1YLPA

Atomic resolution structure of ctx-m-27 beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKHADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGGYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase CTX-M-27
publication title Atomic Resolution Structures of CTX-M beta-Lactamases: Extended Spectrum Activities from Increased Mobility and Decreased Stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 99
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ylpA00
3W4PA 5DTTA 3I7JA 3MZEA 4JXSA 3LCEA 1MY8A 3G2ZA 3IHBA 3IT9A 5J8XA 1ES4A 5EUAA 3SS5A 4BENA 1KGGA 4WZ5A 5DF7A 5KZHA 2Y2MA 4K91A 4FCFA 3OPHA 2H10A 2XFTA 3HL9A 5HX9A 1FCNA 4R4SA 4R0QA 3OC2A 5F82A 1K38A 2EX2A 1KE4A 1JWVA 1XGJA 4OOYA 1MKIA 4R4RA 4OOLA 3VSLA 3ZVTA 1PI4A 1U60A 1HZOA 4X69A 3V3RA 3UPOA 3VSKA 2PU4A 5GLDA 1FSWA 4QD4A 4LV1A 4WBGA 5CERA 2EXBA 5EE8A 5FQ9A 3QNBA 5CEBA 1SDEA 4OPZA 2ZM2A 3UE3A 1PYYA 1CI9A 4XXRA 4M3KA 1JWPA 3PBNA 5I94A 2ZC4B 3O87A 2EFUA 3HLFA 2OV5A 3FWLA 1E3UA 4X6TA 3RXXA 2Y2LA 4RVAA 2Y55A 2UWXA 1O7EA 5FQIA 3SH7A 2Y59A 1DJBA 4HBUA 3VP2A 3QNCA 1W8QA 5GL9A 3OPPA 4WZ4A 4B88A 1EWZA 1ERMA 5CGXA 3HLWA 5HARA 1XA1A 3CJMA 5KSHA 2XGNA 2FFFB 3NDEA 3OPLA 5FA7A 5E2HA 5E2FA 1ZG6A 1K56D 2VGKA 5EOOA 5G18A 2Y2PA 1MWTA 4OOMA 5AQAA 2G2UA 4KZ7A 4OVDA 4QY5A 4CPKA 1IEMA 4KG2A 4WMCA 4DDYA 1NZOA 1RGYA 1LL9A 2EX9A 3MKFA 4OPRA 3ZDJA 5EVID 2HP6A 3P98A 3PBTA 1GHPA 3BEBA 3MKEA 2FFYA 3G35A 2DNSA 3HLDA 2IWDA 3Q1FA 3N8LA 3PBOA 1GA0A 1JWZA 2EX6A 3BFGA 2ZQ8A 3EQVA 2P9VA 1YLTA 4KG6A 4S2IA 3UN7A 3GQZA 4ZAMA 2Y4AA 2HDQA 3EQUA 1I2SA 4KG5A 3GRJA 4N1HA 3MBZA 1YT4A 2BLSA 2HP5A 1CK3A 1ES5A 4OONA 4ZTKA 4CJNA 4KENB 3G31A 3HBRA 5KSCA 4U0XA 3GTCA 1MWSA 2XFSA 3A3JA 2ZQCA 1CEFA 4DXCA 4N9LA 4Y0OA 5AQBA 5HAIA 3HLGA 1NXYA 5M1AA 1PZOA 2WGVA 3HUMA 3GMWA 4JF6A 4PMAA 3N4IA 4LCMA 3IF5A 4X55A 2EXAA 3IF6C 1SHVA 4KQOA 3ZNTA 1NYYA 3Q7VB 2R9XA 4KQRA 5DTSA 3A3DA 4N1XA 1C3BA 2ZC6B 1CEGA 3DTMA 2QZ6A 5E2EA 3BFEA 3IF6A 1J9MA 3V50A 3TOIA 5JYPA 1TDLA 2P74A 3D4FA 3OCLA 1ZG4A 4ZJ1A 4O7DA 4E3KA 3VFFA 1LHYA 2I72A 3G4PA 1ALQA 1L0DA 3IF6B 1EROA 4JXVA 4LV3A 4RX3A 2WKEA 4EUZA 3Q81A 4S2LA 5CECA 3WRTA 1DJCA 5CHUA 2WGWB 3ZG8B 1CI8A 4P0MA 4ZJ3A 2Y2HA 3ZGAB 4GNUA 5FSRA 4KQQA 1YM1A 3LY3A 2JE5A 2ZC5B 3NBLA 4WZ5C 3S1YA 4FSFA 1W8YA 1PI5A 3IXGA 3C7UA 3O86A 4K0WA 4R1GA 1PZPA 2WZXA 2VGJA 3HVFA 3ZFZA 1YMSA 3UO9A 1I5QA 3LEZA 4EV4A 4KZ8A 1GHMA 1QMEA 4JXWA 4KZAA 4S2OA 4PPRA 5A90A 4U0TA 3O88A 2XDMA 3IH8A 1JTDA 2OLVA 3ISGA 2DCFA 4BJPA 1FR1A 4MBFA 2XQZA 5FAPA 2WZZA 1PW8A 3WS4A 1NRFA 1E25A 1TDGA 4KZBA 4R3BA 5FQMA 3MXRA 4YFMA 1E3UD 2HDRA 3NI9A 2JBFA 2HP9A 1PWDA 3VP4A 1YLZA 2WYXA 5DF9A 1E4DA 4NK3A 5GHZA 1BLSA 1Y54A 1K4FA 1SKFA 4UHUA 2ZMAA 1K6RA 2ZLYA 4KZ9A 4JXGA 2Y2IA 4GDBA 3E2LA 4DE0A 3IWOA 1BLPA 4KZ4A 1YQSA 4R23A 3VP1A 4MLLA 2Q9MA 3IXHA 2B5RA 2XLNA 5HW3A 4WELA 1FOFA 3DW0A 2JCHA 3UNWA 4U3TA 3WS1A 4GB7A 4BL2A 5E2GA 2C6WB 3HLEA 2WAEA 4WMCD 3BLSA 2ZQ9A 5GHYA 3VP3A 4KZ6A 4DE2A 3MFDA 1AXBA 2XR0A 4ZDXA 1ESIA 1FR6A 1Q2PA 4UA9A 2G2WA 3VFHA 4UA7A 3G34A 5L2FA 4E3JA 4FH2A 2BG1A 3OPRA 4OQ0A 5DVAA 5AQ7A 3FKWA 4HBTA 2XEPA 1VM1A 2ZC7A 4QB8A 1ONGA 4IVIA 1BLCA 1MWRA 3WS0A 2HDSA 3TSGA 5IHVA 4GKUA 3M6HA 4EBPA 3ZG9B 1YLYA 4C6YA 2OSUA 5FASA 1KGEA 3V3SA 2ZQAA 2P9VB 1YLWA 1FCMA 5TFQA 4E3IA 3HREA 2CC1A 4OKPA 1XA7A 3BM6A 4FD8A 2Y2GA 2Y91A 3W4OA 4X53A 5FAOA 2X71A 2PU2A 2V2FF 3NY4A 4OPYA 4RA7A 4X68A 2OLUA 3MXSA 3N8SA 4QY6A 4DF6A 4E6XA 3PBRA 4LENA 1XXMA 1IYOA 3PAGA 2XD5A 2X02A 2E8IA 3MZDA 2ZQ7A 4GD6A 4WM9A 1XKZA 4RYEA 5CEDA 4JKTA 4N92A 4WEKA 3CZDA 3N8RA 3GVBA 3Q07A 4OP8A 4S2MA 4Z9QA 3SS3A 3WS5A 4BD1A 1IYSA 3IWIA 3FKVA 5FI7A 2WUQA 3AGDA 5KMWA 4RX2A 1KVLA 3UY6A 4DE1A 5CTMA 4E3NA 3OCNA 1H8ZA 1IKGA 1XX2A 2EFXA 3GV9A 4JF4A 1ZC2A 1N9BA 4L0LA 2V20A 5M19A 1RP5A 2V1ZA 2Y2NA 4QJGA 3ZG0A 5HAPA 2Q9NA 5GLBA 4WYYA 1H8YA 5U47A 3SH8A 1HVBA 1QMFA 1WE4A 5TGFA 1JTGA 3BYDA 2H0YA 1K4EA 4HEFA 4HESA 4MEZA 2A3UA 3C4OA 3ZG5A 3BFFA 4KZ5A 3G30A 2WKHA 1KE3A 1OMEA 2EX8A 2XD1A 4WEJA 1IYPA 1NZUA 2WADA 3LO7A 1Z6FA 5TR7A 4DDSA 1GHIA 1LLBA 3BFCA 3IXDA 3NDGA 4R3JA 1KDSA 3IXBA 4D2OA 2Y2QA 5F1GA 3RXWA 1WYCA 4JF5A 4QHCA 4P87A 5CHMA 5FQQA 3IWQA 2J8YA 3BFDA 4OP5A 5GLCA 3V5MA 2WK0A 2XK1A 1NJ4A 4S2JA 4UA6A 4E3LA 1HTZA 3C5AA 3ZNYA 3G2YA 1S6RA 4MNRA 4P85A 3SOIA 4BL3A 3ZVWA 3Q82A 4OH0A 5F1FA 5M18A 3FV7A 3TG9A 5HFOA 4GD8A 4JPMA 1YMXA 3B3XA 4NETA 1HD8A 4OLGA 4S2NC 1K25A 3N7WA 4UAAA 1IYQA 3UE1A 1TVFA 4GDNA 4PM7A 3S4XA 1K6SA 4A5RA 3GSGA 1SCWA 4YINA 3NIAA 4DXBA 2Y2KA 4IVKA 3VMAA 1PIOA 4S2NA 3FYZA 3FZCA 5FQJA 5JYOA 1XGIA 5A93A 2XH9A 4OQIA 3RJUA 2J7VA 2Z2MB 1IELA 4X56A 4BLMA 3PBSA 4IEDA 5FI2A 4Q8IA 3A3FA 5FAQA 3UPNA 1KGFA 4JBFA 5F83A 4EWFA 1LI9A 4FH4A 1IKIA 3SH9A 1G68A 4QU3A 1ES3A 1BUEA 4S2KA 4IBRA 3WS2A 3WRZA 1O07A 3LY4A 1RCJA 1SDNA 4P6BA 3ITBA 4OLDA 5A92A 5BOHA 4E3OA 1PWGA 3BRMA 3W4QA 3VOYA 5GHXA 4BD0A 1ES2A 1TEMA 4B4XA 5CGWA 3ITAA 2RCXA 4PM5A 3P09A 5FDHA 4XUXA 3ZHHA 3DWZA 2XF3A 5HAQA 1W79A 3A3IA 1ERQA 2ZJ9A 2WGIA 2HPBA 1BLHA 3PBQA 4IBXA 1FQGA 3ZG7B 4Y0UA 1MBLA 3HUOA 3G32A 3HLBA 2ZQDA 5EVLA 1K55C 5GLAA 1ZKJA 3HLCA 2H0TA 2ZC3B 1S0WA 3A3EA 3O3VA 5DF8A 3VOZA 4OPQA 1K57C 1ONHA 2J9PA 2ZD8A 1EI5A 2ZM0A 3IHAA 5CGSA 1G6AA 5A91A 1I2WA 1MWUA 1KE0A 1K55A 3BECA 1M6KA 3Q7ZA 4PM8A 4C75A 3IQAA 3AGFA 3AGEA 2C5WB 3N6IA 3W8KA 1BZAA 1BTLA 1DJAA 5HL1A 1K57A 2Z2LB 2R9WA 4ID4A 1LI0A 1W5DA 2WKIA 5EVIC 4KZ3A 4Y7PA 1LL5A 3GR2A 2H5SA 1K56A 3E2KA 4B4ZA 2ZM8A 3UPPA 1L0EA 1BT5A 3IH9A 4H8RA 1L2SA 4OQGA 1L0FA 1NY0A 1RGZA 2Y2JA 1BULA 2HDUA 4S2PA 4DE3A 2GDNA 2QMIA 5CTNA 5EVIA 1XP4A 3UDXA 4DRTA 1GCEA 4BQMA 3DWKA 4EBLA 1K54C 1KVMA 5E43A 1L0GA 1FCOA 5EOEA 5EVIB 3UDFA 4GZBA 3S22A 3C7VA 4GN2A 3VP0A 5AQ9A 3V39A 2A49A 4PM9A 3SS4A 3UDIA 1YLPA 1M40A 5DTKA 3NCKA 1XPBA 1PWCA 1K54A 4DKIA 4N9KA 1GA9A 2Y2OA 3ZCZA 3Q7VA 1W7FA 4E3MA 1PW1A 4LCLA 2J9OA 1FSYA 3UE0A 4C3QA 3C4PA 5FATA 3M6BA 2PBYA 4LV0A 1YLJA 1H5XA 2IWCA 3OZHA 2X01A 3CMZA 3CG5A 5CRFA 2QPNA 1ESUA 1VQQA 1BSGA 1WYBA 4OQHA 4PM6A 3PAEA 4E6WA 2RL3A 1N4OA 5EECA 2WAFA 3QHYA 4MBHA 4EQIA 3HUNA 3M2JA 1KDWA 4JLFA 3MZFA 2IWBA 5FQKA 4K0XA 5CXWA 3BLMA 2WGWA 5EPHA 3NC8A 4XUZA 1MPLA 2JC7A 3PTEA 1DY6A 3JYIA 5D3OA 5FI6A 1NYMA 4GOGA 1MXOA 1JVJA 4MBKA 3M2KA 4Y0TA 4ZJ2A 1Q2QA 4ZBEA 2DRWA 4EBNA 5CHJA 4F94A 4LV2A 3WWXA
chains in the Genus database with same CATH superfamily
5DTTA 3G2ZA 1ES4A 4Q0HA 5EUAA 5KZHA 2Y2MA 2XFTA 4R0QA 1K38A 3QP2A 3MFXA 4WUJA 3UPOA 4EW7A 5GLDA 4QD4A 4R6LA 4LV1A 2O9BA 5FQ9A 2O9AA 2ZM2A 5I94A 3LEQA 4CLCC 4II7A 1ZTUA 4KQDA 4X6TA 2PYRA 3LIEA 2A24B 2Y59A 3QNCA 4B88A 2QHKA 5CGXA 3CJMA 3NDEA 4B93A 4H6JA 5E2HA 1K56D 5G18A 2G2UA 4QY5A 4KG2A 4WMCA 1D06A 2EX9A 1LL9A 3MKFA 2HP6A 3P98A 1GHPA 2OWJA 3IS2A 2GNXA 2IWDA 3PBOA 3BFGA 2ZQ8A 4S2IA 2P9VA 1YLTA 3UN7A 1F2KA 1JNUA 2VK3A 3GQZA 2VKSA 2HDQA 4HJ4A 4KUKA 1I2SA 3LUQA 4KG5A 3T4KA 3CHWP 2BLSA 1ES5A 4CJNA 4KENB 5KSCA 1UWPX 1MWSA 4N9LA 5AQBA 1NXYA 2PDRA 5CX7A 5M1AA 1PZOA 2WGVA 5HWVA 2I9VA 4LGWA 1S67L 3IF5A 4X55A 2EXAA 3ZNTA 3KYZA 4R3AA 2LB9A 3HCYA 4ETZA 5E2EA 5FDSA 3BFEA 3IF6A 1J9MA 2M7VA 2P74A 4ZJ1A 3G4PA 1ALQA 1L0DA 2WKEA 3EEAA 3WRTA 1DJCA 3PHYA 1W63M 2WGWB 4P0MA 3ZGAB 4GNUA 4FSFA 1PI5A 4X1MA 1K0KA 4R1GA 3QP6A 2VGJA 3HVFA 2DMWA 4KZ8A 3F1PA 4S2OA 4U0TA 4P6ZS 2OLVA 4BJPA 2WZZA 3WS4A 1E25A 4KZBA 2L1MA 2VV8A 3UMDA 1PWDA 3VP4A 1SKOB 1P9WA 2QJ7A 4L9FA 4NK3A 1BLSA 1K4FA 4UHUA 2ZMAA 1K6RA 1IOUA 3IWOA 1BLPA 3VP1A 2XLNA 4WELA 1FOFA 3DW0A 2JCHA 3B33A 3A0SA 4WMCD 5GHYA 1S4RA 1AXBA 1VHMA 1ESIA 5HSQA 3BJNA 4NXEA 5L2FA 4E3JA 2OAQ1 3OPRA 5TBMB 5DVAA 1G5UA 5AQ7A 3TJZC 4HBTA 1VM1A 2JKTM 1ONGA 4IVIA 1PNEA 3LIDA 3M6HA 3LFVA 4YOFA 5HWTA 2OSUA 1OJGA 3E4OA 4E3IA 2Y91A 3CUEC 2W1TA 5FAOA 2V2FF 4IUHA 4X68A 3MXSA 3N8SA 4E6XA 3MZDA 4RYEA 4JKTA 2G7UA 2M1CA 3GVBA 3FKVA 5FI7A 3RH8B 3UY6A 5CTMA 3OCNA 1XX2A 2NUTC 1ZC2A 1N9NA 5M19A 1RP5A 2V1ZA 2Y2NA 3ZG0A 5GLBA 1HVBA 4HP9A 3BYDA 3UB6A 5EV0A 4HESA 4MEZA 5HWWA 3ZG5A 1D1JA 2XD1A 2EX8A 2WADA 5TR7A 3T4OA 2Z6CA 4I3IA 5F1GA 3VP2A 1VB6A 4NEED 4S2JA 4EEPA 4BBTA 1HTZA 3ZNYA 1DRMA 3G2YA 3DTKA 5EM1A 4D60A 1S6RA 3ZQ5A 4GD8A 4UAAA 3B3XA 4S2NC 3N7WA 5LBRA 3EGDC 2VGLS 4PM7A 3S4XA 1K6SA 4A5RA 4HP4A 3GSGA 1SCWA 2HJ9C 4YINA 1WA9A 3NIAA 3NHQA 1BYWA 3RJUA 2XA7M 3A3FA 2UV0E 5FAQA 3UPNA 4JBFA 4EQ1A 3SH9A 4IBRA 2QYBA 3LY4A 4OLDA 4E3OA 3W4QA 3HJKA 4BD0A 2XROA 5AVFA 1ES2A 2MJ6A 4B4XA 2Y8HA 5FDHA 3A3IA 2WGIA 3ZG7B 3HLBA 5GLAA 5DKKA 2ZC3B 3T4TA 3UB9A 1YAXA 2ZD8A 3IHAA 4UQIM 1I2WA 1KE0A 3BECA 2FZ0A 4ETXA 1P0ZA 2Z6DA 3UB8A 3QP4A 4ID4A 3D9YA 1OTDA 3GR2A 2ZM8A 3K2NA 3UPPA 1BT5A 4OQGA 2Y2JA 1BULA 3NOTC 1S1ZA 1GCEA 4L9EA 4BQMA 3BWLA 4EBLA 4GZBA 4GN2A 3V39A 5MC7A 4DKIA 3ZCZA 4E3MA 4LCLA 2J9OA 1LSVA 4LV0A 3LIFA 3CG5A 3NJAA 4FOFA 1WYBA 4PM6A 2RL3A 1UGUA 4MBHA 3LI8A 2WGWA 2JKGA 4XUZA 3JYIA 5FEFA 1NYMA 1N9OA 4GS9A 3M2KA 1Q2QA 4Y17A 2DRWA 4ESPA 5FL3A 3SS5A 5HPIA 3T1RA 4R4SA 1KE4A 1XGJA 3VSLA 1MKIA 3ZVTA 4I3AA 2PBDP 1U60A 1SKOA 4X69A 3VSKA 5CERA 3MMHA 3QNBA 3MS6A 1CI9A 4M3KA 3F1NB 3O87A 4QWOA 3HLFA 3FWLA 2Y55A 3B47A 1O7EA 1OTAA 2V8CA 5FQIA 2V1AA 3SH7A 5J4EA 3QP1A 1W8QA 5GL9A 1EWZA 4CLCB 5C5KA 2XGNA 5TBMA 4RQ9A 2Y2PA 4OVDA 2KX6A 4OPRA 1W63Q 4MCWA 4GJ4A 3HLDA 3Q1FA 1CJFA 3CPTB 1GA0A 1JWZA 2EX6A 3EQVA 4KG6A 3KO6A 2Y4AA 4Q0IA 3MBZA 1YT4A 1CK3A 2EA9A 4G3WA 3HBRA 4U0XA 2D02A 1FILA 2XFSA 4DXCA 3MQOA 1Y4OA 1YSQA 4PMAA 4PAUA 4JGPA 2L4RA 4LCMA 2HJEA 3IF6C 1SHVA 4KQOA 2R9XA 1N9LA 4Y3IA 5DTSA 2VA0A 1OTIA 1TD5A 1C3BA 2ZC6B 1T1BA 5JYPA 1TDLA 3KSGA 3VFFA 2XRNA 4HQAA 4EUZA 1ACFA 3LYXA 3D72A 3U2AA 3T12B 1CI8A 4ZJ3A 2Y2HA 5F5YA 2JE5A 4WZ5C 2XA7S 2FH5A 2ZL1B 1NLYA 4ARZB 4ZRRA 1LT0A 2JKRI 4KZAA 5L07A 2XDMA 3IH8A 2DCFA 4MBFA 5FAPA 1PW8A 1NRFA 3TRCA 1TDGA 5FQMA 4R3BA 3PXPA 1OT6A 1T1CA 4YFMA 2HV1A 4G3KA 2JBFA 3PYPA 2WYXA 5DF9A 1E4DA 3A0RA 2ZLYA 4NKPA 1D7EA 4KZ4A 3VE4A 3VE3A 3BQ8A 3WS1A 4YNRA 3H7WB 2B95A 3HLEA 3H9WA 4DE2A 4KZ6A 4GHIA 4ZDXA 1Q2PA 4UA9A 2G2WA 4UQIS 3VFHA 3G34A 4FH2A 4DJ3A 2BG1A 2EWWA 4Z1WA 2NUPC 4I5SA 4JGOA 5EFWA 3H82A 2XEPA 1OTEA 2HDSA 2ZOHA 4I3JA 3TSGA 5IHVA 3KSFA 3S7NA 5FASA 2ZQAA 1FCMA 2W27A 5TFQA 3HREA 4WLAA 4FD8A 2Y2GA 4X53A 2K7SA 4F3LB 3NY4A 3O5YA 2OLUA 4LENA 3PAGA 2XD5A 2X02A 2E8IA 4GD6A 4WM9A 4WEKA 4BD1A 3SS3A 3KSHA 3IWIA 3IX3A 4RX2A 1KVLA 2EFXA 3CI6A 4L0LA 4NXBA 5HAPA 4QJGA 5U47A 4EXOA 1JTGA 1STZA 2H0YA 1K4EA 1VETB 3C4OA 3BFFA 4HNBA 4WEJA 3MQQA 2K31A 1GHIA 3IXDA 1KDSA 1WYCA 5CHMA 1NJ4A 5F69A 3QP5A 4UA6A 5HPFA 3SOIA 3OLOA 3Q82A 4NETA 1YMXA 1IYQA 1TF1A 1TVFA 4EEUA 5DFXA 1VEUA 3TE8A 5A93A 4X25A 5L8MA 1IELA 1XJ4A 3FC7A 4IEDA 4PKYG 2ZMVA 2CMNA 1A0KA 2JN7A 2D01A 1LI9A 1IKIA 5HL6A 5FEGA 1PFLA 1ES3A 1BUEA 1DP6A 3WS2A 3EOIA 1DP9A 1RCJA 3K3CA 1SDNA 5BOHA 1PWGA 2YKFA 4BWIA 1G28A 3F1NA 4LLOB 1HLUP 2RCXA 4LRXC 3ZHHA 3DWZA 3GECA 1W79A 1ERQA 4L9GA 2HPBA 1BLHA 3MF0A 4IBXA 4MMNA 1P97A 3G32A 4NXFA 4CLCA 1H8MA 2ZOIA 2PD7A 4OPQA 3C38A 4ME4A 1ONHA 2J9PA 4HJ3A 1EI5A 4EESA 2ZM0A 5CGSA 1M6KA 4I39A 3N6IA 1BTLA 5HL1A 1K57A 2Z2LB 3CPTA 2R9WA 2JKRM 1W5DA 2WKIA 4KZ3A 3S7OA 1LL5A 2R78A 1L0EA 4H8RA 1L2SA 1TS0A 1RGZA 3IBJA 2HDUA 4S2PA 4DE3A 5CTNA 1YPRA 5EVIA 3DTIA 3T1QB 1S4SA 1AWIA 3UDFA 3C7VA 5AQ9A 4PM9A 2L0WA 3UDIA 1M40A 1OPXA 1W7FA 3L7HA 1PW1A 3UE0A 3BY9A 2PR6A 2IWCA 3OZHA 2X01A 5CRFA 2QPNA 1VQQA 2WAFA 4XT2A 3SZTA 3HUNA 3M2JA 3KX0X 3MZFA 2PRFA 5FQKA 3E0YA 3NOUC 3PTEA 1DY6A 5FI6A 4GOGA 4MBKA 2ZL1A 4EBNA 3T1XA 3KSIA 3W4PA 4HH2A 3I7JA 5L10A 3MZEA 3LCEA 1MY8A 3IT9A 3NULA 5J8XA 1KGGA 5DF7A 3MQ0A 3E98A 4K91A 3OPHA 3HL9A 1FCNA 5HDDA 2EX2A 1JWVA 4OOYA 4R4RA 4BMWA 1GSXA 1HZOA 3V3RA 1T18A 1FSWA 3CAXA 3G6OA 4HI4A 5EE8A 5CEBA 1SDEA 4OPZA 4YWZA 3UE3A 4CLCD 3PBNA 2A24A 2EFUA 2OV5A 2QWSA 5K5BA 1E3UA 3RXXA 4RVAA 3H7WA 2UWXA 3C30A 3OPPA 1XA1A 5KSHA 1TS6A 2FFFB 3OPLA 1XFNA 4M4XA 5E2FA 1ZG6A 5EOOA 4OOMA 1MWTA 4CPKA 1IEMA 3DAVA 1OJ5A 4DDYA 1RGYA 3ZDJA 1XFQA 5EVID 4NXGA 3BQAA 3PBTA 3BEBA 3G35A 2DNSA 3IS2B 1TS8A 4ZAMA 3EQUA 4F3LA 2HP5A 4OONA 3G31A 1XJ2A 3GTCA 3A3JA 2ZQCA 1CEFA 1L3LA 2W3FA 3GMWA 4JF6A 5G4YA 4HJ6A 2J3WA 1NYYA 4KQRA 3A3DA 3VV4A 1CEGA 2QZ6A 3V50A 2WKRA 1Z09A 3D4FA 2W3DA 3V67A 3IF6B 4LV3A 2JHEA 3Q81A 5CHUA 2W3GA 5FSRA 1YM1A 4EETB 2ZC5B 3NBLA 2VX8A 4K0WA 4DJ2A 2WZXA 3ZFZA 5KIZA 5I5LA 3UO9A 3LEZA 4EV4A 4Y2FA 1GHMA 5J7EA 2O9CA 3LR5A 3O88A 1OT9A 3F1PB 2PT7A 2VEAA 3MXRA 2M7UA 1X0OA 1E3UD 5DJUA 3C8CA 4O0PA 5GHZA 3KYQA 1Y54A 2B02A 4O01A 2OAP1 3E2LA 4DE0A 1F5MA 4IJGA 1YQSA 4R23A 2Q9MA 2B5RA 5HW3A 2PAVP 3UNWA 4BL2A 4U3TA 3MR0A 1TS7A 5E2GA 3RFBA 2C6WB 2WAEA 3VP3A 3BLSA 2ZQ9A 1FR6A 2PYPA 3FPVA 4UA7A 5IU1A 2B18A 4OQ0A 2ZC7A 1BLCA 4I38A 2VLGA 3HJIA 3ULFA 2W1RA 4GKUA 4EBPA 3ZG9B 1YLYA 4C6YA 1YLWA 3LR3A 2CC1A 4OKPA 3BM6A 3W4OA 2X71A 2PU2A 4OPYA 4RA7A 4DF6A 3PBRA 4LRYC 1XXMA 1XJ6A 2W1TB 3MJQA 1S66L 1XKZA 5CEDA 3Q07A 4S2MA 4Z9QA 3WS5A 4MN7A 2LB5A 1H8ZA 4JF4A 3W2ZA 1YKDA 3UB7A 2J3TD 3SH8A 1QMFA 3VOLA 3DBAA 4KZ5A 4Y13A 2WKHA 1KE3A 1OMEA 2INWA 5EM0A 1NZUA 1EW0A 3LO7A 4DDSA 2J80A 4R3JA 4D2OA 5FQQA 3V5MA 2J8YA 3BFDA 1SZVA 2WK0A 2ZBBA 4MDZA 3C5AA 4FTXA 4MNRA 4P85A 4BL3A 2O0YA 3ZVWA 4OH0A 5F1FA 5M18A 5HFOA 3FG8A 3T4JA 3UE1A 4GDNA 3NECA 3F1OB 2Y2KA 3VMAA 2H28A 2HF6A 1XGIA 2Z2MB 4WN5A 4BLMA 2KOIA 3LI9A 5FI2A 4Q8IA 4HH3A 1MKMA 3TW8A 4EU0A 4LFUA 4EWFA 4FH4A 1G68A 2VGLM 3WRZA 3BRMA 3VOYA 5GHXA 2V0WA 1TEMA 2BTFP 3S7QA 5CGWA 5HDCA 2E8JA 5IT5A 1NWZA 4XUXA 2V0UA 3UB5P 5HAQA 2ZJ9A 1FQGA 4IHQA 3HUOA 2ZQDA 1XJ3A 3O3VA 5DF8A 3VOZA 3CWFA 3KYEA 3LIAA 1K57C 5AVEA 2VV7A 1G6AA 1MWUA 1K55A 3Q7ZA 4C75A 3IQAA 4HOIA 3AGEA 2C5WB 3EWKA 1DJAA 4BBUA 3K3DA 1LI0A 5EVIC 4Y7PA 3IH9A 3E4PA 1L0FA 1NY0A 1XP4A 2JKFA 2BASA 5E43A 1L0GA 5EOEA 2A49A 3SS4A 5DTKA 4DN0A 1PWCA 2HZ5A 1K54A 4N9KA 5DJTA 2Y2OA 3P7NA 3T4LA 1FSYA 1LSXA 3C4PA 2PBYA 1H5XA 3PR6A 3CMZA 1ESUA 3PAEA 1UWNX 4E04A 4E6WA 2Y79A 5EECA 1H3QA 1GSVA 4UEYA 4EQIA 4HY8A 4JLFA 4K0XA 3NC8A 5D3OA 3JVUA 3GDIA 1JVJA 4Y0TA 4GS9B 1NLZA 4LV2A 3WWXA 3LR4A 4Y15A 4JXSA 3IHBA 5IS1A 4BENA 4WZ5A 4DMZA 4FCFA 2H10A 5HX9A 3EEHA 3OC2A 1LL8A 5F82A 5G4ZA 4OOLA 1PI4A 3LR0A 4KUOA 2PU4A 4WBGA 2EXBA 1CQAA 1PYYA 4XXRA 1JWPA 4B9OA 2ZC4B 3A0VA 3JVVA 2Y2LA 1DP8A 4R70A 5DFYA 1DJBA 4HBUA 5F68A 2VJWA 3IX8A 4WZ4A 1ERMA 2ACGA 3HLWA 5HARA 5FA7A 2VGKA 5AQAA 4KZ7A 3NOPC 1NZOA 5HZHA 3MKEA 2FFYA 3N8LA 5DKLA 1S1YA 3T50A 4EUVA 2WKPA 1ODVA 4HIAA 3GRJA 4N1HA 4ZTKA 3R7WB 4X1LA 3D3OA 4Y0OA 5HAIA 3HLGA 3UMEA 2EWVA 3HUMA 4JGRA 3N4IA 3C2WA 2W0NA 3Q7VB 2KLIA 1LSWA 3LICA 2WKQA 4N1XA 2VV6A 3DTMA 4WF0A 3TOIA 2W3HA 2J3TC 3OCLA 1ZG4A 4O7DA 4E3KA 1LHYA 2I72A 4O8GA 1EROA 4JXVA 4RX3A 4S2LA 5CECA 5TJJA 3ZG8B 4KQQA 2HGVA 3LY3A 4QPRA 4ARZA 3S1YA 2IA2A 1W8YA 4LRZE 3IXGA 3U4LP 3C7UA 3O86A 1PZPA 1YMSA 1I5QA 2KDKA 1QMEA 4JXWA 3F1OA 1GSWA 1V9YA 4PPRA 3LGOA 1PRQA 5A90A 1JTDA 3ISGA 1FR1A 2XQZA 2A2LA 1YSPA 2HDRA 3NI9A 5F6AA 2HP9A 3IBRA 1YLZA 1SKFA 4IUKA 1J3WA 4KZ9A 4JXGA 2Y2IA 4GDBA 3MXQA 4MLLA 3IXHA 4GCZA 1P9RA 3ICYA 4Y5FA 4GB7A 4PKYA 3MFDA 2XR0A 4CLCE 3OBFA 3IX4A 4NG2A 3R4KA 4GHIB 2GZAA 3LIBA 4H6JB 5A8BA 3FKWA 4QB8A 1MWRA 3WS0A 1V9ZA 2XSSA 3H82B 2AVXA 1KGEA 3V3SA 2P9VB 4GW9A 1XA7A 2PD8A 2GX5A 1MZUA 3L9KA 4QY6A 3UE6A 1IYOA 1F9IA 1FIKA 2ZQ7A 4N92A 2P08A 3CUEA 3CZDA 3N8RA 4GLQA 4OP8A 1IYSA 2O99A 2WUQA 3AGDA 5KMWA 4DE1A 4E3NA 1IKGA 3GV9A 2Q0OA 1N9BA 2V20A 2Q9NA 4WYYA 1VETA 1H8YA 1T1AA 4K08A 1WE4A 5TGFA 1G6OA 5EVEA 4HEFA 2A3UA 2QKPA 3G30A 1IYPA 1KOUA 3P01A 1Z6FA 1LLBA 3BFCA 3NDGA 3IXBA 2Y2QA 3RXWA 1ZHHB 4JF5A 4QHCA 4P87A 5GLCA 3IWQA 3DTEA 4OP5A 4JGQA 2XK1A 2PR5A 4E3LA 2GJ3A 5AJGA 3FV7A 3TG9A 3T1SA 4JPMA 4OLGA 1HD8A 1K25A 3RTYA 2P04A 4FUWA 4CQHA 4MN6A 4DXBA 4IVKA 1PIOA 4S2NA 3FYZA 3FZCA 3SW1A 5FQJA 5JYOA 2XH9A 5HDSA 4OQIA 2J7VA 1VEUB 4X56A 1IFQA 3PBSA 2OWHA 1KGFA 3BY8A 2OOLA 5F83A 4QU3A 4S2KA 4PHTA 1O07A 4P6ZM 4P6BA 3ITBA 5A92A 3OOVA 5J3WA 1MC0A 3ITAA 3JPUA 4PM5A 3P09A 3S7PA 2XF3A 1CF0A 2P7JA 3PBQA 2V1BA 2QJ5A 3ZYTA 4Y0UA 1MBLA 3MSHA 4HHDA 4LPZA 5EVLA 1K55C 1ZKJA 3HLCA 2H0TA 1H0MA 1S0WA 3A3EA 3B42A 5A91A 4WL9A 4PM8A 4MN5A 2W3EA 3AGFA 3EGXC 3W8KA 1BZAA 4R38A 4G3VA 2H5SA 1K56A 3E2KA 4B4ZA 3R7WA 3BW6A 2GDNA 2QMIA 4Q0JA 3UDXA 4DRTA 4EERA 3DWKA 3FPWA 1K54C 2V9AA 1KVMA 1FCOA 5EVIB 3S22A 3VP0A 1NRJA 5L09A 1F98A 1YLPA 1Y28A 3NCKA 1XPBA 3CLOA 2ZMFA 1GA9A 3Q7VA 2K2NA 4C3QA 1T19A 3M6BA 5FATA 1YLJA 1BSGA 1OTBA 3E4QA 4OQHA 5HD3A 1N4OA 2V8FA 3QHYA 3QP8A 1KDWA 4AFIA 2VZWA 2IWBA 4XT2B 5CXWA 3BLMA 5EPHA 3T4QA 2PHYA 2JKTI 4BBVA 1MPLA 2JC7A 3T4SA 1MXOA 4ZJ2A 2YKHA 4ZBEA 5HD5A 5CHJA 4F94A 3CITA
chains in the Genus database with same CATH topology
3W4PA 5DTTA 3I7JA 3MZEA 4JXSA 3LCEA 1MY8A 3G2ZA 3IHBA 3IT9A 5J8XA 1ES4A 5EUAA 3SS5A 4BENA 1KGGA 4WZ5A 5DF7A 5KZHA 2Y2MA 4K91A 4FCFA 3OPHA 2H10A 2XFTA 3HL9A 5HX9A 1FCNA 4R4SA 4R0QA 3OC2A 5F82A 1K38A 2EX2A 1KE4A 1JWVA 1XGJA 4OOYA 1MKIA 4R4RA 4OOLA 3VSLA 3ZVTA 1PI4A 1U60A 1HZOA 4X69A 3V3RA 3UPOA 3VSKA 2PU4A 5GLDA 1FSWA 4QD4A 4LV1A 4WBGA 5CERA 2EXBA 5EE8A 5FQ9A 3QNBA 5CEBA 1SDEA 4OPZA 2ZM2A 3UE3A 1PYYA 1CI9A 4XXRA 4M3KA 1JWPA 3PBNA 5I94A 2ZC4B 3O87A 2EFUA 3HLFA 2OV5A 3FWLA 1E3UA 4X6TA 3RXXA 2Y2LA 4RVAA 2Y55A 2UWXA 1O7EA 5FQIA 3SH7A 2Y59A 1DJBA 4HBUA 3VP2A 3QNCA 1W8QA 5GL9A 3OPPA 4WZ4A 4B88A 1EWZA 1ERMA 5CGXA 3HLWA 5HARA 1XA1A 3CJMA 5KSHA 2XGNA 2FFFB 3NDEA 3OPLA 5FA7A 5E2HA 5E2FA 1ZG6A 1K56D 2VGKA 5EOOA 5G18A 2Y2PA 1MWTA 4OOMA 5AQAA 2G2UA 4KZ7A 4OVDA 4QY5A 4CPKA 1IEMA 4KG2A 4WMCA 4DDYA 1NZOA 1RGYA 1LL9A 2EX9A 3MKFA 4OPRA 3ZDJA 5EVID 2HP6A 3P98A 3PBTA 1GHPA 3BEBA 3MKEA 2FFYA 3G35A 2DNSA 3HLDA 2IWDA 3Q1FA 3N8LA 3PBOA 1GA0A 1JWZA 2EX6A 3BFGA 2ZQ8A 3EQVA 2P9VA 1YLTA 4KG6A 4S2IA 3UN7A 3GQZA 4ZAMA 2Y4AA 2HDQA 3EQUA 1I2SA 4KG5A 3GRJA 4N1HA 3MBZA 1YT4A 2BLSA 2HP5A 1CK3A 1ES5A 4OONA 4ZTKA 4CJNA 4KENB 3G31A 3HBRA 5KSCA 4U0XA 3GTCA 1MWSA 2XFSA 3A3JA 2ZQCA 1CEFA 4DXCA 4N9LA 4Y0OA 5AQBA 5HAIA 3HLGA 1NXYA 5M1AA 1PZOA 2WGVA 3HUMA 3GMWA 4JF6A 4PMAA 3N4IA 4LCMA 3IF5A 4X55A 2EXAA 3IF6C 1SHVA 4KQOA 3ZNTA 1NYYA 3Q7VB 2R9XA 4KQRA 5DTSA 3A3DA 4N1XA 1C3BA 2ZC6B 1CEGA 3DTMA 2QZ6A 5E2EA 3BFEA 3IF6A 1J9MA 3V50A 3TOIA 5JYPA 1TDLA 2P74A 3D4FA 3OCLA 1ZG4A 4ZJ1A 4O7DA 4E3KA 3VFFA 1LHYA 2I72A 3G4PA 1ALQA 1L0DA 3IF6B 1EROA 4JXVA 4LV3A 4RX3A 2WKEA 4EUZA 3Q81A 4S2LA 5CECA 3WRTA 1DJCA 5CHUA 2WGWB 3ZG8B 1CI8A 4P0MA 4ZJ3A 2Y2HA 3ZGAB 4GNUA 5FSRA 4KQQA 1YM1A 3LY3A 2JE5A 2ZC5B 3NBLA 4WZ5C 3S1YA 4FSFA 1W8YA 1PI5A 3IXGA 3C7UA 3O86A 4K0WA 4R1GA 1PZPA 2WZXA 2VGJA 3HVFA 3ZFZA 1YMSA 3UO9A 1I5QA 3LEZA 4EV4A 4KZ8A 1GHMA 1QMEA 4JXWA 4KZAA 4S2OA 4PPRA 5A90A 4U0TA 3O88A 2XDMA 3IH8A 1JTDA 2OLVA 3ISGA 2DCFA 4BJPA 1FR1A 4MBFA 2XQZA 5FAPA 2WZZA 1PW8A 3WS4A 1NRFA 1E25A 1TDGA 4KZBA 4R3BA 5FQMA 3MXRA 4YFMA 1E3UD 2HDRA 3NI9A 2JBFA 2HP9A 1PWDA 3VP4A 1YLZA 2WYXA 5DF9A 1E4DA 4NK3A 5GHZA 1BLSA 1Y54A 1K4FA 1SKFA 4UHUA 2ZMAA 1K6RA 2ZLYA 4KZ9A 4JXGA 2Y2IA 4GDBA 3E2LA 4DE0A 3IWOA 1BLPA 4KZ4A 1YQSA 4R23A 3VP1A 4MLLA 2Q9MA 3IXHA 2B5RA 2XLNA 5HW3A 4WELA 1FOFA 3DW0A 2JCHA 3UNWA 4U3TA 3WS1A 4GB7A 4BL2A 5E2GA 2C6WB 3HLEA 2WAEA 4WMCD 3BLSA 2ZQ9A 5GHYA 3VP3A 4KZ6A 4DE2A 3MFDA 1AXBA 2XR0A 4ZDXA 1ESIA 1FR6A 1Q2PA 4UA9A 2G2WA 3VFHA 4UA7A 3G34A 5L2FA 4E3JA 4FH2A 2BG1A 3OPRA 4OQ0A 5DVAA 5AQ7A 3FKWA 4HBTA 2XEPA 1VM1A 2ZC7A 4QB8A 1ONGA 4IVIA 1BLCA 1MWRA 3WS0A 2HDSA 3TSGA 5IHVA 4GKUA 3M6HA 4EBPA 3ZG9B 1YLYA 4C6YA 2OSUA 5FASA 1KGEA 3V3SA 2ZQAA 2P9VB 1YLWA 1FCMA 5TFQA 4E3IA 3HREA 2CC1A 4OKPA 1XA7A 3BM6A 4FD8A 2Y2GA 2Y91A 3W4OA 4X53A 5FAOA 2X71A 2PU2A 2V2FF 3NY4A 4OPYA 4RA7A 4X68A 2OLUA 3MXSA 3N8SA 4QY6A 4DF6A 4E6XA 3PBRA 4LENA 1XXMA 1IYOA 3PAGA 2XD5A 2X02A 2E8IA 3MZDA 2ZQ7A 4GD6A 4WM9A 1XKZA 4RYEA 5CEDA 4JKTA 4N92A 4WEKA 3CZDA 3N8RA 3GVBA 3Q07A 4OP8A 4S2MA 4Z9QA 3SS3A 3WS5A 4BD1A 1IYSA 3IWIA 3FKVA 5FI7A 2WUQA 3AGDA 5KMWA 4RX2A 1KVLA 3UY6A 4DE1A 5CTMA 4E3NA 3OCNA 1H8ZA 1IKGA 1XX2A 2EFXA 3GV9A 4JF4A 1ZC2A 1N9BA 4L0LA 2V20A 5M19A 1RP5A 2V1ZA 2Y2NA 4QJGA 3ZG0A 5HAPA 2Q9NA 5GLBA 4WYYA 1H8YA 5U47A 3SH8A 1HVBA 1QMFA 1WE4A 5TGFA 1JTGA 3BYDA 2H0YA 1K4EA 4HEFA 4HESA 4MEZA 2A3UA 3C4OA 3ZG5A 3BFFA 4KZ5A 3G30A 2WKHA 1KE3A 1OMEA 2EX8A 2XD1A 4WEJA 1IYPA 1NZUA 2WADA 3LO7A 1Z6FA 5TR7A 4DDSA 1GHIA 1LLBA 3BFCA 3IXDA 3NDGA 4R3JA 1KDSA 3IXBA 4D2OA 2Y2QA 5F1GA 3RXWA 1WYCA 4JF5A 4QHCA 4P87A 5CHMA 5FQQA 3IWQA 2J8YA 3BFDA 4OP5A 5GLCA 3V5MA 2WK0A 2XK1A 1NJ4A 4S2JA 4UA6A 4E3LA 1HTZA 3C5AA 3ZNYA 3G2YA 1S6RA 4MNRA 4P85A 3SOIA 4BL3A 3ZVWA 3Q82A 4OH0A 5F1FA 5M18A 3FV7A 3TG9A 5HFOA 4GD8A 4JPMA 1YMXA 3B3XA 4NETA 1HD8A 4OLGA 4S2NC 1K25A 3N7WA 4UAAA 1IYQA 3UE1A 1TVFA 4GDNA 4PM7A 3S4XA 1K6SA 4A5RA 3GSGA 1SCWA 4YINA 3NIAA 4DXBA 2Y2KA 4IVKA 3VMAA 1PIOA 4S2NA 3FYZA 3FZCA 5FQJA 5JYOA 1XGIA 5A93A 2XH9A 4OQIA 3RJUA 2J7VA 2Z2MB 1IELA 4X56A 4BLMA 3PBSA 4IEDA 5FI2A 4Q8IA 3A3FA 5FAQA 3UPNA 1KGFA 4JBFA 5F83A 4EWFA 1LI9A 4FH4A 1IKIA 3SH9A 1G68A 4QU3A 1ES3A 1BUEA 4S2KA 4IBRA 3WS2A 3WRZA 1O07A 3LY4A 1RCJA 1SDNA 4P6BA 3ITBA 4OLDA 5A92A 5BOHA 4E3OA 1PWGA 3BRMA 3W4QA 3VOYA 5GHXA 4BD0A 1ES2A 1TEMA 4B4XA 5CGWA 3ITAA 2RCXA 4PM5A 3P09A 5FDHA 4XUXA 3ZHHA 3DWZA 2XF3A 5HAQA 1W79A 3A3IA 1ERQA 2ZJ9A 2WGIA 2HPBA 1BLHA 3PBQA 4IBXA 1FQGA 3ZG7B 4Y0UA 1MBLA 3HUOA 3G32A 3HLBA 2ZQDA 5EVLA 1K55C 5GLAA 1ZKJA 3HLCA 2H0TA 2ZC3B 1S0WA 3A3EA 3O3VA 5DF8A 3VOZA 4OPQA 1K57C 1ONHA 2J9PA 2ZD8A 1EI5A 2ZM0A 3IHAA 5CGSA 1G6AA 5A91A 1I2WA 1MWUA 1KE0A 1K55A 3BECA 1M6KA 3Q7ZA 4PM8A 4C75A 3IQAA 3AGFA 3AGEA 2C5WB 3N6IA 3W8KA 1BZAA 1BTLA 1DJAA 5HL1A 1K57A 2Z2LB 2R9WA 4ID4A 1LI0A 1W5DA 2WKIA 5EVIC 4KZ3A 4Y7PA 1LL5A 3GR2A 2H5SA 1K56A 3E2KA 4B4ZA 2ZM8A 3UPPA 1L0EA 1BT5A 3IH9A 4H8RA 1L2SA 4OQGA 1L0FA 1NY0A 1RGZA 2Y2JA 1BULA 2HDUA 4S2PA 4DE3A 2GDNA 2QMIA 5CTNA 5EVIA 1XP4A 3UDXA 4DRTA 1GCEA 4BQMA 3DWKA 4EBLA 1K54C 1KVMA 5E43A 1L0GA 1FCOA 5EOEA 5EVIB 3UDFA 4GZBA 3S22A 3C7VA 4GN2A 3VP0A 5AQ9A 3V39A 2A49A 4PM9A 3SS4A 3UDIA 1YLPA 1M40A 5DTKA 3NCKA 1XPBA 1PWCA 1K54A 4DKIA 4N9KA 1GA9A 2Y2OA 3ZCZA 3Q7VA 1W7FA 4E3MA 1PW1A 4LCLA 2J9OA 1FSYA 3UE0A 4C3QA 3C4PA 5FATA 3M6BA 2PBYA 4LV0A 1YLJA 1H5XA 2IWCA 3OZHA 2X01A 3CMZA 3CG5A 5CRFA 2QPNA 1ESUA 1VQQA 1BSGA 1WYBA 4OQHA 4PM6A 3PAEA 4E6WA 2RL3A 1N4OA 5EECA 2WAFA 3QHYA 4MBHA 4EQIA 3HUNA 3M2JA 1KDWA 4JLFA 3MZFA 2IWBA 5FQKA 4K0XA 5CXWA 3BLMA 2WGWA 5EPHA 3NC8A 4XUZA 1MPLA 2JC7A 3PTEA 1DY6A 3JYIA 5D3OA 5FI6A 1NYMA 4GOGA 1MXOA 1JVJA 4MBKA 3M2KA 4Y0TA 4ZJ2A 1Q2QA 4ZBEA 2DRWA 4EBNA 5CHJA 4F94A 4LV2A 3WWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W4P A;  5DTT A;  3I7J A;  3MZE A;  4JXS A;  3LCE A;  1MY8 A;  3G2Z A;  3IHB A;  3IT9 A;  5J8X A;  1ES4 A;  5EUA A;  3SS5 A;  4BEN A;  1KGG A;  4WZ5 A;  5DF7 A;  5KZH A;  2Y2M A;  4K91 A;  4FCF A;  3OPH A;  2H10 A;  2XFT A;  3HL9 A;  5HX9 A;  1FCN A;  4R4S A;  4R0Q A;  3OC2 A;  5F82 A;  1K38 A;  2EX2 A;  1KE4 A;  1JWV A;  1XGJ A;  4OOY A;  1MKI A;  4R4R A;  4OOL A;  3VSL A;  3ZVT A;  1PI4 A;  1U60 A;  1HZO A;  4X69 A;  3V3R A;  3UPO A;  3VSK A;  2PU4 A;  5GLD A;  1FSW A;  4QD4 A;  4LV1 A;  4WBG A;  5CER A;  2EXB A;  5EE8 A;  5FQ9 A;  3QNB A;  5CEB A;  1SDE A;  4OPZ A;  2ZM2 A;  3UE3 A;  1PYY A;  1CI9 A;  4XXR A;  4M3K A;  1JWP A;  3PBN A;  5I94 A;  2ZC4 B;  3O87 A;  2EFU A;  3HLF A;  2OV5 A;  3FWL A;  1E3U A;  4X6T A;  3RXX A;  2Y2L A;  4RVA A;  2Y55 A;  2UWX A;  1O7E A;  5FQI A;  3SH7 A;  2Y59 A;  1DJB A;  4HBU A;  3VP2 A;  3QNC A;  1W8Q A;  5GL9 A;  3OPP A;  4WZ4 A;  4B88 A;  1EWZ A;  1ERM A;  5CGX A;  3HLW A;  5HAR A;  1XA1 A;  3CJM A;  5KSH A;  2XGN A;  2FFF B;  3NDE A;  3OPL A;  5FA7 A;  5E2H A;  5E2F A;  1ZG6 A;  1K56 D;  2VGK A;  5EOO A;  5G18 A;  2Y2P A;  1MWT A;  4OOM A;  5AQA A;  2G2U A;  4KZ7 A;  4OVD A;  4QY5 A;  4CPK A;  1IEM A;  4KG2 A;  4WMC A;  4DDY A;  1NZO A;  1RGY A;  1LL9 A;  2EX9 A;  3MKF A;  4OPR A;  3ZDJ A;  5EVI D;  2HP6 A;  3P98 A;  3PBT A;  1GHP A;  3BEB A;  3MKE A;  2FFY A;  3G35 A;  2DNS A;  3HLD A;  2IWD A;  3Q1F A;  3N8L A;  3PBO A;  1GA0 A;  1JWZ A;  2EX6 A;  3BFG A;  2ZQ8 A;  3EQV A;  2P9V A;  1YLT A;  4KG6 A;  4S2I A;  3UN7 A;  3GQZ A;  4ZAM A;  2Y4A A;  2HDQ A;  3EQU A;  1I2S A;  4KG5 A;  3GRJ A;  4N1H A;  3MBZ A;  1YT4 A;  2BLS A;  2HP5 A;  1CK3 A;  1ES5 A;  4OON A;  4ZTK A;  4CJN A;  4KEN B;  3G31 A;  3HBR A;  5KSC A;  4U0X A;  3GTC A;  1MWS A;  2XFS A;  3A3J A;  2ZQC A;  1CEF A;  4DXC A;  4N9L A;  4Y0O A;  5AQB A;  5HAI A;  3HLG A;  1NXY A;  5M1A A;  1PZO A;  2WGV A;  3HUM A;  3GMW A;  4JF6 A;  4PMA A;  3N4I A;  4LCM A;  3IF5 A;  4X55 A;  2EXA A;  3IF6 C;  1SHV A;  4KQO A;  3ZNT A;  1NYY A;  3Q7V B;  2R9X A;  4KQR A;  5DTS A;  3A3D A;  4N1X A;  1C3B A;  2ZC6 B;  1CEG A;  3DTM A;  2QZ6 A;  5E2E A;  3BFE A;  3IF6 A;  1J9M A;  3V50 A;  3TOI A;  5JYP A;  1TDL A;  2P74 A;  3D4F A;  3OCL A;  1ZG4 A;  4ZJ1 A;  4O7D A;  4E3K A;  3VFF A;  1LHY A;  2I72 A;  3G4P A;  1ALQ A;  1L0D A;  3IF6 B;  1ERO A;  4JXV A;  4LV3 A;  4RX3 A;  2WKE A;  4EUZ A;  3Q81 A;  4S2L A;  5CEC A;  3WRT A;  1DJC A;  5CHU A;  2WGW B;  3ZG8 B;  1CI8 A;  4P0M A;  4ZJ3 A;  2Y2H A;  3ZGA B;  4GNU A;  5FSR A;  4KQQ A;  1YM1 A;  3LY3 A;  2JE5 A;  2ZC5 B;  3NBL A;  4WZ5 C;  3S1Y A;  4FSF A;  1W8Y A;  1PI5 A;  3IXG A;  3C7U A;  3O86 A;  4K0W A;  4R1G A;  1PZP A;  2WZX A;  2VGJ A;  3HVF A;  3ZFZ A;  1YMS A;  3UO9 A;  1I5Q A;  3LEZ A;  4EV4 A;  4KZ8 A;  1GHM A;  1QME A;  4JXW A;  4KZA A;  4S2O A;  4PPR A;  5A90 A;  4U0T A;  3O88 A;  2XDM A;  3IH8 A;  1JTD A;  2OLV A;  3ISG A;  2DCF A;  4BJP A;  1FR1 A;  4MBF A;  2XQZ A;  5FAP A;  2WZZ A;  1PW8 A;  3WS4 A;  1NRF A;  1E25 A;  1TDG A;  4KZB A;  4R3B A;  5FQM A;  3MXR A;  4YFM A;  1E3U D;  2HDR A;  3NI9 A;  2JBF A;  2HP9 A;  1PWD A;  3VP4 A;  1YLZ A;  2WYX A;  5DF9 A;  1E4D A;  4NK3 A;  5GHZ A;  1BLS A;  1Y54 A;  1K4F A;  1SKF A;  4UHU A;  2ZMA A;  1K6R A;  2ZLY A;  4KZ9 A;  4JXG A;  2Y2I A;  4GDB A;  3E2L A;  4DE0 A;  3IWO A;  1BLP A;  4KZ4 A;  1YQS A;  4R23 A;  3VP1 A;  4MLL A;  2Q9M A;  3IXH A;  2B5R A;  2XLN A;  5HW3 A;  4WEL A;  1FOF A;  3DW0 A;  2JCH A;  3UNW A;  4U3T A;  3WS1 A;  4GB7 A;  4BL2 A;  5E2G A;  2C6W B;  3HLE A;  2WAE A;  4WMC D;  3BLS A;  2ZQ9 A;  5GHY A;  3VP3 A;  4KZ6 A;  4DE2 A;  3MFD A;  1AXB A;  2XR0 A;  4ZDX A;  1ESI A;  1FR6 A;  1Q2P A;  4UA9 A;  2G2W A;  3VFH A;  4UA7 A;  3G34 A;  5L2F A;  4E3J A;  4FH2 A;  2BG1 A;  3OPR A;  4OQ0 A;  5DVA A;  5AQ7 A;  3FKW A;  4HBT A;  2XEP A;  1VM1 A;  2ZC7 A;  4QB8 A;  1ONG A;  4IVI A;  1BLC A;  1MWR A;  3WS0 A;  2HDS A;  3TSG A;  5IHV A;  4GKU A;  3M6H A;  4EBP A;  3ZG9 B;  1YLY A;  4C6Y A;  2OSU A;  5FAS A;  1KGE A;  3V3S A;  2ZQA A;  2P9V B;  1YLW A;  1FCM A;  5TFQ A;  4E3I A;  3HRE A;  2CC1 A;  4OKP A;  1XA7 A;  3BM6 A;  4FD8 A;  2Y2G A;  2Y91 A;  3W4O A;  4X53 A;  5FAO A;  2X71 A;  2PU2 A;  2V2F F;  3NY4 A;  4OPY A;  4RA7 A;  4X68 A;  2OLU A;  3MXS A;  3N8S A;  4QY6 A;  4DF6 A;  4E6X A;  3PBR A;  4LEN A;  1XXM A;  1IYO A;  3PAG A;  2XD5 A;  2X02 A;  2E8I A;  3MZD A;  2ZQ7 A;  4GD6 A;  4WM9 A;  1XKZ A;  4RYE A;  5CED A;  4JKT A;  4N92 A;  4WEK A;  3CZD A;  3N8R A;  3GVB A;  3Q07 A;  4OP8 A;  4S2M A;  4Z9Q A;  3SS3 A;  3WS5 A;  4BD1 A;  1IYS A;  3IWI A;  3FKV A;  5FI7 A;  2WUQ A;  3AGD A;  5KMW A;  4RX2 A;  1KVL A;  3UY6 A;  4DE1 A;  5CTM A;  4E3N A;  3OCN A;  1H8Z A;  1IKG A;  1XX2 A;  2EFX A;  3GV9 A;  4JF4 A;  1ZC2 A;  1N9B A;  4L0L A;  2V20 A;  5M19 A;  1RP5 A;  2V1Z A;  2Y2N A;  4QJG A;  3ZG0 A;  5HAP A;  2Q9N A;  5GLB A;  4WYY A;  1H8Y A;  5U47 A;  3SH8 A;  1HVB A;  1QMF A;  1WE4 A;  5TGF A;  1JTG A;  3BYD A;  2H0Y A;  1K4E A;  4HEF A;  4HES A;  4MEZ A;  2A3U A;  3C4O A;  3ZG5 A;  3BFF A;  4KZ5 A;  3G30 A;  2WKH A;  1KE3 A;  1OME A;  2EX8 A;  2XD1 A;  4WEJ A;  1IYP A;  1NZU A;  2WAD A;  3LO7 A;  1Z6F A;  5TR7 A;  4DDS A;  1GHI A;  1LLB A;  3BFC A;  3IXD A;  3NDG A;  4R3J A;  1KDS A;  3IXB A;  4D2O A;  2Y2Q A;  5F1G A;  3RXW A;  1WYC A;  4JF5 A;  4QHC A;  4P87 A;  5CHM A;  5FQQ A;  3IWQ A;  2J8Y A;  3BFD A;  4OP5 A;  5GLC A;  3V5M A;  2WK0 A;  2XK1 A;  1NJ4 A;  4S2J A;  4UA6 A;  4E3L A;  1HTZ A;  3C5A A;  3ZNY A;  3G2Y A;  1S6R A;  4MNR A;  4P85 A;  3SOI A;  4BL3 A;  3ZVW A;  3Q82 A;  4OH0 A;  5F1F A;  5M18 A;  3FV7 A;  3TG9 A;  5HFO A;  4GD8 A;  4JPM A;  1YMX A;  3B3X A;  4NET A;  1HD8 A;  4OLG A;  4S2N C;  1K25 A;  3N7W A;  4UAA A;  1IYQ A;  3UE1 A;  1TVF A;  4GDN A;  4PM7 A;  3S4X A;  1K6S A;  4A5R A;  3GSG A;  1SCW A;  4YIN A;  3NIA A;  4DXB A;  2Y2K A;  4IVK A;  3VMA A;  1PIO A;  4S2N A;  3FYZ A;  3FZC A;  5FQJ A;  5JYO A;  1XGI A;  5A93 A;  2XH9 A;  4OQI A;  3RJU A;  2J7V A;  2Z2M B;  1IEL A;  4X56 A;  4BLM A;  3PBS A;  4IED A;  5FI2 A;  4Q8I A;  3A3F A;  5FAQ A;  3UPN A;  1KGF A;  4JBF A;  5F83 A;  4EWF A;  1LI9 A;  4FH4 A;  1IKI A;  3SH9 A;  1G68 A;  4QU3 A;  1ES3 A;  1BUE A;  4S2K A;  4IBR A;  3WS2 A;  3WRZ A;  1O07 A;  3LY4 A;  1RCJ A;  1SDN A;  4P6B A;  3ITB A;  4OLD A;  5A92 A;  5BOH A;  4E3O A;  1PWG A;  3BRM A;  3W4Q A;  3VOY A;  5GHX A;  4BD0 A;  1ES2 A;  1TEM A;  4B4X A;  5CGW A;  3ITA A;  2RCX A;  4PM5 A;  3P09 A;  5FDH A;  4XUX A;  3ZHH A;  3DWZ A;  2XF3 A;  5HAQ A;  1W79 A;  3A3I A;  1ERQ A;  2ZJ9 A;  2WGI A;  2HPB A;  1BLH A;  3PBQ A;  4IBX A;  1FQG A;  3ZG7 B;  4Y0U A;  1MBL A;  3HUO A;  3G32 A;  3HLB A;  2ZQD A;  5EVL A;  1K55 C;  5GLA A;  1ZKJ A;  3HLC A;  2H0T A;  2ZC3 B;  1S0W A;  3A3E A;  3O3V A;  5DF8 A;  3VOZ A;  4OPQ A;  1K57 C;  1ONH A;  2J9P A;  2ZD8 A;  1EI5 A;  2ZM0 A;  3IHA A;  5CGS A;  1G6A A;  5A91 A;  1I2W A;  1MWU A;  1KE0 A;  1K55 A;  3BEC A;  1M6K A;  3Q7Z A;  4PM8 A;  4C75 A;  3IQA A;  3AGF A;  3AGE A;  2C5W B;  3N6I A;  3W8K A;  1BZA A;  1BTL A;  1DJA A;  5HL1 A;  1K57 A;  2Z2L B;  2R9W A;  4ID4 A;  1LI0 A;  1W5D A;  2WKI A;  5EVI C;  4KZ3 A;  4Y7P A;  1LL5 A;  3GR2 A;  2H5S A;  1K56 A;  3E2K A;  4B4Z A;  2ZM8 A;  3UPP A;  1L0E A;  1BT5 A;  3IH9 A;  4H8R A;  1L2S A;  4OQG A;  1L0F A;  1NY0 A;  1RGZ A;  2Y2J A;  1BUL A;  2HDU A;  4S2P A;  4DE3 A;  2GDN A;  2QMI A;  5CTN A;  5EVI A;  1XP4 A;  3UDX A;  4DRT A;  1GCE A;  4BQM A;  3DWK A;  4EBL A;  1K54 C;  1KVM A;  5E43 A;  1L0G A;  1FCO A;  5EOE A;  5EVI B;  3UDF A;  4GZB A;  3S22 A;  3C7V A;  4GN2 A;  3VP0 A;  5AQ9 A;  3V39 A;  2A49 A;  4PM9 A;  3SS4 A;  3UDI A;  1YLP A;  1M40 A;  5DTK A;  3NCK A;  1XPB A;  1PWC A;  1K54 A;  4DKI A;  4N9K A;  1GA9 A;  2Y2O A;  3ZCZ A;  3Q7V A;  1W7F A;  4E3M A;  1PW1 A;  4LCL A;  2J9O A;  1FSY A;  3UE0 A;  4C3Q A;  3C4P A;  5FAT A;  3M6B A;  2PBY A;  4LV0 A;  1YLJ A;  1H5X A;  2IWC A;  3OZH A;  2X01 A;  3CMZ A;  3CG5 A;  5CRF A;  2QPN A;  1ESU A;  1VQQ A;  1BSG A;  1WYB A;  4OQH A;  4PM6 A;  3PAE A;  4E6W A;  2RL3 A;  1N4O A;  5EEC A;  2WAF A;  3QHY A;  4MBH A;  4EQI A;  3HUN A;  3M2J A;  1KDW A;  4JLF A;  3MZF A;  2IWB A;  5FQK A;  4K0X A;  5CXW A;  3BLM A;  2WGW A;  5EPH A;  3NC8 A;  4XUZ A;  1MPL A;  2JC7 A;  3PTE A;  1DY6 A;  3JYI A;  5D3O A;  5FI6 A;  1NYM A;  4GOG A;  1MXO A;  1JVJ A;  4MBK A;  3M2K A;  4Y0T A;  4ZJ2 A;  1Q2Q A;  4ZBE A;  2DRW A;  4EBN A;  5CHJ A;  4F94 A;  4LV2 A;  3WWX A; 
#chains in the Genus database with same CATH topology
 5DTT A;  3G2Z A;  1ES4 A;  4Q0H A;  5EUA A;  5KZH A;  2Y2M A;  2XFT A;  4R0Q A;  1K38 A;  3QP2 A;  3MFX A;  4WUJ A;  3UPO A;  4EW7 A;  5GLD A;  4QD4 A;  4R6L A;  4LV1 A;  2O9B A;  5FQ9 A;  2O9A A;  2ZM2 A;  5I94 A;  3LEQ A;  4CLC C;  4II7 A;  1ZTU A;  4KQD A;  4X6T A;  2PYR A;  3LIE A;  2A24 B;  2Y59 A;  3QNC A;  4B88 A;  2QHK A;  5CGX A;  3CJM A;  3NDE A;  4B93 A;  4H6J A;  5E2H A;  1K56 D;  5G18 A;  2G2U A;  4QY5 A;  4KG2 A;  4WMC A;  1D06 A;  2EX9 A;  1LL9 A;  3MKF A;  2HP6 A;  3P98 A;  1GHP A;  2OWJ A;  3IS2 A;  2GNX A;  2IWD A;  3PBO A;  3BFG A;  2ZQ8 A;  4S2I A;  2P9V A;  1YLT A;  3UN7 A;  1F2K A;  1JNU A;  2VK3 A;  3GQZ A;  2VKS A;  2HDQ A;  4HJ4 A;  4KUK A;  1I2S A;  3LUQ A;  4KG5 A;  3T4K A;  3CHW P;  2BLS A;  1ES5 A;  4CJN A;  4KEN B;  5KSC A;  1UWP X;  1MWS A;  4N9L A;  5AQB A;  1NXY A;  2PDR A;  5CX7 A;  5M1A A;  1PZO A;  2WGV A;  5HWV A;  2I9V A;  4LGW A;  1S67 L;  3IF5 A;  4X55 A;  2EXA A;  3ZNT A;  3KYZ A;  4R3A A;  2LB9 A;  3HCY A;  4ETZ A;  5E2E A;  5FDS A;  3BFE A;  3IF6 A;  1J9M A;  2M7V A;  2P74 A;  4ZJ1 A;  3G4P A;  1ALQ A;  1L0D A;  2WKE A;  3EEA A;  3WRT A;  1DJC A;  3PHY A;  1W63 M;  2WGW B;  4P0M A;  3ZGA B;  4GNU A;  4FSF A;  1PI5 A;  4X1M A;  1K0K A;  4R1G A;  3QP6 A;  2VGJ A;  3HVF A;  2DMW A;  4KZ8 A;  3F1P A;  4S2O A;  4U0T A;  4P6Z S;  2OLV A;  4BJP A;  2WZZ A;  3WS4 A;  1E25 A;  4KZB A;  2L1M A;  2VV8 A;  3UMD A;  1PWD A;  3VP4 A;  1SKO B;  1P9W A;  2QJ7 A;  4L9F A;  4NK3 A;  1BLS A;  1K4F A;  4UHU A;  2ZMA A;  1K6R A;  1IOU A;  3IWO A;  1BLP A;  3VP1 A;  2XLN A;  4WEL A;  1FOF A;  3DW0 A;  2JCH A;  3B33 A;  3A0S A;  4WMC D;  5GHY A;  1S4R A;  1AXB A;  1VHM A;  1ESI A;  5HSQ A;  3BJN A;  4NXE A;  5L2F A;  4E3J A;  2OAQ 1;  3OPR A;  5TBM B;  5DVA A;  1G5U A;  5AQ7 A;  3TJZ C;  4HBT A;  1VM1 A;  2JKT M;  1ONG A;  4IVI A;  1PNE A;  3LID A;  3M6H A;  3LFV A;  4YOF A;  5HWT A;  2OSU A;  1OJG A;  3E4O A;  4E3I A;  2Y91 A;  3CUE C;  2W1T A;  5FAO A;  2V2F F;  4IUH A;  4X68 A;  3MXS A;  3N8S A;  4E6X A;  3MZD A;  4RYE A;  4JKT A;  2G7U A;  2M1C A;  3GVB A;  3FKV A;  5FI7 A;  3RH8 B;  3UY6 A;  5CTM A;  3OCN A;  1XX2 A;  2NUT C;  1ZC2 A;  1N9N A;  5M19 A;  1RP5 A;  2V1Z A;  2Y2N A;  3ZG0 A;  5GLB A;  1HVB A;  4HP9 A;  3BYD A;  3UB6 A;  5EV0 A;  4HES A;  4MEZ A;  5HWW A;  3ZG5 A;  1D1J A;  2XD1 A;  2EX8 A;  2WAD A;  5TR7 A;  3T4O A;  2Z6C A;  4I3I A;  5F1G A;  3VP2 A;  1VB6 A;  4NEE D;  4S2J A;  4EEP A;  4BBT A;  1HTZ A;  3ZNY A;  1DRM A;  3G2Y A;  3DTK A;  5EM1 A;  4D60 A;  1S6R A;  3ZQ5 A;  4GD8 A;  4UAA A;  3B3X A;  4S2N C;  3N7W A;  5LBR A;  3EGD C;  2VGL S;  4PM7 A;  3S4X A;  1K6S A;  4A5R A;  4HP4 A;  3GSG A;  1SCW A;  2HJ9 C;  4YIN A;  1WA9 A;  3NIA A;  3NHQ A;  1BYW A;  3RJU A;  2XA7 M;  3A3F A;  2UV0 E;  5FAQ A;  3UPN A;  4JBF A;  4EQ1 A;  3SH9 A;  4IBR A;  2QYB A;  3LY4 A;  4OLD A;  4E3O A;  3W4Q A;  3HJK A;  4BD0 A;  2XRO A;  5AVF A;  1ES2 A;  2MJ6 A;  4B4X A;  2Y8H A;  5FDH A;  3A3I A;  2WGI A;  3ZG7 B;  3HLB A;  5GLA A;  5DKK A;  2ZC3 B;  3T4T A;  3UB9 A;  1YAX A;  2ZD8 A;  3IHA A;  4UQI M;  1I2W A;  1KE0 A;  3BEC A;  2FZ0 A;  4ETX A;  1P0Z A;  2Z6D A;  3UB8 A;  3QP4 A;  4ID4 A;  3D9Y A;  1OTD A;  3GR2 A;  2ZM8 A;  3K2N A;  3UPP A;  1BT5 A;  4OQG A;  2Y2J A;  1BUL A;  3NOT C;  1S1Z A;  1GCE A;  4L9E A;  4BQM A;  3BWL A;  4EBL A;  4GZB A;  4GN2 A;  3V39 A;  5MC7 A;  4DKI A;  3ZCZ A;  4E3M A;  4LCL A;  2J9O A;  1LSV A;  4LV0 A;  3LIF A;  3CG5 A;  3NJA A;  4FOF A;  1WYB A;  4PM6 A;  2RL3 A;  1UGU A;  4MBH A;  3LI8 A;  2WGW A;  2JKG A;  4XUZ A;  3JYI A;  5FEF A;  1NYM A;  1N9O A;  4GS9 A;  3M2K A;  1Q2Q A;  4Y17 A;  2DRW A;  4ESP A;  5FL3 A;  3SS5 A;  5HPI A;  3T1R A;  4R4S A;  1KE4 A;  1XGJ A;  3VSL A;  1MKI A;  3ZVT A;  4I3A A;  2PBD P;  1U60 A;  1SKO A;  4X69 A;  3VSK A;  5CER A;  3MMH A;  3QNB A;  3MS6 A;  1CI9 A;  4M3K A;  3F1N B;  3O87 A;  4QWO A;  3HLF A;  3FWL A;  2Y55 A;  3B47 A;  1O7E A;  1OTA A;  2V8C A;  5FQI A;  2V1A A;  3SH7 A;  5J4E A;  3QP1 A;  1W8Q A;  5GL9 A;  1EWZ A;  4CLC B;  5C5K A;  2XGN A;  5TBM A;  4RQ9 A;  2Y2P A;  4OVD A;  2KX6 A;  4OPR A;  1W63 Q;  4MCW A;  4GJ4 A;  3HLD A;  3Q1F A;  1CJF A;  3CPT B;  1GA0 A;  1JWZ A;  2EX6 A;  3EQV A;  4KG6 A;  3KO6 A;  2Y4A A;  4Q0I A;  3MBZ A;  1YT4 A;  1CK3 A;  2EA9 A;  4G3W A;  3HBR A;  4U0X A;  2D02 A;  1FIL A;  2XFS A;  4DXC A;  3MQO A;  1Y4O A;  1YSQ A;  4PMA A;  4PAU A;  4JGP A;  2L4R A;  4LCM A;  2HJE A;  3IF6 C;  1SHV A;  4KQO A;  2R9X A;  1N9L A;  4Y3I A;  5DTS A;  2VA0 A;  1OTI A;  1TD5 A;  1C3B A;  2ZC6 B;  1T1B A;  5JYP A;  1TDL A;  3KSG A;  3VFF A;  2XRN A;  4HQA A;  4EUZ A;  1ACF A;  3LYX A;  3D72 A;  3U2A A;  3T12 B;  1CI8 A;  4ZJ3 A;  2Y2H A;  5F5Y A;  2JE5 A;  4WZ5 C;  2XA7 S;  2FH5 A;  2ZL1 B;  1NLY A;  4ARZ B;  4ZRR A;  1LT0 A;  2JKR I;  4KZA A;  5L07 A;  2XDM A;  3IH8 A;  2DCF A;  4MBF A;  5FAP A;  1PW8 A;  1NRF A;  3TRC A;  1TDG A;  5FQM A;  4R3B A;  3PXP A;  1OT6 A;  1T1C A;  4YFM A;  2HV1 A;  4G3K A;  2JBF A;  3PYP A;  2WYX A;  5DF9 A;  1E4D A;  3A0R A;  2ZLY A;  4NKP A;  1D7E A;  4KZ4 A;  3VE4 A;  3VE3 A;  3BQ8 A;  3WS1 A;  4YNR A;  3H7W B;  2B95 A;  3HLE A;  3H9W A;  4DE2 A;  4KZ6 A;  4GHI A;  4ZDX A;  1Q2P A;  4UA9 A;  2G2W A;  4UQI S;  3VFH A;  3G34 A;  4FH2 A;  4DJ3 A;  2BG1 A;  2EWW A;  4Z1W A;  2NUP C;  4I5S A;  4JGO A;  5EFW A;  3H82 A;  2XEP A;  1OTE A;  2HDS A;  2ZOH A;  4I3J A;  3TSG A;  5IHV A;  3KSF A;  3S7N A;  5FAS A;  2ZQA A;  1FCM A;  2W27 A;  5TFQ A;  3HRE A;  4WLA A;  4FD8 A;  2Y2G A;  4X53 A;  2K7S A;  4F3L B;  3NY4 A;  3O5Y A;  2OLU A;  4LEN A;  3PAG A;  2XD5 A;  2X02 A;  2E8I A;  4GD6 A;  4WM9 A;  4WEK A;  4BD1 A;  3SS3 A;  3KSH A;  3IWI A;  3IX3 A;  4RX2 A;  1KVL A;  2EFX A;  3CI6 A;  4L0L A;  4NXB A;  5HAP A;  4QJG A;  5U47 A;  4EXO A;  1JTG A;  1STZ A;  2H0Y A;  1K4E A;  1VET B;  3C4O A;  3BFF A;  4HNB A;  4WEJ A;  3MQQ A;  2K31 A;  1GHI A;  3IXD A;  1KDS A;  1WYC A;  5CHM A;  1NJ4 A;  5F69 A;  3QP5 A;  4UA6 A;  5HPF A;  3SOI A;  3OLO A;  3Q82 A;  4NET A;  1YMX A;  1IYQ A;  1TF1 A;  1TVF A;  4EEU A;  5DFX A;  1VEU A;  3TE8 A;  5A93 A;  4X25 A;  5L8M A;  1IEL A;  1XJ4 A;  3FC7 A;  4IED A;  4PKY G;  2ZMV A;  2CMN A;  1A0K A;  2JN7 A;  2D01 A;  1LI9 A;  1IKI A;  5HL6 A;  5FEG A;  1PFL A;  1ES3 A;  1BUE A;  1DP6 A;  3WS2 A;  3EOI A;  1DP9 A;  1RCJ A;  3K3C A;  1SDN A;  5BOH A;  1PWG A;  2YKF A;  4BWI A;  1G28 A;  3F1N A;  4LLO B;  1HLU P;  2RCX A;  4LRX C;  3ZHH A;  3DWZ A;  3GEC A;  1W79 A;  1ERQ A;  4L9G A;  2HPB A;  1BLH A;  3MF0 A;  4IBX A;  4MMN A;  1P97 A;  3G32 A;  4NXF A;  4CLC A;  1H8M A;  2ZOI A;  2PD7 A;  4OPQ A;  3C38 A;  4ME4 A;  1ONH A;  2J9P A;  4HJ3 A;  1EI5 A;  4EES A;  2ZM0 A;  5CGS A;  1M6K A;  4I39 A;  3N6I A;  1BTL A;  5HL1 A;  1K57 A;  2Z2L B;  3CPT A;  2R9W A;  2JKR M;  1W5D A;  2WKI A;  4KZ3 A;  3S7O A;  1LL5 A;  2R78 A;  1L0E A;  4H8R A;  1L2S A;  1TS0 A;  1RGZ A;  3IBJ A;  2HDU A;  4S2P A;  4DE3 A;  5CTN A;  1YPR A;  5EVI A;  3DTI A;  3T1Q B;  1S4S A;  1AWI A;  3UDF A;  3C7V A;  5AQ9 A;  4PM9 A;  2L0W A;  3UDI A;  1M40 A;  1OPX A;  1W7F A;  3L7H A;  1PW1 A;  3UE0 A;  3BY9 A;  2PR6 A;  2IWC A;  3OZH A;  2X01 A;  5CRF A;  2QPN A;  1VQQ A;  2WAF A;  4XT2 A;  3SZT A;  3HUN A;  3M2J A;  3KX0 X;  3MZF A;  2PRF A;  5FQK A;  3E0Y A;  3NOU C;  3PTE A;  1DY6 A;  5FI6 A;  4GOG A;  4MBK A;  2ZL1 A;  4EBN A;  3T1X A;  3KSI A;  3W4P A;  4HH2 A;  3I7J A;  5L10 A;  3MZE A;  3LCE A;  1MY8 A;  3IT9 A;  3NUL A;  5J8X A;  1KGG A;  5DF7 A;  3MQ0 A;  3E98 A;  4K91 A;  3OPH A;  3HL9 A;  1FCN A;  5HDD A;  2EX2 A;  1JWV A;  4OOY A;  4R4R A;  4BMW A;  1GSX A;  1HZO A;  3V3R A;  1T18 A;  1FSW A;  3CAX A;  3G6O A;  4HI4 A;  5EE8 A;  5CEB A;  1SDE A;  4OPZ A;  4YWZ A;  3UE3 A;  4CLC D;  3PBN A;  2A24 A;  2EFU A;  2OV5 A;  2QWS A;  5K5B A;  1E3U A;  3RXX A;  4RVA A;  3H7W A;  2UWX A;  3C30 A;  3OPP A;  1XA1 A;  5KSH A;  1TS6 A;  2FFF B;  3OPL A;  1XFN A;  4M4X A;  5E2F A;  1ZG6 A;  5EOO A;  4OOM A;  1MWT A;  4CPK A;  1IEM A;  3DAV A;  1OJ5 A;  4DDY A;  1RGY A;  3ZDJ A;  1XFQ A;  5EVI D;  4NXG A;  3BQA A;  3PBT A;  3BEB A;  3G35 A;  2DNS A;  3IS2 B;  1TS8 A;  4ZAM A;  3EQU A;  4F3L A;  2HP5 A;  4OON A;  3G31 A;  1XJ2 A;  3GTC A;  3A3J A;  2ZQC A;  1CEF A;  1L3L A;  2W3F A;  3GMW A;  4JF6 A;  5G4Y A;  4HJ6 A;  2J3W A;  1NYY A;  4KQR A;  3A3D A;  3VV4 A;  1CEG A;  2QZ6 A;  3V50 A;  2WKR A;  1Z09 A;  3D4F A;  2W3D A;  3V67 A;  3IF6 B;  4LV3 A;  2JHE A;  3Q81 A;  5CHU A;  2W3G A;  5FSR A;  1YM1 A;  4EET B;  2ZC5 B;  3NBL A;  2VX8 A;  4K0W A;  4DJ2 A;  2WZX A;  3ZFZ A;  5KIZ A;  5I5L A;  3UO9 A;  3LEZ A;  4EV4 A;  4Y2F A;  1GHM A;  5J7E A;  2O9C A;  3LR5 A;  3O88 A;  1OT9 A;  3F1P B;  2PT7 A;  2VEA A;  3MXR A;  2M7U A;  1X0O A;  1E3U D;  5DJU A;  3C8C A;  4O0P A;  5GHZ A;  3KYQ A;  1Y54 A;  2B02 A;  4O01 A;  2OAP 1;  3E2L A;  4DE0 A;  1F5M A;  4IJG A;  1YQS A;  4R23 A;  2Q9M A;  2B5R A;  5HW3 A;  2PAV P;  3UNW A;  4BL2 A;  4U3T A;  3MR0 A;  1TS7 A;  5E2G A;  3RFB A;  2C6W B;  2WAE A;  3VP3 A;  3BLS A;  2ZQ9 A;  1FR6 A;  2PYP A;  3FPV A;  4UA7 A;  5IU1 A;  2B18 A;  4OQ0 A;  2ZC7 A;  1BLC A;  4I38 A;  2VLG A;  3HJI A;  3ULF A;  2W1R A;  4GKU A;  4EBP A;  3ZG9 B;  1YLY A;  4C6Y A;  1YLW A;  3LR3 A;  2CC1 A;  4OKP A;  3BM6 A;  3W4O A;  2X71 A;  2PU2 A;  4OPY A;  4RA7 A;  4DF6 A;  3PBR A;  4LRY C;  1XXM A;  1XJ6 A;  2W1T B;  3MJQ A;  1S66 L;  1XKZ A;  5CED A;  3Q07 A;  4S2M A;  4Z9Q A;  3WS5 A;  4MN7 A;  2LB5 A;  1H8Z A;  4JF4 A;  3W2Z A;  1YKD A;  3UB7 A;  2J3T D;  3SH8 A;  1QMF A;  3VOL A;  3DBA A;  4KZ5 A;  4Y13 A;  2WKH A;  1KE3 A;  1OME A;  2INW A;  5EM0 A;  1NZU A;  1EW0 A;  3LO7 A;  4DDS A;  2J80 A;  4R3J A;  4D2O A;  5FQQ A;  3V5M A;  2J8Y A;  3BFD A;  1SZV A;  2WK0 A;  2ZBB A;  4MDZ A;  3C5A A;  4FTX A;  4MNR A;  4P85 A;  4BL3 A;  2O0Y A;  3ZVW A;  4OH0 A;  5F1F A;  5M18 A;  5HFO A;  3FG8 A;  3T4J A;  3UE1 A;  4GDN A;  3NEC A;  3F1O B;  2Y2K A;  3VMA A;  2H28 A;  2HF6 A;  1XGI A;  2Z2M B;  4WN5 A;  4BLM A;  2KOI A;  3LI9 A;  5FI2 A;  4Q8I A;  4HH3 A;  1MKM A;  3TW8 A;  4EU0 A;  4LFU A;  4EWF A;  4FH4 A;  1G68 A;  2VGL M;  3WRZ A;  3BRM A;  3VOY A;  5GHX A;  2V0W A;  1TEM A;  2BTF P;  3S7Q A;  5CGW A;  5HDC A;  2E8J A;  5IT5 A;  1NWZ A;  4XUX A;  2V0U A;  3UB5 P;  5HAQ A;  2ZJ9 A;  1FQG A;  4IHQ A;  3HUO A;  2ZQD A;  1XJ3 A;  3O3V A;  5DF8 A;  3VOZ A;  3CWF A;  3KYE A;  3LIA A;  1K57 C;  5AVE A;  2VV7 A;  1G6A A;  1MWU A;  1K55 A;  3Q7Z A;  4C75 A;  3IQA A;  4HOI A;  3AGE A;  2C5W B;  3EWK A;  1DJA A;  4BBU A;  3K3D A;  1LI0 A;  5EVI C;  4Y7P A;  3IH9 A;  3E4P A;  1L0F A;  1NY0 A;  1XP4 A;  2JKF A;  2BAS A;  5E43 A;  1L0G A;  5EOE A;  2A49 A;  3SS4 A;  5DTK A;  4DN0 A;  1PWC A;  2HZ5 A;  1K54 A;  4N9K A;  5DJT A;  2Y2O A;  3P7N A;  3T4L A;  1FSY A;  1LSX A;  3C4P A;  2PBY A;  1H5X A;  3PR6 A;  3CMZ A;  1ESU A;  3PAE A;  1UWN X;  4E04 A;  4E6W A;  2Y79 A;  5EEC A;  1H3Q A;  1GSV A;  4UEY A;  4EQI A;  4HY8 A;  4JLF A;  4K0X A;  3NC8 A;  5D3O A;  3JVU A;  3GDI A;  1JVJ A;  4Y0T A;  4GS9 B;  1NLZ A;  4LV2 A;  3WWX A;  3LR4 A;  4Y15 A;  4JXS A;  3IHB A;  5IS1 A;  4BEN A;  4WZ5 A;  4DMZ A;  4FCF A;  2H10 A;  5HX9 A;  3EEH A;  3OC2 A;  1LL8 A;  5F82 A;  5G4Z A;  4OOL A;  1PI4 A;  3LR0 A;  4KUO A;  2PU4 A;  4WBG A;  2EXB A;  1CQA A;  1PYY A;  4XXR A;  1JWP A;  4B9O A;  2ZC4 B;  3A0V A;  3JVV A;  2Y2L A;  1DP8 A;  4R70 A;  5DFY A;  1DJB A;  4HBU A;  5F68 A;  2VJW A;  3IX8 A;  4WZ4 A;  1ERM A;  2ACG A;  3HLW A;  5HAR A;  5FA7 A;  2VGK A;  5AQA A;  4KZ7 A;  3NOP C;  1NZO A;  5HZH A;  3MKE A;  2FFY A;  3N8L A;  5DKL A;  1S1Y A;  3T50 A;  4EUV A;  2WKP A;  1ODV A;  4HIA A;  3GRJ A;  4N1H A;  4ZTK A;  3R7W B;  4X1L A;  3D3O A;  4Y0O A;  5HAI A;  3HLG A;  3UME A;  2EWV A;  3HUM A;  4JGR A;  3N4I A;  3C2W A;  2W0N A;  3Q7V B;  2KLI A;  1LSW A;  3LIC A;  2WKQ A;  4N1X A;  2VV6 A;  3DTM A;  4WF0 A;  3TOI A;  2W3H A;  2J3T C;  3OCL A;  1ZG4 A;  4O7D A;  4E3K A;  1LHY A;  2I72 A;  4O8G A;  1ERO A;  4JXV A;  4RX3 A;  4S2L A;  5CEC A;  5TJJ A;  3ZG8 B;  4KQQ A;  2HGV A;  3LY3 A;  4QPR A;  4ARZ A;  3S1Y A;  2IA2 A;  1W8Y A;  4LRZ E;  3IXG A;  3U4L P;  3C7U A;  3O86 A;  1PZP A;  1YMS A;  1I5Q A;  2KDK A;  1QME A;  4JXW A;  3F1O A;  1GSW A;  1V9Y A;  4PPR A;  3LGO A;  1PRQ A;  5A90 A;  1JTD A;  3ISG A;  1FR1 A;  2XQZ A;  2A2L A;  1YSP A;  2HDR A;  3NI9 A;  5F6A A;  2HP9 A;  3IBR A;  1YLZ A;  1SKF A;  4IUK A;  1J3W A;  4KZ9 A;  4JXG A;  2Y2I A;  4GDB A;  3MXQ A;  4MLL A;  3IXH A;  4GCZ A;  1P9R A;  3ICY A;  4Y5F A;  4GB7 A;  4PKY A;  3MFD A;  2XR0 A;  4CLC E;  3OBF A;  3IX4 A;  4NG2 A;  3R4K A;  4GHI B;  2GZA A;  3LIB A;  4H6J B;  5A8B A;  3FKW A;  4QB8 A;  1MWR A;  3WS0 A;  1V9Z A;  2XSS A;  3H82 B;  2AVX A;  1KGE A;  3V3S A;  2P9V B;  4GW9 A;  1XA7 A;  2PD8 A;  2GX5 A;  1MZU A;  3L9K A;  4QY6 A;  3UE6 A;  1IYO A;  1F9I A;  1FIK A;  2ZQ7 A;  4N92 A;  2P08 A;  3CUE A;  3CZD A;  3N8R A;  4GLQ A;  4OP8 A;  1IYS A;  2O99 A;  2WUQ A;  3AGD A;  5KMW A;  4DE1 A;  4E3N A;  1IKG A;  3GV9 A;  2Q0O A;  1N9B A;  2V20 A;  2Q9N A;  4WYY A;  1VET A;  1H8Y A;  1T1A A;  4K08 A;  1WE4 A;  5TGF A;  1G6O A;  5EVE A;  4HEF A;  2A3U A;  2QKP A;  3G30 A;  1IYP A;  1KOU A;  3P01 A;  1Z6F A;  1LLB A;  3BFC A;  3NDG A;  3IXB A;  2Y2Q A;  3RXW A;  1ZHH B;  4JF5 A;  4QHC A;  4P87 A;  5GLC A;  3IWQ A;  3DTE A;  4OP5 A;  4JGQ A;  2XK1 A;  2PR5 A;  4E3L A;  2GJ3 A;  5AJG A;  3FV7 A;  3TG9 A;  3T1S A;  4JPM A;  4OLG A;  1HD8 A;  1K25 A;  3RTY A;  2P04 A;  4FUW A;  4CQH A;  4MN6 A;  4DXB A;  4IVK A;  1PIO A;  4S2N A;  3FYZ A;  3FZC A;  3SW1 A;  5FQJ A;  5JYO A;  2XH9 A;  5HDS A;  4OQI A;  2J7V A;  1VEU B;  4X56 A;  1IFQ A;  3PBS A;  2OWH A;  1KGF A;  3BY8 A;  2OOL A;  5F83 A;  4QU3 A;  4S2K A;  4PHT A;  1O07 A;  4P6Z M;  4P6B A;  3ITB A;  5A92 A;  3OOV A;  5J3W A;  1MC0 A;  3ITA A;  3JPU A;  4PM5 A;  3P09 A;  3S7P A;  2XF3 A;  1CF0 A;  2P7J A;  3PBQ A;  2V1B A;  2QJ5 A;  3ZYT A;  4Y0U A;  1MBL A;  3MSH A;  4HHD A;  4LPZ A;  5EVL A;  1K55 C;  1ZKJ A;  3HLC A;  2H0T A;  1H0M A;  1S0W A;  3A3E A;  3B42 A;  5A91 A;  4WL9 A;  4PM8 A;  4MN5 A;  2W3E A;  3AGF A;  3EGX C;  3W8K A;  1BZA A;  4R38 A;  4G3V A;  2H5S A;  1K56 A;  3E2K A;  4B4Z A;  3R7W A;  3BW6 A;  2GDN A;  2QMI A;  4Q0J A;  3UDX A;  4DRT A;  4EER A;  3DWK A;  3FPW A;  1K54 C;  2V9A A;  1KVM A;  1FCO A;  5EVI B;  3S22 A;  3VP0 A;  1NRJ A;  5L09 A;  1F98 A;  1YLP A;  1Y28 A;  3NCK A;  1XPB A;  3CLO A;  2ZMF A;  1GA9 A;  3Q7V A;  2K2N A;  4C3Q A;  1T19 A;  3M6B A;  5FAT A;  1YLJ A;  1BSG A;  1OTB A;  3E4Q A;  4OQH A;  5HD3 A;  1N4O A;  2V8F A;  3QHY A;  3QP8 A;  1KDW A;  4AFI A;  2VZW A;  2IWB A;  4XT2 B;  5CXW A;  3BLM A;  5EPH A;  3T4Q A;  2PHY A;  2JKT I;  4BBV A;  1MPL A;  2JC7 A;  3T4S A;  1MXO A;  4ZJ2 A;  2YKH A;  4ZBE A;  5HD5 A;  5CHJ A;  4F94 A;  3CIT A; 
#chains in the Genus database with same CATH homology
 3W4P A;  5DTT A;  3I7J A;  3MZE A;  4JXS A;  3LCE A;  1MY8 A;  3G2Z A;  3IHB A;  3IT9 A;  5J8X A;  1ES4 A;  5EUA A;  3SS5 A;  4BEN A;  1KGG A;  4WZ5 A;  5DF7 A;  5KZH A;  2Y2M A;  4K91 A;  4FCF A;  3OPH A;  2H10 A;  2XFT A;  3HL9 A;  5HX9 A;  1FCN A;  4R4S A;  4R0Q A;  3OC2 A;  5F82 A;  1K38 A;  2EX2 A;  1KE4 A;  1JWV A;  1XGJ A;  4OOY A;  1MKI A;  4R4R A;  4OOL A;  3VSL A;  3ZVT A;  1PI4 A;  1U60 A;  1HZO A;  4X69 A;  3V3R A;  3UPO A;  3VSK A;  2PU4 A;  5GLD A;  1FSW A;  4QD4 A;  4LV1 A;  4WBG A;  5CER A;  2EXB A;  5EE8 A;  5FQ9 A;  3QNB A;  5CEB A;  1SDE A;  4OPZ A;  2ZM2 A;  3UE3 A;  1PYY A;  1CI9 A;  4XXR A;  4M3K A;  1JWP A;  3PBN A;  5I94 A;  2ZC4 B;  3O87 A;  2EFU A;  3HLF A;  2OV5 A;  3FWL A;  1E3U A;  4X6T A;  3RXX A;  2Y2L A;  4RVA A;  2Y55 A;  2UWX A;  1O7E A;  5FQI A;  3SH7 A;  2Y59 A;  1DJB A;  4HBU A;  3VP2 A;  3QNC A;  1W8Q A;  5GL9 A;  3OPP A;  4WZ4 A;  4B88 A;  1EWZ A;  1ERM A;  5CGX A;  3HLW A;  5HAR A;  1XA1 A;  3CJM A;  5KSH A;  2XGN A;  2FFF B;  3NDE A;  3OPL A;  5FA7 A;  5E2H A;  5E2F A;  1ZG6 A;  1K56 D;  2VGK A;  5EOO A;  5G18 A;  2Y2P A;  1MWT A;  4OOM A;  5AQA A;  2G2U A;  4KZ7 A;  4OVD A;  4QY5 A;  4CPK A;  1IEM A;  4KG2 A;  4WMC A;  4DDY A;  1NZO A;  1RGY A;  1LL9 A;  2EX9 A;  3MKF A;  4OPR A;  3ZDJ A;  5EVI D;  2HP6 A;  3P98 A;  3PBT A;  1GHP A;  3BEB A;  3MKE A;  2FFY A;  3G35 A;  2DNS A;  3HLD A;  2IWD A;  3Q1F A;  3N8L A;  3PBO A;  1GA0 A;  1JWZ A;  2EX6 A;  3BFG A;  2ZQ8 A;  3EQV A;  2P9V A;  1YLT A;  4KG6 A;  4S2I A;  3UN7 A;  3GQZ A;  4ZAM A;  2Y4A A;  2HDQ A;  3EQU A;  1I2S A;  4KG5 A;  3GRJ A;  4N1H A;  3MBZ A;  1YT4 A;  2BLS A;  2HP5 A;  1CK3 A;  1ES5 A;  4OON A;  4ZTK A;  4CJN A;  4KEN B;  3G31 A;  3HBR A;  5KSC A;  4U0X A;  3GTC A;  1MWS A;  2XFS A;  3A3J A;  2ZQC A;  1CEF A;  4DXC A;  4N9L A;  4Y0O A;  5AQB A;  5HAI A;  3HLG A;  1NXY A;  5M1A A;  1PZO A;  2WGV A;  3HUM A;  3GMW A;  4JF6 A;  4PMA A;  3N4I A;  4LCM A;  3IF5 A;  4X55 A;  2EXA A;  3IF6 C;  1SHV A;  4KQO A;  3ZNT A;  1NYY A;  3Q7V B;  2R9X A;  4KQR A;  5DTS A;  3A3D A;  4N1X A;  1C3B A;  2ZC6 B;  1CEG A;  3DTM A;  2QZ6 A;  5E2E A;  3BFE A;  3IF6 A;  1J9M A;  3V50 A;  3TOI A;  5JYP A;  1TDL A;  2P74 A;  3D4F A;  3OCL A;  1ZG4 A;  4ZJ1 A;  4O7D A;  4E3K A;  3VFF A;  1LHY A;  2I72 A;  3G4P A;  1ALQ A;  1L0D A;  3IF6 B;  1ERO A;  4JXV A;  4LV3 A;  4RX3 A;  2WKE A;  4EUZ A;  3Q81 A;  4S2L A;  5CEC A;  3WRT A;  1DJC A;  5CHU A;  2WGW B;  3ZG8 B;  1CI8 A;  4P0M A;  4ZJ3 A;  2Y2H A;  3ZGA B;  4GNU A;  5FSR A;  4KQQ A;  1YM1 A;  3LY3 A;  2JE5 A;  2ZC5 B;  3NBL A;  4WZ5 C;  3S1Y A;  4FSF A;  1W8Y A;  1PI5 A;  3IXG A;  3C7U A;  3O86 A;  4K0W A;  4R1G A;  1PZP A;  2WZX A;  2VGJ A;  3HVF A;  3ZFZ A;  1YMS A;  3UO9 A;  1I5Q A;  3LEZ A;  4EV4 A;  4KZ8 A;  1GHM A;  1QME A;  4JXW A;  4KZA A;  4S2O A;  4PPR A;  5A90 A;  4U0T A;  3O88 A;  2XDM A;  3IH8 A;  1JTD A;  2OLV A;  3ISG A;  2DCF A;  4BJP A;  1FR1 A;  4MBF A;  2XQZ A;  5FAP A;  2WZZ A;  1PW8 A;  3WS4 A;  1NRF A;  1E25 A;  1TDG A;  4KZB A;  4R3B A;  5FQM A;  3MXR A;  4YFM A;  1E3U D;  2HDR A;  3NI9 A;  2JBF A;  2HP9 A;  1PWD A;  3VP4 A;  1YLZ A;  2WYX A;  5DF9 A;  1E4D A;  4NK3 A;  5GHZ A;  1BLS A;  1Y54 A;  1K4F A;  1SKF A;  4UHU A;  2ZMA A;  1K6R A;  2ZLY A;  4KZ9 A;  4JXG A;  2Y2I A;  4GDB A;  3E2L A;  4DE0 A;  3IWO A;  1BLP A;  4KZ4 A;  1YQS A;  4R23 A;  3VP1 A;  4MLL A;  2Q9M A;  3IXH A;  2B5R A;  2XLN A;  5HW3 A;  4WEL A;  1FOF A;  3DW0 A;  2JCH A;  3UNW A;  4U3T A;  3WS1 A;  4GB7 A;  4BL2 A;  5E2G A;  2C6W B;  3HLE A;  2WAE A;  4WMC D;  3BLS A;  2ZQ9 A;  5GHY A;  3VP3 A;  4KZ6 A;  4DE2 A;  3MFD A;  1AXB A;  2XR0 A;  4ZDX A;  1ESI A;  1FR6 A;  1Q2P A;  4UA9 A;  2G2W A;  3VFH A;  4UA7 A;  3G34 A;  5L2F A;  4E3J A;  4FH2 A;  2BG1 A;  3OPR A;  4OQ0 A;  5DVA A;  5AQ7 A;  3FKW A;  4HBT A;  2XEP A;  1VM1 A;  2ZC7 A;  4QB8 A;  1ONG A;  4IVI A;  1BLC A;  1MWR A;  3WS0 A;  2HDS A;  3TSG A;  5IHV A;  4GKU A;  3M6H A;  4EBP A;  3ZG9 B;  1YLY A;  4C6Y A;  2OSU A;  5FAS A;  1KGE A;  3V3S A;  2ZQA A;  2P9V B;  1YLW A;  1FCM A;  5TFQ A;  4E3I A;  3HRE A;  2CC1 A;  4OKP A;  1XA7 A;  3BM6 A;  4FD8 A;  2Y2G A;  2Y91 A;  3W4O A;  4X53 A;  5FAO A;  2X71 A;  2PU2 A;  2V2F F;  3NY4 A;  4OPY A;  4RA7 A;  4X68 A;  2OLU A;  3MXS A;  3N8S A;  4QY6 A;  4DF6 A;  4E6X A;  3PBR A;  4LEN A;  1XXM A;  1IYO A;  3PAG A;  2XD5 A;  2X02 A;  2E8I A;  3MZD A;  2ZQ7 A;  4GD6 A;  4WM9 A;  1XKZ A;  4RYE A;  5CED A;  4JKT A;  4N92 A;  4WEK A;  3CZD A;  3N8R A;  3GVB A;  3Q07 A;  4OP8 A;  4S2M A;  4Z9Q A;  3SS3 A;  3WS5 A;  4BD1 A;  1IYS A;  3IWI A;  3FKV A;  5FI7 A;  2WUQ A;  3AGD A;  5KMW A;  4RX2 A;  1KVL A;  3UY6 A;  4DE1 A;  5CTM A;  4E3N A;  3OCN A;  1H8Z A;  1IKG A;  1XX2 A;  2EFX A;  3GV9 A;  4JF4 A;  1ZC2 A;  1N9B A;  4L0L A;  2V20 A;  5M19 A;  1RP5 A;  2V1Z A;  2Y2N A;  4QJG A;  3ZG0 A;  5HAP A;  2Q9N A;  5GLB A;  4WYY A;  1H8Y A;  5U47 A;  3SH8 A;  1HVB A;  1QMF A;  1WE4 A;  5TGF A;  1JTG A;  3BYD A;  2H0Y A;  1K4E A;  4HEF A;  4HES A;  4MEZ A;  2A3U A;  3C4O A;  3ZG5 A;  3BFF A;  4KZ5 A;  3G30 A;  2WKH A;  1KE3 A;  1OME A;  2EX8 A;  2XD1 A;  4WEJ A;  1IYP A;  1NZU A;  2WAD A;  3LO7 A;  1Z6F A;  5TR7 A;  4DDS A;  1GHI A;  1LLB A;  3BFC A;  3IXD A;  3NDG A;  4R3J A;  1KDS A;  3IXB A;  4D2O A;  2Y2Q A;  5F1G A;  3RXW A;  1WYC A;  4JF5 A;  4QHC A;  4P87 A;  5CHM A;  5FQQ A;  3IWQ A;  2J8Y A;  3BFD A;  4OP5 A;  5GLC A;  3V5M A;  2WK0 A;  2XK1 A;  1NJ4 A;  4S2J A;  4UA6 A;  4E3L A;  1HTZ A;  3C5A A;  3ZNY A;  3G2Y A;  1S6R A;  4MNR A;  4P85 A;  3SOI A;  4BL3 A;  3ZVW A;  3Q82 A;  4OH0 A;  5F1F A;  5M18 A;  3FV7 A;  3TG9 A;  5HFO A;  4GD8 A;  4JPM A;  1YMX A;  3B3X A;  4NET A;  1HD8 A;  4OLG A;  4S2N C;  1K25 A;  3N7W A;  4UAA A;  1IYQ A;  3UE1 A;  1TVF A;  4GDN A;  4PM7 A;  3S4X A;  1K6S A;  4A5R A;  3GSG A;  1SCW A;  4YIN A;  3NIA A;  4DXB A;  2Y2K A;  4IVK A;  3VMA A;  1PIO A;  4S2N A;  3FYZ A;  3FZC A;  5FQJ A;  5JYO A;  1XGI A;  5A93 A;  2XH9 A;  4OQI A;  3RJU A;  2J7V A;  2Z2M B;  1IEL A;  4X56 A;  4BLM A;  3PBS A;  4IED A;  5FI2 A;  4Q8I A;  3A3F A;  5FAQ A;  3UPN A;  1KGF A;  4JBF A;  5F83 A;  4EWF A;  1LI9 A;  4FH4 A;  1IKI A;  3SH9 A;  1G68 A;  4QU3 A;  1ES3 A;  1BUE A;  4S2K A;  4IBR A;  3WS2 A;  3WRZ A;  1O07 A;  3LY4 A;  1RCJ A;  1SDN A;  4P6B A;  3ITB A;  4OLD A;  5A92 A;  5BOH A;  4E3O A;  1PWG A;  3BRM A;  3W4Q A;  3VOY A;  5GHX A;  4BD0 A;  1ES2 A;  1TEM A;  4B4X A;  5CGW A;  3ITA A;  2RCX A;  4PM5 A;  3P09 A;  5FDH A;  4XUX A;  3ZHH A;  3DWZ A;  2XF3 A;  5HAQ A;  1W79 A;  3A3I A;  1ERQ A;  2ZJ9 A;  2WGI A;  2HPB A;  1BLH A;  3PBQ A;  4IBX A;  1FQG A;  3ZG7 B;  4Y0U A;  1MBL A;  3HUO A;  3G32 A;  3HLB A;  2ZQD A;  5EVL A;  1K55 C;  5GLA A;  1ZKJ A;  3HLC A;  2H0T A;  2ZC3 B;  1S0W A;  3A3E A;  3O3V A;  5DF8 A;  3VOZ A;  4OPQ A;  1K57 C;  1ONH A;  2J9P A;  2ZD8 A;  1EI5 A;  2ZM0 A;  3IHA A;  5CGS A;  1G6A A;  5A91 A;  1I2W A;  1MWU A;  1KE0 A;  1K55 A;  3BEC A;  1M6K A;  3Q7Z A;  4PM8 A;  4C75 A;  3IQA A;  3AGF A;  3AGE A;  2C5W B;  3N6I A;  3W8K A;  1BZA A;  1BTL A;  1DJA A;  5HL1 A;  1K57 A;  2Z2L B;  2R9W A;  4ID4 A;  1LI0 A;  1W5D A;  2WKI A;  5EVI C;  4KZ3 A;  4Y7P A;  1LL5 A;  3GR2 A;  2H5S A;  1K56 A;  3E2K A;  4B4Z A;  2ZM8 A;  3UPP A;  1L0E A;  1BT5 A;  3IH9 A;  4H8R A;  1L2S A;  4OQG A;  1L0F A;  1NY0 A;  1RGZ A;  2Y2J A;  1BUL A;  2HDU A;  4S2P A;  4DE3 A;  2GDN A;  2QMI A;  5CTN A;  5EVI A;  1XP4 A;  3UDX A;  4DRT A;  1GCE A;  4BQM A;  3DWK A;  4EBL A;  1K54 C;  1KVM A;  5E43 A;  1L0G A;  1FCO A;  5EOE A;  5EVI B;  3UDF A;  4GZB A;  3S22 A;  3C7V A;  4GN2 A;  3VP0 A;  5AQ9 A;  3V39 A;  2A49 A;  4PM9 A;  3SS4 A;  3UDI A;  1YLP A;  1M40 A;  5DTK A;  3NCK A;  1XPB A;  1PWC A;  1K54 A;  4DKI A;  4N9K A;  1GA9 A;  2Y2O A;  3ZCZ A;  3Q7V A;  1W7F A;  4E3M A;  1PW1 A;  4LCL A;  2J9O A;  1FSY A;  3UE0 A;  4C3Q A;  3C4P A;  5FAT A;  3M6B A;  2PBY A;  4LV0 A;  1YLJ A;  1H5X A;  2IWC A;  3OZH A;  2X01 A;  3CMZ A;  3CG5 A;  5CRF A;  2QPN A;  1ESU A;  1VQQ A;  1BSG A;  1WYB A;  4OQH A;  4PM6 A;  3PAE A;  4E6W A;  2RL3 A;  1N4O A;  5EEC A;  2WAF A;  3QHY A;  4MBH A;  4EQI A;  3HUN A;  3M2J A;  1KDW A;  4JLF A;  3MZF A;  2IWB A;  5FQK A;  4K0X A;  5CXW A;  3BLM A;  2WGW A;  5EPH A;  3NC8 A;  4XUZ A;  1MPL A;  2JC7 A;  3PTE A;  1DY6 A;  3JYI A;  5D3O A;  5FI6 A;  1NYM A;  4GOG A;  1MXO A;  1JVJ A;  4MBK A;  3M2K A;  4Y0T A;  4ZJ2 A;  1Q2Q A;  4ZBE A;  2DRW A;  4EBN A;  5CHJ A;  4F94 A;  4LV2 A;  3WWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...