 1T1BA 2PDRA 4MMNA 4O01A 3F1NB 2GZAA 2GX5A 3RH8B 3PHYA 3GDIA 3F1OA 4KQOA 4Y2FA 4EUVA 1DP8A 3EQVA 2O99A 4B93A 3BY8A 1MKMA 1UWNX 3UB9A 1T19A 4YWZA 4L9FA 3CUEC 4B9OA 5AJGA 3PBRA 4OOMA 3OCLA 4Y5FA 3R4KA 4FSFA 4MN5A 5TJJA 5HSQA 2INWA 3CWFA 2H28A 3IS2A 2J80A 3MQQA 3VE4A 3T4SA 4IJGA 1JNUA 4II7A 4HH3A 2Y79A 2W1RA 3S7OA 2W3DA 1MC0A 3BJNA 4I3AA 5HDSA 5F68A 4UQIM 4Q0IA 2WKQA 1S4RA 2ZMVA 3OLOA 4ME4A 2JKTM 3LIDA 2ZBBA 1OTBA 5HD5A 4JGPA 3LR5A 4G3WA 1OT9A 1TS6A 4MCWA 4OOLA 4I38A 5IU1A 2VA0A 4P6ZS 4NXBA 4GHIA 2WKRA 4WLAA 2HF6A 2WKPA 3MF0A 3K2NA 2VGLS 3F1OB 4XT2A 1D06A 4KUOA 3O5YA 1EW0A 4HP9A 4HNBA 1LSVA 1TD5A 3RTYA 4QPRA 4HQAA 2Y8HA 5HWVA 1NRJA 4O0PA 2PD8A 3UMDA 3OC2A 2FH5A 1YKDA 2BASA 2O0YA 3W2ZA 1T1AA 2DMWA 3MXQA 4R3AA 2HJ9C 3R7WB 2YKFA 3LI8A 2W1TB 4PHTA 1OJGA 3LFVA 3MQ0A 4MN6A 4WUJA 2W3EA 3CUEA 4EQ1A 3EOIA 1OT6A 1N9OA 3JVVA 5TBMB 1LT0A 5J4EA 1TS0A 3P01A 3LYXA 3C2WA 3V67A 1OJ5A 3C8CA 4ZRRA 3DBAA 4I39A 2QKPA 2P7JA 4BBTA 2JKRM 1XFQA 3R7WA 2XSSA 3EWKA 4H6JA 4PKYA 1P9RA 3OOVA 2EA9A 3ZYTA 2V0WA 4PAUA 3KSIA 3T4TA 3JVUA 2K7SA 2O9AA 3HJIA 4YOFA 3VE3A 1P9WA 4G3VA 5DF9A 5EFWA 4WF0A 3LUQA 1XJ3A 3P7NA 5F69A 4GLQA 3UB8A 4BBUA 1DRMA 3CI6A 1MZUA 5HD3A 5IS1A 4NEED 4GHIB 2HV1A 4GCZA 2KDKA 5DFYA 5HPFA 2NUTC 2A2LA 3E98A 4GW9A 4P6ZM 2PYRA 3CITA 3T4OA 1LSWA 2ZMFA 3OCNA 5L8MA 2OAQ1 1S4SA 2JKTI 1WA9A 4CQHA 1DP9A 4JGQA 1OTIA 4EXOA 3H82A 1F98A 1NWZA 3GECA 2QYBA 3B47A 5DFXA 3H7WA 1F5MA 4IUHA 3PBQA 1ZTUA 1XFNA 4JGRA 3NOUC 3KX0X 1TF1A 4CLCC 2XROA 2O9BA 4NXEA 1OPXA 2PD7A 1G6OA 2OOLA 4HJ6A 1IOUA 4HJ4A 5F5YA 5HWWA 3IS2B 4L9GA 3RFBA 1S1ZA 2OWHA 3VOLA 4EEUA 2XRNA 4O8GA 3PR6A 2Z6DA 1UGUA 2W3GA 4CLCA 4Y3IA 1OTEA 1VB6A 4GS9B 4KUKA 2JHEA 5MC7A 4M4XA 5HPIA 2GNXA 1H3QA 1TS7A 3F1PB 3F1NA 3UE6A 1YSPA 2KLIA 1T18A 3B33A 2VV7A 3UB6A 3NOTC 4LPZA 3BQAA 5K5BA 2EWWA 3LR4A 3K3CA 4BWIA 4L0LA 4BJPA 3T4JA 3C38A 4NXGA 1N9NA 5KIZA 2W1TA 4EERA 4MDZA 3KSFA 3MR0A 4HHDA 3LIBA 1D7EA 5J3WA 4I3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRZ E;  2O99 A;  3OOV A;  4PAU A;  1MKM A;  3KSI A;  2O9A A;  3ZQ5 A;  4YOF A;  4LRX C;  4DMZ A;  4YNR A;  4G3V A;  3IBR A;  2K31 A;  4GLQ A;  4Q0J A;  5AJG A;  3CI6 A;  3EEA A;  2M7U A;  3HCY A;  2O9C A;  4RQ9 A;  3NOP C;  5LBR A;  4Y5F A;  3R4K A;  5HL6 A;  5DFY A;  5TJJ A;  5HSQ A;  4IUK A;  5HPF A;  3E98 A;  4GW9 A;  4R70 A;  3CIT A;  2VJW A;  3IBJ A;  4IJG A;  3S7P A;  2ZMF A;  5L8M A;  2Y79 A;  3D3O A;  2W1R A;  5I5L A;  1VHM A;  3S7O A;  2W3D A;  4CQH A;  1MC0 A;  3BJN A;  3KO6 A;  2IA2 A;  2M7V A;  4Q0I A;  2QYB A;  4ME4 A;  3S7N A;  2K2N A;  5DFX A;  1F5M A;  4G3W A;  4IUH A;  4MCW A;  1ZTU A;  2KOI A;  3NOU C;  1TF1 A;  2HGV A;  2XRO A;  2O9B A;  2VKS A;  4EU0 A;  4FOF A;  3MF0 A;  3K2N A;  1YSQ A;  2OOL A;  3O5Y A;  2B18 A;  1TD5 A;  3KSH A;  4ETZ A;  5C5K A;  4QPR A;  2Y8H A;  4O0P A;  3RFB A;  2XRN A;  2VZW A;  4O8G A;  2W3H A;  1YKD A;  2O0Y A;  2W3G A;  3KSG A;  3W2Z A;  4Y3I A;  4ETX A;  3G6O A;  2W1T B;  2LB9 A;  1STZ A;  3LFV A;  4LRY C;  3MQ0 A;  4Z1W A;  2W3E A;  5HPI A;  2LB5 A;  3E0Y A;  1YSP A;  2KLI A;  4MN7 A;  3TRC A;  3NOT C;  4E04 A;  5K5B A;  4G3K A;  4Q0H A;  4MMN A;  4O01 A;  2GX5 A;  4BWI A;  3NHQ A;  4DN0 A;  2G7U A;  4Y2F A;  3C2W A;  2VEA A;  2W1T A;  4ZRR A;  3OBF A;  3DBA A;  3MMH A;  4MDZ A;  3VV4 A;  4R6L A;  4EUV A;  3KSF A;  2W3F A;  2XSS A;  3S7Q A; 
#chains in the Genus database with same CATH topology
 4LRZ E;  4DXB A;  4DJ2 A;  2VLG A;  3LIF A;  1XKZ A;  3EEH A;  4YNR A;  2ACG A;  5FAT A;  2K31 A;  1JTG A;  3HUN A;  3WWX A;  3NOP C;  5TGF A;  3CAX A;  3KYZ A;  3FWL A;  4YIN A;  1LL5 A;  2V1B A;  2VX8 A;  3N4I A;  2D02 A;  2PR6 A;  2VJW A;  1PYY A;  4HOI A;  1NY0 A;  3D3O A;  2L0W A;  1KOU A;  2XEP A;  2EX9 A;  4JKT A;  4GB7 A;  1H5X A;  4OPQ A;  2L1M A;  1N9L A;  3LR3 A;  3T50 A;  3EGX C;  4ZJ1 A;  4LCM A;  3I7J A;  1LL9 A;  4EW7 A;  1GSX A;  2OLV A;  2ZOH A;  3BLS A;  4L9E A;  4JBF A;  1YLT A;  1KVL A;  4BQM A;  4I3J A;  3M2J A;  1K55 C;  1SKF A;  2B18 A;  2JKG A;  5CX7 A;  4CLC D;  2V1Z A;  1HD8 A;  2A24 A;  4NKP A;  3MS6 A;  4HIA A;  1AXB A;  2PYP A;  4X68 A;  3PAG A;  4ETX A;  3BFG A;  3FPV A;  2BLS A;  2XLN A;  2LB9 A;  2Y2N A;  3U2A A;  2V0U A;  5FQQ A;  4FD8 A;  3W4O A;  1BUE A;  1XJ2 A;  5A91 A;  3ZCZ A;  2QJ5 A;  3ZFZ A;  5FL3 A;  4Q0H A;  3UNW A;  3GRJ A;  1PZP A;  3NHQ A;  1K25 A;  3HLD A;  4I5S A;  1GSW A;  3ULF A;  3VSK A;  3LIA A;  1KGG A;  4JXV A;  4U3T A;  2P08 A;  1O07 A;  3PBT A;  4P85 A;  2VGL M;  2Y2M A;  4WMC D;  2R9X A;  3SZT A;  2IWB A;  1PWC A;  1XGJ A;  4GS9 A;  1KGF A;  2B02 A;  4HP4 A;  1BYW A;  3N8L A;  4QJG A;  2DCF A;  4YFM A;  3LIE A;  2QWS A;  3LI9 A;  3IBJ A;  4FUW A;  5HWT A;  4Y7P A;  3EQU A;  5DTT A;  2J9P A;  3TJZ C;  1NZO A;  2KX6 A;  3G35 A;  3MQO A;  3UE3 A;  1AWI A;  3W8K A;  1S6R A;  2K2N A;  2W0N A;  1ESI A;  2PT7 A;  1FIK A;  3IXG A;  3VP2 A;  1BLP A;  3WS0 A;  1IEL A;  2YKH A;  4KZ7 A;  5HZH A;  4WZ4 A;  3UY6 A;  1ZG6 A;  2J3T C;  1O7E A;  3D72 A;  4K91 A;  2Y91 A;  2HJE A;  3S1Y A;  3LR0 A;  2P04 A;  4JF6 A;  4BBV A;  1PW1 A;  3KSH A;  3W4Q A;  3Q82 A;  3HUO A;  5I94 A;  4GZB A;  2R78 A;  1ES2 A;  1K56 D;  3T1R A;  4OON A;  4IED A;  1STZ A;  2L4R A;  3KYQ A;  1YAX A;  3PXP A;  2LB5 A;  2M1C A;  3E0Y A;  5EVL A;  3IF6 A;  4G3K A;  2PDR A;  3NI9 A;  1SDN A;  2BG1 A;  3GDI A;  3F1O A;  4OPZ A;  2HDQ A;  5FI7 A;  4P0M A;  2P74 A;  3CHW P;  4PPR A;  2BTF P;  1DP8 A;  4KZ6 A;  4NG2 A;  3EQV A;  3IHB A;  2HP9 A;  4B93 A;  1DJA A;  2X71 A;  3CUE C;  1PWG A;  1Y54 A;  3OCL A;  5EVI D;  4QB8 A;  5CED A;  3UPN A;  3HUM A;  4DE2 A;  3DTM A;  4DDS A;  5HSQ A;  2PBY A;  3CWF A;  3IS2 A;  5M19 A;  4II7 A;  3CG5 A;  4HH3 A;  5EVI A;  2W1R A;  1MC0 A;  4LCL A;  5F68 A;  3UB5 P;  3HLG A;  4KZ3 A;  1YPR A;  5L07 A;  1IYQ A;  1FR6 A;  5HD5 A;  3P09 A;  2CC1 A;  5BOH A;  4OOL A;  2WAF A;  4UA9 A;  5IU1 A;  3IF5 A;  1DY6 A;  2XF3 A;  3IWQ A;  5HFO A;  2H10 A;  2VGL S;  4KQQ A;  4XT2 A;  3DWZ A;  3LO7 A;  4KUO A;  3O5Y A;  4HP9 A;  3RJU A;  4RVA A;  5HL1 A;  4HQA A;  1NRJ A;  4ZJ2 A;  3FV7 A;  4PM8 A;  2HZ5 A;  2FH5 A;  2BAS A;  2ZM2 A;  5E2G A;  4DE0 A;  1T1A A;  5EOO A;  3C4O A;  3G4P A;  2YKF A;  2ZQ7 A;  4UA7 A;  3LFV A;  4WUJ A;  2QZ6 A;  3BLM A;  2FFY A;  1XA7 A;  3CUE A;  4MN6 A;  1E3U D;  4OPR A;  4S2I A;  4ZJ3 A;  3LGO A;  1BSG A;  1OT6 A;  2Y2O A;  1N9O A;  2AVX A;  2XFS A;  1TS0 A;  4X56 A;  3V67 A;  1OJ5 A;  3IXD A;  3C8C A;  3DBA A;  5EM0 A;  4PM9 A;  2P7J A;  2JKR M;  4D2O A;  3OOV A;  3IX3 A;  3T4T A;  4YOF A;  3LY4 A;  1P9W A;  1XJ3 A;  3P7N A;  3QHY A;  5F69 A;  1IYS A;  1DRM A;  1MZU A;  4HES A;  5DFY A;  3OPH A;  1ERM A;  1NXY A;  2ZMF A;  4IBX A;  5FAS A;  1S4S A;  3MZF A;  4JGQ A;  2UV0 E;  4BL3 A;  4UA6 A;  1M6K A;  3H7W A;  3PBQ A;  1ZTU A;  1KE0 A;  1XFN A;  4KZA A;  2VK3 A;  1TF1 A;  3LCE A;  3HL9 A;  3V3R A;  3ISG A;  1KE4 A;  3Q7V B;  4GOG A;  2OOL A;  4LV1 A;  1PW8 A;  3LEQ A;  2VGK A;  1S1Z A;  2OWH A;  4O8G A;  3PR6 A;  1UGU A;  2W3G A;  1MKI A;  3UE1 A;  4Y3I A;  1OTE A;  5EVE A;  4GS9 B;  3DAV A;  4RA7 A;  5MC7 A;  2Y2I A;  2ZJ9 A;  4OLD A;  5FEF A;  1L3L A;  2P9V B;  5A92 A;  5CHJ A;  1IYO A;  2GDN A;  3F1N A;  3UE6 A;  1YSP A;  2C6W B;  4E3O A;  2VV7 A;  3VP4 A;  3BQA A;  5K5B A;  1L0E A;  3MKE A;  4BWI A;  4L0L A;  3WRZ A;  3C38 A;  5KIZ A;  5J8X A;  2WGW B;  5FEG A;  4O7D A;  4HJ3 A;  4C6Y A;  3E2K A;  5FQ9 A;  4E6X A;  1SCW A;  1ONG A;  3ZQ5 A;  2Z6C A;  1PRQ A;  1NZU A;  3IBR A;  5CTN A;  4KEN B;  2FFF B;  3H82 B;  4KQD A;  1ACF A;  4ID4 A;  2NUP C;  4S2M A;  5HAP A;  4R70 A;  3WS2 A;  2XQZ A;  3HLB A;  3HLF A;  5IT5 A;  5U47 A;  3KO6 A;  3SH8 A;  3IT9 A;  4IBR A;  2EWV A;  3LEZ A;  2PHY A;  2IWC A;  2KOI A;  3T4Q A;  1MWT A;  1BLH A;  3GTC A;  3UME A;  2CMN A;  2VV8 A;  4WEK A;  3T1X A;  5TBM A;  3UPP A;  3C5A A;  3UDX A;  1N9B A;  4E3N A;  5G4Y A;  4WZ5 C;  4PKY G;  5F1G A;  5HDD A;  2Y2P A;  5C5K A;  4EV4 A;  2WUQ A;  2PU2 A;  3DW0 A;  1S67 L;  2VZW A;  3TOI A;  3C7V A;  2JCH A;  2H5S A;  1T1C A;  1PIO A;  2Y2K A;  3K3D A;  4HY8 A;  1KDW A;  4R38 A;  5GLD A;  1K56 A;  4E04 A;  2PR5 A;  5L2F A;  3UE0 A;  4DN0 A;  1GA9 A;  2VEA A;  3MMH A;  3BM6 A;  4R6L A;  3QP4 A;  2XD5 A;  1FIL A;  3NJA A;  1H8Z A;  4UAA A;  1DP6 A;  4WL9 A;  5KSC A;  3N8S A;  4FCF A;  4OLG A;  5CGW A;  4BD1 A;  4DMZ A;  3EEA A;  5HL6 A;  3TSG A;  4RX2 A;  4KG5 A;  2JN7 A;  4QU3 A;  3ZGA B;  4KZ4 A;  4LV0 A;  2ZQ8 A;  4OQ0 A;  4GD6 A;  4B88 A;  1XX2 A;  3ZHH A;  3PBN A;  5CER A;  2IA2 A;  3C30 A;  4ZDX A;  3LIC A;  4E3L A;  5E2H A;  3IH8 A;  3NY4 A;  4U0X A;  3ZG0 A;  3WS4 A;  4EQI A;  3CPT A;  4OH0 A;  3VP0 A;  3C4P A;  3MJQ A;  2D01 A;  3G32 A;  1CF0 A;  4JGO A;  4X53 A;  1W63 M;  1PI5 A;  2ZC4 B;  3FPW A;  4R23 A;  5A8B A;  2VGJ A;  3GR2 A;  5J7E A;  3UDI A;  5EVI B;  3AGF A;  5FA7 A;  3PYP A;  1MXO A;  4Y15 A;  1G5U A;  4IHQ A;  3A0V A;  5AVE A;  4EET B;  4H6J B;  4WM9 A;  2QHK A;  4H8R A;  3TW8 A;  4E3M A;  2ZQD A;  1PNE A;  4Z1W A;  3GSG A;  2Q0O A;  2WK0 A;  2Y59 A;  2PU4 A;  4KZ5 A;  5FDS A;  4MMN A;  3F1N B;  2GX5 A;  1ZKJ A;  5FI2 A;  4KQO A;  1FSY A;  2WZX A;  4OQG A;  5CTM A;  1JWZ A;  2H0T A;  2OSU A;  2O99 A;  2HPB A;  4WYY A;  3ZDJ A;  2PAV P;  1T19 A;  1IYP A;  4S2N A;  4Y13 A;  1CI9 A;  4B9O A;  3CMZ A;  2EX6 A;  3M6B A;  1K4F A;  3PBR A;  4X69 A;  3R4K A;  2ZMA A;  3DTI A;  2HP6 A;  4MN5 A;  4OQI A;  2H28 A;  3O86 A;  4HBU A;  4PM7 A;  3T4S A;  4B4X A;  4N9L A;  2Y79 A;  3ZG7 B;  3S7O A;  3BJN A;  2ZC7 A;  3Q1F A;  4Q0I A;  2WKQ A;  3V3S A;  1XP4 A;  3OLO A;  2JKT M;  3LID A;  2ZBB A;  5KMW A;  1BTL A;  5AQB A;  3IX4 A;  4E3I A;  1MPL A;  3QP8 A;  4P6Z S;  4NXB A;  2WGW A;  4DE1 A;  2HF6 A;  4EBP A;  3K2N A;  3VOZ A;  3SS3 A;  1ERO A;  3G2Z A;  1TDL A;  3Q7Z A;  1TD5 A;  3IHA A;  1MWR A;  4LV3 A;  4QPR A;  5HWV A;  4KG2 A;  2XGN A;  3A3E A;  3BFD A;  4KZ8 A;  4U0T A;  1FR1 A;  4MBH A;  2O0Y A;  3W2Z A;  3QP6 A;  5HX9 A;  3HRE A;  2HJ9 C;  3R7W B;  2V8C A;  2WZZ A;  1K0K A;  3E2L A;  4EQ1 A;  2W3E A;  1XGI A;  3EOI A;  3VP3 A;  3A3J A;  4S2N C;  4PMA A;  3BEC A;  2ZLY A;  1LT0 A;  3P01 A;  3C2W A;  5CEB A;  4ZRR A;  1PZO A;  1W8Q A;  4BBT A;  1XFQ A;  5DF8 A;  2XSS A;  3EWK A;  4H6J A;  1P9R A;  1HVB A;  3ZYT A;  4S2O A;  3KSI A;  3MXR A;  3N7W A;  4G3V A;  5EFW A;  1JWV A;  4WF0 A;  3LUQ A;  4GLQ A;  3UB8 A;  3Q07 A;  5HD3 A;  4WMC A;  4KZ9 A;  5AQ9 A;  4GHI B;  2HV1 A;  4GCZ A;  2B95 A;  2WGV A;  1PI4 A;  4A5R A;  4S2P A;  4GW9 A;  1K54 C;  1WYC A;  1LSW A;  1M40 A;  4P87 A;  1WA9 A;  3C7U A;  4FH4 A;  2Y2Q A;  4MLL A;  3VP1 A;  4NK3 A;  4BEN A;  3L7H A;  3IWI A;  4ZBE A;  1Z6F A;  5DTK A;  1MBL A;  3ITB A;  4JGR A;  2WAD A;  3NOU C;  3SOI A;  3VOY A;  1VET B;  1G6A A;  4NXE A;  2PD7 A;  3IF6 C;  3QP2 A;  4JF4 A;  4KG6 A;  3HLC A;  2J7V A;  1LHY A;  5F5Y A;  3SS5 A;  5HWW A;  2DRW A;  1TDG A;  3RFB A;  4N1X A;  2P9V A;  2XRN A;  3WRT A;  1ALQ A;  2A3U A;  4KUK A;  4M4X A;  5HW3 A;  1NRF A;  2ZC3 B;  4K0W A;  4QY6 A;  5CRF A;  2GNX A;  1H3Q A;  3F1P B;  4E3K A;  2KLI A;  3NC8 A;  3B33 A;  4LPZ A;  4E6W A;  2ZM0 A;  1N9N A;  4EER A;  1K54 A;  5EM1 A;  4E3J A;  1MWU A;  3LIB A;  5HAI A;  3ZG5 A;  5J3W A;  1IKG A;  4I3I A;  5FAP A;  4GNU A;  4N92 A;  4S2L A;  5A90 A;  2Y4A A;  5DJT A;  5E2E A;  2X02 A;  3F1P A;  5M1A A;  3A3F A;  4Q0J A;  3DTE A;  2M7U A;  2WYX A;  1YMX A;  5AQ7 A;  1BLC A;  2UWX A;  2Z2L B;  2J8Y A;  3RXW A;  3H7W B;  3UB7 A;  4RYE A;  4MNR A;  4UQI S;  5FI6 A;  1VHM A;  1BLS A;  5FSR A;  2RL3 A;  4R3B A;  3G30 A;  3OPL A;  1XJ6 A;  3V50 A;  4F94 A;  1OME A;  4JPM A;  4LGW A;  1K57 A;  1ZHH B;  5DJU A;  1W79 A;  3IXB A;  4HH2 A;  1X0O A;  4ZAM A;  1Y28 A;  1Q2Q A;  4Q8I A;  3ZG9 B;  5HAQ A;  3KYE A;  1V9Y A;  5KSH A;  1ODV A;  5FQK A;  5GLC A;  1W8Y A;  5HDC A;  1S66 L;  3AGE A;  3JPU A;  2V20 A;  3MXS A;  1HTZ A;  2J3T D;  1ZG4 A;  1OTD A;  3H9W A;  1IKI A;  1YLY A;  3IH9 A;  3SS4 A;  3E4P A;  3QP1 A;  3S4X A;  4LLO B;  1QMF A;  1YLP A;  4WBG A;  1E4D A;  2V9A A;  3BFC A;  2OAP 1;  2XA7 M;  3FG8 A;  4BL2 A;  1QME A;  3TG9 A;  4AFI A;  2G7U A;  3VV4 A;  5E2F A;  3SW1 A;  2V1A A;  1WYB A;  4WN5 A;  5L10 A;  1TS8 A;  2QPN A;  4BLM A;  4LRX C;  4XUZ A;  4DJ3 A;  3MKF A;  3V39 A;  4WEL A;  4XT2 B;  1Y4O A;  4QD4 A;  2A49 A;  1P97 A;  3M6H A;  4Y0U A;  2V8F A;  1Z09 A;  5EEC A;  5FAQ A;  1GCE A;  1K55 A;  5I5L A;  4MBF A;  5GLB A;  5GHX A;  5GLA A;  1FQG A;  4HBT A;  2ZOI A;  5GHZ A;  2EFX A;  2QJ7 A;  4EBN A;  3BY9 A;  5EVI C;  1S1Y A;  5CHM A;  2WKI A;  1RGZ A;  1JTD A;  3HJK A;  4UEY A;  3V5M A;  4OVD A;  1A0K A;  3ICY A;  3RXX A;  4ETZ A;  3VFF A;  3A0R A;  4UHU A;  4EES A;  3MFX A;  4OPY A;  3UPO A;  4HI4 A;  2DNS A;  1F2K A;  3IX8 A;  4Y0T A;  2Z2M B;  4LRY C;  4R4R A;  1XA1 A;  4JF5 A;  3P98 A;  4BMW A;  1ESU A;  1TEM A;  1VQQ A;  5FAO A;  2VV6 A;  4JXG A;  2GZA A;  3RH8 B;  3PHY A;  4JXS A;  5DF7 A;  3ZNY A;  1H8Y A;  2X01 A;  4EUV A;  2RCX A;  3NEC A;  2WKE A;  1VEU A;  5TR7 A;  3BY8 A;  4LFU A;  1MKM A;  3UB9 A;  2G2U A;  4YWZ A;  4L9F A;  2Q9N A;  4DE3 A;  3QP5 A;  3FKW A;  5FQI A;  4LEN A;  4CJN A;  5D3O A;  4FTX A;  4Y5F A;  4FSF A;  1VET A;  2JC7 A;  2Q9M A;  2INW A;  4M3K A;  4X55 A;  4DXC A;  3MQQ A;  3BFE A;  3VE4 A;  4IJG A;  1L0D A;  3A3I A;  4WZ5 A;  5TFQ A;  1S4R A;  1ONH A;  4ME4 A;  4EUZ A;  4JGP A;  3LR5 A;  3MFD A;  3GQZ A;  1CEG A;  1LI9 A;  1EI5 A;  4I38 A;  4GHI A;  2WKR A;  2WKP A;  3MF0 A;  1C3B A;  1D06 A;  3G31 A;  4CPK A;  4PM6 A;  1CI8 A;  3IWO A;  4HNB A;  5AQA A;  3RTY A;  1L0F A;  2Y8H A;  1E25 A;  4Y0O A;  2PD8 A;  2DMW A;  2R9W A;  3LI8 A;  4ESP A;  2OV5 A;  3NDG A;  1RGY A;  1S0W A;  1CQA A;  2I72 A;  3MZD A;  3BEB A;  1J9M A;  3OPP A;  4I39 A;  2QKP A;  5EE8 A;  1YQS A;  3R7W A;  1LI0 A;  3IQA A;  4S2J A;  4PKY A;  5FQJ A;  1SKO B;  2JKF A;  4N1H A;  1NYM A;  2EXB A;  1CEF A;  3JVU A;  3HJI A;  1K38 A;  3CPT B;  4X1M A;  1I2W A;  4Z9Q A;  3CI6 A;  2ZC5 B;  2JBF A;  5IS1 A;  1K6S A;  5CGS A;  2ZL1 B;  5HPF A;  2A2L A;  4C75 A;  4P6Z M;  3CIT A;  3ITA A;  3OCN A;  2OAQ 1;  4CQH A;  2HDS A;  3S22 A;  4NET A;  4DDY A;  4P6B A;  3GEC A;  2QYB A;  1KDS A;  1YT4 A;  2PBD P;  3PAE A;  3WS1 A;  2XFT A;  3G2Y A;  4IUH A;  4DF6 A;  3T12 B;  5KZH A;  3KX0 X;  2PRF A;  1BZA A;  2XRO A;  2O9B A;  1OPX A;  1BT5 A;  3VFH A;  1G6O A;  2H0Y A;  1HLU P;  3QNB A;  2JE5 A;  3DTK A;  1SDE A;  1ES3 A;  1I5Q A;  3VOL A;  4CLC A;  2JHE A;  2WGI A;  2EFU A;  3MZE A;  3G34 A;  1U60 A;  1I2S A;  1MWS A;  4D60 A;  3L9K A;  4X1L A;  1K6R A;  4MDZ A;  5DTS A;  3MR0 A;  1RCJ A;  4MBK A;  4K08 A;  3W4P A;  4IVK A;  1GSV A;  2OWJ A;  1LLB A;  2J3W A;  3U4L P;  1FOF A;  5F1F A;  5AVF A;  4ARZ B;  3BQ8 A;  3OPR A;  1LL8 A;  5FQM A;  3HCY A;  3BW6 A;  2O9C A;  4RQ9 A;  1FCM A;  5LBR A;  3QNC A;  1J3W A;  1YLJ A;  3PBO A;  3A3D A;  3GVB A;  4RX3 A;  4IUK A;  4WEJ A;  2ZD8 A;  1GHI A;  3MSH A;  2QMI A;  5F6A A;  2GJ3 A;  3S7P A;  3TE8 A;  3BWL A;  4GD8 A;  4GKU A;  4X25 A;  1MY8 A;  3FYZ A;  2Y2J A;  3ZVT A;  1CK3 A;  1RP5 A;  2HDU A;  5A93 A;  2M7V A;  4QY5 A;  1P0Z A;  3FC7 A;  3HLW A;  5JYP A;  3HLE A;  3T4K A;  1SZV A;  1G68 A;  3E4Q A;  3PTE A;  2JKR I;  1FCN A;  2VKS A;  1NLY A;  2HP5 A;  1GHP A;  1H8M A;  4GJ4 A;  1K4E A;  3UDF A;  1YSQ A;  3PBS A;  1V9Z A;  1XJ4 A;  1G28 A;  1FSW A;  1IEM A;  2MJ6 A;  1W63 Q;  4F3L A;  3KSG A;  3G6O A;  4EWF A;  2IWD A;  2A24 B;  5G18 A;  5G4Z A;  2XD1 A;  3T1Q B;  1VM1 A;  2G2W A;  4NXF A;  5F82 A;  5EOE A;  3OBF A;  4OP8 A;  4CLC B;  3UN7 A;  2W3F A;  3S7Q A;  4JLF A;  4R1G A;  4HEF A;  3JYI A;  5CGX A;  5DKK A;  4EEP A;  1KE3 A;  1IFQ A;  2EX8 A;  5IHV A;  3O3V A;  4X6T A;  4DRT A;  3SH7 A;  3ZG8 B;  4CLC E;  1L0G A;  2FZ0 A;  5DVA A;  4DKI A;  1Q2P A;  3A0S A;  1YMS A;  3S7N A;  1LSX A;  3BFF A;  3HVF A;  1YM1 A;  2HGV A;  5GHY A;  1UWP X;  4EU0 A;  2XDM A;  3B42 A;  1F9I A;  3FZC A;  4FOF A;  5GL9 A;  5DKL A;  3UO9 A;  1YLZ A;  2Y2H A;  1ZC2 A;  4ARZ A;  2EX2 A;  3M2K A;  2I9V A;  1W5D A;  2Y2G A;  4KQR A;  1XPB A;  1OTA A;  2W3H A;  3EGD C;  4R3J A;  4EBL A;  1NLZ A;  3ZNT A;  4OP5 A;  2XA7 S;  4F3L B;  3T4L A;  3E4O A;  1GHM A;  5EV0 A;  3CLO A;  2W27 A;  3OZH A;  1DJB A;  4MN7 A;  3TRC A;  1BUL A;  1T1B A;  1NYY A;  4QWO A;  4O01 A;  4BD0 A;  3MBZ A;  2ZQC A;  4Y2F A;  2ZQ9 A;  5EUA A;  3NCK A;  2Y2L A;  5CXW A;  1UWN X;  1ERQ A;  1SHV A;  1CJF A;  2EXA A;  3GV9 A;  5AJG A;  4OOM A;  3BRM A;  4GN2 A;  1PWD A;  3Q7V A;  4IVI A;  1JVJ A;  5TJJ A;  5L09 A;  1ES5 A;  2J80 A;  4K0X A;  4KZB A;  1JNU A;  4FH2 A;  3LY3 A;  2W3D A;  3CJM A;  3NUL A;  4I3A A;  3ZVW A;  5HDS A;  4UQI M;  4S2K A;  3T1S A;  1EWZ A;  2ZMV A;  3IXH A;  3O87 A;  2ZC6 B;  1OTB A;  3NIA A;  4R0Q A;  3NDE A;  4G3W A;  1OT9 A;  1TS6 A;  4MCW A;  4N9K A;  1HZO A;  2WKH A;  4Y17 A;  5CEC A;  3N6I A;  4OQH A;  1W7F A;  2VA0 A;  3O88 A;  2ZL1 A;  4WLA A;  2XR0 A;  1DJC A;  3F1O B;  2V2F F;  1EW0 A;  1LSV A;  1YLW A;  4XUX A;  4LV2 A;  2WAE A;  4O0P A;  1E3U A;  2HDR A;  4C3Q A;  3UMD A;  3OC2 A;  1YKD A;  3MXQ A;  4R4S A;  4R3A A;  2J9O A;  2W1T B;  4PHT A;  3WS5 A;  1D1J A;  1OJG A;  2XK1 A;  4XXR A;  3MQ0 A;  2ZQA A;  2E8J A;  3JVV A;  5TBM B;  1SKO A;  5J4E A;  3LYX A;  1PFL A;  5FDH A;  2C5W B;  2EA9 A;  2V0W A;  3NBL A;  5EPH A;  4PAU A;  2K7S A;  2O9A A;  3VMA A;  3VE3 A;  5DF9 A;  3GMW A;  4BBU A;  5E43 A;  4NEE D;  3SH9 A;  4OKP A;  4B4Z A;  3D9Y A;  2KDK A;  1FCO A;  1KVM A;  2NUT C;  3E98 A;  2B5R A;  2PYR A;  3T4O A;  5F83 A;  5L8M A;  2JKT I;  5HAR A;  1DP9 A;  1OTI A;  3AGD A;  4OOY A;  4EXO A;  3H82 A;  1F98 A;  1NWZ A;  5CHU A;  3B47 A;  5DFX A;  4QHC A;  1F5M A;  1WE4 A;  4CLC C;  4ZTK A;  1GA0 A;  2XH9 A;  1K57 C;  2E8I A;  2Y55 A;  4HJ6 A;  3VSL A;  3N8R A;  1IOU A;  4HJ4 A;  1TVF A;  3IS2 B;  4L9G A;  4EEU A;  1VEU B;  2Z6D A;  1XXM A;  3DWK A;  1VB6 A;  2OLU A;  5JYO A;  1JWP A;  1H0M A;  3IF6 B;  5HPI A;  1TS7 A;  3BYD A;  1N4O A;  3B3X A;  1T18 A;  1L2S A;  3UB6 A;  3NOT C;  4GDB A;  4GDN A;  2EWW A;  3LR4 A;  3K3C A;  3Q81 A;  4BJP A;  3FKV A;  3T4J A;  1NJ4 A;  4NXG A;  2W1T A;  1ES4 A;  3D4F A;  2ZM8 A;  4PM5 A;  4MEZ A;  3KSF A;  3CZD A;  4HHD A;  4JXW A;  1D7E A;  5M18 A;  1KGE A;  3HBR A; 
#chains in the Genus database with same CATH homology
 4LRZ E;  4K08 A;  4DJ2 A;  1GSV A;  2VLG A;  3LIF A;  2OWJ A;  2J3W A;  3EEH A;  3ZQ5 A;  5DJT A;  4YNR A;  2Z6C A;  5AVF A;  3IBR A;  4ARZ B;  3BQ8 A;  3F1P A;  2K31 A;  4Q0J A;  1LL8 A;  2M7U A;  3HCY A;  3BW6 A;  2O9C A;  4RQ9 A;  3H82 B;  3NOP C;  4KQD A;  5LBR A;  3CAX A;  3KYZ A;  3PBO A;  2NUP C;  4IUK A;  4WEJ A;  2VX8 A;  2V1B A;  3H7W B;  4R70 A;  3UB7 A;  2D02 A;  2PR6 A;  5F6A A;  2VJW A;  2GJ3 A;  3S7P A;  4HOI A;  3TE8 A;  3BWL A;  3D3O A;  4UQI S;  2L0W A;  1VHM A;  1KOU A;  5IT5 A;  3KO6 A;  2M7V A;  1XJ6 A;  1ZHH B;  1P0Z A;  2L1M A;  5DJU A;  3FC7 A;  1N9L A;  3LR3 A;  4HH2 A;  1X0O A;  3T50 A;  2EWV A;  3EGX C;  1Y28 A;  2PHY A;  2KOI A;  3T4Q A;  3T4K A;  3UME A;  1V9Y A;  5KSH A;  1ODV A;  3E4Q A;  2CMN A;  2VV8 A;  2JKR I;  4EW7 A;  2VKS A;  1NLY A;  1GSX A;  2ZOH A;  4L9E A;  1H8M A;  4WEK A;  4GJ4 A;  1YSQ A;  4I3J A;  5TBM A;  5HDC A;  1S66 L;  5G4Y A;  2B18 A;  3PBS A;  4PKY G;  5HDD A;  5C5K A;  1V9Z A;  1XJ4 A;  5CX7 A;  4CLC D;  1G28 A;  2MJ6 A;  1S67 L;  2A24 A;  2J3T D;  2VZW A;  1W63 Q;  4F3L A;  4NKP A;  3KSG A;  1OTD A;  4HIA A;  3H9W A;  2PYP A;  4ETX A;  3FPV A;  3G6O A;  1T1C A;  2LB9 A;  3U2A A;  2V0U A;  3K3D A;  2A24 B;  3E4P A;  4HY8 A;  5G4Z A;  4LLO B;  1XJ2 A;  2QJ5 A;  4R38 A;  2V9A A;  5FL3 A;  4E04 A;  4Q0H A;  2OAP 1;  2XA7 M;  2PR5 A;  3FG8 A;  4NXF A;  3NHQ A;  4DN0 A;  4I5S A;  4AFI A;  2G7U A;  2VEA A;  1GSW A;  3VV4 A;  3OBF A;  3MMH A;  3SW1 A;  4CLC B;  2V1A A;  4R6L A;  3ULF A;  2W3F A;  3NJA A;  3LIA A;  4WN5 A;  3S7Q A;  1TS8 A;  1DP6 A;  4WL9 A;  4LRX C;  2P08 A;  4DMZ A;  3PBT A;  2VGL M;  4DJ3 A;  5DKK A;  4EEP A;  3EEA A;  1IFQ A;  4WEL A;  4XT2 B;  4GS9 A;  5HL6 A;  2B02 A;  4HP4 A;  1BYW A;  1P97 A;  3LIE A;  2JN7 A;  2QWS A;  4CLC E;  3LI9 A;  2FZ0 A;  3IBJ A;  5HWT A;  3EQU A;  5I5L A;  3TJZ C;  2KX6 A;  3PBN A;  3MQO A;  3UE3 A;  2IA2 A;  3C30 A;  3A0S A;  3LIC A;  3S7N A;  2ZOI A;  2K2N A;  1LSX A;  2W0N A;  2PT7 A;  2QJ7 A;  3MJQ A;  3BY9 A;  2D01 A;  2YKH A;  2HGV A;  1S1Y A;  4JGO A;  1W63 M;  1UWP X;  5HZH A;  3HJK A;  4EU0 A;  4UEY A;  3B42 A;  1F9I A;  4FOF A;  2J3T C;  4HJ3 A;  3FPW A;  5A8B A;  5DKL A;  3D72 A;  2HJE A;  3LR0 A;  3ICY A;  2P04 A;  4BBV A;  5J7E A;  3KSH A;  4ARZ A;  4ETZ A;  3A0R A;  2I9V A;  3PYP A;  4EES A;  3MFX A;  2R78 A;  4IHQ A;  3A0V A;  1OTA A;  2W3H A;  4HI4 A;  5AVE A;  4EET B;  4H6J B;  3EGD C;  2QHK A;  3TW8 A;  1NLZ A;  1STZ A;  2L4R A;  2XA7 S;  3KYQ A;  4F3L B;  1YAX A;  3T4L A;  4LRY C;  3E4O A;  3PXP A;  4Z1W A;  3CLO A;  2LB5 A;  2M1C A;  2W27 A;  3E0Y A;  4BMW A;  4MN7 A;  3TRC A;  2VV6 A;  4G3K A;  1T1B A;  2PDR A;  4MMN A;  4O01 A;  3F1N B;  2GZA A;  2GX5 A;  3RH8 B;  3PHY A;  3GDI A;  3F1O A;  4KQO A;  4Y2F A;  4EUV A;  1DP8 A;  3EQV A;  2O99 A;  4B93 A;  3BY8 A;  1MKM A;  1UWN X;  3UB9 A;  1T19 A;  4YWZ A;  4L9F A;  3CUE C;  4B9O A;  5AJG A;  3PBR A;  4OOM A;  3OCL A;  4Y5F A;  3R4K A;  4FSF A;  4MN5 A;  5TJJ A;  5HSQ A;  2INW A;  3CWF A;  2H28 A;  3IS2 A;  2J80 A;  3MQQ A;  3VE4 A;  3T4S A;  4IJG A;  1JNU A;  4II7 A;  4HH3 A;  2Y79 A;  2W1R A;  3S7O A;  2W3D A;  1MC0 A;  3BJN A;  4I3A A;  5HDS A;  5F68 A;  4UQI M;  4Q0I A;  2WKQ A;  1S4R A;  2ZMV A;  3OLO A;  4ME4 A;  2JKT M;  3LID A;  2ZBB A;  1OTB A;  5HD5 A;  4JGP A;  3LR5 A;  4G3W A;  1OT9 A;  1TS6 A;  4MCW A;  4OOL A;  4I38 A;  5IU1 A;  2VA0 A;  4P6Z S;  4NXB A;  4GHI A;  2WKR A;  4WLA A;  2HF6 A;  2WKP A;  3MF0 A;  3K2N A;  2VGL S;  3F1O B;  4XT2 A;  1D06 A;  4KUO A;  3O5Y A;  1EW0 A;  4HP9 A;  4HNB A;  1LSV A;  1TD5 A;  3RTY A;  4QPR A;  4HQA A;  2Y8H A;  5HWV A;  1NRJ A;  4O0P A;  2PD8 A;  3UMD A;  3OC2 A;  2FH5 A;  1YKD A;  2BAS A;  2O0Y A;  3W2Z A;  1T1A A;  2DMW A;  3MXQ A;  4R3A A;  2HJ9 C;  3R7W B;  2YKF A;  3LI8 A;  2W1T B;  4PHT A;  1OJG A;  3LFV A;  3MQ0 A;  4MN6 A;  4WUJ A;  2W3E A;  3CUE A;  4EQ1 A;  3EOI A;  1OT6 A;  1N9O A;  3JVV A;  5TBM B;  1LT0 A;  5J4E A;  1TS0 A;  3P01 A;  3LYX A;  3C2W A;  3V67 A;  1OJ5 A;  3C8C A;  4ZRR A;  3DBA A;  4I39 A;  2QKP A;  2P7J A;  4BBT A;  2JKR M;  1XFQ A;  3R7W A;  2XSS A;  3EWK A;  4H6J A;  4PKY A;  1P9R A;  3OOV A;  2EA9 A;  3ZYT A;  2V0W A;  4PAU A;  3KSI A;  3T4T A;  3JVU A;  2K7S A;  2O9A A;  3HJI A;  4YOF A;  3VE3 A;  1P9W A;  4G3V A;  5DF9 A;  5EFW A;  4WF0 A;  3LUQ A;  1XJ3 A;  3P7N A;  5F69 A;  4GLQ A;  3UB8 A;  4BBU A;  1DRM A;  3CI6 A;  1MZU A;  5HD3 A;  5IS1 A;  4NEE D;  4GHI B;  2HV1 A;  4GCZ A;  2KDK A;  5DFY A;  5HPF A;  2NUT C;  2A2L A;  3E98 A;  4GW9 A;  4P6Z M;  2PYR A;  3CIT A;  3T4O A;  1LSW A;  2ZMF A;  3OCN A;  5L8M A;  2OAQ 1;  1S4S A;  2JKT I;  1WA9 A;  4CQH A;  1DP9 A;  4JGQ A;  1OTI A;  4EXO A;  3H82 A;  1F98 A;  1NWZ A;  3GEC A;  2QYB A;  3B47 A;  5DFX A;  3H7W A;  1F5M A;  4IUH A;  3PBQ A;  1ZTU A;  1XFN A;  4JGR A;  3NOU C;  3KX0 X;  1TF1 A;  4CLC C;  2XRO A;  2O9B A;  4NXE A;  1OPX A;  2PD7 A;  1G6O A;  2OOL A;  4HJ6 A;  1IOU A;  4HJ4 A;  5F5Y A;  5HWW A;  3IS2 B;  4L9G A;  3RFB A;  1S1Z A;  2OWH A;  3VOL A;  4EEU A;  2XRN A;  4O8G A;  3PR6 A;  2Z6D A;  1UGU A;  2W3G A;  4CLC A;  4Y3I A;  1OTE A;  1VB6 A;  4GS9 B;  4KUK A;  2JHE A;  5MC7 A;  4M4X A;  5HPI A;  2GNX A;  1H3Q A;  1TS7 A;  3F1P B;  3F1N A;  3UE6 A;  1YSP A;  2KLI A;  1T18 A;  3B33 A;  2VV7 A;  3UB6 A;  3NOT C;  4LPZ A;  3BQA A;  5K5B A;  2EWW A;  3LR4 A;  3K3C A;  4BWI A;  4L0L A;  4BJP A;  3T4J A;  3C38 A;  4NXG A;  1N9N A;  5KIZ A;  2W1T A;  4EER A;  4MDZ A;  3KSF A;  3MR0 A;  4HHD A;  3LIB A;  1D7E A;  5J3W A;  4I3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...