1YLPA

Atomic resolution structure of ctx-m-27 beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
b'QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKHADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGGYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase CTX-M-27
molecule tags Hydrolase
source organism Escherichia coli
publication title Atomic Resolution Structures of CTX-M beta-Lactamases: Extended Spectrum Activities from Increased Mobility and Decreased Stability.
pubmed doi rcsb
total genus 99
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ylpA00
5DF7A 3SH9A 3VP4A 4EBNA 4DE0A 4OVDA 4IBXA 3SOIA 2ZD8A 2EX6A 1K56D 5CHUA 1CEFA 3M6HA 1ONGA 1MKIA 1RGZA 4LENA 4ZAMA 4GB7A 4N1HA 3BFEA 2HDUA 1E25A 4KZ7A 2ZC4B 2Y4AA 4WBGA 3RXXA 3HUOA 3Q1FA 4PM6A 3TG9A 2J8YA 3HLCA 4GDNA 2C6WB 4ID4A 2HPBA 1KDWA 3WRZA 1CI8A 5CEDA 5BOHA 5CEBA 4OQIA 1NYYA 4KZ9A 2Y2JA 1ZKJA 5M18A 5CHMA 3CG5A 1DJCA 5CXWA 3M2JA 3BM6A 2G2UA 1PYYA 3IF6C 2BLSA 2J9OA 1FSYA 3CJMA 3NDGA 5I94A 1XKZA 1ZG4A 2XLNA 1JTGA 5TFQA 4RYEA 4R1GA 3LY4A 2G2WA 3LCEA 5FA7A 4EUZA 4PM9A 1DJAA 5HW3A 3OC2A 3MBZA 5FAOA 2OLUA 1YLJA 5CGSA 1IYOA 4OPQA 5E2FA 5HAPA 5CHJA 1FQGA 3IXBA 1JWPA 3MZEA 1BZAA 3TSGA 1YQSA 3O86A 3NDEA 3S4XA 4F94A 1ES5A 5EOEA 4JKTA 3B3XA 3V39A 3PTEA 4OKPA 3ZG9B 1YMXA 2WUQA 4E3LA 1Z6FA 1W8QA 1YLZA 1ZC2A 3PAEA 4MBHA 3UN7A 3UE1A 1J9MA 2ZQ8A 1FR1A 5GLCA 4ZTKA 1EI5A 3SH8A 3GMWA 1ZG6A 3MFDA 4WZ5A 3PBNA 1TDGA 2X71A 4OH0A 4XXRA 5GLDA 4WMCA 2Y55A 2Y59A 3ISGA 4JF6A 5HL1A 3VMAA 3C7UA 4UA6A 3ZCZA 5HX9A 3W4QA 2XFSA 2QMIA 1K57A 3W4OA 3OPLA 4KQRA 4P87A 3W8KA 3ZFZA 1C3BA 4WEJA 4B4ZA 4KZ4A 3NI9A 3SH7A 3UDFA 4U3TA 1K56A 3UNWA 5FQKA 4EWFA 5EUAA 4BL2A 3UPOA 1HVBA 1TVFA 3VP0A 1S0WA 4DF6A 1YLTA 3GR2A 4QU3A 3DW0A 4JXGA 3QNCA 1GHPA 2R9XA 2Y2MA 3IXDA 1K55A 4ZDXA 2OLVA 4QY6A 5DTKA 4OOMA 5G18A 4OPZA 1TDLA 4DKIA 5GHXA 3N8LA 4MNRA 2WKHA 4ZJ2A 4U0TA 4X6TA 4E3OA 3BFGA 3C4PA 3V5MA 1U60A 4FSFA 2C5WB 2UWXA 4WEKA 3ZG8B 1L0GA 3QHYA 2PU4A 5FDHA 3PBTA 5FQMA 4Y7PA 5TGFA 2OV5A 1RGYA 1K4EA 3A3EA 4S2IA 1GCEA 3G32A 5AQAA 1CK3A 4S2KA 4OLGA 4CJNA 2PU2A 1K57C 1NZUA 2EXAA 5IHVA 1FOFA 2Y91A 4IEDA 1MY8A 1CEGA 3CMZA 5EE8A 3GV9A 4QY5A 2WGVA 1L2SA 1JWVA 1KVMA 4O7DA 3BRMA 4N92A 1KDSA 3WS5A 1FCMA 5A92A 3ZG5A 2ZC5B 2GDNA 2JCHA 3VFHA 2ZC6B 2HDRA 1BSGA 4E3IA 2WAFA 4R4SA 2WKIA 5EVIC 3I7JA 2Y2IA 1AXBA 2XEPA 4BJPA 4E6WA 3A3DA 2ZC3B 1MWTA 5EVID 4KQOA 4E3NA 1BLSA 3EQVA 3MXSA 3OZHA 3N4IA 3PBOA 2EX9A 5EVIA 1K38A 3MKEA 4R0QA 3NC8A 5DTTA 4RX2A 4MBKA 1BLHA 1XGIA 3IWIA 2BG1A 3NCKA 2ZM2A 1NYMA 3SS4A 4UA7A 3VP3A 1YT4A 5JYOA 1FCOA 3HL9A 4RA7A 2VGKA 1WYBA 3ZDJA 2XQZA 5KSHA 3IH8A 4MLLA 2ZQ9A 1MWSA 1GHMA 4GN2A 4JF4A 2XD1A 1BLCA 1IYPA 3S1YA 1E4DA 2HDSA 3HLFA 2ZLYA 3N6IA 2Q9MA 5GLAA 3HLGA 1BLPA 3AGFA 3C7VA 3PBRA 3OCLA 4C75A 5AQBA 1KE0A 1QMFA 3Q7ZA 4Q8IA 1HZOA 4LCMA 3ZNTA 5EVIB 2A49A 3OPPA 4HBUA 3G35A 4E3KA 1CI9A 1K54A 3A3FA 2WGWA 5FI2A 1ES2A 1M6KA 2WGWB 1LI0A 3LEZA 5DF9A 4S2NA 3G2ZA 5FQ9A 5A91A 2R9WA 3UE3A 3Q7VB 5FQIA 5EPHA 1QMEA 1WE4A 3GVBA 4JLFA 2H5SA 2IWCA 4KG2A 4N1XA 2XK1A 5GLBA 3QNBA 4EBPA 4LCLA 1FCNA 4KG5A 4GKUA 4S2NC 1ES4A 2H10A 3UPPA 4RVAA 4GZBA 2V1ZA 2Y2PA 4R3JA 3VSLA 3GRJA 3ZVWA 4K91A 1H8ZA 5E2HA 2E8IA 3Q82A 4MEZA 3DWZA 5FASA 4X56A 4KG6A 2DRWA 1YLYA 2WZXA 4KZ3A 4NETA 4OQGA 3MKFA 4C6YA 5GHYA 5CERA 4QJGA 5J8XA 2Z2MB 1I2WA 3E2LA 4JXWA 1I5QA 1RCJA 2HP9A 5U47A 5F1GA 1SHVA 4KZBA 1JTDA 4DDYA 4PM5A 3ZHHA 1VQQA 4IVKA 4ZJ3A 4BD1A 2Y2NA 3N8RA 5DF8A 3WS4A 2QPNA 3ZVTA 3FKWA 1IYSA 2Y2OA 1DJBA 1W79A 4KQQA 2ZM8A 4X69A 5FI6A 2EX8A 4HBTA 1XGJA 4X68A 3G31A 3W4PA 4DXCA 4WYYA 4DDSA 3P09A 1OMEA 2EFUA 1KVLA 3NIAA 4PM7A 4UA9A 3IWQA 4KZ6A 3PBQA 5M19A 4C3QA 5CTNA 1JVJA 2ZJ9A 1NY0A 3WS0A 4DE1A 1L0FA 3Q07A 2WK0A 4OPYA 4ZBEA 5KZHA 2Y2QA 4Y0TA 4FCFA 3BFDA 2IWDA 2P9VA 1S6RA 2Y2LA 3M2KA 1PI4A 5FAPA 4BD0A 3OCNA 1YMSA 4OP8A 3V3SA 2A3UA 4BENA 5FQJA 1K6SA 1M40A 3FZCA 4WZ4A 3HLWA 1G68A 1W7FA 4MBFA 1PZOA 3HLDA 3PAGA 4R3BA 3IHAA 4S2JA 1MPLA 1EROA 2HP6A 3ZG7B 3HREA 2ZMAA 3HLBA 4P85A 4NK3A 1KGFA 5CGWA 1ONHA 4S2MA 1E3UD 4LV1A 4PMAA 2XFTA 2EFXA 3AGEA 1HTZA 1NZOA 3O88A 1N4OA 3UPNA 3WWXA 2V2FF 3IF5A 1W8YA 1SKFA 4QD4A 3BECA 3FV7A 3IT9A 2HDQA 3OPRA 4EQIA 3HUMA 5E2EA 5FQQA 3ZNYA 4P0MA 1DY6A 2X01A 4JXSA 4EBLA 4UAAA 3IQAA 4GD8A 4KZAA 2EX2A 4Y0UA 3AGDA 3SS3A 1K25A 2XDMA 3MZDA 1E3UA 1Q2PA 2EXBA 3G2YA 4U0XA 4KZ8A 1BUEA 4N9LA 1N9BA 1PWDA 1YLPA 4GDBA 3IXGA 3NBLA 4GNUA 2Z2LB 4XUXA 3VP2A 3N7WA 4K0WA 3ZGAB 3LY3A 1LLBA 1YM1A 1BULA 3ITBA 1GA9A 4OP5A 3VOZA 4BQMA 4JF5A 4QHCA 4LV2A 2X02A 5CRFA 3GTCA 3D4FA 4WZ5C 5HAIA 4XUZA 1MBLA 3C4OA 3GSGA 3DWKA 4JBFA 3CZDA 5HFOA 4DE3A 1XXMA 2WKEA 3Q81A 5A93A 1IYQA 4GOGA 2P9VB 3N8SA 4X55A 5AQ9A 2P74A 1ESUA 3RJUA 1EWZA 3WRTA 1TEMA 5EECA 3FWLA 5FATA 4OOYA 2JBFA 1ERMA 3V3RA 1ES3A 1NXYA 4S2LA 4DRTA 1NRFA 1PWGA 1XA7A 2XH9A 5HARA 1L0DA 1LL9A 2QZ6A 4OLDA 1O7EA 3IXHA 1SDEA 4K0XA 1XPBA 4OOLA 3VOYA 4JPMA 1Y54A 1IEMA 4OPRA 2V20A 3ZG0A 4LV3A 2IWBA 1LI9A 4H8RA 4CPKA 4IBRA 4WM9A 3UE0A 4E6XA 2OSUA 4LV0A 2ZQCA 1ESIA 5FI7A 1H8YA 3EQUA 1MWRA 4Z9QA 2JE5A 3DTMA 2RL3A 5CTMA 3S22A 2PBYA 1I2SA 2WYXA 3HBRA 3WS2A 1HD8A 5M1AA 3FYZA 4P6BA 4BLMA 4OONA 2FFFB 3TOIA 5EOOA 3IF6A 1VM1A 4GD6A 1IKGA 2Y2GA 1SDNA 3JYIA 1PI5A 3Q7VA 4WELA 4PM8A 2JC7A 1FSWA 4KZ5A 3UDIA 3O3VA 1W5DA 3G34A 4RX3A 3MXRA 2VGJA 3VP1A 3BYDA 5F82A 1BTLA 1G6AA 2RCXA 2B5RA 4S2OA 1K54C 5CGXA 2XD5A 2ZQDA 4IVIA 4FH4A 2FFYA 5E43A 3RXWA 2J7VA 1KE4A 2ZQAA 1PW1A 2XR0A 1LHYA 1O07A 5HAQA 3BLSA 5TR7A 1ERQA 1PWCA 4YINA 5GL9A 5D3OA 5A90A 3P98A 1K4FA 4R4RA 3V50A 4YFMA 4UHUA 3LO7A 3M6BA 4S2PA 3UDXA 3VSKA 2XGNA 2DCFA 3OPHA 1MWUA 5CECA 3FKVA 4FD8A 1XX2A 3BFCA 1KGGA 2Y2HA 4B4XA 1MXOA 5KMWA 2WGIA 3ITAA 1H5XA 2CC1A 4HESA 4EV4A 4ZJ1A 1YLWA 1NJ4A 4BL3A 3A3IA 3A3JA 1JWZA 3G30A 4PPRA 2J9PA 5FSRA 3UO9A 1KE3A 4HEFA 4JXVA 4N9KA 5F83A 4WMCD 5AQ7A 4KENB 4B88A 1WYCA 3MZFA 3O87A 4Y0OA 1GHIA 3BLMA 3BEBA 3IWOA 1PIOA 1Q2QA 2Q9NA 2WZZA 3BFFA 2WAEA 3IHBA 2H0YA 4A5RA 4QB8A 5EVLA 3VFFA 4D2OA 2ZQ7A 3IH9A 4X53A 3G4PA 1KGEA 5E2GA 5DVAA 1GA0A 1K6RA 1FR6A 2DNSA 4R23A 1BT5A 1XA1A 2I72A 3E2KA 3HLEA 2ZM0A 1XP4A 3WS1A 3C5AA 2H0TA 1ALQA 1SCWA 3NY4A 4OQ0A 1PZPA 3SS5A 4FH2A 4E3MA 2Y2KA 3HUNA 3IF6B 2HP5A 1IKIA 5DTSA 2ZC7A 5F1FA 1IELA 2XF3A 1PW8A 4L0LA 1LL5A 3HVFA 4M3KA 3UY6A 4E3JA 2WADA 1RP5A 5GHZA 5JYPA 1L0EA 3PBSA 5FAQA 3GQZA 4DE2A 5L2FA 4OQHA 4DXBA 5KSCA 1K55C
chains in the Genus database with same CATH superfamily
3SH9A 4EBNA 4IBXA 3SOIA 2ZD8A 2EX6A 5F68A 1CEFA 3M6HA 4ZAMA 1YSPA 3PYPA 3F1OA 1V9ZA 2QWSA 2ZC4B 3RXXA 3HUOA 3Q1FA 1F2KA 4PKYG 3TG9A 5DKLA 5BOHA 4OQIA 1NYYA 3H82B 1ZKJA 5CHMA 3CJMA 2E8JA 4G3KA 3F1NB 4EXOA 1JTGA 5TFQA 1NLYA 4ESPA 5FEFA 2G2WA 4EUZA 1DJAA 5HW3A 1IYOA 4OPQA 5HAPA 5CHJA 4MDZA 3TSGA 3NDEA 4F94A 3F1OB 1ES5A 2VV6A 4OKPA 1XFQA 3PAEA 2V9AA 4MBHA 3JVVA 2V1BA 4R6LA 5GLCA 4ZTKA 1EI5A 3GMWA 1ZG6A 4WZ5A 5GLDA 5HDDA 1CF0A 2Y59A 1N9OA 3ISGA 2A24B 4I38A 3W4QA 3CAXA 3MF0A 3W8KA 4M4XA 3UDFA 5FQKA 4BL2A 4DF6A 3VP0A 3DW0A 1WA9A 2R9XA 4ZDXA 1K55A 2OLVA 4QY6A 3QP1A 4OPZA 4ETXA 1CQAA 4ZJ2A 3CI6A 3VV4A 4WEKA 2BTFP 3QHYA 5FDHA 2OV5A 3H9WA 1RGYA 1K4EA 1CK3A 3MS6A 4X1MA 1NZUA 2EXAA 3T4LA 5EE8A 3GV9A 4QY5A 2WGVA 3LFVA 3K2NA 3BRMA 4N92A 1KDSA 3WS5A 2ZC5B 2GDNA 2JCHA 5HWTA 3VFHA 4R4SA 5EVIC 1SKOA 3VE3A 3CUEC 1W63M 5EVID 4E3NA 3EQVA 3MXSA 4R3AA 3PBOA 5EVIA 3MKEA 1G6OA 3K3CA 5JYOA 3HL9A 1WYBA 5KSHA 2ZQ9A 2PYPA 4GN2A 3IS2B 4JF4A 1IYPA 1PFLA 2UV0E 3N6IA 3CHWP 3HLGA 4E04A 1BLPA 4JGQA 3KX0X 4PKYA 3UMDA 2VKSA 3VOLA 3ICYA 4GS9A 1HZOA 5EVIB 3NJAA 3H7WB 5FI2A 1AWIA 2WGWA 2WGWB 2PD7A 3LEZA 4UEYA 3G2ZA 3Q7VB 2PDRA 2VK3A 4KG2A 2XK1A 5GLBA 4LCLA 4H6JA 4S2NC 4HH2A 5HSQA 1HLUP 4Q0JA 4R3JA 2P08A 3GRJA 3ZVWA 2KDKA 3E0YA 3DWZA 5FASA 2WZXA 4KZ3A 2HGVA 1I2WA 3E2LA 3QP8A 4IVKA 2XSSA 1DJBA 3BY8A 4X68A 3TRCA 4PM7A 1P97A 3KO6A 4C3QA 4DE1A 2WK0A 4ZBEA 5KZHA 3BFDA 2L0WA 5L09A 3V3SA 2A3UA 5FQJA 4FTXA 3QP2A 3KYQA 4MBFA 4R3BA 3IHAA 3HREA 2GX5A 4LV1A 3AGEA 2W3FA 1PRQA 2V2FF 2PRFA 3IT9A 3FV7A 2ZOHA 3OPRA 5FQQA 3IQAA 4Y0UA 1K25A 1E3UA 1Q2PA 3O5YA 4CQHA 4U0XA 1BUEA 4GDBA 3NBLA 2Z2LB 1A0KA 4B9OA 1LLBA 3VOZA 3ITBA 4OP5A 3DTKA 4NXGA 1H3QA 3CZDA 1XXMA 2WKEA 3Q81A 3LR3A 2P9VB 2XA7M 2G7UA 2JBFA 3V3RA 2H28A 1ES3A 1NXYA 4S2LA 1VHMA 1XJ3A 2V1AA 3T4KA 1L0DA 4OLDA 1O7EA 3EEAA 1S66L 1UWPX 4EEPA 3VOYA 2ZL1B 4L9EA 1LI9A 4H8RA 4ME4A 4YNRA 1F98A 3C2WA 3EQUA 1MWRA 4Z9QA 3DTMA 3S22A 2Q0OA 2WYXA 2XRNA 4G3VA 3TOIA 3T4JA 1N9NA 2OOLA 4GD6A 1IKGA 4HI4A 3EGDC 1OTEA 3T1SA 2L1MA 4CLCC 3H7WA 1TF1A 3VP1A 3BYDA 4S2OA 2RCXA 2ZQDA 4Y15A 3RXWA 4Y17A 2XR0A 5HZHA 4HNBA 3FPWA 1DRMA 5GL9A 4X25A 4YFMA 5CECA 3T1QB 3BFCA 4WUJA 3T4OA 4EV4A 2A2LA 1NJ4A 1YAXA 4JGPA 4BBTA 4KENB 4B88A 4YOFA 3TJZC 1X0OA 1SKOB 3BEBA 1PIOA 3CITA 3IHBA 4HH3A 4QB8A 5EVLA 3IH9A 4P6ZS 3OLOA 4X53A 5E2GA 5DVAA 5FEGA 3HLEA 3WS1A 3C5AA 3NOPC 1TS8A 4OQ0A 3T1RA 1XJ2A 5HPIA 3HUNA 3HVFA 4M3KA 2QJ5A 4E3JA 5GHZA 3GQZA 4WLAA 4FUWA 1EW0A 3DAVA 3DTIA 3IBJA 5KSCA 3L9KA 5DF7A 3VP4A 4BMWA 4NG2A 4PHTA 2JHEA 5CHUA 1N9LA 4LENA 3F1PB 3LI8A 3UB7A 2HDUA 2O99A 1SZVA 4WBGA 1OPXA 2J8YA 1CI8A 5CEBA 4H6JB 3M2JA 1PYYA 3TE8A 1XKZA 1ZG4A 2XLNA 4HJ4A 4R1GA 1OTBA 2PR6A 1NRJA 3MBZA 1YLJA 5CGSA 5E2FA 1FQGA 3IXBA 1BZAA 4JKTA 3PTEA 3ZG9B 2ZOIA 1YMXA 2WUQA 4II7A 1W8QA 1ZC2A 1MC0A 5HL6A 1J9MA 1FR1A 2ZQ8A 3MFDA 3PBNA 2O9AA 4WMCA 3VMAA 5J7EA 2W3GA 3MQ0A 4UA6A 5EFWA 5HX9A 2XFSA 3W4OA 2KOIA 3OPLA 1S4RA 4P87A 4HOIA 2VGLS 3UNWA 4EWFA 5EUAA 3UPOA 2PYRA 2Z6DA 1UWNX 1S0WA 1YLTA 3BJNA 4QU3A 5C5KA 5DTKA 3CWFA 4MNRA 2WKHA 4U0TA 4E3OA 2C5WB 1NLZA 1L0GA 3QP5A 4Y3IA 1VETB 3PBTA 5FQMA 5TGFA 3G32A 2Y8HA 1K57C 5IHVA 2QYBA 1YPRA 4IEDA 3CMZA 1H8MA 1TS7A 2QKPA 1FCMA 3ZG5A 2ZC6B 4E3IA 2VX8A 2WAFA 4BJPA 4E6WA 1XFNA 2ZC3B 4KQOA 1BLSA 3HJIA 3N4IA 2JKRI 5DTTA 4MBKA 3IWIA 2BG1A 3NCKA 1LL8A 4F3LA 4UA7A 1FCOA 2O9CA 2VGKA 3ZDJA 4EEUA 5TJJA 2OAP1 1VEUB 4KQDA 1S1YA 2QHKA 3LIBA 3AGFA 3OCLA 3Q7ZA 4Q8IA 3LI9A 2HJEA 4O01A 1ES2A 2W3HA 2XA7S 4S2NA 3K3DA 5FQ9A 5A91A 1PNEA 2R9WA 3MXQA 4KUKA 5EPHA 4EBPA 4KUOA 4X1LA 3UB5P 3S7OA 3UPPA 2V1ZA 3VSLA 3MSHA 1YLYA 2PT7A 3MKFA 5CERA 2Z2MB 4JXWA 2WKQA 2OWJA 2HP9A 2O9BA 1SHVA 5F1GA 3ZHHA 4HP9A 5IS1A 4BD1A 3N8RA 2QPNA 3ZVTA 3FKWA 4X69A 2ZM8A 5FI6A 4HBTA 4NEED 4DDSA 4GLQA 3IWQA 3PBQA 1NY0A 5J3WA 3M2KA 2P9VA 2Y2LA 5FAPA 1XJ6A 1YMSA 1MZUA 4BENA 2JKRM 1K6SA 3HLWA 1W7FA 2Z6CA 1G28A 1MPLA 2HP6A 1LSVA 4XT2B 1E3UD 4R38A 4UQIS 1HTZA 3WWXA 2A24A 4CLCA 5I5LA 4QD4A 4I39A 3HJKA 3LR5A 4GD8A 3AGDA 2EXBA 3G2YA 4KZ8A 4N9LA 1YLPA 3VP2A 4K0WA 3ZGAB 1YM1A 4BQMA 4JF5A 3D4FA 1OT9A 1IOUA 4JBFA 5HFOA 4DE3A 1F5MA 4NXEA 1ESUA 1EWZA 4CLCE 2HV1A 2LB9A 1ERMA 1D1JA 4DRTA 1LL9A 3FG8A 3KYZA 1T1AA 1SDEA 3IX8A 4K0XA 3LEQA 4OOLA 1Y54A 1IEMA 4OPRA 4E6XA 3UE0A 4ETZA 2OSUA 2ZQCA 4HJ6A 1ESIA 5FI7A 2PBYA 1I2SA 1T19A 5AVFA 4P6BA 3LR4A 3IF6A 4EU0A 3JYIA 3Q7VA 4WELA 2JC7A 4KZ5A 3UDIA 3G34A 1ACFA 2VV7A 4RX3A 3EWKA 1OTAA 1G6AA 5E43A 2ZQAA 1O07A 5HAQA 3BLSA 5TR7A 1ERQA 3P98A 1K4FA 1D06A 3LO7A 3UDXA 2XGNA 3OPHA 3FKVA 4FD8A 3ULFA 3QP6A 4B4XA 5KMWA 1H5XA 2CC1A 2IA2A 1LSXA 5L07A 4PPRA 4YWZA 3UO9A 4HHDA 4HEFA 3EOIA 5K5BA 2W1TB 4Y0OA 3BLMA 2P04A 4D60A 1DP8A 3VFFA 4R23A 2DNSA 3JVUA 1XP4A 2H0TA 4E3MA 2JKTM 3C8CA 4HY8A 2HP5A 1IKIA 2XF3A 1PW8A 2GJ3A 4Y5FA 2OAQ1 1Z09A 3UY6A 1RP5A 2WADA 1LSWA 3T1XA 3NOUC 4DE2A 5AJGA 3D9YA 4DXBA 2VV8A 4GHIA 4DE0A 4OVDA 4Q0IA 1ONGA 4GB7A 1OT6A 1T1CA 4MN7A 5F5YA 4IHQA 4KZ7A 4PM6A 2DMWA 3HLCA 4GDNA 3BWLA 3R4KA 2C6WB 1KDWA 5CEDA 5M18A 3CG5A 1DJCA 3BM6A 2G2UA 2BLSA 2J9OA 1FSYA 3NDGA 5I94A 4RYEA 3UB8A 3LY4A 3MMHA 3LGOA 4PM9A 3B42A 2VJWA 3MZEA 1JWPA 1YQSA 3B3XA 3V39A 4E3LA 1YLZA 1G5UA 3IX3A 4O8GA 3UE1A 5J4EA 3W2ZA 4BBVA 1TDGA 2X71A 4XXRA 1L3LA 2LB5A 2PR5A 1D7EA 5HL1A 4MMNA 4BBUA 2HZ5A 3C7UA 2YKHA 3H82A 2QMIA 2JN7A 2W1RA 3NULA 2K2NA 2NUPC 4B4ZA 4KZ4A 3NI9A 1K56A 3ZQ5A 2W27A 1HVBA 5F6AA 2B95A 3GR2A 3UMEA 3QNCA 2V0WA 2Y2MA 5G18A 1TDLA 4DKIA 3N8LA 4X6TA 3C4PA 3A0VA 4GCZA 3V5MA 1GSWA 3IX4A 3BQAA 3LR0A 1CJFA 4AFIA 4Y7PA 3A3EA 4S2IA 1DP6A 2YKFA 4S2KA 4OLGA 4CJNA 4EETB 2ZMVA 1FOFA 3EGXC 2Y91A 1MY8A 1CEGA 2AVXA 4LFUA 1L2SA 1KVMA 5A92A 2WKIA 5HD5A 3LUQA 3UE6A 2Y2IA 1AXBA 1K0KA 2KX6A 2EX9A 4DN0A 3CPTA 4R0QA 3NC8A 4RX2A 1BLHA 1XGIA 3VP3A 1YT4A 4RA7A 2W0NA 1Y4OA 3IH8A 4MLLA 1BLCA 3S1YA 1BYWA 2VGLM 2HDSA 2R78A 3HLFA 3C7VA 4C75A 5L10A 1QMFA 4LCMA 3ZNTA 2A49A 2XROA 2W3DA 3KSFA 1K54A 3A3FA 2Y79A 3G6OA 3UE3A 1QMEA 2IWCA 1FCNA 4GZBA 2Y2PA 4K91A 1H8ZA 5E2HA 2E8IA 3SW1A 5EVEA 2DRWA 5GHYA 4QJGA 3EEHA 3QP4A 1RCJA 1TS0A 2FZ0A 5U47A 4KZBA 1JTDA 4DDYA 3KSIA 1VQQA 4ZJ3A 1S4SA 2Y2NA 3BW6A 5DF8A 3WS4A 2Y2OA 4KQQA 3W4PA 4DXCA 3G31A 3PXPA 5AVEA 4WYYA 3P09A 1OMEA 2EFUA 3NIAA 4UA9A 1ZTUA 5CTNA 2ZJ9A 3WS0A 2OWHA 3LIFA 3TW8A 4FCFA 5L8MA 4OP8A 2PHYA 1TD5A 4I3IA 4WZ4A 3HLDA 4S2JA 2B18A 2ZMAA 3HLBA 4IJGA 4NK3A 1KGFA 4P85A 5CGWA 4PMAA 2XFTA 2EFXA 4EESA 1DP9A 3BECA 4GHIB 4IUHA 2M1CA 4MCWA 3HUMA 4ARZA 3ZNYA 2X01A 4JXSA 4EBLA 4KZAA 2EX2A 2M7UA 4L9FA 2XDMA 2V8FA 3MZDA 2BASA 4XUXA 4GNUA 4B93A 4I3AA 3LY3A 1GA9A 1P0ZA 3S7QA 4LV2A 5CRFA 3GTCA 1MKMA 4WZ5C 5HAIA 3P01A 1MBLA 3C4OA 3GSGA 4MN5A 1T18A 3LYXA 4I5SA 4X55A 3N8SA 5AQ9A 2P74A 3PHYA 2HF6A 1TEMA 5HWVA 3FWLA 4WF0A 5FATA 4LRYC 1XA7A 1YSQA 2XH9A 5LBRA 5HARA 1OJ5A 3F1PA 4IUKA 1XPBA 5TBMA 5G4ZA 2V20A 4PAUA 4LV3A 2IWBA 5KIZA 4CPKA 4WM9A 3S7PA 3B33A 1H8YA 1OTDA 2JE5A 5CTMA 2J3WA 2ACGA 3HBRA 5M1AA 3FYZA 4BLMA 1VM1A 3E98A 1SDNA 4PM8A 1FSWA 3O3VA 1W5DA 3MXRA 2VGJA 4LRZE 5F82A 1BTLA 2B5RA 1K54C 5CGXA 2XD5A 2J7VA 4O0PA 2K7SA 5D3OA 4R4RA 2J80A 1T1BA 3V50A 4F3LB 4UHUA 3M6BA 4S2PA 1FIKA 2DCFA 1VETA 1KGGA 2WGIA 4LLOB 3A3IA 2GZAA 5HWWA 2J9PA 1OJGA 5FSRA 3LIDA 2PAVP 1KE3A 4JXVA 3E4PA 5AQ7A 2ZMFA 1WYCA 1VB6A 2Q9NA 4WN5A 4A5RA 3MJQA 4D2OA 2ZQ7A 2GNXA 3L7HA 3G4PA 1KGEA 4XT2A 4JGOA 1K6RA 3FPVA 1XA1A 3E2KA 2ZM0A 3NY4A 3SS5A 2Y2KA 5DTSA 2ZC7A 5F1FA 1IELA 1LL5A 4Q0HA 4L9GA 1JNUA 3LIEA 3PBSA 5G4YA 2L4RA 1K55C 2EWVA 1K56D 1MKIA 1RGZA 2VEAA 3MR0A 4N1HA 3BFEA 1E25A 2Y4AA 4EERA 3F1NA 4ID4A 2HPBA 2VZWA 3GDIA 3WRZA 4KZ9A 2Y2JA 5EV0A 5CXWA 3IF6C 3A0SA 1UGUA 3ZYTA 1J3WA 3LCEA 2D02A 2J3TC 5FA7A 3OC2A 5FAOA 2OLUA 2VLGA 3MQQA 3E4OA 2K31A 4I3JA 3O86A 3BY9A 3S4XA 5EOEA 3C30A 1Z6FA 3UN7A 1VEUA 3SH8A 3D3OA 4LRXC 4OH0A 4Y2FA 2I9VA 1YKDA 1TS6A 5F69A 5HD3A 2Y55A 4GW9A 4JF6A 3S7NA 3ZCZA 1LT0A 5A8BA 1K57A 3R7WA 4KQRA 3NOTC 3ZFZA 1C3BA 4WEJA 3SH7A 3NECA 4U3TA 4DJ2A 1TVFA 4JXGA 1GHPA 3IXDA 2P7JA 4OOMA 4GJ4A 3IS2A 5GHXA 3BFGA 1U60A 4FSFA 2UWXA 3ZG8B 1P9WA 4MN6A 2PU4A 1GCEA 3T4SA 5AQAA 4UQIM 2PU2A 2MJ6A 4QPRA 1JWVA 4O7DA 4FOFA 2INWA 2HDRA 1BSGA 4BWIA 3I7JA 2FH5A 2XEPA 3A3DA 1MWTA 4G3WA 3OZHA 2EA9A 1K38A 3T4TA 3MFXA 5FL3A 1XJ4A 2O0YA 2ZM2A 1NYMA 3SS4A 5HPFA 2V8CA 4LGWA 2HJ9C 2XQZA 1MWSA 2JKGA 1GHMA 3LICA 2XD1A 1E4DA 2ZLYA 2Q9MA 5GLAA 5CX7A 3PBRA 5AQBA 1KE0A 5IU1A 5TBMB 3OPPA 4HBUA 3G35A 4E3KA 1CI9A 1M6KA 3IBRA 1LI0A 3UB6A 3CUEA 5DF9A 5HDSA 3RH8B 5DJTA 5HDCA 1Y28A 5FQIA 1WE4A 3GVBA 4K08A 4JLFA 2H5SA 4N1XA 3QNBA 4KG5A 4GKUA 1ES4A 1GSVA 2H10A 4RVAA 3Q82A 4MEZA 5MC7A 5DJUA 4DJ3A 4X56A 4KG6A 4NETA 4OQGA 4C6YA 5J8XA 1I5QA 3CLOA 4PM5A 5IT5A 3CPTB 3P7NA 1IYSA 1S67L 1W79A 4Y13A 2EX8A 1XGJA 1KVLA 5DFXA 3RFBA 4LPZA 1NWZA 4KZ6A 5M19A 1JVJA 3U2AA 1L0FA 3Q07A 4OPYA 2Y2QA 1W63Q 4Y0TA 4BD0A 2IWDA 3DTEA 1S6RA 1PI4A 3OCNA 2PD8A 1M40A 3KSGA 3FZCA 1G68A 1PZOA 3PAGA 1OTIA 4WL9A 4JGRA 4HJ3A 1EROA 3ZG7B 4P6ZM 1ONHA 3R7WB 4S2MA 5EM1A 1NZOA 4HIAA 3O88A 1N4OA 3UPNA 3IF5A 1W8YA 1SKFA 3OBFA 2HDQA 4EQIA 4RQ9A 5E2EA 4EQ1A 4P0MA 1DY6A 3T50A 4UAAA 1ODVA 4Z1WA 3SS3A 2W3EA 2D01A 2QJ7A 1N9BA 1PWDA 3IXGA 3N7WA 4EW7A 3PR6A 1BULA 4QHCA 2X02A 2V0UA 4NXBA 4XUZA 4HQAA 3U4LP 3DWKA 1S1ZA 2JKFA 2WKRA 1GSXA 5A93A 3FC7A 1IYQA 4GOGA 3RJUA 3D72A 3WRTA 5EECA 4OOYA 3DBAA 1STZA 2W1TA 3T12B 1NRFA 1PWGA 4ZRRA 3GECA 2J3TD 2QZ6A 2JKTI 3IXHA 1ZHHB 1FILA 2NUTC 1V9YA 4JPMA 3ZG0A 3T4QA 4R70A 1H0MA 4IBRA 4LV0A 3E4QA 5FDSA 2RL3A 3KSHA 4QWOA 3WS2A 1HD8A 3SZTA 4OONA 2FFFB 2ZL1A 2M7VA 5EOOA 2Y2GA 1PI5A 3BQ8A 2B02A 2VA0A 3C38A 4GS9B 5DFYA 2WKPA 4IVIA 4FH4A 2FFYA 3KYEA 3OOVA 1KE4A 1PW1A 1LHYA 3A0RA 1PWCA 4YINA 5A90A 2ZBBA 4NXFA 3VSKA 3JPUA 1MWUA 1XX2A 2Y2HA 1MXOA 2PBDP 3ITAA 5DKKA 4HESA 4ZJ1A 1YLWA 4BL3A 3A3JA 1JWZA 3G30A 4HP4A 4N9KA 5F83A 3HCYA 4ARZB 4WMCD 3MQOA 3MZFA 3O87A 1GHIA 3IWOA 1F9IA 1Q2QA 3RTYA 2WZZA 3BFFA 2WAEA 4CLCB 5EM0A 2H0YA 2KLIA 4NKPA 3VE4A 1GA0A 1FR6A 3NHQA 1BT5A 3B47A 3UB9A 2I72A 1ALQA 1SCWA 4DMZA 1KOUA 1PZPA 4FH2A 3V67A 3IF6B 2EWWA 4L0LA 1L0EA 4EUVA 3LIAA 1P9RA 1IFQA 5FAQA 4CLCD 5L2FA 2CMNA 4OQHA 5JYPA
chains in the Genus database with same CATH topology
5DF7A 3SH9A 3VP4A 4EBNA 4DE0A 4OVDA 4IBXA 3SOIA 2ZD8A 2EX6A 1K56D 5CHUA 1CEFA 3M6HA 1ONGA 1MKIA 1RGZA 4LENA 4ZAMA 4GB7A 4N1HA 3BFEA 2HDUA 1E25A 4KZ7A 2ZC4B 2Y4AA 4WBGA 3RXXA 3HUOA 3Q1FA 4PM6A 3TG9A 2J8YA 3HLCA 4GDNA 2C6WB 4ID4A 2HPBA 1KDWA 3WRZA 1CI8A 5CEDA 5BOHA 5CEBA 4OQIA 1NYYA 4KZ9A 2Y2JA 1ZKJA 5M18A 5CHMA 3CG5A 1DJCA 5CXWA 3M2JA 3BM6A 2G2UA 1PYYA 3IF6C 2BLSA 2J9OA 1FSYA 3CJMA 3NDGA 5I94A 1XKZA 1ZG4A 2XLNA 1JTGA 5TFQA 4RYEA 4R1GA 3LY4A 2G2WA 3LCEA 5FA7A 4EUZA 4PM9A 1DJAA 5HW3A 3OC2A 3MBZA 5FAOA 2OLUA 1YLJA 5CGSA 1IYOA 4OPQA 5E2FA 5HAPA 5CHJA 1FQGA 3IXBA 1JWPA 3MZEA 1BZAA 3TSGA 1YQSA 3O86A 3NDEA 3S4XA 4F94A 1ES5A 5EOEA 4JKTA 3B3XA 3V39A 3PTEA 4OKPA 3ZG9B 1YMXA 2WUQA 4E3LA 1Z6FA 1W8QA 1YLZA 1ZC2A 3PAEA 4MBHA 3UN7A 3UE1A 1J9MA 2ZQ8A 1FR1A 5GLCA 4ZTKA 1EI5A 3SH8A 3GMWA 1ZG6A 3MFDA 4WZ5A 3PBNA 1TDGA 2X71A 4OH0A 4XXRA 5GLDA 4WMCA 2Y55A 2Y59A 3ISGA 4JF6A 5HL1A 3VMAA 3C7UA 4UA6A 3ZCZA 5HX9A 3W4QA 2XFSA 2QMIA 1K57A 3W4OA 3OPLA 4KQRA 4P87A 3W8KA 3ZFZA 1C3BA 4WEJA 4B4ZA 4KZ4A 3NI9A 3SH7A 3UDFA 4U3TA 1K56A 3UNWA 5FQKA 4EWFA 5EUAA 4BL2A 3UPOA 1HVBA 1TVFA 3VP0A 1S0WA 4DF6A 1YLTA 3GR2A 4QU3A 3DW0A 4JXGA 3QNCA 1GHPA 2R9XA 2Y2MA 3IXDA 1K55A 4ZDXA 2OLVA 4QY6A 5DTKA 4OOMA 5G18A 4OPZA 1TDLA 4DKIA 5GHXA 3N8LA 4MNRA 2WKHA 4ZJ2A 4U0TA 4X6TA 4E3OA 3BFGA 3C4PA 3V5MA 1U60A 4FSFA 2C5WB 2UWXA 4WEKA 3ZG8B 1L0GA 3QHYA 2PU4A 5FDHA 3PBTA 5FQMA 4Y7PA 5TGFA 2OV5A 1RGYA 1K4EA 3A3EA 4S2IA 1GCEA 3G32A 5AQAA 1CK3A 4S2KA 4OLGA 4CJNA 2PU2A 1K57C 1NZUA 2EXAA 5IHVA 1FOFA 2Y91A 4IEDA 1MY8A 1CEGA 3CMZA 5EE8A 3GV9A 4QY5A 2WGVA 1L2SA 1JWVA 1KVMA 4O7DA 3BRMA 4N92A 1KDSA 3WS5A 1FCMA 5A92A 3ZG5A 2ZC5B 2GDNA 2JCHA 3VFHA 2ZC6B 2HDRA 1BSGA 4E3IA 2WAFA 4R4SA 2WKIA 5EVIC 3I7JA 2Y2IA 1AXBA 2XEPA 4BJPA 4E6WA 3A3DA 2ZC3B 1MWTA 5EVID 4KQOA 4E3NA 1BLSA 3EQVA 3MXSA 3OZHA 3N4IA 3PBOA 2EX9A 5EVIA 1K38A 3MKEA 4R0QA 3NC8A 5DTTA 4RX2A 4MBKA 1BLHA 1XGIA 3IWIA 2BG1A 3NCKA 2ZM2A 1NYMA 3SS4A 4UA7A 3VP3A 1YT4A 5JYOA 1FCOA 3HL9A 4RA7A 2VGKA 1WYBA 3ZDJA 2XQZA 5KSHA 3IH8A 4MLLA 2ZQ9A 1MWSA 1GHMA 4GN2A 4JF4A 2XD1A 1BLCA 1IYPA 3S1YA 1E4DA 2HDSA 3HLFA 2ZLYA 3N6IA 2Q9MA 5GLAA 3HLGA 1BLPA 3AGFA 3C7VA 3PBRA 3OCLA 4C75A 5AQBA 1KE0A 1QMFA 3Q7ZA 4Q8IA 1HZOA 4LCMA 3ZNTA 5EVIB 2A49A 3OPPA 4HBUA 3G35A 4E3KA 1CI9A 1K54A 3A3FA 2WGWA 5FI2A 1ES2A 1M6KA 2WGWB 1LI0A 3LEZA 5DF9A 4S2NA 3G2ZA 5FQ9A 5A91A 2R9WA 3UE3A 3Q7VB 5FQIA 5EPHA 1QMEA 1WE4A 3GVBA 4JLFA 2H5SA 2IWCA 4KG2A 4N1XA 2XK1A 5GLBA 3QNBA 4EBPA 4LCLA 1FCNA 4KG5A 4GKUA 4S2NC 1ES4A 2H10A 3UPPA 4RVAA 4GZBA 2V1ZA 2Y2PA 4R3JA 3VSLA 3GRJA 3ZVWA 4K91A 1H8ZA 5E2HA 2E8IA 3Q82A 4MEZA 3DWZA 5FASA 4X56A 4KG6A 2DRWA 1YLYA 2WZXA 4KZ3A 4NETA 4OQGA 3MKFA 4C6YA 5GHYA 5CERA 4QJGA 5J8XA 2Z2MB 1I2WA 3E2LA 4JXWA 1I5QA 1RCJA 2HP9A 5U47A 5F1GA 1SHVA 4KZBA 1JTDA 4DDYA 4PM5A 3ZHHA 1VQQA 4IVKA 4ZJ3A 4BD1A 2Y2NA 3N8RA 5DF8A 3WS4A 2QPNA 3ZVTA 3FKWA 1IYSA 2Y2OA 1DJBA 1W79A 4KQQA 2ZM8A 4X69A 5FI6A 2EX8A 4HBTA 1XGJA 4X68A 3G31A 3W4PA 4DXCA 4WYYA 4DDSA 3P09A 1OMEA 2EFUA 1KVLA 3NIAA 4PM7A 4UA9A 3IWQA 4KZ6A 3PBQA 5M19A 4C3QA 5CTNA 1JVJA 2ZJ9A 1NY0A 3WS0A 4DE1A 1L0FA 3Q07A 2WK0A 4OPYA 4ZBEA 5KZHA 2Y2QA 4Y0TA 4FCFA 3BFDA 2IWDA 2P9VA 1S6RA 2Y2LA 3M2KA 1PI4A 5FAPA 4BD0A 3OCNA 1YMSA 4OP8A 3V3SA 2A3UA 4BENA 5FQJA 1K6SA 1M40A 3FZCA 4WZ4A 3HLWA 1G68A 1W7FA 4MBFA 1PZOA 3HLDA 3PAGA 4R3BA 3IHAA 4S2JA 1MPLA 1EROA 2HP6A 3ZG7B 3HREA 2ZMAA 3HLBA 4P85A 4NK3A 1KGFA 5CGWA 1ONHA 4S2MA 1E3UD 4LV1A 4PMAA 2XFTA 2EFXA 3AGEA 1HTZA 1NZOA 3O88A 1N4OA 3UPNA 3WWXA 2V2FF 3IF5A 1W8YA 1SKFA 4QD4A 3BECA 3FV7A 3IT9A 2HDQA 3OPRA 4EQIA 3HUMA 5E2EA 5FQQA 3ZNYA 4P0MA 1DY6A 2X01A 4JXSA 4EBLA 4UAAA 3IQAA 4GD8A 4KZAA 2EX2A 4Y0UA 3AGDA 3SS3A 1K25A 2XDMA 3MZDA 1E3UA 1Q2PA 2EXBA 3G2YA 4U0XA 4KZ8A 1BUEA 4N9LA 1N9BA 1PWDA 1YLPA 4GDBA 3IXGA 3NBLA 4GNUA 2Z2LB 4XUXA 3VP2A 3N7WA 4K0WA 3ZGAB 3LY3A 1LLBA 1YM1A 1BULA 3ITBA 1GA9A 4OP5A 3VOZA 4BQMA 4JF5A 4QHCA 4LV2A 2X02A 5CRFA 3GTCA 3D4FA 4WZ5C 5HAIA 4XUZA 1MBLA 3C4OA 3GSGA 3DWKA 4JBFA 3CZDA 5HFOA 4DE3A 1XXMA 2WKEA 3Q81A 5A93A 1IYQA 4GOGA 2P9VB 3N8SA 4X55A 5AQ9A 2P74A 1ESUA 3RJUA 1EWZA 3WRTA 1TEMA 5EECA 3FWLA 5FATA 4OOYA 2JBFA 1ERMA 3V3RA 1ES3A 1NXYA 4S2LA 4DRTA 1NRFA 1PWGA 1XA7A 2XH9A 5HARA 1L0DA 1LL9A 2QZ6A 4OLDA 1O7EA 3IXHA 1SDEA 4K0XA 1XPBA 4OOLA 3VOYA 4JPMA 1Y54A 1IEMA 4OPRA 2V20A 3ZG0A 4LV3A 2IWBA 1LI9A 4H8RA 4CPKA 4IBRA 4WM9A 3UE0A 4E6XA 2OSUA 4LV0A 2ZQCA 1ESIA 5FI7A 1H8YA 3EQUA 1MWRA 4Z9QA 2JE5A 3DTMA 2RL3A 5CTMA 3S22A 2PBYA 1I2SA 2WYXA 3HBRA 3WS2A 1HD8A 5M1AA 3FYZA 4P6BA 4BLMA 4OONA 2FFFB 3TOIA 5EOOA 3IF6A 1VM1A 4GD6A 1IKGA 2Y2GA 1SDNA 3JYIA 1PI5A 3Q7VA 4WELA 4PM8A 2JC7A 1FSWA 4KZ5A 3UDIA 3O3VA 1W5DA 3G34A 4RX3A 3MXRA 2VGJA 3VP1A 3BYDA 5F82A 1BTLA 1G6AA 2RCXA 2B5RA 4S2OA 1K54C 5CGXA 2XD5A 2ZQDA 4IVIA 4FH4A 2FFYA 5E43A 3RXWA 2J7VA 1KE4A 2ZQAA 1PW1A 2XR0A 1LHYA 1O07A 5HAQA 3BLSA 5TR7A 1ERQA 1PWCA 4YINA 5GL9A 5D3OA 5A90A 3P98A 1K4FA 4R4RA 3V50A 4YFMA 4UHUA 3LO7A 3M6BA 4S2PA 3UDXA 3VSKA 2XGNA 2DCFA 3OPHA 1MWUA 5CECA 3FKVA 4FD8A 1XX2A 3BFCA 1KGGA 2Y2HA 4B4XA 1MXOA 5KMWA 2WGIA 3ITAA 1H5XA 2CC1A 4HESA 4EV4A 4ZJ1A 1YLWA 1NJ4A 4BL3A 3A3IA 3A3JA 1JWZA 3G30A 4PPRA 2J9PA 5FSRA 3UO9A 1KE3A 4HEFA 4JXVA 4N9KA 5F83A 4WMCD 5AQ7A 4KENB 4B88A 1WYCA 3MZFA 3O87A 4Y0OA 1GHIA 3BLMA 3BEBA 3IWOA 1PIOA 1Q2QA 2Q9NA 2WZZA 3BFFA 2WAEA 3IHBA 2H0YA 4A5RA 4QB8A 5EVLA 3VFFA 4D2OA 2ZQ7A 3IH9A 4X53A 3G4PA 1KGEA 5E2GA 5DVAA 1GA0A 1K6RA 1FR6A 2DNSA 4R23A 1BT5A 1XA1A 2I72A 3E2KA 3HLEA 2ZM0A 1XP4A 3WS1A 3C5AA 2H0TA 1ALQA 1SCWA 3NY4A 4OQ0A 1PZPA 3SS5A 4FH2A 4E3MA 2Y2KA 3HUNA 3IF6B 2HP5A 1IKIA 5DTSA 2ZC7A 5F1FA 1IELA 2XF3A 1PW8A 4L0LA 1LL5A 3HVFA 4M3KA 3UY6A 4E3JA 2WADA 1RP5A 5GHZA 5JYPA 1L0EA 3PBSA 5FAQA 3GQZA 4DE2A 5L2FA 4OQHA 4DXBA 5KSCA 1K55C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DF7 A;  3SH9 A;  3VP4 A;  4EBN A;  4DE0 A;  4OVD A;  4IBX A;  3SOI A;  2ZD8 A;  2EX6 A;  1K56 D;  5CHU A;  1CEF A;  3M6H A;  1ONG A;  1MKI A;  1RGZ A;  4LEN A;  4ZAM A;  4GB7 A;  4N1H A;  3BFE A;  2HDU A;  1E25 A;  4KZ7 A;  2ZC4 B;  2Y4A A;  4WBG A;  3RXX A;  3HUO A;  3Q1F A;  4PM6 A;  3TG9 A;  2J8Y A;  3HLC A;  4GDN A;  2C6W B;  4ID4 A;  2HPB A;  1KDW A;  3WRZ A;  1CI8 A;  5CED A;  5BOH A;  5CEB A;  4OQI A;  1NYY A;  4KZ9 A;  2Y2J A;  1ZKJ A;  5M18 A;  5CHM A;  3CG5 A;  1DJC A;  5CXW A;  3M2J A;  3BM6 A;  2G2U A;  1PYY A;  3IF6 C;  2BLS A;  2J9O A;  1FSY A;  3CJM A;  3NDG A;  5I94 A;  1XKZ A;  1ZG4 A;  2XLN A;  1JTG A;  5TFQ A;  4RYE A;  4R1G A;  3LY4 A;  2G2W A;  3LCE A;  5FA7 A;  4EUZ A;  4PM9 A;  1DJA A;  5HW3 A;  3OC2 A;  3MBZ A;  5FAO A;  2OLU A;  1YLJ A;  5CGS A;  1IYO A;  4OPQ A;  5E2F A;  5HAP A;  5CHJ A;  1FQG A;  3IXB A;  1JWP A;  3MZE A;  1BZA A;  3TSG A;  1YQS A;  3O86 A;  3NDE A;  3S4X A;  4F94 A;  1ES5 A;  5EOE A;  4JKT A;  3B3X A;  3V39 A;  3PTE A;  4OKP A;  3ZG9 B;  1YMX A;  2WUQ A;  4E3L A;  1Z6F A;  1W8Q A;  1YLZ A;  1ZC2 A;  3PAE A;  4MBH A;  3UN7 A;  3UE1 A;  1J9M A;  2ZQ8 A;  1FR1 A;  5GLC A;  4ZTK A;  1EI5 A;  3SH8 A;  3GMW A;  1ZG6 A;  3MFD A;  4WZ5 A;  3PBN A;  1TDG A;  2X71 A;  4OH0 A;  4XXR A;  5GLD A;  4WMC A;  2Y55 A;  2Y59 A;  3ISG A;  4JF6 A;  5HL1 A;  3VMA A;  3C7U A;  4UA6 A;  3ZCZ A;  5HX9 A;  3W4Q A;  2XFS A;  2QMI A;  1K57 A;  3W4O A;  3OPL A;  4KQR A;  4P87 A;  3W8K A;  3ZFZ A;  1C3B A;  4WEJ A;  4B4Z A;  4KZ4 A;  3NI9 A;  3SH7 A;  3UDF A;  4U3T A;  1K56 A;  3UNW A;  5FQK A;  4EWF A;  5EUA A;  4BL2 A;  3UPO A;  1HVB A;  1TVF A;  3VP0 A;  1S0W A;  4DF6 A;  1YLT A;  3GR2 A;  4QU3 A;  3DW0 A;  4JXG A;  3QNC A;  1GHP A;  2R9X A;  2Y2M A;  3IXD A;  1K55 A;  4ZDX A;  2OLV A;  4QY6 A;  5DTK A;  4OOM A;  5G18 A;  4OPZ A;  1TDL A;  4DKI A;  5GHX A;  3N8L A;  4MNR A;  2WKH A;  4ZJ2 A;  4U0T A;  4X6T A;  4E3O A;  3BFG A;  3C4P A;  3V5M A;  1U60 A;  4FSF A;  2C5W B;  2UWX A;  4WEK A;  3ZG8 B;  1L0G A;  3QHY A;  2PU4 A;  5FDH A;  3PBT A;  5FQM A;  4Y7P A;  5TGF A;  2OV5 A;  1RGY A;  1K4E A;  3A3E A;  4S2I A;  1GCE A;  3G32 A;  5AQA A;  1CK3 A;  4S2K A;  4OLG A;  4CJN A;  2PU2 A;  1K57 C;  1NZU A;  2EXA A;  5IHV A;  1FOF A;  2Y91 A;  4IED A;  1MY8 A;  1CEG A;  3CMZ A;  5EE8 A;  3GV9 A;  4QY5 A;  2WGV A;  1L2S A;  1JWV A;  1KVM A;  4O7D A;  3BRM A;  4N92 A;  1KDS A;  3WS5 A;  1FCM A;  5A92 A;  3ZG5 A;  2ZC5 B;  2GDN A;  2JCH A;  3VFH A;  2ZC6 B;  2HDR A;  1BSG A;  4E3I A;  2WAF A;  4R4S A;  2WKI A;  5EVI C;  3I7J A;  2Y2I A;  1AXB A;  2XEP A;  4BJP A;  4E6W A;  3A3D A;  2ZC3 B;  1MWT A;  5EVI D;  4KQO A;  4E3N A;  1BLS A;  3EQV A;  3MXS A;  3OZH A;  3N4I A;  3PBO A;  2EX9 A;  5EVI A;  1K38 A;  3MKE A;  4R0Q A;  3NC8 A;  5DTT A;  4RX2 A;  4MBK A;  1BLH A;  1XGI A;  3IWI A;  2BG1 A;  3NCK A;  2ZM2 A;  1NYM A;  3SS4 A;  4UA7 A;  3VP3 A;  1YT4 A;  5JYO A;  1FCO A;  3HL9 A;  4RA7 A;  2VGK A;  1WYB A;  3ZDJ A;  2XQZ A;  5KSH A;  3IH8 A;  4MLL A;  2ZQ9 A;  1MWS A;  1GHM A;  4GN2 A;  4JF4 A;  2XD1 A;  1BLC A;  1IYP A;  3S1Y A;  1E4D A;  2HDS A;  3HLF A;  2ZLY A;  3N6I A;  2Q9M A;  5GLA A;  3HLG A;  1BLP A;  3AGF A;  3C7V A;  3PBR A;  3OCL A;  4C75 A;  5AQB A;  1KE0 A;  1QMF A;  3Q7Z A;  4Q8I A;  1HZO A;  4LCM A;  3ZNT A;  5EVI B;  2A49 A;  3OPP A;  4HBU A;  3G35 A;  4E3K A;  1CI9 A;  1K54 A;  3A3F A;  2WGW A;  5FI2 A;  1ES2 A;  1M6K A;  2WGW B;  1LI0 A;  3LEZ A;  5DF9 A;  4S2N A;  3G2Z A;  5FQ9 A;  5A91 A;  2R9W A;  3UE3 A;  3Q7V B;  5FQI A;  5EPH A;  1QME A;  1WE4 A;  3GVB A;  4JLF A;  2H5S A;  2IWC A;  4KG2 A;  4N1X A;  2XK1 A;  5GLB A;  3QNB A;  4EBP A;  4LCL A;  1FCN A;  4KG5 A;  4GKU A;  4S2N C;  1ES4 A;  2H10 A;  3UPP A;  4RVA A;  4GZB A;  2V1Z A;  2Y2P A;  4R3J A;  3VSL A;  3GRJ A;  3ZVW A;  4K91 A;  1H8Z A;  5E2H A;  2E8I A;  3Q82 A;  4MEZ A;  3DWZ A;  5FAS A;  4X56 A;  4KG6 A;  2DRW A;  1YLY A;  2WZX A;  4KZ3 A;  4NET A;  4OQG A;  3MKF A;  4C6Y A;  5GHY A;  5CER A;  4QJG A;  5J8X A;  2Z2M B;  1I2W A;  3E2L A;  4JXW A;  1I5Q A;  1RCJ A;  2HP9 A;  5U47 A;  5F1G A;  1SHV A;  4KZB A;  1JTD A;  4DDY A;  4PM5 A;  3ZHH A;  1VQQ A;  4IVK A;  4ZJ3 A;  4BD1 A;  2Y2N A;  3N8R A;  5DF8 A;  3WS4 A;  2QPN A;  3ZVT A;  3FKW A;  1IYS A;  2Y2O A;  1DJB A;  1W79 A;  4KQQ A;  2ZM8 A;  4X69 A;  5FI6 A;  2EX8 A;  4HBT A;  1XGJ A;  4X68 A;  3G31 A;  3W4P A;  4DXC A;  4WYY A;  4DDS A;  3P09 A;  1OME A;  2EFU A;  1KVL A;  3NIA A;  4PM7 A;  4UA9 A;  3IWQ A;  4KZ6 A;  3PBQ A;  5M19 A;  4C3Q A;  5CTN A;  1JVJ A;  2ZJ9 A;  1NY0 A;  3WS0 A;  4DE1 A;  1L0F A;  3Q07 A;  2WK0 A;  4OPY A;  4ZBE A;  5KZH A;  2Y2Q A;  4Y0T A;  4FCF A;  3BFD A;  2IWD A;  2P9V A;  1S6R A;  2Y2L A;  3M2K A;  1PI4 A;  5FAP A;  4BD0 A;  3OCN A;  1YMS A;  4OP8 A;  3V3S A;  2A3U A;  4BEN A;  5FQJ A;  1K6S A;  1M40 A;  3FZC A;  4WZ4 A;  3HLW A;  1G68 A;  1W7F A;  4MBF A;  1PZO A;  3HLD A;  3PAG A;  4R3B A;  3IHA A;  4S2J A;  1MPL A;  1ERO A;  2HP6 A;  3ZG7 B;  3HRE A;  2ZMA A;  3HLB A;  4P85 A;  4NK3 A;  1KGF A;  5CGW A;  1ONH A;  4S2M A;  1E3U D;  4LV1 A;  4PMA A;  2XFT A;  2EFX A;  3AGE A;  1HTZ A;  1NZO A;  3O88 A;  1N4O A;  3UPN A;  3WWX A;  2V2F F;  3IF5 A;  1W8Y A;  1SKF A;  4QD4 A;  3BEC A;  3FV7 A;  3IT9 A;  2HDQ A;  3OPR A;  4EQI A;  3HUM A;  5E2E A;  5FQQ A;  3ZNY A;  4P0M A;  1DY6 A;  2X01 A;  4JXS A;  4EBL A;  4UAA A;  3IQA A;  4GD8 A;  4KZA A;  2EX2 A;  4Y0U A;  3AGD A;  3SS3 A;  1K25 A;  2XDM A;  3MZD A;  1E3U A;  1Q2P A;  2EXB A;  3G2Y A;  4U0X A;  4KZ8 A;  1BUE A;  4N9L A;  1N9B A;  1PWD A;  1YLP A;  4GDB A;  3IXG A;  3NBL A;  4GNU A;  2Z2L B;  4XUX A;  3VP2 A;  3N7W A;  4K0W A;  3ZGA B;  3LY3 A;  1LLB A;  1YM1 A;  1BUL A;  3ITB A;  1GA9 A;  4OP5 A;  3VOZ A;  4BQM A;  4JF5 A;  4QHC A;  4LV2 A;  2X02 A;  5CRF A;  3GTC A;  3D4F A;  4WZ5 C;  5HAI A;  4XUZ A;  1MBL A;  3C4O A;  3GSG A;  3DWK A;  4JBF A;  3CZD A;  5HFO A;  4DE3 A;  1XXM A;  2WKE A;  3Q81 A;  5A93 A;  1IYQ A;  4GOG A;  2P9V B;  3N8S A;  4X55 A;  5AQ9 A;  2P74 A;  1ESU A;  3RJU A;  1EWZ A;  3WRT A;  1TEM A;  5EEC A;  3FWL A;  5FAT A;  4OOY A;  2JBF A;  1ERM A;  3V3R A;  1ES3 A;  1NXY A;  4S2L A;  4DRT A;  1NRF A;  1PWG A;  1XA7 A;  2XH9 A;  5HAR A;  1L0D A;  1LL9 A;  2QZ6 A;  4OLD A;  1O7E A;  3IXH A;  1SDE A;  4K0X A;  1XPB A;  4OOL A;  3VOY A;  4JPM A;  1Y54 A;  1IEM A;  4OPR A;  2V20 A;  3ZG0 A;  4LV3 A;  2IWB A;  1LI9 A;  4H8R A;  4CPK A;  4IBR A;  4WM9 A;  3UE0 A;  4E6X A;  2OSU A;  4LV0 A;  2ZQC A;  1ESI A;  5FI7 A;  1H8Y A;  3EQU A;  1MWR A;  4Z9Q A;  2JE5 A;  3DTM A;  2RL3 A;  5CTM A;  3S22 A;  2PBY A;  1I2S A;  2WYX A;  3HBR A;  3WS2 A;  1HD8 A;  5M1A A;  3FYZ A;  4P6B A;  4BLM A;  4OON A;  2FFF B;  3TOI A;  5EOO A;  3IF6 A;  1VM1 A;  4GD6 A;  1IKG A;  2Y2G A;  1SDN A;  3JYI A;  1PI5 A;  3Q7V A;  4WEL A;  4PM8 A;  2JC7 A;  1FSW A;  4KZ5 A;  3UDI A;  3O3V A;  1W5D A;  3G34 A;  4RX3 A;  3MXR A;  2VGJ A;  3VP1 A;  3BYD A;  5F82 A;  1BTL A;  1G6A A;  2RCX A;  2B5R A;  4S2O A;  1K54 C;  5CGX A;  2XD5 A;  2ZQD A;  4IVI A;  4FH4 A;  2FFY A;  5E43 A;  3RXW A;  2J7V A;  1KE4 A;  2ZQA A;  1PW1 A;  2XR0 A;  1LHY A;  1O07 A;  5HAQ A;  3BLS A;  5TR7 A;  1ERQ A;  1PWC A;  4YIN A;  5GL9 A;  5D3O A;  5A90 A;  3P98 A;  1K4F A;  4R4R A;  3V50 A;  4YFM A;  4UHU A;  3LO7 A;  3M6B A;  4S2P A;  3UDX A;  3VSK A;  2XGN A;  2DCF A;  3OPH A;  1MWU A;  5CEC A;  3FKV A;  4FD8 A;  1XX2 A;  3BFC A;  1KGG A;  2Y2H A;  4B4X A;  1MXO A;  5KMW A;  2WGI A;  3ITA A;  1H5X A;  2CC1 A;  4HES A;  4EV4 A;  4ZJ1 A;  1YLW A;  1NJ4 A;  4BL3 A;  3A3I A;  3A3J A;  1JWZ A;  3G30 A;  4PPR A;  2J9P A;  5FSR A;  3UO9 A;  1KE3 A;  4HEF A;  4JXV A;  4N9K A;  5F83 A;  4WMC D;  5AQ7 A;  4KEN B;  4B88 A;  1WYC A;  3MZF A;  3O87 A;  4Y0O A;  1GHI A;  3BLM A;  3BEB A;  3IWO A;  1PIO A;  1Q2Q A;  2Q9N A;  2WZZ A;  3BFF A;  2WAE A;  3IHB A;  2H0Y A;  4A5R A;  4QB8 A;  5EVL A;  3VFF A;  4D2O A;  2ZQ7 A;  3IH9 A;  4X53 A;  3G4P A;  1KGE A;  5E2G A;  5DVA A;  1GA0 A;  1K6R A;  1FR6 A;  2DNS A;  4R23 A;  1BT5 A;  1XA1 A;  2I72 A;  3E2K A;  3HLE A;  2ZM0 A;  1XP4 A;  3WS1 A;  3C5A A;  2H0T A;  1ALQ A;  1SCW A;  3NY4 A;  4OQ0 A;  1PZP A;  3SS5 A;  4FH2 A;  4E3M A;  2Y2K A;  3HUN A;  3IF6 B;  2HP5 A;  1IKI A;  5DTS A;  2ZC7 A;  5F1F A;  1IEL A;  2XF3 A;  1PW8 A;  4L0L A;  1LL5 A;  3HVF A;  4M3K A;  3UY6 A;  4E3J A;  2WAD A;  1RP5 A;  5GHZ A;  5JYP A;  1L0E A;  3PBS A;  5FAQ A;  3GQZ A;  4DE2 A;  5L2F A;  4OQH A;  4DXB A;  5KSC A;  1K55 C; 
#chains in the Genus database with same CATH topology
 3SH9 A;  4EBN A;  4IBX A;  3SOI A;  2ZD8 A;  2EX6 A;  5F68 A;  1CEF A;  3M6H A;  4ZAM A;  1YSP A;  3PYP A;  3F1O A;  1V9Z A;  2QWS A;  2ZC4 B;  3RXX A;  3HUO A;  3Q1F A;  1F2K A;  4PKY G;  3TG9 A;  5DKL A;  5BOH A;  4OQI A;  1NYY A;  3H82 B;  1ZKJ A;  5CHM A;  3CJM A;  2E8J A;  4G3K A;  3F1N B;  4EXO A;  1JTG A;  5TFQ A;  1NLY A;  4ESP A;  5FEF A;  2G2W A;  4EUZ A;  1DJA A;  5HW3 A;  1IYO A;  4OPQ A;  5HAP A;  5CHJ A;  4MDZ A;  3TSG A;  3NDE A;  4F94 A;  3F1O B;  1ES5 A;  2VV6 A;  4OKP A;  1XFQ A;  3PAE A;  2V9A A;  4MBH A;  3JVV A;  2V1B A;  4R6L A;  5GLC A;  4ZTK A;  1EI5 A;  3GMW A;  1ZG6 A;  4WZ5 A;  5GLD A;  5HDD A;  1CF0 A;  2Y59 A;  1N9O A;  3ISG A;  2A24 B;  4I38 A;  3W4Q A;  3CAX A;  3MF0 A;  3W8K A;  4M4X A;  3UDF A;  5FQK A;  4BL2 A;  4DF6 A;  3VP0 A;  3DW0 A;  1WA9 A;  2R9X A;  4ZDX A;  1K55 A;  2OLV A;  4QY6 A;  3QP1 A;  4OPZ A;  4ETX A;  1CQA A;  4ZJ2 A;  3CI6 A;  3VV4 A;  4WEK A;  2BTF P;  3QHY A;  5FDH A;  2OV5 A;  3H9W A;  1RGY A;  1K4E A;  1CK3 A;  3MS6 A;  4X1M A;  1NZU A;  2EXA A;  3T4L A;  5EE8 A;  3GV9 A;  4QY5 A;  2WGV A;  3LFV A;  3K2N A;  3BRM A;  4N92 A;  1KDS A;  3WS5 A;  2ZC5 B;  2GDN A;  2JCH A;  5HWT A;  3VFH A;  4R4S A;  5EVI C;  1SKO A;  3VE3 A;  3CUE C;  1W63 M;  5EVI D;  4E3N A;  3EQV A;  3MXS A;  4R3A A;  3PBO A;  5EVI A;  3MKE A;  1G6O A;  3K3C A;  5JYO A;  3HL9 A;  1WYB A;  5KSH A;  2ZQ9 A;  2PYP A;  4GN2 A;  3IS2 B;  4JF4 A;  1IYP A;  1PFL A;  2UV0 E;  3N6I A;  3CHW P;  3HLG A;  4E04 A;  1BLP A;  4JGQ A;  3KX0 X;  4PKY A;  3UMD A;  2VKS A;  3VOL A;  3ICY A;  4GS9 A;  1HZO A;  5EVI B;  3NJA A;  3H7W B;  5FI2 A;  1AWI A;  2WGW A;  2WGW B;  2PD7 A;  3LEZ A;  4UEY A;  3G2Z A;  3Q7V B;  2PDR A;  2VK3 A;  4KG2 A;  2XK1 A;  5GLB A;  4LCL A;  4H6J A;  4S2N C;  4HH2 A;  5HSQ A;  1HLU P;  4Q0J A;  4R3J A;  2P08 A;  3GRJ A;  3ZVW A;  2KDK A;  3E0Y A;  3DWZ A;  5FAS A;  2WZX A;  4KZ3 A;  2HGV A;  1I2W A;  3E2L A;  3QP8 A;  4IVK A;  2XSS A;  1DJB A;  3BY8 A;  4X68 A;  3TRC A;  4PM7 A;  1P97 A;  3KO6 A;  4C3Q A;  4DE1 A;  2WK0 A;  4ZBE A;  5KZH A;  3BFD A;  2L0W A;  5L09 A;  3V3S A;  2A3U A;  5FQJ A;  4FTX A;  3QP2 A;  3KYQ A;  4MBF A;  4R3B A;  3IHA A;  3HRE A;  2GX5 A;  4LV1 A;  3AGE A;  2W3F A;  1PRQ A;  2V2F F;  2PRF A;  3IT9 A;  3FV7 A;  2ZOH A;  3OPR A;  5FQQ A;  3IQA A;  4Y0U A;  1K25 A;  1E3U A;  1Q2P A;  3O5Y A;  4CQH A;  4U0X A;  1BUE A;  4GDB A;  3NBL A;  2Z2L B;  1A0K A;  4B9O A;  1LLB A;  3VOZ A;  3ITB A;  4OP5 A;  3DTK A;  4NXG A;  1H3Q A;  3CZD A;  1XXM A;  2WKE A;  3Q81 A;  3LR3 A;  2P9V B;  2XA7 M;  2G7U A;  2JBF A;  3V3R A;  2H28 A;  1ES3 A;  1NXY A;  4S2L A;  1VHM A;  1XJ3 A;  2V1A A;  3T4K A;  1L0D A;  4OLD A;  1O7E A;  3EEA A;  1S66 L;  1UWP X;  4EEP A;  3VOY A;  2ZL1 B;  4L9E A;  1LI9 A;  4H8R A;  4ME4 A;  4YNR A;  1F98 A;  3C2W A;  3EQU A;  1MWR A;  4Z9Q A;  3DTM A;  3S22 A;  2Q0O A;  2WYX A;  2XRN A;  4G3V A;  3TOI A;  3T4J A;  1N9N A;  2OOL A;  4GD6 A;  1IKG A;  4HI4 A;  3EGD C;  1OTE A;  3T1S A;  2L1M A;  4CLC C;  3H7W A;  1TF1 A;  3VP1 A;  3BYD A;  4S2O A;  2RCX A;  2ZQD A;  4Y15 A;  3RXW A;  4Y17 A;  2XR0 A;  5HZH A;  4HNB A;  3FPW A;  1DRM A;  5GL9 A;  4X25 A;  4YFM A;  5CEC A;  3T1Q B;  3BFC A;  4WUJ A;  3T4O A;  4EV4 A;  2A2L A;  1NJ4 A;  1YAX A;  4JGP A;  4BBT A;  4KEN B;  4B88 A;  4YOF A;  3TJZ C;  1X0O A;  1SKO B;  3BEB A;  1PIO A;  3CIT A;  3IHB A;  4HH3 A;  4QB8 A;  5EVL A;  3IH9 A;  4P6Z S;  3OLO A;  4X53 A;  5E2G A;  5DVA A;  5FEG A;  3HLE A;  3WS1 A;  3C5A A;  3NOP C;  1TS8 A;  4OQ0 A;  3T1R A;  1XJ2 A;  5HPI A;  3HUN A;  3HVF A;  4M3K A;  2QJ5 A;  4E3J A;  5GHZ A;  3GQZ A;  4WLA A;  4FUW A;  1EW0 A;  3DAV A;  3DTI A;  3IBJ A;  5KSC A;  3L9K A;  5DF7 A;  3VP4 A;  4BMW A;  4NG2 A;  4PHT A;  2JHE A;  5CHU A;  1N9L A;  4LEN A;  3F1P B;  3LI8 A;  3UB7 A;  2HDU A;  2O99 A;  1SZV A;  4WBG A;  1OPX A;  2J8Y A;  1CI8 A;  5CEB A;  4H6J B;  3M2J A;  1PYY A;  3TE8 A;  1XKZ A;  1ZG4 A;  2XLN A;  4HJ4 A;  4R1G A;  1OTB A;  2PR6 A;  1NRJ A;  3MBZ A;  1YLJ A;  5CGS A;  5E2F A;  1FQG A;  3IXB A;  1BZA A;  4JKT A;  3PTE A;  3ZG9 B;  2ZOI A;  1YMX A;  2WUQ A;  4II7 A;  1W8Q A;  1ZC2 A;  1MC0 A;  5HL6 A;  1J9M A;  1FR1 A;  2ZQ8 A;  3MFD A;  3PBN A;  2O9A A;  4WMC A;  3VMA A;  5J7E A;  2W3G A;  3MQ0 A;  4UA6 A;  5EFW A;  5HX9 A;  2XFS A;  3W4O A;  2KOI A;  3OPL A;  1S4R A;  4P87 A;  4HOI A;  2VGL S;  3UNW A;  4EWF A;  5EUA A;  3UPO A;  2PYR A;  2Z6D A;  1UWN X;  1S0W A;  1YLT A;  3BJN A;  4QU3 A;  5C5K A;  5DTK A;  3CWF A;  4MNR A;  2WKH A;  4U0T A;  4E3O A;  2C5W B;  1NLZ A;  1L0G A;  3QP5 A;  4Y3I A;  1VET B;  3PBT A;  5FQM A;  5TGF A;  3G32 A;  2Y8H A;  1K57 C;  5IHV A;  2QYB A;  1YPR A;  4IED A;  3CMZ A;  1H8M A;  1TS7 A;  2QKP A;  1FCM A;  3ZG5 A;  2ZC6 B;  4E3I A;  2VX8 A;  2WAF A;  4BJP A;  4E6W A;  1XFN A;  2ZC3 B;  4KQO A;  1BLS A;  3HJI A;  3N4I A;  2JKR I;  5DTT A;  4MBK A;  3IWI A;  2BG1 A;  3NCK A;  1LL8 A;  4F3L A;  4UA7 A;  1FCO A;  2O9C A;  2VGK A;  3ZDJ A;  4EEU A;  5TJJ A;  2OAP 1;  1VEU B;  4KQD A;  1S1Y A;  2QHK A;  3LIB A;  3AGF A;  3OCL A;  3Q7Z A;  4Q8I A;  3LI9 A;  2HJE A;  4O01 A;  1ES2 A;  2W3H A;  2XA7 S;  4S2N A;  3K3D A;  5FQ9 A;  5A91 A;  1PNE A;  2R9W A;  3MXQ A;  4KUK A;  5EPH A;  4EBP A;  4KUO A;  4X1L A;  3UB5 P;  3S7O A;  3UPP A;  2V1Z A;  3VSL A;  3MSH A;  1YLY A;  2PT7 A;  3MKF A;  5CER A;  2Z2M B;  4JXW A;  2WKQ A;  2OWJ A;  2HP9 A;  2O9B A;  1SHV A;  5F1G A;  3ZHH A;  4HP9 A;  5IS1 A;  4BD1 A;  3N8R A;  2QPN A;  3ZVT A;  3FKW A;  4X69 A;  2ZM8 A;  5FI6 A;  4HBT A;  4NEE D;  4DDS A;  4GLQ A;  3IWQ A;  3PBQ A;  1NY0 A;  5J3W A;  3M2K A;  2P9V A;  2Y2L A;  5FAP A;  1XJ6 A;  1YMS A;  1MZU A;  4BEN A;  2JKR M;  1K6S A;  3HLW A;  1W7F A;  2Z6C A;  1G28 A;  1MPL A;  2HP6 A;  1LSV A;  4XT2 B;  1E3U D;  4R38 A;  4UQI S;  1HTZ A;  3WWX A;  2A24 A;  4CLC A;  5I5L A;  4QD4 A;  4I39 A;  3HJK A;  3LR5 A;  4GD8 A;  3AGD A;  2EXB A;  3G2Y A;  4KZ8 A;  4N9L A;  1YLP A;  3VP2 A;  4K0W A;  3ZGA B;  1YM1 A;  4BQM A;  4JF5 A;  3D4F A;  1OT9 A;  1IOU A;  4JBF A;  5HFO A;  4DE3 A;  1F5M A;  4NXE A;  1ESU A;  1EWZ A;  4CLC E;  2HV1 A;  2LB9 A;  1ERM A;  1D1J A;  4DRT A;  1LL9 A;  3FG8 A;  3KYZ A;  1T1A A;  1SDE A;  3IX8 A;  4K0X A;  3LEQ A;  4OOL A;  1Y54 A;  1IEM A;  4OPR A;  4E6X A;  3UE0 A;  4ETZ A;  2OSU A;  2ZQC A;  4HJ6 A;  1ESI A;  5FI7 A;  2PBY A;  1I2S A;  1T19 A;  5AVF A;  4P6B A;  3LR4 A;  3IF6 A;  4EU0 A;  3JYI A;  3Q7V A;  4WEL A;  2JC7 A;  4KZ5 A;  3UDI A;  3G34 A;  1ACF A;  2VV7 A;  4RX3 A;  3EWK A;  1OTA A;  1G6A A;  5E43 A;  2ZQA A;  1O07 A;  5HAQ A;  3BLS A;  5TR7 A;  1ERQ A;  3P98 A;  1K4F A;  1D06 A;  3LO7 A;  3UDX A;  2XGN A;  3OPH A;  3FKV A;  4FD8 A;  3ULF A;  3QP6 A;  4B4X A;  5KMW A;  1H5X A;  2CC1 A;  2IA2 A;  1LSX A;  5L07 A;  4PPR A;  4YWZ A;  3UO9 A;  4HHD A;  4HEF A;  3EOI A;  5K5B A;  2W1T B;  4Y0O A;  3BLM A;  2P04 A;  4D60 A;  1DP8 A;  3VFF A;  4R23 A;  2DNS A;  3JVU A;  1XP4 A;  2H0T A;  4E3M A;  2JKT M;  3C8C A;  4HY8 A;  2HP5 A;  1IKI A;  2XF3 A;  1PW8 A;  2GJ3 A;  4Y5F A;  2OAQ 1;  1Z09 A;  3UY6 A;  1RP5 A;  2WAD A;  1LSW A;  3T1X A;  3NOU C;  4DE2 A;  5AJG A;  3D9Y A;  4DXB A;  2VV8 A;  4GHI A;  4DE0 A;  4OVD A;  4Q0I A;  1ONG A;  4GB7 A;  1OT6 A;  1T1C A;  4MN7 A;  5F5Y A;  4IHQ A;  4KZ7 A;  4PM6 A;  2DMW A;  3HLC A;  4GDN A;  3BWL A;  3R4K A;  2C6W B;  1KDW A;  5CED A;  5M18 A;  3CG5 A;  1DJC A;  3BM6 A;  2G2U A;  2BLS A;  2J9O A;  1FSY A;  3NDG A;  5I94 A;  4RYE A;  3UB8 A;  3LY4 A;  3MMH A;  3LGO A;  4PM9 A;  3B42 A;  2VJW A;  3MZE A;  1JWP A;  1YQS A;  3B3X A;  3V39 A;  4E3L A;  1YLZ A;  1G5U A;  3IX3 A;  4O8G A;  3UE1 A;  5J4E A;  3W2Z A;  4BBV A;  1TDG A;  2X71 A;  4XXR A;  1L3L A;  2LB5 A;  2PR5 A;  1D7E A;  5HL1 A;  4MMN A;  4BBU A;  2HZ5 A;  3C7U A;  2YKH A;  3H82 A;  2QMI A;  2JN7 A;  2W1R A;  3NUL A;  2K2N A;  2NUP C;  4B4Z A;  4KZ4 A;  3NI9 A;  1K56 A;  3ZQ5 A;  2W27 A;  1HVB A;  5F6A A;  2B95 A;  3GR2 A;  3UME A;  3QNC A;  2V0W A;  2Y2M A;  5G18 A;  1TDL A;  4DKI A;  3N8L A;  4X6T A;  3C4P A;  3A0V A;  4GCZ A;  3V5M A;  1GSW A;  3IX4 A;  3BQA A;  3LR0 A;  1CJF A;  4AFI A;  4Y7P A;  3A3E A;  4S2I A;  1DP6 A;  2YKF A;  4S2K A;  4OLG A;  4CJN A;  4EET B;  2ZMV A;  1FOF A;  3EGX C;  2Y91 A;  1MY8 A;  1CEG A;  2AVX A;  4LFU A;  1L2S A;  1KVM A;  5A92 A;  2WKI A;  5HD5 A;  3LUQ A;  3UE6 A;  2Y2I A;  1AXB A;  1K0K A;  2KX6 A;  2EX9 A;  4DN0 A;  3CPT A;  4R0Q A;  3NC8 A;  4RX2 A;  1BLH A;  1XGI A;  3VP3 A;  1YT4 A;  4RA7 A;  2W0N A;  1Y4O A;  3IH8 A;  4MLL A;  1BLC A;  3S1Y A;  1BYW A;  2VGL M;  2HDS A;  2R78 A;  3HLF A;  3C7V A;  4C75 A;  5L10 A;  1QMF A;  4LCM A;  3ZNT A;  2A49 A;  2XRO A;  2W3D A;  3KSF A;  1K54 A;  3A3F A;  2Y79 A;  3G6O A;  3UE3 A;  1QME A;  2IWC A;  1FCN A;  4GZB A;  2Y2P A;  4K91 A;  1H8Z A;  5E2H A;  2E8I A;  3SW1 A;  5EVE A;  2DRW A;  5GHY A;  4QJG A;  3EEH A;  3QP4 A;  1RCJ A;  1TS0 A;  2FZ0 A;  5U47 A;  4KZB A;  1JTD A;  4DDY A;  3KSI A;  1VQQ A;  4ZJ3 A;  1S4S A;  2Y2N A;  3BW6 A;  5DF8 A;  3WS4 A;  2Y2O A;  4KQQ A;  3W4P A;  4DXC A;  3G31 A;  3PXP A;  5AVE A;  4WYY A;  3P09 A;  1OME A;  2EFU A;  3NIA A;  4UA9 A;  1ZTU A;  5CTN A;  2ZJ9 A;  3WS0 A;  2OWH A;  3LIF A;  3TW8 A;  4FCF A;  5L8M A;  4OP8 A;  2PHY A;  1TD5 A;  4I3I A;  4WZ4 A;  3HLD A;  4S2J A;  2B18 A;  2ZMA A;  3HLB A;  4IJG A;  4NK3 A;  1KGF A;  4P85 A;  5CGW A;  4PMA A;  2XFT A;  2EFX A;  4EES A;  1DP9 A;  3BEC A;  4GHI B;  4IUH A;  2M1C A;  4MCW A;  3HUM A;  4ARZ A;  3ZNY A;  2X01 A;  4JXS A;  4EBL A;  4KZA A;  2EX2 A;  2M7U A;  4L9F A;  2XDM A;  2V8F A;  3MZD A;  2BAS A;  4XUX A;  4GNU A;  4B93 A;  4I3A A;  3LY3 A;  1GA9 A;  1P0Z A;  3S7Q A;  4LV2 A;  5CRF A;  3GTC A;  1MKM A;  4WZ5 C;  5HAI A;  3P01 A;  1MBL A;  3C4O A;  3GSG A;  4MN5 A;  1T18 A;  3LYX A;  4I5S A;  4X55 A;  3N8S A;  5AQ9 A;  2P74 A;  3PHY A;  2HF6 A;  1TEM A;  5HWV A;  3FWL A;  4WF0 A;  5FAT A;  4LRY C;  1XA7 A;  1YSQ A;  2XH9 A;  5LBR A;  5HAR A;  1OJ5 A;  3F1P A;  4IUK A;  1XPB A;  5TBM A;  5G4Z A;  2V20 A;  4PAU A;  4LV3 A;  2IWB A;  5KIZ A;  4CPK A;  4WM9 A;  3S7P A;  3B33 A;  1H8Y A;  1OTD A;  2JE5 A;  5CTM A;  2J3W A;  2ACG A;  3HBR A;  5M1A A;  3FYZ A;  4BLM A;  1VM1 A;  3E98 A;  1SDN A;  4PM8 A;  1FSW A;  3O3V A;  1W5D A;  3MXR A;  2VGJ A;  4LRZ E;  5F82 A;  1BTL A;  2B5R A;  1K54 C;  5CGX A;  2XD5 A;  2J7V A;  4O0P A;  2K7S A;  5D3O A;  4R4R A;  2J80 A;  1T1B A;  3V50 A;  4F3L B;  4UHU A;  3M6B A;  4S2P A;  1FIK A;  2DCF A;  1VET A;  1KGG A;  2WGI A;  4LLO B;  3A3I A;  2GZA A;  5HWW A;  2J9P A;  1OJG A;  5FSR A;  3LID A;  2PAV P;  1KE3 A;  4JXV A;  3E4P A;  5AQ7 A;  2ZMF A;  1WYC A;  1VB6 A;  2Q9N A;  4WN5 A;  4A5R A;  3MJQ A;  4D2O A;  2ZQ7 A;  2GNX A;  3L7H A;  3G4P A;  1KGE A;  4XT2 A;  4JGO A;  1K6R A;  3FPV A;  1XA1 A;  3E2K A;  2ZM0 A;  3NY4 A;  3SS5 A;  2Y2K A;  5DTS A;  2ZC7 A;  5F1F A;  1IEL A;  1LL5 A;  4Q0H A;  4L9G A;  1JNU A;  3LIE A;  3PBS A;  5G4Y A;  2L4R A;  1K55 C;  2EWV A;  1K56 D;  1MKI A;  1RGZ A;  2VEA A;  3MR0 A;  4N1H A;  3BFE A;  1E25 A;  2Y4A A;  4EER A;  3F1N A;  4ID4 A;  2HPB A;  2VZW A;  3GDI A;  3WRZ A;  4KZ9 A;  2Y2J A;  5EV0 A;  5CXW A;  3IF6 C;  3A0S A;  1UGU A;  3ZYT A;  1J3W A;  3LCE A;  2D02 A;  2J3T C;  5FA7 A;  3OC2 A;  5FAO A;  2OLU A;  2VLG A;  3MQQ A;  3E4O A;  2K31 A;  4I3J A;  3O86 A;  3BY9 A;  3S4X A;  5EOE A;  3C30 A;  1Z6F A;  3UN7 A;  1VEU A;  3SH8 A;  3D3O A;  4LRX C;  4OH0 A;  4Y2F A;  2I9V A;  1YKD A;  1TS6 A;  5F69 A;  5HD3 A;  2Y55 A;  4GW9 A;  4JF6 A;  3S7N A;  3ZCZ A;  1LT0 A;  5A8B A;  1K57 A;  3R7W A;  4KQR A;  3NOT C;  3ZFZ A;  1C3B A;  4WEJ A;  3SH7 A;  3NEC A;  4U3T A;  4DJ2 A;  1TVF A;  4JXG A;  1GHP A;  3IXD A;  2P7J A;  4OOM A;  4GJ4 A;  3IS2 A;  5GHX A;  3BFG A;  1U60 A;  4FSF A;  2UWX A;  3ZG8 B;  1P9W A;  4MN6 A;  2PU4 A;  1GCE A;  3T4S A;  5AQA A;  4UQI M;  2PU2 A;  2MJ6 A;  4QPR A;  1JWV A;  4O7D A;  4FOF A;  2INW A;  2HDR A;  1BSG A;  4BWI A;  3I7J A;  2FH5 A;  2XEP A;  3A3D A;  1MWT A;  4G3W A;  3OZH A;  2EA9 A;  1K38 A;  3T4T A;  3MFX A;  5FL3 A;  1XJ4 A;  2O0Y A;  2ZM2 A;  1NYM A;  3SS4 A;  5HPF A;  2V8C A;  4LGW A;  2HJ9 C;  2XQZ A;  1MWS A;  2JKG A;  1GHM A;  3LIC A;  2XD1 A;  1E4D A;  2ZLY A;  2Q9M A;  5GLA A;  5CX7 A;  3PBR A;  5AQB A;  1KE0 A;  5IU1 A;  5TBM B;  3OPP A;  4HBU A;  3G35 A;  4E3K A;  1CI9 A;  1M6K A;  3IBR A;  1LI0 A;  3UB6 A;  3CUE A;  5DF9 A;  5HDS A;  3RH8 B;  5DJT A;  5HDC A;  1Y28 A;  5FQI A;  1WE4 A;  3GVB A;  4K08 A;  4JLF A;  2H5S A;  4N1X A;  3QNB A;  4KG5 A;  4GKU A;  1ES4 A;  1GSV A;  2H10 A;  4RVA A;  3Q82 A;  4MEZ A;  5MC7 A;  5DJU A;  4DJ3 A;  4X56 A;  4KG6 A;  4NET A;  4OQG A;  4C6Y A;  5J8X A;  1I5Q A;  3CLO A;  4PM5 A;  5IT5 A;  3CPT B;  3P7N A;  1IYS A;  1S67 L;  1W79 A;  4Y13 A;  2EX8 A;  1XGJ A;  1KVL A;  5DFX A;  3RFB A;  4LPZ A;  1NWZ A;  4KZ6 A;  5M19 A;  1JVJ A;  3U2A A;  1L0F A;  3Q07 A;  4OPY A;  2Y2Q A;  1W63 Q;  4Y0T A;  4BD0 A;  2IWD A;  3DTE A;  1S6R A;  1PI4 A;  3OCN A;  2PD8 A;  1M40 A;  3KSG A;  3FZC A;  1G68 A;  1PZO A;  3PAG A;  1OTI A;  4WL9 A;  4JGR A;  4HJ3 A;  1ERO A;  3ZG7 B;  4P6Z M;  1ONH A;  3R7W B;  4S2M A;  5EM1 A;  1NZO A;  4HIA A;  3O88 A;  1N4O A;  3UPN A;  3IF5 A;  1W8Y A;  1SKF A;  3OBF A;  2HDQ A;  4EQI A;  4RQ9 A;  5E2E A;  4EQ1 A;  4P0M A;  1DY6 A;  3T50 A;  4UAA A;  1ODV A;  4Z1W A;  3SS3 A;  2W3E A;  2D01 A;  2QJ7 A;  1N9B A;  1PWD A;  3IXG A;  3N7W A;  4EW7 A;  3PR6 A;  1BUL A;  4QHC A;  2X02 A;  2V0U A;  4NXB A;  4XUZ A;  4HQA A;  3U4L P;  3DWK A;  1S1Z A;  2JKF A;  2WKR A;  1GSX A;  5A93 A;  3FC7 A;  1IYQ A;  4GOG A;  3RJU A;  3D72 A;  3WRT A;  5EEC A;  4OOY A;  3DBA A;  1STZ A;  2W1T A;  3T12 B;  1NRF A;  1PWG A;  4ZRR A;  3GEC A;  2J3T D;  2QZ6 A;  2JKT I;  3IXH A;  1ZHH B;  1FIL A;  2NUT C;  1V9Y A;  4JPM A;  3ZG0 A;  3T4Q A;  4R70 A;  1H0M A;  4IBR A;  4LV0 A;  3E4Q A;  5FDS A;  2RL3 A;  3KSH A;  4QWO A;  3WS2 A;  1HD8 A;  3SZT A;  4OON A;  2FFF B;  2ZL1 A;  2M7V A;  5EOO A;  2Y2G A;  1PI5 A;  3BQ8 A;  2B02 A;  2VA0 A;  3C38 A;  4GS9 B;  5DFY A;  2WKP A;  4IVI A;  4FH4 A;  2FFY A;  3KYE A;  3OOV A;  1KE4 A;  1PW1 A;  1LHY A;  3A0R A;  1PWC A;  4YIN A;  5A90 A;  2ZBB A;  4NXF A;  3VSK A;  3JPU A;  1MWU A;  1XX2 A;  2Y2H A;  1MXO A;  2PBD P;  3ITA A;  5DKK A;  4HES A;  4ZJ1 A;  1YLW A;  4BL3 A;  3A3J A;  1JWZ A;  3G30 A;  4HP4 A;  4N9K A;  5F83 A;  3HCY A;  4ARZ B;  4WMC D;  3MQO A;  3MZF A;  3O87 A;  1GHI A;  3IWO A;  1F9I A;  1Q2Q A;  3RTY A;  2WZZ A;  3BFF A;  2WAE A;  4CLC B;  5EM0 A;  2H0Y A;  2KLI A;  4NKP A;  3VE4 A;  1GA0 A;  1FR6 A;  3NHQ A;  1BT5 A;  3B47 A;  3UB9 A;  2I72 A;  1ALQ A;  1SCW A;  4DMZ A;  1KOU A;  1PZP A;  4FH2 A;  3V67 A;  3IF6 B;  2EWW A;  4L0L A;  1L0E A;  4EUV A;  3LIA A;  1P9R A;  1IFQ A;  5FAQ A;  4CLC D;  5L2F A;  2CMN A;  4OQH A;  5JYP A; 
#chains in the Genus database with same CATH homology
 5DF7 A;  3SH9 A;  3VP4 A;  4EBN A;  4DE0 A;  4OVD A;  4IBX A;  3SOI A;  2ZD8 A;  2EX6 A;  1K56 D;  5CHU A;  1CEF A;  3M6H A;  1ONG A;  1MKI A;  1RGZ A;  4LEN A;  4ZAM A;  4GB7 A;  4N1H A;  3BFE A;  2HDU A;  1E25 A;  4KZ7 A;  2ZC4 B;  2Y4A A;  4WBG A;  3RXX A;  3HUO A;  3Q1F A;  4PM6 A;  3TG9 A;  2J8Y A;  3HLC A;  4GDN A;  2C6W B;  4ID4 A;  2HPB A;  1KDW A;  3WRZ A;  1CI8 A;  5CED A;  5BOH A;  5CEB A;  4OQI A;  1NYY A;  4KZ9 A;  2Y2J A;  1ZKJ A;  5M18 A;  5CHM A;  3CG5 A;  1DJC A;  5CXW A;  3M2J A;  3BM6 A;  2G2U A;  1PYY A;  3IF6 C;  2BLS A;  2J9O A;  1FSY A;  3CJM A;  3NDG A;  5I94 A;  1XKZ A;  1ZG4 A;  2XLN A;  1JTG A;  5TFQ A;  4RYE A;  4R1G A;  3LY4 A;  2G2W A;  3LCE A;  5FA7 A;  4EUZ A;  4PM9 A;  1DJA A;  5HW3 A;  3OC2 A;  3MBZ A;  5FAO A;  2OLU A;  1YLJ A;  5CGS A;  1IYO A;  4OPQ A;  5E2F A;  5HAP A;  5CHJ A;  1FQG A;  3IXB A;  1JWP A;  3MZE A;  1BZA A;  3TSG A;  1YQS A;  3O86 A;  3NDE A;  3S4X A;  4F94 A;  1ES5 A;  5EOE A;  4JKT A;  3B3X A;  3V39 A;  3PTE A;  4OKP A;  3ZG9 B;  1YMX A;  2WUQ A;  4E3L A;  1Z6F A;  1W8Q A;  1YLZ A;  1ZC2 A;  3PAE A;  4MBH A;  3UN7 A;  3UE1 A;  1J9M A;  2ZQ8 A;  1FR1 A;  5GLC A;  4ZTK A;  1EI5 A;  3SH8 A;  3GMW A;  1ZG6 A;  3MFD A;  4WZ5 A;  3PBN A;  1TDG A;  2X71 A;  4OH0 A;  4XXR A;  5GLD A;  4WMC A;  2Y55 A;  2Y59 A;  3ISG A;  4JF6 A;  5HL1 A;  3VMA A;  3C7U A;  4UA6 A;  3ZCZ A;  5HX9 A;  3W4Q A;  2XFS A;  2QMI A;  1K57 A;  3W4O A;  3OPL A;  4KQR A;  4P87 A;  3W8K A;  3ZFZ A;  1C3B A;  4WEJ A;  4B4Z A;  4KZ4 A;  3NI9 A;  3SH7 A;  3UDF A;  4U3T A;  1K56 A;  3UNW A;  5FQK A;  4EWF A;  5EUA A;  4BL2 A;  3UPO A;  1HVB A;  1TVF A;  3VP0 A;  1S0W A;  4DF6 A;  1YLT A;  3GR2 A;  4QU3 A;  3DW0 A;  4JXG A;  3QNC A;  1GHP A;  2R9X A;  2Y2M A;  3IXD A;  1K55 A;  4ZDX A;  2OLV A;  4QY6 A;  5DTK A;  4OOM A;  5G18 A;  4OPZ A;  1TDL A;  4DKI A;  5GHX A;  3N8L A;  4MNR A;  2WKH A;  4ZJ2 A;  4U0T A;  4X6T A;  4E3O A;  3BFG A;  3C4P A;  3V5M A;  1U60 A;  4FSF A;  2C5W B;  2UWX A;  4WEK A;  3ZG8 B;  1L0G A;  3QHY A;  2PU4 A;  5FDH A;  3PBT A;  5FQM A;  4Y7P A;  5TGF A;  2OV5 A;  1RGY A;  1K4E A;  3A3E A;  4S2I A;  1GCE A;  3G32 A;  5AQA A;  1CK3 A;  4S2K A;  4OLG A;  4CJN A;  2PU2 A;  1K57 C;  1NZU A;  2EXA A;  5IHV A;  1FOF A;  2Y91 A;  4IED A;  1MY8 A;  1CEG A;  3CMZ A;  5EE8 A;  3GV9 A;  4QY5 A;  2WGV A;  1L2S A;  1JWV A;  1KVM A;  4O7D A;  3BRM A;  4N92 A;  1KDS A;  3WS5 A;  1FCM A;  5A92 A;  3ZG5 A;  2ZC5 B;  2GDN A;  2JCH A;  3VFH A;  2ZC6 B;  2HDR A;  1BSG A;  4E3I A;  2WAF A;  4R4S A;  2WKI A;  5EVI C;  3I7J A;  2Y2I A;  1AXB A;  2XEP A;  4BJP A;  4E6W A;  3A3D A;  2ZC3 B;  1MWT A;  5EVI D;  4KQO A;  4E3N A;  1BLS A;  3EQV A;  3MXS A;  3OZH A;  3N4I A;  3PBO A;  2EX9 A;  5EVI A;  1K38 A;  3MKE A;  4R0Q A;  3NC8 A;  5DTT A;  4RX2 A;  4MBK A;  1BLH A;  1XGI A;  3IWI A;  2BG1 A;  3NCK A;  2ZM2 A;  1NYM A;  3SS4 A;  4UA7 A;  3VP3 A;  1YT4 A;  5JYO A;  1FCO A;  3HL9 A;  4RA7 A;  2VGK A;  1WYB A;  3ZDJ A;  2XQZ A;  5KSH A;  3IH8 A;  4MLL A;  2ZQ9 A;  1MWS A;  1GHM A;  4GN2 A;  4JF4 A;  2XD1 A;  1BLC A;  1IYP A;  3S1Y A;  1E4D A;  2HDS A;  3HLF A;  2ZLY A;  3N6I A;  2Q9M A;  5GLA A;  3HLG A;  1BLP A;  3AGF A;  3C7V A;  3PBR A;  3OCL A;  4C75 A;  5AQB A;  1KE0 A;  1QMF A;  3Q7Z A;  4Q8I A;  1HZO A;  4LCM A;  3ZNT A;  5EVI B;  2A49 A;  3OPP A;  4HBU A;  3G35 A;  4E3K A;  1CI9 A;  1K54 A;  3A3F A;  2WGW A;  5FI2 A;  1ES2 A;  1M6K A;  2WGW B;  1LI0 A;  3LEZ A;  5DF9 A;  4S2N A;  3G2Z A;  5FQ9 A;  5A91 A;  2R9W A;  3UE3 A;  3Q7V B;  5FQI A;  5EPH A;  1QME A;  1WE4 A;  3GVB A;  4JLF A;  2H5S A;  2IWC A;  4KG2 A;  4N1X A;  2XK1 A;  5GLB A;  3QNB A;  4EBP A;  4LCL A;  1FCN A;  4KG5 A;  4GKU A;  4S2N C;  1ES4 A;  2H10 A;  3UPP A;  4RVA A;  4GZB A;  2V1Z A;  2Y2P A;  4R3J A;  3VSL A;  3GRJ A;  3ZVW A;  4K91 A;  1H8Z A;  5E2H A;  2E8I A;  3Q82 A;  4MEZ A;  3DWZ A;  5FAS A;  4X56 A;  4KG6 A;  2DRW A;  1YLY A;  2WZX A;  4KZ3 A;  4NET A;  4OQG A;  3MKF A;  4C6Y A;  5GHY A;  5CER A;  4QJG A;  5J8X A;  2Z2M B;  1I2W A;  3E2L A;  4JXW A;  1I5Q A;  1RCJ A;  2HP9 A;  5U47 A;  5F1G A;  1SHV A;  4KZB A;  1JTD A;  4DDY A;  4PM5 A;  3ZHH A;  1VQQ A;  4IVK A;  4ZJ3 A;  4BD1 A;  2Y2N A;  3N8R A;  5DF8 A;  3WS4 A;  2QPN A;  3ZVT A;  3FKW A;  1IYS A;  2Y2O A;  1DJB A;  1W79 A;  4KQQ A;  2ZM8 A;  4X69 A;  5FI6 A;  2EX8 A;  4HBT A;  1XGJ A;  4X68 A;  3G31 A;  3W4P A;  4DXC A;  4WYY A;  4DDS A;  3P09 A;  1OME A;  2EFU A;  1KVL A;  3NIA A;  4PM7 A;  4UA9 A;  3IWQ A;  4KZ6 A;  3PBQ A;  5M19 A;  4C3Q A;  5CTN A;  1JVJ A;  2ZJ9 A;  1NY0 A;  3WS0 A;  4DE1 A;  1L0F A;  3Q07 A;  2WK0 A;  4OPY A;  4ZBE A;  5KZH A;  2Y2Q A;  4Y0T A;  4FCF A;  3BFD A;  2IWD A;  2P9V A;  1S6R A;  2Y2L A;  3M2K A;  1PI4 A;  5FAP A;  4BD0 A;  3OCN A;  1YMS A;  4OP8 A;  3V3S A;  2A3U A;  4BEN A;  5FQJ A;  1K6S A;  1M40 A;  3FZC A;  4WZ4 A;  3HLW A;  1G68 A;  1W7F A;  4MBF A;  1PZO A;  3HLD A;  3PAG A;  4R3B A;  3IHA A;  4S2J A;  1MPL A;  1ERO A;  2HP6 A;  3ZG7 B;  3HRE A;  2ZMA A;  3HLB A;  4P85 A;  4NK3 A;  1KGF A;  5CGW A;  1ONH A;  4S2M A;  1E3U D;  4LV1 A;  4PMA A;  2XFT A;  2EFX A;  3AGE A;  1HTZ A;  1NZO A;  3O88 A;  1N4O A;  3UPN A;  3WWX A;  2V2F F;  3IF5 A;  1W8Y A;  1SKF A;  4QD4 A;  3BEC A;  3FV7 A;  3IT9 A;  2HDQ A;  3OPR A;  4EQI A;  3HUM A;  5E2E A;  5FQQ A;  3ZNY A;  4P0M A;  1DY6 A;  2X01 A;  4JXS A;  4EBL A;  4UAA A;  3IQA A;  4GD8 A;  4KZA A;  2EX2 A;  4Y0U A;  3AGD A;  3SS3 A;  1K25 A;  2XDM A;  3MZD A;  1E3U A;  1Q2P A;  2EXB A;  3G2Y A;  4U0X A;  4KZ8 A;  1BUE A;  4N9L A;  1N9B A;  1PWD A;  1YLP A;  4GDB A;  3IXG A;  3NBL A;  4GNU A;  2Z2L B;  4XUX A;  3VP2 A;  3N7W A;  4K0W A;  3ZGA B;  3LY3 A;  1LLB A;  1YM1 A;  1BUL A;  3ITB A;  1GA9 A;  4OP5 A;  3VOZ A;  4BQM A;  4JF5 A;  4QHC A;  4LV2 A;  2X02 A;  5CRF A;  3GTC A;  3D4F A;  4WZ5 C;  5HAI A;  4XUZ A;  1MBL A;  3C4O A;  3GSG A;  3DWK A;  4JBF A;  3CZD A;  5HFO A;  4DE3 A;  1XXM A;  2WKE A;  3Q81 A;  5A93 A;  1IYQ A;  4GOG A;  2P9V B;  3N8S A;  4X55 A;  5AQ9 A;  2P74 A;  1ESU A;  3RJU A;  1EWZ A;  3WRT A;  1TEM A;  5EEC A;  3FWL A;  5FAT A;  4OOY A;  2JBF A;  1ERM A;  3V3R A;  1ES3 A;  1NXY A;  4S2L A;  4DRT A;  1NRF A;  1PWG A;  1XA7 A;  2XH9 A;  5HAR A;  1L0D A;  1LL9 A;  2QZ6 A;  4OLD A;  1O7E A;  3IXH A;  1SDE A;  4K0X A;  1XPB A;  4OOL A;  3VOY A;  4JPM A;  1Y54 A;  1IEM A;  4OPR A;  2V20 A;  3ZG0 A;  4LV3 A;  2IWB A;  1LI9 A;  4H8R A;  4CPK A;  4IBR A;  4WM9 A;  3UE0 A;  4E6X A;  2OSU A;  4LV0 A;  2ZQC A;  1ESI A;  5FI7 A;  1H8Y A;  3EQU A;  1MWR A;  4Z9Q A;  2JE5 A;  3DTM A;  2RL3 A;  5CTM A;  3S22 A;  2PBY A;  1I2S A;  2WYX A;  3HBR A;  3WS2 A;  1HD8 A;  5M1A A;  3FYZ A;  4P6B A;  4BLM A;  4OON A;  2FFF B;  3TOI A;  5EOO A;  3IF6 A;  1VM1 A;  4GD6 A;  1IKG A;  2Y2G A;  1SDN A;  3JYI A;  1PI5 A;  3Q7V A;  4WEL A;  4PM8 A;  2JC7 A;  1FSW A;  4KZ5 A;  3UDI A;  3O3V A;  1W5D A;  3G34 A;  4RX3 A;  3MXR A;  2VGJ A;  3VP1 A;  3BYD A;  5F82 A;  1BTL A;  1G6A A;  2RCX A;  2B5R A;  4S2O A;  1K54 C;  5CGX A;  2XD5 A;  2ZQD A;  4IVI A;  4FH4 A;  2FFY A;  5E43 A;  3RXW A;  2J7V A;  1KE4 A;  2ZQA A;  1PW1 A;  2XR0 A;  1LHY A;  1O07 A;  5HAQ A;  3BLS A;  5TR7 A;  1ERQ A;  1PWC A;  4YIN A;  5GL9 A;  5D3O A;  5A90 A;  3P98 A;  1K4F A;  4R4R A;  3V50 A;  4YFM A;  4UHU A;  3LO7 A;  3M6B A;  4S2P A;  3UDX A;  3VSK A;  2XGN A;  2DCF A;  3OPH A;  1MWU A;  5CEC A;  3FKV A;  4FD8 A;  1XX2 A;  3BFC A;  1KGG A;  2Y2H A;  4B4X A;  1MXO A;  5KMW A;  2WGI A;  3ITA A;  1H5X A;  2CC1 A;  4HES A;  4EV4 A;  4ZJ1 A;  1YLW A;  1NJ4 A;  4BL3 A;  3A3I A;  3A3J A;  1JWZ A;  3G30 A;  4PPR A;  2J9P A;  5FSR A;  3UO9 A;  1KE3 A;  4HEF A;  4JXV A;  4N9K A;  5F83 A;  4WMC D;  5AQ7 A;  4KEN B;  4B88 A;  1WYC A;  3MZF A;  3O87 A;  4Y0O A;  1GHI A;  3BLM A;  3BEB A;  3IWO A;  1PIO A;  1Q2Q A;  2Q9N A;  2WZZ A;  3BFF A;  2WAE A;  3IHB A;  2H0Y A;  4A5R A;  4QB8 A;  5EVL A;  3VFF A;  4D2O A;  2ZQ7 A;  3IH9 A;  4X53 A;  3G4P A;  1KGE A;  5E2G A;  5DVA A;  1GA0 A;  1K6R A;  1FR6 A;  2DNS A;  4R23 A;  1BT5 A;  1XA1 A;  2I72 A;  3E2K A;  3HLE A;  2ZM0 A;  1XP4 A;  3WS1 A;  3C5A A;  2H0T A;  1ALQ A;  1SCW A;  3NY4 A;  4OQ0 A;  1PZP A;  3SS5 A;  4FH2 A;  4E3M A;  2Y2K A;  3HUN A;  3IF6 B;  2HP5 A;  1IKI A;  5DTS A;  2ZC7 A;  5F1F A;  1IEL A;  2XF3 A;  1PW8 A;  4L0L A;  1LL5 A;  3HVF A;  4M3K A;  3UY6 A;  4E3J A;  2WAD A;  1RP5 A;  5GHZ A;  5JYP A;  1L0E A;  3PBS A;  5FAQ A;  3GQZ A;  4DE2 A;  5L2F A;  4OQH A;  4DXB A;  5KSC A;  1K55 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...