4GLQA

Crystal structure of the blue-light absorbing form of the thermosynechococcus elongatus pixj gaf-domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
149
structure length
149
Chain Sequence
ELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methyl-accepting chemotaxis protein
publication title A Photo-Labile Thioether Linkage to Phycoviolobilin Provides the Foundation for the Blue/Green Photocycles in DXCF-Cyanobacteriochromes.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Signaling protein
total genus 50
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2012-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4glqA00
2O9CA 5I5LA 4GLQA 5DFXA 2IA2A 3KSGA 3KSHA 4FOFA 4R6LA 4G3WA 4DMZA 2VEAA 4Q0IA 4LRXC 3S7PA 5HPIA 3VV4A 1MC0A 3S7NA 1TF1A 2W3HA 2XSSA 3NOPC 2W1TA 3DBAA 4Y2FA 4BWIA 4Y3IA 4O8GA 3OOVA 2W3GA 3MQ0A 5L8MA 3CI6A 2LB5A 2W3FA 4ZRRA 4O0PA 2M7UA 4ME4A 1MKMA 4CQHA 1VHMA 2B18A 2W3EA 4MN7A 2O99A 3RFBA 2W1RA 4LRZE 4EUVA 4Z1WA 4G3VA 3O5YA 4LRYC 3MF0A 2KLIA 3NOUC 3E0YA 2G7UA 4YNRA 2VKSA 3NHQA 2XROA 2XRNA 1STZA 3CITA 3S7OA 4IUKA 3IBRA 4E04A 2W1TB 5K5BA 3MMHA 3S7QA 3KSIA 4MMNA 2OOLA 2HGVA 4O01A 3W2ZA 3LFVA 2ZMFA 3IBJA 2Y79A 1YSQA 1ZTUA 2LB9A 3G6OA 3ZQ5A 4DN0A 4ETXA 4RQ9A 2O9BA 2VJWA 4MCWA 4QPRA 5HSQA 3KSFA 5C5KA 4G3KA 4Q0HA 3R4KA 2W3DA 4EU0A 4Q0JA 3BJNA 5HL6A 2QYBA 3HCYA 5LBRA 4YOFA 4IJGA 3D3OA 3E98A 4ETZA 3TRCA 4R70A 1YSPA 2M7VA 3K2NA 2VZWA 2KOIA 3EEAA 5TJJA 2O9AA 3OBFA 5DFYA 2K2NA 5AJGA 1YKDA 2O0YA 4MDZA 1F5MA 4GW9A 3KO6A 2GX5A 5HPFA 4IUHA 2Y8HA 3NOTC 3C2WA 1TD5A 4PAUA 2K31A 4Y5FA
chains in the Genus database with same CATH superfamily
3QP8A 3LR4A 3N6IA 5GLDA 5E2EA 4G3WA 2HP6A 2HJ9C 5DJTA 4GJ4A 3T4OA 5GHYA 4KG2A 4EQ1A 4WZ5A 1TS0A 3SW1A 4YINA 3TJZC 4U3TA 3OPRA 4KQDA 5EVIC 2VV7A 1FCOA 1VQQA 5HAQA 4NKPA 4KZAA 2VK3A 5CGSA 4Y3IA 4K91A 2EX2A 5DVAA 1K6SA 3AGEA 3RFBA 3IWOA 4BJPA 2B02A 4ZJ2A 4QD4A 1SDEA 4L9EA 4QU3A 3C7VA 3VOYA 3LR3A 5EFWA 5U47A 4HESA 3IBRA 2A24A 2JHEA 1PZOA 4KZ6A 5E43A 4QJGA 4E3JA 4PM9A 3DTMA 3BEBA 3VP0A 1W79A 1YLWA 3NBLA 4RYEA 4CJNA 4N1HA 3TRCA 2UWXA 3Q82A 2HDUA 4GD8A 2XA7M 5EPHA 1SKOB 1LSVA 4HOIA 5FQJA 1S66L 4X56A 2XK1A 1K55A 3E4QA 5CTMA 3FC7A 1BLCA 3QNCA 1SZVA 1KDWA 2ZJ9A 4LRXC 4KUOA 1W63M 5FEFA 4EBLA 1PYYA 1TF1A 3QP1A 3HLEA 3UPNA 1OPXA 5G18A 3V3RA 2Y2PA 2DNSA 2EXAA 4O8GA 1T1BA 1PWDA 4OOYA 4KZ8A 4JBFA 1VHMA 3H7WB 3JVVA 2EFXA 1F98A 3T4LA 1T1AA 4PKYG 1JNUA 1VEUA 1L0DA 2OWHA 2ZQCA 1XP4A 1NLZA 3A3DA 3SS4A 3G2YA 1T1CA 4L9FA 2I72A 3ZYTA 1KGFA 2OOLA 3W2ZA 2DRWA 3F1NB 1PI5A 3IBJA 2Y79A 2JN7A 4ETXA 3ZFZA 1FCMA 3ZHHA 1IFQA 1XA7A 1LI0A 4DDYA 3HVFA 5MC7A 4DJ3A 3BRMA 3BJNA 2JKTI 3ISGA 3MXQA 1I2WA 4YOFA 1YMXA 3LIAA 1K4FA 3H82A 4WZ4A 1K25A 2W0NA 4E3LA 3BFFA 1F5MA 3V5MA 4HI4A 1YQSA 4JXVA 4L0LA 3O88A 2XF3A 2WKPA 3JVUA 3ZG9B 1YLYA 3F1PB 3GVBA 5FDHA 4GCZA 1L0EA 5HZHA 1IKGA 1J3WA 3IWIA 3UO9A 2PU4A 2W3HA 3T1SA 2QKPA 1PRQA 4JGPA 1LLBA 4Y2FA 2VGLM 4P6BA 4BWIA 4II7A 4H6JB 3O87A 1YLTA 4NXFA 5GL9A 4GD6A 1KOUA 3BM6A 1OTAA 2GZAA 4O0PA 4EESA 2XLNA 2O99A 4MN6A 2H10A 5CRFA 2P04A 2Y2OA 5AQAA 3OPLA 4L9GA 2NUTC 3O5YA 4WLAA 2JKGA 2WK0A 1LL8A 1S6RA 3NECA 1WYCA 2Y2MA 1EROA 5HD3A 3FV7A 3KYEA 3A0SA 2Y2QA 4IUKA 3NCKA 3V50A 3S7QA 4OPZA 1S0WA 4PPRA 2BTFP 5HW3A 4HJ3A 3OCNA 3DAVA 3S22A 2Z2MB 3HBRA 2ZL1A 2VJWA 3MFDA 1YAXA 3IF6A 4NXEA 2K7SA 4Y0UA 1H3QA 4DE2A 5HSQA 2WZZA 4Z9QA 4Q0HA 1ZG4A 3HCYA 1TS6A 1ES4A 3Q7ZA 4CLCC 2QWSA 3FKWA 4ETZA 3ZG5A 5BOHA 2O9AA 4DE3A 2K2NA 3LIFA 2O0YA 5GLCA 3OCLA 1K56D 1TD5A 3G35A 2XQZA 2E8JA 4X25A 3P98A 1DRMA 1ZHHB 1KGEA 3LEQA 1JWZA 3VV4A 2J80A 1UWNX 3FPVA 5CTNA 4QHCA 2WAFA 4UQIS 5FI7A 5M18A 4C6YA 3UDFA 1G28A 2RCXA 4LGWA 2W3GA 5L8MA 3N8RA 2Y59A 5EVIA 4OQ0A 3IS2B 3IX3A 5E2HA 5J8XA 3AGFA 3VP4A 5IU1A 1FQGA 2R9WA 1N4OA 4FTXA 5TR7A 3WS2A 1FIKA 3HUNA 1MBLA 1ODVA 1GHIA 2ZC5B 3W4PA 4LV3A 4S2OA 4KQRA 4RA7A 3WWXA 3UB5P 4N92A 4IVKA 5HDCA 2PBYA 3SS5A 4LV0A 2LB9A 5FQMA 4S2IA 5EUAA 4HNBA 2O9BA 3PBRA 1NZOA 1OTEA 3B3XA 4EW7A 4UAAA 5FL3A 4IEDA 3R7WA 2PRFA 2J9OA 1K4EA 2L1MA 4XUXA 1T18A 2FH5A 4IJGA 1PWGA 4JGOA 3GMWA 4HH2A 2PR5A 4NXBA 2EFUA 2ZOIA 1TS7A 3LIEA 2WKEA 3U2AA 1PNEA 3LI8A 3UB8A 1PW8A 2Y8HA 5CHJA 3LYXA 2RL3A 3IQAA 5L09A 4XUZA 4GS9A 4WELA 3RXWA 3S7PA 5HPIA 4MLLA 1BLHA 3EGDC 3BLMA 4HIAA 4LPZA 3NY4A 3LICA 4MBKA 4EWFA 3DBAA 3BWLA 3UMEA 4ZDXA 2V1ZA 3HLWA 4GDBA 2LB5A 4WM9A 3OLOA 5J3WA 5HL1A 2J9PA 4BD1A 4I3AA 2V9AA 2E8IA 1XJ6A 2ZC3B 1XA1A 5DTKA 4I5SA 4D2OA 3DW0A 3VP2A 4DJ2A 1I2SA 2C5WB 1ES3A 1G6OA 4RX3A 5DTSA 4YFMA 4JF5A 3MBZA 5A92A 3LIBA 5F83A 4C3QA 2ACGA 5HAPA 4B4ZA 5CX7A 4P6ZS 3KSFA 4WMCD 2V20A 3C8CA 5DF9A 3HUOA 5AQ9A 2DCFA 2EX6A 3CJMA 4R70A 1H8MA 3G31A 2M7VA 1HVBA 5TJJA 4MEZA 3G2ZA 2ZQ9A 5CECA 4IUHA 5AVEA 1Q2QA 4B93A 4Y15A 2WKRA 1ALQA 3CPTA 5I5LA 2Y2GA 1CEGA 1ZC2A 2Q9NA 2H28A 3KSHA 4FOFA 3N4IA 4S2JA 4DMZA 1YM1A 3TG9A 4EQIA 3LY3A 1MC0A 4HQAA 1IKIA 4GB7A 1E25A 1W5DA 3Q7VA 3VFFA 3QP5A 3VSKA 3N8SA 1DJBA 1ES5A 2G2WA 1CQAA 4F3LB 2BASA 5CHUA 3MZFA 4EUZA 2EX8A 4KQQA 4QB8A 3IXDA 2A49A 2V1AA 5FI6A 3E0YA 1D1JA 2WGIA 3B33A 1P0ZA 2OSUA 3PYPA 3ZGAB 4BMWA 3ITBA 1GCEA 2XFSA 5FI2A 3ZQ5A 4DN0A 1I5QA 3T4QA 1DJCA 2ZC6B 3CAXA 2HDSA 3U4LP 1BTLA 2V0UA 2D02A 4P0MA 1LSXA 5HFOA 2Y55A 2NUPC 2QYBA 1S1ZA 4E3NA 5LBRA 3KX0X 4HH3A 1EI5A 1PIOA 3MSHA 5JYOA 3BFEA 4KZ5A 3OBFA 1ESUA 4CLCA 2M1CA 5DF7A 3KO6A 3T12B 1S67L 1NRJA 3V3SA 2Y91A 3NC8A 2XD5A 4PAUA 5HDDA 3C30A 4PKYA 1GSWA 1NY0A 3G32A 3SH9A 4LLOB 3LUQA 1QMFA 5FAPA 1DJAA 2A3UA 2Y2JA 1IEMA 3EWKA 4KG5A 4KG6A 4X69A 4WN5A 1NZUA 4N9KA 2V2FF 1S1YA 3SZTA 4CPKA 1IOUA 3ITAA 3NJAA 1SCWA 4WYYA 1VETA 1VM1A 2J7VA 1FSWA 2W3EA 3G34A 1Y4OA 1YLJA 2W1RA 5IT5A 3DWKA 1PFLA 2H0YA 3SS3A 1IYOA 3NIAA 4OOMA 4JF4A 3DTIA 1SKFA 4H8RA 4S2LA 5F1FA 4XT2B 4GOGA 3HLDA 2ZLYA 2XROA 4ID4A 3ZG7B 3G30A 4WL9A 4XXRA 1BLSA 3F1OA 3TE8A 4GN2A 3AGDA 5J7EA 3T1QB 3G6OA 5IHVA 4QWOA 2ZMVA 1Y28A 5FAQA 4HJ4A 4I38A 2D01A 3IWQA 3GECA 1DP8A 4S2MA 5L2FA 4OVDA 4OLGA 4FH2A 4OPRA 3C4OA 4GHIA 1PW1A 4N1XA 4X1LA 1J9MA 4DKIA 5TBMA 4WF0A 4OH0A 5CERA 1AXBA 2JE5A 4Y5FA 1F2KA 3M6HA 1FR1A 3KYZA 1OT9A 4HY8A 4ARZB 2VEAA 4OP5A 4X6TA 4FH4A 3WRTA 5EM0A 2V8CA 4Y7PA 1E3UA 2W1TA 2J3TD 3C4PA 3ZG0A 1BZAA 2R78A 4ZRRA 2IWBA 1DY6A 4MBFA 1EW0A 3E4OA 4ESPA 5FATA 1BULA 4BBTA 3LO7A 1XJ2A 2P9VA 3LGOA 5CEBA 2EXBA 2B5RA 3ZCZA 1O7EA 3MMHA 4E6WA 3IX4A 4BLMA 1N9BA 2VGJA 1XFQA 3FYZA 3LR5A 4LV2A 1JTDA 1RGYA 4MCWA 2H0TA 4PMAA 2I9VA 1LI9A 1FILA 1NJ4A 5HL6A 3DTKA 1MWTA 3WS5A 2VZWA 4JXGA 1TVFA 5EE8A 3GQZA 3GDIA 3QHYA 1CK3A 3PAGA 3GV9A 1MZUA 2VLGA 5FDSA 2A24B 3UY6A 1ONHA 2WGWA 4RVAA 4I39A 2ZM8A 4WBGA 1PI4A 2H5SA 3W8KA 2Y2HA 3VOLA 2OAP1 2OAQ1 3RXXA 1BT5A 1CF0A 1S4RA 2L0WA 3IXHA 4OQHA 1WE4A 2JBFA 4X55A 4HJ6A 1TDLA 4JLFA 4KZ4A 5G4YA 2XFTA 4WEKA 3DTEA 1W7FA 1JVJA 2FZ0A 3OC2A 5FQIA 2QMIA 2HP5A 5AQ7A 2HP9A 2JCHA 4MN7A 2V0WA 3SH8A 5KMWA 3B47A 1MXOA 2ZQDA 3IT9A 4ZJ3A 3MF0A 3PBQA 1KVMA 4OQIA 3FKVA 4Y13A 2XR0A 2GJ3A 1CI8A 4E04A 1K54C 1U60A 2Y2IA 4R4RA 3LY4A 3WS0A 1IYSA 2JKRM 5D3OA 1OJ5A 4I3JA 1LSWA 4KZBA 3LIDA 2WUQA 3LEZA 3ZG8B 2WKHA 4UEYA 5GHZA 2Z6DA 4DE1A 4E6XA 4JKTA 1VEUB 1MWRA 5GLBA 3A3EA 3EEAA 4MBHA 2Y2KA 4S2KA 1W63Q 3T4SA 1M6KA 3IHAA 1ES2A 3FG8A 2K31A 4R3JA 3NI9A 4K0XA 4JGQA 2IA2A 1UWPX 2HDQA 3QP4A 4S2PA 3BY9A 2PYRA 3LI9A 4OOLA 1NXYA 3C7UA 3OPHA 1KE0A 3Q07A 1BLPA 2PD7A 3H82B 5EECA 4PM6A 2AVXA 1FOFA 4F94A 2W3FA 1NYMA 4ME4A 1LHYA 4LCMA 1XPBA 4Y0OA 3QP6A 3CG5A 1MY8A 4G3VA 1P9WA 4GZBA 2KLIA 5F1GA 3HLGA 3UN7A 3EQUA 2ZC4B 1SKOA 2ZC7A 3S7OA 5CGWA 1H8YA 2EA9A 2EWWA 2PAVP 1E4DA 3BFGA 1S4SA 3IXGA 2OV5A 1FCNA 1VB6A 3UE3A 1NLYA 3MS6A 5GHXA 1YSQA 1ERMA 3D9YA 2WKIA 3SH7A 1KE3A 5L10A 3RJUA 1L3LA 3UPOA 4U0TA 1CEFA 4YWZA 1T19A 4Q0JA 2PT7A 4K0WA 4M4XA 1XGJA 3PBSA 4DF6A 5A8BA 2KOIA 1V9YA 2Y2LA 4KZ3A 2J8YA 3IH9A 1W8QA 5EVLA 4KENB 1H5XA 2PYPA 1P97A 5JYPA 3BW6A 3HJIA 3FWLA 1O07A 2PD8A 3H7WA 2ZL1B 5EVID 3IF6B 5KZHA 3BLSA 3VP1A 4EEPA 4Q0IA 4P87A 5EV0A 3S7NA 3BQAA 2WZXA 2QJ5A 1XKZA 3I7JA 1FR6A 4EETB 3T4JA 2ZM0A 3F1NA 3IH8A 3OOVA 3MXSA 3MQ0A 1HD8A 5KSHA 2M7UA 4IVIA 3W4OA 3UB6A 4KUKA 3UB9A 3C5AA 3LR0A 1M40A 4Y0TA 4OPQA 4X68A 4HBUA 3NOUC 3MKEA 1ERQA 3BY8A 4B4XA 4E3OA 2HGVA 4AFIA 3LFVA 3MR0A 4NG2A 5EVIB 3F1PA 1OTBA 4UA6A 1C3BA 3BECA 2X01A 5CXWA 2VX8A 4NXGA 2Q9MA 4QY5A 4UA7A 4OPYA 1DP9A 3E2KA 3V67A 2FFFB 1YSPA 1WYBA 3K2NA 3LCEA 5HX9A 1ZKJA 3ZDJA 1RGZA 5HD5A 4H6JA 2GX5A 3KYQA 5A90A 2VV8A 4I3IA 4WUJA 3HLCA 4U0XA 1IYPA 2QHKA 5DFXA 4RX2A 5KSCA 3PHYA 2ZQ7A 5F69A 3R7WB 3GRJA 3CMZA 3UE1A 5IS1A 3A3IA 3VE3A 4BD0A 3CUEC 5I94A 2Y4AA 1Y54A 3NULA 4GNUA 2CC1A 1CI9A 1SHVA 3A3FA 5F68A 4LENA 1NYYA 2G2UA 4S2NC 3VFHA 1V9ZA 3P01A 3WS1A 4OONA 2FFYA 2QZ6A 5HARA 4EEUA 3PAEA 4Y17A 4EUVA 1X0OA 4GS9B 3SOIA 3T50A 3FZCA 3HLBA 5G4ZA 2ZOHA 1IELA 2YKFA 5FAOA 3RH8B 3UNWA 4GKUA 1K6RA 2JKRI 2XRNA 3CWFA 4BL3A 3HUMA 4LV1A 4ZBEA 5GLAA 2Z6CA 3ZNYA 4JPMA 1ZTUA 5FASA 3T4TA 4OP8A 1K54A 3E2LA 3S4XA 2ZQ8A 1GHPA 3K3DA 2EX9A 3VP3A 3R4KA 3MQQA 2EWVA 1K0KA 3D3OA 1AWIA 2ZMAA 4DXBA 2X71A 5FQ9A 5HWWA 3L9KA 1GSVA 3H9WA 2MJ6A 2IWCA 5HPFA 1GA9A 5CHMA 5F82A 3C2WA 4BBUA 2WAEA 3IS2A 1GHMA 4ZJ1A 4FD8A 4IBRA 4X53A 4JF6A 2WKQA 1H0MA 5A93A 3IHBA 2HPBA 3ZVWA 1NRFA 4JGRA 5TFQA 2P7JA 5DKLA 4JXSA 1MWSA 4HEFA 3PBNA 3NOPC 5E2FA 1QMEA 1G68A 3G4PA 5A91A 2PU2A 1G5UA 3CZDA 1K56A 2ZQAA 2PBDP 3A0RA 5EOOA 4ZTKA 1HTZA 3C38A 3VE4A 2HF6A 5CGXA 4EV4A 2VV6A 1LL9A 1K57C 1MKMA 3O3VA 3QNBA 3CPTB 1G6AA 3NDEA 3L7HA 4LRZE 1ESIA 3HREA 2YKHA 3VMAA 4HP4A 4UQIM 3Q7VB 4R38A 3CITA 1OJGA 3PR6A 2Q0OA 2WYXA 3KSIA 3NDGA 5DF8A 2B95A 4CLCD 4NETA 4B9OA 2ZBBA 1YMSA 5CEDA 5AVFA 1UGUA 4QPRA 4X1MA 1ONGA 1JTGA 2W3DA 3Q1FA 2XA7S 1KGGA 4OLDA 4OQGA 1N9OA 5HWVA 1F9IA 5AQBA 2OLVA 2GDNA 5AJGA 4HBTA 2XGNA 4MDZA 5HWTA 3MFXA 4FSFA 2KDKA 1YLPA 2O9CA 4B88A 1H8ZA 1K38A 3K3CA 4WZ5C 4R1GA 1SDNA 3A3JA 3IX8A 3KSGA 4R6LA 3EQVA 4PM5A 3JPUA 4DRTA 3P7NA 4BENA 1PWCA 3CLOA 3OPPA 2J3WA 2WADA 5TGFA 4Q8IA 1XJ4A 3VOZA 4CLCB 4MN5A 2C6WB 3IF5A 1XX2A 5F5YA 4R4SA 4CQHA 4QY6A 2XH9A 2B18A 5EOEA 3B42A 2X02A 4M3KA 2R9XA 4HP9A 1OTDA 2J3TC 4KZ9A 2XD1A 3HJKA 4LRYC 1MPLA 3D4FA 1KE4A 4GDNA 3NHQA 3ULFA 4FUWA 3UB7A 4NK3A 3MJQA 1KVLA 1Z6FA 5FA7A 2JC7A 3MZDA 3EOIA 4MMNA 2L4RA 3HL9A 3TSGA 4O7DA 1VETB 1OTIA 5HAIA 3CHWP 3A0VA 3QP2A 3EEHA 4G3KA 1LL5A 1TS8A 2HDRA 3BYDA 2OWJA 1Q2PA 1MKIA 1E3UD 1K55C 1TDGA 3OZHA 2HZ5A 4F3LA 3UDIA 3F1OB 4EBNA 4BBVA 3IXBA 4E3IA 4WMCA 4PHTA 4GLQA 1KDSA 4UA9A 2INWA 4IBXA 1BSGA 4P6ZM 5FSRA 1PZPA 1TEMA 5M19A 1W8YA 3WS4A 3DWZA 4CLCE 3V39A 3FPWA 2VGLS 4IHQA 1IYQA 3MQOA 2PR6A 3ZVTA 4GHIB 3T1RA 4C75A 4DXCA 3CUEA 1HLUP 1XGIA 4DDSA 3O86A 1ZG6A 2GNXA 5FEGA 5TBMB 2JKFA 4FCFA 2Z2LB 4KZ7A 1OMEA 3JYIA 4S2NA 2V1BA 4EBPA 1XJ3A 2HV1A 4NEED 1WA9A 2QPNA 3T1XA 2G7UA 3T4KA 1RCJA 3P09A 1BUEA 2V8FA 3MKFA 3UMDA 3TW8A 2W1TB 1YPRA 3MZEA 4O01A 3D72A 3UPPA 2W27A 3PXPA 3PTEA 4WEJA 4R23A 2QJ7A 5EVEA 1CJFA 2DMWA 5L07A 3BQ8A 4PM8A 5KIZA 1LT0A 2VGKA 3M2JA 1N9LA 3GTCA 4R3AA 1D06A 1A0KA 1D7EA 1YT4A 3E98A 1YLZA 3MXRA 3N8LA 1EWZA 3UE6A 2P9VB 2ZD8A 1JWPA 3WRZA 4K08A 2ZM2A 3HLFA 2OLUA 1YKDA 2BG1A 2JKTM 4GW9A 4A5RA 4OKPA 4KQOA 4BL2A 4EERA 2WGVA 1GA0A 2UV0E 3NOTC 1L0GA 3PBOA 4DE0A 2IWDA 5FQKA 5DTTA 5J4EA 5F6AA 5M1AA 4PM7A 5HDSA 5DJUA 2KX6A 1HZOA 5FQQA 4XT2A 4EXOA 1P9RA 2XSSA 2HJEA 2XDMA 1NWZA 3S1YA 2P08A 3Q81A 3N7WA 3PBTA 1MWUA 2XEPA 4E3KA 4JXWA 3RTYA 3CI6A 1N9NA 4R3BA 2WGWB 3UE0A 1JWVA 1Z09A 3ZNTA 1GSXA 4ZAMA 4MNRA 4E3MA 2P74A 4Z1WA 1K57A 4LCLA 1BYWA 2Y2NA 2VA0A 1OT6A 1L0FA 4LFUA 4YNRA 2VKSA 1STZA 3W4QA 2PDRA 5K5BA 1L2SA 5DKKA 3UDXA 3IF6C 2PHYA 4N9LA 4UHUA 1FSYA 2ZMFA 1ACFA 4HHDA 4RQ9A 3VSLA 3ICYA 4R0QA 5C5KA 3M2KA 4ARZA 3M6BA 4EU0A 4P85A 5EM1A 5E2GA 3BFCA 3GR2A 4D60A 2CMNA 3GSGA 1XXMA 3E4PA 3BFDA 5DFYA 2BLSA 2A2LA 4BQMA 3EGXC 1XFNA 1DP6A 1RP5A 3TOIA
chains in the Genus database with same CATH topology
3LR4A 2WKQA 4G3WA 4GS9A 2HJ9C 5DJTA 4GJ4A 4WELA 3VOLA 2OAP1 2OAQ1 3T4OA 3S7PA 5HPIA 4JGRA 4EQ1A 1TS0A 2P7JA 1S4RA 5DKLA 3EGDC 3SW1A 2L0WA 4LPZA 4HIAA 3TJZC 3PBNA 3LICA 3NOPC 4HJ6A 4KQDA 3DBAA 2VV7A 3BWLA 4NKPA 3UMEA 4Y3IA 3A0RA 3C38A 3VE4A 5G4YA 2HF6A 4WEKA 2LB5A 2FZ0A 2VV6A 3OC2A 1MKMA 3OLOA 5J3WA 4MN7A 2V0WA 3RFBA 4BJPA 4I3AA 4LRZE 2V9AA 3B47A 2B02A 1XJ6A 3MF0A 3PBQA 2YKHA 4I5SA 4L9EA 4HP4A 4UQIM 4R38A 3CITA 3LR3A 5EFWA 1OJGA 3PR6A 2GJ3A 3IBRA 4E04A 4DJ2A 2A24A 2JHEA 1G6OA 3KSIA 4CLCD 4B9OA 2ZBBA 3LIBA 2JKRM 5AVFA 5CX7A 4P6ZS 1OJ5A 1UGUA 4QPRA 4I3JA 1LSWA 3KSFA 3LIDA 3C8CA 5DF9A 2W3DA 4UEYA 2XA7S 2Z6DA 1N9OA 5HWVA 1F9IA 3TRCA 4R70A 1H8MA 2M7VA 2XA7M 3EEAA 5TJJA 5AJGA 1LSVA 4HOIA 4MDZA 1S66L 1W63Q 5HWTA 3MFXA 3T4SA 4IUHA 5AVEA 4FSFA 2KDKA 4B93A 3FG8A 2WKRA 3E4QA 2K31A 2O9CA 5I5LA 4JGQA 3K3CA 2IA2A 2H28A 1UWPX 3FC7A 3KSHA 3KSGA 4FOFA 4R6LA 3EQVA 3BY9A 2PYRA 3LI9A 4OOLA 4DMZA 3P7NA 4LRXC 1MC0A 3CLOA 4KUOA 1W63M 4HQAA 2J3WA 1TF1A 2PD7A 3H82B 1OPXA 1XJ4A 4CLCB 4O8GA 1T1BA 4MN5A 2W3FA 2BASA 4F3LB 5F5YA 4ME4A 4CQHA 1VHMA 2B18A 3B42A 3H7WB 3JVVA 4HP9A 1F98A 1OTDA 2J3TC 4G3VA 1P9WA 3T4LA 3HJKA 1T1AA 4LRYC 4PKYG 2V1AA 1JNUA 2KLIA 3E0YA 3B33A 2OWHA 3NHQA 3EQUA 3ULFA 3UB7A 3S7OA 1NLZA 2EA9A 1P0ZA 2EWWA 3MJQA 3PYPA 1T1CA 3EOIA 1S4SA 4L9FA 4MMNA 4BMWA 3ZYTA 2OOLA 2L4RA 1VB6A 3UE3A 3W2ZA 1NLYA 3F1NB 3IBJA 2Y79A 1YSQA 2JN7A 3ZQ5A 4ETXA 4DN0A 1OTIA 3T4QA 3A0VA 3EEHA 3CAXA 1IFQA 4G3KA 4YWZA 2V0UA 1TS8A 2D02A 1T19A 1LSXA 5MC7A 4Q0JA 4DJ3A 2PT7A 2JKTI 3BJNA 3MXQA 2OWJA 2NUPC 2QYBA 1S1ZA 5LBRA 4YOFA 4M4XA 3KX0X 4HH3A 3LIAA 3PBSA 5A8BA 3H82A 2KOIA 1V9YA 3OBFA 2W0NA 4CLCA 1F5MA 2M1CA 3KO6A 1S67L 1NRJA 4HI4A 2PYPA 4L0LA 4F3LA 3F1OB 1P97A 3BW6A 4BBVA 3HJIA 4PAUA 5HDDA 2WKPA 3JVUA 3C30A 2PD8A 4PKYA 3H7WA 1GSWA 4GLQA 4PHTA 2INWA 4P6ZM 3F1PB 4LLOB 3LYXA 3LUQA 4GCZA 4EEPA 5HZHA 4Q0IA 4CLCE 3S7NA 3FPWA 2VGLS 2W3HA 4IHQA 3BQAA 3MQOA 3EWKA 2PR6A 2QJ5A 2QKPA 4WN5A 4JGPA 1S1YA 4GHIB 4Y2FA 2VGLM 4BWIA 4II7A 4EETB 3T4JA 3CUEA 3F1NA 1IOUA 4H6JB 3NJAA 4NXFA 3OOVA 3MQ0A 5KSHA 2GNXA 1KOUA 5TBMB 1OTAA 2GZAA 4O0PA 2M7UA 4EESA 3UB6A 4KUKA 2W3EA 2O99A 4MN6A 3UB9A 2W1RA 5IT5A 2P04A 3LR0A 2V1BA 1XJ3A 2HV1A 4L9GA 4NEED 2NUTC 4OOMA 3O5YA 4WLAA 1WA9A 1LL8A 3NOUC 4XT2B 2G7UA 3T4KA 5HD3A 2XROA 3UMDA 3A0SA 3BY8A 4IUKA 3TW8A 4WL9A 2W1TB 3S7QA 3F1OA 3TE8A 2HGVA 4O01A 5J7EA 3D72A 4AFIA 3LFVA 2W27A 3PXPA 4HJ3A 3G6OA 3MR0A 3OCNA 4WEJA 2VJWA 3F1PA 1OTBA 2QJ7A 1YAXA 4NXEA 2K7SA 1H3QA 5HSQA 2DMWA 2ZMVA 2VX8A 3BQ8A 4NXGA 5KIZA 1LT0A 1Y28A 4Q0HA 1N9LA 4HJ4A 4I38A 2D01A 4R3AA 1D06A 3HCYA 1TS6A 1D7EA 3GECA 1DP8A 2QWSA 4CLCC 3E98A 1DP9A 4ETZA 3V67A 1YSPA 3K2NA 3UE6A 2O9AA 4GHIA 4K08A 2K2NA 3LIFA 1YKDA 2O0YA 5HD5A 2JKTM 4GW9A 4H6JA 2GX5A 3KYQA 4KQOA 2VV8A 4I3IA 3OCLA 5TBMA 4EERA 4WF0A 4WUJA 3NOTC 1TD5A 3PBOA 4Y5FA 2QHKA 5J4EA 5DFXA 3KYZA 5F6AA 1OT9A 4HY8A 3PHYA 4ARZB 5F69A 1DRMA 1ZHHB 2VEAA 5DJUA 5HDSA 2KX6A 3R7WB 3VV4A 5IS1A 4XT2A 2J80A 1UWNX 3FPVA 4EXOA 3VE3A 3CUEC 1P9RA 2XSSA 4UQIS 2HJEA 1NWZA 2P08A 2W1TA 2J3TD 1G28A 3PBTA 2R78A 5F68A 2W3GA 5L8MA 3CI6A 3RTYA 4ZRRA 1N9NA 1V9ZA 3P01A 3IS2B 1EW0A 1GSXA 3E4OA 4EEUA 4EUVA 1X0OA 4Z1WA 4GS9B 3T50A 5IU1A 1BYWA 4BBTA 2VA0A 1OT6A 5G4ZA 1XJ2A 2ZOHA 2YKFA 3RH8B 4YNRA 2VKSA 1ODVA 2JKRI 2XRNA 1STZA 3CWFA 2PDRA 5K5BA 3MMHA 5DKKA 2Z6CA 2PHYA 5HDCA 2ZMFA 1ZTUA 2LB9A 1XFQA 4HHDA 4RQ9A 3LR5A 3T4TA 4HNBA 3ICYA 2O9BA 3PBRA 4MCWA 5C5KA 4ARZA 1OTEA 2I9VA 3K3DA 4EW7A 5FL3A 3R7WA 3R4KA 4EU0A 3MQQA 5HL6A 2EWVA 2L1MA 1T18A 2FH5A 4IJGA 3D3OA 4JGOA 4HH2A 2PR5A 2CMNA 4NXBA 2ZOIA 2VZWA 1TS7A 3E4PA 3LIEA 3GDIA 5HWWA 5DFYA 3U2AA 1GSVA 2A2LA 3H9WA 3EGXC 1MZUA 2MJ6A 2VLGA 2A24B 3LI8A 3UB8A 5HPFA 1XFNA 2Y8HA 3C2WA 1DP6A 4BBUA 3IS2A 4I39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9C A;  5I5L A;  4GLQ A;  5DFX A;  2IA2 A;  3KSG A;  3KSH A;  4FOF A;  4R6L A;  4G3W A;  4DMZ A;  2VEA A;  4Q0I A;  4LRX C;  3S7P A;  5HPI A;  3VV4 A;  1MC0 A;  3S7N A;  1TF1 A;  2W3H A;  2XSS A;  3NOP C;  2W1T A;  3DBA A;  4Y2F A;  4BWI A;  4Y3I A;  4O8G A;  3OOV A;  2W3G A;  3MQ0 A;  5L8M A;  3CI6 A;  2LB5 A;  2W3F A;  4ZRR A;  4O0P A;  2M7U A;  4ME4 A;  1MKM A;  4CQH A;  1VHM A;  2B18 A;  2W3E A;  4MN7 A;  2O99 A;  3RFB A;  2W1R A;  4LRZ E;  4EUV A;  4Z1W A;  4G3V A;  3O5Y A;  4LRY C;  3MF0 A;  2KLI A;  3NOU C;  3E0Y A;  2G7U A;  4YNR A;  2VKS A;  3NHQ A;  2XRO A;  2XRN A;  1STZ A;  3CIT A;  3S7O A;  4IUK A;  3IBR A;  4E04 A;  2W1T B;  5K5B A;  3MMH A;  3S7Q A;  3KSI A;  4MMN A;  2OOL A;  2HGV A;  4O01 A;  3W2Z A;  3LFV A;  2ZMF A;  3IBJ A;  2Y79 A;  1YSQ A;  1ZTU A;  2LB9 A;  3G6O A;  3ZQ5 A;  4DN0 A;  4ETX A;  4RQ9 A;  2O9B A;  2VJW A;  4MCW A;  4QPR A;  5HSQ A;  3KSF A;  5C5K A;  4G3K A;  4Q0H A;  3R4K A;  2W3D A;  4EU0 A;  4Q0J A;  3BJN A;  5HL6 A;  2QYB A;  3HCY A;  5LBR A;  4YOF A;  4IJG A;  3D3O A;  3E98 A;  4ETZ A;  3TRC A;  4R70 A;  1YSP A;  2M7V A;  3K2N A;  2VZW A;  2KOI A;  3EEA A;  5TJJ A;  2O9A A;  3OBF A;  5DFY A;  2K2N A;  5AJG A;  1YKD A;  2O0Y A;  4MDZ A;  1F5M A;  4GW9 A;  3KO6 A;  2GX5 A;  5HPF A;  4IUH A;  2Y8H A;  3NOT C;  3C2W A;  1TD5 A;  4PAU A;  2K31 A;  4Y5F A; 
#chains in the Genus database with same CATH topology
 3QP8 A;  3LR4 A;  3N6I A;  5GLD A;  5E2E A;  4G3W A;  2HP6 A;  2HJ9 C;  5DJT A;  4GJ4 A;  3T4O A;  5GHY A;  4KG2 A;  4EQ1 A;  4WZ5 A;  1TS0 A;  3SW1 A;  4YIN A;  3TJZ C;  4U3T A;  3OPR A;  4KQD A;  5EVI C;  2VV7 A;  1FCO A;  1VQQ A;  5HAQ A;  4NKP A;  4KZA A;  2VK3 A;  5CGS A;  4Y3I A;  4K91 A;  2EX2 A;  5DVA A;  1K6S A;  3AGE A;  3RFB A;  3IWO A;  4BJP A;  2B02 A;  4ZJ2 A;  4QD4 A;  1SDE A;  4L9E A;  4QU3 A;  3C7V A;  3VOY A;  3LR3 A;  5EFW A;  5U47 A;  4HES A;  3IBR A;  2A24 A;  2JHE A;  1PZO A;  4KZ6 A;  5E43 A;  4QJG A;  4E3J A;  4PM9 A;  3DTM A;  3BEB A;  3VP0 A;  1W79 A;  1YLW A;  3NBL A;  4RYE A;  4CJN A;  4N1H A;  3TRC A;  2UWX A;  3Q82 A;  2HDU A;  4GD8 A;  2XA7 M;  5EPH A;  1SKO B;  1LSV A;  4HOI A;  5FQJ A;  1S66 L;  4X56 A;  2XK1 A;  1K55 A;  3E4Q A;  5CTM A;  3FC7 A;  1BLC A;  3QNC A;  1SZV A;  1KDW A;  2ZJ9 A;  4LRX C;  4KUO A;  1W63 M;  5FEF A;  4EBL A;  1PYY A;  1TF1 A;  3QP1 A;  3HLE A;  3UPN A;  1OPX A;  5G18 A;  3V3R A;  2Y2P A;  2DNS A;  2EXA A;  4O8G A;  1T1B A;  1PWD A;  4OOY A;  4KZ8 A;  4JBF A;  1VHM A;  3H7W B;  3JVV A;  2EFX A;  1F98 A;  3T4L A;  1T1A A;  4PKY G;  1JNU A;  1VEU A;  1L0D A;  2OWH A;  2ZQC A;  1XP4 A;  1NLZ A;  3A3D A;  3SS4 A;  3G2Y A;  1T1C A;  4L9F A;  2I72 A;  3ZYT A;  1KGF A;  2OOL A;  3W2Z A;  2DRW A;  3F1N B;  1PI5 A;  3IBJ A;  2Y79 A;  2JN7 A;  4ETX A;  3ZFZ A;  1FCM A;  3ZHH A;  1IFQ A;  1XA7 A;  1LI0 A;  4DDY A;  3HVF A;  5MC7 A;  4DJ3 A;  3BRM A;  3BJN A;  2JKT I;  3ISG A;  3MXQ A;  1I2W A;  4YOF A;  1YMX A;  3LIA A;  1K4F A;  3H82 A;  4WZ4 A;  1K25 A;  2W0N A;  4E3L A;  3BFF A;  1F5M A;  3V5M A;  4HI4 A;  1YQS A;  4JXV A;  4L0L A;  3O88 A;  2XF3 A;  2WKP A;  3JVU A;  3ZG9 B;  1YLY A;  3F1P B;  3GVB A;  5FDH A;  4GCZ A;  1L0E A;  5HZH A;  1IKG A;  1J3W A;  3IWI A;  3UO9 A;  2PU4 A;  2W3H A;  3T1S A;  2QKP A;  1PRQ A;  4JGP A;  1LLB A;  4Y2F A;  2VGL M;  4P6B A;  4BWI A;  4II7 A;  4H6J B;  3O87 A;  1YLT A;  4NXF A;  5GL9 A;  4GD6 A;  1KOU A;  3BM6 A;  1OTA A;  2GZA A;  4O0P A;  4EES A;  2XLN A;  2O99 A;  4MN6 A;  2H10 A;  5CRF A;  2P04 A;  2Y2O A;  5AQA A;  3OPL A;  4L9G A;  2NUT C;  3O5Y A;  4WLA A;  2JKG A;  2WK0 A;  1LL8 A;  1S6R A;  3NEC A;  1WYC A;  2Y2M A;  1ERO A;  5HD3 A;  3FV7 A;  3KYE A;  3A0S A;  2Y2Q A;  4IUK A;  3NCK A;  3V50 A;  3S7Q A;  4OPZ A;  1S0W A;  4PPR A;  2BTF P;  5HW3 A;  4HJ3 A;  3OCN A;  3DAV A;  3S22 A;  2Z2M B;  3HBR A;  2ZL1 A;  2VJW A;  3MFD A;  1YAX A;  3IF6 A;  4NXE A;  2K7S A;  4Y0U A;  1H3Q A;  4DE2 A;  5HSQ A;  2WZZ A;  4Z9Q A;  4Q0H A;  1ZG4 A;  3HCY A;  1TS6 A;  1ES4 A;  3Q7Z A;  4CLC C;  2QWS A;  3FKW A;  4ETZ A;  3ZG5 A;  5BOH A;  2O9A A;  4DE3 A;  2K2N A;  3LIF A;  2O0Y A;  5GLC A;  3OCL A;  1K56 D;  1TD5 A;  3G35 A;  2XQZ A;  2E8J A;  4X25 A;  3P98 A;  1DRM A;  1ZHH B;  1KGE A;  3LEQ A;  1JWZ A;  3VV4 A;  2J80 A;  1UWN X;  3FPV A;  5CTN A;  4QHC A;  2WAF A;  4UQI S;  5FI7 A;  5M18 A;  4C6Y A;  3UDF A;  1G28 A;  2RCX A;  4LGW A;  2W3G A;  5L8M A;  3N8R A;  2Y59 A;  5EVI A;  4OQ0 A;  3IS2 B;  3IX3 A;  5E2H A;  5J8X A;  3AGF A;  3VP4 A;  5IU1 A;  1FQG A;  2R9W A;  1N4O A;  4FTX A;  5TR7 A;  3WS2 A;  1FIK A;  3HUN A;  1MBL A;  1ODV A;  1GHI A;  2ZC5 B;  3W4P A;  4LV3 A;  4S2O A;  4KQR A;  4RA7 A;  3WWX A;  3UB5 P;  4N92 A;  4IVK A;  5HDC A;  2PBY A;  3SS5 A;  4LV0 A;  2LB9 A;  5FQM A;  4S2I A;  5EUA A;  4HNB A;  2O9B A;  3PBR A;  1NZO A;  1OTE A;  3B3X A;  4EW7 A;  4UAA A;  5FL3 A;  4IED A;  3R7W A;  2PRF A;  2J9O A;  1K4E A;  2L1M A;  4XUX A;  1T18 A;  2FH5 A;  4IJG A;  1PWG A;  4JGO A;  3GMW A;  4HH2 A;  2PR5 A;  4NXB A;  2EFU A;  2ZOI A;  1TS7 A;  3LIE A;  2WKE A;  3U2A A;  1PNE A;  3LI8 A;  3UB8 A;  1PW8 A;  2Y8H A;  5CHJ A;  3LYX A;  2RL3 A;  3IQA A;  5L09 A;  4XUZ A;  4GS9 A;  4WEL A;  3RXW A;  3S7P A;  5HPI A;  4MLL A;  1BLH A;  3EGD C;  3BLM A;  4HIA A;  4LPZ A;  3NY4 A;  3LIC A;  4MBK A;  4EWF A;  3DBA A;  3BWL A;  3UME A;  4ZDX A;  2V1Z A;  3HLW A;  4GDB A;  2LB5 A;  4WM9 A;  3OLO A;  5J3W A;  5HL1 A;  2J9P A;  4BD1 A;  4I3A A;  2V9A A;  2E8I A;  1XJ6 A;  2ZC3 B;  1XA1 A;  5DTK A;  4I5S A;  4D2O A;  3DW0 A;  3VP2 A;  4DJ2 A;  1I2S A;  2C5W B;  1ES3 A;  1G6O A;  4RX3 A;  5DTS A;  4YFM A;  4JF5 A;  3MBZ A;  5A92 A;  3LIB A;  5F83 A;  4C3Q A;  2ACG A;  5HAP A;  4B4Z A;  5CX7 A;  4P6Z S;  3KSF A;  4WMC D;  2V20 A;  3C8C A;  5DF9 A;  3HUO A;  5AQ9 A;  2DCF A;  2EX6 A;  3CJM A;  4R70 A;  1H8M A;  3G31 A;  2M7V A;  1HVB A;  5TJJ A;  4MEZ A;  3G2Z A;  2ZQ9 A;  5CEC A;  4IUH A;  5AVE A;  1Q2Q A;  4B93 A;  4Y15 A;  2WKR A;  1ALQ A;  3CPT A;  5I5L A;  2Y2G A;  1CEG A;  1ZC2 A;  2Q9N A;  2H28 A;  3KSH A;  4FOF A;  3N4I A;  4S2J A;  4DMZ A;  1YM1 A;  3TG9 A;  4EQI A;  3LY3 A;  1MC0 A;  4HQA A;  1IKI A;  4GB7 A;  1E25 A;  1W5D A;  3Q7V A;  3VFF A;  3QP5 A;  3VSK A;  3N8S A;  1DJB A;  1ES5 A;  2G2W A;  1CQA A;  4F3L B;  2BAS A;  5CHU A;  3MZF A;  4EUZ A;  2EX8 A;  4KQQ A;  4QB8 A;  3IXD A;  2A49 A;  2V1A A;  5FI6 A;  3E0Y A;  1D1J A;  2WGI A;  3B33 A;  1P0Z A;  2OSU A;  3PYP A;  3ZGA B;  4BMW A;  3ITB A;  1GCE A;  2XFS A;  5FI2 A;  3ZQ5 A;  4DN0 A;  1I5Q A;  3T4Q A;  1DJC A;  2ZC6 B;  3CAX A;  2HDS A;  3U4L P;  1BTL A;  2V0U A;  2D02 A;  4P0M A;  1LSX A;  5HFO A;  2Y55 A;  2NUP C;  2QYB A;  1S1Z A;  4E3N A;  5LBR A;  3KX0 X;  4HH3 A;  1EI5 A;  1PIO A;  3MSH A;  5JYO A;  3BFE A;  4KZ5 A;  3OBF A;  1ESU A;  4CLC A;  2M1C A;  5DF7 A;  3KO6 A;  3T12 B;  1S67 L;  1NRJ A;  3V3S A;  2Y91 A;  3NC8 A;  2XD5 A;  4PAU A;  5HDD A;  3C30 A;  4PKY A;  1GSW A;  1NY0 A;  3G32 A;  3SH9 A;  4LLO B;  3LUQ A;  1QMF A;  5FAP A;  1DJA A;  2A3U A;  2Y2J A;  1IEM A;  3EWK A;  4KG5 A;  4KG6 A;  4X69 A;  4WN5 A;  1NZU A;  4N9K A;  2V2F F;  1S1Y A;  3SZT A;  4CPK A;  1IOU A;  3ITA A;  3NJA A;  1SCW A;  4WYY A;  1VET A;  1VM1 A;  2J7V A;  1FSW A;  2W3E A;  3G34 A;  1Y4O A;  1YLJ A;  2W1R A;  5IT5 A;  3DWK A;  1PFL A;  2H0Y A;  3SS3 A;  1IYO A;  3NIA A;  4OOM A;  4JF4 A;  3DTI A;  1SKF A;  4H8R A;  4S2L A;  5F1F A;  4XT2 B;  4GOG A;  3HLD A;  2ZLY A;  2XRO A;  4ID4 A;  3ZG7 B;  3G30 A;  4WL9 A;  4XXR A;  1BLS A;  3F1O A;  3TE8 A;  4GN2 A;  3AGD A;  5J7E A;  3T1Q B;  3G6O A;  5IHV A;  4QWO A;  2ZMV A;  1Y28 A;  5FAQ A;  4HJ4 A;  4I38 A;  2D01 A;  3IWQ A;  3GEC A;  1DP8 A;  4S2M A;  5L2F A;  4OVD A;  4OLG A;  4FH2 A;  4OPR A;  3C4O A;  4GHI A;  1PW1 A;  4N1X A;  4X1L A;  1J9M A;  4DKI A;  5TBM A;  4WF0 A;  4OH0 A;  5CER A;  1AXB A;  2JE5 A;  4Y5F A;  1F2K A;  3M6H A;  1FR1 A;  3KYZ A;  1OT9 A;  4HY8 A;  4ARZ B;  2VEA A;  4OP5 A;  4X6T A;  4FH4 A;  3WRT A;  5EM0 A;  2V8C A;  4Y7P A;  1E3U A;  2W1T A;  2J3T D;  3C4P A;  3ZG0 A;  1BZA A;  2R78 A;  4ZRR A;  2IWB A;  1DY6 A;  4MBF A;  1EW0 A;  3E4O A;  4ESP A;  5FAT A;  1BUL A;  4BBT A;  3LO7 A;  1XJ2 A;  2P9V A;  3LGO A;  5CEB A;  2EXB A;  2B5R A;  3ZCZ A;  1O7E A;  3MMH A;  4E6W A;  3IX4 A;  4BLM A;  1N9B A;  2VGJ A;  1XFQ A;  3FYZ A;  3LR5 A;  4LV2 A;  1JTD A;  1RGY A;  4MCW A;  2H0T A;  4PMA A;  2I9V A;  1LI9 A;  1FIL A;  1NJ4 A;  5HL6 A;  3DTK A;  1MWT A;  3WS5 A;  2VZW A;  4JXG A;  1TVF A;  5EE8 A;  3GQZ A;  3GDI A;  3QHY A;  1CK3 A;  3PAG A;  3GV9 A;  1MZU A;  2VLG A;  5FDS A;  2A24 B;  3UY6 A;  1ONH A;  2WGW A;  4RVA A;  4I39 A;  2ZM8 A;  4WBG A;  1PI4 A;  2H5S A;  3W8K A;  2Y2H A;  3VOL A;  2OAP 1;  2OAQ 1;  3RXX A;  1BT5 A;  1CF0 A;  1S4R A;  2L0W A;  3IXH A;  4OQH A;  1WE4 A;  2JBF A;  4X55 A;  4HJ6 A;  1TDL A;  4JLF A;  4KZ4 A;  5G4Y A;  2XFT A;  4WEK A;  3DTE A;  1W7F A;  1JVJ A;  2FZ0 A;  3OC2 A;  5FQI A;  2QMI A;  2HP5 A;  5AQ7 A;  2HP9 A;  2JCH A;  4MN7 A;  2V0W A;  3SH8 A;  5KMW A;  3B47 A;  1MXO A;  2ZQD A;  3IT9 A;  4ZJ3 A;  3MF0 A;  3PBQ A;  1KVM A;  4OQI A;  3FKV A;  4Y13 A;  2XR0 A;  2GJ3 A;  1CI8 A;  4E04 A;  1K54 C;  1U60 A;  2Y2I A;  4R4R A;  3LY4 A;  3WS0 A;  1IYS A;  2JKR M;  5D3O A;  1OJ5 A;  4I3J A;  1LSW A;  4KZB A;  3LID A;  2WUQ A;  3LEZ A;  3ZG8 B;  2WKH A;  4UEY A;  5GHZ A;  2Z6D A;  4DE1 A;  4E6X A;  4JKT A;  1VEU B;  1MWR A;  5GLB A;  3A3E A;  3EEA A;  4MBH A;  2Y2K A;  4S2K A;  1W63 Q;  3T4S A;  1M6K A;  3IHA A;  1ES2 A;  3FG8 A;  2K31 A;  4R3J A;  3NI9 A;  4K0X A;  4JGQ A;  2IA2 A;  1UWP X;  2HDQ A;  3QP4 A;  4S2P A;  3BY9 A;  2PYR A;  3LI9 A;  4OOL A;  1NXY A;  3C7U A;  3OPH A;  1KE0 A;  3Q07 A;  1BLP A;  2PD7 A;  3H82 B;  5EEC A;  4PM6 A;  2AVX A;  1FOF A;  4F94 A;  2W3F A;  1NYM A;  4ME4 A;  1LHY A;  4LCM A;  1XPB A;  4Y0O A;  3QP6 A;  3CG5 A;  1MY8 A;  4G3V A;  1P9W A;  4GZB A;  2KLI A;  5F1G A;  3HLG A;  3UN7 A;  3EQU A;  2ZC4 B;  1SKO A;  2ZC7 A;  3S7O A;  5CGW A;  1H8Y A;  2EA9 A;  2EWW A;  2PAV P;  1E4D A;  3BFG A;  1S4S A;  3IXG A;  2OV5 A;  1FCN A;  1VB6 A;  3UE3 A;  1NLY A;  3MS6 A;  5GHX A;  1YSQ A;  1ERM A;  3D9Y A;  2WKI A;  3SH7 A;  1KE3 A;  5L10 A;  3RJU A;  1L3L A;  3UPO A;  4U0T A;  1CEF A;  4YWZ A;  1T19 A;  4Q0J A;  2PT7 A;  4K0W A;  4M4X A;  1XGJ A;  3PBS A;  4DF6 A;  5A8B A;  2KOI A;  1V9Y A;  2Y2L A;  4KZ3 A;  2J8Y A;  3IH9 A;  1W8Q A;  5EVL A;  4KEN B;  1H5X A;  2PYP A;  1P97 A;  5JYP A;  3BW6 A;  3HJI A;  3FWL A;  1O07 A;  2PD8 A;  3H7W A;  2ZL1 B;  5EVI D;  3IF6 B;  5KZH A;  3BLS A;  3VP1 A;  4EEP A;  4Q0I A;  4P87 A;  5EV0 A;  3S7N A;  3BQA A;  2WZX A;  2QJ5 A;  1XKZ A;  3I7J A;  1FR6 A;  4EET B;  3T4J A;  2ZM0 A;  3F1N A;  3IH8 A;  3OOV A;  3MXS A;  3MQ0 A;  1HD8 A;  5KSH A;  2M7U A;  4IVI A;  3W4O A;  3UB6 A;  4KUK A;  3UB9 A;  3C5A A;  3LR0 A;  1M40 A;  4Y0T A;  4OPQ A;  4X68 A;  4HBU A;  3NOU C;  3MKE A;  1ERQ A;  3BY8 A;  4B4X A;  4E3O A;  2HGV A;  4AFI A;  3LFV A;  3MR0 A;  4NG2 A;  5EVI B;  3F1P A;  1OTB A;  4UA6 A;  1C3B A;  3BEC A;  2X01 A;  5CXW A;  2VX8 A;  4NXG A;  2Q9M A;  4QY5 A;  4UA7 A;  4OPY A;  1DP9 A;  3E2K A;  3V67 A;  2FFF B;  1YSP A;  1WYB A;  3K2N A;  3LCE A;  5HX9 A;  1ZKJ A;  3ZDJ A;  1RGZ A;  5HD5 A;  4H6J A;  2GX5 A;  3KYQ A;  5A90 A;  2VV8 A;  4I3I A;  4WUJ A;  3HLC A;  4U0X A;  1IYP A;  2QHK A;  5DFX A;  4RX2 A;  5KSC A;  3PHY A;  2ZQ7 A;  5F69 A;  3R7W B;  3GRJ A;  3CMZ A;  3UE1 A;  5IS1 A;  3A3I A;  3VE3 A;  4BD0 A;  3CUE C;  5I94 A;  2Y4A A;  1Y54 A;  3NUL A;  4GNU A;  2CC1 A;  1CI9 A;  1SHV A;  3A3F A;  5F68 A;  4LEN A;  1NYY A;  2G2U A;  4S2N C;  3VFH A;  1V9Z A;  3P01 A;  3WS1 A;  4OON A;  2FFY A;  2QZ6 A;  5HAR A;  4EEU A;  3PAE A;  4Y17 A;  4EUV A;  1X0O A;  4GS9 B;  3SOI A;  3T50 A;  3FZC A;  3HLB A;  5G4Z A;  2ZOH A;  1IEL A;  2YKF A;  5FAO A;  3RH8 B;  3UNW A;  4GKU A;  1K6R A;  2JKR I;  2XRN A;  3CWF A;  4BL3 A;  3HUM A;  4LV1 A;  4ZBE A;  5GLA A;  2Z6C A;  3ZNY A;  4JPM A;  1ZTU A;  5FAS A;  3T4T A;  4OP8 A;  1K54 A;  3E2L A;  3S4X A;  2ZQ8 A;  1GHP A;  3K3D A;  2EX9 A;  3VP3 A;  3R4K A;  3MQQ A;  2EWV A;  1K0K A;  3D3O A;  1AWI A;  2ZMA A;  4DXB A;  2X71 A;  5FQ9 A;  5HWW A;  3L9K A;  1GSV A;  3H9W A;  2MJ6 A;  2IWC A;  5HPF A;  1GA9 A;  5CHM A;  5F82 A;  3C2W A;  4BBU A;  2WAE A;  3IS2 A;  1GHM A;  4ZJ1 A;  4FD8 A;  4IBR A;  4X53 A;  4JF6 A;  2WKQ A;  1H0M A;  5A93 A;  3IHB A;  2HPB A;  3ZVW A;  1NRF A;  4JGR A;  5TFQ A;  2P7J A;  5DKL A;  4JXS A;  1MWS A;  4HEF A;  3PBN A;  3NOP C;  5E2F A;  1QME A;  1G68 A;  3G4P A;  5A91 A;  2PU2 A;  1G5U A;  3CZD A;  1K56 A;  2ZQA A;  2PBD P;  3A0R A;  5EOO A;  4ZTK A;  1HTZ A;  3C38 A;  3VE4 A;  2HF6 A;  5CGX A;  4EV4 A;  2VV6 A;  1LL9 A;  1K57 C;  1MKM A;  3O3V A;  3QNB A;  3CPT B;  1G6A A;  3NDE A;  3L7H A;  4LRZ E;  1ESI A;  3HRE A;  2YKH A;  3VMA A;  4HP4 A;  4UQI M;  3Q7V B;  4R38 A;  3CIT A;  1OJG A;  3PR6 A;  2Q0O A;  2WYX A;  3KSI A;  3NDG A;  5DF8 A;  2B95 A;  4CLC D;  4NET A;  4B9O A;  2ZBB A;  1YMS A;  5CED A;  5AVF A;  1UGU A;  4QPR A;  4X1M A;  1ONG A;  1JTG A;  2W3D A;  3Q1F A;  2XA7 S;  1KGG A;  4OLD A;  4OQG A;  1N9O A;  5HWV A;  1F9I A;  5AQB A;  2OLV A;  2GDN A;  5AJG A;  4HBT A;  2XGN A;  4MDZ A;  5HWT A;  3MFX A;  4FSF A;  2KDK A;  1YLP A;  2O9C A;  4B88 A;  1H8Z A;  1K38 A;  3K3C A;  4WZ5 C;  4R1G A;  1SDN A;  3A3J A;  3IX8 A;  3KSG A;  4R6L A;  3EQV A;  4PM5 A;  3JPU A;  4DRT A;  3P7N A;  4BEN A;  1PWC A;  3CLO A;  3OPP A;  2J3W A;  2WAD A;  5TGF A;  4Q8I A;  1XJ4 A;  3VOZ A;  4CLC B;  4MN5 A;  2C6W B;  3IF5 A;  1XX2 A;  5F5Y A;  4R4S A;  4CQH A;  4QY6 A;  2XH9 A;  2B18 A;  5EOE A;  3B42 A;  2X02 A;  4M3K A;  2R9X A;  4HP9 A;  1OTD A;  2J3T C;  4KZ9 A;  2XD1 A;  3HJK A;  4LRY C;  1MPL A;  3D4F A;  1KE4 A;  4GDN A;  3NHQ A;  3ULF A;  4FUW A;  3UB7 A;  4NK3 A;  3MJQ A;  1KVL A;  1Z6F A;  5FA7 A;  2JC7 A;  3MZD A;  3EOI A;  4MMN A;  2L4R A;  3HL9 A;  3TSG A;  4O7D A;  1VET B;  1OTI A;  5HAI A;  3CHW P;  3A0V A;  3QP2 A;  3EEH A;  4G3K A;  1LL5 A;  1TS8 A;  2HDR A;  3BYD A;  2OWJ A;  1Q2P A;  1MKI A;  1E3U D;  1K55 C;  1TDG A;  3OZH A;  2HZ5 A;  4F3L A;  3UDI A;  3F1O B;  4EBN A;  4BBV A;  3IXB A;  4E3I A;  4WMC A;  4PHT A;  4GLQ A;  1KDS A;  4UA9 A;  2INW A;  4IBX A;  1BSG A;  4P6Z M;  5FSR A;  1PZP A;  1TEM A;  5M19 A;  1W8Y A;  3WS4 A;  3DWZ A;  4CLC E;  3V39 A;  3FPW A;  2VGL S;  4IHQ A;  1IYQ A;  3MQO A;  2PR6 A;  3ZVT A;  4GHI B;  3T1R A;  4C75 A;  4DXC A;  3CUE A;  1HLU P;  1XGI A;  4DDS A;  3O86 A;  1ZG6 A;  2GNX A;  5FEG A;  5TBM B;  2JKF A;  4FCF A;  2Z2L B;  4KZ7 A;  1OME A;  3JYI A;  4S2N A;  2V1B A;  4EBP A;  1XJ3 A;  2HV1 A;  4NEE D;  1WA9 A;  2QPN A;  3T1X A;  2G7U A;  3T4K A;  1RCJ A;  3P09 A;  1BUE A;  2V8F A;  3MKF A;  3UMD A;  3TW8 A;  2W1T B;  1YPR A;  3MZE A;  4O01 A;  3D72 A;  3UPP A;  2W27 A;  3PXP A;  3PTE A;  4WEJ A;  4R23 A;  2QJ7 A;  5EVE A;  1CJF A;  2DMW A;  5L07 A;  3BQ8 A;  4PM8 A;  5KIZ A;  1LT0 A;  2VGK A;  3M2J A;  1N9L A;  3GTC A;  4R3A A;  1D06 A;  1A0K A;  1D7E A;  1YT4 A;  3E98 A;  1YLZ A;  3MXR A;  3N8L A;  1EWZ A;  3UE6 A;  2P9V B;  2ZD8 A;  1JWP A;  3WRZ A;  4K08 A;  2ZM2 A;  3HLF A;  2OLU A;  1YKD A;  2BG1 A;  2JKT M;  4GW9 A;  4A5R A;  4OKP A;  4KQO A;  4BL2 A;  4EER A;  2WGV A;  1GA0 A;  2UV0 E;  3NOT C;  1L0G A;  3PBO A;  4DE0 A;  2IWD A;  5FQK A;  5DTT A;  5J4E A;  5F6A A;  5M1A A;  4PM7 A;  5HDS A;  5DJU A;  2KX6 A;  1HZO A;  5FQQ A;  4XT2 A;  4EXO A;  1P9R A;  2XSS A;  2HJE A;  2XDM A;  1NWZ A;  3S1Y A;  2P08 A;  3Q81 A;  3N7W A;  3PBT A;  1MWU A;  2XEP A;  4E3K A;  4JXW A;  3RTY A;  3CI6 A;  1N9N A;  4R3B A;  2WGW B;  3UE0 A;  1JWV A;  1Z09 A;  3ZNT A;  1GSX A;  4ZAM A;  4MNR A;  4E3M A;  2P74 A;  4Z1W A;  1K57 A;  4LCL A;  1BYW A;  2Y2N A;  2VA0 A;  1OT6 A;  1L0F A;  4LFU A;  4YNR A;  2VKS A;  1STZ A;  3W4Q A;  2PDR A;  5K5B A;  1L2S A;  5DKK A;  3UDX A;  3IF6 C;  2PHY A;  4N9L A;  4UHU A;  1FSY A;  2ZMF A;  1ACF A;  4HHD A;  4RQ9 A;  3VSL A;  3ICY A;  4R0Q A;  5C5K A;  3M2K A;  4ARZ A;  3M6B A;  4EU0 A;  4P85 A;  5EM1 A;  5E2G A;  3BFC A;  3GR2 A;  4D60 A;  2CMN A;  3GSG A;  1XXM A;  3E4P A;  3BFD A;  5DFY A;  2BLS A;  2A2L A;  4BQM A;  3EGX C;  1XFN A;  1DP6 A;  1RP5 A;  3TOI A; 
#chains in the Genus database with same CATH homology
 3LR4 A;  2WKQ A;  4G3W A;  4GS9 A;  2HJ9 C;  5DJT A;  4GJ4 A;  4WEL A;  3VOL A;  2OAP 1;  2OAQ 1;  3T4O A;  3S7P A;  5HPI A;  4JGR A;  4EQ1 A;  1TS0 A;  2P7J A;  1S4R A;  5DKL A;  3EGD C;  3SW1 A;  2L0W A;  4LPZ A;  4HIA A;  3TJZ C;  3PBN A;  3LIC A;  3NOP C;  4HJ6 A;  4KQD A;  3DBA A;  2VV7 A;  3BWL A;  4NKP A;  3UME A;  4Y3I A;  3A0R A;  3C38 A;  3VE4 A;  5G4Y A;  2HF6 A;  4WEK A;  2LB5 A;  2FZ0 A;  2VV6 A;  3OC2 A;  1MKM A;  3OLO A;  5J3W A;  4MN7 A;  2V0W A;  3RFB A;  4BJP A;  4I3A A;  4LRZ E;  2V9A A;  3B47 A;  2B02 A;  1XJ6 A;  3MF0 A;  3PBQ A;  2YKH A;  4I5S A;  4L9E A;  4HP4 A;  4UQI M;  4R38 A;  3CIT A;  3LR3 A;  5EFW A;  1OJG A;  3PR6 A;  2GJ3 A;  3IBR A;  4E04 A;  4DJ2 A;  2A24 A;  2JHE A;  1G6O A;  3KSI A;  4CLC D;  4B9O A;  2ZBB A;  3LIB A;  2JKR M;  5AVF A;  5CX7 A;  4P6Z S;  1OJ5 A;  1UGU A;  4QPR A;  4I3J A;  1LSW A;  3KSF A;  3LID A;  3C8C A;  5DF9 A;  2W3D A;  4UEY A;  2XA7 S;  2Z6D A;  1N9O A;  5HWV A;  1F9I A;  3TRC A;  4R70 A;  1H8M A;  2M7V A;  2XA7 M;  3EEA A;  5TJJ A;  5AJG A;  1LSV A;  4HOI A;  4MDZ A;  1S66 L;  1W63 Q;  5HWT A;  3MFX A;  3T4S A;  4IUH A;  5AVE A;  4FSF A;  2KDK A;  4B93 A;  3FG8 A;  2WKR A;  3E4Q A;  2K31 A;  2O9C A;  5I5L A;  4JGQ A;  3K3C A;  2IA2 A;  2H28 A;  1UWP X;  3FC7 A;  3KSH A;  3KSG A;  4FOF A;  4R6L A;  3EQV A;  3BY9 A;  2PYR A;  3LI9 A;  4OOL A;  4DMZ A;  3P7N A;  4LRX C;  1MC0 A;  3CLO A;  4KUO A;  1W63 M;  4HQA A;  2J3W A;  1TF1 A;  2PD7 A;  3H82 B;  1OPX A;  1XJ4 A;  4CLC B;  4O8G A;  1T1B A;  4MN5 A;  2W3F A;  2BAS A;  4F3L B;  5F5Y A;  4ME4 A;  4CQH A;  1VHM A;  2B18 A;  3B42 A;  3H7W B;  3JVV A;  4HP9 A;  1F98 A;  1OTD A;  2J3T C;  4G3V A;  1P9W A;  3T4L A;  3HJK A;  1T1A A;  4LRY C;  4PKY G;  2V1A A;  1JNU A;  2KLI A;  3E0Y A;  3B33 A;  2OWH A;  3NHQ A;  3EQU A;  3ULF A;  3UB7 A;  3S7O A;  1NLZ A;  2EA9 A;  1P0Z A;  2EWW A;  3MJQ A;  3PYP A;  1T1C A;  3EOI A;  1S4S A;  4L9F A;  4MMN A;  4BMW A;  3ZYT A;  2OOL A;  2L4R A;  1VB6 A;  3UE3 A;  3W2Z A;  1NLY A;  3F1N B;  3IBJ A;  2Y79 A;  1YSQ A;  2JN7 A;  3ZQ5 A;  4ETX A;  4DN0 A;  1OTI A;  3T4Q A;  3A0V A;  3EEH A;  3CAX A;  1IFQ A;  4G3K A;  4YWZ A;  2V0U A;  1TS8 A;  2D02 A;  1T19 A;  1LSX A;  5MC7 A;  4Q0J A;  4DJ3 A;  2PT7 A;  2JKT I;  3BJN A;  3MXQ A;  2OWJ A;  2NUP C;  2QYB A;  1S1Z A;  5LBR A;  4YOF A;  4M4X A;  3KX0 X;  4HH3 A;  3LIA A;  3PBS A;  5A8B A;  3H82 A;  2KOI A;  1V9Y A;  3OBF A;  2W0N A;  4CLC A;  1F5M A;  2M1C A;  3KO6 A;  1S67 L;  1NRJ A;  4HI4 A;  2PYP A;  4L0L A;  4F3L A;  3F1O B;  1P97 A;  3BW6 A;  4BBV A;  3HJI A;  4PAU A;  5HDD A;  2WKP A;  3JVU A;  3C30 A;  2PD8 A;  4PKY A;  3H7W A;  1GSW A;  4GLQ A;  4PHT A;  2INW A;  4P6Z M;  3F1P B;  4LLO B;  3LYX A;  3LUQ A;  4GCZ A;  4EEP A;  5HZH A;  4Q0I A;  4CLC E;  3S7N A;  3FPW A;  2VGL S;  2W3H A;  4IHQ A;  3BQA A;  3MQO A;  3EWK A;  2PR6 A;  2QJ5 A;  2QKP A;  4WN5 A;  4JGP A;  1S1Y A;  4GHI B;  4Y2F A;  2VGL M;  4BWI A;  4II7 A;  4EET B;  3T4J A;  3CUE A;  3F1N A;  1IOU A;  4H6J B;  3NJA A;  4NXF A;  3OOV A;  3MQ0 A;  5KSH A;  2GNX A;  1KOU A;  5TBM B;  1OTA A;  2GZA A;  4O0P A;  2M7U A;  4EES A;  3UB6 A;  4KUK A;  2W3E A;  2O99 A;  4MN6 A;  3UB9 A;  2W1R A;  5IT5 A;  2P04 A;  3LR0 A;  2V1B A;  1XJ3 A;  2HV1 A;  4L9G A;  4NEE D;  2NUT C;  4OOM A;  3O5Y A;  4WLA A;  1WA9 A;  1LL8 A;  3NOU C;  4XT2 B;  2G7U A;  3T4K A;  5HD3 A;  2XRO A;  3UMD A;  3A0S A;  3BY8 A;  4IUK A;  3TW8 A;  4WL9 A;  2W1T B;  3S7Q A;  3F1O A;  3TE8 A;  2HGV A;  4O01 A;  5J7E A;  3D72 A;  4AFI A;  3LFV A;  2W27 A;  3PXP A;  4HJ3 A;  3G6O A;  3MR0 A;  3OCN A;  4WEJ A;  2VJW A;  3F1P A;  1OTB A;  2QJ7 A;  1YAX A;  4NXE A;  2K7S A;  1H3Q A;  5HSQ A;  2DMW A;  2ZMV A;  2VX8 A;  3BQ8 A;  4NXG A;  5KIZ A;  1LT0 A;  1Y28 A;  4Q0H A;  1N9L A;  4HJ4 A;  4I38 A;  2D01 A;  4R3A A;  1D06 A;  3HCY A;  1TS6 A;  1D7E A;  3GEC A;  1DP8 A;  2QWS A;  4CLC C;  3E98 A;  1DP9 A;  4ETZ A;  3V67 A;  1YSP A;  3K2N A;  3UE6 A;  2O9A A;  4GHI A;  4K08 A;  2K2N A;  3LIF A;  1YKD A;  2O0Y A;  5HD5 A;  2JKT M;  4GW9 A;  4H6J A;  2GX5 A;  3KYQ A;  4KQO A;  2VV8 A;  4I3I A;  3OCL A;  5TBM A;  4EER A;  4WF0 A;  4WUJ A;  3NOT C;  1TD5 A;  3PBO A;  4Y5F A;  2QHK A;  5J4E A;  5DFX A;  3KYZ A;  5F6A A;  1OT9 A;  4HY8 A;  3PHY A;  4ARZ B;  5F69 A;  1DRM A;  1ZHH B;  2VEA A;  5DJU A;  5HDS A;  2KX6 A;  3R7W B;  3VV4 A;  5IS1 A;  4XT2 A;  2J80 A;  1UWN X;  3FPV A;  4EXO A;  3VE3 A;  3CUE C;  1P9R A;  2XSS A;  4UQI S;  2HJE A;  1NWZ A;  2P08 A;  2W1T A;  2J3T D;  1G28 A;  3PBT A;  2R78 A;  5F68 A;  2W3G A;  5L8M A;  3CI6 A;  3RTY A;  4ZRR A;  1N9N A;  1V9Z A;  3P01 A;  3IS2 B;  1EW0 A;  1GSX A;  3E4O A;  4EEU A;  4EUV A;  1X0O A;  4Z1W A;  4GS9 B;  3T50 A;  5IU1 A;  1BYW A;  4BBT A;  2VA0 A;  1OT6 A;  5G4Z A;  1XJ2 A;  2ZOH A;  2YKF A;  3RH8 B;  4YNR A;  2VKS A;  1ODV A;  2JKR I;  2XRN A;  1STZ A;  3CWF A;  2PDR A;  5K5B A;  3MMH A;  5DKK A;  2Z6C A;  2PHY A;  5HDC A;  2ZMF A;  1ZTU A;  2LB9 A;  1XFQ A;  4HHD A;  4RQ9 A;  3LR5 A;  3T4T A;  4HNB A;  3ICY A;  2O9B A;  3PBR A;  4MCW A;  5C5K A;  4ARZ A;  1OTE A;  2I9V A;  3K3D A;  4EW7 A;  5FL3 A;  3R7W A;  3R4K A;  4EU0 A;  3MQQ A;  5HL6 A;  2EWV A;  2L1M A;  1T18 A;  2FH5 A;  4IJG A;  3D3O A;  4JGO A;  4HH2 A;  2PR5 A;  2CMN A;  4NXB A;  2ZOI A;  2VZW A;  1TS7 A;  3E4P A;  3LIE A;  3GDI A;  5HWW A;  5DFY A;  3U2A A;  1GSV A;  2A2L A;  3H9W A;  3EGX C;  1MZU A;  2MJ6 A;  2VLG A;  2A24 B;  3LI8 A;  3UB8 A;  5HPF A;  1XFN A;  2Y8H A;  3C2W A;  1DP6 A;  4BBU A;  3IS2 A;  4I39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...