1YLPA

Atomic resolution structure of ctx-m-27 beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKHADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGGYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structures of CTX-M beta-Lactamases: Extended Spectrum Activities from Increased Mobility and Decreased Stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords beta-lactamase CTX-M-27
total genus 99
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ylpA00
3SS4A 2WKIA 2DCFA 3CZDA 4X53A 3M6BA 5CERA 4MBHA 1PI5A 2Y2OA 3PBNA 3VP1A 4E3NA 2OV5A 1LI9A 1DY6A 3AGFA 3M2JA 3MXSA 3IH8A 1YM1A 4KZAA 3VP0A 3IF6A 3FWLA 4P85A 5FATA 1FR1A 1BTLA 1NY0A 3NC8A 4S2MA 2HP5A 4P87A 5FSRA 3S1YA 3PBRA 1S6RA 5EVIB 2H10A 4WBGA 3SS5A 1KE3A 4WM9A 2WZZA 1DJAA 2OLVA 4S2LA 1GA0A 1LI0A 1K56D 3BRMA 3WRTA 4S2NC 5CHJA 4E3JA 2WAEA 3NCKA 4ID4A 4N1HA 4EBLA 5FASA 2G2WA 5E2FA 3PAEA 3Q1FA 4KZ6A 3GMWA 3UDIA 4PM8A 1MKIA 1GHIA 2VGKA 3DTMA 4JPMA 3MKFA 4X69A 4LCLA 4QB8A 1ESUA 1I2WA 1MY8A 1PWDA 1SHVA 2XH9A 3N4IA 1RCJA 4B4ZA 1BSGA 3G35A 3Q07A 5L2FA 3DW0A 4X55A 1L2SA 1NZUA 3BFCA 4WELA 5FI2A 4C75A 4OQGA 2Y59A 4PM6A 4RX3A 5BOHA 4QY5A 5DF9A 1IYOA 1YLJA 2V20A 4OKPA 1HZOA 2WGIA 4GN2A 3IXGA 4S2JA 4XXRA 3GQZA 2EX8A 4ZBEA 2JBFA 3UPNA 4MBKA 3G34A 4X6TA 3UNWA 3VFFA 2V1ZA 4BL2A 2WKEA 4C6YA 3HREA 1IEMA 2ZQ9A 3FKWA 5CTNA 3GV9A 2Y2IA 4OOYA 2P9VB 5CHMA 1K6RA 3N8LA 1BLCA 1XXMA 2EX6A 2EX2A 4OOLA 2EFXA 3LO7A 3IWOA 2FFFB 3UPOA 1XX2A 4UAAA 4Y0UA 3UO9A 4KZ8A 1BULA 1ONGA 4OPRA 3UDFA 4OLGA 5E43A 4B4XA 3SOIA 5GLDA 2Y4AA 3NIAA 2HP9A 4HEFA 4KZ4A 5EE8A 1YLWA 4OP5A 4DE2A 1IKGA 1O07A 2BLSA 4E3IA 4M3KA 4CJNA 2ZM2A 4PM7A 4E6WA 4X56A 4KG6A 3UE1A 2V2FF 2WKHA 3BLMA 2ZC4B 4QJGA 4S2IA 3G2ZA 5CHUA 2XDMA 1PWGA 3VFHA 3AGDA 3O87A 1QMFA 1IYSA 5CGXA 2Y2JA 1GHMA 2XD1A 1DJCA 3A3FA 3C4OA 4GNUA 3CMZA 3MKEA 1E4DA 4ZJ3A 1K56A 4OQ0A 3BYDA 4GDBA 3DWKA 1MXOA 1SKFA 2OSUA 2R9WA 1KE0A 3VP2A 5CXWA 2G2UA 1HTZA 4KZ5A 3VSKA 4DF6A 4KZ3A 2ZJ9A 4BD1A 2IWBA 3ZHHA 2QZ6A 1S0WA 3NY4A 5FDHA 2Y2MA 5HAPA 4LENA 1SDNA 4YINA 3IF6B 3BLSA 5AQBA 4DXCA 3ZVWA 2IWCA 5FQJA 1K4FA 1ES2A 1KGEA 1FCNA 1VM1A 3MXRA 1BLSA 1XKZA 2ZD8A 5DTTA 1RP5A 3IXDA 4BD0A 1KDSA 1CK3A 4HESA 3ZG9B 4RYEA 1AXBA 1WYBA 3GTCA 3UY6A 1YLTA 3IHAA 5CTMA 4Z9QA 2EXAA 4JXGA 4BJPA 4GKUA 3LCEA 1N4OA 4UA7A 2WYXA 1W7FA 3HUNA 1JTDA 4KZ7A 4RA7A 1ES3A 1NJ4A 5IHVA 3WS4A 3ISGA 1U60A 1K57A 1Y54A 3BFGA 3IWQA 5FQKA 2HDSA 3MFDA 3V3RA 3PAGA 3WS1A 3PBSA 5U47A 3GRJA 4FH4A 4EV4A 4GD6A 3C7VA 2Q9MA 1ZG6A 3GR2A 1CEFA 5CGWA 4UA9A 3W4OA 4E3MA 1VQQA 5EOOA 4WYYA 4DKIA 5GLCA 4K0XA 5F1GA 2JC7A 4S2NA 4K91A 4A5RA 3NI9A 3A3JA 4LCMA 5EVIC 3IH9A 3NBLA 3D4FA 5JYOA 3BFDA 1PW8A 2CC1A 1MPLA 3S22A 1G6AA 2ZC7A 3HLEA 3OPRA 4NETA 5HW3A 3G4PA 4OOMA 4UHUA 1KE4A 5E2GA 4LV3A 5FAPA 1I5QA 4E3LA 3N6IA 5HAIA 1GA9A 4R0QA 3JYIA 2BG1A 3V39A 4O7DA 3HLCA 3QNCA 2Y55A 5DF8A 2Z2MB 3HLFA 1C3BA 4FH2A 2Y2KA 3W4PA 5F82A 1N9BA 4BENA 1FCOA 3ZNTA 3O3VA 1IYPA 4ZDXA 2PBYA 4EBNA 3A3IA 2IWDA 4WEKA 4WMCD 1XGJA 5E2EA 2DNSA 2Y2LA 4OP8A 4R1GA 3O88A 1NXYA 4KG2A 1L0EA 2XK1A 3PBTA 1BLHA 4L0LA 1FCMA 4R3BA 4DE0A 3IXHA 5D3OA 3QNBA 4UA6A 2ZQ7A 4GOGA 4ZAMA 1RGZA 1YMSA 3HLBA 3CG5A 4MLLA 5DTKA 1CI9A 5A93A 2XFTA 3MBZA 4ZTKA 4KZ9A 2XEPA 3ZVTA 4K0WA 1MBLA 4FD8A 5FQMA 5FI6A 3ZG7B 4GDNA 1FSYA 1TEMA 2ZMAA 1H5XA 3M6HA 1FQGA 1NYMA 3M2KA 4P6BA 2A49A 1K4EA 4U0TA 1KVMA 3TG9A 1CEGA 1K6SA 3E2KA 3VOYA 4EQIA 3Q7VA 3Q82A 4IVIA 4LV0A 3A3EA 4OONA 1MWUA 1GCEA 2ZC6B 1H8ZA 3G30A 1IELA 3DWZA 3ZGAB 3FKVA 1ESIA 4LV1A 2ZQ8A 2C5WB 4WZ5A 3W8KA 4BQMA 4EUZA 3IXBA 1H8YA 5A92A 1TVFA 4QU3A 2B5RA 3ZNYA 2XD5A 3RXXA 2X71A 5DTSA 3IT9A 5HL1A 1K54C 3O86A 4IBXA 3V50A 2UWXA 1E25A 5AQ7A 3HLGA 2I72A 5GLBA 3SH7A 2XR0A 3HBRA 4JLFA 2RL3A 2H0TA 5CGSA 4R4SA 4IVKA 3E2LA 3EQVA 3Q7ZA 3WS0A 4E3KA 1ZC2A 5KZHA 1M6KA 1KDWA 4KENB 1SDEA 3HLDA 3UDXA 1DJBA 2J9OA 3I7JA 4N9KA 2QPNA 4GB7A 3RJUA 2GDNA 2PU4A 4OQIA 4PMAA 3SS3A 3C5AA 2QMIA 1EI5A 4JF4A 1FOFA 2WGWA 4KQQA 3SH9A 4DRTA 5JYPA 3WS2A 1IYQA 2PU2A 3HLWA 1SCWA 1OMEA 3PBOA 2XLNA 1PZOA 4Y0OA 4OPQA 1MWRA 3VP3A 3IF6C 3GSGA 1PI4A 3OPHA 3BFEA 3N8SA 1JWPA 2Y2HA 5EPHA 3ZG8B 2WZXA 1ERMA 1BT5A 2Y2GA 5KSHA 1KGGA 1KVLA 2WAFA 3WS5A 1MWTA 5F83A 4KG5A 1LL9A 4WMCA 2Y91A 4BLMA 1M40A 3HVFA 1Q2QA 3EQUA 1QMEA 1ES5A 1O7EA 2DRWA 3CJMA 4GZBA 2ZC3B 2Z2LB 4BL3A 3OC2A 4IEDA 3P09A 5M19A 1BLPA 4CPKA 4JF5A 2EXBA 1NZOA 2ZM8A 1NYYA 3G31A 1PYYA 5GHYA 5GHXA 4MBFA 1E3UA 1YT4A 5FAOA 5M1AA 4KQOA 1TDLA 5KMWA 3LY3A 2JE5A 3OPPA 4P0MA 2Y2QA 3G32A 3VSLA 1YLYA 2HDRA 1K55C 3HUMA 4HBTA 3IHBA 4DDSA 4XUXA 4FCFA 4X68A 3ZG5A 1L0FA 3NDGA 4JXWA 4R3JA 5FQQA 1BUEA 1L0DA 2EFUA 3P98A 3Q81A 4OPZA 4IBRA 4N1XA 2RCXA 5FI7A 3ITBA 5G18A 1JWZA 3S4XA 4S2OA 2WGWB 2XQZA 1XPBA 4OQHA 1EROA 3SH8A 3HL9A 3UN7A 3UPPA 4DDYA 4S2KA 5HAQA 5CRFA 2ZLYA 5FA7A 3OZHA 1HD8A 1YQSA 4JXVA 1K55A 2C6WB 1JTGA 3OCLA 3QHYA 5EVIA 1FR6A 1WYCA 5FQIA 2FFYA 3N8RA 1W8QA 1XA7A 3ZFZA 3C4PA 5M18A 3OCNA 2R9XA 5TFQA 3FZCA 3PBQA 4QD4A 2X01A 4XUZA 1XA1A 4QHCA 5GHZA 4DE3A 3LEZA 1E3UD 3Q7VB 2XF3A 4GD8A 3BECA 4R4RA 5CEBA 1Q2PA 3HUOA 4FSFA 3LY4A 4H8RA 3N7WA 1HVBA 1K57C 4RX2A 2HPBA 5FAQA 3VOZA 3MZDA 5J8XA 1ES4A 1YLPA 2EX9A 1YMXA 3FYZA 4Y0TA 5CEDA 4MNRA 2WK0A 5GL9A 3GVBA 1PIOA 3IF5A 1L0GA 4JBFA 1J9MA 1JVJA 3RXWA 3TOIA 1YLZA 1TDGA 3WWXA 3ZG0A 5F1FA 2WADA 1ALQA 2ZQCA 4PM9A 1LL5A 3IWIA 5HX9A 1KGFA 1W5DA 2HDQA 3BM6A 4N9LA 5TR7A 1NRFA 4ZJ1A 2H0YA 5EECA 5EOEA 2J8YA 1K54A 3UE3A 1PW1A 3AGEA 1EWZA 2P74A 1XP4A 5AQ9A 1Z6FA 5TGFA 1BZAA 2Q9NA 2X02A 1W79A 3WRZA 5I94A 2P9VA 4EWFA 4LV2A 4WEJA 5AQAA 1FSWA 5EVID 4E6XA 4PPRA 4Q8IA 5DVAA 3ZCZA 3G2YA 4E3OA 2OLUA 4WZ4A 5GLAA 1LLBA 4U0XA 5FQ9A 5A91A 3FV7A 4F94A 2HDUA 1CI8A 4JKTA 1GHPA 3ITAA 2ZC5B 2VGJA 2H5SA 2ZQDA 3OPLA 1W8YA 1RGYA 3B3XA 2A3UA 4YFMA 4KQRA 3V5MA 2JCHA 3VMAA 1XGIA 3MZEA 2Y2PA 1JWVA 4Y7PA 1ERQA 1ONHA 1ZG4A 3W4QA 5HARA 4OVDA 1IKIA 3A3DA 4EBPA 2ZQAA 4B88A 4JF6A 2Y2NA 4OPYA 4R23A 4ZJ2A 5E2HA 4DE1A 2ZM0A 3BEBA 4C3QA 3MZFA 3UE0A 2WGVA 1PWCA 2HP6A 4NK3A 5A90A 4PM5A 2E8IA 1K25A 4U3TA 3TSGA 3PTEA 1PZPA 5HFOA 5DF7A 3C7UA 3NDEA 3VP4A 4D2OA 3ZDJA 5CECA 1ZKJA 1G68A 1K38A 3BFFA 4HBUA 4N92A 5EUAA 5EVLA 3V3SA 4JXSA 2XGNA 2J7VA 1MWSA 2XFSA 1WE4A 4RVAA 2WUQA 4OLDA 4WZ5C 4OH0A 2J9PA 1LHYA 4MEZA 4S2PA 4DXBA 5KSCA 4KZBA 3IQAA 1I2SA 4QY6A
chains in the Genus database with same CATH superfamily
3SS4A 3CZDA 2Y2OA 2Y8HA 3T4LA 2HJ9C 1TD5A 5FATA 1NY0A 1S6RA 3NOPC 2VV6A 2H10A 2K2NA 2OLVA 3PXPA 3WRTA 4WF0A 3QP4A 4ID4A 4EBLA 2NUPC 3U4LP 4NKPA 2P7JA 3UDIA 1MKIA 3DTMA 3MKFA 4X69A 4QB8A 3N4IA 1RCJA 2J3TC 2W1TA 3DW0A 4X55A 1TS6A 2Y59A 2A2LA 3P7NA 4OKPA 2WGIA 4S2JA 4XXRA 4ZBEA 3CLOA 2JBFA 4FUWA 4MBKA 2V1ZA 4F3LB 3CHWP 2ZQ9A 3FKWA 5C5KA 2Y2IA 4EETB 1K6RA 1BLCA 2EX6A 4OOLA 5J4EA 4EQ1A 2O9AA 3UDFA 4OLGA 1D7EA 5GLDA 3EGDC 2Y4AA 3NIAA 2HP9A 4HEFA 4G3VA 1IKGA 5G4YA 2YKFA 3CI6A 1OTEA 4PM7A 3UE1A 2VA0A 4QJGA 2XDMA 1PWGA 3AGDA 2EWWA 1IYSA 3C4OA 2O99A 1F5MA 1K56A 3BYDA 1F2KA 4GDBA 4HOIA 1KE0A 3MF0A 1FILA 5CXWA 3VSKA 4KZ3A 1SZVA 4D60A 4HQAA 3NY4A 2Y2MA 4IUKA 4UQIS 3SZTA 2IWCA 3A0RA 2GZAA 1RP5A 4BD0A 4CLCD 1KDSA 4HESA 1AXBA 3GTCA 3LFVA 4Z9QA 2EXAA 4JXGA 1P0ZA 2WYXA 3HUNA 4RA7A 1NJ4A 1K57A 5L8MA 2HDSA 4ETXA 3CUEA 2V1AA 1D1JA 3GRJA 4EV4A 3C2WA 4ARZB 4WUJA 2QJ7A 2B02A 5GLCA 4K91A 4HH3A 5JYOA 4JGRA 1MPLA 4LV3A 1PRQA 4FOFA 1OPXA 3V39A 4KUOA 2Z2MB 4FH2A 4RQ9A 3W4PA 3ZNTA 3O3VA 4E04A 1XGJA 3QP1A 4R1GA 2XK1A 3UB8A 5D3OA 2VX8A 1T19A 4UA6A 2JHEA 1RGZA 2KLIA 3CG5A 4QWOA 4R3AA 1CI9A 2KX6A 4KZ9A 3ZVTA 3LI9A 2OOLA 1MBLA 3C38A 4GDNA 1FSYA 4O8GA 3JPUA 3M2KA 4HI4A 1K6SA 5MC7A 4LV0A 4OONA 3E4PA 3C8CA 3FKVA 3DTKA 2ZQ8A 3W8KA 3IS2A 4EW7A 4Q0IA 3ZNYA 5DTSA 4IBXA 5EM0A 5DKLA 3SH7A 2RL3A 3LUQA 2B18A 5DFYA 2V8CA 4JF4A 3EWKA 4KQQA 4DRTA 3HLWA 4II7A 1OMEA 4Y0OA 4OPQA 1D06A 1PI4A 2V8FA 5HDSA 5EPHA 2OWJA 1KVLA 2ZOIA 2O0YA 5F83A 2Y91A 1M40A 2INWA 3UB5P 4X25A 1O7EA 4NXEA 3CJMA 1DP6A 4IEDA 1S1YA 4CPKA 2I9VA 4JF5A 2ZMVA 3G31A 5GHYA 1YT4A 5LBRA 3LY3A 2Y2QA 3T1XA 3HUMA 4HBTA 3VE4A 5L07A 5FQQA 1BUEA 2EFUA 3GECA 3Q81A 3B42A 4M4XA 3HCYA 3T50A 4BBVA 3HL9A 3UPPA 1K0KA 3DBAA 5CRFA 1L3LA 2ZLYA 4P6ZM 2GX5A 3OZHA 3QP8A 1JTGA 1YKDA 5EVIA 1FR6A 2W1TB 2FFYA 5TBMB 1W8QA 1XA7A 3UB7A 4YNRA 5M18A 1MC0A 3R7WA 4QD4A 2JKFA 1XA1A 3LIAA 2PHYA 1Q2PA 5CEBA 3D3OA 3KSFA 3N7WA 4RX2A 4EXOA 2JKTM 2EX9A 1YMXA 1H3QA 3FYZA 4MNRA 1XJ6A 3WWXA 5F1FA 5DFXA 1LL5A 3BM6A 4I3JA 3UMEA 5EOEA 3UE3A 2P74A 1XP4A 3LR4A 3S7NA 2P9VA 5F69A 2Z6CA 1FSWA 4E6XA 4PPRA 3ZCZA 3G2YA 4E3OA 2OLUA 5FQ9A 3KYZA 2DMWA 2HDUA 1CI8A 2VGJA 2H5SA 3T4TA 1ACFA 1S4SA 4Y3IA 2LB5A 5HL6A 4YFMA 1XGIA 5J3WA 3O5YA 4CLCA 4GLQA 2ZQAA 4JGOA 4C3QA 1OTAA 4PHTA 2R78A 1T1CA 2G7UA 4PM5A 2E8IA 4U3TA 3TSGA 4P6ZS 5HFOA 3EEHA 4MN5A 1OT9A 3NDEA 4GHIB 1X0OA 1G68A 4N92A 2XGNA 1MWSA 3EGXC 1WE4A 2WUQA 4WZ5C 1LHYA 4MEZA 3JVVA 3IQAA 2WKIA 2W3FA 3VP1A 4LRZE 2V0WA 3AGFA 4ETZA 3MXSA 3IH8A 1YM1A 4P85A 2V1BA 4NG2A 4P87A 3U2AA 5EVIB 4WBGA 2PD8A 3FG8A 1KE3A 1DJAA 3NULA 1LI0A 3BRMA 3LIEA 3OOVA 4I38A 2WAEA 4N1HA 4BMWA 2OWHA 3S7QA 4PM8A 1GHIA 1YPRA 2VGKA 3OBFA 3F1PB 4B4ZA 3G35A 4R70A 3BFCA 5BOHA 4QY5A 2JKRM 4GN2A 4X6TA 3VFFA 4JGPA 3QP2A 2P9VB 5CHMA 1XXMA 2EX2A 1XX2A 4UAAA 4KZ8A 3ICYA 1BULA 2L4RA 4OPRA 3KSHA 4B4XA 3BWLA 2WKRA 4HH2A 4KZ4A 2K31A 4HY8A 5EE8A 4DE2A 4PKYG 4ZRRA 2BLSA 2VEAA 4E3IA 2ZM2A 4KG6A 3BJNA 2PR6A 3BLMA 4Z1WA 3G2ZA 1P9WA 1QMFA 2M7UA 2Y2JA 3LYXA 3A3FA 4GNUA 4O01A 4OQ0A 5CX7A 4HIAA 2OSUA 2V0UA 4DF6A 5TJJA 1MZUA 4BWIA 5IS1A 4YINA 3L7HA 5AQBA 5FQJA 3LEQA 1KGEA 3MXRA 2ZD8A 3IXDA 1CK3A 3D72A 2D02A 1YLTA 3IHAA 3IBJA 3MS6A 5CTMA 3KX0X 3VV4A 4BJPA 3LCEA 4FTXA 2AVXA 4GCZA 5IHVA 1CJFA 2WKPA 1U60A 3BFGA 3IWQA 5FEGA 4H6JA 3PAGA 3BY9A 3SW1A 5F68A 3ZQ5A 3GR2A 5CGWA 1PNEA 2QJ5A 3HJKA 5EOOA 5F1GA 4B93A 4LCMA 3NOTC 3S22A 2ZC7A 3HLEA 3NOUC 4UHUA 5FAPA 1KE4A 5HPIA 4O7DA 4F3LA 3HLFA 2PDRA 5F82A 4BENA 1FCOA 1IYPA 1N9OA 4WEKA 4WMCD 5E2EA 2Y2LA 2LB9A 5K5BA 1ZTUA 1T18A 4DE0A 3IXHA 1V9ZA 3LI8A 3H7WB 5DJTA 3HLBA 4MLLA 2XEPA 3PR6A 3ZG7B 1TEMA 4R6LA 1H5XA 3M6HA 1FQGA 4CLCC 1NYMA 1NWZA 2A49A 1K4EA 3VOYA 1KVMA 1CEGA 4MDZA 1VEUA 1MWUA 1GCEA 1H8ZA 2ZBBA 5HSQA 1N9LA 3ZGAB 1VETB 4LV1A 2C5WB 4EUZA 4QU3A 2B5RA 1N9NA 3O86A 2XA7S 2UWXA 1E25A 2XR0A 3HBRA 5EV0A 2H0TA 3E2LA 4E3KA 5KZHA 3LIBA 1SDEA 3HLDA 2J9OA 1G6OA 3RJUA 2PU4A 4KUKA 1EI5A 1LT0A 3BQAA 3WS2A 2XLNA 1PZOA 2W3EA 3H9WA 3GSGA 3OPHA 1JWPA 2WZXA 1ERMA 4I39A 5HDDA 1BT5A 2Y2GA 5KSHA 1KGGA 3WS5A 1MWTA 4BLMA 3HVFA 1F98A 4HNBA 3EQUA 5AVFA 1ES5A 2DRWA 3CWFA 4GZBA 2ZC3B 3P09A 5A8BA 1BYWA 4Y17A 5HWTA 2ZM8A 3OPPA 4PAUA 3VSLA 2W1RA 2HDRA 2M7VA 4X68A 3ZG5A 3BY8A 2OAQ1 1ODVA 2Y79A 4N1XA 5G18A 1W63Q 3ITBA 4S2OA 4OQHA 3SH8A 3TW8A 1XJ3A 2UV0E 2ZL1A 1I2SA 1LSXA 1YQSA 4JXVA 1YSPA 4YWZA 3FPVA 3ZFZA 3C4PA 3S7PA 1GSXA 3MXQA 3PBQA 4NXGA 4QHCA 5GHZA 4DE3A 3K3CA 2XF3A 4GD8A 4H8RA 1HVBA 3CPTA 4G3WA 5J8XA 2WK0A 3RTYA 3IF5A 1YLZA 2WADA 4MMNA 2ZQCA 1KGFA 2H0YA 1STZA 2J8YA 1PW1A 1EWZA 1DP9A 5AQ9A 1VETA 3T4JA 1Z6FA 1BZAA 4EWFA 4LV2A 5DKKA 5TBMA 3L9KA 5DVAA 4GJ4A 4WZ4A 4LRYC 3IX4A 1XJ4A 1NLZA 3OPLA 1RGYA 3B3XA 3V5MA 4KQRA 2JCHA 1CF0A 3MMHA 5AVEA 3W4QA 2Y2NA 4R23A 4DE1A 3BEBA 3PTEA 1IFQA 4GS9B 3LGOA 4D2OA 3ZDJA 5CECA 2ZMFA 1K38A 3V3SA 2J7VA 3S7OA 4BBUA 2VKSA 4MN6A 2J9PA 3D9YA 4KZBA 4QY6A 4MN7A 5CERA 4MBHA 4E3NA 3PBNA 2OV5A 2VZWA 4KZAA 3DTIA 3TRCA 3VP0A 3FWLA 3CUEC 4S2MA 5FSRA 3PBRA 5HDCA 3SS5A 4WM9A 2WZZA 5KIZA 4S2LA 1K56D 3UB6A 1V9YA 3NCKA 2Q0OA 2G2WA 5E2FA 3PAEA 3Q1FA 4KZ6A 3GMWA 3JVUA 4Y2FA 2O9BA 4ME4A 4LCLA 1ESUA 1PWDA 1SHVA 3Q07A 3OLOA 1H0MA 1L2SA 1NZUA 1OJGA 4RX3A 5DF9A 3GDIA 1IYOA 1YLJA 4ESPA 1HZOA 2EX8A 3G34A 4DJ3A 3UNWA 4BL2A 2L0WA 5FEFA 5CTNA 4OOYA 3N8LA 1OTBA 3NHQA 3LO7A 1Y28A 3IWOA 4Y0UA 3UO9A 4QPRA 2XSSA 1YLWA 1O07A 5L09A 1OT6A 4X56A 4Y13A 2ZC4B 3VFHA 5CGXA 3MQOA 1NLYA 3C30A 2XD1A 1DJCA 3MKEA 1E4DA 2JKTI 4ZJ3A 1MXOA 2HJEA 2ZJ9A 4BD1A 2IWBA 3ZHHA 1XFQA 2QZ6A 1T1BA 2PYRA 5FDHA 5HAPA 1SDNA 3ZYTA 2JKGA 4DXCA 5IT5A 1K4FA 1ES2A 1FCNA 1BLSA 1F9IA 3F1PA 3A0SA 2PT7A 3ZG9B 4IHQA 1G5UA 1GSWA 4GKUA 1N4OA 3A0VA 1DP8A 3HJIA 1W7FA 1JTDA 1ES3A 2NUTC 3ISGA 3V3RA 3PBSA 3LICA 5U47A 4FH4A 1IOUA 2YKHA 2Q9MA 1ZG6A 1CEFA 3EEAA 4UA9A 3W4OA 4E3MA 4S2NA 5AJGA 3A3JA 3NBLA 3D4FA 3T4OA 3P01A 1PW8A 1J3WA 4IUHA 1TF1A 3OPRA 4NETA 5HW3A 4OOMA 4Y5FA 4E3LA 3N6IA 5HAIA 4G3KA 1GA9A 3NJAA 5L10A 3QP6A 4R0QA 3JYIA 3HLCA 3QNCA 4HJ3A 1C3BA 2JN7A 3LIDA 1OTDA 4NEED 4L9FA 2MJ6A 1OTIA 4EBNA 3A3IA 2IWDA 2DNSA 2VLGA 1A0KA 3O88A 1MKMA 1BLHA 4L0LA 1FCMA 3MR0A 2PYPA 2VGLM 2ZQ7A 5DTKA 5A93A 3MBZA 4FD8A 2W3DA 2O9CA 4HHDA 2ZMAA 5EVEA 3TG9A 4LRXC 3E2KA 4I5SA 4IVIA 3IS2B 5HZHA 4NXBA 3E4OA 5J7EA 1LL8A 4LFUA 3EOIA 4WZ5A 5A92A 1TVFA 2XD5A 3IBRA 3IT9A 1K54C 3K2NA 2XRNA 5AQ7A 3IX8A 2HZ5A 4JLFA 4LGWA 5CGSA 4R4SA 1OJ5A 4IVKA 3EQVA 1M6KA 3BQ8A 3UDXA 1DJBA 3I7JA 4N9KA 2QPNA 5F6AA 4PMAA 3C5AA 2QMIA 3SH9A 1IYQA 1SCWA 1YAXA 1P9RA 3BFEA 2Y2HA 5HWVA 3ULFA 2VJWA 4GS9A 2WAFA 4WN5A 4KG5A 5G4ZA 4XT2A 2EA9A 1SKOB 3MQ0A 5HWWA 2Z2LB 4BL3A 3OC2A 1BLPA 4O0PA 1LSWA 1NZOA 1PYYA 4MBFA 1E3UA 5M1AA 5KMWA 4KQOA 1TDLA 2QKPA 1WA9A 2JE5A 3G32A 2PR5A 1K55C 3IHBA 3H82A 2VV7A 4XUXA 4FCFA 3VE3A 1L0FA 3KO6A 4JXWA 3LR5A 4R3JA 3P98A 4OPZA 3T1QB 4IBRA 4I3AA 2RCXA 5FI7A 1JWZA 4DDYA 5HAQA 5FA7A 1HD8A 3MQQA 3E98A 2C6WB 3OCLA 5FQIA 1CQAA 3OCNA 2R9XA 2PAVP 2HGVA 2X01A 4EESA 5F5YA 2FH5A 3LEZA 3Q7VB 1EW0A 3BECA 4R4RA 3LY4A 3MFXA 2H28A 2D01A 2HPBA 3MZDA 1YLPA 3MSHA 5CEDA 5GL9A 3GVBA 1PIOA 1L0GA 2V9AA 1J9MA 4L9GA 4MCWA 1TDGA 1ALQA 4KQDA 2PD7A 3IWIA 5HX9A 2Z6DA 4LLOB 2HDQA 1ZHHB 4N9LA 1NRFA 4ZJ1A 5EECA 3AGEA 3K3DA 4K08A 2Q9NA 4HJ4A 4WEJA 5AQAA 5EVID 4Q8IA 2E8JA 5GLAA 5A91A 4U0XA 3FV7A 1XJ2A 2A24B 2ZC5B 4H6JB 1TS8A 4EUVA 3FPWA 2XROA 2Y2PA 4Y7PA 1ZG4A 2FZ0A 4OVDA 4EBPA 4B88A 4JF6A 4OPYA 4PKYA 4ZJ2A 5E2HA 2ZM0A 3MZFA 3UE0A 2HP6A 3T4SA 1K25A 1UWNX 5DF7A 5IU1A 3C7UA 3T4QA 3VP4A 4WL9A 1ZKJA 3BFFA 3B47A 2W3GA 4OLDA 4OH0A 4X53A 2DCFA 3M6BA 1PI5A 2P08A 1LI9A 1DY6A 4CQHA 3M2JA 3IF6A 1FR1A 1BTLA 3NC8A 4EERA 4IJGA 2HP5A 3S1YA 2VV8A 3DAVA 1GA0A 3T12B 2BTFP 4S2NC 5CHJA 3RH8B 4CLCB 3UE6A 4E3JA 5FASA 2M1CA 2B95A 1VEUB 4JPMA 2XA7M 1JNUA 1I2WA 1MY8A 2XH9A 1BSGA 2W0NA 4HJ6A 5L2FA 4C75A 4WELA 5FI2A 4OQGA 1DRMA 4PM6A 2V20A 2HV1A 3KSIA 3IXGA 1G28A 3GQZA 3UPNA 2WKEA 4C6YA 3KYEA 3HREA 1IEMA 3GV9A 4CLCE 2BASA 2J3WA 2EFXA 2FFFB 1S66L 4B9OA 3UPOA 1T1AA 2JKRI 1ONGA 5E43A 2P04A 3SOIA 2ACGA 3CAXA 2QHKA 4OP5A 1H8MA 1UWPX 5I5LA 2VK3A 4M3KA 4CJNA 4E6WA 2V2FF 2WKHA 4S2IA 5CHUA 3T1RA 3O87A 1S4RA 1GHMA 3CMZA 2VGLS 3DWKA 1SKFA 2R9WA 3VP2A 2G2UA 1HTZA 4KZ5A 4L9EA 1S0WA 4LENA 3V67A 3E4QA 3IF6B 3BLSA 3ZVWA 1TS0A 1VM1A 1XKZA 5DTTA 3LIFA 2HF6A 4RYEA 1WYBA 3UY6A 1SKOA 2EWVA 4UA7A 4GHIA 4KZ7A 5EM1A 3WS4A 1W63M 1Y54A 5FQKA 3MFDA 3WS1A 4GW9A 2GNXA 4GD6A 3C7VA 3BW6A 3T1SA 1FIKA 3VOLA 1VQQA 4WYYA 4UQIM 3R7WB 4DKIA 4K0XA 2JC7A 4A5RA 3NI9A 1TS7A 5EVIC 3F1OB 3IH9A 3BFDA 2CC1A 1G6AA 1VB6A 3UMDA 4EEPA 3G4PA 5E2GA 2ZOHA 1I5QA 3IX3A 2BG1A 1XFNA 2Y55A 5DF8A 1PFLA 2Y2KA 1N9BA 4ZDXA 2PBYA 4LPZA 4OP8A 1NXYA 4KG2A 1L0EA 3PBTA 2GJ3A 1KOUA 4R3BA 3QNBA 4GOGA 4ZAMA 1YMSA 2KOIA 2PBDP 2XFTA 4ZTKA 4K0WA 5FQMA 5FI6A 3TJZC 1P97A 4X1LA 4EEUA 2KDKA 4P6BA 4Q0HA 4U0TA 2PRFA 4EQIA 4Y15A 3Q7VA 3Q82A 3A3EA 2ZC6B 3G30A 1IELA 3DWZA 1ESIA 4Q0JA 5FDSA 4BQMA 3IXBA 1H8YA 1GSVA 1YSQA 1NRJA 3RXXA 2X71A 5HL1A 3V50A 1LSVA 3HLGA 2I72A 3PYPA 5GLBA 3F1OA 2QWSA 3Q7ZA 2WKQA 3WS0A 1ZC2A 1KDWA 4KENB 4GB7A 2GDNA 4OQIA 3SS3A 4DMZA 5EFWA 1FOFA 2WGWA 3TE8A 5JYPA 3LR0A 3DTEA 2PU2A 4HP4A 3PBOA 1MWRA 3VP3A 3IF6C 4AFIA 3RFBA 4WLAA 3ZG8B 4I3IA 3G6OA 4ARZA 4NXFA 1LL9A 4WMCA 1S67L 1Q2QA 1QMEA 2ZL1B 4YOFA 5M19A 2QYBA 2EXBA 1NYYA 3F1NA 3B33A 5GHXA 5FAOA 4P0MA 1YLYA 3PHYA 4DDSA 3QP5A 4R38A 3E0YA 2J3TD 3NDGA 1L0DA 5HD3A 3W2ZA 3S4XA 1AWIA 2WGWB 3H82B 2XQZA 1XPBA 4UEYA 1EROA 3UN7A 1Z09A 4S2KA 1UGUA 3H7WA 3CPTB 3FC7A 1K55A 1S1ZA 3LR3A 3QHYA 1WYCA 3N8RA 5HD5A 5TFQA 3FZCA 2W27A 4XUZA 3R4KA 1E3UD 4DN0A 3HUOA 4FSFA 1K57C 2A24A 5FAQA 3VOZA 1ES4A 4Y0TA 4EU0A 3T4KA 1HLUP 3KYQA 4JBFA 1JVJA 3RXWA 3TOIA 4HP9A 1Y4OA 3ZG0A 4XT2B 4PM9A 5FL3A 5DJUA 1W5DA 3NECA 2IA2A 5TR7A 2K7SA 1K54A 3F1NB 5TGFA 3WRZA 2W3HA 2X02A 1W79A 5I94A 3CITA 2CMNA 1LLBA 4F94A 3KSGA 4JKTA 1GHPA 3ITAA 2L1MA 2ZQDA 1W8YA 2A3UA 3VMAA 3MZEA 4DJ2A 1JWVA 1ERQA 1ONHA 3MJQA 5HARA 1IKIA 3A3DA 2J80A 1VHMA 2WGVA 1PWCA 5HPFA 4NK3A 5A90A 2OAP1 1PZPA 4X1MA 5EUAA 4HBUA 5EVLA 4JXSA 4BBTA 2XFSA 4RVAA 4DXBA 4S2PA 5KSCA 4JGQA 3UB9A 3N8SA
chains in the Genus database with same CATH topology
3SS4A 2WKIA 2DCFA 3CZDA 4X53A 3M6BA 5CERA 4MBHA 1PI5A 2Y2OA 3PBNA 3VP1A 4E3NA 2OV5A 1LI9A 1DY6A 3AGFA 3M2JA 3MXSA 3IH8A 1YM1A 4KZAA 3VP0A 3IF6A 3FWLA 4P85A 5FATA 1FR1A 1BTLA 1NY0A 3NC8A 4S2MA 2HP5A 4P87A 5FSRA 3S1YA 3PBRA 1S6RA 5EVIB 2H10A 4WBGA 3SS5A 1KE3A 4WM9A 2WZZA 1DJAA 2OLVA 4S2LA 1GA0A 1LI0A 1K56D 3BRMA 3WRTA 4S2NC 5CHJA 4E3JA 2WAEA 3NCKA 4ID4A 4N1HA 4EBLA 5FASA 2G2WA 5E2FA 3PAEA 3Q1FA 4KZ6A 3GMWA 3UDIA 4PM8A 1MKIA 1GHIA 2VGKA 3DTMA 4JPMA 3MKFA 4X69A 4LCLA 4QB8A 1ESUA 1I2WA 1MY8A 1PWDA 1SHVA 2XH9A 3N4IA 1RCJA 4B4ZA 1BSGA 3G35A 3Q07A 5L2FA 3DW0A 4X55A 1L2SA 1NZUA 3BFCA 4WELA 5FI2A 4C75A 4OQGA 2Y59A 4PM6A 4RX3A 5BOHA 4QY5A 5DF9A 1IYOA 1YLJA 2V20A 4OKPA 1HZOA 2WGIA 4GN2A 3IXGA 4S2JA 4XXRA 3GQZA 2EX8A 4ZBEA 2JBFA 3UPNA 4MBKA 3G34A 4X6TA 3UNWA 3VFFA 2V1ZA 4BL2A 2WKEA 4C6YA 3HREA 1IEMA 2ZQ9A 3FKWA 5CTNA 3GV9A 2Y2IA 4OOYA 2P9VB 5CHMA 1K6RA 3N8LA 1BLCA 1XXMA 2EX6A 2EX2A 4OOLA 2EFXA 3LO7A 3IWOA 2FFFB 3UPOA 1XX2A 4UAAA 4Y0UA 3UO9A 4KZ8A 1BULA 1ONGA 4OPRA 3UDFA 4OLGA 5E43A 4B4XA 3SOIA 5GLDA 2Y4AA 3NIAA 2HP9A 4HEFA 4KZ4A 5EE8A 1YLWA 4OP5A 4DE2A 1IKGA 1O07A 2BLSA 4E3IA 4M3KA 4CJNA 2ZM2A 4PM7A 4E6WA 4X56A 4KG6A 3UE1A 2V2FF 2WKHA 3BLMA 2ZC4B 4QJGA 4S2IA 3G2ZA 5CHUA 2XDMA 1PWGA 3VFHA 3AGDA 3O87A 1QMFA 1IYSA 5CGXA 2Y2JA 1GHMA 2XD1A 1DJCA 3A3FA 3C4OA 4GNUA 3CMZA 3MKEA 1E4DA 4ZJ3A 1K56A 4OQ0A 3BYDA 4GDBA 3DWKA 1MXOA 1SKFA 2OSUA 2R9WA 1KE0A 3VP2A 5CXWA 2G2UA 1HTZA 4KZ5A 3VSKA 4DF6A 4KZ3A 2ZJ9A 4BD1A 2IWBA 3ZHHA 2QZ6A 1S0WA 3NY4A 5FDHA 2Y2MA 5HAPA 4LENA 1SDNA 4YINA 3IF6B 3BLSA 5AQBA 4DXCA 3ZVWA 2IWCA 5FQJA 1K4FA 1ES2A 1KGEA 1FCNA 1VM1A 3MXRA 1BLSA 1XKZA 2ZD8A 5DTTA 1RP5A 3IXDA 4BD0A 1KDSA 1CK3A 4HESA 3ZG9B 4RYEA 1AXBA 1WYBA 3GTCA 3UY6A 1YLTA 3IHAA 5CTMA 4Z9QA 2EXAA 4JXGA 4BJPA 4GKUA 3LCEA 1N4OA 4UA7A 2WYXA 1W7FA 3HUNA 1JTDA 4KZ7A 4RA7A 1ES3A 1NJ4A 5IHVA 3WS4A 3ISGA 1U60A 1K57A 1Y54A 3BFGA 3IWQA 5FQKA 2HDSA 3MFDA 3V3RA 3PAGA 3WS1A 3PBSA 5U47A 3GRJA 4FH4A 4EV4A 4GD6A 3C7VA 2Q9MA 1ZG6A 3GR2A 1CEFA 5CGWA 4UA9A 3W4OA 4E3MA 1VQQA 5EOOA 4WYYA 4DKIA 5GLCA 4K0XA 5F1GA 2JC7A 4S2NA 4K91A 4A5RA 3NI9A 3A3JA 4LCMA 5EVIC 3IH9A 3NBLA 3D4FA 5JYOA 3BFDA 1PW8A 2CC1A 1MPLA 3S22A 1G6AA 2ZC7A 3HLEA 3OPRA 4NETA 5HW3A 3G4PA 4OOMA 4UHUA 1KE4A 5E2GA 4LV3A 5FAPA 1I5QA 4E3LA 3N6IA 5HAIA 1GA9A 4R0QA 3JYIA 2BG1A 3V39A 4O7DA 3HLCA 3QNCA 2Y55A 5DF8A 2Z2MB 3HLFA 1C3BA 4FH2A 2Y2KA 3W4PA 5F82A 1N9BA 4BENA 1FCOA 3ZNTA 3O3VA 1IYPA 4ZDXA 2PBYA 4EBNA 3A3IA 2IWDA 4WEKA 4WMCD 1XGJA 5E2EA 2DNSA 2Y2LA 4OP8A 4R1GA 3O88A 1NXYA 4KG2A 1L0EA 2XK1A 3PBTA 1BLHA 4L0LA 1FCMA 4R3BA 4DE0A 3IXHA 5D3OA 3QNBA 4UA6A 2ZQ7A 4GOGA 4ZAMA 1RGZA 1YMSA 3HLBA 3CG5A 4MLLA 5DTKA 1CI9A 5A93A 2XFTA 3MBZA 4ZTKA 4KZ9A 2XEPA 3ZVTA 4K0WA 1MBLA 4FD8A 5FQMA 5FI6A 3ZG7B 4GDNA 1FSYA 1TEMA 2ZMAA 1H5XA 3M6HA 1FQGA 1NYMA 3M2KA 4P6BA 2A49A 1K4EA 4U0TA 1KVMA 3TG9A 1CEGA 1K6SA 3E2KA 3VOYA 4EQIA 3Q7VA 3Q82A 4IVIA 4LV0A 3A3EA 4OONA 1MWUA 1GCEA 2ZC6B 1H8ZA 3G30A 1IELA 3DWZA 3ZGAB 3FKVA 1ESIA 4LV1A 2ZQ8A 2C5WB 4WZ5A 3W8KA 4BQMA 4EUZA 3IXBA 1H8YA 5A92A 1TVFA 4QU3A 2B5RA 3ZNYA 2XD5A 3RXXA 2X71A 5DTSA 3IT9A 5HL1A 1K54C 3O86A 4IBXA 3V50A 2UWXA 1E25A 5AQ7A 3HLGA 2I72A 5GLBA 3SH7A 2XR0A 3HBRA 4JLFA 2RL3A 2H0TA 5CGSA 4R4SA 4IVKA 3E2LA 3EQVA 3Q7ZA 3WS0A 4E3KA 1ZC2A 5KZHA 1M6KA 1KDWA 4KENB 1SDEA 3HLDA 3UDXA 1DJBA 2J9OA 3I7JA 4N9KA 2QPNA 4GB7A 3RJUA 2GDNA 2PU4A 4OQIA 4PMAA 3SS3A 3C5AA 2QMIA 1EI5A 4JF4A 1FOFA 2WGWA 4KQQA 3SH9A 4DRTA 5JYPA 3WS2A 1IYQA 2PU2A 3HLWA 1SCWA 1OMEA 3PBOA 2XLNA 1PZOA 4Y0OA 4OPQA 1MWRA 3VP3A 3IF6C 3GSGA 1PI4A 3OPHA 3BFEA 3N8SA 1JWPA 2Y2HA 5EPHA 3ZG8B 2WZXA 1ERMA 1BT5A 2Y2GA 5KSHA 1KGGA 1KVLA 2WAFA 3WS5A 1MWTA 5F83A 4KG5A 1LL9A 4WMCA 2Y91A 4BLMA 1M40A 3HVFA 1Q2QA 3EQUA 1QMEA 1ES5A 1O7EA 2DRWA 3CJMA 4GZBA 2ZC3B 2Z2LB 4BL3A 3OC2A 4IEDA 3P09A 5M19A 1BLPA 4CPKA 4JF5A 2EXBA 1NZOA 2ZM8A 1NYYA 3G31A 1PYYA 5GHYA 5GHXA 4MBFA 1E3UA 1YT4A 5FAOA 5M1AA 4KQOA 1TDLA 5KMWA 3LY3A 2JE5A 3OPPA 4P0MA 2Y2QA 3G32A 3VSLA 1YLYA 2HDRA 1K55C 3HUMA 4HBTA 3IHBA 4DDSA 4XUXA 4FCFA 4X68A 3ZG5A 1L0FA 3NDGA 4JXWA 4R3JA 5FQQA 1BUEA 1L0DA 2EFUA 3P98A 3Q81A 4OPZA 4IBRA 4N1XA 2RCXA 5FI7A 3ITBA 5G18A 1JWZA 3S4XA 4S2OA 2WGWB 2XQZA 1XPBA 4OQHA 1EROA 3SH8A 3HL9A 3UN7A 3UPPA 4DDYA 4S2KA 5HAQA 5CRFA 2ZLYA 5FA7A 3OZHA 1HD8A 1YQSA 4JXVA 1K55A 2C6WB 1JTGA 3OCLA 3QHYA 5EVIA 1FR6A 1WYCA 5FQIA 2FFYA 3N8RA 1W8QA 1XA7A 3ZFZA 3C4PA 5M18A 3OCNA 2R9XA 5TFQA 3FZCA 3PBQA 4QD4A 2X01A 4XUZA 1XA1A 4QHCA 5GHZA 4DE3A 3LEZA 1E3UD 3Q7VB 2XF3A 4GD8A 3BECA 4R4RA 5CEBA 1Q2PA 3HUOA 4FSFA 3LY4A 4H8RA 3N7WA 1HVBA 1K57C 4RX2A 2HPBA 5FAQA 3VOZA 3MZDA 5J8XA 1ES4A 1YLPA 2EX9A 1YMXA 3FYZA 4Y0TA 5CEDA 4MNRA 2WK0A 5GL9A 3GVBA 1PIOA 3IF5A 1L0GA 4JBFA 1J9MA 1JVJA 3RXWA 3TOIA 1YLZA 1TDGA 3WWXA 3ZG0A 5F1FA 2WADA 1ALQA 2ZQCA 4PM9A 1LL5A 3IWIA 5HX9A 1KGFA 1W5DA 2HDQA 3BM6A 4N9LA 5TR7A 1NRFA 4ZJ1A 2H0YA 5EECA 5EOEA 2J8YA 1K54A 3UE3A 1PW1A 3AGEA 1EWZA 2P74A 1XP4A 5AQ9A 1Z6FA 5TGFA 1BZAA 2Q9NA 2X02A 1W79A 3WRZA 5I94A 2P9VA 4EWFA 4LV2A 4WEJA 5AQAA 1FSWA 5EVID 4E6XA 4PPRA 4Q8IA 5DVAA 3ZCZA 3G2YA 4E3OA 2OLUA 4WZ4A 5GLAA 1LLBA 4U0XA 5FQ9A 5A91A 3FV7A 4F94A 2HDUA 1CI8A 4JKTA 1GHPA 3ITAA 2ZC5B 2VGJA 2H5SA 2ZQDA 3OPLA 1W8YA 1RGYA 3B3XA 2A3UA 4YFMA 4KQRA 3V5MA 2JCHA 3VMAA 1XGIA 3MZEA 2Y2PA 1JWVA 4Y7PA 1ERQA 1ONHA 1ZG4A 3W4QA 5HARA 4OVDA 1IKIA 3A3DA 4EBPA 2ZQAA 4B88A 4JF6A 2Y2NA 4OPYA 4R23A 4ZJ2A 5E2HA 4DE1A 2ZM0A 3BEBA 4C3QA 3MZFA 3UE0A 2WGVA 1PWCA 2HP6A 4NK3A 5A90A 4PM5A 2E8IA 1K25A 4U3TA 3TSGA 3PTEA 1PZPA 5HFOA 5DF7A 3C7UA 3NDEA 3VP4A 4D2OA 3ZDJA 5CECA 1ZKJA 1G68A 1K38A 3BFFA 4HBUA 4N92A 5EUAA 5EVLA 3V3SA 4JXSA 2XGNA 2J7VA 1MWSA 2XFSA 1WE4A 4RVAA 2WUQA 4OLDA 4WZ5C 4OH0A 2J9PA 1LHYA 4MEZA 4S2PA 4DXBA 5KSCA 4KZBA 3IQAA 1I2SA 4QY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SS4 A;  2WKI A;  2DCF A;  3CZD A;  4X53 A;  3M6B A;  5CER A;  4MBH A;  1PI5 A;  2Y2O A;  3PBN A;  3VP1 A;  4E3N A;  2OV5 A;  1LI9 A;  1DY6 A;  3AGF A;  3M2J A;  3MXS A;  3IH8 A;  1YM1 A;  4KZA A;  3VP0 A;  3IF6 A;  3FWL A;  4P85 A;  5FAT A;  1FR1 A;  1BTL A;  1NY0 A;  3NC8 A;  4S2M A;  2HP5 A;  4P87 A;  5FSR A;  3S1Y A;  3PBR A;  1S6R A;  5EVI B;  2H10 A;  4WBG A;  3SS5 A;  1KE3 A;  4WM9 A;  2WZZ A;  1DJA A;  2OLV A;  4S2L A;  1GA0 A;  1LI0 A;  1K56 D;  3BRM A;  3WRT A;  4S2N C;  5CHJ A;  4E3J A;  2WAE A;  3NCK A;  4ID4 A;  4N1H A;  4EBL A;  5FAS A;  2G2W A;  5E2F A;  3PAE A;  3Q1F A;  4KZ6 A;  3GMW A;  3UDI A;  4PM8 A;  1MKI A;  1GHI A;  2VGK A;  3DTM A;  4JPM A;  3MKF A;  4X69 A;  4LCL A;  4QB8 A;  1ESU A;  1I2W A;  1MY8 A;  1PWD A;  1SHV A;  2XH9 A;  3N4I A;  1RCJ A;  4B4Z A;  1BSG A;  3G35 A;  3Q07 A;  5L2F A;  3DW0 A;  4X55 A;  1L2S A;  1NZU A;  3BFC A;  4WEL A;  5FI2 A;  4C75 A;  4OQG A;  2Y59 A;  4PM6 A;  4RX3 A;  5BOH A;  4QY5 A;  5DF9 A;  1IYO A;  1YLJ A;  2V20 A;  4OKP A;  1HZO A;  2WGI A;  4GN2 A;  3IXG A;  4S2J A;  4XXR A;  3GQZ A;  2EX8 A;  4ZBE A;  2JBF A;  3UPN A;  4MBK A;  3G34 A;  4X6T A;  3UNW A;  3VFF A;  2V1Z A;  4BL2 A;  2WKE A;  4C6Y A;  3HRE A;  1IEM A;  2ZQ9 A;  3FKW A;  5CTN A;  3GV9 A;  2Y2I A;  4OOY A;  2P9V B;  5CHM A;  1K6R A;  3N8L A;  1BLC A;  1XXM A;  2EX6 A;  2EX2 A;  4OOL A;  2EFX A;  3LO7 A;  3IWO A;  2FFF B;  3UPO A;  1XX2 A;  4UAA A;  4Y0U A;  3UO9 A;  4KZ8 A;  1BUL A;  1ONG A;  4OPR A;  3UDF A;  4OLG A;  5E43 A;  4B4X A;  3SOI A;  5GLD A;  2Y4A A;  3NIA A;  2HP9 A;  4HEF A;  4KZ4 A;  5EE8 A;  1YLW A;  4OP5 A;  4DE2 A;  1IKG A;  1O07 A;  2BLS A;  4E3I A;  4M3K A;  4CJN A;  2ZM2 A;  4PM7 A;  4E6W A;  4X56 A;  4KG6 A;  3UE1 A;  2V2F F;  2WKH A;  3BLM A;  2ZC4 B;  4QJG A;  4S2I A;  3G2Z A;  5CHU A;  2XDM A;  1PWG A;  3VFH A;  3AGD A;  3O87 A;  1QMF A;  1IYS A;  5CGX A;  2Y2J A;  1GHM A;  2XD1 A;  1DJC A;  3A3F A;  3C4O A;  4GNU A;  3CMZ A;  3MKE A;  1E4D A;  4ZJ3 A;  1K56 A;  4OQ0 A;  3BYD A;  4GDB A;  3DWK A;  1MXO A;  1SKF A;  2OSU A;  2R9W A;  1KE0 A;  3VP2 A;  5CXW A;  2G2U A;  1HTZ A;  4KZ5 A;  3VSK A;  4DF6 A;  4KZ3 A;  2ZJ9 A;  4BD1 A;  2IWB A;  3ZHH A;  2QZ6 A;  1S0W A;  3NY4 A;  5FDH A;  2Y2M A;  5HAP A;  4LEN A;  1SDN A;  4YIN A;  3IF6 B;  3BLS A;  5AQB A;  4DXC A;  3ZVW A;  2IWC A;  5FQJ A;  1K4F A;  1ES2 A;  1KGE A;  1FCN A;  1VM1 A;  3MXR A;  1BLS A;  1XKZ A;  2ZD8 A;  5DTT A;  1RP5 A;  3IXD A;  4BD0 A;  1KDS A;  1CK3 A;  4HES A;  3ZG9 B;  4RYE A;  1AXB A;  1WYB A;  3GTC A;  3UY6 A;  1YLT A;  3IHA A;  5CTM A;  4Z9Q A;  2EXA A;  4JXG A;  4BJP A;  4GKU A;  3LCE A;  1N4O A;  4UA7 A;  2WYX A;  1W7F A;  3HUN A;  1JTD A;  4KZ7 A;  4RA7 A;  1ES3 A;  1NJ4 A;  5IHV A;  3WS4 A;  3ISG A;  1U60 A;  1K57 A;  1Y54 A;  3BFG A;  3IWQ A;  5FQK A;  2HDS A;  3MFD A;  3V3R A;  3PAG A;  3WS1 A;  3PBS A;  5U47 A;  3GRJ A;  4FH4 A;  4EV4 A;  4GD6 A;  3C7V A;  2Q9M A;  1ZG6 A;  3GR2 A;  1CEF A;  5CGW A;  4UA9 A;  3W4O A;  4E3M A;  1VQQ A;  5EOO A;  4WYY A;  4DKI A;  5GLC A;  4K0X A;  5F1G A;  2JC7 A;  4S2N A;  4K91 A;  4A5R A;  3NI9 A;  3A3J A;  4LCM A;  5EVI C;  3IH9 A;  3NBL A;  3D4F A;  5JYO A;  3BFD A;  1PW8 A;  2CC1 A;  1MPL A;  3S22 A;  1G6A A;  2ZC7 A;  3HLE A;  3OPR A;  4NET A;  5HW3 A;  3G4P A;  4OOM A;  4UHU A;  1KE4 A;  5E2G A;  4LV3 A;  5FAP A;  1I5Q A;  4E3L A;  3N6I A;  5HAI A;  1GA9 A;  4R0Q A;  3JYI A;  2BG1 A;  3V39 A;  4O7D A;  3HLC A;  3QNC A;  2Y55 A;  5DF8 A;  2Z2M B;  3HLF A;  1C3B A;  4FH2 A;  2Y2K A;  3W4P A;  5F82 A;  1N9B A;  4BEN A;  1FCO A;  3ZNT A;  3O3V A;  1IYP A;  4ZDX A;  2PBY A;  4EBN A;  3A3I A;  2IWD A;  4WEK A;  4WMC D;  1XGJ A;  5E2E A;  2DNS A;  2Y2L A;  4OP8 A;  4R1G A;  3O88 A;  1NXY A;  4KG2 A;  1L0E A;  2XK1 A;  3PBT A;  1BLH A;  4L0L A;  1FCM A;  4R3B A;  4DE0 A;  3IXH A;  5D3O A;  3QNB A;  4UA6 A;  2ZQ7 A;  4GOG A;  4ZAM A;  1RGZ A;  1YMS A;  3HLB A;  3CG5 A;  4MLL A;  5DTK A;  1CI9 A;  5A93 A;  2XFT A;  3MBZ A;  4ZTK A;  4KZ9 A;  2XEP A;  3ZVT A;  4K0W A;  1MBL A;  4FD8 A;  5FQM A;  5FI6 A;  3ZG7 B;  4GDN A;  1FSY A;  1TEM A;  2ZMA A;  1H5X A;  3M6H A;  1FQG A;  1NYM A;  3M2K A;  4P6B A;  2A49 A;  1K4E A;  4U0T A;  1KVM A;  3TG9 A;  1CEG A;  1K6S A;  3E2K A;  3VOY A;  4EQI A;  3Q7V A;  3Q82 A;  4IVI A;  4LV0 A;  3A3E A;  4OON A;  1MWU A;  1GCE A;  2ZC6 B;  1H8Z A;  3G30 A;  1IEL A;  3DWZ A;  3ZGA B;  3FKV A;  1ESI A;  4LV1 A;  2ZQ8 A;  2C5W B;  4WZ5 A;  3W8K A;  4BQM A;  4EUZ A;  3IXB A;  1H8Y A;  5A92 A;  1TVF A;  4QU3 A;  2B5R A;  3ZNY A;  2XD5 A;  3RXX A;  2X71 A;  5DTS A;  3IT9 A;  5HL1 A;  1K54 C;  3O86 A;  4IBX A;  3V50 A;  2UWX A;  1E25 A;  5AQ7 A;  3HLG A;  2I72 A;  5GLB A;  3SH7 A;  2XR0 A;  3HBR A;  4JLF A;  2RL3 A;  2H0T A;  5CGS A;  4R4S A;  4IVK A;  3E2L A;  3EQV A;  3Q7Z A;  3WS0 A;  4E3K A;  1ZC2 A;  5KZH A;  1M6K A;  1KDW A;  4KEN B;  1SDE A;  3HLD A;  3UDX A;  1DJB A;  2J9O A;  3I7J A;  4N9K A;  2QPN A;  4GB7 A;  3RJU A;  2GDN A;  2PU4 A;  4OQI A;  4PMA A;  3SS3 A;  3C5A A;  2QMI A;  1EI5 A;  4JF4 A;  1FOF A;  2WGW A;  4KQQ A;  3SH9 A;  4DRT A;  5JYP A;  3WS2 A;  1IYQ A;  2PU2 A;  3HLW A;  1SCW A;  1OME A;  3PBO A;  2XLN A;  1PZO A;  4Y0O A;  4OPQ A;  1MWR A;  3VP3 A;  3IF6 C;  3GSG A;  1PI4 A;  3OPH A;  3BFE A;  3N8S A;  1JWP A;  2Y2H A;  5EPH A;  3ZG8 B;  2WZX A;  1ERM A;  1BT5 A;  2Y2G A;  5KSH A;  1KGG A;  1KVL A;  2WAF A;  3WS5 A;  1MWT A;  5F83 A;  4KG5 A;  1LL9 A;  4WMC A;  2Y91 A;  4BLM A;  1M40 A;  3HVF A;  1Q2Q A;  3EQU A;  1QME A;  1ES5 A;  1O7E A;  2DRW A;  3CJM A;  4GZB A;  2ZC3 B;  2Z2L B;  4BL3 A;  3OC2 A;  4IED A;  3P09 A;  5M19 A;  1BLP A;  4CPK A;  4JF5 A;  2EXB A;  1NZO A;  2ZM8 A;  1NYY A;  3G31 A;  1PYY A;  5GHY A;  5GHX A;  4MBF A;  1E3U A;  1YT4 A;  5FAO A;  5M1A A;  4KQO A;  1TDL A;  5KMW A;  3LY3 A;  2JE5 A;  3OPP A;  4P0M A;  2Y2Q A;  3G32 A;  3VSL A;  1YLY A;  2HDR A;  1K55 C;  3HUM A;  4HBT A;  3IHB A;  4DDS A;  4XUX A;  4FCF A;  4X68 A;  3ZG5 A;  1L0F A;  3NDG A;  4JXW A;  4R3J A;  5FQQ A;  1BUE A;  1L0D A;  2EFU A;  3P98 A;  3Q81 A;  4OPZ A;  4IBR A;  4N1X A;  2RCX A;  5FI7 A;  3ITB A;  5G18 A;  1JWZ A;  3S4X A;  4S2O A;  2WGW B;  2XQZ A;  1XPB A;  4OQH A;  1ERO A;  3SH8 A;  3HL9 A;  3UN7 A;  3UPP A;  4DDY A;  4S2K A;  5HAQ A;  5CRF A;  2ZLY A;  5FA7 A;  3OZH A;  1HD8 A;  1YQS A;  4JXV A;  1K55 A;  2C6W B;  1JTG A;  3OCL A;  3QHY A;  5EVI A;  1FR6 A;  1WYC A;  5FQI A;  2FFY A;  3N8R A;  1W8Q A;  1XA7 A;  3ZFZ A;  3C4P A;  5M18 A;  3OCN A;  2R9X A;  5TFQ A;  3FZC A;  3PBQ A;  4QD4 A;  2X01 A;  4XUZ A;  1XA1 A;  4QHC A;  5GHZ A;  4DE3 A;  3LEZ A;  1E3U D;  3Q7V B;  2XF3 A;  4GD8 A;  3BEC A;  4R4R A;  5CEB A;  1Q2P A;  3HUO A;  4FSF A;  3LY4 A;  4H8R A;  3N7W A;  1HVB A;  1K57 C;  4RX2 A;  2HPB A;  5FAQ A;  3VOZ A;  3MZD A;  5J8X A;  1ES4 A;  1YLP A;  2EX9 A;  1YMX A;  3FYZ A;  4Y0T A;  5CED A;  4MNR A;  2WK0 A;  5GL9 A;  3GVB A;  1PIO A;  3IF5 A;  1L0G A;  4JBF A;  1J9M A;  1JVJ A;  3RXW A;  3TOI A;  1YLZ A;  1TDG A;  3WWX A;  3ZG0 A;  5F1F A;  2WAD A;  1ALQ A;  2ZQC A;  4PM9 A;  1LL5 A;  3IWI A;  5HX9 A;  1KGF A;  1W5D A;  2HDQ A;  3BM6 A;  4N9L A;  5TR7 A;  1NRF A;  4ZJ1 A;  2H0Y A;  5EEC A;  5EOE A;  2J8Y A;  1K54 A;  3UE3 A;  1PW1 A;  3AGE A;  1EWZ A;  2P74 A;  1XP4 A;  5AQ9 A;  1Z6F A;  5TGF A;  1BZA A;  2Q9N A;  2X02 A;  1W79 A;  3WRZ A;  5I94 A;  2P9V A;  4EWF A;  4LV2 A;  4WEJ A;  5AQA A;  1FSW A;  5EVI D;  4E6X A;  4PPR A;  4Q8I A;  5DVA A;  3ZCZ A;  3G2Y A;  4E3O A;  2OLU A;  4WZ4 A;  5GLA A;  1LLB A;  4U0X A;  5FQ9 A;  5A91 A;  3FV7 A;  4F94 A;  2HDU A;  1CI8 A;  4JKT A;  1GHP A;  3ITA A;  2ZC5 B;  2VGJ A;  2H5S A;  2ZQD A;  3OPL A;  1W8Y A;  1RGY A;  3B3X A;  2A3U A;  4YFM A;  4KQR A;  3V5M A;  2JCH A;  3VMA A;  1XGI A;  3MZE A;  2Y2P A;  1JWV A;  4Y7P A;  1ERQ A;  1ONH A;  1ZG4 A;  3W4Q A;  5HAR A;  4OVD A;  1IKI A;  3A3D A;  4EBP A;  2ZQA A;  4B88 A;  4JF6 A;  2Y2N A;  4OPY A;  4R23 A;  4ZJ2 A;  5E2H A;  4DE1 A;  2ZM0 A;  3BEB A;  4C3Q A;  3MZF A;  3UE0 A;  2WGV A;  1PWC A;  2HP6 A;  4NK3 A;  5A90 A;  4PM5 A;  2E8I A;  1K25 A;  4U3T A;  3TSG A;  3PTE A;  1PZP A;  5HFO A;  5DF7 A;  3C7U A;  3NDE A;  3VP4 A;  4D2O A;  3ZDJ A;  5CEC A;  1ZKJ A;  1G68 A;  1K38 A;  3BFF A;  4HBU A;  4N92 A;  5EUA A;  5EVL A;  3V3S A;  4JXS A;  2XGN A;  2J7V A;  1MWS A;  2XFS A;  1WE4 A;  4RVA A;  2WUQ A;  4OLD A;  4WZ5 C;  4OH0 A;  2J9P A;  1LHY A;  4MEZ A;  4S2P A;  4DXB A;  5KSC A;  4KZB A;  3IQA A;  1I2S A;  4QY6 A; 
#chains in the Genus database with same CATH topology
 3SS4 A;  3CZD A;  2Y2O A;  2Y8H A;  3T4L A;  2HJ9 C;  1TD5 A;  5FAT A;  1NY0 A;  1S6R A;  3NOP C;  2VV6 A;  2H10 A;  2K2N A;  2OLV A;  3PXP A;  3WRT A;  4WF0 A;  3QP4 A;  4ID4 A;  4EBL A;  2NUP C;  3U4L P;  4NKP A;  2P7J A;  3UDI A;  1MKI A;  3DTM A;  3MKF A;  4X69 A;  4QB8 A;  3N4I A;  1RCJ A;  2J3T C;  2W1T A;  3DW0 A;  4X55 A;  1TS6 A;  2Y59 A;  2A2L A;  3P7N A;  4OKP A;  2WGI A;  4S2J A;  4XXR A;  4ZBE A;  3CLO A;  2JBF A;  4FUW A;  4MBK A;  2V1Z A;  4F3L B;  3CHW P;  2ZQ9 A;  3FKW A;  5C5K A;  2Y2I A;  4EET B;  1K6R A;  1BLC A;  2EX6 A;  4OOL A;  5J4E A;  4EQ1 A;  2O9A A;  3UDF A;  4OLG A;  1D7E A;  5GLD A;  3EGD C;  2Y4A A;  3NIA A;  2HP9 A;  4HEF A;  4G3V A;  1IKG A;  5G4Y A;  2YKF A;  3CI6 A;  1OTE A;  4PM7 A;  3UE1 A;  2VA0 A;  4QJG A;  2XDM A;  1PWG A;  3AGD A;  2EWW A;  1IYS A;  3C4O A;  2O99 A;  1F5M A;  1K56 A;  3BYD A;  1F2K A;  4GDB A;  4HOI A;  1KE0 A;  3MF0 A;  1FIL A;  5CXW A;  3VSK A;  4KZ3 A;  1SZV A;  4D60 A;  4HQA A;  3NY4 A;  2Y2M A;  4IUK A;  4UQI S;  3SZT A;  2IWC A;  3A0R A;  2GZA A;  1RP5 A;  4BD0 A;  4CLC D;  1KDS A;  4HES A;  1AXB A;  3GTC A;  3LFV A;  4Z9Q A;  2EXA A;  4JXG A;  1P0Z A;  2WYX A;  3HUN A;  4RA7 A;  1NJ4 A;  1K57 A;  5L8M A;  2HDS A;  4ETX A;  3CUE A;  2V1A A;  1D1J A;  3GRJ A;  4EV4 A;  3C2W A;  4ARZ B;  4WUJ A;  2QJ7 A;  2B02 A;  5GLC A;  4K91 A;  4HH3 A;  5JYO A;  4JGR A;  1MPL A;  4LV3 A;  1PRQ A;  4FOF A;  1OPX A;  3V39 A;  4KUO A;  2Z2M B;  4FH2 A;  4RQ9 A;  3W4P A;  3ZNT A;  3O3V A;  4E04 A;  1XGJ A;  3QP1 A;  4R1G A;  2XK1 A;  3UB8 A;  5D3O A;  2VX8 A;  1T19 A;  4UA6 A;  2JHE A;  1RGZ A;  2KLI A;  3CG5 A;  4QWO A;  4R3A A;  1CI9 A;  2KX6 A;  4KZ9 A;  3ZVT A;  3LI9 A;  2OOL A;  1MBL A;  3C38 A;  4GDN A;  1FSY A;  4O8G A;  3JPU A;  3M2K A;  4HI4 A;  1K6S A;  5MC7 A;  4LV0 A;  4OON A;  3E4P A;  3C8C A;  3FKV A;  3DTK A;  2ZQ8 A;  3W8K A;  3IS2 A;  4EW7 A;  4Q0I A;  3ZNY A;  5DTS A;  4IBX A;  5EM0 A;  5DKL A;  3SH7 A;  2RL3 A;  3LUQ A;  2B18 A;  5DFY A;  2V8C A;  4JF4 A;  3EWK A;  4KQQ A;  4DRT A;  3HLW A;  4II7 A;  1OME A;  4Y0O A;  4OPQ A;  1D06 A;  1PI4 A;  2V8F A;  5HDS A;  5EPH A;  2OWJ A;  1KVL A;  2ZOI A;  2O0Y A;  5F83 A;  2Y91 A;  1M40 A;  2INW A;  3UB5 P;  4X25 A;  1O7E A;  4NXE A;  3CJM A;  1DP6 A;  4IED A;  1S1Y A;  4CPK A;  2I9V A;  4JF5 A;  2ZMV A;  3G31 A;  5GHY A;  1YT4 A;  5LBR A;  3LY3 A;  2Y2Q A;  3T1X A;  3HUM A;  4HBT A;  3VE4 A;  5L07 A;  5FQQ A;  1BUE A;  2EFU A;  3GEC A;  3Q81 A;  3B42 A;  4M4X A;  3HCY A;  3T50 A;  4BBV A;  3HL9 A;  3UPP A;  1K0K A;  3DBA A;  5CRF A;  1L3L A;  2ZLY A;  4P6Z M;  2GX5 A;  3OZH A;  3QP8 A;  1JTG A;  1YKD A;  5EVI A;  1FR6 A;  2W1T B;  2FFY A;  5TBM B;  1W8Q A;  1XA7 A;  3UB7 A;  4YNR A;  5M18 A;  1MC0 A;  3R7W A;  4QD4 A;  2JKF A;  1XA1 A;  3LIA A;  2PHY A;  1Q2P A;  5CEB A;  3D3O A;  3KSF A;  3N7W A;  4RX2 A;  4EXO A;  2JKT M;  2EX9 A;  1YMX A;  1H3Q A;  3FYZ A;  4MNR A;  1XJ6 A;  3WWX A;  5F1F A;  5DFX A;  1LL5 A;  3BM6 A;  4I3J A;  3UME A;  5EOE A;  3UE3 A;  2P74 A;  1XP4 A;  3LR4 A;  3S7N A;  2P9V A;  5F69 A;  2Z6C A;  1FSW A;  4E6X A;  4PPR A;  3ZCZ A;  3G2Y A;  4E3O A;  2OLU A;  5FQ9 A;  3KYZ A;  2DMW A;  2HDU A;  1CI8 A;  2VGJ A;  2H5S A;  3T4T A;  1ACF A;  1S4S A;  4Y3I A;  2LB5 A;  5HL6 A;  4YFM A;  1XGI A;  5J3W A;  3O5Y A;  4CLC A;  4GLQ A;  2ZQA A;  4JGO A;  4C3Q A;  1OTA A;  4PHT A;  2R78 A;  1T1C A;  2G7U A;  4PM5 A;  2E8I A;  4U3T A;  3TSG A;  4P6Z S;  5HFO A;  3EEH A;  4MN5 A;  1OT9 A;  3NDE A;  4GHI B;  1X0O A;  1G68 A;  4N92 A;  2XGN A;  1MWS A;  3EGX C;  1WE4 A;  2WUQ A;  4WZ5 C;  1LHY A;  4MEZ A;  3JVV A;  3IQA A;  2WKI A;  2W3F A;  3VP1 A;  4LRZ E;  2V0W A;  3AGF A;  4ETZ A;  3MXS A;  3IH8 A;  1YM1 A;  4P85 A;  2V1B A;  4NG2 A;  4P87 A;  3U2A A;  5EVI B;  4WBG A;  2PD8 A;  3FG8 A;  1KE3 A;  1DJA A;  3NUL A;  1LI0 A;  3BRM A;  3LIE A;  3OOV A;  4I38 A;  2WAE A;  4N1H A;  4BMW A;  2OWH A;  3S7Q A;  4PM8 A;  1GHI A;  1YPR A;  2VGK A;  3OBF A;  3F1P B;  4B4Z A;  3G35 A;  4R70 A;  3BFC A;  5BOH A;  4QY5 A;  2JKR M;  4GN2 A;  4X6T A;  3VFF A;  4JGP A;  3QP2 A;  2P9V B;  5CHM A;  1XXM A;  2EX2 A;  1XX2 A;  4UAA A;  4KZ8 A;  3ICY A;  1BUL A;  2L4R A;  4OPR A;  3KSH A;  4B4X A;  3BWL A;  2WKR A;  4HH2 A;  4KZ4 A;  2K31 A;  4HY8 A;  5EE8 A;  4DE2 A;  4PKY G;  4ZRR A;  2BLS A;  2VEA A;  4E3I A;  2ZM2 A;  4KG6 A;  3BJN A;  2PR6 A;  3BLM A;  4Z1W A;  3G2Z A;  1P9W A;  1QMF A;  2M7U A;  2Y2J A;  3LYX A;  3A3F A;  4GNU A;  4O01 A;  4OQ0 A;  5CX7 A;  4HIA A;  2OSU A;  2V0U A;  4DF6 A;  5TJJ A;  1MZU A;  4BWI A;  5IS1 A;  4YIN A;  3L7H A;  5AQB A;  5FQJ A;  3LEQ A;  1KGE A;  3MXR A;  2ZD8 A;  3IXD A;  1CK3 A;  3D72 A;  2D02 A;  1YLT A;  3IHA A;  3IBJ A;  3MS6 A;  5CTM A;  3KX0 X;  3VV4 A;  4BJP A;  3LCE A;  4FTX A;  2AVX A;  4GCZ A;  5IHV A;  1CJF A;  2WKP A;  1U60 A;  3BFG A;  3IWQ A;  5FEG A;  4H6J A;  3PAG A;  3BY9 A;  3SW1 A;  5F68 A;  3ZQ5 A;  3GR2 A;  5CGW A;  1PNE A;  2QJ5 A;  3HJK A;  5EOO A;  5F1G A;  4B93 A;  4LCM A;  3NOT C;  3S22 A;  2ZC7 A;  3HLE A;  3NOU C;  4UHU A;  5FAP A;  1KE4 A;  5HPI A;  4O7D A;  4F3L A;  3HLF A;  2PDR A;  5F82 A;  4BEN A;  1FCO A;  1IYP A;  1N9O A;  4WEK A;  4WMC D;  5E2E A;  2Y2L A;  2LB9 A;  5K5B A;  1ZTU A;  1T18 A;  4DE0 A;  3IXH A;  1V9Z A;  3LI8 A;  3H7W B;  5DJT A;  3HLB A;  4MLL A;  2XEP A;  3PR6 A;  3ZG7 B;  1TEM A;  4R6L A;  1H5X A;  3M6H A;  1FQG A;  4CLC C;  1NYM A;  1NWZ A;  2A49 A;  1K4E A;  3VOY A;  1KVM A;  1CEG A;  4MDZ A;  1VEU A;  1MWU A;  1GCE A;  1H8Z A;  2ZBB A;  5HSQ A;  1N9L A;  3ZGA B;  1VET B;  4LV1 A;  2C5W B;  4EUZ A;  4QU3 A;  2B5R A;  1N9N A;  3O86 A;  2XA7 S;  2UWX A;  1E25 A;  2XR0 A;  3HBR A;  5EV0 A;  2H0T A;  3E2L A;  4E3K A;  5KZH A;  3LIB A;  1SDE A;  3HLD A;  2J9O A;  1G6O A;  3RJU A;  2PU4 A;  4KUK A;  1EI5 A;  1LT0 A;  3BQA A;  3WS2 A;  2XLN A;  1PZO A;  2W3E A;  3H9W A;  3GSG A;  3OPH A;  1JWP A;  2WZX A;  1ERM A;  4I39 A;  5HDD A;  1BT5 A;  2Y2G A;  5KSH A;  1KGG A;  3WS5 A;  1MWT A;  4BLM A;  3HVF A;  1F98 A;  4HNB A;  3EQU A;  5AVF A;  1ES5 A;  2DRW A;  3CWF A;  4GZB A;  2ZC3 B;  3P09 A;  5A8B A;  1BYW A;  4Y17 A;  5HWT A;  2ZM8 A;  3OPP A;  4PAU A;  3VSL A;  2W1R A;  2HDR A;  2M7V A;  4X68 A;  3ZG5 A;  3BY8 A;  2OAQ 1;  1ODV A;  2Y79 A;  4N1X A;  5G18 A;  1W63 Q;  3ITB A;  4S2O A;  4OQH A;  3SH8 A;  3TW8 A;  1XJ3 A;  2UV0 E;  2ZL1 A;  1I2S A;  1LSX A;  1YQS A;  4JXV A;  1YSP A;  4YWZ A;  3FPV A;  3ZFZ A;  3C4P A;  3S7P A;  1GSX A;  3MXQ A;  3PBQ A;  4NXG A;  4QHC A;  5GHZ A;  4DE3 A;  3K3C A;  2XF3 A;  4GD8 A;  4H8R A;  1HVB A;  3CPT A;  4G3W A;  5J8X A;  2WK0 A;  3RTY A;  3IF5 A;  1YLZ A;  2WAD A;  4MMN A;  2ZQC A;  1KGF A;  2H0Y A;  1STZ A;  2J8Y A;  1PW1 A;  1EWZ A;  1DP9 A;  5AQ9 A;  1VET A;  3T4J A;  1Z6F A;  1BZA A;  4EWF A;  4LV2 A;  5DKK A;  5TBM A;  3L9K A;  5DVA A;  4GJ4 A;  4WZ4 A;  4LRY C;  3IX4 A;  1XJ4 A;  1NLZ A;  3OPL A;  1RGY A;  3B3X A;  3V5M A;  4KQR A;  2JCH A;  1CF0 A;  3MMH A;  5AVE A;  3W4Q A;  2Y2N A;  4R23 A;  4DE1 A;  3BEB A;  3PTE A;  1IFQ A;  4GS9 B;  3LGO A;  4D2O A;  3ZDJ A;  5CEC A;  2ZMF A;  1K38 A;  3V3S A;  2J7V A;  3S7O A;  4BBU A;  2VKS A;  4MN6 A;  2J9P A;  3D9Y A;  4KZB A;  4QY6 A;  4MN7 A;  5CER A;  4MBH A;  4E3N A;  3PBN A;  2OV5 A;  2VZW A;  4KZA A;  3DTI A;  3TRC A;  3VP0 A;  3FWL A;  3CUE C;  4S2M A;  5FSR A;  3PBR A;  5HDC A;  3SS5 A;  4WM9 A;  2WZZ A;  5KIZ A;  4S2L A;  1K56 D;  3UB6 A;  1V9Y A;  3NCK A;  2Q0O A;  2G2W A;  5E2F A;  3PAE A;  3Q1F A;  4KZ6 A;  3GMW A;  3JVU A;  4Y2F A;  2O9B A;  4ME4 A;  4LCL A;  1ESU A;  1PWD A;  1SHV A;  3Q07 A;  3OLO A;  1H0M A;  1L2S A;  1NZU A;  1OJG A;  4RX3 A;  5DF9 A;  3GDI A;  1IYO A;  1YLJ A;  4ESP A;  1HZO A;  2EX8 A;  3G34 A;  4DJ3 A;  3UNW A;  4BL2 A;  2L0W A;  5FEF A;  5CTN A;  4OOY A;  3N8L A;  1OTB A;  3NHQ A;  3LO7 A;  1Y28 A;  3IWO A;  4Y0U A;  3UO9 A;  4QPR A;  2XSS A;  1YLW A;  1O07 A;  5L09 A;  1OT6 A;  4X56 A;  4Y13 A;  2ZC4 B;  3VFH A;  5CGX A;  3MQO A;  1NLY A;  3C30 A;  2XD1 A;  1DJC A;  3MKE A;  1E4D A;  2JKT I;  4ZJ3 A;  1MXO A;  2HJE A;  2ZJ9 A;  4BD1 A;  2IWB A;  3ZHH A;  1XFQ A;  2QZ6 A;  1T1B A;  2PYR A;  5FDH A;  5HAP A;  1SDN A;  3ZYT A;  2JKG A;  4DXC A;  5IT5 A;  1K4F A;  1ES2 A;  1FCN A;  1BLS A;  1F9I A;  3F1P A;  3A0S A;  2PT7 A;  3ZG9 B;  4IHQ A;  1G5U A;  1GSW A;  4GKU A;  1N4O A;  3A0V A;  1DP8 A;  3HJI A;  1W7F A;  1JTD A;  1ES3 A;  2NUT C;  3ISG A;  3V3R A;  3PBS A;  3LIC A;  5U47 A;  4FH4 A;  1IOU A;  2YKH A;  2Q9M A;  1ZG6 A;  1CEF A;  3EEA A;  4UA9 A;  3W4O A;  4E3M A;  4S2N A;  5AJG A;  3A3J A;  3NBL A;  3D4F A;  3T4O A;  3P01 A;  1PW8 A;  1J3W A;  4IUH A;  1TF1 A;  3OPR A;  4NET A;  5HW3 A;  4OOM A;  4Y5F A;  4E3L A;  3N6I A;  5HAI A;  4G3K A;  1GA9 A;  3NJA A;  5L10 A;  3QP6 A;  4R0Q A;  3JYI A;  3HLC A;  3QNC A;  4HJ3 A;  1C3B A;  2JN7 A;  3LID A;  1OTD A;  4NEE D;  4L9F A;  2MJ6 A;  1OTI A;  4EBN A;  3A3I A;  2IWD A;  2DNS A;  2VLG A;  1A0K A;  3O88 A;  1MKM A;  1BLH A;  4L0L A;  1FCM A;  3MR0 A;  2PYP A;  2VGL M;  2ZQ7 A;  5DTK A;  5A93 A;  3MBZ A;  4FD8 A;  2W3D A;  2O9C A;  4HHD A;  2ZMA A;  5EVE A;  3TG9 A;  4LRX C;  3E2K A;  4I5S A;  4IVI A;  3IS2 B;  5HZH A;  4NXB A;  3E4O A;  5J7E A;  1LL8 A;  4LFU A;  3EOI A;  4WZ5 A;  5A92 A;  1TVF A;  2XD5 A;  3IBR A;  3IT9 A;  1K54 C;  3K2N A;  2XRN A;  5AQ7 A;  3IX8 A;  2HZ5 A;  4JLF A;  4LGW A;  5CGS A;  4R4S A;  1OJ5 A;  4IVK A;  3EQV A;  1M6K A;  3BQ8 A;  3UDX A;  1DJB A;  3I7J A;  4N9K A;  2QPN A;  5F6A A;  4PMA A;  3C5A A;  2QMI A;  3SH9 A;  1IYQ A;  1SCW A;  1YAX A;  1P9R A;  3BFE A;  2Y2H A;  5HWV A;  3ULF A;  2VJW A;  4GS9 A;  2WAF A;  4WN5 A;  4KG5 A;  5G4Z A;  4XT2 A;  2EA9 A;  1SKO B;  3MQ0 A;  5HWW A;  2Z2L B;  4BL3 A;  3OC2 A;  1BLP A;  4O0P A;  1LSW A;  1NZO A;  1PYY A;  4MBF A;  1E3U A;  5M1A A;  5KMW A;  4KQO A;  1TDL A;  2QKP A;  1WA9 A;  2JE5 A;  3G32 A;  2PR5 A;  1K55 C;  3IHB A;  3H82 A;  2VV7 A;  4XUX A;  4FCF A;  3VE3 A;  1L0F A;  3KO6 A;  4JXW A;  3LR5 A;  4R3J A;  3P98 A;  4OPZ A;  3T1Q B;  4IBR A;  4I3A A;  2RCX A;  5FI7 A;  1JWZ A;  4DDY A;  5HAQ A;  5FA7 A;  1HD8 A;  3MQQ A;  3E98 A;  2C6W B;  3OCL A;  5FQI A;  1CQA A;  3OCN A;  2R9X A;  2PAV P;  2HGV A;  2X01 A;  4EES A;  5F5Y A;  2FH5 A;  3LEZ A;  3Q7V B;  1EW0 A;  3BEC A;  4R4R A;  3LY4 A;  3MFX A;  2H28 A;  2D01 A;  2HPB A;  3MZD A;  1YLP A;  3MSH A;  5CED A;  5GL9 A;  3GVB A;  1PIO A;  1L0G A;  2V9A A;  1J9M A;  4L9G A;  4MCW A;  1TDG A;  1ALQ A;  4KQD A;  2PD7 A;  3IWI A;  5HX9 A;  2Z6D A;  4LLO B;  2HDQ A;  1ZHH B;  4N9L A;  1NRF A;  4ZJ1 A;  5EEC A;  3AGE A;  3K3D A;  4K08 A;  2Q9N A;  4HJ4 A;  4WEJ A;  5AQA A;  5EVI D;  4Q8I A;  2E8J A;  5GLA A;  5A91 A;  4U0X A;  3FV7 A;  1XJ2 A;  2A24 B;  2ZC5 B;  4H6J B;  1TS8 A;  4EUV A;  3FPW A;  2XRO A;  2Y2P A;  4Y7P A;  1ZG4 A;  2FZ0 A;  4OVD A;  4EBP A;  4B88 A;  4JF6 A;  4OPY A;  4PKY A;  4ZJ2 A;  5E2H A;  2ZM0 A;  3MZF A;  3UE0 A;  2HP6 A;  3T4S A;  1K25 A;  1UWN X;  5DF7 A;  5IU1 A;  3C7U A;  3T4Q A;  3VP4 A;  4WL9 A;  1ZKJ A;  3BFF A;  3B47 A;  2W3G A;  4OLD A;  4OH0 A;  4X53 A;  2DCF A;  3M6B A;  1PI5 A;  2P08 A;  1LI9 A;  1DY6 A;  4CQH A;  3M2J A;  3IF6 A;  1FR1 A;  1BTL A;  3NC8 A;  4EER A;  4IJG A;  2HP5 A;  3S1Y A;  2VV8 A;  3DAV A;  1GA0 A;  3T12 B;  2BTF P;  4S2N C;  5CHJ A;  3RH8 B;  4CLC B;  3UE6 A;  4E3J A;  5FAS A;  2M1C A;  2B95 A;  1VEU B;  4JPM A;  2XA7 M;  1JNU A;  1I2W A;  1MY8 A;  2XH9 A;  1BSG A;  2W0N A;  4HJ6 A;  5L2F A;  4C75 A;  4WEL A;  5FI2 A;  4OQG A;  1DRM A;  4PM6 A;  2V20 A;  2HV1 A;  3KSI A;  3IXG A;  1G28 A;  3GQZ A;  3UPN A;  2WKE A;  4C6Y A;  3KYE A;  3HRE A;  1IEM A;  3GV9 A;  4CLC E;  2BAS A;  2J3W A;  2EFX A;  2FFF B;  1S66 L;  4B9O A;  3UPO A;  1T1A A;  2JKR I;  1ONG A;  5E43 A;  2P04 A;  3SOI A;  2ACG A;  3CAX A;  2QHK A;  4OP5 A;  1H8M A;  1UWP X;  5I5L A;  2VK3 A;  4M3K A;  4CJN A;  4E6W A;  2V2F F;  2WKH A;  4S2I A;  5CHU A;  3T1R A;  3O87 A;  1S4R A;  1GHM A;  3CMZ A;  2VGL S;  3DWK A;  1SKF A;  2R9W A;  3VP2 A;  2G2U A;  1HTZ A;  4KZ5 A;  4L9E A;  1S0W A;  4LEN A;  3V67 A;  3E4Q A;  3IF6 B;  3BLS A;  3ZVW A;  1TS0 A;  1VM1 A;  1XKZ A;  5DTT A;  3LIF A;  2HF6 A;  4RYE A;  1WYB A;  3UY6 A;  1SKO A;  2EWV A;  4UA7 A;  4GHI A;  4KZ7 A;  5EM1 A;  3WS4 A;  1W63 M;  1Y54 A;  5FQK A;  3MFD A;  3WS1 A;  4GW9 A;  2GNX A;  4GD6 A;  3C7V A;  3BW6 A;  3T1S A;  1FIK A;  3VOL A;  1VQQ A;  4WYY A;  4UQI M;  3R7W B;  4DKI A;  4K0X A;  2JC7 A;  4A5R A;  3NI9 A;  1TS7 A;  5EVI C;  3F1O B;  3IH9 A;  3BFD A;  2CC1 A;  1G6A A;  1VB6 A;  3UMD A;  4EEP A;  3G4P A;  5E2G A;  2ZOH A;  1I5Q A;  3IX3 A;  2BG1 A;  1XFN A;  2Y55 A;  5DF8 A;  1PFL A;  2Y2K A;  1N9B A;  4ZDX A;  2PBY A;  4LPZ A;  4OP8 A;  1NXY A;  4KG2 A;  1L0E A;  3PBT A;  2GJ3 A;  1KOU A;  4R3B A;  3QNB A;  4GOG A;  4ZAM A;  1YMS A;  2KOI A;  2PBD P;  2XFT A;  4ZTK A;  4K0W A;  5FQM A;  5FI6 A;  3TJZ C;  1P97 A;  4X1L A;  4EEU A;  2KDK A;  4P6B A;  4Q0H A;  4U0T A;  2PRF A;  4EQI A;  4Y15 A;  3Q7V A;  3Q82 A;  3A3E A;  2ZC6 B;  3G30 A;  1IEL A;  3DWZ A;  1ESI A;  4Q0J A;  5FDS A;  4BQM A;  3IXB A;  1H8Y A;  1GSV A;  1YSQ A;  1NRJ A;  3RXX A;  2X71 A;  5HL1 A;  3V50 A;  1LSV A;  3HLG A;  2I72 A;  3PYP A;  5GLB A;  3F1O A;  2QWS A;  3Q7Z A;  2WKQ A;  3WS0 A;  1ZC2 A;  1KDW A;  4KEN B;  4GB7 A;  2GDN A;  4OQI A;  3SS3 A;  4DMZ A;  5EFW A;  1FOF A;  2WGW A;  3TE8 A;  5JYP A;  3LR0 A;  3DTE A;  2PU2 A;  4HP4 A;  3PBO A;  1MWR A;  3VP3 A;  3IF6 C;  4AFI A;  3RFB A;  4WLA A;  3ZG8 B;  4I3I A;  3G6O A;  4ARZ A;  4NXF A;  1LL9 A;  4WMC A;  1S67 L;  1Q2Q A;  1QME A;  2ZL1 B;  4YOF A;  5M19 A;  2QYB A;  2EXB A;  1NYY A;  3F1N A;  3B33 A;  5GHX A;  5FAO A;  4P0M A;  1YLY A;  3PHY A;  4DDS A;  3QP5 A;  4R38 A;  3E0Y A;  2J3T D;  3NDG A;  1L0D A;  5HD3 A;  3W2Z A;  3S4X A;  1AWI A;  2WGW B;  3H82 B;  2XQZ A;  1XPB A;  4UEY A;  1ERO A;  3UN7 A;  1Z09 A;  4S2K A;  1UGU A;  3H7W A;  3CPT B;  3FC7 A;  1K55 A;  1S1Z A;  3LR3 A;  3QHY A;  1WYC A;  3N8R A;  5HD5 A;  5TFQ A;  3FZC A;  2W27 A;  4XUZ A;  3R4K A;  1E3U D;  4DN0 A;  3HUO A;  4FSF A;  1K57 C;  2A24 A;  5FAQ A;  3VOZ A;  1ES4 A;  4Y0T A;  4EU0 A;  3T4K A;  1HLU P;  3KYQ A;  4JBF A;  1JVJ A;  3RXW A;  3TOI A;  4HP9 A;  1Y4O A;  3ZG0 A;  4XT2 B;  4PM9 A;  5FL3 A;  5DJU A;  1W5D A;  3NEC A;  2IA2 A;  5TR7 A;  2K7S A;  1K54 A;  3F1N B;  5TGF A;  3WRZ A;  2W3H A;  2X02 A;  1W79 A;  5I94 A;  3CIT A;  2CMN A;  1LLB A;  4F94 A;  3KSG A;  4JKT A;  1GHP A;  3ITA A;  2L1M A;  2ZQD A;  1W8Y A;  2A3U A;  3VMA A;  3MZE A;  4DJ2 A;  1JWV A;  1ERQ A;  1ONH A;  3MJQ A;  5HAR A;  1IKI A;  3A3D A;  2J80 A;  1VHM A;  2WGV A;  1PWC A;  5HPF A;  4NK3 A;  5A90 A;  2OAP 1;  1PZP A;  4X1M A;  5EUA A;  4HBU A;  5EVL A;  4JXS A;  4BBT A;  2XFS A;  4RVA A;  4DXB A;  4S2P A;  5KSC A;  4JGQ A;  3UB9 A;  3N8S A; 
#chains in the Genus database with same CATH homology
 3SS4 A;  2WKI A;  2DCF A;  3CZD A;  4X53 A;  3M6B A;  5CER A;  4MBH A;  1PI5 A;  2Y2O A;  3PBN A;  3VP1 A;  4E3N A;  2OV5 A;  1LI9 A;  1DY6 A;  3AGF A;  3M2J A;  3MXS A;  3IH8 A;  1YM1 A;  4KZA A;  3VP0 A;  3IF6 A;  3FWL A;  4P85 A;  5FAT A;  1FR1 A;  1BTL A;  1NY0 A;  3NC8 A;  4S2M A;  2HP5 A;  4P87 A;  5FSR A;  3S1Y A;  3PBR A;  1S6R A;  5EVI B;  2H10 A;  4WBG A;  3SS5 A;  1KE3 A;  4WM9 A;  2WZZ A;  1DJA A;  2OLV A;  4S2L A;  1GA0 A;  1LI0 A;  1K56 D;  3BRM A;  3WRT A;  4S2N C;  5CHJ A;  4E3J A;  2WAE A;  3NCK A;  4ID4 A;  4N1H A;  4EBL A;  5FAS A;  2G2W A;  5E2F A;  3PAE A;  3Q1F A;  4KZ6 A;  3GMW A;  3UDI A;  4PM8 A;  1MKI A;  1GHI A;  2VGK A;  3DTM A;  4JPM A;  3MKF A;  4X69 A;  4LCL A;  4QB8 A;  1ESU A;  1I2W A;  1MY8 A;  1PWD A;  1SHV A;  2XH9 A;  3N4I A;  1RCJ A;  4B4Z A;  1BSG A;  3G35 A;  3Q07 A;  5L2F A;  3DW0 A;  4X55 A;  1L2S A;  1NZU A;  3BFC A;  4WEL A;  5FI2 A;  4C75 A;  4OQG A;  2Y59 A;  4PM6 A;  4RX3 A;  5BOH A;  4QY5 A;  5DF9 A;  1IYO A;  1YLJ A;  2V20 A;  4OKP A;  1HZO A;  2WGI A;  4GN2 A;  3IXG A;  4S2J A;  4XXR A;  3GQZ A;  2EX8 A;  4ZBE A;  2JBF A;  3UPN A;  4MBK A;  3G34 A;  4X6T A;  3UNW A;  3VFF A;  2V1Z A;  4BL2 A;  2WKE A;  4C6Y A;  3HRE A;  1IEM A;  2ZQ9 A;  3FKW A;  5CTN A;  3GV9 A;  2Y2I A;  4OOY A;  2P9V B;  5CHM A;  1K6R A;  3N8L A;  1BLC A;  1XXM A;  2EX6 A;  2EX2 A;  4OOL A;  2EFX A;  3LO7 A;  3IWO A;  2FFF B;  3UPO A;  1XX2 A;  4UAA A;  4Y0U A;  3UO9 A;  4KZ8 A;  1BUL A;  1ONG A;  4OPR A;  3UDF A;  4OLG A;  5E43 A;  4B4X A;  3SOI A;  5GLD A;  2Y4A A;  3NIA A;  2HP9 A;  4HEF A;  4KZ4 A;  5EE8 A;  1YLW A;  4OP5 A;  4DE2 A;  1IKG A;  1O07 A;  2BLS A;  4E3I A;  4M3K A;  4CJN A;  2ZM2 A;  4PM7 A;  4E6W A;  4X56 A;  4KG6 A;  3UE1 A;  2V2F F;  2WKH A;  3BLM A;  2ZC4 B;  4QJG A;  4S2I A;  3G2Z A;  5CHU A;  2XDM A;  1PWG A;  3VFH A;  3AGD A;  3O87 A;  1QMF A;  1IYS A;  5CGX A;  2Y2J A;  1GHM A;  2XD1 A;  1DJC A;  3A3F A;  3C4O A;  4GNU A;  3CMZ A;  3MKE A;  1E4D A;  4ZJ3 A;  1K56 A;  4OQ0 A;  3BYD A;  4GDB A;  3DWK A;  1MXO A;  1SKF A;  2OSU A;  2R9W A;  1KE0 A;  3VP2 A;  5CXW A;  2G2U A;  1HTZ A;  4KZ5 A;  3VSK A;  4DF6 A;  4KZ3 A;  2ZJ9 A;  4BD1 A;  2IWB A;  3ZHH A;  2QZ6 A;  1S0W A;  3NY4 A;  5FDH A;  2Y2M A;  5HAP A;  4LEN A;  1SDN A;  4YIN A;  3IF6 B;  3BLS A;  5AQB A;  4DXC A;  3ZVW A;  2IWC A;  5FQJ A;  1K4F A;  1ES2 A;  1KGE A;  1FCN A;  1VM1 A;  3MXR A;  1BLS A;  1XKZ A;  2ZD8 A;  5DTT A;  1RP5 A;  3IXD A;  4BD0 A;  1KDS A;  1CK3 A;  4HES A;  3ZG9 B;  4RYE A;  1AXB A;  1WYB A;  3GTC A;  3UY6 A;  1YLT A;  3IHA A;  5CTM A;  4Z9Q A;  2EXA A;  4JXG A;  4BJP A;  4GKU A;  3LCE A;  1N4O A;  4UA7 A;  2WYX A;  1W7F A;  3HUN A;  1JTD A;  4KZ7 A;  4RA7 A;  1ES3 A;  1NJ4 A;  5IHV A;  3WS4 A;  3ISG A;  1U60 A;  1K57 A;  1Y54 A;  3BFG A;  3IWQ A;  5FQK A;  2HDS A;  3MFD A;  3V3R A;  3PAG A;  3WS1 A;  3PBS A;  5U47 A;  3GRJ A;  4FH4 A;  4EV4 A;  4GD6 A;  3C7V A;  2Q9M A;  1ZG6 A;  3GR2 A;  1CEF A;  5CGW A;  4UA9 A;  3W4O A;  4E3M A;  1VQQ A;  5EOO A;  4WYY A;  4DKI A;  5GLC A;  4K0X A;  5F1G A;  2JC7 A;  4S2N A;  4K91 A;  4A5R A;  3NI9 A;  3A3J A;  4LCM A;  5EVI C;  3IH9 A;  3NBL A;  3D4F A;  5JYO A;  3BFD A;  1PW8 A;  2CC1 A;  1MPL A;  3S22 A;  1G6A A;  2ZC7 A;  3HLE A;  3OPR A;  4NET A;  5HW3 A;  3G4P A;  4OOM A;  4UHU A;  1KE4 A;  5E2G A;  4LV3 A;  5FAP A;  1I5Q A;  4E3L A;  3N6I A;  5HAI A;  1GA9 A;  4R0Q A;  3JYI A;  2BG1 A;  3V39 A;  4O7D A;  3HLC A;  3QNC A;  2Y55 A;  5DF8 A;  2Z2M B;  3HLF A;  1C3B A;  4FH2 A;  2Y2K A;  3W4P A;  5F82 A;  1N9B A;  4BEN A;  1FCO A;  3ZNT A;  3O3V A;  1IYP A;  4ZDX A;  2PBY A;  4EBN A;  3A3I A;  2IWD A;  4WEK A;  4WMC D;  1XGJ A;  5E2E A;  2DNS A;  2Y2L A;  4OP8 A;  4R1G A;  3O88 A;  1NXY A;  4KG2 A;  1L0E A;  2XK1 A;  3PBT A;  1BLH A;  4L0L A;  1FCM A;  4R3B A;  4DE0 A;  3IXH A;  5D3O A;  3QNB A;  4UA6 A;  2ZQ7 A;  4GOG A;  4ZAM A;  1RGZ A;  1YMS A;  3HLB A;  3CG5 A;  4MLL A;  5DTK A;  1CI9 A;  5A93 A;  2XFT A;  3MBZ A;  4ZTK A;  4KZ9 A;  2XEP A;  3ZVT A;  4K0W A;  1MBL A;  4FD8 A;  5FQM A;  5FI6 A;  3ZG7 B;  4GDN A;  1FSY A;  1TEM A;  2ZMA A;  1H5X A;  3M6H A;  1FQG A;  1NYM A;  3M2K A;  4P6B A;  2A49 A;  1K4E A;  4U0T A;  1KVM A;  3TG9 A;  1CEG A;  1K6S A;  3E2K A;  3VOY A;  4EQI A;  3Q7V A;  3Q82 A;  4IVI A;  4LV0 A;  3A3E A;  4OON A;  1MWU A;  1GCE A;  2ZC6 B;  1H8Z A;  3G30 A;  1IEL A;  3DWZ A;  3ZGA B;  3FKV A;  1ESI A;  4LV1 A;  2ZQ8 A;  2C5W B;  4WZ5 A;  3W8K A;  4BQM A;  4EUZ A;  3IXB A;  1H8Y A;  5A92 A;  1TVF A;  4QU3 A;  2B5R A;  3ZNY A;  2XD5 A;  3RXX A;  2X71 A;  5DTS A;  3IT9 A;  5HL1 A;  1K54 C;  3O86 A;  4IBX A;  3V50 A;  2UWX A;  1E25 A;  5AQ7 A;  3HLG A;  2I72 A;  5GLB A;  3SH7 A;  2XR0 A;  3HBR A;  4JLF A;  2RL3 A;  2H0T A;  5CGS A;  4R4S A;  4IVK A;  3E2L A;  3EQV A;  3Q7Z A;  3WS0 A;  4E3K A;  1ZC2 A;  5KZH A;  1M6K A;  1KDW A;  4KEN B;  1SDE A;  3HLD A;  3UDX A;  1DJB A;  2J9O A;  3I7J A;  4N9K A;  2QPN A;  4GB7 A;  3RJU A;  2GDN A;  2PU4 A;  4OQI A;  4PMA A;  3SS3 A;  3C5A A;  2QMI A;  1EI5 A;  4JF4 A;  1FOF A;  2WGW A;  4KQQ A;  3SH9 A;  4DRT A;  5JYP A;  3WS2 A;  1IYQ A;  2PU2 A;  3HLW A;  1SCW A;  1OME A;  3PBO A;  2XLN A;  1PZO A;  4Y0O A;  4OPQ A;  1MWR A;  3VP3 A;  3IF6 C;  3GSG A;  1PI4 A;  3OPH A;  3BFE A;  3N8S A;  1JWP A;  2Y2H A;  5EPH A;  3ZG8 B;  2WZX A;  1ERM A;  1BT5 A;  2Y2G A;  5KSH A;  1KGG A;  1KVL A;  2WAF A;  3WS5 A;  1MWT A;  5F83 A;  4KG5 A;  1LL9 A;  4WMC A;  2Y91 A;  4BLM A;  1M40 A;  3HVF A;  1Q2Q A;  3EQU A;  1QME A;  1ES5 A;  1O7E A;  2DRW A;  3CJM A;  4GZB A;  2ZC3 B;  2Z2L B;  4BL3 A;  3OC2 A;  4IED A;  3P09 A;  5M19 A;  1BLP A;  4CPK A;  4JF5 A;  2EXB A;  1NZO A;  2ZM8 A;  1NYY A;  3G31 A;  1PYY A;  5GHY A;  5GHX A;  4MBF A;  1E3U A;  1YT4 A;  5FAO A;  5M1A A;  4KQO A;  1TDL A;  5KMW A;  3LY3 A;  2JE5 A;  3OPP A;  4P0M A;  2Y2Q A;  3G32 A;  3VSL A;  1YLY A;  2HDR A;  1K55 C;  3HUM A;  4HBT A;  3IHB A;  4DDS A;  4XUX A;  4FCF A;  4X68 A;  3ZG5 A;  1L0F A;  3NDG A;  4JXW A;  4R3J A;  5FQQ A;  1BUE A;  1L0D A;  2EFU A;  3P98 A;  3Q81 A;  4OPZ A;  4IBR A;  4N1X A;  2RCX A;  5FI7 A;  3ITB A;  5G18 A;  1JWZ A;  3S4X A;  4S2O A;  2WGW B;  2XQZ A;  1XPB A;  4OQH A;  1ERO A;  3SH8 A;  3HL9 A;  3UN7 A;  3UPP A;  4DDY A;  4S2K A;  5HAQ A;  5CRF A;  2ZLY A;  5FA7 A;  3OZH A;  1HD8 A;  1YQS A;  4JXV A;  1K55 A;  2C6W B;  1JTG A;  3OCL A;  3QHY A;  5EVI A;  1FR6 A;  1WYC A;  5FQI A;  2FFY A;  3N8R A;  1W8Q A;  1XA7 A;  3ZFZ A;  3C4P A;  5M18 A;  3OCN A;  2R9X A;  5TFQ A;  3FZC A;  3PBQ A;  4QD4 A;  2X01 A;  4XUZ A;  1XA1 A;  4QHC A;  5GHZ A;  4DE3 A;  3LEZ A;  1E3U D;  3Q7V B;  2XF3 A;  4GD8 A;  3BEC A;  4R4R A;  5CEB A;  1Q2P A;  3HUO A;  4FSF A;  3LY4 A;  4H8R A;  3N7W A;  1HVB A;  1K57 C;  4RX2 A;  2HPB A;  5FAQ A;  3VOZ A;  3MZD A;  5J8X A;  1ES4 A;  1YLP A;  2EX9 A;  1YMX A;  3FYZ A;  4Y0T A;  5CED A;  4MNR A;  2WK0 A;  5GL9 A;  3GVB A;  1PIO A;  3IF5 A;  1L0G A;  4JBF A;  1J9M A;  1JVJ A;  3RXW A;  3TOI A;  1YLZ A;  1TDG A;  3WWX A;  3ZG0 A;  5F1F A;  2WAD A;  1ALQ A;  2ZQC A;  4PM9 A;  1LL5 A;  3IWI A;  5HX9 A;  1KGF A;  1W5D A;  2HDQ A;  3BM6 A;  4N9L A;  5TR7 A;  1NRF A;  4ZJ1 A;  2H0Y A;  5EEC A;  5EOE A;  2J8Y A;  1K54 A;  3UE3 A;  1PW1 A;  3AGE A;  1EWZ A;  2P74 A;  1XP4 A;  5AQ9 A;  1Z6F A;  5TGF A;  1BZA A;  2Q9N A;  2X02 A;  1W79 A;  3WRZ A;  5I94 A;  2P9V A;  4EWF A;  4LV2 A;  4WEJ A;  5AQA A;  1FSW A;  5EVI D;  4E6X A;  4PPR A;  4Q8I A;  5DVA A;  3ZCZ A;  3G2Y A;  4E3O A;  2OLU A;  4WZ4 A;  5GLA A;  1LLB A;  4U0X A;  5FQ9 A;  5A91 A;  3FV7 A;  4F94 A;  2HDU A;  1CI8 A;  4JKT A;  1GHP A;  3ITA A;  2ZC5 B;  2VGJ A;  2H5S A;  2ZQD A;  3OPL A;  1W8Y A;  1RGY A;  3B3X A;  2A3U A;  4YFM A;  4KQR A;  3V5M A;  2JCH A;  3VMA A;  1XGI A;  3MZE A;  2Y2P A;  1JWV A;  4Y7P A;  1ERQ A;  1ONH A;  1ZG4 A;  3W4Q A;  5HAR A;  4OVD A;  1IKI A;  3A3D A;  4EBP A;  2ZQA A;  4B88 A;  4JF6 A;  2Y2N A;  4OPY A;  4R23 A;  4ZJ2 A;  5E2H A;  4DE1 A;  2ZM0 A;  3BEB A;  4C3Q A;  3MZF A;  3UE0 A;  2WGV A;  1PWC A;  2HP6 A;  4NK3 A;  5A90 A;  4PM5 A;  2E8I A;  1K25 A;  4U3T A;  3TSG A;  3PTE A;  1PZP A;  5HFO A;  5DF7 A;  3C7U A;  3NDE A;  3VP4 A;  4D2O A;  3ZDJ A;  5CEC A;  1ZKJ A;  1G68 A;  1K38 A;  3BFF A;  4HBU A;  4N92 A;  5EUA A;  5EVL A;  3V3S A;  4JXS A;  2XGN A;  2J7V A;  1MWS A;  2XFS A;  1WE4 A;  4RVA A;  2WUQ A;  4OLD A;  4WZ5 C;  4OH0 A;  2J9P A;  1LHY A;  4MEZ A;  4S2P A;  4DXB A;  5KSC A;  4KZB A;  3IQA A;  1I2S A;  4QY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...