4GLQA

Crystal structure of the blue-light absorbing form of the thermosynechococcus elongatus pixj gaf-domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
149
structure length
149
Chain Sequence
ELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein
publication title A Photo-Labile Thioether Linkage to Phycoviolobilin Provides the Foundation for the Blue/Green Photocycles in DXCF-Cyanobacteriochromes.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
total genus 50
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2012-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4glqA00
4Y5FA 1MC0A 4BWIA 3MQ0A 1VHMA 3MF0A 4Q0HA 1STZA 2VKSA 4RQ9A 2Y8HA 2LB5A 2M7UA 2KOIA 2W3GA 4ZRRA 2B18A 5C5KA 3D3OA 3VV4A 4LRZE 5LBRA 5L8MA 2VJWA 4YOFA 2G7UA 2K31A 2LB9A 4EU0A 1F5MA 2XRNA 4YNRA 4EUVA 3K2NA 3OBFA 5DFXA 1YSQA 3OOVA 4PAUA 2W3HA 2Y79A 4R6LA 3IBJA 1YKDA 2IA2A 3O5YA 2O0YA 4IJGA 4DN0A 2ZMFA 3S7NA 4O01A 5DFYA 2W3EA 2W1RA 4G3KA 3DBAA 3LFVA 4Y2FA 3NHQA 3S7OA 5HPFA 5TJJA 3KSIA 4QPRA 2QYBA 3R4KA 4FOFA 3MMHA 3HCYA 4LRYC 2OOLA 3KO6A 3KSGA 3NOPC 3NOUC 3EEAA 2VEAA 4ME4A 4ETZA 3E98A 2HGVA 1MKMA 5HL6A 2O9CA 2O99A 1TD5A 4G3WA 5I5LA 4MCWA 2XSSA 3C2WA 4MMNA 3S7PA 4O0PA 2KLIA 2K2NA 2O9BA 3S7QA 4IUKA 4GLQA 5K5BA 4G3VA 3CI6A 3W2ZA 5HPIA 4MDZA 3BJNA 1TF1A 4LRXC 4Q0JA 2W3DA 2W1TB 4Q0IA 3E0YA 3ZQ5A 2GX5A 3G6OA 4MN7A 3CITA 2M7VA 2W1TA 1YSPA 4IUHA 3NOTC 4CQHA 3IBRA 5HSQA 2XROA 2W3FA 2O9AA 4O8GA 4ETXA 4Z1WA 2VZWA 3KSHA 4GW9A 3TRCA 4R70A 4Y3IA 4DMZA 5AJGA 1ZTUA 3KSFA 4E04A 3RFBA
chains in the Genus database with same CATH superfamily
3FC7A 3VOZA 3ISGA 5GHZA 4FH4A 3P09A 5FA7A 4X56A 5LBRA 4N1XA 2PU2A 2PDRA 4RVAA 2XA7S 5FI2A 4HH2A 2EFUA 2NUPC 2Y2LA 3HLDA 4ZDXA 3A3IA 3Q81A 3H7WB 2WYXA 2Z6DA 4I3IA 3E4OA 5EM0A 2OV5A 4RYEA 3V3RA 2ZC5B 1WA9A 4PM7A 4KZAA 5EVIA 3SS3A 5FI6A 3KSIA 1OTIA 1PWDA 1YMSA 2V2FF 3MKEA 5TBMA 4PM5A 5F1GA 3QP8A 1BLPA 4ETZA 5M18A 4UEYA 1ZHHB 4QU3A 1K6SA 5HL1A 1TS8A 4X69A 2Z2MB 3UB5P 1SKOB 4JF4A 4E3OA 4WF0A 5K5BA 4U3TA 3IWIA 2J7VA 5FASA 3MXRA 1TF1A 5G4YA 1PWGA 4EBNA 5DVAA 4EUZA 4C6YA 1PZPA 3IWQA 4WLAA 1DP6A 5E2FA 2C6WB 1KDSA 2WGVA 4QD4A 4KZ5A 2PU4A 4EBPA 4S2MA 4D60A 1T1AA 3SW1A 4ZJ2A 2B5RA 5HPFA 3A0RA 4BWIA 5FQKA 4EERA 1KGFA 4Q8IA 3MF0A 2WKHA 2P9VB 2Y2QA 4R0QA 4HJ6A 4A5RA 4X25A 4QWOA 2P7JA 3HUOA 4S2LA 4F94A 4KQOA 1XJ2A 4UAAA 4WBGA 2JE5A 5DF7A 4UA9A 1CEGA 3ZG9B 3V50A 1XPBA 3Q7ZA 3E4PA 3BW6A 3O87A 1S0WA 1IOUA 1H8YA 1JWPA 3ITBA 2JKRM 3H7WA 5F83A 3T4KA 1XP4A 1UWNX 3EQUA 5HDCA 4PHTA 1GA9A 4BBUA 5TJJA 1YPRA 2UWXA 1MBLA 2ZLYA 5FAQA 2R78A 3EEAA 2PYPA 1AWIA 2OWJA 4BLMA 1DJCA 5HW3A 3HLWA 1LLBA 1PYYA 4NEED 1MPLA 2XSSA 1UWPX 5EM1A 4R4RA 3S7QA 3C7UA 4I5SA 3SH7A 1PI4A 1FR1A 3ZGAB 4HJ3A 1F98A 4IHQA 2JKFA 1GA0A 2ZOHA 2W3FA 2XA7M 4O8GA 4LGWA 3D9YA 2HF6A 3NY4A 2XLNA 5HD5A 4DMZA 4I3JA 4X1LA 5HAQA 4Y5FA 2PBYA 2J3TD 2ZBBA 3UDXA 4E6WA 3GVBA 2LB5A 3Q1FA 2D01A 4E3LA 4GDNA 4LRZE 4WYYA 1H8MA 4NK3A 3H82B 3KYZA 5M19A 3CZDA 4OPYA 3OBFA 3VP2A 4ARZB 5CHUA 2BLSA 3Q82A 2W3HA 4JXGA 2D02A 1LL8A 3O5YA 5L10A 4WN5A 4E3JA 3N8RA 3BFFA 3LIAA 4E6XA 3LIDA 1BLCA 5FATA 4BBTA 5DKLA 5GLCA 4Y2FA 2J3WA 1CK3A 3HBRA 5EECA 2B02A 1IKGA 4JXWA 1K54A 2FFYA 2GJ3A 4HQAA 1PIOA 4IVKA 5EVIC 2W0NA 3F1NA 3V5MA 2H0YA 4UA7A 4S2IA 3BY8A 3KSGA 3HLFA 2VX8A 4WZ5A 4BQMA 2WUQA 3JYIA 1T18A 3CG5A 2XFTA 4E3IA 1K4EA 3WWXA 2VGKA 5EVEA 4B4XA 4HP9A 3W4PA 2XD5A 1W7FA 3T1XA 3UB7A 2Y2KA 3PR6A 3D72A 2H0TA 1YLPA 4KZ8A 4OQHA 4I39A 1S67L 3ZYTA 4IUHA 4CQHA 3VE4A 4WUJA 5F1FA 5DJTA 2P08A 4BJPA 3C30A 1BYWA 4DF6A 2G2UA 3LR5A 5AJGA 2X01A 1YT4A 3RFBA 4JF6A 2I9VA 3VP4A 4N1HA 4R4SA 3HLCA 3GR2A 4R38A 4LCMA 2WAFA 4HP4A 1IEMA 2PBDP 3TW8A 3T50A 2HDUA 5C5KA 5FAPA 1XA1A 1XGIA 3BM6A 5A92A 5J7EA 1FIKA 4P6ZM 4PMAA 3DTKA 1YKDA 2H5SA 3IX4A 4OH0A 4DN0A 2WGWB 3JPUA 1Z6FA 1HTZA 3T4LA 4JPMA 3SS4A 1L0FA 3IXDA 3IS2A 5CX7A 3OPRA 1JTGA 1Q2QA 3S22A 4OLDA 3GMWA 3IF5A 2ZL1B 3LUQA 5E2EA 4PKYA 1RGZA 4QB8A 4B93A 4IUKA 4GD6A 1BLSA 1W8QA 4E3MA 5L07A 1L2SA 3M2JA 4B4ZA 2HDQA 1BTLA 2M7VA 3ZCZA 3GRJA 1Z09A 3C7VA 2XROA 3WS2A 2O9AA 1WYCA 4KUOA 3TRCA 4NKPA 3WS1A 5HWTA 4E04A 3MFDA 2HJ9C 3O86A 1FCNA 4E3NA 5DJUA 2V1AA 1UGUA 2WZZA 4UA6A 4YWZA 5FL3A 1N9NA 3M6BA 5FQQA 3LR3A 4AFIA 5FAOA 3VV4A 2QZ6A 4JLFA 5CTMA 3A0VA 1DJBA 4D2OA 3V39A 2ZM0A 3BYDA 4GD8A 3A3EA 4EUVA 1GHIA 3ITAA 3FPWA 1NRFA 1YLJA 4JGRA 3T4SA 4S2PA 3N7WA 3Q07A 4O01A 1IFQA 5AQBA 4RX2A 4BBVA 2Y4AA 1S6RA 2WGWA 2KDKA 3B47A 4FUWA 4JGQA 1IKIA 3LI9A 1K54C 3MMHA 1ZG4A 4OOYA 1KE0A 2HDRA 4IEDA 2ZOIA 3FPVA 3R7WA 1OTEA 4X6TA 2ZL1A 1KOUA 2XQZA 2K2NA 5E2HA 3JVUA 4KG2A 4GS9B 2V1BA 5EOOA 2QJ5A 5FDSA 3CUEA 3C38A 4RX3A 3SH8A 5AQ9A 2EXBA 4MN7A 2JBFA 5A91A 5HSQA 3NECA 5FEGA 4PPRA 3FG8A 3L7HA 2Y2OA 1NXYA 3HLGA 4Z1WA 3G4PA 4L9EA 2VK3A 2VV6A 3RXXA 3CPTB 2J3TC 4IBRA 3VE3A 2Z6CA 1XKZA 4DRTA 3HJKA 4HEFA 1JWVA 1ACFA 1CI9A 3BECA 4CLCB 2VKSA 4RQ9A 1Y4OA 2M7UA 2W3GA 3PBNA 3LCEA 4ZTKA 1HLUP 1P9WA 3MXQA 5IT5A 1EW0A 2BTFP 4CLCD 3K2NA 1V9YA 4BD1A 4KZ4A 1PNEA 4WMCA 2A24A 1TS7A 2A3UA 4YFMA 3Q7VA 2ZMFA 3MXSA 3S7NA 3VOYA 4WZ4A 2W27A 4OQGA 1ES5A 3ULFA 4NXGA 1YLYA 1SZVA 2ZQDA 1ES2A 2A2LA 4UQIM 1VEUB 2XGNA 3QP5A 2Y2IA 2AVXA 1BZAA 4FOFA 5GLAA 4OQIA 2P04A 4DKIA 2JKTI 1F2KA 1MKMA 3QNBA 3CMZA 4EETB 1TD5A 3NC8A 2HP6A 4O0PA 4FD8A 2O9BA 1WYBA 1NZUA 2HV1A 3IH8A 3AGEA 3RJUA 3N8SA 2W3DA 1MXOA 2XF3A 2PR5A 2WKQA 4OPQA 3PBTA 4K91A 5FEFA 1W8YA 1DJAA 1L0DA 3A3DA 1MZUA 4LLOB 4OQ0A 3M2KA 2IWCA 5CEDA 1ZTUA 2ZQ9A 2VV8A 4LCLA 2WZXA 2V9AA 1IYPA 1ESIA 3HREA 3IH9A 1JTDA 3BFCA 1W79A 4O7DA 4PM6A 3QP6A 3N8LA 4JXVA 4CLCA 4P0MA 1E3UA 4YINA 1YLTA 4GN2A 2BG1A 3B3XA 3PBOA 3N4IA 2VJWA 4OOLA 3IWOA 3FKWA 4GCZA 5J8XA 2OWHA 4YNRA 4FCFA 5FQIA 3L9KA 2VA0A 1K4FA 2V8FA 3IXBA 2H28A 4R6LA 2XDMA 4II7A 3T4QA 3OCNA 1MKIA 3DWZA 3QHYA 3NDGA 4MLLA 4MBKA 4DE2A 2QJ7A 1BUEA 1OT6A 1T1CA 3WRZA 3WS0A 5J3WA 3V67A 2GDNA 4EW7A 2Y2HA 2EWVA 3UE1A 3C2WA 5FI7A 1BT5A 3SH9A 5EPHA 3BQ8A 2G2WA 2PT7A 4H8RA 2HZ5A 3CUEC 1K25A 1ERQA 2ZD8A 1DY6A 4R3BA 3A3JA 1FSWA 1TS6A 1XA7A 1E4DA 1PZOA 4BL3A 4P6ZS 3P7NA 2OAP1 4GW9A 4M4XA 5CGXA 2J9PA 3KSFA 3OPHA 3E2LA 4M3KA 1SKOA 1Q2PA 4IVIA 2P74A 1G6AA 3VSKA 1BLHA 2I72A 5G18A 3BLSA 2HP9A 3KYQA 1H0MA 4YOFA 1NYYA 5DTKA 2Y59A 1K6RA 2ZM2A 3GECA 2Y79A 4FTXA 1FR6A 1OT9A 5HAPA 4KZBA 3MQOA 1NLZA 2P9VA 4DXBA 4S2KA 2FFFB 5F5YA 1RGYA 3UMDA 1KVMA 1EWZA 5IS1A 2ZQ8A 2JCHA 5AQAA 3T1QB 3ZHHA 4KZ6A 2ZC7A 3O3VA 5U47A 1I2SA 1K56D 1G28A 2A49A 2XFSA 4DE1A 3OLOA 2WAEA 2PHYA 3LIEA 4MMNA 3RXWA 2ZM8A 3BRMA 1YLZA 4PM8A 3MR0A 3W2ZA 3OCLA 2WADA 2JN7A 1NYMA 2PAVP 3ZQ5A 5E43A 3BEBA 5AQ7A 3G6OA 1ONGA 4WL9A 3LIBA 2WKEA 2BASA 2OLVA 3LEQA 1K38A 5CECA 2QPNA 3UE3A 1KVLA 1CEFA 1KGGA 1MC0A 2EXAA 3H9WA 4NXEA 1VHMA 3ZG5A 3A3FA 5EV0A 4BL2A 4DJ3A 3ZG0A 4ZRRA 5JYPA 4CLCC 4HY8A 3UY6A 3NCKA 2K31A 4U0TA 2EX8A 3M6HA 1AXBA 4R3AA 2ZC4B 2RL3A 3F1PB 4PAUA 3TSGA 1Y54A 2E8JA 5AVFA 5HDDA 4I3AA 1ONHA 3LFVA 1LHYA 2JHEA 3CLOA 3CWFA 1BULA 3T4JA 4Y0UA 4MNRA 3SZTA 4L9GA 3H82A 4S2NC 3MZDA 3DTIA 2L0WA 4ARZA 2EA9A 1T1BA 3WS5A 3GSGA 3DTEA 4Y7PA 2O9CA 1DRMA 1TDGA 4G3WA 1OTAA 1K55C 3AGFA 3EEHA 2JC7A 1CJFA 4H6JB 4LENA 5HARA 4LRXC 4HH3A 1XX2A 2W1TB 3EOIA 5HFOA 5FQJA 3G32A 1I2WA 1XJ4A 4NG2A 1S1YA 3DWKA 2WGIA 4N9KA 2L4RA 1KE4A 5A8BA 3DTMA 1IYSA 5A90A 2FH5A 4HBTA 4JGOA 4Y3IA 3IT9A 4GB7A 2K7SA 1V9ZA 3UPPA 3HJIA 3T1RA 1S4RA 5KMWA 4JXSA 2J80A 3AGDA 4UQIS 2VV7A 2EWWA 4QY5A 3ZNTA 4HI4A 3IXGA 3TE8A 5L8MA 2LB9A 3E2KA 4EU0A 2X02A 5CGSA 5HWVA 2DNSA 2Y2NA 1NZOA 4HNBA 3OPLA 3T1SA 2W3EA 3T4TA 1I5QA 4GKUA 2ZJ9A 3VOLA 3S7OA 3PBRA 2X71A 3BWLA 5CXWA 4QPRA 2QYBA 3R4KA 3UB8A 3W8KA 1N9LA 3IF6B 2PYRA 5F82A 5HL6A 5CGWA 2O99A 3VP3A 4OPRA 3LY3A 1SCWA 3S7PA 1L3LA 2UV0E 2R9WA 3CI6A 5EVLA 5FSRA 3NIAA 1K0KA 4EEUA 4Q0IA 4H6JA 3E0YA 5HDSA 5GL9A 4Z9QA 2JKTM 2WK0A 2W1TA 5JYOA 1C3BA 1K57C 4DE0A 3T4OA 2VGJA 4GOGA 1ES3A 4KZ3A 4K0WA 3MKFA 2PD8A 2GZAA 3BLMA 3VFFA 4DJ2A 1ES4A 1GSWA 1CF0A 3B33A 2PR6A 3SOIA 1DP8A 1TS0A 3P01A 1EROA 3GDIA 3UDFA 1G5UA 4XXRA 2XK1A 4DDYA 4N9LA 1PWCA 5GHYA 5TBMB 4HOIA 3LYXA 4EXOA 4NXFA 2V20A 3VMAA 2V8CA 3HVFA 1NLYA 2J9OA 4LFUA 5EVID 3BQAA 5DTSA 3V3SA 3NULA 2XD1A 1VB6A 3F1OB 3UO9A 4OLGA 1D06A 1NRJA 4G3KA 3UMEA 1N9BA 5HX9A 3PHYA 1QMFA 1H5XA 5FDHA 1N4OA 3OPPA 4LV0A 4I38A 1OMEA 4X53A 4KQDA 1M6KA 4MCWA 4NXBA 4P6BA 2KLIA 2KX6A 4GLQA 4LV2A 1H8ZA 5HPIA 3MBZA 4MDZA 4JKTA 1KGEA 3G35A 4BENA 3ZVWA 2INWA 1QMEA 3CITA 3LI8A 1MY8A 3MS6A 2ZC3B 3WS4A 1RP5A 4LPZA 1D1JA 4KZ7A 1TDLA 4JF5A 2WKRA 1L0GA 2Q0OA 1XGJA 1WE4A 4EQIA 1JVJA 4S2JA 4EESA 2H10A 3OZHA 1VETB 3LY4A 5HD3A 4GS9A 1ZC2A 3P98A 5KZHA 3G2YA 3FV7A 5KSHA 2M1CA 1SDEA 2Q9MA 1P9RA 3D3OA 1U60A 2HPBA 1CQAA 2HDSA 3UE6A 4ZAMA 3K3DA 1YMXA 4K0XA 4EWFA 4CLCE 1XXMA 3CPTA 4EV4A 1OPXA 3G31A 4Y13A 1JWZA 3UN7A 3HLBA 1LSXA 4MEZA 1KE3A 4BMWA 2V0UA 1XJ6A 3C4PA 3PYPA 1TVFA 3F1OA 4EEPA 5EFWA 5HAIA 4OONA 3IX3A 4ZJ1A 4DXCA 4KZ9A 1L0EA 2RCXA 3HL9A 3IHBA 1LT0A 4X68A 1LI9A 1VM1A 5I5LA 4Y0TA 3BFDA 4GDBA 3D4FA 2OAQ1 1YQSA 3CJMA 1P97A 2ZQ7A 3RH8B 1FILA 1H3QA 1LSVA 2VGLM 3OC2A 3ICYA 4S2NA 3CAXA 1VEUA 3IBRA 3QNCA 4KG5A 3PBQA 3HUMA 1K55A 3UB9A 1A0KA 5EUAA 5A93A 5KIZA 3GQZA 3IQAA 4R70A 4C3QA 2R9XA 5FQ9A 2ZC6B 1S1ZA 3UDIA 4MBHA 5FQMA 3LEZA 4QHCA 1VETA 1STZA 2KOIA 3CHWP 2QMIA 3KX0X 3F1NB 5DF8A 3VP0A 2EX9A 1XFNA 4HIAA 2ACGA 4OP5A 2IA2A 5CTNA 1TEMA 4X55A 3PAGA 4BD0A 4U0XA 1P0ZA 4ESPA 3MZEA 2WKIA 1S66L 4Y17A 1PI5A 2QWSA 3B42A 1JNUA 4LRYC 2VEAA 2FZ0A 5DTTA 4MN5A 3E98A 1GCEA 3BFGA 3ZG7B 1MWRA 3IF6C 2QHKA 1ZG6A 2V0WA 3DW0A 3QP4A 4G3VA 2YKFA 3LO7A 3UNWA 5F68A 2OSUA 4JBFA 2XR0A 5L09A 3UPOA 3KYEA 2DMWA 3NOTC 2VLGA 1IYOA 2JKGA 4CJNA 4EQ1A 5CHMA 1GHPA 5HZHA 1ERMA 1ESUA 1ZKJA 3C4OA 3TOIA 2L1MA 5TR7A 4MBFA 1F9IA 3W4QA 4E3KA 3C5AA 4N92A 3FZCA 2CC1A 5TGFA 5MC7A 2GNXA 3UE0A 4Q0HA 1O7EA 3EGXC 1MWSA 1K57A 1X0OA 5M1AA 2CMNA 3IS2B 4C75A 2JKRI 5CRFA 4HJ4A 5IHVA 4MN6A 2EX6A 5F6AA 1T19A 4OVDA 4KUKA 4PM9A 1MWUA 1F5MA 3UPNA 3MFXA 4P87A 2DRWA 3OOVA 1NY0A 2ZQCA 4JGPA 4QJGA 3G34A 3I7JA 3S4XA 4GNUA 4IBXA 3PXPA 3ZFZA 3FKVA 1LL5A 3VFHA 2HJEA 5HWWA 2B95A 5D3OA 4ID4A 1KDWA 4OP8A 3ZNYA 2OLUA 3KO6A 3NOPC 4NETA 4GJ4A 4HHDA 1YAXA 4XT2B 5CHJA 3FYZA 4GZBA 4DDSA 4B88A 1K56A 4RA7A 1W63M 2V1ZA 2PRFA 4KQQA 3O88A 5F69A 4UHUA 1CI8A 1W63Q 1YM1A 1GSXA 4Q0JA 3NBLA 3FWLA 4OKPA 3U4LP 1FCOA 1SHVA 1G68A 4L9FA 1YSPA 5EOEA 2MJ6A 3IX8A 3JVVA 4GHIB 1HD8A 5GHXA 1ALQA 4ETXA 2PD7A 1PRQA 4KQRA 1GHMA 1J9MA 1HVBA 3RTYA 2EFXA 3K3CA 3WRTA 1RCJA 5IU1A 1XFQA 3IHAA 3PTEA 2E8IA 1G6OA 3NDEA 3VSLA 2Y91A 3PBSA 2Y2GA 4WEJA 2DCFA 2B18A 1PFLA 5J4EA 2YKHA 1LI0A 3HLEA 2G7UA 1N9OA 4F3LB 3W4OA 2ZMAA 3TG9A 1MWTA 2XRNA 3EQVA 1PW1A 4ZJ3A 3R7WB 2Q9NA 5AVEA 1YSQA 4FSFA 2EX2A 2IWBA 4B9OA 2O0YA 3ZG8B 4FH2A 1ODVA 1Y28A 2QKPA 4HESA 3BFEA 3NHQA 4QY6A 3A0SA 4R3JA 4WEKA 5KSCA 1M40A 3NOUC 2IWDA 3HUNA 4WELA 4ME4A 3LGOA 3F1PA 5DKKA 3EWKA 1IYQA 4XUZA 1BSGA 4XT2A 2ZMVA 3E4QA 4DE3A 3ZVTA 1O07A 2Y2JA 3BJNA 1E25A 3SS5A 4PKYG 3T12B 3VP1A 3MJQA 5BOHA 2Y2PA 2Y55A 4EBLA 2VZWA 3QP1A 4HBUA 4LV1A 3KSHA 1NWZA 3S1YA 4GHIA 1W5DA 1VQQA 3NJAA 3G30A 4ZBEA 2NUTC 4S2OA 1DP9A 5EE8A 1YLWA 3MQQA 4WM9A 1LSWA 2A24B 3C8CA 3Q7VB 3EGDC 3MQ0A 1OJGA 4X1MA 5CERA 1J3WA 1S4SA 3DAVA 3G2ZA 4OOMA 2Y8HA 2WKPA 5E2GA 1IELA 4WMCD 4KENB 3LIFA 3LR4A 1FSYA 3U2AA 4K08A 3TJZC 4R1GA 1OTDA 3IXHA 4R23A 1LL9A 4F3LA 1FCMA 5DFXA 5GLDA 1HZOA 3QP2A 3LICA 3IBJA 4IJGA 2VGLS 4WZ5C 1D7EA 5GLBA 5DFYA 1OTBA 2W1RA 1SKFA 4L0LA 5EVIB 3DBAA 3UB6A 4LV3A 4Y0OA 3MZFA 3HCYA 3PAEA 4XUXA 2OOLA 1PW8A 4P85A 4Y15A 2Y2MA 3N6IA 3BY9A 2HGVA 5DF9A 2J8YA 2XH9A 5I94A 1NJ4A 1XJ3A 2XEPA 5TFQA 1SDNA 5CEBA 2C5WB 4KG6A 2Z2LB 1FQGA 5G4ZA 2GX5A 5L2FA 3MSHA 2ZQAA 3LR0A 2HP5A 4OPZA 3GV9A 3IF6A 1EI5A 1FOFA 3NI9A 3GTCA 3ZDJA 4CPKA 1OJ5A 1E3UD 1GSVA
chains in the Genus database with same CATH topology
1S1ZA 1MC0A 5DJUA 3FC7A 2V1AA 1UGUA 3H9WA 4NXEA 1VHMA 1STZA 4YWZA 5FL3A 1N9NA 4DJ3A 2KOIA 3LR3A 4AFIA 4ZRRA 4CLCC 3VV4A 4HY8A 3A0VA 3KX0X 5LBRA 3F1NB 2PDRA 2K31A 2XA7S 4HH2A 4EUVA 4R3AA 1XFNA 2NUPC 3FPWA 4HIAA 4JGRA 3F1PB 4PAUA 3H7WB 2Z6DA 4I3IA 3T4SA 2IA2A 3E4OA 5AVFA 5HDDA 4I3AA 4O01A 1IFQA 1WA9A 4BBVA 3LFVA 1P0ZA 2JHEA 2KDKA 3B47A 3CLOA 3CWFA 1S66L 3T4JA 4JGQA 3KSIA 3LI9A 2QWSA 1OTIA 3B42A 4L9GA 1JNUA 3H82A 3MMHA 4LRYC 5TBMA 2VEAA 2FZ0A 2ZOIA 2L0WA 4MN5A 3FPVA 4ARZA 2EA9A 1T1BA 3E98A 3R7WA 4ETZA 1OTEA 1ZHHB 4UEYA 2O9CA 1DRMA 4G3WA 1OTAA 1TS8A 1KOUA 2QHKA 2V0WA 2K2NA 4WF0A 3EEHA 5K5BA 4G3VA 3JVUA 2YKFA 4GS9B 2V1BA 4H6JB 5F68A 1TF1A 4LRXC 4HH3A 5G4YA 2QJ5A 2W1TB 3CUEA 3C38A 3EOIA 1XJ4A 2DMWA 1S1YA 4MN7A 3NOTC 5HSQA 2L4RA 2VLGA 4WLAA 1DP6A 3FG8A 5A8BA 4EQ1A 5HZHA 2FH5A 4Z1WA 4L9EA 2VV6A 4JGOA 2J3TC 1T1AA 3SW1A 2L1MA 4Y3IA 1F9IA 3VE3A 2Z6CA 2K7SA 5HPFA 1V9ZA 3HJIA 3A0RA 3HJKA 4BWIA 1S4RA 5MC7A 2GNXA 4EERA 4CLCB 3MF0A 4Q0HA 2J80A 3EGXC 4UQIS 2VKSA 4HJ6A 4RQ9A 2VV7A 2P7JA 2M7UA 1X0OA 2W3GA 2CMNA 3PBNA 3IS2B 2JKRI 4HJ4A 2EWWA 4KQOA 1P9WA 3MXQA 4MN6A 4HI4A 3TE8A 5F6AA 1XJ2A 5L8MA 1T19A 3UE3A 5IT5A 1EW0A 4KUKA 2LB9A 4EU0A 1F5MA 4CLCD 3K2NA 1V9YA 3MFXA 5HWVA 3OOVA 2A24A 3E4PA 1TS7A 3BW6A 4JGPA 1IOUA 4HNBA 2JKRM 3H7WA 2ZMFA 3S7NA 3T4KA 1UWNX 3EQUA 2W3EA 5HDCA 2W27A 3PXPA 3ULFA 3T4TA 4PHTA 4BBUA 4NXGA 3VOLA 3S7OA 3PBRA 2HJEA 2A2LA 3BWLA 4UQIM 5HWWA 5TJJA 4QPRA 2QYBA 3R4KA 4FOFA 3UB8A 3KO6A 3NOPC 1N9LA 2R78A 3EEAA 4GJ4A 2P04A 2PYPA 4HHDA 1YAXA 2OWJA 2PYRA 2JKTI 4XT2B 1MKMA 5HL6A 4EETB 2O99A 4NEED 1TD5A 2XSSA 3S7PA 1W63M 4O0PA 1UWPX 2O9BA 3S7QA 5F69A 3CI6A 1W63Q 4I5SA 2HV1A 1GSXA 4Q0JA 2W3DA 4EEUA 4HJ3A 4H6JA 3E0YA 4Q0IA 5HDSA 2JKTM 4L9FA 2W1TA 1YSPA 2PR5A 1F98A 4IHQA 2WKQA 2MJ6A 3JVVA 3PBTA 2ZOHA 4GHIB 2W3FA 2XA7M 3T4OA 4O8GA 4ETXA 2HF6A 1MZUA 2PD7A 5HD5A 4LLOB 4DMZA 2PD8A 2GZAA 4DJ2A 4I3JA 1ZTUA 3RTYA 3K3CA 2VV8A 1GSWA 3B33A 4Y5FA 5IU1A 1XFQA 2PR6A 2V9AA 2J3TD 2ZBBA 1DP8A 1TS0A 3P01A 1G6OA 3GDIA 3PBSA 2LB5A 4WEJA 4CLCA 2D01A 2B18A 5J4EA 2YKHA 4LRZE 1H8MA 3PBOA 2VJWA 2G7UA 4OOLA 1N9OA 3H82B 3KYZA 4F3LB 5TBMB 4GCZA 4HOIA 2OWHA 3LYXA 2XRNA 4YNRA 4EXOA 3EQVA 3OBFA 4NXFA 4ARZB 2VA0A 3R7WB 1NLYA 5AVEA 1YSQA 4FSFA 2H28A 2W3HA 4R6LA 2D02A 1LL8A 3O5YA 4B9OA 2O0YA 4WN5A 3BQAA 4II7A 3T4QA 3LIAA 3OCNA 1VB6A 3F1OB 1ODVA 3LIDA 1D06A 1NRJA 1Y28A 4G3KA 5DKLA 2QKPA 4Y2FA 3UMEA 4BBTA 2J3WA 3PHYA 3NHQA 2B02A 2GJ3A 4HQAA 2QJ7A 3A0SA 2W0NA 3F1NA 4WEKA 1OT6A 3BY8A 3KSGA 3NOUC 2VX8A 4WELA 1T1CA 4I38A 4ME4A 5J3WA 3V67A 4EW7A 2EWVA 1T18A 4KQDA 3F1PA 5DKKA 3EWKA 4MCWA 3C2WA 4XT2A 2ZMVA 3E4QA 4NXBA 4HP9A 2KLIA 2KX6A 4GLQA 3UB7A 5HPIA 4MDZA 3BJNA 3BQ8A 3PR6A 2PT7A 3D72A 4PKYG 2INWA 4I39A 3CUEC 3CITA 1S67L 3MJQA 3ZYTA 4IUHA 4CQHA 3LI8A 3VE4A 4WUJA 1TS6A 5DJTA 2P08A 4LPZA 2VZWA 4P6ZS 3KSHA 1NWZA 2WKRA 3P7NA 2OAP1 4BJPA 4GHIA 3NJAA 3C30A 2NUTC 4GW9A 1BYWA 1DP9A 4M4XA 3LR5A 3MQQA 5AJGA 4EESA 1LSWA 3KSFA 2A24B 3RFBA 3C8CA 2I9VA 3EGDC 5HD3A 4GS9A 3MQ0A 1OJGA 4R38A 1S4SA 4HP4A 5KSHA 4OOMA 2Y8HA 2M1CA 2WKPA 3TW8A 1P9RA 3T50A 5C5KA 3D3OA 3KYQA 3UE6A 3LIFA 3K3DA 4YOFA 3LR4A 3U2AA 4CLCE 4K08A 3TJZC 1OTDA 1OPXA 4F3LA 5DFXA 3GECA 5J7EA 4P6ZM 1LSXA 2Y79A 3LICA 3IBJA 1YKDA 4BMWA 4IJGA 1OT9A 2VGLS 2V0UA 1D7EA 4DN0A 3MQOA 1NLZA 1XJ6A 1OTBA 5DFYA 3T4LA 2W1RA 4L0LA 3DBAA 3PYPA 5F5YA 3UB6A 3UMDA 3F1OA 5IS1A 3IS2A 4EEPA 5EFWA 5CX7A 3HCYA 2OOLA 1G28A 1LT0A 3BY9A 2HGVA 3LUQA 3OLOA 4PKYA 5I5LA 2PHYA 5DF9A 3LIEA 4MMNA 2OAQ1 4B93A 4IUKA 1XJ3A 1P97A 3MR0A 3W2ZA 3RH8B 3OC2A 1LSVA 1H3QA 2VGLM 3OCLA 3ICYA 2JN7A 3ZQ5A 3CAXA 5G4ZA 2GX5A 3G6OA 2M7VA 3IBRA 4WL9A 3LIBA 3LR0A 3PBQA 2BASA 2XROA 3UB9A 2O9AA 5KIZA 4KUOA 3TRCA 4NKPA 4R70A 5HWTA 1OJ5A 4E04A 2HJ9C 1GSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y5F A;  1MC0 A;  4BWI A;  3MQ0 A;  1VHM A;  3MF0 A;  4Q0H A;  1STZ A;  2VKS A;  4RQ9 A;  2Y8H A;  2LB5 A;  2M7U A;  2KOI A;  2W3G A;  4ZRR A;  2B18 A;  5C5K A;  3D3O A;  3VV4 A;  4LRZ E;  5LBR A;  5L8M A;  2VJW A;  4YOF A;  2G7U A;  2K31 A;  2LB9 A;  4EU0 A;  1F5M A;  2XRN A;  4YNR A;  4EUV A;  3K2N A;  3OBF A;  5DFX A;  1YSQ A;  3OOV A;  4PAU A;  2W3H A;  2Y79 A;  4R6L A;  3IBJ A;  1YKD A;  2IA2 A;  3O5Y A;  2O0Y A;  4IJG A;  4DN0 A;  2ZMF A;  3S7N A;  4O01 A;  5DFY A;  2W3E A;  2W1R A;  4G3K A;  3DBA A;  3LFV A;  4Y2F A;  3NHQ A;  3S7O A;  5HPF A;  5TJJ A;  3KSI A;  4QPR A;  2QYB A;  3R4K A;  4FOF A;  3MMH A;  3HCY A;  4LRY C;  2OOL A;  3KO6 A;  3KSG A;  3NOP C;  3NOU C;  3EEA A;  2VEA A;  4ME4 A;  4ETZ A;  3E98 A;  2HGV A;  1MKM A;  5HL6 A;  2O9C A;  2O99 A;  1TD5 A;  4G3W A;  5I5L A;  4MCW A;  2XSS A;  3C2W A;  4MMN A;  3S7P A;  4O0P A;  2KLI A;  2K2N A;  2O9B A;  3S7Q A;  4IUK A;  4GLQ A;  5K5B A;  4G3V A;  3CI6 A;  3W2Z A;  5HPI A;  4MDZ A;  3BJN A;  1TF1 A;  4LRX C;  4Q0J A;  2W3D A;  2W1T B;  4Q0I A;  3E0Y A;  3ZQ5 A;  2GX5 A;  3G6O A;  4MN7 A;  3CIT A;  2M7V A;  2W1T A;  1YSP A;  4IUH A;  3NOT C;  4CQH A;  3IBR A;  5HSQ A;  2XRO A;  2W3F A;  2O9A A;  4O8G A;  4ETX A;  4Z1W A;  2VZW A;  3KSH A;  4GW9 A;  3TRC A;  4R70 A;  4Y3I A;  4DMZ A;  5AJG A;  1ZTU A;  3KSF A;  4E04 A;  3RFB A; 
#chains in the Genus database with same CATH topology
 3FC7 A;  3VOZ A;  3ISG A;  5GHZ A;  4FH4 A;  3P09 A;  5FA7 A;  4X56 A;  5LBR A;  4N1X A;  2PU2 A;  2PDR A;  4RVA A;  2XA7 S;  5FI2 A;  4HH2 A;  2EFU A;  2NUP C;  2Y2L A;  3HLD A;  4ZDX A;  3A3I A;  3Q81 A;  3H7W B;  2WYX A;  2Z6D A;  4I3I A;  3E4O A;  5EM0 A;  2OV5 A;  4RYE A;  3V3R A;  2ZC5 B;  1WA9 A;  4PM7 A;  4KZA A;  5EVI A;  3SS3 A;  5FI6 A;  3KSI A;  1OTI A;  1PWD A;  1YMS A;  2V2F F;  3MKE A;  5TBM A;  4PM5 A;  5F1G A;  3QP8 A;  1BLP A;  4ETZ A;  5M18 A;  4UEY A;  1ZHH B;  4QU3 A;  1K6S A;  5HL1 A;  1TS8 A;  4X69 A;  2Z2M B;  3UB5 P;  1SKO B;  4JF4 A;  4E3O A;  4WF0 A;  5K5B A;  4U3T A;  3IWI A;  2J7V A;  5FAS A;  3MXR A;  1TF1 A;  5G4Y A;  1PWG A;  4EBN A;  5DVA A;  4EUZ A;  4C6Y A;  1PZP A;  3IWQ A;  4WLA A;  1DP6 A;  5E2F A;  2C6W B;  1KDS A;  2WGV A;  4QD4 A;  4KZ5 A;  2PU4 A;  4EBP A;  4S2M A;  4D60 A;  1T1A A;  3SW1 A;  4ZJ2 A;  2B5R A;  5HPF A;  3A0R A;  4BWI A;  5FQK A;  4EER A;  1KGF A;  4Q8I A;  3MF0 A;  2WKH A;  2P9V B;  2Y2Q A;  4R0Q A;  4HJ6 A;  4A5R A;  4X25 A;  4QWO A;  2P7J A;  3HUO A;  4S2L A;  4F94 A;  4KQO A;  1XJ2 A;  4UAA A;  4WBG A;  2JE5 A;  5DF7 A;  4UA9 A;  1CEG A;  3ZG9 B;  3V50 A;  1XPB A;  3Q7Z A;  3E4P A;  3BW6 A;  3O87 A;  1S0W A;  1IOU A;  1H8Y A;  1JWP A;  3ITB A;  2JKR M;  3H7W A;  5F83 A;  3T4K A;  1XP4 A;  1UWN X;  3EQU A;  5HDC A;  4PHT A;  1GA9 A;  4BBU A;  5TJJ A;  1YPR A;  2UWX A;  1MBL A;  2ZLY A;  5FAQ A;  2R78 A;  3EEA A;  2PYP A;  1AWI A;  2OWJ A;  4BLM A;  1DJC A;  5HW3 A;  3HLW A;  1LLB A;  1PYY A;  4NEE D;  1MPL A;  2XSS A;  1UWP X;  5EM1 A;  4R4R A;  3S7Q A;  3C7U A;  4I5S A;  3SH7 A;  1PI4 A;  1FR1 A;  3ZGA B;  4HJ3 A;  1F98 A;  4IHQ A;  2JKF A;  1GA0 A;  2ZOH A;  2W3F A;  2XA7 M;  4O8G A;  4LGW A;  3D9Y A;  2HF6 A;  3NY4 A;  2XLN A;  5HD5 A;  4DMZ A;  4I3J A;  4X1L A;  5HAQ A;  4Y5F A;  2PBY A;  2J3T D;  2ZBB A;  3UDX A;  4E6W A;  3GVB A;  2LB5 A;  3Q1F A;  2D01 A;  4E3L A;  4GDN A;  4LRZ E;  4WYY A;  1H8M A;  4NK3 A;  3H82 B;  3KYZ A;  5M19 A;  3CZD A;  4OPY A;  3OBF A;  3VP2 A;  4ARZ B;  5CHU A;  2BLS A;  3Q82 A;  2W3H A;  4JXG A;  2D02 A;  1LL8 A;  3O5Y A;  5L10 A;  4WN5 A;  4E3J A;  3N8R A;  3BFF A;  3LIA A;  4E6X A;  3LID A;  1BLC A;  5FAT A;  4BBT A;  5DKL A;  5GLC A;  4Y2F A;  2J3W A;  1CK3 A;  3HBR A;  5EEC A;  2B02 A;  1IKG A;  4JXW A;  1K54 A;  2FFY A;  2GJ3 A;  4HQA A;  1PIO A;  4IVK A;  5EVI C;  2W0N A;  3F1N A;  3V5M A;  2H0Y A;  4UA7 A;  4S2I A;  3BY8 A;  3KSG A;  3HLF A;  2VX8 A;  4WZ5 A;  4BQM A;  2WUQ A;  3JYI A;  1T18 A;  3CG5 A;  2XFT A;  4E3I A;  1K4E A;  3WWX A;  2VGK A;  5EVE A;  4B4X A;  4HP9 A;  3W4P A;  2XD5 A;  1W7F A;  3T1X A;  3UB7 A;  2Y2K A;  3PR6 A;  3D72 A;  2H0T A;  1YLP A;  4KZ8 A;  4OQH A;  4I39 A;  1S67 L;  3ZYT A;  4IUH A;  4CQH A;  3VE4 A;  4WUJ A;  5F1F A;  5DJT A;  2P08 A;  4BJP A;  3C30 A;  1BYW A;  4DF6 A;  2G2U A;  3LR5 A;  5AJG A;  2X01 A;  1YT4 A;  3RFB A;  4JF6 A;  2I9V A;  3VP4 A;  4N1H A;  4R4S A;  3HLC A;  3GR2 A;  4R38 A;  4LCM A;  2WAF A;  4HP4 A;  1IEM A;  2PBD P;  3TW8 A;  3T50 A;  2HDU A;  5C5K A;  5FAP A;  1XA1 A;  1XGI A;  3BM6 A;  5A92 A;  5J7E A;  1FIK A;  4P6Z M;  4PMA A;  3DTK A;  1YKD A;  2H5S A;  3IX4 A;  4OH0 A;  4DN0 A;  2WGW B;  3JPU A;  1Z6F A;  1HTZ A;  3T4L A;  4JPM A;  3SS4 A;  1L0F A;  3IXD A;  3IS2 A;  5CX7 A;  3OPR A;  1JTG A;  1Q2Q A;  3S22 A;  4OLD A;  3GMW A;  3IF5 A;  2ZL1 B;  3LUQ A;  5E2E A;  4PKY A;  1RGZ A;  4QB8 A;  4B93 A;  4IUK A;  4GD6 A;  1BLS A;  1W8Q A;  4E3M A;  5L07 A;  1L2S A;  3M2J A;  4B4Z A;  2HDQ A;  1BTL A;  2M7V A;  3ZCZ A;  3GRJ A;  1Z09 A;  3C7V A;  2XRO A;  3WS2 A;  2O9A A;  1WYC A;  4KUO A;  3TRC A;  4NKP A;  3WS1 A;  5HWT A;  4E04 A;  3MFD A;  2HJ9 C;  3O86 A;  1FCN A;  4E3N A;  5DJU A;  2V1A A;  1UGU A;  2WZZ A;  4UA6 A;  4YWZ A;  5FL3 A;  1N9N A;  3M6B A;  5FQQ A;  3LR3 A;  4AFI A;  5FAO A;  3VV4 A;  2QZ6 A;  4JLF A;  5CTM A;  3A0V A;  1DJB A;  4D2O A;  3V39 A;  2ZM0 A;  3BYD A;  4GD8 A;  3A3E A;  4EUV A;  1GHI A;  3ITA A;  3FPW A;  1NRF A;  1YLJ A;  4JGR A;  3T4S A;  4S2P A;  3N7W A;  3Q07 A;  4O01 A;  1IFQ A;  5AQB A;  4RX2 A;  4BBV A;  2Y4A A;  1S6R A;  2WGW A;  2KDK A;  3B47 A;  4FUW A;  4JGQ A;  1IKI A;  3LI9 A;  1K54 C;  3MMH A;  1ZG4 A;  4OOY A;  1KE0 A;  2HDR A;  4IED A;  2ZOI A;  3FPV A;  3R7W A;  1OTE A;  4X6T A;  2ZL1 A;  1KOU A;  2XQZ A;  2K2N A;  5E2H A;  3JVU A;  4KG2 A;  4GS9 B;  2V1B A;  5EOO A;  2QJ5 A;  5FDS A;  3CUE A;  3C38 A;  4RX3 A;  3SH8 A;  5AQ9 A;  2EXB A;  4MN7 A;  2JBF A;  5A91 A;  5HSQ A;  3NEC A;  5FEG A;  4PPR A;  3FG8 A;  3L7H A;  2Y2O A;  1NXY A;  3HLG A;  4Z1W A;  3G4P A;  4L9E A;  2VK3 A;  2VV6 A;  3RXX A;  3CPT B;  2J3T C;  4IBR A;  3VE3 A;  2Z6C A;  1XKZ A;  4DRT A;  3HJK A;  4HEF A;  1JWV A;  1ACF A;  1CI9 A;  3BEC A;  4CLC B;  2VKS A;  4RQ9 A;  1Y4O A;  2M7U A;  2W3G A;  3PBN A;  3LCE A;  4ZTK A;  1HLU P;  1P9W A;  3MXQ A;  5IT5 A;  1EW0 A;  2BTF P;  4CLC D;  3K2N A;  1V9Y A;  4BD1 A;  4KZ4 A;  1PNE A;  4WMC A;  2A24 A;  1TS7 A;  2A3U A;  4YFM A;  3Q7V A;  2ZMF A;  3MXS A;  3S7N A;  3VOY A;  4WZ4 A;  2W27 A;  4OQG A;  1ES5 A;  3ULF A;  4NXG A;  1YLY A;  1SZV A;  2ZQD A;  1ES2 A;  2A2L A;  4UQI M;  1VEU B;  2XGN A;  3QP5 A;  2Y2I A;  2AVX A;  1BZA A;  4FOF A;  5GLA A;  4OQI A;  2P04 A;  4DKI A;  2JKT I;  1F2K A;  1MKM A;  3QNB A;  3CMZ A;  4EET B;  1TD5 A;  3NC8 A;  2HP6 A;  4O0P A;  4FD8 A;  2O9B A;  1WYB A;  1NZU A;  2HV1 A;  3IH8 A;  3AGE A;  3RJU A;  3N8S A;  2W3D A;  1MXO A;  2XF3 A;  2PR5 A;  2WKQ A;  4OPQ A;  3PBT A;  4K91 A;  5FEF A;  1W8Y A;  1DJA A;  1L0D A;  3A3D A;  1MZU A;  4LLO B;  4OQ0 A;  3M2K A;  2IWC A;  5CED A;  1ZTU A;  2ZQ9 A;  2VV8 A;  4LCL A;  2WZX A;  2V9A A;  1IYP A;  1ESI A;  3HRE A;  3IH9 A;  1JTD A;  3BFC A;  1W79 A;  4O7D A;  4PM6 A;  3QP6 A;  3N8L A;  4JXV A;  4CLC A;  4P0M A;  1E3U A;  4YIN A;  1YLT A;  4GN2 A;  2BG1 A;  3B3X A;  3PBO A;  3N4I A;  2VJW A;  4OOL A;  3IWO A;  3FKW A;  4GCZ A;  5J8X A;  2OWH A;  4YNR A;  4FCF A;  5FQI A;  3L9K A;  2VA0 A;  1K4F A;  2V8F A;  3IXB A;  2H28 A;  4R6L A;  2XDM A;  4II7 A;  3T4Q A;  3OCN A;  1MKI A;  3DWZ A;  3QHY A;  3NDG A;  4MLL A;  4MBK A;  4DE2 A;  2QJ7 A;  1BUE A;  1OT6 A;  1T1C A;  3WRZ A;  3WS0 A;  5J3W A;  3V67 A;  2GDN A;  4EW7 A;  2Y2H A;  2EWV A;  3UE1 A;  3C2W A;  5FI7 A;  1BT5 A;  3SH9 A;  5EPH A;  3BQ8 A;  2G2W A;  2PT7 A;  4H8R A;  2HZ5 A;  3CUE C;  1K25 A;  1ERQ A;  2ZD8 A;  1DY6 A;  4R3B A;  3A3J A;  1FSW A;  1TS6 A;  1XA7 A;  1E4D A;  1PZO A;  4BL3 A;  4P6Z S;  3P7N A;  2OAP 1;  4GW9 A;  4M4X A;  5CGX A;  2J9P A;  3KSF A;  3OPH A;  3E2L A;  4M3K A;  1SKO A;  1Q2P A;  4IVI A;  2P74 A;  1G6A A;  3VSK A;  1BLH A;  2I72 A;  5G18 A;  3BLS A;  2HP9 A;  3KYQ A;  1H0M A;  4YOF A;  1NYY A;  5DTK A;  2Y59 A;  1K6R A;  2ZM2 A;  3GEC A;  2Y79 A;  4FTX A;  1FR6 A;  1OT9 A;  5HAP A;  4KZB A;  3MQO A;  1NLZ A;  2P9V A;  4DXB A;  4S2K A;  2FFF B;  5F5Y A;  1RGY A;  3UMD A;  1KVM A;  1EWZ A;  5IS1 A;  2ZQ8 A;  2JCH A;  5AQA A;  3T1Q B;  3ZHH A;  4KZ6 A;  2ZC7 A;  3O3V A;  5U47 A;  1I2S A;  1K56 D;  1G28 A;  2A49 A;  2XFS A;  4DE1 A;  3OLO A;  2WAE A;  2PHY A;  3LIE A;  4MMN A;  3RXW A;  2ZM8 A;  3BRM A;  1YLZ A;  4PM8 A;  3MR0 A;  3W2Z A;  3OCL A;  2WAD A;  2JN7 A;  1NYM A;  2PAV P;  3ZQ5 A;  5E43 A;  3BEB A;  5AQ7 A;  3G6O A;  1ONG A;  4WL9 A;  3LIB A;  2WKE A;  2BAS A;  2OLV A;  3LEQ A;  1K38 A;  5CEC A;  2QPN A;  3UE3 A;  1KVL A;  1CEF A;  1KGG A;  1MC0 A;  2EXA A;  3H9W A;  4NXE A;  1VHM A;  3ZG5 A;  3A3F A;  5EV0 A;  4BL2 A;  4DJ3 A;  3ZG0 A;  4ZRR A;  5JYP A;  4CLC C;  4HY8 A;  3UY6 A;  3NCK A;  2K31 A;  4U0T A;  2EX8 A;  3M6H A;  1AXB A;  4R3A A;  2ZC4 B;  2RL3 A;  3F1P B;  4PAU A;  3TSG A;  1Y54 A;  2E8J A;  5AVF A;  5HDD A;  4I3A A;  1ONH A;  3LFV A;  1LHY A;  2JHE A;  3CLO A;  3CWF A;  1BUL A;  3T4J A;  4Y0U A;  4MNR A;  3SZT A;  4L9G A;  3H82 A;  4S2N C;  3MZD A;  3DTI A;  2L0W A;  4ARZ A;  2EA9 A;  1T1B A;  3WS5 A;  3GSG A;  3DTE A;  4Y7P A;  2O9C A;  1DRM A;  1TDG A;  4G3W A;  1OTA A;  1K55 C;  3AGF A;  3EEH A;  2JC7 A;  1CJF A;  4H6J B;  4LEN A;  5HAR A;  4LRX C;  4HH3 A;  1XX2 A;  2W1T B;  3EOI A;  5HFO A;  5FQJ A;  3G32 A;  1I2W A;  1XJ4 A;  4NG2 A;  1S1Y A;  3DWK A;  2WGI A;  4N9K A;  2L4R A;  1KE4 A;  5A8B A;  3DTM A;  1IYS A;  5A90 A;  2FH5 A;  4HBT A;  4JGO A;  4Y3I A;  3IT9 A;  4GB7 A;  2K7S A;  1V9Z A;  3UPP A;  3HJI A;  3T1R A;  1S4R A;  5KMW A;  4JXS A;  2J80 A;  3AGD A;  4UQI S;  2VV7 A;  2EWW A;  4QY5 A;  3ZNT A;  4HI4 A;  3IXG A;  3TE8 A;  5L8M A;  2LB9 A;  3E2K A;  4EU0 A;  2X02 A;  5CGS A;  5HWV A;  2DNS A;  2Y2N A;  1NZO A;  4HNB A;  3OPL A;  3T1S A;  2W3E A;  3T4T A;  1I5Q A;  4GKU A;  2ZJ9 A;  3VOL A;  3S7O A;  3PBR A;  2X71 A;  3BWL A;  5CXW A;  4QPR A;  2QYB A;  3R4K A;  3UB8 A;  3W8K A;  1N9L A;  3IF6 B;  2PYR A;  5F82 A;  5HL6 A;  5CGW A;  2O99 A;  3VP3 A;  4OPR A;  3LY3 A;  1SCW A;  3S7P A;  1L3L A;  2UV0 E;  2R9W A;  3CI6 A;  5EVL A;  5FSR A;  3NIA A;  1K0K A;  4EEU A;  4Q0I A;  4H6J A;  3E0Y A;  5HDS A;  5GL9 A;  4Z9Q A;  2JKT M;  2WK0 A;  2W1T A;  5JYO A;  1C3B A;  1K57 C;  4DE0 A;  3T4O A;  2VGJ A;  4GOG A;  1ES3 A;  4KZ3 A;  4K0W A;  3MKF A;  2PD8 A;  2GZA A;  3BLM A;  3VFF A;  4DJ2 A;  1ES4 A;  1GSW A;  1CF0 A;  3B33 A;  2PR6 A;  3SOI A;  1DP8 A;  1TS0 A;  3P01 A;  1ERO A;  3GDI A;  3UDF A;  1G5U A;  4XXR A;  2XK1 A;  4DDY A;  4N9L A;  1PWC A;  5GHY A;  5TBM B;  4HOI A;  3LYX A;  4EXO A;  4NXF A;  2V20 A;  3VMA A;  2V8C A;  3HVF A;  1NLY A;  2J9O A;  4LFU A;  5EVI D;  3BQA A;  5DTS A;  3V3S A;  3NUL A;  2XD1 A;  1VB6 A;  3F1O B;  3UO9 A;  4OLG A;  1D06 A;  1NRJ A;  4G3K A;  3UME A;  1N9B A;  5HX9 A;  3PHY A;  1QMF A;  1H5X A;  5FDH A;  1N4O A;  3OPP A;  4LV0 A;  4I38 A;  1OME A;  4X53 A;  4KQD A;  1M6K A;  4MCW A;  4NXB A;  4P6B A;  2KLI A;  2KX6 A;  4GLQ A;  4LV2 A;  1H8Z A;  5HPI A;  3MBZ A;  4MDZ A;  4JKT A;  1KGE A;  3G35 A;  4BEN A;  3ZVW A;  2INW A;  1QME A;  3CIT A;  3LI8 A;  1MY8 A;  3MS6 A;  2ZC3 B;  3WS4 A;  1RP5 A;  4LPZ A;  1D1J A;  4KZ7 A;  1TDL A;  4JF5 A;  2WKR A;  1L0G A;  2Q0O A;  1XGJ A;  1WE4 A;  4EQI A;  1JVJ A;  4S2J A;  4EES A;  2H10 A;  3OZH A;  1VET B;  3LY4 A;  5HD3 A;  4GS9 A;  1ZC2 A;  3P98 A;  5KZH A;  3G2Y A;  3FV7 A;  5KSH A;  2M1C A;  1SDE A;  2Q9M A;  1P9R A;  3D3O A;  1U60 A;  2HPB A;  1CQA A;  2HDS A;  3UE6 A;  4ZAM A;  3K3D A;  1YMX A;  4K0X A;  4EWF A;  4CLC E;  1XXM A;  3CPT A;  4EV4 A;  1OPX A;  3G31 A;  4Y13 A;  1JWZ A;  3UN7 A;  3HLB A;  1LSX A;  4MEZ A;  1KE3 A;  4BMW A;  2V0U A;  1XJ6 A;  3C4P A;  3PYP A;  1TVF A;  3F1O A;  4EEP A;  5EFW A;  5HAI A;  4OON A;  3IX3 A;  4ZJ1 A;  4DXC A;  4KZ9 A;  1L0E A;  2RCX A;  3HL9 A;  3IHB A;  1LT0 A;  4X68 A;  1LI9 A;  1VM1 A;  5I5L A;  4Y0T A;  3BFD A;  4GDB A;  3D4F A;  2OAQ 1;  1YQS A;  3CJM A;  1P97 A;  2ZQ7 A;  3RH8 B;  1FIL A;  1H3Q A;  1LSV A;  2VGL M;  3OC2 A;  3ICY A;  4S2N A;  3CAX A;  1VEU A;  3IBR A;  3QNC A;  4KG5 A;  3PBQ A;  3HUM A;  1K55 A;  3UB9 A;  1A0K A;  5EUA A;  5A93 A;  5KIZ A;  3GQZ A;  3IQA A;  4R70 A;  4C3Q A;  2R9X A;  5FQ9 A;  2ZC6 B;  1S1Z A;  3UDI A;  4MBH A;  5FQM A;  3LEZ A;  4QHC A;  1VET A;  1STZ A;  2KOI A;  3CHW P;  2QMI A;  3KX0 X;  3F1N B;  5DF8 A;  3VP0 A;  2EX9 A;  1XFN A;  4HIA A;  2ACG A;  4OP5 A;  2IA2 A;  5CTN A;  1TEM A;  4X55 A;  3PAG A;  4BD0 A;  4U0X A;  1P0Z A;  4ESP A;  3MZE A;  2WKI A;  1S66 L;  4Y17 A;  1PI5 A;  2QWS A;  3B42 A;  1JNU A;  4LRY C;  2VEA A;  2FZ0 A;  5DTT A;  4MN5 A;  3E98 A;  1GCE A;  3BFG A;  3ZG7 B;  1MWR A;  3IF6 C;  2QHK A;  1ZG6 A;  2V0W A;  3DW0 A;  3QP4 A;  4G3V A;  2YKF A;  3LO7 A;  3UNW A;  5F68 A;  2OSU A;  4JBF A;  2XR0 A;  5L09 A;  3UPO A;  3KYE A;  2DMW A;  3NOT C;  2VLG A;  1IYO A;  2JKG A;  4CJN A;  4EQ1 A;  5CHM A;  1GHP A;  5HZH A;  1ERM A;  1ESU A;  1ZKJ A;  3C4O A;  3TOI A;  2L1M A;  5TR7 A;  4MBF A;  1F9I A;  3W4Q A;  4E3K A;  3C5A A;  4N92 A;  3FZC A;  2CC1 A;  5TGF A;  5MC7 A;  2GNX A;  3UE0 A;  4Q0H A;  1O7E A;  3EGX C;  1MWS A;  1K57 A;  1X0O A;  5M1A A;  2CMN A;  3IS2 B;  4C75 A;  2JKR I;  5CRF A;  4HJ4 A;  5IHV A;  4MN6 A;  2EX6 A;  5F6A A;  1T19 A;  4OVD A;  4KUK A;  4PM9 A;  1MWU A;  1F5M A;  3UPN A;  3MFX A;  4P87 A;  2DRW A;  3OOV A;  1NY0 A;  2ZQC A;  4JGP A;  4QJG A;  3G34 A;  3I7J A;  3S4X A;  4GNU A;  4IBX A;  3PXP A;  3ZFZ A;  3FKV A;  1LL5 A;  3VFH A;  2HJE A;  5HWW A;  2B95 A;  5D3O A;  4ID4 A;  1KDW A;  4OP8 A;  3ZNY A;  2OLU A;  3KO6 A;  3NOP C;  4NET A;  4GJ4 A;  4HHD A;  1YAX A;  4XT2 B;  5CHJ A;  3FYZ A;  4GZB A;  4DDS A;  4B88 A;  1K56 A;  4RA7 A;  1W63 M;  2V1Z A;  2PRF A;  4KQQ A;  3O88 A;  5F69 A;  4UHU A;  1CI8 A;  1W63 Q;  1YM1 A;  1GSX A;  4Q0J A;  3NBL A;  3FWL A;  4OKP A;  3U4L P;  1FCO A;  1SHV A;  1G68 A;  4L9F A;  1YSP A;  5EOE A;  2MJ6 A;  3IX8 A;  3JVV A;  4GHI B;  1HD8 A;  5GHX A;  1ALQ A;  4ETX A;  2PD7 A;  1PRQ A;  4KQR A;  1GHM A;  1J9M A;  1HVB A;  3RTY A;  2EFX A;  3K3C A;  3WRT A;  1RCJ A;  5IU1 A;  1XFQ A;  3IHA A;  3PTE A;  2E8I A;  1G6O A;  3NDE A;  3VSL A;  2Y91 A;  3PBS A;  2Y2G A;  4WEJ A;  2DCF A;  2B18 A;  1PFL A;  5J4E A;  2YKH A;  1LI0 A;  3HLE A;  2G7U A;  1N9O A;  4F3L B;  3W4O A;  2ZMA A;  3TG9 A;  1MWT A;  2XRN A;  3EQV A;  1PW1 A;  4ZJ3 A;  3R7W B;  2Q9N A;  5AVE A;  1YSQ A;  4FSF A;  2EX2 A;  2IWB A;  4B9O A;  2O0Y A;  3ZG8 B;  4FH2 A;  1ODV A;  1Y28 A;  2QKP A;  4HES A;  3BFE A;  3NHQ A;  4QY6 A;  3A0S A;  4R3J A;  4WEK A;  5KSC A;  1M40 A;  3NOU C;  2IWD A;  3HUN A;  4WEL A;  4ME4 A;  3LGO A;  3F1P A;  5DKK A;  3EWK A;  1IYQ A;  4XUZ A;  1BSG A;  4XT2 A;  2ZMV A;  3E4Q A;  4DE3 A;  3ZVT A;  1O07 A;  2Y2J A;  3BJN A;  1E25 A;  3SS5 A;  4PKY G;  3T12 B;  3VP1 A;  3MJQ A;  5BOH A;  2Y2P A;  2Y55 A;  4EBL A;  2VZW A;  3QP1 A;  4HBU A;  4LV1 A;  3KSH A;  1NWZ A;  3S1Y A;  4GHI A;  1W5D A;  1VQQ A;  3NJA A;  3G30 A;  4ZBE A;  2NUT C;  4S2O A;  1DP9 A;  5EE8 A;  1YLW A;  3MQQ A;  4WM9 A;  1LSW A;  2A24 B;  3C8C A;  3Q7V B;  3EGD C;  3MQ0 A;  1OJG A;  4X1M A;  5CER A;  1J3W A;  1S4S A;  3DAV A;  3G2Z A;  4OOM A;  2Y8H A;  2WKP A;  5E2G A;  1IEL A;  4WMC D;  4KEN B;  3LIF A;  3LR4 A;  1FSY A;  3U2A A;  4K08 A;  3TJZ C;  4R1G A;  1OTD A;  3IXH A;  4R23 A;  1LL9 A;  4F3L A;  1FCM A;  5DFX A;  5GLD A;  1HZO A;  3QP2 A;  3LIC A;  3IBJ A;  4IJG A;  2VGL S;  4WZ5 C;  1D7E A;  5GLB A;  5DFY A;  1OTB A;  2W1R A;  1SKF A;  4L0L A;  5EVI B;  3DBA A;  3UB6 A;  4LV3 A;  4Y0O A;  3MZF A;  3HCY A;  3PAE A;  4XUX A;  2OOL A;  1PW8 A;  4P85 A;  4Y15 A;  2Y2M A;  3N6I A;  3BY9 A;  2HGV A;  5DF9 A;  2J8Y A;  2XH9 A;  5I94 A;  1NJ4 A;  1XJ3 A;  2XEP A;  5TFQ A;  1SDN A;  5CEB A;  2C5W B;  4KG6 A;  2Z2L B;  1FQG A;  5G4Z A;  2GX5 A;  5L2F A;  3MSH A;  2ZQA A;  3LR0 A;  2HP5 A;  4OPZ A;  3GV9 A;  3IF6 A;  1EI5 A;  1FOF A;  3NI9 A;  3GTC A;  3ZDJ A;  4CPK A;  1OJ5 A;  1E3U D;  1GSV A; 
#chains in the Genus database with same CATH homology
 1S1Z A;  1MC0 A;  5DJU A;  3FC7 A;  2V1A A;  1UGU A;  3H9W A;  4NXE A;  1VHM A;  1STZ A;  4YWZ A;  5FL3 A;  1N9N A;  4DJ3 A;  2KOI A;  3LR3 A;  4AFI A;  4ZRR A;  4CLC C;  3VV4 A;  4HY8 A;  3A0V A;  3KX0 X;  5LBR A;  3F1N B;  2PDR A;  2K31 A;  2XA7 S;  4HH2 A;  4EUV A;  4R3A A;  1XFN A;  2NUP C;  3FPW A;  4HIA A;  4JGR A;  3F1P B;  4PAU A;  3H7W B;  2Z6D A;  4I3I A;  3T4S A;  2IA2 A;  3E4O A;  5AVF A;  5HDD A;  4I3A A;  4O01 A;  1IFQ A;  1WA9 A;  4BBV A;  3LFV A;  1P0Z A;  2JHE A;  2KDK A;  3B47 A;  3CLO A;  3CWF A;  1S66 L;  3T4J A;  4JGQ A;  3KSI A;  3LI9 A;  2QWS A;  1OTI A;  3B42 A;  4L9G A;  1JNU A;  3H82 A;  3MMH A;  4LRY C;  5TBM A;  2VEA A;  2FZ0 A;  2ZOI A;  2L0W A;  4MN5 A;  3FPV A;  4ARZ A;  2EA9 A;  1T1B A;  3E98 A;  3R7W A;  4ETZ A;  1OTE A;  1ZHH B;  4UEY A;  2O9C A;  1DRM A;  4G3W A;  1OTA A;  1TS8 A;  1KOU A;  2QHK A;  2V0W A;  2K2N A;  4WF0 A;  3EEH A;  5K5B A;  4G3V A;  3JVU A;  2YKF A;  4GS9 B;  2V1B A;  4H6J B;  5F68 A;  1TF1 A;  4LRX C;  4HH3 A;  5G4Y A;  2QJ5 A;  2W1T B;  3CUE A;  3C38 A;  3EOI A;  1XJ4 A;  2DMW A;  1S1Y A;  4MN7 A;  3NOT C;  5HSQ A;  2L4R A;  2VLG A;  4WLA A;  1DP6 A;  3FG8 A;  5A8B A;  4EQ1 A;  5HZH A;  2FH5 A;  4Z1W A;  4L9E A;  2VV6 A;  4JGO A;  2J3T C;  1T1A A;  3SW1 A;  2L1M A;  4Y3I A;  1F9I A;  3VE3 A;  2Z6C A;  2K7S A;  5HPF A;  1V9Z A;  3HJI A;  3A0R A;  3HJK A;  4BWI A;  1S4R A;  5MC7 A;  2GNX A;  4EER A;  4CLC B;  3MF0 A;  4Q0H A;  2J80 A;  3EGX C;  4UQI S;  2VKS A;  4HJ6 A;  4RQ9 A;  2VV7 A;  2P7J A;  2M7U A;  1X0O A;  2W3G A;  2CMN A;  3PBN A;  3IS2 B;  2JKR I;  4HJ4 A;  2EWW A;  4KQO A;  1P9W A;  3MXQ A;  4MN6 A;  4HI4 A;  3TE8 A;  5F6A A;  1XJ2 A;  5L8M A;  1T19 A;  3UE3 A;  5IT5 A;  1EW0 A;  4KUK A;  2LB9 A;  4EU0 A;  1F5M A;  4CLC D;  3K2N A;  1V9Y A;  3MFX A;  5HWV A;  3OOV A;  2A24 A;  3E4P A;  1TS7 A;  3BW6 A;  4JGP A;  1IOU A;  4HNB A;  2JKR M;  3H7W A;  2ZMF A;  3S7N A;  3T4K A;  1UWN X;  3EQU A;  2W3E A;  5HDC A;  2W27 A;  3PXP A;  3ULF A;  3T4T A;  4PHT A;  4BBU A;  4NXG A;  3VOL A;  3S7O A;  3PBR A;  2HJE A;  2A2L A;  3BWL A;  4UQI M;  5HWW A;  5TJJ A;  4QPR A;  2QYB A;  3R4K A;  4FOF A;  3UB8 A;  3KO6 A;  3NOP C;  1N9L A;  2R78 A;  3EEA A;  4GJ4 A;  2P04 A;  2PYP A;  4HHD A;  1YAX A;  2OWJ A;  2PYR A;  2JKT I;  4XT2 B;  1MKM A;  5HL6 A;  4EET B;  2O99 A;  4NEE D;  1TD5 A;  2XSS A;  3S7P A;  1W63 M;  4O0P A;  1UWP X;  2O9B A;  3S7Q A;  5F69 A;  3CI6 A;  1W63 Q;  4I5S A;  2HV1 A;  1GSX A;  4Q0J A;  2W3D A;  4EEU A;  4HJ3 A;  4H6J A;  3E0Y A;  4Q0I A;  5HDS A;  2JKT M;  4L9F A;  2W1T A;  1YSP A;  2PR5 A;  1F98 A;  4IHQ A;  2WKQ A;  2MJ6 A;  3JVV A;  3PBT A;  2ZOH A;  4GHI B;  2W3F A;  2XA7 M;  3T4O A;  4O8G A;  4ETX A;  2HF6 A;  1MZU A;  2PD7 A;  5HD5 A;  4LLO B;  4DMZ A;  2PD8 A;  2GZA A;  4DJ2 A;  4I3J A;  1ZTU A;  3RTY A;  3K3C A;  2VV8 A;  1GSW A;  3B33 A;  4Y5F A;  5IU1 A;  1XFQ A;  2PR6 A;  2V9A A;  2J3T D;  2ZBB A;  1DP8 A;  1TS0 A;  3P01 A;  1G6O A;  3GDI A;  3PBS A;  2LB5 A;  4WEJ A;  4CLC A;  2D01 A;  2B18 A;  5J4E A;  2YKH A;  4LRZ E;  1H8M A;  3PBO A;  2VJW A;  2G7U A;  4OOL A;  1N9O A;  3H82 B;  3KYZ A;  4F3L B;  5TBM B;  4GCZ A;  4HOI A;  2OWH A;  3LYX A;  2XRN A;  4YNR A;  4EXO A;  3EQV A;  3OBF A;  4NXF A;  4ARZ B;  2VA0 A;  3R7W B;  1NLY A;  5AVE A;  1YSQ A;  4FSF A;  2H28 A;  2W3H A;  4R6L A;  2D02 A;  1LL8 A;  3O5Y A;  4B9O A;  2O0Y A;  4WN5 A;  3BQA A;  4II7 A;  3T4Q A;  3LIA A;  3OCN A;  1VB6 A;  3F1O B;  1ODV A;  3LID A;  1D06 A;  1NRJ A;  1Y28 A;  4G3K A;  5DKL A;  2QKP A;  4Y2F A;  3UME A;  4BBT A;  2J3W A;  3PHY A;  3NHQ A;  2B02 A;  2GJ3 A;  4HQA A;  2QJ7 A;  3A0S A;  2W0N A;  3F1N A;  4WEK A;  1OT6 A;  3BY8 A;  3KSG A;  3NOU C;  2VX8 A;  4WEL A;  1T1C A;  4I38 A;  4ME4 A;  5J3W A;  3V67 A;  4EW7 A;  2EWV A;  1T18 A;  4KQD A;  3F1P A;  5DKK A;  3EWK A;  4MCW A;  3C2W A;  4XT2 A;  2ZMV A;  3E4Q A;  4NXB A;  4HP9 A;  2KLI A;  2KX6 A;  4GLQ A;  3UB7 A;  5HPI A;  4MDZ A;  3BJN A;  3BQ8 A;  3PR6 A;  2PT7 A;  3D72 A;  4PKY G;  2INW A;  4I39 A;  3CUE C;  3CIT A;  1S67 L;  3MJQ A;  3ZYT A;  4IUH A;  4CQH A;  3LI8 A;  3VE4 A;  4WUJ A;  1TS6 A;  5DJT A;  2P08 A;  4LPZ A;  2VZW A;  4P6Z S;  3KSH A;  1NWZ A;  2WKR A;  3P7N A;  2OAP 1;  4BJP A;  4GHI A;  3NJA A;  3C30 A;  2NUT C;  4GW9 A;  1BYW A;  1DP9 A;  4M4X A;  3LR5 A;  3MQQ A;  5AJG A;  4EES A;  1LSW A;  3KSF A;  2A24 B;  3RFB A;  3C8C A;  2I9V A;  3EGD C;  5HD3 A;  4GS9 A;  3MQ0 A;  1OJG A;  4R38 A;  1S4S A;  4HP4 A;  5KSH A;  4OOM A;  2Y8H A;  2M1C A;  2WKP A;  3TW8 A;  1P9R A;  3T50 A;  5C5K A;  3D3O A;  3KYQ A;  3UE6 A;  3LIF A;  3K3D A;  4YOF A;  3LR4 A;  3U2A A;  4CLC E;  4K08 A;  3TJZ C;  1OTD A;  1OPX A;  4F3L A;  5DFX A;  3GEC A;  5J7E A;  4P6Z M;  1LSX A;  2Y79 A;  3LIC A;  3IBJ A;  1YKD A;  4BMW A;  4IJG A;  1OT9 A;  2VGL S;  2V0U A;  1D7E A;  4DN0 A;  3MQO A;  1NLZ A;  1XJ6 A;  1OTB A;  5DFY A;  3T4L A;  2W1R A;  4L0L A;  3DBA A;  3PYP A;  5F5Y A;  3UB6 A;  3UMD A;  3F1O A;  5IS1 A;  3IS2 A;  4EEP A;  5EFW A;  5CX7 A;  3HCY A;  2OOL A;  1G28 A;  1LT0 A;  3BY9 A;  2HGV A;  3LUQ A;  3OLO A;  4PKY A;  5I5L A;  2PHY A;  5DF9 A;  3LIE A;  4MMN A;  2OAQ 1;  4B93 A;  4IUK A;  1XJ3 A;  1P97 A;  3MR0 A;  3W2Z A;  3RH8 B;  3OC2 A;  1LSV A;  1H3Q A;  2VGL M;  3OCL A;  3ICY A;  2JN7 A;  3ZQ5 A;  3CAX A;  5G4Z A;  2GX5 A;  3G6O A;  2M7V A;  3IBR A;  4WL9 A;  3LIB A;  3LR0 A;  3PBQ A;  2BAS A;  2XRO A;  3UB9 A;  2O9A A;  5KIZ A;  4KUO A;  3TRC A;  4NKP A;  4R70 A;  5HWT A;  1OJ5 A;  4E04 A;  2HJ9 C;  1GSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...