1YLPA

Atomic resolution structure of ctx-m-27 beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKHADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGGYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-lactamase CTX-M-27
publication title Atomic Resolution Structures of CTX-M beta-Lactamases: Extended Spectrum Activities from Increased Mobility and Decreased Stability.
pubmed doi rcsb
source organism Escherichia coli
total genus 99
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ylpA00
2IWDA 2ZC7A 4LV1A 4OLDA 3FYZA 3W4PA 4S2KA 2X71A 3VP1A 1CI9A 3VP3A 1KE0A 4DKIA 1BTLA 1BSGA 4JBFA 4K91A 3ZG9B 1KGEA 4BQMA 2WGWB 3OPRA 1XXMA 1XKZA 3IXGA 1GA0A 1L0DA 2WAEA 5HAQA 3RJUA 3SS4A 3MXRA 2XEPA 4OOLA 4E3IA 1GHMA 3G2YA 1BLHA 1TDLA 4QHCA 2XGNA 4B4XA 1K4EA 3A3DA 1IKIA 3OCNA 3C4PA 5F1FA 1W8QA 5M18A 2C5WB 3G34A 3PAGA 1RGYA 1TEMA 1MPLA 4JXSA 5EECA 4ID4A 4CPKA 5DTTA 1S6RA 3SS5A 5CTMA 4P85A 1FOFA 1PWGA 5AQ7A 3DW0A 1FCNA 1RCJA 3ZG5A 4FCFA 1VQQA 4K0XA 4WELA 2P9VA 2DRWA 3GR2A 5CGWA 3UE0A 1IEMA 2R9WA 3NI9A 1BUEA 1U60A 3IH8A 1Z6FA 4LENA 5KMWA 1YM1A 1BLCA 3Q82A 1ES2A 3PBSA 1LI9A 3IHAA 1XPBA 4PM8A 3MKEA 3HUOA 4PPRA 4S2IA 5E2EA 4X6TA 4ZDXA 4N1HA 3ZHHA 3ZVTA 4KZBA 2BG1A 4U0XA 3AGEA 4F94A 3V5MA 5AQBA 2XFTA 3IWQA 4GD8A 1PW8A 3HLCA 5FQIA 5HW3A 3W8KA 4N9KA 1FSWA 5FAOA 4UA9A 2JCHA 3C5AA 3N4IA 2EXBA 3PBOA 3OC2A 3UE3A 3P09A 3VOZA 3LY3A 3ZGAB 3ZNTA 4DE1A 4KZ8A 5A91A 5DF8A 1XX2A 2ZM2A 1H8YA 4KG2A 5HL1A 5EVLA 5CHMA 5TGFA 2J9PA 4OOMA 2VGJA 3O86A 3M2KA 4DF6A 2H0YA 5G18A 4QY6A 4GOGA 3WS4A 3C7VA 1SDNA 4N9LA 2XF3A 1HD8A 3NCKA 1PWDA 4QY5A 3VMAA 3ZNYA 4LV2A 3IWIA 3C4OA 4OQHA 4JF6A 5GLBA 2ZQ7A 2HDSA 4GDNA 4M3KA 3V3SA 2QZ6A 4QD4A 3TOIA 1KE3A 2ZM8A 1HTZA 2UWXA 5FAPA 4BL3A 4MLLA 4S2LA 1NXYA 2DCFA 3WS0A 1FR1A 1N9BA 2ZQCA 5HFOA 2WKIA 1SDEA 4DXBA 3IT9A 1KVMA 3OPPA 2OV5A 5DF7A 1PZOA 1W5DA 1ALQA 2XR0A 3EQUA 1ZKJA 4DXCA 3M2JA 1FR6A 3ITBA 3DWZA 4OPZA 4ZJ2A 3ZVWA 4S2OA 5A90A 4DDYA 3IH9A 3SH8A 1YQSA 5FSRA 4OPYA 1QMEA 4R3JA 5E2FA 3ITAA 4HEFA 5FI2A 5JYOA 1K56D 4KZ9A 3ZG0A 2WZZA 4K0WA 1BZAA 1L0FA 4E6XA 3BYDA 3PBTA 3CJMA 2V1ZA 3LY4A 1E25A 1KVLA 4BD1A 4KQQA 3N8SA 2XFSA 5E2GA 2ZC4B 1YMXA 1WE4A 3GTCA 4EBLA 2EX2A 4OH0A 2V2FF 4D2OA 3V50A 1EWZA 2A49A 3AGDA 1FCMA 3GRJA 2ZQ8A 3GVBA 3HBRA 3HL9A 4GNUA 5FAQA 1MXOA 5CHJA 1IYSA 4OLGA 1K56A 5M1AA 4HBUA 4OKPA 4HBTA 5HARA 4KQOA 2XH9A 4IEDA 2J7VA 4OVDA 1YLPA 3HUNA 1FQGA 4E6WA 1NZOA 3MFDA 2P74A 2WUQA 3BFDA 3NY4A 1PW1A 1EI5A 1W79A 2Q9MA 2WADA 3A3EA 4LV0A 4MNRA 4UAAA 4E3JA 5CECA 1PWCA 2Y2MA 4QJGA 3B3XA 4S2PA 3HUMA 1PZPA 4B88A 4NK3A 1I2SA 4PM9A 2Y2KA 1YT4A 1ZG4A 5EPHA 5GHYA 3BLSA 2EX6A 1I5QA 1TVFA 1K4FA 4HESA 5FATA 3WS1A 3BLMA 4KQRA 5F83A 5FQKA 4GDBA 4UA6A 5TFQA 5TR7A 2Z2LB 4XUXA 2RL3A 3UE1A 4IVKA 4E3NA 4IBRA 1KDSA 4GD6A 3BRMA 2FFYA 5EVID 1L0EA 2Y2IA 5GHXA 4R23A 1K57C 2HDRA 5EVIC 4L0LA 3VP4A 5FASA 1CK3A 4FD8A 4X53A 1BLSA 3FV7A 2XD5A 3BFEA 2ZD8A 3GV9A 4R0QA 1JWZA 4S2MA 4U3TA 3G35A 5CXWA 3V3RA 3UPPA 5GLAA 5E2HA 3NDEA 3VSKA 3NBLA 4IVIA 4MBHA 3PBRA 1GA9A 5U47A 2QMIA 2WGIA 4JLFA 1IELA 2XQZA 2ZC6B 4EBNA 3E2LA 5L2FA 2CC1A 1W8YA 2Y2HA 1GHIA 3MZEA 4P87A 2P9VB 1K57A 5EOOA 5EVIA 1MWRA 4WZ4A 1TDGA 1SKFA 3E2KA 3D4FA 3N8LA 4WYYA 5AQ9A 2JE5A 5GL9A 5F1GA 2B5RA 3G4PA 1ES5A 3VFFA 1PI4A 4R1GA 4KZ5A 4OQGA 3C7UA 1LL9A 4WZ5C 4RA7A 3IF6C 3Q7ZA 2H10A 4N1XA 3VSLA 3WWXA 2HDQA 3ZG7B 3BEBA 4X69A 4BENA 5GLCA 2E8IA 1YLTA 3QNCA 4RX3A 2WKEA 4DE0A 3G30A 2Y2JA 5F82A 1LHYA 1AXBA 3S1YA 4JXVA 1K54C 3IWOA 4KZ3A 1ERMA 5CRFA 5FI7A 3UDIA 2FFFB 3W4OA 1O7EA 4OONA 4LV3A 2H0TA 2WKHA 5KSCA 3LCEA 1K55C 2EX9A 1ONGA 1KE4A 3BFGA 3S22A 1NRFA 1Y54A 4N92A 4WZ5A 3IF6A 2ZJ9A 4B4ZA 2Y2QA 3FKVA 3WRZA 3BFCA 3CMZA 4JXWA 1ESIA 1M6KA 3PAEA 2WGVA 1EROA 1XGJA 2ZMAA 3OZHA 4S2JA 4ZTKA 2Y4AA 2WZXA 4KENB 4KG5A 1ZG6A 1JTGA 4PM6A 2V20A 3M6BA 4GZBA 4Q8IA 2JBFA 1WYCA 2HP5A 3FZCA 5AQAA 3HLEA 1CI8A 2IWBA 1NJ4A 4H8RA 4WMCD 5CEBA 3O3VA 1MBLA 1NZUA 4C3QA 2I72A 1ESUA 3WS2A 4JPMA 5DTKA 2Y2OA 3Q7VA 3UO9A 4EV4A 4BD0A 1MWUA 2A3UA 1H8ZA 4X56A 2ZLYA 4Y0UA 3NDGA 4C75A 2Y55A 1YMSA 1L2SA 4GN2A 3G2ZA 1JVJA 4EUZA 4FSFA 3QHYA 1ONHA 3UPNA 3ZCZA 3NIAA 3NC8A 3G32A 1XA7A 1IYQA 2ZQDA 1YLZA 4WMCA 3DTMA 5HAPA 5J8XA 2Q9NA 2Y91A 3QNBA 3UY6A 1I2WA 5DF9A 3JYIA 2X02A 1YLJA 5CERA 5BOHA 5CGSA 2VGKA 4OQ0A 4X55A 5A93A 1DJCA 1LI0A 2WGWA 5FQQA 1J9MA 3OPHA 4NETA 3VFHA 1ES3A 2ZQAA 3I7JA 5D3OA 3SH7A 3IXDA 3N7WA 2WK0A 4C6YA 1ZC2A 1QMFA 1IYPA 4OPQA 4JKTA 4XUZA 4FH4A 1K6SA 4BJPA 3FWLA 3GMWA 4P6BA 1L0GA 1PI5A 1Q2PA 4RX2A 5I94A 2GDNA 4P0MA 3TG9A 4EWFA 5DVAA 2XD1A 1O07A 3BFFA 1SHVA 1WYBA 1XA1A 4DRTA 2PU4A 3IQAA 5GLDA 4KZ6A 2DNSA 2ZC3B 4X68A 1GHPA 2QPNA 3O88A 4OP5A 1BT5A 4OOYA 2ZQ9A 1FSYA 3SH9A 4WEKA 4UHUA 2PBYA 5IHVA 4GKUA 3BECA 4CJNA 1NY0A 3HLWA 4MEZA 5EE8A 2JC7A 2WYXA 1IYOA 5FDHA 3MZFA 5KZHA 2OLUA 4EBPA 1VM1A 4ZAMA 1KDWA 4R4RA 1E4DA 4S2NC 3G31A 5CHUA 4ZBEA 5EOEA 3VP0A 4YFMA 4E3MA 3AGFA 2PU2A 3A3FA 4QB8A 2EFXA 4JXGA 1MWTA 4KZ4A 2OLVA 3CG5A 5A92A 1JWVA 1KGGA 3MKFA 3RXWA 1SCWA 4BLMA 2HP6A 3GSGA 1K25A 2EXAA 1S0WA 3VP2A 2G2WA 4DE3A 3HVFA 3M6HA 4U0TA 3WRTA 1JTDA 3ISGA 3HLDA 1OMEA 4S2NA 3OCLA 4YINA 3SS3A 3GQZA 4DE2A 2HDUA 4E3KA 4KZ7A 5CTNA 3PBQA 1NYMA 1IKGA 4A5RA 5HAIA 1E3UD 2G2UA 4RVAA 3UPOA 1XGIA 4PMAA 3MZDA 4MBFA 5CGXA 2EX8A 1W7FA 5CEDA 5EVIB 4E3LA 1RGZA 5JYPA 1PYYA 3Q07A 2XK1A 4DDSA 1XP4A 1G68A 3OPLA 3O87A 1K6RA 1MKIA 3BM6A 5FQJA 3HLGA 4GB7A 4XXRA 1GCEA 3ZFZA 3PBNA 1DJBA 1DJAA 1HVBA 4WEJA 1K54A 1YLWA 1DY6A 4ZJ3A 4JF5A 3IHBA 1ES4A 1E3UA 1CEFA 3HLFA 2C6WB 3MBZA 2Y2GA 1KGFA 4FH2A 1M40A 4OP8A 5GHZA 3MXSA 2BLSA 2RCXA 3VOYA 1YLYA 4O7DA 1JWPA 4OPRA 1K55A 2HPBA 3UDXA 1LLBA 1Q2QA 4R4SA 4WM9A 3V39A 4BL2A 4OQIA 1G6AA 3A3IA 5DTSA 3EQVA 4Y7PA 1BULA 5FA7A 3IF6B 2XDMA 4E3OA 3PTEA 3P98A 2ZC5B 4JF4A 2IWCA 4QU3A 1ERQA 1FCOA 1K38A 1LL5A 5EUAA 1PIOA 3ZDJA 4KG6A 3TSGA 2J9OA 4MBKA 2OSUA 2X01A 3W4QA 1HZOA 2WAFA 3N8RA 2Y2NA 4IBXA 5E43A 1CEGA 5FI6A 2ZM0A 3N6IA 5FQMA 3SOIA 5KSHA 1MWSA 3IXBA 5HX9A 5M19A 3IXHA 3WS5A 4ZJ1A 3UDFA 3ZG8B 2XLNA 2Z2MB 4RYEA 4LCLA 2Y2LA 4PM7A 1MY8A 2H5SA 3RXXA 3LEZA 3Q1FA 2HP9A 1C3BA 2Y2PA 2J8YA 1RP5A 2Y59A 4Y0TA 3Q7VB 4WBGA 4KZAA 3IF5A 3HLBA 3Q81A 4EQIA 1NYYA 3A3JA 2EFUA 3LO7A 2R9XA 4Z9QA 1N4OA 3CZDA 3DWKA 5FQ9A 3UN7A 3S4XA 3HREA 3FKWA 1H5XA 4Y0OA 3UNWA 4LCMA 4R3BA 4UA7A 4PM5A 1BLPA
chains in the Genus database with same CATH superfamily
3FYZA 3W4PA 2X71A 2VGLM 2HJEA 4K91A 3ZG9B 1KGEA 4BQMA 1XXMA 2W3GA 1Y28A 1L0DA 2WAEA 4ARZB 5HAQA 2GJ3A 1GHMA 1TDLA 3F1OA 1L3LA 3VV4A 2W1RA 3OCNA 3C4PA 5F1FA 1W8QA 1N9NA 1MPLA 4ID4A 1TS6A 5DTTA 1MZUA 4P85A 5AQ7A 3DW0A 1RCJA 3ZG5A 5TJJA 1P97A 3CAXA 3UE0A 5CGWA 2BTFP 5J4EA 2PR5A 4M4XA 3B33A 5KMWA 1S1YA 1BLCA 1XPBA 4PPRA 4X6TA 4ZDXA 4UEYA 1F2KA 3ZVTA 3IBRA 4F94A 1YPRA 2XFTA 4WN5A 2B18A 4XT2B 5FQIA 3OBFA 2XROA 3KSFA 2JCHA 3KYZA 4HI4A 4I3IA 3ZGAB 3LGOA 2VJWA 4NXFA 4NG2A 4KG2A 3O86A 5G18A 4QY6A 2A2LA 1HD8A 1PWDA 4OQHA 2HDSA 4GDNA 4QD4A 3TOIA 1KE3A 4X1LA 4BL3A 2XA7M 5L8MA 2WKIA 1KVMA 2OV5A 5DF7A 1W5DA 4E04A 2XR0A 3M2JA 3LFVA 3RH8B 4OPZA 1VETA 5A90A 2VGLS 4EXOA 5G4ZA 3L7HA 1QMEA 4R3JA 5E2FA 2PRFA 1CJFA 2BASA 1K56D 3ZG0A 4EU0A 5MC7A 1BZAA 5A8BA 3DTEA 3V50A 5CHJA 1IYSA 1K56A 1MKMA 4OKPA 4F3LB 4HBTA 4KQOA 2XH9A 4IEDA 1YLPA 4E6WA 2Q9MA 4UAAA 2Y2MA 3U4LP 3LR5A 4S2PA 1PZPA 1TVFA 5FATA 5HPFA 4KQRA 5F83A 3TW8A 2PD7A 5FQKA 4UA6A 5TFQA 4XUXA 2JKRI 2FFYA 1L0EA 5FASA 3VP4A 4X53A 1BLSA 1STZA 3GV9A 4R0QA 1JWZA 4S2MA 4U3TA 3U2AA 5CXWA 2J3TD 3V3RA 5GLAA 3NDEA 3PBRA 1GA9A 4IJGA 5U47A 2Y8HA 4EBNA 4EQ1A 4R3AA 1W8YA 1GHIA 3MZEA 1JNUA 1F98A 3N8LA 4WF0A 3D4FA 4FTXA 4WYYA 5F1GA 1IOUA 3VFFA 2XA7S 4RQ9A 3C7UA 4RA7A 3VSLA 3ZG7B 1TS0A 1YLTA 4MN5A 2XSSA 2Y2JA 4QWOA 1LHYA 1LSVA 3MSHA 4KUKA 5K5BA 1GSVA 4R38A 3UE6A 3KYQA 3LCEA 3BQAA 3T4OA 2B95A 3IF6A 3BFCA 4JXWA 1XGJA 4GZBA 5AQAA 3HLEA 1W63M 5CEBA 1MBLA 3C30A 4C3QA 2I72A 1ESUA 3WS2A 3T50A 1MWUA 4Y0UA 1L2SA 1BYWA 3CUEA 4EUZA 4LFUA 3G32A 1IYQA 1YLZA 4Q0HA 1PFLA 2M7UA 2Q9NA 3UY6A 5DF9A 3JYIA 2OAQ1 5CGSA 4II7A 3CPTB 4NETA 3IS2B 5D3OA 2LB5A 3UMDA 2GNXA 5HD3A 3LI8A 2UV0E 4FH4A 4BJPA 4MN7A 4HIAA 5I94A 2GDNA 4EWFA 2XD1A 3BFFA 1WYBA 4ETXA 3QP2A 3EWKA 1TF1A 4DJ3A 3SH9A 5FEGA 2D02A 4HH2A 2PBYA 4GKUA 2ZBBA 1NY0A 4HNBA 4MEZA 2JC7A 5LBRA 5FDHA 1K0KA 2ZMVA 4EERA 1VM1A 4R4RA 1E4DA 3IX8A 4S2NC 4E3MA 2PU2A 4XT2A 5C5KA 1ZHHB 1KGGA 1OTIA 1SCWA 4LRXC 4UQIM 3VP2A 4DE3A 3A0RA 3EEHA 3ISGA 3HLDA 5DKLA 1OMEA 3C8CA 1XJ3A 5EM0A 4A5RA 3SW1A 1XGIA 5CGXA 2OWJA 2EX8A 4E3LA 5JYPA 1PYYA 1MKIA 4BBVA 4XXRA 3ZFZA 3ULFA 4L9GA 2L1MA 4CLCB 1K54A 1DY6A 4ME4A 4ZJ3A 1ES4A 1CEFA 4OP8A 2Y2GA 4O7DA 1LLBA 2INWA 1SZVA 5FA7A 3P98A 1D7EA 1VEUB 5L09A 3ZDJA 2X01A 5FI6A 1CEGA 5M19A 1P9RA 5AVEA 2Y2LA 3QP5A 2H5SA 3LEZA 4Y13A 1C3BA 3DTKA 5L10A 4EQIA 5TBMA 3LO7A 4F3LA 4G3VA 1N4OA 3DWKA 3S4XA 3LYXA 3FKWA 3CITA 3MQ0A 3UNWA 3P01A 4MCWA 4LV1A 2OOLA 1CI9A 2ZOHA 2R78A 2A24B 1BSGA 1XKZA 3MXRA 2XEPA 3G2YA 1NWZA 1IKIA 1UWPX 2C5WB 3G34A 5J3WA 1RGYA 4JXSA 4QPRA 5CTMA 1FCNA 4PKYG 2ACGA 3QP8A 4K0XA 4WELA 2R9WA 3D9YA 3NI9A 3IH8A 1U60A 4LENA 3T1XA 3T4SA 1S4SA 3HUOA 5E2EA 2XRNA 4N1HA 1H0MA 1LSXA 3IWQA 3HLCA 5HW3A 2QJ7A 3W8KA 4N9KA 1FSWA 5FAOA 4EW7A 4O0PA 3N4IA 2EXBA 3PBOA 3P09A 3VOZA 5A91A 3ZYTA 1XX2A 5EVLA 4KUOA 3G6OA 4HP9A 3M2KA 3OOVA 1ZTUA 3ICYA 3EGXC 4QY5A 2ZL1B 3VMAA 3ZNYA 4LV2A 4GJ4A 4JF6A 2ZQ7A 3KX0X 4M3KA 3V3SA 2QZ6A 2PHYA 2ZM8A 2UWXA 4S2LA 1NXYA 2DCFA 1FR1A 1N9BA 5HFOA 2KX6A 5EM1A 1S67L 1ZKJA 4ZJ2A 3ZVWA 1D1JA 5AJGA 4EEPA 1D06A 5HWVA 3IH9A 3IS2A 5FSRA 4OPYA 3ITAA 4KZ9A 4K0WA 1L0FA 3PBTA 3CJMA 2V1ZA 3DTIA 3E98A 3KSHA 1T18A 3N8SA 5E2GA 4FOFA 4OH0A 2V2FF 2A49A 3GRJA 5TGFA 2ZQ8A 4EEUA 4H6JB 1NLZA 3UB6A 3HUNA 1FQGA 4ESPA 2P74A 2WUQA 3NY4A 2PDRA 4LV0A 1W79A 5F69A 4E3JA 4HHDA 4QJGA 5HZHA 4B88A 1I2SA 2Y2KA 1YT4A 1ZG4A 5EPHA 5F6AA 5GHYA 3BLSA 1I5QA 3KYEA 2O9BA 3BW6A 4HESA 3WS1A 3BLMA 4GDBA 3UE1A 5HPIA 3BRMA 1F9IA 1K57C 2HDRA 4L0LA 3KO6A 4FD8A 3T1QB 3LUQA 4O01A 3S7QA 4CLCD 4G3KA 5E2HA 3K2NA 5CX7A 3VSKA 3NBLA 4MBHA 2J80A 2V0WA 4L9FA 2XQZA 2ZC6B 4JGOA 2P9VB 1DP6A 1SKFA 5GL9A 5AQ9A 2B5RA 1PI4A 4OQGA 1LL9A 4N1XA 4I3AA 3WWXA 2HDQA 4CLCA 4B93A 3BEBA 4X69A 5GLCA 1SKOB 3C38A 3R4KA 1F5MA 4LRZE 4JXVA 5F5YA 5CRFA 5FI7A 2K31A 3W4OA 2H0TA 1K55C 2ZJ9A 4B4ZA 4PKYA 3T1SA 1ESIA 1EROA 2ZMAA 5HL6A 2QWSA 2Y4AA 4HJ3A 4KG5A 4Q8IA 1JTGA 2VV8A 1WYCA 2HP5A 2QKPA 1CI8A 3UMEA 1NJ4A 1IFQA 5DFXA 4JPMA 5DTKA 2Y2OA 2L0WA 2A3UA 2FZ0A 1WA9A 3NDGA 2Y55A 1YMSA 5EFWA 2V1AA 1ONHA 2M7VA 4WUJA 3NIAA 2ZQDA 1YSQA 2AVXA 1LSWA 3H7WB 3EOIA 5J8XA 3QNBA 3CLOA 3H82A 1I2WA 1YLJA 3FC7A 2A24A 4OQ0A 5FQQA 2ZQAA 3LR3A 4IUKA 3SH7A 2WK0A 4I38A 3S7OA 1VHMA 1QMFA 1IYPA 4OPQA 4JKTA 4LLOB 1K6SA 4IHQA 3GMWA 2Z6CA 3R7WB 1PI5A 4X1MA 4P0MA 5DVAA 3LR4A 1PNEA 2PU4A 1T1BA 1PRQA 2ZC3B 1XFNA 1GHPA 3O88A 4EUVA 4OOYA 3DBAA 5IHVA 4CJNA 3HLWA 2V0UA 3MZFA 4EBPA 5HSQA 4HOIA 3G31A 3VP0A 5EOEA 1G28A 3ZQ5A 4JXGA 3CG5A 2O9CA 5DJTA 3RXWA 3LIAA 3F1NB 4BLMA 3GSGA 3IBJA 2PYRA 3M6HA 2OAP1 4U0TA 3V67A 1JTDA 3T4JA 5G4YA 4S2NA 3OCLA 3T4TA 2HDUA 5CTNA 1IKGA 2G2UA 4MBFA 3JVUA 2ZL1A 1RGZA 3Q07A 2XK1A 2JKRM 4DDSA 1XP4A 1GSXA 1G68A 4MMNA 3O87A 2VV6A 3BY9A 1DJAA 1HVBA 2JKFA 4WEJA 3E4OA 4BWIA 1M40A 3T4QA 5GHZA 3MXSA 2RCXA 2HPBA 2QJ5A 4WM9A 4R4SA 5KIZA 3A3IA 3MS6A 3PTEA 4JF4A 1OT6A 1K38A 5HDCA 4KG6A 3F1PB 4MBKA 5E43A 3SOIA 3IXBA 2IA2A 4ZJ1A 4O8GA 3RXXA 4I39A 3VE4A 3Q7VB 1ODVA 3IF5A 4H6JA 4ARZA 2EFUA 3CZDA 3VOLA 5FQ9A 3UN7A 4Y0OA 3LR0A 2IWDA 2ZC7A 4OLDA 4S2KA 3KSIA 4KQDA 1KE0A 4DKIA 4JBFA 2W27A 3SZTA 2WGWB 3OPRA 2W1TB 1GA0A 5EVEA 1Y4OA 1T1CA 1LL8A 5DKKA 2XGNA 4B4XA 1K4EA 1S4RA 2H28A 3A3DA 5M18A 3CHWP 1TEMA 5EECA 3IX3A 1FOFA 1DP9A 4EESA 1VQQA 2P9VA 2PT7A 2DRWA 3GR2A 4FUWA 1TS7A 1YM1A 3VE3A 3Q82A 1V9YA 3PBSA 1LI9A 4PM8A 3MKEA 3E4QA 3ZHHA 4KZBA 4U0XA 3V5MA 5AQBA 4GD8A 1YAXA 3CWFA 4UA9A 3C5AA 3OC2A 3UE3A 3B42A 3DAVA 3LY3A 5DF8A 2ZM2A 1H8YA 2FH5A 4PAUA 5CHMA 4JGPA 4DF6A 1OTBA 3C7VA 3IWIA 4Q0IA 3C4OA 3BY8A 3D72A 2L4RA 4I3JA 2JHEA 1SDEA 4DXBA 3IT9A 1ALQA 3S7NA 3CUEC 2E8JA 3EQUA 1FR6A 3TE8A 3ITBA 3DWZA 4HJ6A 2W3DA 1P0ZA 1H8MA 5FDSA 3SH8A 4DN0A 3NHQA 3L9KA 4JGQA 1S1ZA 4E6XA 1E25A 2ZOIA 3MMHA 4BD1A 1TS8A 3R7WA 2XFSA 2ZC4B 1WE4A 2KDKA 1EWZA 3AGDA 3GVBA 4HY8A 1MXOA 3B47A 4Q0JA 4OLGA 4GLQA 3IX4A 2VLGA 1P9WA 5M1AA 2PYPA 4HBUA 5HARA 3MQOA 1NZOA 4UQIS 2WADA 3A3EA 5CECA 2GX5A 1K4FA 1OPXA 3EGDC 3F1NA 5TR7A 2Z2LB 2RL3A 4IVKA 4IBRA 1KDSA 4E3OA 1G6OA 2VEAA 2Y2IA 4R23A 5EVIC 3FV7A 2XD5A 1CQAA 2ZD8A 2QMIA 2WGIA 2V8CA 3S7PA 2HF6A 5L2FA 4P87A 1K57A 1MWRA 3E2KA 4Y15A 4R1GA 4WZ5C 2H10A 4YOFA 4BENA 4RX3A 2WKEA 4DE0A 3G30A 5HWWA 3S1YA 5F82A 1K54C 2QHKA 4KZ3A 1ERMA 1NLYA 3UDIA 2W3HA 2WKHA 4LV3A 3K3CA 1ONGA 1KE4A 1NRFA 1Y54A 3NOTC 1XJ6A 2WKPA 3CMZA 1M6KA 2WGVA 3NECA 2EWWA 4S2JA 4ZTKA 2WZXA 4KENB 4HQAA 1ZG6A 2V20A 2JBFA 3GECA 2JKTI 3FG8A 3FZCA 1UGUA 2VZWA 4LGWA 4H8RA 4WMCD 4BMWA 3O3VA 4BBUA 3MJQA 3CPTA 3Q7VA 4EV4A 1H8ZA 2ZLYA 4C75A 4GN2A 3G2ZA 4FSFA 1XA7A 4WMCA 2DMWA 2PAVP 3DTMA 5HAPA 2G7UA 2Y91A 2CMNA 1OTAA 1CF0A 2VA0A 5CERA 1OJ5A 5BOHA 2VGKA 4GS9B 4X55A 1DJCA 1LI0A 2WGWA 3VFHA 3OPHA 2V9AA 2W1TA 2W3EA 3I7JA 2B02A 3N7WA 5DFYA 3MQQA 4XUZA 3LIDA 2GZAA 3FWLA 2YKFA 1XFQA 1Q2PA 3TG9A 3GDIA 1SHVA 1MC0A 1XA1A 2VV7A 5GLDA 1X0OA 2DNSA 1FIKA 2QPNA 3LIFA 1BT5A 2V8FA 2ZQ9A 1FSYA 2P7JA 2JN7A 4WEKA 3BECA 5EE8A 2OWHA 2WYXA 2OLUA 4ZAMA 1KDWA 4ZBEA 4CQHA 4YFMA 4Y5FA 3AGFA 5HD5A 3A3FA 2M1CA 4QB8A 2EFXA 2OLVA 5AVFA 1K25A 2EXAA 1S0WA 2MJ6A 3RFBA 3HJKA 3E0YA 5FEFA 4YINA 1TD5A 3GQZA 4KZ7A 3PBQA 3BWLA 3HJIA 5HAIA 1E3UD 3UPOA 4LRYC 1FILA 5EVIB 3BM6A 2KOIA 4GB7A 3UB7A 1VEUA 1YLWA 3P7NA 4JF5A 3QP4A 1E3UA 3MFXA 5IU1A 3MBZA 1KGFA 3VOYA 1JWPA 1OTDA 3UDXA 1V9ZA 1Q2QA 4R70A 3V39A 3PXPA 4BL2A 4OQIA 5DTSA 4Y7PA 1BULA 3JPUA 2ZC5B 2IWCA 2W0NA 4QU3A 3NOPC 3TSGA 2WAFA 4IBXA 3C2WA 5FQMA 2NUPC 1VB6A 1MWSA 4IUHA 3IXHA 2JKGA 3UDFA 3T1RA 2XLNA 4RYEA 4LCLA 4HJ4A 2QYBA 3Q1FA 2J8YA 4Y0TA 3HLBA 3A3JA 4Z9QA 3HREA 1OJGA 4R3BA 4UA7A 1BLPA 4I5SA 3VP1A 4X25A 3VP3A 1HLUP 1BTLA 3JVVA 4BBTA 3IXGA 4L9EA 4LPZA 5TBMB 3RJUA 3SS4A 2WKQA 3CI6A 4OOLA 4E3IA 1BLHA 4QHCA 1J3WA 4YNRA 2Y79A 3PAGA 4CPKA 3LEQA 1S6RA 3SS5A 3HCYA 1PWGA 4GHIB 4FCFA 1KOUA 3UB9A 1IEMA 4Y2FA 1BUEA 1Z6FA 1ES2A 4NXBA 3IHAA 4S2IA 2O99A 3UB5P 2BG1A 4CLCC 3AGEA 1NRJA 1PW8A 2HV1A 2HZ5A 4GW9A 3FPVA 4DE1A 4KZ8A 5HL1A 3A0VA 2J9PA 3UB8A 4OOMA 2VGJA 2H0YA 4GOGA 1DRMA 5FL3A 3WS4A 1SDNA 4NXGA 1W63Q 4N9LA 2XF3A 4G3WA 3NCKA 4EETB 4WL9A 5GLBA 1Z09A 1HTZA 5FAPA 4MLLA 3WS0A 5HDDA 2ZQCA 2ZMFA 3BQ8A 4MDZA 3OPPA 1PZOA 4Y3IA 4DMZA 4DXCA 1EW0A 5IT5A 2VKSA 4S2OA 4DDYA 4GS9A 1YQSA 2V1BA 3T4LA 4HH3A 5JYOA 4HEFA 5FI2A 2WZZA 3NOUC 3BYDA 3LY4A 1KVLA 5J7EA 4KQQA 1YMXA 3GTCA 4WLAA 4EBLA 2EX2A 4D2OA 3HBRA 4GNUA 1FCMA 3HL9A 5FAQA 2Q0OA 2PBDP 2P04A 3NULA 2J7VA 4OVDA 3QP1A 2KLIA 3MFDA 3BFDA 4MNRA 3ZNTA 1PW1A 1EI5A 4P6ZM 3NJAA 1PWCA 3B3XA 3MXQA 3HUMA 4NK3A 4PM9A 1OTEA 2K7SA 2EX6A 4YWZA 3MF0A 3H9WA 4B9OA 4E3NA 5GHXA 4GD6A 5EVID 3F1OB 3E4PA 1CK3A 5I5LA 3BFEA 2NUTC 5L07A 3G35A 1SKOA 3PYPA 3UPPA 2J3TC 3FPWA 4IVIA 4JLFA 1IELA 2O0YA 3E2LA 2CC1A 2J3WA 2Y2HA 5EOOA 5EVIA 4WZ4A 1TDGA 2JE5A 3G4PA 3A0SA 1ES5A 4KZ5A 4NKPA 3IF6C 3Q7ZA 1S66L 3LICA 2E8IA 3QNCA 4MN6A 1AXBA 3IWOA 1DP8A 2FFFB 3KSGA 1O7EA 4OONA 5KSCA 3T4KA 2EX9A 3BFGA 3S22A 4N92A 4WZ5A 3T12B 2Y2QA 3FKVA 3WRZA 4HP4A 3PAEA 3OZHA 4PM6A 3M6BA 4GCZA 2IWBA 2VX8A 2EWVA 3H7WA 3LIEA 4PHTA 1AWIA 2VK3A 1ACFA 2D01A 3W2ZA 1NZUA 1OT9A 2PR6A 2YKHA 4AFIA 1H3QA 3UO9A 4BD0A 4X56A 1JVJA 3K3DA 3QHYA 3UPNA 3ZCZA 3NC8A 1T1AA 4P6ZS 4Z1WA 1VETB 2X02A 5EV0A 5A93A 2PD8A 1J9MA 1ES3A 3IXDA 4Y17A 4C6YA 1ZC2A 2Z6DA 5F68A 1XJ2A 5DJUA 3BJNA 4P6BA 1L0GA 4R6LA 3LI9A 4RX2A 3H82B 1O07A 4DRTA 3IQAA 2I9VA 4GHIA 4KZ6A 2P08A 4X68A 3TJZC 3OLOA 4OP5A 4UHUA 5HDSA 1YKDA 1IYOA 3RTYA 5KZHA 1N9OA 4JGRA 5CHUA 1MWTA 4KZ4A 5A92A 1JWVA 3MKFA 2HP6A 1A0KA 1GSWA 2K2NA 1T19A 2G2WA 2W3FA 3HVFA 3WRTA 2O9AA 4ETZA 3SS3A 4DE2A 4E3KA 3EEAA 1NYMA 4RVAA 4PMAA 3MZDA 1XJ4A 5IS1A 1W7FA 5CEDA 1N9LA 3QP6A 1LT0A 3OPLA 1K6RA 2HJ9C 5FQJA 3HLGA 1GCEA 2LB9A 3PBNA 1DJBA 2WKRA 3F1PA 3IHBA 3LIBA 3HLFA 2C6WB 4FH2A 2BLSA 1YLYA 4OPRA 1K55A 4NEED 2EA9A 5HWTA 2HGVA 1G6AA 3EQVA 3IF6B 2XDMA 1UWNX 3PHYA 1ERQA 1FCOA 1LL5A 5EUAA 4K08A 1PIOA 2J9OA 2OSUA 4DJ2A 3W4QA 1HZOA 3N8RA 2Y2NA 2ZM0A 3N6IA 5KSHA 3O5YA 5HX9A 3MR0A 3WS5A 4NXEA 3ZG8B 2Z2MB 4PM7A 4CLCE 3PR6A 1MY8A 2HP9A 2Y2PA 4D60A 2Y59A 1RP5A 4WBGA 1YSPA 4KZAA 3Q81A 1NYYA 4ZRRA 1G5UA 2R9XA 3TRCA 3D3OA 1H5XA 2JKTM 4LCMA 4PM5A
chains in the Genus database with same CATH topology
2IWDA 2ZC7A 4LV1A 4OLDA 3FYZA 3W4PA 4S2KA 2X71A 3VP1A 1CI9A 3VP3A 1KE0A 4DKIA 1BTLA 1BSGA 4JBFA 4K91A 3ZG9B 1KGEA 4BQMA 2WGWB 3OPRA 1XXMA 1XKZA 3IXGA 1GA0A 1L0DA 2WAEA 5HAQA 3RJUA 3SS4A 3MXRA 2XEPA 4OOLA 4E3IA 1GHMA 3G2YA 1BLHA 1TDLA 4QHCA 2XGNA 4B4XA 1K4EA 3A3DA 1IKIA 3OCNA 3C4PA 5F1FA 1W8QA 5M18A 2C5WB 3G34A 3PAGA 1RGYA 1TEMA 1MPLA 4JXSA 5EECA 4ID4A 4CPKA 5DTTA 1S6RA 3SS5A 5CTMA 4P85A 1FOFA 1PWGA 5AQ7A 3DW0A 1FCNA 1RCJA 3ZG5A 4FCFA 1VQQA 4K0XA 4WELA 2P9VA 2DRWA 3GR2A 5CGWA 3UE0A 1IEMA 2R9WA 3NI9A 1BUEA 1U60A 3IH8A 1Z6FA 4LENA 5KMWA 1YM1A 1BLCA 3Q82A 1ES2A 3PBSA 1LI9A 3IHAA 1XPBA 4PM8A 3MKEA 3HUOA 4PPRA 4S2IA 5E2EA 4X6TA 4ZDXA 4N1HA 3ZHHA 3ZVTA 4KZBA 2BG1A 4U0XA 3AGEA 4F94A 3V5MA 5AQBA 2XFTA 3IWQA 4GD8A 1PW8A 3HLCA 5FQIA 5HW3A 3W8KA 4N9KA 1FSWA 5FAOA 4UA9A 2JCHA 3C5AA 3N4IA 2EXBA 3PBOA 3OC2A 3UE3A 3P09A 3VOZA 3LY3A 3ZGAB 3ZNTA 4DE1A 4KZ8A 5A91A 5DF8A 1XX2A 2ZM2A 1H8YA 4KG2A 5HL1A 5EVLA 5CHMA 5TGFA 2J9PA 4OOMA 2VGJA 3O86A 3M2KA 4DF6A 2H0YA 5G18A 4QY6A 4GOGA 3WS4A 3C7VA 1SDNA 4N9LA 2XF3A 1HD8A 3NCKA 1PWDA 4QY5A 3VMAA 3ZNYA 4LV2A 3IWIA 3C4OA 4OQHA 4JF6A 5GLBA 2ZQ7A 2HDSA 4GDNA 4M3KA 3V3SA 2QZ6A 4QD4A 3TOIA 1KE3A 2ZM8A 1HTZA 2UWXA 5FAPA 4BL3A 4MLLA 4S2LA 1NXYA 2DCFA 3WS0A 1FR1A 1N9BA 2ZQCA 5HFOA 2WKIA 1SDEA 4DXBA 3IT9A 1KVMA 3OPPA 2OV5A 5DF7A 1PZOA 1W5DA 1ALQA 2XR0A 3EQUA 1ZKJA 4DXCA 3M2JA 1FR6A 3ITBA 3DWZA 4OPZA 4ZJ2A 3ZVWA 4S2OA 5A90A 4DDYA 3IH9A 3SH8A 1YQSA 5FSRA 4OPYA 1QMEA 4R3JA 5E2FA 3ITAA 4HEFA 5FI2A 5JYOA 1K56D 4KZ9A 3ZG0A 2WZZA 4K0WA 1BZAA 1L0FA 4E6XA 3BYDA 3PBTA 3CJMA 2V1ZA 3LY4A 1E25A 1KVLA 4BD1A 4KQQA 3N8SA 2XFSA 5E2GA 2ZC4B 1YMXA 1WE4A 3GTCA 4EBLA 2EX2A 4OH0A 2V2FF 4D2OA 3V50A 1EWZA 2A49A 3AGDA 1FCMA 3GRJA 2ZQ8A 3GVBA 3HBRA 3HL9A 4GNUA 5FAQA 1MXOA 5CHJA 1IYSA 4OLGA 1K56A 5M1AA 4HBUA 4OKPA 4HBTA 5HARA 4KQOA 2XH9A 4IEDA 2J7VA 4OVDA 1YLPA 3HUNA 1FQGA 4E6WA 1NZOA 3MFDA 2P74A 2WUQA 3BFDA 3NY4A 1PW1A 1EI5A 1W79A 2Q9MA 2WADA 3A3EA 4LV0A 4MNRA 4UAAA 4E3JA 5CECA 1PWCA 2Y2MA 4QJGA 3B3XA 4S2PA 3HUMA 1PZPA 4B88A 4NK3A 1I2SA 4PM9A 2Y2KA 1YT4A 1ZG4A 5EPHA 5GHYA 3BLSA 2EX6A 1I5QA 1TVFA 1K4FA 4HESA 5FATA 3WS1A 3BLMA 4KQRA 5F83A 5FQKA 4GDBA 4UA6A 5TFQA 5TR7A 2Z2LB 4XUXA 2RL3A 3UE1A 4IVKA 4E3NA 4IBRA 1KDSA 4GD6A 3BRMA 2FFYA 5EVID 1L0EA 2Y2IA 5GHXA 4R23A 1K57C 2HDRA 5EVIC 4L0LA 3VP4A 5FASA 1CK3A 4FD8A 4X53A 1BLSA 3FV7A 2XD5A 3BFEA 2ZD8A 3GV9A 4R0QA 1JWZA 4S2MA 4U3TA 3G35A 5CXWA 3V3RA 3UPPA 5GLAA 5E2HA 3NDEA 3VSKA 3NBLA 4IVIA 4MBHA 3PBRA 1GA9A 5U47A 2QMIA 2WGIA 4JLFA 1IELA 2XQZA 2ZC6B 4EBNA 3E2LA 5L2FA 2CC1A 1W8YA 2Y2HA 1GHIA 3MZEA 4P87A 2P9VB 1K57A 5EOOA 5EVIA 1MWRA 4WZ4A 1TDGA 1SKFA 3E2KA 3D4FA 3N8LA 4WYYA 5AQ9A 2JE5A 5GL9A 5F1GA 2B5RA 3G4PA 1ES5A 3VFFA 1PI4A 4R1GA 4KZ5A 4OQGA 3C7UA 1LL9A 4WZ5C 4RA7A 3IF6C 3Q7ZA 2H10A 4N1XA 3VSLA 3WWXA 2HDQA 3ZG7B 3BEBA 4X69A 4BENA 5GLCA 2E8IA 1YLTA 3QNCA 4RX3A 2WKEA 4DE0A 3G30A 2Y2JA 5F82A 1LHYA 1AXBA 3S1YA 4JXVA 1K54C 3IWOA 4KZ3A 1ERMA 5CRFA 5FI7A 3UDIA 2FFFB 3W4OA 1O7EA 4OONA 4LV3A 2H0TA 2WKHA 5KSCA 3LCEA 1K55C 2EX9A 1ONGA 1KE4A 3BFGA 3S22A 1NRFA 1Y54A 4N92A 4WZ5A 3IF6A 2ZJ9A 4B4ZA 2Y2QA 3FKVA 3WRZA 3BFCA 3CMZA 4JXWA 1ESIA 1M6KA 3PAEA 2WGVA 1EROA 1XGJA 2ZMAA 3OZHA 4S2JA 4ZTKA 2Y4AA 2WZXA 4KENB 4KG5A 1ZG6A 1JTGA 4PM6A 2V20A 3M6BA 4GZBA 4Q8IA 2JBFA 1WYCA 2HP5A 3FZCA 5AQAA 3HLEA 1CI8A 2IWBA 1NJ4A 4H8RA 4WMCD 5CEBA 3O3VA 1MBLA 1NZUA 4C3QA 2I72A 1ESUA 3WS2A 4JPMA 5DTKA 2Y2OA 3Q7VA 3UO9A 4EV4A 4BD0A 1MWUA 2A3UA 1H8ZA 4X56A 2ZLYA 4Y0UA 3NDGA 4C75A 2Y55A 1YMSA 1L2SA 4GN2A 3G2ZA 1JVJA 4EUZA 4FSFA 3QHYA 1ONHA 3UPNA 3ZCZA 3NIAA 3NC8A 3G32A 1XA7A 1IYQA 2ZQDA 1YLZA 4WMCA 3DTMA 5HAPA 5J8XA 2Q9NA 2Y91A 3QNBA 3UY6A 1I2WA 5DF9A 3JYIA 2X02A 1YLJA 5CERA 5BOHA 5CGSA 2VGKA 4OQ0A 4X55A 5A93A 1DJCA 1LI0A 2WGWA 5FQQA 1J9MA 3OPHA 4NETA 3VFHA 1ES3A 2ZQAA 3I7JA 5D3OA 3SH7A 3IXDA 3N7WA 2WK0A 4C6YA 1ZC2A 1QMFA 1IYPA 4OPQA 4JKTA 4XUZA 4FH4A 1K6SA 4BJPA 3FWLA 3GMWA 4P6BA 1L0GA 1PI5A 1Q2PA 4RX2A 5I94A 2GDNA 4P0MA 3TG9A 4EWFA 5DVAA 2XD1A 1O07A 3BFFA 1SHVA 1WYBA 1XA1A 4DRTA 2PU4A 3IQAA 5GLDA 4KZ6A 2DNSA 2ZC3B 4X68A 1GHPA 2QPNA 3O88A 4OP5A 1BT5A 4OOYA 2ZQ9A 1FSYA 3SH9A 4WEKA 4UHUA 2PBYA 5IHVA 4GKUA 3BECA 4CJNA 1NY0A 3HLWA 4MEZA 5EE8A 2JC7A 2WYXA 1IYOA 5FDHA 3MZFA 5KZHA 2OLUA 4EBPA 1VM1A 4ZAMA 1KDWA 4R4RA 1E4DA 4S2NC 3G31A 5CHUA 4ZBEA 5EOEA 3VP0A 4YFMA 4E3MA 3AGFA 2PU2A 3A3FA 4QB8A 2EFXA 4JXGA 1MWTA 4KZ4A 2OLVA 3CG5A 5A92A 1JWVA 1KGGA 3MKFA 3RXWA 1SCWA 4BLMA 2HP6A 3GSGA 1K25A 2EXAA 1S0WA 3VP2A 2G2WA 4DE3A 3HVFA 3M6HA 4U0TA 3WRTA 1JTDA 3ISGA 3HLDA 1OMEA 4S2NA 3OCLA 4YINA 3SS3A 3GQZA 4DE2A 2HDUA 4E3KA 4KZ7A 5CTNA 3PBQA 1NYMA 1IKGA 4A5RA 5HAIA 1E3UD 2G2UA 4RVAA 3UPOA 1XGIA 4PMAA 3MZDA 4MBFA 5CGXA 2EX8A 1W7FA 5CEDA 5EVIB 4E3LA 1RGZA 5JYPA 1PYYA 3Q07A 2XK1A 4DDSA 1XP4A 1G68A 3OPLA 3O87A 1K6RA 1MKIA 3BM6A 5FQJA 3HLGA 4GB7A 4XXRA 1GCEA 3ZFZA 3PBNA 1DJBA 1DJAA 1HVBA 4WEJA 1K54A 1YLWA 1DY6A 4ZJ3A 4JF5A 3IHBA 1ES4A 1E3UA 1CEFA 3HLFA 2C6WB 3MBZA 2Y2GA 1KGFA 4FH2A 1M40A 4OP8A 5GHZA 3MXSA 2BLSA 2RCXA 3VOYA 1YLYA 4O7DA 1JWPA 4OPRA 1K55A 2HPBA 3UDXA 1LLBA 1Q2QA 4R4SA 4WM9A 3V39A 4BL2A 4OQIA 1G6AA 3A3IA 5DTSA 3EQVA 4Y7PA 1BULA 5FA7A 3IF6B 2XDMA 4E3OA 3PTEA 3P98A 2ZC5B 4JF4A 2IWCA 4QU3A 1ERQA 1FCOA 1K38A 1LL5A 5EUAA 1PIOA 3ZDJA 4KG6A 3TSGA 2J9OA 4MBKA 2OSUA 2X01A 3W4QA 1HZOA 2WAFA 3N8RA 2Y2NA 4IBXA 5E43A 1CEGA 5FI6A 2ZM0A 3N6IA 5FQMA 3SOIA 5KSHA 1MWSA 3IXBA 5HX9A 5M19A 3IXHA 3WS5A 4ZJ1A 3UDFA 3ZG8B 2XLNA 2Z2MB 4RYEA 4LCLA 2Y2LA 4PM7A 1MY8A 2H5SA 3RXXA 3LEZA 3Q1FA 2HP9A 1C3BA 2Y2PA 2J8YA 1RP5A 2Y59A 4Y0TA 3Q7VB 4WBGA 4KZAA 3IF5A 3HLBA 3Q81A 4EQIA 1NYYA 3A3JA 2EFUA 3LO7A 2R9XA 4Z9QA 1N4OA 3CZDA 3DWKA 5FQ9A 3UN7A 3S4XA 3HREA 3FKWA 1H5XA 4Y0OA 3UNWA 4LCMA 4R3BA 4UA7A 4PM5A 1BLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWD A;  2ZC7 A;  4LV1 A;  4OLD A;  3FYZ A;  3W4P A;  4S2K A;  2X71 A;  3VP1 A;  1CI9 A;  3VP3 A;  1KE0 A;  4DKI A;  1BTL A;  1BSG A;  4JBF A;  4K91 A;  3ZG9 B;  1KGE A;  4BQM A;  2WGW B;  3OPR A;  1XXM A;  1XKZ A;  3IXG A;  1GA0 A;  1L0D A;  2WAE A;  5HAQ A;  3RJU A;  3SS4 A;  3MXR A;  2XEP A;  4OOL A;  4E3I A;  1GHM A;  3G2Y A;  1BLH A;  1TDL A;  4QHC A;  2XGN A;  4B4X A;  1K4E A;  3A3D A;  1IKI A;  3OCN A;  3C4P A;  5F1F A;  1W8Q A;  5M18 A;  2C5W B;  3G34 A;  3PAG A;  1RGY A;  1TEM A;  1MPL A;  4JXS A;  5EEC A;  4ID4 A;  4CPK A;  5DTT A;  1S6R A;  3SS5 A;  5CTM A;  4P85 A;  1FOF A;  1PWG A;  5AQ7 A;  3DW0 A;  1FCN A;  1RCJ A;  3ZG5 A;  4FCF A;  1VQQ A;  4K0X A;  4WEL A;  2P9V A;  2DRW A;  3GR2 A;  5CGW A;  3UE0 A;  1IEM A;  2R9W A;  3NI9 A;  1BUE A;  1U60 A;  3IH8 A;  1Z6F A;  4LEN A;  5KMW A;  1YM1 A;  1BLC A;  3Q82 A;  1ES2 A;  3PBS A;  1LI9 A;  3IHA A;  1XPB A;  4PM8 A;  3MKE A;  3HUO A;  4PPR A;  4S2I A;  5E2E A;  4X6T A;  4ZDX A;  4N1H A;  3ZHH A;  3ZVT A;  4KZB A;  2BG1 A;  4U0X A;  3AGE A;  4F94 A;  3V5M A;  5AQB A;  2XFT A;  3IWQ A;  4GD8 A;  1PW8 A;  3HLC A;  5FQI A;  5HW3 A;  3W8K A;  4N9K A;  1FSW A;  5FAO A;  4UA9 A;  2JCH A;  3C5A A;  3N4I A;  2EXB A;  3PBO A;  3OC2 A;  3UE3 A;  3P09 A;  3VOZ A;  3LY3 A;  3ZGA B;  3ZNT A;  4DE1 A;  4KZ8 A;  5A91 A;  5DF8 A;  1XX2 A;  2ZM2 A;  1H8Y A;  4KG2 A;  5HL1 A;  5EVL A;  5CHM A;  5TGF A;  2J9P A;  4OOM A;  2VGJ A;  3O86 A;  3M2K A;  4DF6 A;  2H0Y A;  5G18 A;  4QY6 A;  4GOG A;  3WS4 A;  3C7V A;  1SDN A;  4N9L A;  2XF3 A;  1HD8 A;  3NCK A;  1PWD A;  4QY5 A;  3VMA A;  3ZNY A;  4LV2 A;  3IWI A;  3C4O A;  4OQH A;  4JF6 A;  5GLB A;  2ZQ7 A;  2HDS A;  4GDN A;  4M3K A;  3V3S A;  2QZ6 A;  4QD4 A;  3TOI A;  1KE3 A;  2ZM8 A;  1HTZ A;  2UWX A;  5FAP A;  4BL3 A;  4MLL A;  4S2L A;  1NXY A;  2DCF A;  3WS0 A;  1FR1 A;  1N9B A;  2ZQC A;  5HFO A;  2WKI A;  1SDE A;  4DXB A;  3IT9 A;  1KVM A;  3OPP A;  2OV5 A;  5DF7 A;  1PZO A;  1W5D A;  1ALQ A;  2XR0 A;  3EQU A;  1ZKJ A;  4DXC A;  3M2J A;  1FR6 A;  3ITB A;  3DWZ A;  4OPZ A;  4ZJ2 A;  3ZVW A;  4S2O A;  5A90 A;  4DDY A;  3IH9 A;  3SH8 A;  1YQS A;  5FSR A;  4OPY A;  1QME A;  4R3J A;  5E2F A;  3ITA A;  4HEF A;  5FI2 A;  5JYO A;  1K56 D;  4KZ9 A;  3ZG0 A;  2WZZ A;  4K0W A;  1BZA A;  1L0F A;  4E6X A;  3BYD A;  3PBT A;  3CJM A;  2V1Z A;  3LY4 A;  1E25 A;  1KVL A;  4BD1 A;  4KQQ A;  3N8S A;  2XFS A;  5E2G A;  2ZC4 B;  1YMX A;  1WE4 A;  3GTC A;  4EBL A;  2EX2 A;  4OH0 A;  2V2F F;  4D2O A;  3V50 A;  1EWZ A;  2A49 A;  3AGD A;  1FCM A;  3GRJ A;  2ZQ8 A;  3GVB A;  3HBR A;  3HL9 A;  4GNU A;  5FAQ A;  1MXO A;  5CHJ A;  1IYS A;  4OLG A;  1K56 A;  5M1A A;  4HBU A;  4OKP A;  4HBT A;  5HAR A;  4KQO A;  2XH9 A;  4IED A;  2J7V A;  4OVD A;  1YLP A;  3HUN A;  1FQG A;  4E6W A;  1NZO A;  3MFD A;  2P74 A;  2WUQ A;  3BFD A;  3NY4 A;  1PW1 A;  1EI5 A;  1W79 A;  2Q9M A;  2WAD A;  3A3E A;  4LV0 A;  4MNR A;  4UAA A;  4E3J A;  5CEC A;  1PWC A;  2Y2M A;  4QJG A;  3B3X A;  4S2P A;  3HUM A;  1PZP A;  4B88 A;  4NK3 A;  1I2S A;  4PM9 A;  2Y2K A;  1YT4 A;  1ZG4 A;  5EPH A;  5GHY A;  3BLS A;  2EX6 A;  1I5Q A;  1TVF A;  1K4F A;  4HES A;  5FAT A;  3WS1 A;  3BLM A;  4KQR A;  5F83 A;  5FQK A;  4GDB A;  4UA6 A;  5TFQ A;  5TR7 A;  2Z2L B;  4XUX A;  2RL3 A;  3UE1 A;  4IVK A;  4E3N A;  4IBR A;  1KDS A;  4GD6 A;  3BRM A;  2FFY A;  5EVI D;  1L0E A;  2Y2I A;  5GHX A;  4R23 A;  1K57 C;  2HDR A;  5EVI C;  4L0L A;  3VP4 A;  5FAS A;  1CK3 A;  4FD8 A;  4X53 A;  1BLS A;  3FV7 A;  2XD5 A;  3BFE A;  2ZD8 A;  3GV9 A;  4R0Q A;  1JWZ A;  4S2M A;  4U3T A;  3G35 A;  5CXW A;  3V3R A;  3UPP A;  5GLA A;  5E2H A;  3NDE A;  3VSK A;  3NBL A;  4IVI A;  4MBH A;  3PBR A;  1GA9 A;  5U47 A;  2QMI A;  2WGI A;  4JLF A;  1IEL A;  2XQZ A;  2ZC6 B;  4EBN A;  3E2L A;  5L2F A;  2CC1 A;  1W8Y A;  2Y2H A;  1GHI A;  3MZE A;  4P87 A;  2P9V B;  1K57 A;  5EOO A;  5EVI A;  1MWR A;  4WZ4 A;  1TDG A;  1SKF A;  3E2K A;  3D4F A;  3N8L A;  4WYY A;  5AQ9 A;  2JE5 A;  5GL9 A;  5F1G A;  2B5R A;  3G4P A;  1ES5 A;  3VFF A;  1PI4 A;  4R1G A;  4KZ5 A;  4OQG A;  3C7U A;  1LL9 A;  4WZ5 C;  4RA7 A;  3IF6 C;  3Q7Z A;  2H10 A;  4N1X A;  3VSL A;  3WWX A;  2HDQ A;  3ZG7 B;  3BEB A;  4X69 A;  4BEN A;  5GLC A;  2E8I A;  1YLT A;  3QNC A;  4RX3 A;  2WKE A;  4DE0 A;  3G30 A;  2Y2J A;  5F82 A;  1LHY A;  1AXB A;  3S1Y A;  4JXV A;  1K54 C;  3IWO A;  4KZ3 A;  1ERM A;  5CRF A;  5FI7 A;  3UDI A;  2FFF B;  3W4O A;  1O7E A;  4OON A;  4LV3 A;  2H0T A;  2WKH A;  5KSC A;  3LCE A;  1K55 C;  2EX9 A;  1ONG A;  1KE4 A;  3BFG A;  3S22 A;  1NRF A;  1Y54 A;  4N92 A;  4WZ5 A;  3IF6 A;  2ZJ9 A;  4B4Z A;  2Y2Q A;  3FKV A;  3WRZ A;  3BFC A;  3CMZ A;  4JXW A;  1ESI A;  1M6K A;  3PAE A;  2WGV A;  1ERO A;  1XGJ A;  2ZMA A;  3OZH A;  4S2J A;  4ZTK A;  2Y4A A;  2WZX A;  4KEN B;  4KG5 A;  1ZG6 A;  1JTG A;  4PM6 A;  2V20 A;  3M6B A;  4GZB A;  4Q8I A;  2JBF A;  1WYC A;  2HP5 A;  3FZC A;  5AQA A;  3HLE A;  1CI8 A;  2IWB A;  1NJ4 A;  4H8R A;  4WMC D;  5CEB A;  3O3V A;  1MBL A;  1NZU A;  4C3Q A;  2I72 A;  1ESU A;  3WS2 A;  4JPM A;  5DTK A;  2Y2O A;  3Q7V A;  3UO9 A;  4EV4 A;  4BD0 A;  1MWU A;  2A3U A;  1H8Z A;  4X56 A;  2ZLY A;  4Y0U A;  3NDG A;  4C75 A;  2Y55 A;  1YMS A;  1L2S A;  4GN2 A;  3G2Z A;  1JVJ A;  4EUZ A;  4FSF A;  3QHY A;  1ONH A;  3UPN A;  3ZCZ A;  3NIA A;  3NC8 A;  3G32 A;  1XA7 A;  1IYQ A;  2ZQD A;  1YLZ A;  4WMC A;  3DTM A;  5HAP A;  5J8X A;  2Q9N A;  2Y91 A;  3QNB A;  3UY6 A;  1I2W A;  5DF9 A;  3JYI A;  2X02 A;  1YLJ A;  5CER A;  5BOH A;  5CGS A;  2VGK A;  4OQ0 A;  4X55 A;  5A93 A;  1DJC A;  1LI0 A;  2WGW A;  5FQQ A;  1J9M A;  3OPH A;  4NET A;  3VFH A;  1ES3 A;  2ZQA A;  3I7J A;  5D3O A;  3SH7 A;  3IXD A;  3N7W A;  2WK0 A;  4C6Y A;  1ZC2 A;  1QMF A;  1IYP A;  4OPQ A;  4JKT A;  4XUZ A;  4FH4 A;  1K6S A;  4BJP A;  3FWL A;  3GMW A;  4P6B A;  1L0G A;  1PI5 A;  1Q2P A;  4RX2 A;  5I94 A;  2GDN A;  4P0M A;  3TG9 A;  4EWF A;  5DVA A;  2XD1 A;  1O07 A;  3BFF A;  1SHV A;  1WYB A;  1XA1 A;  4DRT A;  2PU4 A;  3IQA A;  5GLD A;  4KZ6 A;  2DNS A;  2ZC3 B;  4X68 A;  1GHP A;  2QPN A;  3O88 A;  4OP5 A;  1BT5 A;  4OOY A;  2ZQ9 A;  1FSY A;  3SH9 A;  4WEK A;  4UHU A;  2PBY A;  5IHV A;  4GKU A;  3BEC A;  4CJN A;  1NY0 A;  3HLW A;  4MEZ A;  5EE8 A;  2JC7 A;  2WYX A;  1IYO A;  5FDH A;  3MZF A;  5KZH A;  2OLU A;  4EBP A;  1VM1 A;  4ZAM A;  1KDW A;  4R4R A;  1E4D A;  4S2N C;  3G31 A;  5CHU A;  4ZBE A;  5EOE A;  3VP0 A;  4YFM A;  4E3M A;  3AGF A;  2PU2 A;  3A3F A;  4QB8 A;  2EFX A;  4JXG A;  1MWT A;  4KZ4 A;  2OLV A;  3CG5 A;  5A92 A;  1JWV A;  1KGG A;  3MKF A;  3RXW A;  1SCW A;  4BLM A;  2HP6 A;  3GSG A;  1K25 A;  2EXA A;  1S0W A;  3VP2 A;  2G2W A;  4DE3 A;  3HVF A;  3M6H A;  4U0T A;  3WRT A;  1JTD A;  3ISG A;  3HLD A;  1OME A;  4S2N A;  3OCL A;  4YIN A;  3SS3 A;  3GQZ A;  4DE2 A;  2HDU A;  4E3K A;  4KZ7 A;  5CTN A;  3PBQ A;  1NYM A;  1IKG A;  4A5R A;  5HAI A;  1E3U D;  2G2U A;  4RVA A;  3UPO A;  1XGI A;  4PMA A;  3MZD A;  4MBF A;  5CGX A;  2EX8 A;  1W7F A;  5CED A;  5EVI B;  4E3L A;  1RGZ A;  5JYP A;  1PYY A;  3Q07 A;  2XK1 A;  4DDS A;  1XP4 A;  1G68 A;  3OPL A;  3O87 A;  1K6R A;  1MKI A;  3BM6 A;  5FQJ A;  3HLG A;  4GB7 A;  4XXR A;  1GCE A;  3ZFZ A;  3PBN A;  1DJB A;  1DJA A;  1HVB A;  4WEJ A;  1K54 A;  1YLW A;  1DY6 A;  4ZJ3 A;  4JF5 A;  3IHB A;  1ES4 A;  1E3U A;  1CEF A;  3HLF A;  2C6W B;  3MBZ A;  2Y2G A;  1KGF A;  4FH2 A;  1M40 A;  4OP8 A;  5GHZ A;  3MXS A;  2BLS A;  2RCX A;  3VOY A;  1YLY A;  4O7D A;  1JWP A;  4OPR A;  1K55 A;  2HPB A;  3UDX A;  1LLB A;  1Q2Q A;  4R4S A;  4WM9 A;  3V39 A;  4BL2 A;  4OQI A;  1G6A A;  3A3I A;  5DTS A;  3EQV A;  4Y7P A;  1BUL A;  5FA7 A;  3IF6 B;  2XDM A;  4E3O A;  3PTE A;  3P98 A;  2ZC5 B;  4JF4 A;  2IWC A;  4QU3 A;  1ERQ A;  1FCO A;  1K38 A;  1LL5 A;  5EUA A;  1PIO A;  3ZDJ A;  4KG6 A;  3TSG A;  2J9O A;  4MBK A;  2OSU A;  2X01 A;  3W4Q A;  1HZO A;  2WAF A;  3N8R A;  2Y2N A;  4IBX A;  5E43 A;  1CEG A;  5FI6 A;  2ZM0 A;  3N6I A;  5FQM A;  3SOI A;  5KSH A;  1MWS A;  3IXB A;  5HX9 A;  5M19 A;  3IXH A;  3WS5 A;  4ZJ1 A;  3UDF A;  3ZG8 B;  2XLN A;  2Z2M B;  4RYE A;  4LCL A;  2Y2L A;  4PM7 A;  1MY8 A;  2H5S A;  3RXX A;  3LEZ A;  3Q1F A;  2HP9 A;  1C3B A;  2Y2P A;  2J8Y A;  1RP5 A;  2Y59 A;  4Y0T A;  3Q7V B;  4WBG A;  4KZA A;  3IF5 A;  3HLB A;  3Q81 A;  4EQI A;  1NYY A;  3A3J A;  2EFU A;  3LO7 A;  2R9X A;  4Z9Q A;  1N4O A;  3CZD A;  3DWK A;  5FQ9 A;  3UN7 A;  3S4X A;  3HRE A;  3FKW A;  1H5X A;  4Y0O A;  3UNW A;  4LCM A;  4R3B A;  4UA7 A;  4PM5 A;  1BLP A; 
#chains in the Genus database with same CATH topology
 3FYZ A;  3W4P A;  2X71 A;  2VGL M;  2HJE A;  4K91 A;  3ZG9 B;  1KGE A;  4BQM A;  1XXM A;  2W3G A;  1Y28 A;  1L0D A;  2WAE A;  4ARZ B;  5HAQ A;  2GJ3 A;  1GHM A;  1TDL A;  3F1O A;  1L3L A;  3VV4 A;  2W1R A;  3OCN A;  3C4P A;  5F1F A;  1W8Q A;  1N9N A;  1MPL A;  4ID4 A;  1TS6 A;  5DTT A;  1MZU A;  4P85 A;  5AQ7 A;  3DW0 A;  1RCJ A;  3ZG5 A;  5TJJ A;  1P97 A;  3CAX A;  3UE0 A;  5CGW A;  2BTF P;  5J4E A;  2PR5 A;  4M4X A;  3B33 A;  5KMW A;  1S1Y A;  1BLC A;  1XPB A;  4PPR A;  4X6T A;  4ZDX A;  4UEY A;  1F2K A;  3ZVT A;  3IBR A;  4F94 A;  1YPR A;  2XFT A;  4WN5 A;  2B18 A;  4XT2 B;  5FQI A;  3OBF A;  2XRO A;  3KSF A;  2JCH A;  3KYZ A;  4HI4 A;  4I3I A;  3ZGA B;  3LGO A;  2VJW A;  4NXF A;  4NG2 A;  4KG2 A;  3O86 A;  5G18 A;  4QY6 A;  2A2L A;  1HD8 A;  1PWD A;  4OQH A;  2HDS A;  4GDN A;  4QD4 A;  3TOI A;  1KE3 A;  4X1L A;  4BL3 A;  2XA7 M;  5L8M A;  2WKI A;  1KVM A;  2OV5 A;  5DF7 A;  1W5D A;  4E04 A;  2XR0 A;  3M2J A;  3LFV A;  3RH8 B;  4OPZ A;  1VET A;  5A90 A;  2VGL S;  4EXO A;  5G4Z A;  3L7H A;  1QME A;  4R3J A;  5E2F A;  2PRF A;  1CJF A;  2BAS A;  1K56 D;  3ZG0 A;  4EU0 A;  5MC7 A;  1BZA A;  5A8B A;  3DTE A;  3V50 A;  5CHJ A;  1IYS A;  1K56 A;  1MKM A;  4OKP A;  4F3L B;  4HBT A;  4KQO A;  2XH9 A;  4IED A;  1YLP A;  4E6W A;  2Q9M A;  4UAA A;  2Y2M A;  3U4L P;  3LR5 A;  4S2P A;  1PZP A;  1TVF A;  5FAT A;  5HPF A;  4KQR A;  5F83 A;  3TW8 A;  2PD7 A;  5FQK A;  4UA6 A;  5TFQ A;  4XUX A;  2JKR I;  2FFY A;  1L0E A;  5FAS A;  3VP4 A;  4X53 A;  1BLS A;  1STZ A;  3GV9 A;  4R0Q A;  1JWZ A;  4S2M A;  4U3T A;  3U2A A;  5CXW A;  2J3T D;  3V3R A;  5GLA A;  3NDE A;  3PBR A;  1GA9 A;  4IJG A;  5U47 A;  2Y8H A;  4EBN A;  4EQ1 A;  4R3A A;  1W8Y A;  1GHI A;  3MZE A;  1JNU A;  1F98 A;  3N8L A;  4WF0 A;  3D4F A;  4FTX A;  4WYY A;  5F1G A;  1IOU A;  3VFF A;  2XA7 S;  4RQ9 A;  3C7U A;  4RA7 A;  3VSL A;  3ZG7 B;  1TS0 A;  1YLT A;  4MN5 A;  2XSS A;  2Y2J A;  4QWO A;  1LHY A;  1LSV A;  3MSH A;  4KUK A;  5K5B A;  1GSV A;  4R38 A;  3UE6 A;  3KYQ A;  3LCE A;  3BQA A;  3T4O A;  2B95 A;  3IF6 A;  3BFC A;  4JXW A;  1XGJ A;  4GZB A;  5AQA A;  3HLE A;  1W63 M;  5CEB A;  1MBL A;  3C30 A;  4C3Q A;  2I72 A;  1ESU A;  3WS2 A;  3T50 A;  1MWU A;  4Y0U A;  1L2S A;  1BYW A;  3CUE A;  4EUZ A;  4LFU A;  3G32 A;  1IYQ A;  1YLZ A;  4Q0H A;  1PFL A;  2M7U A;  2Q9N A;  3UY6 A;  5DF9 A;  3JYI A;  2OAQ 1;  5CGS A;  4II7 A;  3CPT B;  4NET A;  3IS2 B;  5D3O A;  2LB5 A;  3UMD A;  2GNX A;  5HD3 A;  3LI8 A;  2UV0 E;  4FH4 A;  4BJP A;  4MN7 A;  4HIA A;  5I94 A;  2GDN A;  4EWF A;  2XD1 A;  3BFF A;  1WYB A;  4ETX A;  3QP2 A;  3EWK A;  1TF1 A;  4DJ3 A;  3SH9 A;  5FEG A;  2D02 A;  4HH2 A;  2PBY A;  4GKU A;  2ZBB A;  1NY0 A;  4HNB A;  4MEZ A;  2JC7 A;  5LBR A;  5FDH A;  1K0K A;  2ZMV A;  4EER A;  1VM1 A;  4R4R A;  1E4D A;  3IX8 A;  4S2N C;  4E3M A;  2PU2 A;  4XT2 A;  5C5K A;  1ZHH B;  1KGG A;  1OTI A;  1SCW A;  4LRX C;  4UQI M;  3VP2 A;  4DE3 A;  3A0R A;  3EEH A;  3ISG A;  3HLD A;  5DKL A;  1OME A;  3C8C A;  1XJ3 A;  5EM0 A;  4A5R A;  3SW1 A;  1XGI A;  5CGX A;  2OWJ A;  2EX8 A;  4E3L A;  5JYP A;  1PYY A;  1MKI A;  4BBV A;  4XXR A;  3ZFZ A;  3ULF A;  4L9G A;  2L1M A;  4CLC B;  1K54 A;  1DY6 A;  4ME4 A;  4ZJ3 A;  1ES4 A;  1CEF A;  4OP8 A;  2Y2G A;  4O7D A;  1LLB A;  2INW A;  1SZV A;  5FA7 A;  3P98 A;  1D7E A;  1VEU B;  5L09 A;  3ZDJ A;  2X01 A;  5FI6 A;  1CEG A;  5M19 A;  1P9R A;  5AVE A;  2Y2L A;  3QP5 A;  2H5S A;  3LEZ A;  4Y13 A;  1C3B A;  3DTK A;  5L10 A;  4EQI A;  5TBM A;  3LO7 A;  4F3L A;  4G3V A;  1N4O A;  3DWK A;  3S4X A;  3LYX A;  3FKW A;  3CIT A;  3MQ0 A;  3UNW A;  3P01 A;  4MCW A;  4LV1 A;  2OOL A;  1CI9 A;  2ZOH A;  2R78 A;  2A24 B;  1BSG A;  1XKZ A;  3MXR A;  2XEP A;  3G2Y A;  1NWZ A;  1IKI A;  1UWP X;  2C5W B;  3G34 A;  5J3W A;  1RGY A;  4JXS A;  4QPR A;  5CTM A;  1FCN A;  4PKY G;  2ACG A;  3QP8 A;  4K0X A;  4WEL A;  2R9W A;  3D9Y A;  3NI9 A;  3IH8 A;  1U60 A;  4LEN A;  3T1X A;  3T4S A;  1S4S A;  3HUO A;  5E2E A;  2XRN A;  4N1H A;  1H0M A;  1LSX A;  3IWQ A;  3HLC A;  5HW3 A;  2QJ7 A;  3W8K A;  4N9K A;  1FSW A;  5FAO A;  4EW7 A;  4O0P A;  3N4I A;  2EXB A;  3PBO A;  3P09 A;  3VOZ A;  5A91 A;  3ZYT A;  1XX2 A;  5EVL A;  4KUO A;  3G6O A;  4HP9 A;  3M2K A;  3OOV A;  1ZTU A;  3ICY A;  3EGX C;  4QY5 A;  2ZL1 B;  3VMA A;  3ZNY A;  4LV2 A;  4GJ4 A;  4JF6 A;  2ZQ7 A;  3KX0 X;  4M3K A;  3V3S A;  2QZ6 A;  2PHY A;  2ZM8 A;  2UWX A;  4S2L A;  1NXY A;  2DCF A;  1FR1 A;  1N9B A;  5HFO A;  2KX6 A;  5EM1 A;  1S67 L;  1ZKJ A;  4ZJ2 A;  3ZVW A;  1D1J A;  5AJG A;  4EEP A;  1D06 A;  5HWV A;  3IH9 A;  3IS2 A;  5FSR A;  4OPY A;  3ITA A;  4KZ9 A;  4K0W A;  1L0F A;  3PBT A;  3CJM A;  2V1Z A;  3DTI A;  3E98 A;  3KSH A;  1T18 A;  3N8S A;  5E2G A;  4FOF A;  4OH0 A;  2V2F F;  2A49 A;  3GRJ A;  5TGF A;  2ZQ8 A;  4EEU A;  4H6J B;  1NLZ A;  3UB6 A;  3HUN A;  1FQG A;  4ESP A;  2P74 A;  2WUQ A;  3NY4 A;  2PDR A;  4LV0 A;  1W79 A;  5F69 A;  4E3J A;  4HHD A;  4QJG A;  5HZH A;  4B88 A;  1I2S A;  2Y2K A;  1YT4 A;  1ZG4 A;  5EPH A;  5F6A A;  5GHY A;  3BLS A;  1I5Q A;  3KYE A;  2O9B A;  3BW6 A;  4HES A;  3WS1 A;  3BLM A;  4GDB A;  3UE1 A;  5HPI A;  3BRM A;  1F9I A;  1K57 C;  2HDR A;  4L0L A;  3KO6 A;  4FD8 A;  3T1Q B;  3LUQ A;  4O01 A;  3S7Q A;  4CLC D;  4G3K A;  5E2H A;  3K2N A;  5CX7 A;  3VSK A;  3NBL A;  4MBH A;  2J80 A;  2V0W A;  4L9F A;  2XQZ A;  2ZC6 B;  4JGO A;  2P9V B;  1DP6 A;  1SKF A;  5GL9 A;  5AQ9 A;  2B5R A;  1PI4 A;  4OQG A;  1LL9 A;  4N1X A;  4I3A A;  3WWX A;  2HDQ A;  4CLC A;  4B93 A;  3BEB A;  4X69 A;  5GLC A;  1SKO B;  3C38 A;  3R4K A;  1F5M A;  4LRZ E;  4JXV A;  5F5Y A;  5CRF A;  5FI7 A;  2K31 A;  3W4O A;  2H0T A;  1K55 C;  2ZJ9 A;  4B4Z A;  4PKY A;  3T1S A;  1ESI A;  1ERO A;  2ZMA A;  5HL6 A;  2QWS A;  2Y4A A;  4HJ3 A;  4KG5 A;  4Q8I A;  1JTG A;  2VV8 A;  1WYC A;  2HP5 A;  2QKP A;  1CI8 A;  3UME A;  1NJ4 A;  1IFQ A;  5DFX A;  4JPM A;  5DTK A;  2Y2O A;  2L0W A;  2A3U A;  2FZ0 A;  1WA9 A;  3NDG A;  2Y55 A;  1YMS A;  5EFW A;  2V1A A;  1ONH A;  2M7V A;  4WUJ A;  3NIA A;  2ZQD A;  1YSQ A;  2AVX A;  1LSW A;  3H7W B;  3EOI A;  5J8X A;  3QNB A;  3CLO A;  3H82 A;  1I2W A;  1YLJ A;  3FC7 A;  2A24 A;  4OQ0 A;  5FQQ A;  2ZQA A;  3LR3 A;  4IUK A;  3SH7 A;  2WK0 A;  4I38 A;  3S7O A;  1VHM A;  1QMF A;  1IYP A;  4OPQ A;  4JKT A;  4LLO B;  1K6S A;  4IHQ A;  3GMW A;  2Z6C A;  3R7W B;  1PI5 A;  4X1M A;  4P0M A;  5DVA A;  3LR4 A;  1PNE A;  2PU4 A;  1T1B A;  1PRQ A;  2ZC3 B;  1XFN A;  1GHP A;  3O88 A;  4EUV A;  4OOY A;  3DBA A;  5IHV A;  4CJN A;  3HLW A;  2V0U A;  3MZF A;  4EBP A;  5HSQ A;  4HOI A;  3G31 A;  3VP0 A;  5EOE A;  1G28 A;  3ZQ5 A;  4JXG A;  3CG5 A;  2O9C A;  5DJT A;  3RXW A;  3LIA A;  3F1N B;  4BLM A;  3GSG A;  3IBJ A;  2PYR A;  3M6H A;  2OAP 1;  4U0T A;  3V67 A;  1JTD A;  3T4J A;  5G4Y A;  4S2N A;  3OCL A;  3T4T A;  2HDU A;  5CTN A;  1IKG A;  2G2U A;  4MBF A;  3JVU A;  2ZL1 A;  1RGZ A;  3Q07 A;  2XK1 A;  2JKR M;  4DDS A;  1XP4 A;  1GSX A;  1G68 A;  4MMN A;  3O87 A;  2VV6 A;  3BY9 A;  1DJA A;  1HVB A;  2JKF A;  4WEJ A;  3E4O A;  4BWI A;  1M40 A;  3T4Q A;  5GHZ A;  3MXS A;  2RCX A;  2HPB A;  2QJ5 A;  4WM9 A;  4R4S A;  5KIZ A;  3A3I A;  3MS6 A;  3PTE A;  4JF4 A;  1OT6 A;  1K38 A;  5HDC A;  4KG6 A;  3F1P B;  4MBK A;  5E43 A;  3SOI A;  3IXB A;  2IA2 A;  4ZJ1 A;  4O8G A;  3RXX A;  4I39 A;  3VE4 A;  3Q7V B;  1ODV A;  3IF5 A;  4H6J A;  4ARZ A;  2EFU A;  3CZD A;  3VOL A;  5FQ9 A;  3UN7 A;  4Y0O A;  3LR0 A;  2IWD A;  2ZC7 A;  4OLD A;  4S2K A;  3KSI A;  4KQD A;  1KE0 A;  4DKI A;  4JBF A;  2W27 A;  3SZT A;  2WGW B;  3OPR A;  2W1T B;  1GA0 A;  5EVE A;  1Y4O A;  1T1C A;  1LL8 A;  5DKK A;  2XGN A;  4B4X A;  1K4E A;  1S4R A;  2H28 A;  3A3D A;  5M18 A;  3CHW P;  1TEM A;  5EEC A;  3IX3 A;  1FOF A;  1DP9 A;  4EES A;  1VQQ A;  2P9V A;  2PT7 A;  2DRW A;  3GR2 A;  4FUW A;  1TS7 A;  1YM1 A;  3VE3 A;  3Q82 A;  1V9Y A;  3PBS A;  1LI9 A;  4PM8 A;  3MKE A;  3E4Q A;  3ZHH A;  4KZB A;  4U0X A;  3V5M A;  5AQB A;  4GD8 A;  1YAX A;  3CWF A;  4UA9 A;  3C5A A;  3OC2 A;  3UE3 A;  3B42 A;  3DAV A;  3LY3 A;  5DF8 A;  2ZM2 A;  1H8Y A;  2FH5 A;  4PAU A;  5CHM A;  4JGP A;  4DF6 A;  1OTB A;  3C7V A;  3IWI A;  4Q0I A;  3C4O A;  3BY8 A;  3D72 A;  2L4R A;  4I3J A;  2JHE A;  1SDE A;  4DXB A;  3IT9 A;  1ALQ A;  3S7N A;  3CUE C;  2E8J A;  3EQU A;  1FR6 A;  3TE8 A;  3ITB A;  3DWZ A;  4HJ6 A;  2W3D A;  1P0Z A;  1H8M A;  5FDS A;  3SH8 A;  4DN0 A;  3NHQ A;  3L9K A;  4JGQ A;  1S1Z A;  4E6X A;  1E25 A;  2ZOI A;  3MMH A;  4BD1 A;  1TS8 A;  3R7W A;  2XFS A;  2ZC4 B;  1WE4 A;  2KDK A;  1EWZ A;  3AGD A;  3GVB A;  4HY8 A;  1MXO A;  3B47 A;  4Q0J A;  4OLG A;  4GLQ A;  3IX4 A;  2VLG A;  1P9W A;  5M1A A;  2PYP A;  4HBU A;  5HAR A;  3MQO A;  1NZO A;  4UQI S;  2WAD A;  3A3E A;  5CEC A;  2GX5 A;  1K4F A;  1OPX A;  3EGD C;  3F1N A;  5TR7 A;  2Z2L B;  2RL3 A;  4IVK A;  4IBR A;  1KDS A;  4E3O A;  1G6O A;  2VEA A;  2Y2I A;  4R23 A;  5EVI C;  3FV7 A;  2XD5 A;  1CQA A;  2ZD8 A;  2QMI A;  2WGI A;  2V8C A;  3S7P A;  2HF6 A;  5L2F A;  4P87 A;  1K57 A;  1MWR A;  3E2K A;  4Y15 A;  4R1G A;  4WZ5 C;  2H10 A;  4YOF A;  4BEN A;  4RX3 A;  2WKE A;  4DE0 A;  3G30 A;  5HWW A;  3S1Y A;  5F82 A;  1K54 C;  2QHK A;  4KZ3 A;  1ERM A;  1NLY A;  3UDI A;  2W3H A;  2WKH A;  4LV3 A;  3K3C A;  1ONG A;  1KE4 A;  1NRF A;  1Y54 A;  3NOT C;  1XJ6 A;  2WKP A;  3CMZ A;  1M6K A;  2WGV A;  3NEC A;  2EWW A;  4S2J A;  4ZTK A;  2WZX A;  4KEN B;  4HQA A;  1ZG6 A;  2V20 A;  2JBF A;  3GEC A;  2JKT I;  3FG8 A;  3FZC A;  1UGU A;  2VZW A;  4LGW A;  4H8R A;  4WMC D;  4BMW A;  3O3V A;  4BBU A;  3MJQ A;  3CPT A;  3Q7V A;  4EV4 A;  1H8Z A;  2ZLY A;  4C75 A;  4GN2 A;  3G2Z A;  4FSF A;  1XA7 A;  4WMC A;  2DMW A;  2PAV P;  3DTM A;  5HAP A;  2G7U A;  2Y91 A;  2CMN A;  1OTA A;  1CF0 A;  2VA0 A;  5CER A;  1OJ5 A;  5BOH A;  2VGK A;  4GS9 B;  4X55 A;  1DJC A;  1LI0 A;  2WGW A;  3VFH A;  3OPH A;  2V9A A;  2W1T A;  2W3E A;  3I7J A;  2B02 A;  3N7W A;  5DFY A;  3MQQ A;  4XUZ A;  3LID A;  2GZA A;  3FWL A;  2YKF A;  1XFQ A;  1Q2P A;  3TG9 A;  3GDI A;  1SHV A;  1MC0 A;  1XA1 A;  2VV7 A;  5GLD A;  1X0O A;  2DNS A;  1FIK A;  2QPN A;  3LIF A;  1BT5 A;  2V8F A;  2ZQ9 A;  1FSY A;  2P7J A;  2JN7 A;  4WEK A;  3BEC A;  5EE8 A;  2OWH A;  2WYX A;  2OLU A;  4ZAM A;  1KDW A;  4ZBE A;  4CQH A;  4YFM A;  4Y5F A;  3AGF A;  5HD5 A;  3A3F A;  2M1C A;  4QB8 A;  2EFX A;  2OLV A;  5AVF A;  1K25 A;  2EXA A;  1S0W A;  2MJ6 A;  3RFB A;  3HJK A;  3E0Y A;  5FEF A;  4YIN A;  1TD5 A;  3GQZ A;  4KZ7 A;  3PBQ A;  3BWL A;  3HJI A;  5HAI A;  1E3U D;  3UPO A;  4LRY C;  1FIL A;  5EVI B;  3BM6 A;  2KOI A;  4GB7 A;  3UB7 A;  1VEU A;  1YLW A;  3P7N A;  4JF5 A;  3QP4 A;  1E3U A;  3MFX A;  5IU1 A;  3MBZ A;  1KGF A;  3VOY A;  1JWP A;  1OTD A;  3UDX A;  1V9Z A;  1Q2Q A;  4R70 A;  3V39 A;  3PXP A;  4BL2 A;  4OQI A;  5DTS A;  4Y7P A;  1BUL A;  3JPU A;  2ZC5 B;  2IWC A;  2W0N A;  4QU3 A;  3NOP C;  3TSG A;  2WAF A;  4IBX A;  3C2W A;  5FQM A;  2NUP C;  1VB6 A;  1MWS A;  4IUH A;  3IXH A;  2JKG A;  3UDF A;  3T1R A;  2XLN A;  4RYE A;  4LCL A;  4HJ4 A;  2QYB A;  3Q1F A;  2J8Y A;  4Y0T A;  3HLB A;  3A3J A;  4Z9Q A;  3HRE A;  1OJG A;  4R3B A;  4UA7 A;  1BLP A;  4I5S A;  3VP1 A;  4X25 A;  3VP3 A;  1HLU P;  1BTL A;  3JVV A;  4BBT A;  3IXG A;  4L9E A;  4LPZ A;  5TBM B;  3RJU A;  3SS4 A;  2WKQ A;  3CI6 A;  4OOL A;  4E3I A;  1BLH A;  4QHC A;  1J3W A;  4YNR A;  2Y79 A;  3PAG A;  4CPK A;  3LEQ A;  1S6R A;  3SS5 A;  3HCY A;  1PWG A;  4GHI B;  4FCF A;  1KOU A;  3UB9 A;  1IEM A;  4Y2F A;  1BUE A;  1Z6F A;  1ES2 A;  4NXB A;  3IHA A;  4S2I A;  2O99 A;  3UB5 P;  2BG1 A;  4CLC C;  3AGE A;  1NRJ A;  1PW8 A;  2HV1 A;  2HZ5 A;  4GW9 A;  3FPV A;  4DE1 A;  4KZ8 A;  5HL1 A;  3A0V A;  2J9P A;  3UB8 A;  4OOM A;  2VGJ A;  2H0Y A;  4GOG A;  1DRM A;  5FL3 A;  3WS4 A;  1SDN A;  4NXG A;  1W63 Q;  4N9L A;  2XF3 A;  4G3W A;  3NCK A;  4EET B;  4WL9 A;  5GLB A;  1Z09 A;  1HTZ A;  5FAP A;  4MLL A;  3WS0 A;  5HDD A;  2ZQC A;  2ZMF A;  3BQ8 A;  4MDZ A;  3OPP A;  1PZO A;  4Y3I A;  4DMZ A;  4DXC A;  1EW0 A;  5IT5 A;  2VKS A;  4S2O A;  4DDY A;  4GS9 A;  1YQS A;  2V1B A;  3T4L A;  4HH3 A;  5JYO A;  4HEF A;  5FI2 A;  2WZZ A;  3NOU C;  3BYD A;  3LY4 A;  1KVL A;  5J7E A;  4KQQ A;  1YMX A;  3GTC A;  4WLA A;  4EBL A;  2EX2 A;  4D2O A;  3HBR A;  4GNU A;  1FCM A;  3HL9 A;  5FAQ A;  2Q0O A;  2PBD P;  2P04 A;  3NUL A;  2J7V A;  4OVD A;  3QP1 A;  2KLI A;  3MFD A;  3BFD A;  4MNR A;  3ZNT A;  1PW1 A;  1EI5 A;  4P6Z M;  3NJA A;  1PWC A;  3B3X A;  3MXQ A;  3HUM A;  4NK3 A;  4PM9 A;  1OTE A;  2K7S A;  2EX6 A;  4YWZ A;  3MF0 A;  3H9W A;  4B9O A;  4E3N A;  5GHX A;  4GD6 A;  5EVI D;  3F1O B;  3E4P A;  1CK3 A;  5I5L A;  3BFE A;  2NUT C;  5L07 A;  3G35 A;  1SKO A;  3PYP A;  3UPP A;  2J3T C;  3FPW A;  4IVI A;  4JLF A;  1IEL A;  2O0Y A;  3E2L A;  2CC1 A;  2J3W A;  2Y2H A;  5EOO A;  5EVI A;  4WZ4 A;  1TDG A;  2JE5 A;  3G4P A;  3A0S A;  1ES5 A;  4KZ5 A;  4NKP A;  3IF6 C;  3Q7Z A;  1S66 L;  3LIC A;  2E8I A;  3QNC A;  4MN6 A;  1AXB A;  3IWO A;  1DP8 A;  2FFF B;  3KSG A;  1O7E A;  4OON A;  5KSC A;  3T4K A;  2EX9 A;  3BFG A;  3S22 A;  4N92 A;  4WZ5 A;  3T12 B;  2Y2Q A;  3FKV A;  3WRZ A;  4HP4 A;  3PAE A;  3OZH A;  4PM6 A;  3M6B A;  4GCZ A;  2IWB A;  2VX8 A;  2EWV A;  3H7W A;  3LIE A;  4PHT A;  1AWI A;  2VK3 A;  1ACF A;  2D01 A;  3W2Z A;  1NZU A;  1OT9 A;  2PR6 A;  2YKH A;  4AFI A;  1H3Q A;  3UO9 A;  4BD0 A;  4X56 A;  1JVJ A;  3K3D A;  3QHY A;  3UPN A;  3ZCZ A;  3NC8 A;  1T1A A;  4P6Z S;  4Z1W A;  1VET B;  2X02 A;  5EV0 A;  5A93 A;  2PD8 A;  1J9M A;  1ES3 A;  3IXD A;  4Y17 A;  4C6Y A;  1ZC2 A;  2Z6D A;  5F68 A;  1XJ2 A;  5DJU A;  3BJN A;  4P6B A;  1L0G A;  4R6L A;  3LI9 A;  4RX2 A;  3H82 B;  1O07 A;  4DRT A;  3IQA A;  2I9V A;  4GHI A;  4KZ6 A;  2P08 A;  4X68 A;  3TJZ C;  3OLO A;  4OP5 A;  4UHU A;  5HDS A;  1YKD A;  1IYO A;  3RTY A;  5KZH A;  1N9O A;  4JGR A;  5CHU A;  1MWT A;  4KZ4 A;  5A92 A;  1JWV A;  3MKF A;  2HP6 A;  1A0K A;  1GSW A;  2K2N A;  1T19 A;  2G2W A;  2W3F A;  3HVF A;  3WRT A;  2O9A A;  4ETZ A;  3SS3 A;  4DE2 A;  4E3K A;  3EEA A;  1NYM A;  4RVA A;  4PMA A;  3MZD A;  1XJ4 A;  5IS1 A;  1W7F A;  5CED A;  1N9L A;  3QP6 A;  1LT0 A;  3OPL A;  1K6R A;  2HJ9 C;  5FQJ A;  3HLG A;  1GCE A;  2LB9 A;  3PBN A;  1DJB A;  2WKR A;  3F1P A;  3IHB A;  3LIB A;  3HLF A;  2C6W B;  4FH2 A;  2BLS A;  1YLY A;  4OPR A;  1K55 A;  4NEE D;  2EA9 A;  5HWT A;  2HGV A;  1G6A A;  3EQV A;  3IF6 B;  2XDM A;  1UWN X;  3PHY A;  1ERQ A;  1FCO A;  1LL5 A;  5EUA A;  4K08 A;  1PIO A;  2J9O A;  2OSU A;  4DJ2 A;  3W4Q A;  1HZO A;  3N8R A;  2Y2N A;  2ZM0 A;  3N6I A;  5KSH A;  3O5Y A;  5HX9 A;  3MR0 A;  3WS5 A;  4NXE A;  3ZG8 B;  2Z2M B;  4PM7 A;  4CLC E;  3PR6 A;  1MY8 A;  2HP9 A;  2Y2P A;  4D60 A;  2Y59 A;  1RP5 A;  4WBG A;  1YSP A;  4KZA A;  3Q81 A;  1NYY A;  4ZRR A;  1G5U A;  2R9X A;  3TRC A;  3D3O A;  1H5X A;  2JKT M;  4LCM A;  4PM5 A; 
#chains in the Genus database with same CATH homology
 2IWD A;  2ZC7 A;  4LV1 A;  4OLD A;  3FYZ A;  3W4P A;  4S2K A;  2X71 A;  3VP1 A;  1CI9 A;  3VP3 A;  1KE0 A;  4DKI A;  1BTL A;  1BSG A;  4JBF A;  4K91 A;  3ZG9 B;  1KGE A;  4BQM A;  2WGW B;  3OPR A;  1XXM A;  1XKZ A;  3IXG A;  1GA0 A;  1L0D A;  2WAE A;  5HAQ A;  3RJU A;  3SS4 A;  3MXR A;  2XEP A;  4OOL A;  4E3I A;  1GHM A;  3G2Y A;  1BLH A;  1TDL A;  4QHC A;  2XGN A;  4B4X A;  1K4E A;  3A3D A;  1IKI A;  3OCN A;  3C4P A;  5F1F A;  1W8Q A;  5M18 A;  2C5W B;  3G34 A;  3PAG A;  1RGY A;  1TEM A;  1MPL A;  4JXS A;  5EEC A;  4ID4 A;  4CPK A;  5DTT A;  1S6R A;  3SS5 A;  5CTM A;  4P85 A;  1FOF A;  1PWG A;  5AQ7 A;  3DW0 A;  1FCN A;  1RCJ A;  3ZG5 A;  4FCF A;  1VQQ A;  4K0X A;  4WEL A;  2P9V A;  2DRW A;  3GR2 A;  5CGW A;  3UE0 A;  1IEM A;  2R9W A;  3NI9 A;  1BUE A;  1U60 A;  3IH8 A;  1Z6F A;  4LEN A;  5KMW A;  1YM1 A;  1BLC A;  3Q82 A;  1ES2 A;  3PBS A;  1LI9 A;  3IHA A;  1XPB A;  4PM8 A;  3MKE A;  3HUO A;  4PPR A;  4S2I A;  5E2E A;  4X6T A;  4ZDX A;  4N1H A;  3ZHH A;  3ZVT A;  4KZB A;  2BG1 A;  4U0X A;  3AGE A;  4F94 A;  3V5M A;  5AQB A;  2XFT A;  3IWQ A;  4GD8 A;  1PW8 A;  3HLC A;  5FQI A;  5HW3 A;  3W8K A;  4N9K A;  1FSW A;  5FAO A;  4UA9 A;  2JCH A;  3C5A A;  3N4I A;  2EXB A;  3PBO A;  3OC2 A;  3UE3 A;  3P09 A;  3VOZ A;  3LY3 A;  3ZGA B;  3ZNT A;  4DE1 A;  4KZ8 A;  5A91 A;  5DF8 A;  1XX2 A;  2ZM2 A;  1H8Y A;  4KG2 A;  5HL1 A;  5EVL A;  5CHM A;  5TGF A;  2J9P A;  4OOM A;  2VGJ A;  3O86 A;  3M2K A;  4DF6 A;  2H0Y A;  5G18 A;  4QY6 A;  4GOG A;  3WS4 A;  3C7V A;  1SDN A;  4N9L A;  2XF3 A;  1HD8 A;  3NCK A;  1PWD A;  4QY5 A;  3VMA A;  3ZNY A;  4LV2 A;  3IWI A;  3C4O A;  4OQH A;  4JF6 A;  5GLB A;  2ZQ7 A;  2HDS A;  4GDN A;  4M3K A;  3V3S A;  2QZ6 A;  4QD4 A;  3TOI A;  1KE3 A;  2ZM8 A;  1HTZ A;  2UWX A;  5FAP A;  4BL3 A;  4MLL A;  4S2L A;  1NXY A;  2DCF A;  3WS0 A;  1FR1 A;  1N9B A;  2ZQC A;  5HFO A;  2WKI A;  1SDE A;  4DXB A;  3IT9 A;  1KVM A;  3OPP A;  2OV5 A;  5DF7 A;  1PZO A;  1W5D A;  1ALQ A;  2XR0 A;  3EQU A;  1ZKJ A;  4DXC A;  3M2J A;  1FR6 A;  3ITB A;  3DWZ A;  4OPZ A;  4ZJ2 A;  3ZVW A;  4S2O A;  5A90 A;  4DDY A;  3IH9 A;  3SH8 A;  1YQS A;  5FSR A;  4OPY A;  1QME A;  4R3J A;  5E2F A;  3ITA A;  4HEF A;  5FI2 A;  5JYO A;  1K56 D;  4KZ9 A;  3ZG0 A;  2WZZ A;  4K0W A;  1BZA A;  1L0F A;  4E6X A;  3BYD A;  3PBT A;  3CJM A;  2V1Z A;  3LY4 A;  1E25 A;  1KVL A;  4BD1 A;  4KQQ A;  3N8S A;  2XFS A;  5E2G A;  2ZC4 B;  1YMX A;  1WE4 A;  3GTC A;  4EBL A;  2EX2 A;  4OH0 A;  2V2F F;  4D2O A;  3V50 A;  1EWZ A;  2A49 A;  3AGD A;  1FCM A;  3GRJ A;  2ZQ8 A;  3GVB A;  3HBR A;  3HL9 A;  4GNU A;  5FAQ A;  1MXO A;  5CHJ A;  1IYS A;  4OLG A;  1K56 A;  5M1A A;  4HBU A;  4OKP A;  4HBT A;  5HAR A;  4KQO A;  2XH9 A;  4IED A;  2J7V A;  4OVD A;  1YLP A;  3HUN A;  1FQG A;  4E6W A;  1NZO A;  3MFD A;  2P74 A;  2WUQ A;  3BFD A;  3NY4 A;  1PW1 A;  1EI5 A;  1W79 A;  2Q9M A;  2WAD A;  3A3E A;  4LV0 A;  4MNR A;  4UAA A;  4E3J A;  5CEC A;  1PWC A;  2Y2M A;  4QJG A;  3B3X A;  4S2P A;  3HUM A;  1PZP A;  4B88 A;  4NK3 A;  1I2S A;  4PM9 A;  2Y2K A;  1YT4 A;  1ZG4 A;  5EPH A;  5GHY A;  3BLS A;  2EX6 A;  1I5Q A;  1TVF A;  1K4F A;  4HES A;  5FAT A;  3WS1 A;  3BLM A;  4KQR A;  5F83 A;  5FQK A;  4GDB A;  4UA6 A;  5TFQ A;  5TR7 A;  2Z2L B;  4XUX A;  2RL3 A;  3UE1 A;  4IVK A;  4E3N A;  4IBR A;  1KDS A;  4GD6 A;  3BRM A;  2FFY A;  5EVI D;  1L0E A;  2Y2I A;  5GHX A;  4R23 A;  1K57 C;  2HDR A;  5EVI C;  4L0L A;  3VP4 A;  5FAS A;  1CK3 A;  4FD8 A;  4X53 A;  1BLS A;  3FV7 A;  2XD5 A;  3BFE A;  2ZD8 A;  3GV9 A;  4R0Q A;  1JWZ A;  4S2M A;  4U3T A;  3G35 A;  5CXW A;  3V3R A;  3UPP A;  5GLA A;  5E2H A;  3NDE A;  3VSK A;  3NBL A;  4IVI A;  4MBH A;  3PBR A;  1GA9 A;  5U47 A;  2QMI A;  2WGI A;  4JLF A;  1IEL A;  2XQZ A;  2ZC6 B;  4EBN A;  3E2L A;  5L2F A;  2CC1 A;  1W8Y A;  2Y2H A;  1GHI A;  3MZE A;  4P87 A;  2P9V B;  1K57 A;  5EOO A;  5EVI A;  1MWR A;  4WZ4 A;  1TDG A;  1SKF A;  3E2K A;  3D4F A;  3N8L A;  4WYY A;  5AQ9 A;  2JE5 A;  5GL9 A;  5F1G A;  2B5R A;  3G4P A;  1ES5 A;  3VFF A;  1PI4 A;  4R1G A;  4KZ5 A;  4OQG A;  3C7U A;  1LL9 A;  4WZ5 C;  4RA7 A;  3IF6 C;  3Q7Z A;  2H10 A;  4N1X A;  3VSL A;  3WWX A;  2HDQ A;  3ZG7 B;  3BEB A;  4X69 A;  4BEN A;  5GLC A;  2E8I A;  1YLT A;  3QNC A;  4RX3 A;  2WKE A;  4DE0 A;  3G30 A;  2Y2J A;  5F82 A;  1LHY A;  1AXB A;  3S1Y A;  4JXV A;  1K54 C;  3IWO A;  4KZ3 A;  1ERM A;  5CRF A;  5FI7 A;  3UDI A;  2FFF B;  3W4O A;  1O7E A;  4OON A;  4LV3 A;  2H0T A;  2WKH A;  5KSC A;  3LCE A;  1K55 C;  2EX9 A;  1ONG A;  1KE4 A;  3BFG A;  3S22 A;  1NRF A;  1Y54 A;  4N92 A;  4WZ5 A;  3IF6 A;  2ZJ9 A;  4B4Z A;  2Y2Q A;  3FKV A;  3WRZ A;  3BFC A;  3CMZ A;  4JXW A;  1ESI A;  1M6K A;  3PAE A;  2WGV A;  1ERO A;  1XGJ A;  2ZMA A;  3OZH A;  4S2J A;  4ZTK A;  2Y4A A;  2WZX A;  4KEN B;  4KG5 A;  1ZG6 A;  1JTG A;  4PM6 A;  2V20 A;  3M6B A;  4GZB A;  4Q8I A;  2JBF A;  1WYC A;  2HP5 A;  3FZC A;  5AQA A;  3HLE A;  1CI8 A;  2IWB A;  1NJ4 A;  4H8R A;  4WMC D;  5CEB A;  3O3V A;  1MBL A;  1NZU A;  4C3Q A;  2I72 A;  1ESU A;  3WS2 A;  4JPM A;  5DTK A;  2Y2O A;  3Q7V A;  3UO9 A;  4EV4 A;  4BD0 A;  1MWU A;  2A3U A;  1H8Z A;  4X56 A;  2ZLY A;  4Y0U A;  3NDG A;  4C75 A;  2Y55 A;  1YMS A;  1L2S A;  4GN2 A;  3G2Z A;  1JVJ A;  4EUZ A;  4FSF A;  3QHY A;  1ONH A;  3UPN A;  3ZCZ A;  3NIA A;  3NC8 A;  3G32 A;  1XA7 A;  1IYQ A;  2ZQD A;  1YLZ A;  4WMC A;  3DTM A;  5HAP A;  5J8X A;  2Q9N A;  2Y91 A;  3QNB A;  3UY6 A;  1I2W A;  5DF9 A;  3JYI A;  2X02 A;  1YLJ A;  5CER A;  5BOH A;  5CGS A;  2VGK A;  4OQ0 A;  4X55 A;  5A93 A;  1DJC A;  1LI0 A;  2WGW A;  5FQQ A;  1J9M A;  3OPH A;  4NET A;  3VFH A;  1ES3 A;  2ZQA A;  3I7J A;  5D3O A;  3SH7 A;  3IXD A;  3N7W A;  2WK0 A;  4C6Y A;  1ZC2 A;  1QMF A;  1IYP A;  4OPQ A;  4JKT A;  4XUZ A;  4FH4 A;  1K6S A;  4BJP A;  3FWL A;  3GMW A;  4P6B A;  1L0G A;  1PI5 A;  1Q2P A;  4RX2 A;  5I94 A;  2GDN A;  4P0M A;  3TG9 A;  4EWF A;  5DVA A;  2XD1 A;  1O07 A;  3BFF A;  1SHV A;  1WYB A;  1XA1 A;  4DRT A;  2PU4 A;  3IQA A;  5GLD A;  4KZ6 A;  2DNS A;  2ZC3 B;  4X68 A;  1GHP A;  2QPN A;  3O88 A;  4OP5 A;  1BT5 A;  4OOY A;  2ZQ9 A;  1FSY A;  3SH9 A;  4WEK A;  4UHU A;  2PBY A;  5IHV A;  4GKU A;  3BEC A;  4CJN A;  1NY0 A;  3HLW A;  4MEZ A;  5EE8 A;  2JC7 A;  2WYX A;  1IYO A;  5FDH A;  3MZF A;  5KZH A;  2OLU A;  4EBP A;  1VM1 A;  4ZAM A;  1KDW A;  4R4R A;  1E4D A;  4S2N C;  3G31 A;  5CHU A;  4ZBE A;  5EOE A;  3VP0 A;  4YFM A;  4E3M A;  3AGF A;  2PU2 A;  3A3F A;  4QB8 A;  2EFX A;  4JXG A;  1MWT A;  4KZ4 A;  2OLV A;  3CG5 A;  5A92 A;  1JWV A;  1KGG A;  3MKF A;  3RXW A;  1SCW A;  4BLM A;  2HP6 A;  3GSG A;  1K25 A;  2EXA A;  1S0W A;  3VP2 A;  2G2W A;  4DE3 A;  3HVF A;  3M6H A;  4U0T A;  3WRT A;  1JTD A;  3ISG A;  3HLD A;  1OME A;  4S2N A;  3OCL A;  4YIN A;  3SS3 A;  3GQZ A;  4DE2 A;  2HDU A;  4E3K A;  4KZ7 A;  5CTN A;  3PBQ A;  1NYM A;  1IKG A;  4A5R A;  5HAI A;  1E3U D;  2G2U A;  4RVA A;  3UPO A;  1XGI A;  4PMA A;  3MZD A;  4MBF A;  5CGX A;  2EX8 A;  1W7F A;  5CED A;  5EVI B;  4E3L A;  1RGZ A;  5JYP A;  1PYY A;  3Q07 A;  2XK1 A;  4DDS A;  1XP4 A;  1G68 A;  3OPL A;  3O87 A;  1K6R A;  1MKI A;  3BM6 A;  5FQJ A;  3HLG A;  4GB7 A;  4XXR A;  1GCE A;  3ZFZ A;  3PBN A;  1DJB A;  1DJA A;  1HVB A;  4WEJ A;  1K54 A;  1YLW A;  1DY6 A;  4ZJ3 A;  4JF5 A;  3IHB A;  1ES4 A;  1E3U A;  1CEF A;  3HLF A;  2C6W B;  3MBZ A;  2Y2G A;  1KGF A;  4FH2 A;  1M40 A;  4OP8 A;  5GHZ A;  3MXS A;  2BLS A;  2RCX A;  3VOY A;  1YLY A;  4O7D A;  1JWP A;  4OPR A;  1K55 A;  2HPB A;  3UDX A;  1LLB A;  1Q2Q A;  4R4S A;  4WM9 A;  3V39 A;  4BL2 A;  4OQI A;  1G6A A;  3A3I A;  5DTS A;  3EQV A;  4Y7P A;  1BUL A;  5FA7 A;  3IF6 B;  2XDM A;  4E3O A;  3PTE A;  3P98 A;  2ZC5 B;  4JF4 A;  2IWC A;  4QU3 A;  1ERQ A;  1FCO A;  1K38 A;  1LL5 A;  5EUA A;  1PIO A;  3ZDJ A;  4KG6 A;  3TSG A;  2J9O A;  4MBK A;  2OSU A;  2X01 A;  3W4Q A;  1HZO A;  2WAF A;  3N8R A;  2Y2N A;  4IBX A;  5E43 A;  1CEG A;  5FI6 A;  2ZM0 A;  3N6I A;  5FQM A;  3SOI A;  5KSH A;  1MWS A;  3IXB A;  5HX9 A;  5M19 A;  3IXH A;  3WS5 A;  4ZJ1 A;  3UDF A;  3ZG8 B;  2XLN A;  2Z2M B;  4RYE A;  4LCL A;  2Y2L A;  4PM7 A;  1MY8 A;  2H5S A;  3RXX A;  3LEZ A;  3Q1F A;  2HP9 A;  1C3B A;  2Y2P A;  2J8Y A;  1RP5 A;  2Y59 A;  4Y0T A;  3Q7V B;  4WBG A;  4KZA A;  3IF5 A;  3HLB A;  3Q81 A;  4EQI A;  1NYY A;  3A3J A;  2EFU A;  3LO7 A;  2R9X A;  4Z9Q A;  1N4O A;  3CZD A;  3DWK A;  5FQ9 A;  3UN7 A;  3S4X A;  3HRE A;  3FKW A;  1H5X A;  4Y0O A;  3UNW A;  4LCM A;  4R3B A;  4UA7 A;  4PM5 A;  1BLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...