4BQMA

Crystal structure of human liver-type glutaminase, catalytic domain
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
318
structure length
296
Chain Sequence
LYFQSMIPDFEEFTGHVDRIFEDVKELPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHKFVGKEPSLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAGNEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGAILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMINASE LIVER ISOFORM, MITOCHONDRIAL
publication title Crystal Structure of Human Liver-Type Glutaminase, Catalytic Domain
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 104
structure length 296
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04960 Glutaminase Glutaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4bqmA00
5HAQA 5FQKA 1PI4A 1BSGA 5CHJA 5GHZA 4C75A 3ZDJA 1HVBA 1YLWA 4OPQA 1LL5A 5DVAA 4NK3A 5HW3A 1IYOA 5CHMA 5EVIC 2EX6A 1EWZA 3SS3A 3TSGA 4HBTA 5FI6A 4U0XA 3RJUA 2HDQA 4BQMA 3MBZA 4E3JA 4IEDA 3IXDA 3RXWA 1LI0A 1NJ4A 2HDSA 2WUQA 3N7WA 3PBRA 3ITBA 3Q81A 4OOMA 1C3BA 4EWFA 4WEKA 1ALQA 2HDUA 3PBTA 4GZBA 1Q2QA 3UO9A 3W4QA 3VMAA 2X02A 1LHYA 2WKHA 1G68A 4KZ4A 5CTMA 2WKEA 3S22A 2JBFA 3NI9A 3WRTA 3G31A 1MWUA 3G4PA 4GB7A 2IWBA 4N1HA 4NETA 3HUOA 1K6RA 1WYCA 2BLSA 4WZ5A 3V5MA 3OPPA 3DWKA 4R3JA 4ZBEA 5G18A 1MBLA 3VFHA 1W7FA 4FH2A 5EVID 3VP2A 3PBSA 2QZ6A 2Y2QA 1BLHA 4OQIA 4OLGA 5EE8A 3Q07A 5AQ9A 3E2KA 5HX9A 5I94A 4OVDA 4KZ9A 2P9VA 3BRMA 3MZEA 4WMCD 3HBRA 1FR1A 2A49A 4QY5A 4WZ5C 3PBOA 4YFMA 2OV5A 2XD5A 1KGGA 3TG9A 4OLDA 4X56A 2ZC7A 2WZXA 1PI5A 4E3OA 1ESUA 4PM6A 5A91A 1MWSA 1NYYA 2PU4A 4JXWA 3M2KA 4P0MA 1L0DA 4S2NA 2HP9A 4EBPA 2XK1A 1JVJA 3SS4A 4B4ZA 5DTTA 1XKZA 3ZFZA 3JYIA 3N8LA 4K0WA 1CEFA 4JF5A 2ZMAA 4KQRA 3CJMA 4OH0A 4FCFA 1PIOA 2FFFB 2BG1A 2I72A 4KZ6A 4EBNA 1FR6A 1HD8A 2WGWA 2XLNA 1H5XA 4GDNA 2CC1A 4DE1A 3ZNTA 5A92A 3NIAA 1QMFA 1K54A 5JYPA 3C4PA 1G6AA 2HPBA 2DRWA 4K91A 1YMXA 4UA9A 1E3UA 2Q9MA 1GHMA 5CTNA 4PM8A 2OSUA 4LCMA 1GA9A 1LL9A 2WYXA 3I7JA 1PWDA 5GLDA 4E3KA 1SKFA 1K55A 3IXHA 4WEJA 1K54C 5U47A 2Y2OA 5FQ9A 3GRJA 4X6TA 3UDFA 3OCNA 2IWCA 2J9OA 4KZ5A 5CEDA 1E25A 1BULA 3OCLA 4M3KA 5D3OA 3PBQA 2Y2GA 3GQZA 1K55C 4L0LA 1W5DA 3C7VA 3HLEA 1IYSA 3ZVTA 3EQVA 1JWVA 1PZOA 3IHBA 3LO7A 2Y2IA 4C3QA 5DTSA 4DRTA 1FSWA 3NY4A 3OPRA 3MZDA 4JF6A 5GLBA 3CG5A 5FAOA 1KGFA 3HLBA 2Z2MB 1PW8A 2EX9A 2WKIA 3VOYA 2Q9NA 3MXRA 4IBRA 2OLUA 4N9LA 3BLMA 3A3FA 1EI5A 2H10A 3P98A 1Y54A 1RGZA 1FCNA 2X01A 4DE2A 2VGKA 4QJGA 3UNWA 4Y0TA 1NZUA 2V20A 5EECA 2ZM0A 4IVKA 3UY6A 2JC7A 2H5SA 3G30A 2XH9A 3LY4A 4RA7A 2ZLYA 3UN7A 3PTEA 2XR0A 3M6HA 1HTZA 4FD8A 3SS5A 2HP5A 2P9VB 3EQUA 5FDHA 5M18A 1CI9A 1EROA 3IH9A 1DY6A 1PWGA 3A3EA 4MBFA 4S2PA 5GLAA 5EVIA 5FASA 3Q1FA 4OPRA 5GHYA 1W8QA 1KE4A 1LI9A 1K57A 2WK0A 4KZ3A 1E4DA 5DTKA 1YLTA 4KENB 4WMCA 2XEPA 4OOYA 3SH9A 5AQAA 1HZOA 3DW0A 2JE5A 4DXCA 3QNBA 2ZQAA 3ZG9B 4OQGA 3ISGA 2ZD8A 2IWDA 3VFFA 4MBHA 1K57C 1ZG6A 1XXMA 1GCEA 2Z2LB 3A3IA 4P87A 4A5RA 1DJAA 2ZQ8A 1TDGA 3IF6A 2WGWB 2XFTA 4BL2A 1W79A 1YQSA 2DCFA 3BFDA 3VP0A 3S4XA 4DDSA 4Z9QA 4EUZA 3FZCA 2H0YA 4KZBA 2R9XA 3ZG0A 4IVIA 4DF6A 1KVMA 1MKIA 4B88A 5KZHA 1CK3A 2Y2LA 1YT4A 1ZC2A 5CXWA 3HLGA 5CECA 3WS2A 3IF6C 3QHYA 5EPHA 3ZGAB 2G2UA 4BD1A 3IWIA 3MFDA 4D2OA 5FATA 1OMEA 1XP4A 1NZOA 1Z6FA 1ES2A 1BLPA 1GHIA 1GA0A 5DF9A 4GKUA 2C6WB 4JXGA 4QD4A 1IYQA 5CGSA 2QPNA 2VGJA 1XPBA 1I2SA 2XFSA 1Q2PA 3Q7VA 4R4RA 1NRFA 2G2WA 3BFEA 1MXOA 3E2LA 4OP5A 3O3VA 1S0WA 2HDRA 4PPRA 4OPYA 1M6KA 2E8IA 1KVLA 3UE1A 2WAEA 3WRZA 1K4EA 3NBLA 3DTMA 3G34A 1BT5A 4GOGA 1MWTA 1TEMA 4EV4A 2EX2A 3BM6A 2V1ZA 3W4PA 3IXGA 4GD8A 3HLWA 3UDIA 3UPNA 4BJPA 4MBKA 3FKWA 3UDXA 1K6SA 5KSHA 1L2SA 3NC8A 5GLCA 2Y2HA 4RX3A 3RXXA 3SOIA 3UE3A 4E3LA 3VOZA 1KDWA 4OP8A 4QU3A 5KSCA 5E2EA 1PYYA 3BLSA 3N4IA 2JCHA 3A3DA 5A93A 2EXAA 5FI2A 3W4OA 4ZJ1A 4KG2A 3GV9A 4DDYA 1L0GA 5EVIB 5GL9A 1KE0A 3Q82A 4KZAA 1JWPA 2ZC3B 1FCOA 5CRFA 2ZC5B 1ZKJA 4N9KA 3C4OA 2ZQ9A 4KQQA 4MEZA 3BYDA 1PZPA 1ERQA 3BEBA 3TOIA 3UPPA 3ZHHA 2WGVA 4PM7A 3G2YA 4DE0A 3IHAA 1NY0A 4UA6A 1YMSA 4OOLA 4H8RA 3ZNYA 2A3UA 4BL3A 4F94A 2RCXA 1L0FA 1YLZA 3HREA 4X53A 2ZQDA 1YLPA 1DJBA 1K25A 4Y0UA 1CI8A 2Y2KA 1SHVA 2WAFA 1L0EA 1M40A 4Y0OA 5FQQA 1O7EA 3Q7ZA 3V39A 3IF6B 4R1GA 2R9WA 1IKIA 2ZM8A 4Q8IA 4JKTA 3SH8A 3BFGA 4E3IA 4EQIA 3BFCA 3WS0A 1IKGA 4S2IA 2Y2NA 2WZZA 3BFFA 5HAIA 2Y55A 3VP1A 2ZM2A 4KZ7A 3G35A 5F82A 4XUZA 4LENA 3MKEA 2FFYA 5E2HA 4ZJ3A 5FA7A 5E2FA 3GSGA 3MXSA 3MKFA 4OONA 3HLCA 1WYBA 3GR2A 1RGYA 4PM9A 3VSLA 3V3SA 5FQJA 4EBLA 4IBXA 1N4OA 5F1GA 3M6BA 3OZHA 3FYZA 5TFQA 3C7UA 3G32A 3Q7VB 4MLLA 5FQIA 1ERMA 4GDBA 3UPOA 1SCWA 3IQAA 1AXBA 5TGFA 4KG6A 4BLMA 3AGEA 4P85A 1YM1A 3AGDA 3FWLA 4X55A 4ID4A 2PU2A 1K38A 4HBUA 4N92A 1BZAA 1K56D 3W8KA 4WELA 1JTGA 1NXYA 5FQMA 2X71A 1ES5A 1XGJA 2RL3A 2EFUA 3LEZA 1U60A 4OQHA 3HLFA 4MNRA 5FAPA 3HL9A 5BOHA 2Y4AA 1I2WA 3S1YA 3DWZA 5M1AA 5E43A 4OPZA 1TVFA 4O7DA 3VP4A 3NCKA 4S2LA 1YLJA 1H8ZA 3FKVA 1MWRA 1ES4A 1DJCA 1MY8A 4LCLA 4GNUA 4QB8A 1J9MA 1IYPA 3IWQA 5AQ7A 4R3BA 5J8XA 4UA7A 5L2FA 2ZJ9A 1IEMA 4R4SA 1XA1A 3WS4A 3GMWA 2V2FF 4GN2A 4S2KA 3P09A 3V50A 3SH7A 4KG5A 4S2JA 5TR7A 2XD1A 4PMAA 3MZFA 1KE3A 2XQZA 3PAEA 4BD0A 3WS5A 2EX8A 4S2OA 5AQBA 4N1XA 1XX2A 1W8YA 4RX2A 5CGXA 2OLVA 3ZCZA 4DKIA 5EVLA 1FCMA 3WS1A 4ZDXA 3M2JA 2ZC4B 4HESA 4PM5A 5CHUA 1KDSA 1RCJA 3PAGA 4Y7PA 4XXRA 1K4FA 2ZQ7A 2B5RA 4XUXA 1FQGA 4C6YA 4E3MA 5GHXA 2ZC6B 1NYMA 5DF7A 4UHUA 1SDNA 2ZQCA 2EFXA 4JF4A 5CEBA 1RP5A 3VP3A 1FOFA 3N8SA 4UAAA 5EOEA 5A90A 1BUEA 1FSYA 1H8YA 1JWZA 3O88A 3D4FA 4U0TA 5F83A 3IXBA 4ZAMA 3HVFA 1BLSA 5HL1A 3WWXA 3IH8A 1CEGA 3C5AA 4YINA 3G2ZA 4ZJ2A 5JYOA 3ITAA 3NDGA 4QHCA 2XDMA 3O86A 4DE3A 3QNCA 5F1FA 1XGIA 3FV7A 2Y2PA 4DXBA 1ES3A 4KQOA 3ZG5A 2Y2JA 3A3JA 3N8RA 4S2NC 1ESIA 5EOOA 1BLCA 3ZG7B 1GHPA 1VM1A 2WGIA 1O07A 3B3XA 2XF3A 4R0QA 5HARA 3ZG8B 3IT9A 4U3TA 3HUMA 3ZVWA 1QMEA 4HEFA 3GTCA 3HLDA 4JBFA 3CZDA 4WYYA 4BENA 4JPMA 3LY3A 4QY6A 1K56A 1ONGA 1ONHA 2J8YA 5E2GA 4LV2A 5CGWA 4B4XA 3GVBA 4OQ0A 5FSRA 2P74A 2Y59A 4JXSA 1ZG4A 1SDEA 4P6BA 1PW1A 3OPHA 4X68A 5HAPA 2XGNA 3CMZA 1S6RA 2PBYA 2Y91A 1LLBA 4GD6A 1N9BA 1KGEA 4WM9A 5FI7A 2Y2MA 4JXVA 4S2MA 4E3NA 3OPLA 1TDLA 2J9PA 3VSKA 1I5QA 3AGFA 4E6XA 4K0XA 4RYEA 4WZ4A 4FSFA 1BTLA 2H0TA 4LV1A 4CPKA 3V3RA 2UWXA 4LV3A 4RVAA 2GDNA 5M19A 1MPLA 4LV0A 5EUAA 1XA7A 4ZTKA 3BECA 3NDEA 2J7VA 4FH4A 4WBGA 4KZ8A 2EXBA 3IF5A 3PBNA 4JLFA 4X69A 4CJNA 1JTDA 1E3UD 5DF8A 5FAQA 5HFOA 2C5WB 2DNSA 1IELA 4OKPA 2HP6A 3N6IA 1VQQA 2QMIA 1PWCA 5IHVA 2WADA 3OC2A 1YLYA 5CERA 1WE4A 3HUNA 3IWOA 4R23A 5KMWA 3UE0A 3O87A 4E6WA 3LCEA
chains in the Genus database with same CATH superfamily
2HJEA 2V0WA 5GHZA 5CHJA 1YLWA 4EESA 2O0YA 5DVAA 4NK3A 5CHMA 5EVIC 4EQ1A 3SS3A 4HBTA 3RJUA 2HDQA 3KO6A 4IEDA 5J3WA 4JGPA 1C3BA 2O9AA 4DN0A 1T1CA 2X02A 5L8MA 1LHYA 2Z6DA 4KZ4A 3NI9A 3G4PA 2E8JA 4N1HA 4WUJA 1D1JA 3CLOA 1VETB 2BLSA 4WZ5A 1MBLA 5IU1A 3VFHA 3VP2A 2VK3A 5EVID 5EE8A 1BLHA 3Q07A 5I94A 4LRXC 4NG2A 1FR1A 5HZHA 4L9GA 3PBOA 4OLDA 2ZC7A 1PI5A 4E3OA 1ESUA 2W3HA 2PU4A 4JXWA 3M2KA 4S2NA 1L0DA 2HP9A 2YKFA 4B93A 3SS4A 1CEFA 4JF5A 1T18A 2I72A 1GSWA 2JN7A 1FR6A 1H5XA 4NEED 3ZNTA 3T4SA 3NIAA 1QMFA 1K54A 5JYPA 1G6AA 2HPBA 1E3UA 1NWZA 4PM8A 4LCMA 1GA9A 1LL9A 5GLDA 1K55A 4HH2A 3IXHA 4WEJA 5U47A 5A8BA 2IWCA 3C38A 3DAVA 4M3KA 3ICYA 3D3OA 3MXQA 3ZVTA 3EQVA 4DMZA 2Y2IA 2JKGA 2LB9A 1FSWA 4JF6A 3MZDA 5F69A 2HF6A 1KGFA 3HLBA 2OLUA 2H10A 1RGZA 3QP4A 4DE2A 4Y3IA 2VGKA 3UNWA 1NZUA 4IVKA 2JC7A 1F5MA 2L0WA 3PTEA 3M6HA 3HJKA 3SS5A 2HP5A 2P9VB 3EQUA 2HGVA 3PXPA 4OPRA 4WLAA 1W8QA 4LLOB 4KENB 4WMCA 3T1SA 2PT7A 2JE5A 3UMDA 3QNBA 2ZQAA 4DXCA 3NHQA 2ZD8A 1XXMA 4Y15A 3VE3A 3A3IA 4CQHA 4H6JB 1DJAA 2ZQ8A 4O8GA 2KDKA 3QP2A 1YQSA 2B95A 2V9AA 3BFDA 3VP0A 4I3JA 4ESPA 1OTDA 2H0YA 1KVMA 1CK3A 1ZC2A 4Y13A 3IF6C 3QHYA 2BASA 4Y5FA 5TJJA 5FATA 4BBVA 1OMEA 1XP4A 3O5YA 1Z6FA 2KLIA 1BLPA 1GA0A 4JXGA 5G4YA 3TW8A 1Q2PA 3OLOA 1NRFA 4X25A 3BFEA 3E2LA 1G5UA 2HDRA 4PPRA 2E8IA 3UE1A 4UEYA 3NBLA 1BT5A 1TEMA 3F1OA 3W4PA 4EXOA 5AVFA 3TRCA 2J3TD 3UB8A 4MBKA 5KSHA 3NC8A 3UE3A 4E3LA 1KDWA 5KSCA 5E2EA 3T4KA 3A0SA 5A93A 2EXAA 3W4OA 1JWPA 3LIEA 5CRFA 1FCOA 2ZQ9A 3BEBA 3ZHHA 3IHAA 4GLQA 4OOLA 2A3UA 3MJQA 2ZQDA 1SHVA 3B42A 1M40A 3IF6B 1MC0A 4G3VA 4YWZA 3OBFA 2VEAA 1G28A 2Y2NA 2WZZA 4M4XA 5HAIA 3S7QA 4Q0HA 4II7A 4ARZA 2GJ3A 5HD5A 3MKFA 1WYBA 1RGYA 4R6LA 1F2KA 4JGQA 1XJ4A 4ETXA 4UQIM 5TGFA 4KG6A 1YM1A 5HD3A 3RH8B 3FWLA 4LRZE 2X71A 2EFUA 4RQ9A 2D01A 2OWHA 5HL6A 4MNRA 5FAPA 3UB7A 2M7UA 5L07A 1OT9A 5M1AA 5E43A 3VP4A 3NCKA 4LRYC 3T4OA 4FOFA 1W63M 4PKYG 1TS6A 4ZRRA 5L2FA 3SZTA 2ZJ9A 1IEMA 4R4SA 3TJZC 3IX3A 3GMWA 4GN2A 4L9FA 4KG5A 3E0YA 5TR7A 4Q0JA 3DTKA 2ACGA 2EX8A 1W8YA 5L09A 4DKIA 4EUVA 1KDSA 1RCJA 3PAGA 1K4FA 1OTIA 4C6YA 2FH5A 2ZC6B 4JF4A 3LIDA 4Y17A 1OTBA 4U0TA 4ZAMA 2XSSA 5HL1A 3WWXA 3IH8A 4YINA 3G2ZA 4ZJ2A 3ITAA 3LR5A 4NXBA 4H6JA 3DBAA 4S2NC 5F6AA 4F3LA 1GHPA 1O07A 4LGWA 1TS8A 3HUMA 1P9RA 2JKTI 1YAXA 3BY8A 2P74A 1SDEA 1PW1A 4X68A 2PYPA 1N9LA 1N9BA 4HH3A 5FI7A 4KQDA 1VB6A 4I3IA 4S2MA 3OPLA 2ZOIA 2VLGA 4WF0A 2VA0A 2WKQA 3MSHA 4LV3A 4UQIS 1XA7A 4WBGA 4X69A 4CJNA 1E3UD 3U4LP 2DNSA 1S1ZA 4BBTA 3N6IA 3F1PB 1YLYA 3DTEA 4MN7A 5KMWA 2W1TA 5HAQA 5FQKA 1HLUP 3LYXA 1BSGA 4OPQA 1LL5A 1UGUA 4U0XA 4BQMA 4E3JA 2K2NA 1NJ4A 1S4RA 4G3WA 4OOMA 4WEKA 3UO9A 3VMAA 5CTMA 2WKEA 2P08A 4R70A 3L9KA 2V8CA 4HHDA 3OPPA 3DWKA 4ZBEA 5G18A 2JKRI 3E2KA 5F5YA 4OVDA 1Z09A 3QP5A 4I3AA 5MC7A 4WMCD 2OAQ1 3F1NA 2A49A 5J7EA 2OV5A 3KX0X 3C30A 1KGGA 3TG9A 4X56A 3IBRA 5A91A 1MWSA 4EBPA 2XK1A 4B4ZA 5DTTA 1XKZA 3ZFZA 4K0WA 4FCFA 1PIOA 5FEGA 2BG1A 1PRQA 1LSWA 2XLNA 4GDNA 3T1XA 1FILA 3MS6A 5A92A 4EU0A 2JKRM 4UA9A 2Q9MA 1V9ZA 2OSUA 2WYXA 3I7JA 1PWDA 2L1MA 2Z6CA 4HQAA 2Y2OA 5FQ9A 2QWSA 4CLCC 2V1AA 2VX8A 4KZ5A 5CEDA 3IS2A 1E25A 2B18A 3PBQA 2Y2GA 3LIAA 3GQZA 1YKDA 3A0VA 3IHBA 3KYEA 2ZMVA 5GLBA 3CG5A 2ZL1B 5FAOA 1XJ2A 2K7SA 2EX9A 2WKIA 1LSVA 2Q9NA 3MXRA 4IBRA 3LGOA 3A3FA 1Y54A 1FCNA 2X01A 1CQAA 2V20A 5EECA 1MZUA 5KIZA 4MMNA 4R38A 3MQ0A 3UN7A 3H7WB 5G4ZA 3H82A 5FDHA 5HDCA 3P7NA 5GLAA 5HPIA 1E4DA 2DMWA 2LB5A 2XEPA 4AFIA 4OOYA 5AQAA 4OQGA 3ISGA 2IWDA 1K57C 1GCEA 1TDGA 1XFNA 2WGWB 2D02A 2XFTA 4BL2A 5L10A 2DCFA 3BJNA 4Z9QA 2VGLM 4DF6A 3ZG0A 2PAVP 4CLCB 1YT4A 4PKYA 3HLGA 3WS2A 4XT2B 3MFDA 4D2OA 2GNXA 2W1RA 2EWWA 2I9VA 5CGSA 2QPNA 1XPBA 3S7NA 3Q7VA 1VEUA 4R4RA 4MN6A 4GS9B 3HJIA 3O3VA 1S0WA 4B9OA 3UMEA 4IHQA 1K4EA 4HNBA 4EV4A 2EX2A 2V1BA 1PFLA 3FKWA 4OP8A 4QU3A 2HV1A 1P0ZA 1PYYA 3N4IA 3A3DA 3CAXA 5FI2A 3K3DA 5EVIB 4GHIA 4CLCE 2ZC3B 2ZC5B 3BYDA 2VV7A 3CPTB 1JNUA 3TOIA 1NY0A 1YMSA 3ZNYA 4H8RA 3RFBA 4BL3A 2RCXA 1YLZA 1XJ6A 3HREA 4X53A 1YLPA 1K25A 3P01A 2Y2KA 2ZOHA 1L0EA 4YNRA 3KSFA 5DJUA 3GDIA 2ZM8A 4JKTA 3BFGA 2PD7A 3VP1A 2AVXA 2QKPA 2ZM2A 3G35A 4KZ7A 4XUZA 3MKEA 2FFYA 4ZJ3A 3BW6A 5LBRA 4OONA 4PAUA 5DKLA 2BTFP 4PM9A 3VSLA 5FQJA 4ME4A 3MR0A 1N4OA 5F1GA 3M6BA 3OOVA 3UPOA 3G32A 3MF0A 3KYZA 4GJ4A 4DJ2A 3IQAA 1AXBA 1W63Q 2W0NA 4I5SA 1K38A 1BZAA 4O0PA 2M7VA 1NXYA 2RL3A 3HLFA 4GW9A 5HPFA 1OTAA 3R4KA 2OOLA 2VGLS 2M1CA 1TVFA 4HOIA 3FKVA 1MWRA 1DJCA 1MY8A 1SZVA 3BWLA 4QB8A 1IYPA 3R7WA 2J3TC 4UA7A 4X1LA 2ZL1A 4R3AA 3WS4A 1V9YA 4S2KA 3P09A 3V50A 3SH7A 2XD1A 4PMAA 3MZFA 1KE3A 3WS5A 4RX2A 2OLVA 4LFUA 5EVLA 1FCMA 4ZDXA 2ZC4B 4HESA 5J4EA 4JGOA 1UWNX 4XUXA 1NYMA 3PR6A 5DF7A 4UHUA 2QHKA 2EFXA 3VP3A 5EOEA 3N8SA 4UAAA 1SKOB 2P7JA 1T1AA 3HVFA 3LI8A 2A24B 1BLSA 5I5LA 4NXFA 3RTYA 3C5AA 1K0KA 2O99A 4QHCA 2XDMA 3O86A 4DE3A 1XGIA 4DXBA 3LIBA 3A3JA 3N8RA 3ZG7B 1H0MA 1VM1A 2WGIA 3B3XA 2XF3A 5HWTA 2PR5A 1VETA 3TE8A 1CF0A 4MDZA 5AJGA 4XT2A 4JBFA 1GSVA 4WYYA 4JPMA 3UB5P 4QY6A 3LI9A 3VV4A 2J8YA 4LV2A 5CGWA 4D60A 2HJ9C 2VZWA 1DP6A 2XGNA 3CMZA 1S6RA 4L9EA 2Y91A 1LLBA 1YSPA 5EFWA 1TDLA 2J9PA 4FSFA 3U2AA 4RVAA 5M19A 1MPLA 3E4OA 4ZTKA 2J7VA 2EXBA 3IF5A 4JLFA 5FAQA 5HFOA 1IELA 2QMIA 3MMHA 3HUNA 1TF1A 4E6WA 3NULA 1PI4A 3CHWP 3B33A 3IX4A 4C75A 3BQAA 3ZDJA 1HVBA 2CMNA 5HW3A 1EWZA 3TSGA 4MN5A 5FI6A 3MBZA 3BQ8A 4DJ3A 3IXDA 3RXWA 1LI0A 2HDSA 3Q81A 3ITBA 1ALQA 4NXEA 2HDUA 3W4QA 2WKHA 1G68A 1F98A 3S22A 2JBFA 2J3WA 3G31A 3LR3A 2W27A 4NETA 1WA9A 4HJ3A 1S66L 4R3JA 1IOUA 1W7FA 4FH2A 3PBSA 2QZ6A 2Y2QA 4I39A 4KZ9A 2P9VA 1H3QA 3MZEA 3HCYA 4QY5A 4WZ5C 4YFMA 2XD5A 1XJ3A 1D7EA 3QP8A 3C8CA 1NYYA 2W3GA 4KUKA 1N9NA 2ZMAA 3CJMA 4KQRA 2B02A 5TBMB 2FFFB 4KZ6A 1HD8A 4P6ZM 2CC1A 4DE1A 2K31A 1BYWA 3C4PA 1YMXA 3T12B 4HJ4A 4E3KA 4BMWA 2A2LA 1K54C 3JPUA 4IUKA 4X6TA 3UDFA 3OCNA 3LFVA 3OCLA 5D3OA 1K55C 1W5DA 3C7VA 1IYSA 1MKMA 4IJGA 1KOUA 5DTSA 4DRTA 3T4LA 3NY4A 3ULFA 3VOYA 2H28A 1PNEA 3E98A 3BLMA 4I38A 3P98A 3A0RA 4QJGA 4Y0TA 3UY6A 3W2ZA 2H5SA 3G30A 3LY4A 4MCWA 2ZLYA 2VV6A 1VHMA 4FD8A 5M18A 1EROA 3IH9A 1PWGA 3A3EA 4S2PA 5FASA 1KE4A 3NECA 1LI9A 4K08A 2WK0A 4KZ3A 5DTKA 2UV0E 2VV8A 4IUHA 3SH9A 3ZG9B 2PR6A 3VFFA 1T19A 1ZG6A 1H8MA 3IF6A 1W79A 3S4XA 1LL8A 2NUPC 4IVIA 5KZHA 2Y2LA 5CXWA 5CECA 3KSGA 3ZGAB 2G2UA 1UWPX 1GHIA 3FC7A 5DF9A 1NLYA 4GKUA 4QD4A 3G6OA 2FZ0A 1I2SA 2XFSA 2XA7M 2G2WA 1DP8A 4OPYA 3KSIA 1KVLA 2WAEA 4WL9A 3LICA 3DTMA 3G34A 4GOGA 1MWTA 2INWA 3BM6A 4GD8A 2VKSA 4P6ZS 1S67L 5DKKA 1STZA 1K6SA 4Z1WA 3VOZA 4LPZA 3EWKA 4DDYA 1L0GA 2XROA 1KE0A 3Q82A 3LR4A 5FQQA 4N9KA 3C4OA 4KQQA 1ERQA 3G2YA 4DE0A 4UA6A 1L0FA 4Y0UA 1CI8A 4Y0OA 3V39A 1O7EA 4R1GA 3KYQA 2R9WA 1IKIA 4Q8IA 4EQIA 3WS0A 1IKGA 4S2IA 3EGXC 3BFFA 2Y55A 1G6OA 5F82A 4LENA 3FG8A 5E2HA 2YKHA 2PRFA 3GSGA 3KSHA 3T4TA 3T4JA 3V3SA 3JVUA 1LT0A 3EOIA 3C7UA 4MLLA 5FQIA 1FIKA 4BLMA 3AGEA 2IA2A 3AGDA 4ID4A 2PU2A 4WELA 1XGJA 3F1OB 3CITA 3LEZA 3EGDC 3HL9A 5BOHA 1I2WA 1J3WA 3DWZA 4S2LA 1YLJA 4LCLA 5AQ7A 2V2FF 2XA7S 1P97A 3PAEA 4BD0A 4NKPA 5HSQA 4S2OA 5AQBA 4N1XA 2O9BA 5CGXA 1ACFA 5C5KA 3ZCZA 3M2JA 4PM5A 5CHUA 4XXRA 2ZQ7A 3SW1A 3F1PA 1FQGA 5GHXA 1SDNA 2ZQCA 3CI6A 3T1RA 5A90A 1BUEA 1FSYA 3O88A 3D4FA 5F83A 5HDSA 4ARZB 3D72A 3NDGA 1Y28A 2Y2PA 4KUOA 1ES3A 3ZG5A 2Y2JA 4BWIA 4E04A 1ESIA 2QYBA 1BLCA 2O9CA 4R0QA 5HARA 3ZG8B 3IT9A 3L7HA 3HLDA 2P04A 4Y2FA 4BENA 3E4PA 3LY3A 4HIAA 1K56A 1ONHA 1LSXA 3GVBA 4OQ0A 5FSRA 4JXSA 2Y59A 5HWWA 3UE6A 3CWFA 2PBYA 3NOPC 2XRNA 3E4QA 2QJ5A 4E3NA 2W3EA 4E6XA 4WZ4A 4CPKA 2V8FA 2GDNA 1OPXA 5HWVA 3NDEA 4FH4A 4KZ8A 3PBNA 4HJ6A 1GSXA 1JTDA 5DF8A 2HP6A 3EEAA 1PWCA 5IHVA 3OC2A 3B47A 3T4QA 5CERA 2MJ6A 1WE4A 3UE0A 3O87A 3LCEA 1IYOA 1EW0A 2EX6A 3EEHA 2WUQA 3PBRA 3N7WA 4EWFA 4F3LB 3PBTA 4GZBA 1Q2QA 3WRTA 1MWUA 4GB7A 2IWBA 4EERA 3HUOA 1K6RA 1WYCA 3V5MA 3IX8A 5EM0A 2JKFA 2W3FA 3H7WA 5HX9A 4OQIA 4OLGA 5AQ9A 5K5BA 3BRMA 4WN5A 3HBRA 2QJ7A 2WZXA 3CUEA 2EWVA 4PM6A 4QWOA 4P0MA 3GECA 1JVJA 3DTIA 3JYIA 3N8LA 3T50A 3VE4A 4OH0A 4EBNA 2WGWA 2VJWA 1OJ5A 1NRJA 5EV0A 4CLCA 2KX6A 2DRWA 2WKPA 4K91A 3UB9A 1GHMA 5CTNA 1YPRA 1SKFA 5CX7A 1XFQA 2PBDP 2W1TB 3GRJA 2J9OA 2Y8HA 4FUWA 1BULA 4L0LA 3HLEA 4GS9A 1JWVA 1PZOA 3LO7A 4C3QA 5AVEA 2KOIA 2ZBBA 3OPRA 3T1QB 5IS1A 2NUTC 2Z2MB 1PW8A 4N9LA 1EI5A 2ZM0A 1OJGA 1OTEA 4HY8A 4EEPA 2XH9A 4RA7A 1P9WA 2XR0A 1HTZA 5HDDA 1CI9A 1TD5A 1DY6A 4MBFA 3F1NB 5EVIA 3Q1FA 5GHYA 1K57A 3K3CA 1YLTA 1ZHHB 2WKRA 3CPTA 1HZOA 3DW0A 5EM1A 3BY9A 4MBHA 5EVEA 2Z2LB 4P87A 3D9YA 4A5RA 3IBJA 1Y4OA 2PD8A 3NOTC 1CJFA 4GCZA 1X0OA 4DDSA 4EUZA 3FZCA 4KZBA 2R9XA 4B88A 1MKIA 4FTXA 5EPHA 4BD1A 3IWIA 1IFQA 2Y79A 1NZOA 1ES2A 2C6WB 1IYQA 2VGJA 2PDRA 3IS2B 1ODVA 1OT6A 2GX5A 1MXOA 1D06A 4OP5A 1M6KA 3WRZA 1NLZA 2V1ZA 3MQOA 3IXGA 3UPNA 3HLWA 3UDIA 4BJPA 3QP1A 3FPWA 3LEQA 3UDXA 1L2SA 5GLCA 2Y2HA 4RX3A 3RXXA 3SOIA 5DFYA 3BLSA 3PYPA 2JCHA 3H82B 4NXGA 4ZJ1A 4KG2A 3GV9A 5GL9A 3NJAA 4KZAA 3MFXA 1ZKJA 4MEZA 2G7UA 1PZPA 3UPPA 2WGVA 4PM7A 4G3KA 4F94A 3LIFA 1DJBA 3LUQA 2WAFA 3Q7ZA 5FEFA 2OAP1 3SH8A 4E3IA 3BFCA 1SKOA 5DFXA 2A24A 5FA7A 4HI4A 5E2FA 3ZYTA 3MXSA 3HLCA 3GR2A 2OWJA 2Q0OA 3K2NA 4EBLA 4IBXA 3OZHA 1L3LA 3FYZA 5TFQA 3Q7VB 1VEUB 1ERMA 4GDBA 3VOLA 1N9OA 1SCWA 2L4RA 2R78A 4P85A 5IT5A 2JKTM 3JVVA 4X55A 4HBUA 4N92A 3PHYA 1K56D 4HP4A 3W8KA 5FDSA 1JTGA 5FQMA 1ES5A 3ZQ5A 1U60A 4OQHA 2Y4AA 3S1YA 1TS0A 4OPZA 4O7DA 1H8ZA 1S1YA 3QP6A 1ES4A 1AWIA 4GHIB 4GNUA 1J9MA 5J8XA 3IWQA 4R3BA 1XA1A 3LR0A 1TS7A 4Q0IA 3S7OA 4S2JA 3UB6A 2XQZA 3NOUC 1XX2A 3WS1A 4JGRA 3MQQA 4Y7PA 1DRMA 4HP9A 2B5RA 4QPRA 4E3MA 4O01A 4X1MA 1ZTUA 5CEBA 1RP5A 4EETB 1FOFA 2W3DA 1H8YA 2PHYA 1JWZA 3FPVA 3IXBA 3H9WA 2EA9A 1F9IA 2V0UA 1CEGA 4BBUA 5JYOA 5F1FA 3QNCA 3FV7A 3CUEC 4KQOA 4YOFA 5EOOA 4PHTA 2J80A 1S4SA 1T1BA 4U3TA 3ZVWA 2HZ5A 1QMEA 4HEFA 3GTCA 3C2WA 3CZDA 2ZMFA 1ONGA 5E2GA 4B4XA 5DJTA 1ZG4A 3V67A 4P6BA 5HAPA 3OPHA 4GD6A 1KGEA 4WM9A 2Y2MA 4JXVA 4EEUA 3R7WB 1DP9A 3VSKA 1I5QA 4ETZA 3AGFA 4K0XA 4RYEA 1BTLA 2H0TA 4LV1A 5TBMA 3V3RA 2GZAA 2UWXA 5FL3A 4LV0A 5EUAA 1YSQA 1A0KA 5F68A 3BECA 4EW7A 4CLCD 2C5WB 4OKPA 3S7PA 1VQQA 2WADA 2PYRA 3IWOA 4R23A 2JHEA
chains in the Genus database with same CATH topology
5HAQA 5FQKA 1PI4A 1BSGA 5CHJA 5GHZA 4C75A 3ZDJA 1HVBA 1YLWA 4OPQA 1LL5A 5DVAA 4NK3A 5HW3A 1IYOA 5CHMA 5EVIC 2EX6A 1EWZA 3SS3A 3TSGA 4HBTA 5FI6A 4U0XA 3RJUA 2HDQA 4BQMA 3MBZA 4E3JA 4IEDA 3IXDA 3RXWA 1LI0A 1NJ4A 2HDSA 2WUQA 3N7WA 3PBRA 3ITBA 3Q81A 4OOMA 1C3BA 4EWFA 4WEKA 1ALQA 2HDUA 3PBTA 4GZBA 1Q2QA 3UO9A 3W4QA 3VMAA 2X02A 1LHYA 2WKHA 1G68A 4KZ4A 5CTMA 2WKEA 3S22A 2JBFA 3NI9A 3WRTA 3G31A 1MWUA 3G4PA 4GB7A 2IWBA 4N1HA 4NETA 3HUOA 1K6RA 1WYCA 2BLSA 4WZ5A 3V5MA 3OPPA 3DWKA 4R3JA 4ZBEA 5G18A 1MBLA 3VFHA 1W7FA 4FH2A 5EVID 3VP2A 3PBSA 2QZ6A 2Y2QA 1BLHA 4OQIA 4OLGA 5EE8A 3Q07A 5AQ9A 3E2KA 5HX9A 5I94A 4OVDA 4KZ9A 2P9VA 3BRMA 3MZEA 4WMCD 3HBRA 1FR1A 2A49A 4QY5A 4WZ5C 3PBOA 4YFMA 2OV5A 2XD5A 1KGGA 3TG9A 4OLDA 4X56A 2ZC7A 2WZXA 1PI5A 4E3OA 1ESUA 4PM6A 5A91A 1MWSA 1NYYA 2PU4A 4JXWA 3M2KA 4P0MA 1L0DA 4S2NA 2HP9A 4EBPA 2XK1A 1JVJA 3SS4A 4B4ZA 5DTTA 1XKZA 3ZFZA 3JYIA 3N8LA 4K0WA 1CEFA 4JF5A 2ZMAA 4KQRA 3CJMA 4OH0A 4FCFA 1PIOA 2FFFB 2BG1A 2I72A 4KZ6A 4EBNA 1FR6A 1HD8A 2WGWA 2XLNA 1H5XA 4GDNA 2CC1A 4DE1A 3ZNTA 5A92A 3NIAA 1QMFA 1K54A 5JYPA 3C4PA 1G6AA 2HPBA 2DRWA 4K91A 1YMXA 4UA9A 1E3UA 2Q9MA 1GHMA 5CTNA 4PM8A 2OSUA 4LCMA 1GA9A 1LL9A 2WYXA 3I7JA 1PWDA 5GLDA 4E3KA 1SKFA 1K55A 3IXHA 4WEJA 1K54C 5U47A 2Y2OA 5FQ9A 3GRJA 4X6TA 3UDFA 3OCNA 2IWCA 2J9OA 4KZ5A 5CEDA 1E25A 1BULA 3OCLA 4M3KA 5D3OA 3PBQA 2Y2GA 3GQZA 1K55C 4L0LA 1W5DA 3C7VA 3HLEA 1IYSA 3ZVTA 3EQVA 1JWVA 1PZOA 3IHBA 3LO7A 2Y2IA 4C3QA 5DTSA 4DRTA 1FSWA 3NY4A 3OPRA 3MZDA 4JF6A 5GLBA 3CG5A 5FAOA 1KGFA 3HLBA 2Z2MB 1PW8A 2EX9A 2WKIA 3VOYA 2Q9NA 3MXRA 4IBRA 2OLUA 4N9LA 3BLMA 3A3FA 1EI5A 2H10A 3P98A 1Y54A 1RGZA 1FCNA 2X01A 4DE2A 2VGKA 4QJGA 3UNWA 4Y0TA 1NZUA 2V20A 5EECA 2ZM0A 4IVKA 3UY6A 2JC7A 2H5SA 3G30A 2XH9A 3LY4A 4RA7A 2ZLYA 3UN7A 3PTEA 2XR0A 3M6HA 1HTZA 4FD8A 3SS5A 2HP5A 2P9VB 3EQUA 5FDHA 5M18A 1CI9A 1EROA 3IH9A 1DY6A 1PWGA 3A3EA 4MBFA 4S2PA 5GLAA 5EVIA 5FASA 3Q1FA 4OPRA 5GHYA 1W8QA 1KE4A 1LI9A 1K57A 2WK0A 4KZ3A 1E4DA 5DTKA 1YLTA 4KENB 4WMCA 2XEPA 4OOYA 3SH9A 5AQAA 1HZOA 3DW0A 2JE5A 4DXCA 3QNBA 2ZQAA 3ZG9B 4OQGA 3ISGA 2ZD8A 2IWDA 3VFFA 4MBHA 1K57C 1ZG6A 1XXMA 1GCEA 2Z2LB 3A3IA 4P87A 4A5RA 1DJAA 2ZQ8A 1TDGA 3IF6A 2WGWB 2XFTA 4BL2A 1W79A 1YQSA 2DCFA 3BFDA 3VP0A 3S4XA 4DDSA 4Z9QA 4EUZA 3FZCA 2H0YA 4KZBA 2R9XA 3ZG0A 4IVIA 4DF6A 1KVMA 1MKIA 4B88A 5KZHA 1CK3A 2Y2LA 1YT4A 1ZC2A 5CXWA 3HLGA 5CECA 3WS2A 3IF6C 3QHYA 5EPHA 3ZGAB 2G2UA 4BD1A 3IWIA 3MFDA 4D2OA 5FATA 1OMEA 1XP4A 1NZOA 1Z6FA 1ES2A 1BLPA 1GHIA 1GA0A 5DF9A 4GKUA 2C6WB 4JXGA 4QD4A 1IYQA 5CGSA 2QPNA 2VGJA 1XPBA 1I2SA 2XFSA 1Q2PA 3Q7VA 4R4RA 1NRFA 2G2WA 3BFEA 1MXOA 3E2LA 4OP5A 3O3VA 1S0WA 2HDRA 4PPRA 4OPYA 1M6KA 2E8IA 1KVLA 3UE1A 2WAEA 3WRZA 1K4EA 3NBLA 3DTMA 3G34A 1BT5A 4GOGA 1MWTA 1TEMA 4EV4A 2EX2A 3BM6A 2V1ZA 3W4PA 3IXGA 4GD8A 3HLWA 3UDIA 3UPNA 4BJPA 4MBKA 3FKWA 3UDXA 1K6SA 5KSHA 1L2SA 3NC8A 5GLCA 2Y2HA 4RX3A 3RXXA 3SOIA 3UE3A 4E3LA 3VOZA 1KDWA 4OP8A 4QU3A 5KSCA 5E2EA 1PYYA 3BLSA 3N4IA 2JCHA 3A3DA 5A93A 2EXAA 5FI2A 3W4OA 4ZJ1A 4KG2A 3GV9A 4DDYA 1L0GA 5EVIB 5GL9A 1KE0A 3Q82A 4KZAA 1JWPA 2ZC3B 1FCOA 5CRFA 2ZC5B 1ZKJA 4N9KA 3C4OA 2ZQ9A 4KQQA 4MEZA 3BYDA 1PZPA 1ERQA 3BEBA 3TOIA 3UPPA 3ZHHA 2WGVA 4PM7A 3G2YA 4DE0A 3IHAA 1NY0A 4UA6A 1YMSA 4OOLA 4H8RA 3ZNYA 2A3UA 4BL3A 4F94A 2RCXA 1L0FA 1YLZA 3HREA 4X53A 2ZQDA 1YLPA 1DJBA 1K25A 4Y0UA 1CI8A 2Y2KA 1SHVA 2WAFA 1L0EA 1M40A 4Y0OA 5FQQA 1O7EA 3Q7ZA 3V39A 3IF6B 4R1GA 2R9WA 1IKIA 2ZM8A 4Q8IA 4JKTA 3SH8A 3BFGA 4E3IA 4EQIA 3BFCA 3WS0A 1IKGA 4S2IA 2Y2NA 2WZZA 3BFFA 5HAIA 2Y55A 3VP1A 2ZM2A 4KZ7A 3G35A 5F82A 4XUZA 4LENA 3MKEA 2FFYA 5E2HA 4ZJ3A 5FA7A 5E2FA 3GSGA 3MXSA 3MKFA 4OONA 3HLCA 1WYBA 3GR2A 1RGYA 4PM9A 3VSLA 3V3SA 5FQJA 4EBLA 4IBXA 1N4OA 5F1GA 3M6BA 3OZHA 3FYZA 5TFQA 3C7UA 3G32A 3Q7VB 4MLLA 5FQIA 1ERMA 4GDBA 3UPOA 1SCWA 3IQAA 1AXBA 5TGFA 4KG6A 4BLMA 3AGEA 4P85A 1YM1A 3AGDA 3FWLA 4X55A 4ID4A 2PU2A 1K38A 4HBUA 4N92A 1BZAA 1K56D 3W8KA 4WELA 1JTGA 1NXYA 5FQMA 2X71A 1ES5A 1XGJA 2RL3A 2EFUA 3LEZA 1U60A 4OQHA 3HLFA 4MNRA 5FAPA 3HL9A 5BOHA 2Y4AA 1I2WA 3S1YA 3DWZA 5M1AA 5E43A 4OPZA 1TVFA 4O7DA 3VP4A 3NCKA 4S2LA 1YLJA 1H8ZA 3FKVA 1MWRA 1ES4A 1DJCA 1MY8A 4LCLA 4GNUA 4QB8A 1J9MA 1IYPA 3IWQA 5AQ7A 4R3BA 5J8XA 4UA7A 5L2FA 2ZJ9A 1IEMA 4R4SA 1XA1A 3WS4A 3GMWA 2V2FF 4GN2A 4S2KA 3P09A 3V50A 3SH7A 4KG5A 4S2JA 5TR7A 2XD1A 4PMAA 3MZFA 1KE3A 2XQZA 3PAEA 4BD0A 3WS5A 2EX8A 4S2OA 5AQBA 4N1XA 1XX2A 1W8YA 4RX2A 5CGXA 2OLVA 3ZCZA 4DKIA 5EVLA 1FCMA 3WS1A 4ZDXA 3M2JA 2ZC4B 4HESA 4PM5A 5CHUA 1KDSA 1RCJA 3PAGA 4Y7PA 4XXRA 1K4FA 2ZQ7A 2B5RA 4XUXA 1FQGA 4C6YA 4E3MA 5GHXA 2ZC6B 1NYMA 5DF7A 4UHUA 1SDNA 2ZQCA 2EFXA 4JF4A 5CEBA 1RP5A 3VP3A 1FOFA 3N8SA 4UAAA 5EOEA 5A90A 1BUEA 1FSYA 1H8YA 1JWZA 3O88A 3D4FA 4U0TA 5F83A 3IXBA 4ZAMA 3HVFA 1BLSA 5HL1A 3WWXA 3IH8A 1CEGA 3C5AA 4YINA 3G2ZA 4ZJ2A 5JYOA 3ITAA 3NDGA 4QHCA 2XDMA 3O86A 4DE3A 3QNCA 5F1FA 1XGIA 3FV7A 2Y2PA 4DXBA 1ES3A 4KQOA 3ZG5A 2Y2JA 3A3JA 3N8RA 4S2NC 1ESIA 5EOOA 1BLCA 3ZG7B 1GHPA 1VM1A 2WGIA 1O07A 3B3XA 2XF3A 4R0QA 5HARA 3ZG8B 3IT9A 4U3TA 3HUMA 3ZVWA 1QMEA 4HEFA 3GTCA 3HLDA 4JBFA 3CZDA 4WYYA 4BENA 4JPMA 3LY3A 4QY6A 1K56A 1ONGA 1ONHA 2J8YA 5E2GA 4LV2A 5CGWA 4B4XA 3GVBA 4OQ0A 5FSRA 2P74A 2Y59A 4JXSA 1ZG4A 1SDEA 4P6BA 1PW1A 3OPHA 4X68A 5HAPA 2XGNA 3CMZA 1S6RA 2PBYA 2Y91A 1LLBA 4GD6A 1N9BA 1KGEA 4WM9A 5FI7A 2Y2MA 4JXVA 4S2MA 4E3NA 3OPLA 1TDLA 2J9PA 3VSKA 1I5QA 3AGFA 4E6XA 4K0XA 4RYEA 4WZ4A 4FSFA 1BTLA 2H0TA 4LV1A 4CPKA 3V3RA 2UWXA 4LV3A 4RVAA 2GDNA 5M19A 1MPLA 4LV0A 5EUAA 1XA7A 4ZTKA 3BECA 3NDEA 2J7VA 4FH4A 4WBGA 4KZ8A 2EXBA 3IF5A 3PBNA 4JLFA 4X69A 4CJNA 1JTDA 1E3UD 5DF8A 5FAQA 5HFOA 2C5WB 2DNSA 1IELA 4OKPA 2HP6A 3N6IA 1VQQA 2QMIA 1PWCA 5IHVA 2WADA 3OC2A 1YLYA 5CERA 1WE4A 3HUNA 3IWOA 4R23A 5KMWA 3UE0A 3O87A 4E6WA 3LCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HAQ A;  5FQK A;  1PI4 A;  1BSG A;  5CHJ A;  5GHZ A;  4C75 A;  3ZDJ A;  1HVB A;  1YLW A;  4OPQ A;  1LL5 A;  5DVA A;  4NK3 A;  5HW3 A;  1IYO A;  5CHM A;  5EVI C;  2EX6 A;  1EWZ A;  3SS3 A;  3TSG A;  4HBT A;  5FI6 A;  4U0X A;  3RJU A;  2HDQ A;  4BQM A;  3MBZ A;  4E3J A;  4IED A;  3IXD A;  3RXW A;  1LI0 A;  1NJ4 A;  2HDS A;  2WUQ A;  3N7W A;  3PBR A;  3ITB A;  3Q81 A;  4OOM A;  1C3B A;  4EWF A;  4WEK A;  1ALQ A;  2HDU A;  3PBT A;  4GZB A;  1Q2Q A;  3UO9 A;  3W4Q A;  3VMA A;  2X02 A;  1LHY A;  2WKH A;  1G68 A;  4KZ4 A;  5CTM A;  2WKE A;  3S22 A;  2JBF A;  3NI9 A;  3WRT A;  3G31 A;  1MWU A;  3G4P A;  4GB7 A;  2IWB A;  4N1H A;  4NET A;  3HUO A;  1K6R A;  1WYC A;  2BLS A;  4WZ5 A;  3V5M A;  3OPP A;  3DWK A;  4R3J A;  4ZBE A;  5G18 A;  1MBL A;  3VFH A;  1W7F A;  4FH2 A;  5EVI D;  3VP2 A;  3PBS A;  2QZ6 A;  2Y2Q A;  1BLH A;  4OQI A;  4OLG A;  5EE8 A;  3Q07 A;  5AQ9 A;  3E2K A;  5HX9 A;  5I94 A;  4OVD A;  4KZ9 A;  2P9V A;  3BRM A;  3MZE A;  4WMC D;  3HBR A;  1FR1 A;  2A49 A;  4QY5 A;  4WZ5 C;  3PBO A;  4YFM A;  2OV5 A;  2XD5 A;  1KGG A;  3TG9 A;  4OLD A;  4X56 A;  2ZC7 A;  2WZX A;  1PI5 A;  4E3O A;  1ESU A;  4PM6 A;  5A91 A;  1MWS A;  1NYY A;  2PU4 A;  4JXW A;  3M2K A;  4P0M A;  1L0D A;  4S2N A;  2HP9 A;  4EBP A;  2XK1 A;  1JVJ A;  3SS4 A;  4B4Z A;  5DTT A;  1XKZ A;  3ZFZ A;  3JYI A;  3N8L A;  4K0W A;  1CEF A;  4JF5 A;  2ZMA A;  4KQR A;  3CJM A;  4OH0 A;  4FCF A;  1PIO A;  2FFF B;  2BG1 A;  2I72 A;  4KZ6 A;  4EBN A;  1FR6 A;  1HD8 A;  2WGW A;  2XLN A;  1H5X A;  4GDN A;  2CC1 A;  4DE1 A;  3ZNT A;  5A92 A;  3NIA A;  1QMF A;  1K54 A;  5JYP A;  3C4P A;  1G6A A;  2HPB A;  2DRW A;  4K91 A;  1YMX A;  4UA9 A;  1E3U A;  2Q9M A;  1GHM A;  5CTN A;  4PM8 A;  2OSU A;  4LCM A;  1GA9 A;  1LL9 A;  2WYX A;  3I7J A;  1PWD A;  5GLD A;  4E3K A;  1SKF A;  1K55 A;  3IXH A;  4WEJ A;  1K54 C;  5U47 A;  2Y2O A;  5FQ9 A;  3GRJ A;  4X6T A;  3UDF A;  3OCN A;  2IWC A;  2J9O A;  4KZ5 A;  5CED A;  1E25 A;  1BUL A;  3OCL A;  4M3K A;  5D3O A;  3PBQ A;  2Y2G A;  3GQZ A;  1K55 C;  4L0L A;  1W5D A;  3C7V A;  3HLE A;  1IYS A;  3ZVT A;  3EQV A;  1JWV A;  1PZO A;  3IHB A;  3LO7 A;  2Y2I A;  4C3Q A;  5DTS A;  4DRT A;  1FSW A;  3NY4 A;  3OPR A;  3MZD A;  4JF6 A;  5GLB A;  3CG5 A;  5FAO A;  1KGF A;  3HLB A;  2Z2M B;  1PW8 A;  2EX9 A;  2WKI A;  3VOY A;  2Q9N A;  3MXR A;  4IBR A;  2OLU A;  4N9L A;  3BLM A;  3A3F A;  1EI5 A;  2H10 A;  3P98 A;  1Y54 A;  1RGZ A;  1FCN A;  2X01 A;  4DE2 A;  2VGK A;  4QJG A;  3UNW A;  4Y0T A;  1NZU A;  2V20 A;  5EEC A;  2ZM0 A;  4IVK A;  3UY6 A;  2JC7 A;  2H5S A;  3G30 A;  2XH9 A;  3LY4 A;  4RA7 A;  2ZLY A;  3UN7 A;  3PTE A;  2XR0 A;  3M6H A;  1HTZ A;  4FD8 A;  3SS5 A;  2HP5 A;  2P9V B;  3EQU A;  5FDH A;  5M18 A;  1CI9 A;  1ERO A;  3IH9 A;  1DY6 A;  1PWG A;  3A3E A;  4MBF A;  4S2P A;  5GLA A;  5EVI A;  5FAS A;  3Q1F A;  4OPR A;  5GHY A;  1W8Q A;  1KE4 A;  1LI9 A;  1K57 A;  2WK0 A;  4KZ3 A;  1E4D A;  5DTK A;  1YLT A;  4KEN B;  4WMC A;  2XEP A;  4OOY A;  3SH9 A;  5AQA A;  1HZO A;  3DW0 A;  2JE5 A;  4DXC A;  3QNB A;  2ZQA A;  3ZG9 B;  4OQG A;  3ISG A;  2ZD8 A;  2IWD A;  3VFF A;  4MBH A;  1K57 C;  1ZG6 A;  1XXM A;  1GCE A;  2Z2L B;  3A3I A;  4P87 A;  4A5R A;  1DJA A;  2ZQ8 A;  1TDG A;  3IF6 A;  2WGW B;  2XFT A;  4BL2 A;  1W79 A;  1YQS A;  2DCF A;  3BFD A;  3VP0 A;  3S4X A;  4DDS A;  4Z9Q A;  4EUZ A;  3FZC A;  2H0Y A;  4KZB A;  2R9X A;  3ZG0 A;  4IVI A;  4DF6 A;  1KVM A;  1MKI A;  4B88 A;  5KZH A;  1CK3 A;  2Y2L A;  1YT4 A;  1ZC2 A;  5CXW A;  3HLG A;  5CEC A;  3WS2 A;  3IF6 C;  3QHY A;  5EPH A;  3ZGA B;  2G2U A;  4BD1 A;  3IWI A;  3MFD A;  4D2O A;  5FAT A;  1OME A;  1XP4 A;  1NZO A;  1Z6F A;  1ES2 A;  1BLP A;  1GHI A;  1GA0 A;  5DF9 A;  4GKU A;  2C6W B;  4JXG A;  4QD4 A;  1IYQ A;  5CGS A;  2QPN A;  2VGJ A;  1XPB A;  1I2S A;  2XFS A;  1Q2P A;  3Q7V A;  4R4R A;  1NRF A;  2G2W A;  3BFE A;  1MXO A;  3E2L A;  4OP5 A;  3O3V A;  1S0W A;  2HDR A;  4PPR A;  4OPY A;  1M6K A;  2E8I A;  1KVL A;  3UE1 A;  2WAE A;  3WRZ A;  1K4E A;  3NBL A;  3DTM A;  3G34 A;  1BT5 A;  4GOG A;  1MWT A;  1TEM A;  4EV4 A;  2EX2 A;  3BM6 A;  2V1Z A;  3W4P A;  3IXG A;  4GD8 A;  3HLW A;  3UDI A;  3UPN A;  4BJP A;  4MBK A;  3FKW A;  3UDX A;  1K6S A;  5KSH A;  1L2S A;  3NC8 A;  5GLC A;  2Y2H A;  4RX3 A;  3RXX A;  3SOI A;  3UE3 A;  4E3L A;  3VOZ A;  1KDW A;  4OP8 A;  4QU3 A;  5KSC A;  5E2E A;  1PYY A;  3BLS A;  3N4I A;  2JCH A;  3A3D A;  5A93 A;  2EXA A;  5FI2 A;  3W4O A;  4ZJ1 A;  4KG2 A;  3GV9 A;  4DDY A;  1L0G A;  5EVI B;  5GL9 A;  1KE0 A;  3Q82 A;  4KZA A;  1JWP A;  2ZC3 B;  1FCO A;  5CRF A;  2ZC5 B;  1ZKJ A;  4N9K A;  3C4O A;  2ZQ9 A;  4KQQ A;  4MEZ A;  3BYD A;  1PZP A;  1ERQ A;  3BEB A;  3TOI A;  3UPP A;  3ZHH A;  2WGV A;  4PM7 A;  3G2Y A;  4DE0 A;  3IHA A;  1NY0 A;  4UA6 A;  1YMS A;  4OOL A;  4H8R A;  3ZNY A;  2A3U A;  4BL3 A;  4F94 A;  2RCX A;  1L0F A;  1YLZ A;  3HRE A;  4X53 A;  2ZQD A;  1YLP A;  1DJB A;  1K25 A;  4Y0U A;  1CI8 A;  2Y2K A;  1SHV A;  2WAF A;  1L0E A;  1M40 A;  4Y0O A;  5FQQ A;  1O7E A;  3Q7Z A;  3V39 A;  3IF6 B;  4R1G A;  2R9W A;  1IKI A;  2ZM8 A;  4Q8I A;  4JKT A;  3SH8 A;  3BFG A;  4E3I A;  4EQI A;  3BFC A;  3WS0 A;  1IKG A;  4S2I A;  2Y2N A;  2WZZ A;  3BFF A;  5HAI A;  2Y55 A;  3VP1 A;  2ZM2 A;  4KZ7 A;  3G35 A;  5F82 A;  4XUZ A;  4LEN A;  3MKE A;  2FFY A;  5E2H A;  4ZJ3 A;  5FA7 A;  5E2F A;  3GSG A;  3MXS A;  3MKF A;  4OON A;  3HLC A;  1WYB A;  3GR2 A;  1RGY A;  4PM9 A;  3VSL A;  3V3S A;  5FQJ A;  4EBL A;  4IBX A;  1N4O A;  5F1G A;  3M6B A;  3OZH A;  3FYZ A;  5TFQ A;  3C7U A;  3G32 A;  3Q7V B;  4MLL A;  5FQI A;  1ERM A;  4GDB A;  3UPO A;  1SCW A;  3IQA A;  1AXB A;  5TGF A;  4KG6 A;  4BLM A;  3AGE A;  4P85 A;  1YM1 A;  3AGD A;  3FWL A;  4X55 A;  4ID4 A;  2PU2 A;  1K38 A;  4HBU A;  4N92 A;  1BZA A;  1K56 D;  3W8K A;  4WEL A;  1JTG A;  1NXY A;  5FQM A;  2X71 A;  1ES5 A;  1XGJ A;  2RL3 A;  2EFU A;  3LEZ A;  1U60 A;  4OQH A;  3HLF A;  4MNR A;  5FAP A;  3HL9 A;  5BOH A;  2Y4A A;  1I2W A;  3S1Y A;  3DWZ A;  5M1A A;  5E43 A;  4OPZ A;  1TVF A;  4O7D A;  3VP4 A;  3NCK A;  4S2L A;  1YLJ A;  1H8Z A;  3FKV A;  1MWR A;  1ES4 A;  1DJC A;  1MY8 A;  4LCL A;  4GNU A;  4QB8 A;  1J9M A;  1IYP A;  3IWQ A;  5AQ7 A;  4R3B A;  5J8X A;  4UA7 A;  5L2F A;  2ZJ9 A;  1IEM A;  4R4S A;  1XA1 A;  3WS4 A;  3GMW A;  2V2F F;  4GN2 A;  4S2K A;  3P09 A;  3V50 A;  3SH7 A;  4KG5 A;  4S2J A;  5TR7 A;  2XD1 A;  4PMA A;  3MZF A;  1KE3 A;  2XQZ A;  3PAE A;  4BD0 A;  3WS5 A;  2EX8 A;  4S2O A;  5AQB A;  4N1X A;  1XX2 A;  1W8Y A;  4RX2 A;  5CGX A;  2OLV A;  3ZCZ A;  4DKI A;  5EVL A;  1FCM A;  3WS1 A;  4ZDX A;  3M2J A;  2ZC4 B;  4HES A;  4PM5 A;  5CHU A;  1KDS A;  1RCJ A;  3PAG A;  4Y7P A;  4XXR A;  1K4F A;  2ZQ7 A;  2B5R A;  4XUX A;  1FQG A;  4C6Y A;  4E3M A;  5GHX A;  2ZC6 B;  1NYM A;  5DF7 A;  4UHU A;  1SDN A;  2ZQC A;  2EFX A;  4JF4 A;  5CEB A;  1RP5 A;  3VP3 A;  1FOF A;  3N8S A;  4UAA A;  5EOE A;  5A90 A;  1BUE A;  1FSY A;  1H8Y A;  1JWZ A;  3O88 A;  3D4F A;  4U0T A;  5F83 A;  3IXB A;  4ZAM A;  3HVF A;  1BLS A;  5HL1 A;  3WWX A;  3IH8 A;  1CEG A;  3C5A A;  4YIN A;  3G2Z A;  4ZJ2 A;  5JYO A;  3ITA A;  3NDG A;  4QHC A;  2XDM A;  3O86 A;  4DE3 A;  3QNC A;  5F1F A;  1XGI A;  3FV7 A;  2Y2P A;  4DXB A;  1ES3 A;  4KQO A;  3ZG5 A;  2Y2J A;  3A3J A;  3N8R A;  4S2N C;  1ESI A;  5EOO A;  1BLC A;  3ZG7 B;  1GHP A;  1VM1 A;  2WGI A;  1O07 A;  3B3X A;  2XF3 A;  4R0Q A;  5HAR A;  3ZG8 B;  3IT9 A;  4U3T A;  3HUM A;  3ZVW A;  1QME A;  4HEF A;  3GTC A;  3HLD A;  4JBF A;  3CZD A;  4WYY A;  4BEN A;  4JPM A;  3LY3 A;  4QY6 A;  1K56 A;  1ONG A;  1ONH A;  2J8Y A;  5E2G A;  4LV2 A;  5CGW A;  4B4X A;  3GVB A;  4OQ0 A;  5FSR A;  2P74 A;  2Y59 A;  4JXS A;  1ZG4 A;  1SDE A;  4P6B A;  1PW1 A;  3OPH A;  4X68 A;  5HAP A;  2XGN A;  3CMZ A;  1S6R A;  2PBY A;  2Y91 A;  1LLB A;  4GD6 A;  1N9B A;  1KGE A;  4WM9 A;  5FI7 A;  2Y2M A;  4JXV A;  4S2M A;  4E3N A;  3OPL A;  1TDL A;  2J9P A;  3VSK A;  1I5Q A;  3AGF A;  4E6X A;  4K0X A;  4RYE A;  4WZ4 A;  4FSF A;  1BTL A;  2H0T A;  4LV1 A;  4CPK A;  3V3R A;  2UWX A;  4LV3 A;  4RVA A;  2GDN A;  5M19 A;  1MPL A;  4LV0 A;  5EUA A;  1XA7 A;  4ZTK A;  3BEC A;  3NDE A;  2J7V A;  4FH4 A;  4WBG A;  4KZ8 A;  2EXB A;  3IF5 A;  3PBN A;  4JLF A;  4X69 A;  4CJN A;  1JTD A;  1E3U D;  5DF8 A;  5FAQ A;  5HFO A;  2C5W B;  2DNS A;  1IEL A;  4OKP A;  2HP6 A;  3N6I A;  1VQQ A;  2QMI A;  1PWC A;  5IHV A;  2WAD A;  3OC2 A;  1YLY A;  5CER A;  1WE4 A;  3HUN A;  3IWO A;  4R23 A;  5KMW A;  3UE0 A;  3O87 A;  4E6W A;  3LCE A; 
#chains in the Genus database with same CATH topology
 2HJE A;  2V0W A;  5GHZ A;  5CHJ A;  1YLW A;  4EES A;  2O0Y A;  5DVA A;  4NK3 A;  5CHM A;  5EVI C;  4EQ1 A;  3SS3 A;  4HBT A;  3RJU A;  2HDQ A;  3KO6 A;  4IED A;  5J3W A;  4JGP A;  1C3B A;  2O9A A;  4DN0 A;  1T1C A;  2X02 A;  5L8M A;  1LHY A;  2Z6D A;  4KZ4 A;  3NI9 A;  3G4P A;  2E8J A;  4N1H A;  4WUJ A;  1D1J A;  3CLO A;  1VET B;  2BLS A;  4WZ5 A;  1MBL A;  5IU1 A;  3VFH A;  3VP2 A;  2VK3 A;  5EVI D;  5EE8 A;  1BLH A;  3Q07 A;  5I94 A;  4LRX C;  4NG2 A;  1FR1 A;  5HZH A;  4L9G A;  3PBO A;  4OLD A;  2ZC7 A;  1PI5 A;  4E3O A;  1ESU A;  2W3H A;  2PU4 A;  4JXW A;  3M2K A;  4S2N A;  1L0D A;  2HP9 A;  2YKF A;  4B93 A;  3SS4 A;  1CEF A;  4JF5 A;  1T18 A;  2I72 A;  1GSW A;  2JN7 A;  1FR6 A;  1H5X A;  4NEE D;  3ZNT A;  3T4S A;  3NIA A;  1QMF A;  1K54 A;  5JYP A;  1G6A A;  2HPB A;  1E3U A;  1NWZ A;  4PM8 A;  4LCM A;  1GA9 A;  1LL9 A;  5GLD A;  1K55 A;  4HH2 A;  3IXH A;  4WEJ A;  5U47 A;  5A8B A;  2IWC A;  3C38 A;  3DAV A;  4M3K A;  3ICY A;  3D3O A;  3MXQ A;  3ZVT A;  3EQV A;  4DMZ A;  2Y2I A;  2JKG A;  2LB9 A;  1FSW A;  4JF6 A;  3MZD A;  5F69 A;  2HF6 A;  1KGF A;  3HLB A;  2OLU A;  2H10 A;  1RGZ A;  3QP4 A;  4DE2 A;  4Y3I A;  2VGK A;  3UNW A;  1NZU A;  4IVK A;  2JC7 A;  1F5M A;  2L0W A;  3PTE A;  3M6H A;  3HJK A;  3SS5 A;  2HP5 A;  2P9V B;  3EQU A;  2HGV A;  3PXP A;  4OPR A;  4WLA A;  1W8Q A;  4LLO B;  4KEN B;  4WMC A;  3T1S A;  2PT7 A;  2JE5 A;  3UMD A;  3QNB A;  2ZQA A;  4DXC A;  3NHQ A;  2ZD8 A;  1XXM A;  4Y15 A;  3VE3 A;  3A3I A;  4CQH A;  4H6J B;  1DJA A;  2ZQ8 A;  4O8G A;  2KDK A;  3QP2 A;  1YQS A;  2B95 A;  2V9A A;  3BFD A;  3VP0 A;  4I3J A;  4ESP A;  1OTD A;  2H0Y A;  1KVM A;  1CK3 A;  1ZC2 A;  4Y13 A;  3IF6 C;  3QHY A;  2BAS A;  4Y5F A;  5TJJ A;  5FAT A;  4BBV A;  1OME A;  1XP4 A;  3O5Y A;  1Z6F A;  2KLI A;  1BLP A;  1GA0 A;  4JXG A;  5G4Y A;  3TW8 A;  1Q2P A;  3OLO A;  1NRF A;  4X25 A;  3BFE A;  3E2L A;  1G5U A;  2HDR A;  4PPR A;  2E8I A;  3UE1 A;  4UEY A;  3NBL A;  1BT5 A;  1TEM A;  3F1O A;  3W4P A;  4EXO A;  5AVF A;  3TRC A;  2J3T D;  3UB8 A;  4MBK A;  5KSH A;  3NC8 A;  3UE3 A;  4E3L A;  1KDW A;  5KSC A;  5E2E A;  3T4K A;  3A0S A;  5A93 A;  2EXA A;  3W4O A;  1JWP A;  3LIE A;  5CRF A;  1FCO A;  2ZQ9 A;  3BEB A;  3ZHH A;  3IHA A;  4GLQ A;  4OOL A;  2A3U A;  3MJQ A;  2ZQD A;  1SHV A;  3B42 A;  1M40 A;  3IF6 B;  1MC0 A;  4G3V A;  4YWZ A;  3OBF A;  2VEA A;  1G28 A;  2Y2N A;  2WZZ A;  4M4X A;  5HAI A;  3S7Q A;  4Q0H A;  4II7 A;  4ARZ A;  2GJ3 A;  5HD5 A;  3MKF A;  1WYB A;  1RGY A;  4R6L A;  1F2K A;  4JGQ A;  1XJ4 A;  4ETX A;  4UQI M;  5TGF A;  4KG6 A;  1YM1 A;  5HD3 A;  3RH8 B;  3FWL A;  4LRZ E;  2X71 A;  2EFU A;  4RQ9 A;  2D01 A;  2OWH A;  5HL6 A;  4MNR A;  5FAP A;  3UB7 A;  2M7U A;  5L07 A;  1OT9 A;  5M1A A;  5E43 A;  3VP4 A;  3NCK A;  4LRY C;  3T4O A;  4FOF A;  1W63 M;  4PKY G;  1TS6 A;  4ZRR A;  5L2F A;  3SZT A;  2ZJ9 A;  1IEM A;  4R4S A;  3TJZ C;  3IX3 A;  3GMW A;  4GN2 A;  4L9F A;  4KG5 A;  3E0Y A;  5TR7 A;  4Q0J A;  3DTK A;  2ACG A;  2EX8 A;  1W8Y A;  5L09 A;  4DKI A;  4EUV A;  1KDS A;  1RCJ A;  3PAG A;  1K4F A;  1OTI A;  4C6Y A;  2FH5 A;  2ZC6 B;  4JF4 A;  3LID A;  4Y17 A;  1OTB A;  4U0T A;  4ZAM A;  2XSS A;  5HL1 A;  3WWX A;  3IH8 A;  4YIN A;  3G2Z A;  4ZJ2 A;  3ITA A;  3LR5 A;  4NXB A;  4H6J A;  3DBA A;  4S2N C;  5F6A A;  4F3L A;  1GHP A;  1O07 A;  4LGW A;  1TS8 A;  3HUM A;  1P9R A;  2JKT I;  1YAX A;  3BY8 A;  2P74 A;  1SDE A;  1PW1 A;  4X68 A;  2PYP A;  1N9L A;  1N9B A;  4HH3 A;  5FI7 A;  4KQD A;  1VB6 A;  4I3I A;  4S2M A;  3OPL A;  2ZOI A;  2VLG A;  4WF0 A;  2VA0 A;  2WKQ A;  3MSH A;  4LV3 A;  4UQI S;  1XA7 A;  4WBG A;  4X69 A;  4CJN A;  1E3U D;  3U4L P;  2DNS A;  1S1Z A;  4BBT A;  3N6I A;  3F1P B;  1YLY A;  3DTE A;  4MN7 A;  5KMW A;  2W1T A;  5HAQ A;  5FQK A;  1HLU P;  3LYX A;  1BSG A;  4OPQ A;  1LL5 A;  1UGU A;  4U0X A;  4BQM A;  4E3J A;  2K2N A;  1NJ4 A;  1S4R A;  4G3W A;  4OOM A;  4WEK A;  3UO9 A;  3VMA A;  5CTM A;  2WKE A;  2P08 A;  4R70 A;  3L9K A;  2V8C A;  4HHD A;  3OPP A;  3DWK A;  4ZBE A;  5G18 A;  2JKR I;  3E2K A;  5F5Y A;  4OVD A;  1Z09 A;  3QP5 A;  4I3A A;  5MC7 A;  4WMC D;  2OAQ 1;  3F1N A;  2A49 A;  5J7E A;  2OV5 A;  3KX0 X;  3C30 A;  1KGG A;  3TG9 A;  4X56 A;  3IBR A;  5A91 A;  1MWS A;  4EBP A;  2XK1 A;  4B4Z A;  5DTT A;  1XKZ A;  3ZFZ A;  4K0W A;  4FCF A;  1PIO A;  5FEG A;  2BG1 A;  1PRQ A;  1LSW A;  2XLN A;  4GDN A;  3T1X A;  1FIL A;  3MS6 A;  5A92 A;  4EU0 A;  2JKR M;  4UA9 A;  2Q9M A;  1V9Z A;  2OSU A;  2WYX A;  3I7J A;  1PWD A;  2L1M A;  2Z6C A;  4HQA A;  2Y2O A;  5FQ9 A;  2QWS A;  4CLC C;  2V1A A;  2VX8 A;  4KZ5 A;  5CED A;  3IS2 A;  1E25 A;  2B18 A;  3PBQ A;  2Y2G A;  3LIA A;  3GQZ A;  1YKD A;  3A0V A;  3IHB A;  3KYE A;  2ZMV A;  5GLB A;  3CG5 A;  2ZL1 B;  5FAO A;  1XJ2 A;  2K7S A;  2EX9 A;  2WKI A;  1LSV A;  2Q9N A;  3MXR A;  4IBR A;  3LGO A;  3A3F A;  1Y54 A;  1FCN A;  2X01 A;  1CQA A;  2V20 A;  5EEC A;  1MZU A;  5KIZ A;  4MMN A;  4R38 A;  3MQ0 A;  3UN7 A;  3H7W B;  5G4Z A;  3H82 A;  5FDH A;  5HDC A;  3P7N A;  5GLA A;  5HPI A;  1E4D A;  2DMW A;  2LB5 A;  2XEP A;  4AFI A;  4OOY A;  5AQA A;  4OQG A;  3ISG A;  2IWD A;  1K57 C;  1GCE A;  1TDG A;  1XFN A;  2WGW B;  2D02 A;  2XFT A;  4BL2 A;  5L10 A;  2DCF A;  3BJN A;  4Z9Q A;  2VGL M;  4DF6 A;  3ZG0 A;  2PAV P;  4CLC B;  1YT4 A;  4PKY A;  3HLG A;  3WS2 A;  4XT2 B;  3MFD A;  4D2O A;  2GNX A;  2W1R A;  2EWW A;  2I9V A;  5CGS A;  2QPN A;  1XPB A;  3S7N A;  3Q7V A;  1VEU A;  4R4R A;  4MN6 A;  4GS9 B;  3HJI A;  3O3V A;  1S0W A;  4B9O A;  3UME A;  4IHQ A;  1K4E A;  4HNB A;  4EV4 A;  2EX2 A;  2V1B A;  1PFL A;  3FKW A;  4OP8 A;  4QU3 A;  2HV1 A;  1P0Z A;  1PYY A;  3N4I A;  3A3D A;  3CAX A;  5FI2 A;  3K3D A;  5EVI B;  4GHI A;  4CLC E;  2ZC3 B;  2ZC5 B;  3BYD A;  2VV7 A;  3CPT B;  1JNU A;  3TOI A;  1NY0 A;  1YMS A;  3ZNY A;  4H8R A;  3RFB A;  4BL3 A;  2RCX A;  1YLZ A;  1XJ6 A;  3HRE A;  4X53 A;  1YLP A;  1K25 A;  3P01 A;  2Y2K A;  2ZOH A;  1L0E A;  4YNR A;  3KSF A;  5DJU A;  3GDI A;  2ZM8 A;  4JKT A;  3BFG A;  2PD7 A;  3VP1 A;  2AVX A;  2QKP A;  2ZM2 A;  3G35 A;  4KZ7 A;  4XUZ A;  3MKE A;  2FFY A;  4ZJ3 A;  3BW6 A;  5LBR A;  4OON A;  4PAU A;  5DKL A;  2BTF P;  4PM9 A;  3VSL A;  5FQJ A;  4ME4 A;  3MR0 A;  1N4O A;  5F1G A;  3M6B A;  3OOV A;  3UPO A;  3G32 A;  3MF0 A;  3KYZ A;  4GJ4 A;  4DJ2 A;  3IQA A;  1AXB A;  1W63 Q;  2W0N A;  4I5S A;  1K38 A;  1BZA A;  4O0P A;  2M7V A;  1NXY A;  2RL3 A;  3HLF A;  4GW9 A;  5HPF A;  1OTA A;  3R4K A;  2OOL A;  2VGL S;  2M1C A;  1TVF A;  4HOI A;  3FKV A;  1MWR A;  1DJC A;  1MY8 A;  1SZV A;  3BWL A;  4QB8 A;  1IYP A;  3R7W A;  2J3T C;  4UA7 A;  4X1L A;  2ZL1 A;  4R3A A;  3WS4 A;  1V9Y A;  4S2K A;  3P09 A;  3V50 A;  3SH7 A;  2XD1 A;  4PMA A;  3MZF A;  1KE3 A;  3WS5 A;  4RX2 A;  2OLV A;  4LFU A;  5EVL A;  1FCM A;  4ZDX A;  2ZC4 B;  4HES A;  5J4E A;  4JGO A;  1UWN X;  4XUX A;  1NYM A;  3PR6 A;  5DF7 A;  4UHU A;  2QHK A;  2EFX A;  3VP3 A;  5EOE A;  3N8S A;  4UAA A;  1SKO B;  2P7J A;  1T1A A;  3HVF A;  3LI8 A;  2A24 B;  1BLS A;  5I5L A;  4NXF A;  3RTY A;  3C5A A;  1K0K A;  2O99 A;  4QHC A;  2XDM A;  3O86 A;  4DE3 A;  1XGI A;  4DXB A;  3LIB A;  3A3J A;  3N8R A;  3ZG7 B;  1H0M A;  1VM1 A;  2WGI A;  3B3X A;  2XF3 A;  5HWT A;  2PR5 A;  1VET A;  3TE8 A;  1CF0 A;  4MDZ A;  5AJG A;  4XT2 A;  4JBF A;  1GSV A;  4WYY A;  4JPM A;  3UB5 P;  4QY6 A;  3LI9 A;  3VV4 A;  2J8Y A;  4LV2 A;  5CGW A;  4D60 A;  2HJ9 C;  2VZW A;  1DP6 A;  2XGN A;  3CMZ A;  1S6R A;  4L9E A;  2Y91 A;  1LLB A;  1YSP A;  5EFW A;  1TDL A;  2J9P A;  4FSF A;  3U2A A;  4RVA A;  5M19 A;  1MPL A;  3E4O A;  4ZTK A;  2J7V A;  2EXB A;  3IF5 A;  4JLF A;  5FAQ A;  5HFO A;  1IEL A;  2QMI A;  3MMH A;  3HUN A;  1TF1 A;  4E6W A;  3NUL A;  1PI4 A;  3CHW P;  3B33 A;  3IX4 A;  4C75 A;  3BQA A;  3ZDJ A;  1HVB A;  2CMN A;  5HW3 A;  1EWZ A;  3TSG A;  4MN5 A;  5FI6 A;  3MBZ A;  3BQ8 A;  4DJ3 A;  3IXD A;  3RXW A;  1LI0 A;  2HDS A;  3Q81 A;  3ITB A;  1ALQ A;  4NXE A;  2HDU A;  3W4Q A;  2WKH A;  1G68 A;  1F98 A;  3S22 A;  2JBF A;  2J3W A;  3G31 A;  3LR3 A;  2W27 A;  4NET A;  1WA9 A;  4HJ3 A;  1S66 L;  4R3J A;  1IOU A;  1W7F A;  4FH2 A;  3PBS A;  2QZ6 A;  2Y2Q A;  4I39 A;  4KZ9 A;  2P9V A;  1H3Q A;  3MZE A;  3HCY A;  4QY5 A;  4WZ5 C;  4YFM A;  2XD5 A;  1XJ3 A;  1D7E A;  3QP8 A;  3C8C A;  1NYY A;  2W3G A;  4KUK A;  1N9N A;  2ZMA A;  3CJM A;  4KQR A;  2B02 A;  5TBM B;  2FFF B;  4KZ6 A;  1HD8 A;  4P6Z M;  2CC1 A;  4DE1 A;  2K31 A;  1BYW A;  3C4P A;  1YMX A;  3T12 B;  4HJ4 A;  4E3K A;  4BMW A;  2A2L A;  1K54 C;  3JPU A;  4IUK A;  4X6T A;  3UDF A;  3OCN A;  3LFV A;  3OCL A;  5D3O A;  1K55 C;  1W5D A;  3C7V A;  1IYS A;  1MKM A;  4IJG A;  1KOU A;  5DTS A;  4DRT A;  3T4L A;  3NY4 A;  3ULF A;  3VOY A;  2H28 A;  1PNE A;  3E98 A;  3BLM A;  4I38 A;  3P98 A;  3A0R A;  4QJG A;  4Y0T A;  3UY6 A;  3W2Z A;  2H5S A;  3G30 A;  3LY4 A;  4MCW A;  2ZLY A;  2VV6 A;  1VHM A;  4FD8 A;  5M18 A;  1ERO A;  3IH9 A;  1PWG A;  3A3E A;  4S2P A;  5FAS A;  1KE4 A;  3NEC A;  1LI9 A;  4K08 A;  2WK0 A;  4KZ3 A;  5DTK A;  2UV0 E;  2VV8 A;  4IUH A;  3SH9 A;  3ZG9 B;  2PR6 A;  3VFF A;  1T19 A;  1ZG6 A;  1H8M A;  3IF6 A;  1W79 A;  3S4X A;  1LL8 A;  2NUP C;  4IVI A;  5KZH A;  2Y2L A;  5CXW A;  5CEC A;  3KSG A;  3ZGA B;  2G2U A;  1UWP X;  1GHI A;  3FC7 A;  5DF9 A;  1NLY A;  4GKU A;  4QD4 A;  3G6O A;  2FZ0 A;  1I2S A;  2XFS A;  2XA7 M;  2G2W A;  1DP8 A;  4OPY A;  3KSI A;  1KVL A;  2WAE A;  4WL9 A;  3LIC A;  3DTM A;  3G34 A;  4GOG A;  1MWT A;  2INW A;  3BM6 A;  4GD8 A;  2VKS A;  4P6Z S;  1S67 L;  5DKK A;  1STZ A;  1K6S A;  4Z1W A;  3VOZ A;  4LPZ A;  3EWK A;  4DDY A;  1L0G A;  2XRO A;  1KE0 A;  3Q82 A;  3LR4 A;  5FQQ A;  4N9K A;  3C4O A;  4KQQ A;  1ERQ A;  3G2Y A;  4DE0 A;  4UA6 A;  1L0F A;  4Y0U A;  1CI8 A;  4Y0O A;  3V39 A;  1O7E A;  4R1G A;  3KYQ A;  2R9W A;  1IKI A;  4Q8I A;  4EQI A;  3WS0 A;  1IKG A;  4S2I A;  3EGX C;  3BFF A;  2Y55 A;  1G6O A;  5F82 A;  4LEN A;  3FG8 A;  5E2H A;  2YKH A;  2PRF A;  3GSG A;  3KSH A;  3T4T A;  3T4J A;  3V3S A;  3JVU A;  1LT0 A;  3EOI A;  3C7U A;  4MLL A;  5FQI A;  1FIK A;  4BLM A;  3AGE A;  2IA2 A;  3AGD A;  4ID4 A;  2PU2 A;  4WEL A;  1XGJ A;  3F1O B;  3CIT A;  3LEZ A;  3EGD C;  3HL9 A;  5BOH A;  1I2W A;  1J3W A;  3DWZ A;  4S2L A;  1YLJ A;  4LCL A;  5AQ7 A;  2V2F F;  2XA7 S;  1P97 A;  3PAE A;  4BD0 A;  4NKP A;  5HSQ A;  4S2O A;  5AQB A;  4N1X A;  2O9B A;  5CGX A;  1ACF A;  5C5K A;  3ZCZ A;  3M2J A;  4PM5 A;  5CHU A;  4XXR A;  2ZQ7 A;  3SW1 A;  3F1P A;  1FQG A;  5GHX A;  1SDN A;  2ZQC A;  3CI6 A;  3T1R A;  5A90 A;  1BUE A;  1FSY A;  3O88 A;  3D4F A;  5F83 A;  5HDS A;  4ARZ B;  3D72 A;  3NDG A;  1Y28 A;  2Y2P A;  4KUO A;  1ES3 A;  3ZG5 A;  2Y2J A;  4BWI A;  4E04 A;  1ESI A;  2QYB A;  1BLC A;  2O9C A;  4R0Q A;  5HAR A;  3ZG8 B;  3IT9 A;  3L7H A;  3HLD A;  2P04 A;  4Y2F A;  4BEN A;  3E4P A;  3LY3 A;  4HIA A;  1K56 A;  1ONH A;  1LSX A;  3GVB A;  4OQ0 A;  5FSR A;  4JXS A;  2Y59 A;  5HWW A;  3UE6 A;  3CWF A;  2PBY A;  3NOP C;  2XRN A;  3E4Q A;  2QJ5 A;  4E3N A;  2W3E A;  4E6X A;  4WZ4 A;  4CPK A;  2V8F A;  2GDN A;  1OPX A;  5HWV A;  3NDE A;  4FH4 A;  4KZ8 A;  3PBN A;  4HJ6 A;  1GSX A;  1JTD A;  5DF8 A;  2HP6 A;  3EEA A;  1PWC A;  5IHV A;  3OC2 A;  3B47 A;  3T4Q A;  5CER A;  2MJ6 A;  1WE4 A;  3UE0 A;  3O87 A;  3LCE A;  1IYO A;  1EW0 A;  2EX6 A;  3EEH A;  2WUQ A;  3PBR A;  3N7W A;  4EWF A;  4F3L B;  3PBT A;  4GZB A;  1Q2Q A;  3WRT A;  1MWU A;  4GB7 A;  2IWB A;  4EER A;  3HUO A;  1K6R A;  1WYC A;  3V5M A;  3IX8 A;  5EM0 A;  2JKF A;  2W3F A;  3H7W A;  5HX9 A;  4OQI A;  4OLG A;  5AQ9 A;  5K5B A;  3BRM A;  4WN5 A;  3HBR A;  2QJ7 A;  2WZX A;  3CUE A;  2EWV A;  4PM6 A;  4QWO A;  4P0M A;  3GEC A;  1JVJ A;  3DTI A;  3JYI A;  3N8L A;  3T50 A;  3VE4 A;  4OH0 A;  4EBN A;  2WGW A;  2VJW A;  1OJ5 A;  1NRJ A;  5EV0 A;  4CLC A;  2KX6 A;  2DRW A;  2WKP A;  4K91 A;  3UB9 A;  1GHM A;  5CTN A;  1YPR A;  1SKF A;  5CX7 A;  1XFQ A;  2PBD P;  2W1T B;  3GRJ A;  2J9O A;  2Y8H A;  4FUW A;  1BUL A;  4L0L A;  3HLE A;  4GS9 A;  1JWV A;  1PZO A;  3LO7 A;  4C3Q A;  5AVE A;  2KOI A;  2ZBB A;  3OPR A;  3T1Q B;  5IS1 A;  2NUT C;  2Z2M B;  1PW8 A;  4N9L A;  1EI5 A;  2ZM0 A;  1OJG A;  1OTE A;  4HY8 A;  4EEP A;  2XH9 A;  4RA7 A;  1P9W A;  2XR0 A;  1HTZ A;  5HDD A;  1CI9 A;  1TD5 A;  1DY6 A;  4MBF A;  3F1N B;  5EVI A;  3Q1F A;  5GHY A;  1K57 A;  3K3C A;  1YLT A;  1ZHH B;  2WKR A;  3CPT A;  1HZO A;  3DW0 A;  5EM1 A;  3BY9 A;  4MBH A;  5EVE A;  2Z2L B;  4P87 A;  3D9Y A;  4A5R A;  3IBJ A;  1Y4O A;  2PD8 A;  3NOT C;  1CJF A;  4GCZ A;  1X0O A;  4DDS A;  4EUZ A;  3FZC A;  4KZB A;  2R9X A;  4B88 A;  1MKI A;  4FTX A;  5EPH A;  4BD1 A;  3IWI A;  1IFQ A;  2Y79 A;  1NZO A;  1ES2 A;  2C6W B;  1IYQ A;  2VGJ A;  2PDR A;  3IS2 B;  1ODV A;  1OT6 A;  2GX5 A;  1MXO A;  1D06 A;  4OP5 A;  1M6K A;  3WRZ A;  1NLZ A;  2V1Z A;  3MQO A;  3IXG A;  3UPN A;  3HLW A;  3UDI A;  4BJP A;  3QP1 A;  3FPW A;  3LEQ A;  3UDX A;  1L2S A;  5GLC A;  2Y2H A;  4RX3 A;  3RXX A;  3SOI A;  5DFY A;  3BLS A;  3PYP A;  2JCH A;  3H82 B;  4NXG A;  4ZJ1 A;  4KG2 A;  3GV9 A;  5GL9 A;  3NJA A;  4KZA A;  3MFX A;  1ZKJ A;  4MEZ A;  2G7U A;  1PZP A;  3UPP A;  2WGV A;  4PM7 A;  4G3K A;  4F94 A;  3LIF A;  1DJB A;  3LUQ A;  2WAF A;  3Q7Z A;  5FEF A;  2OAP 1;  3SH8 A;  4E3I A;  3BFC A;  1SKO A;  5DFX A;  2A24 A;  5FA7 A;  4HI4 A;  5E2F A;  3ZYT A;  3MXS A;  3HLC A;  3GR2 A;  2OWJ A;  2Q0O A;  3K2N A;  4EBL A;  4IBX A;  3OZH A;  1L3L A;  3FYZ A;  5TFQ A;  3Q7V B;  1VEU B;  1ERM A;  4GDB A;  3VOL A;  1N9O A;  1SCW A;  2L4R A;  2R78 A;  4P85 A;  5IT5 A;  2JKT M;  3JVV A;  4X55 A;  4HBU A;  4N92 A;  3PHY A;  1K56 D;  4HP4 A;  3W8K A;  5FDS A;  1JTG A;  5FQM A;  1ES5 A;  3ZQ5 A;  1U60 A;  4OQH A;  2Y4A A;  3S1Y A;  1TS0 A;  4OPZ A;  4O7D A;  1H8Z A;  1S1Y A;  3QP6 A;  1ES4 A;  1AWI A;  4GHI B;  4GNU A;  1J9M A;  5J8X A;  3IWQ A;  4R3B A;  1XA1 A;  3LR0 A;  1TS7 A;  4Q0I A;  3S7O A;  4S2J A;  3UB6 A;  2XQZ A;  3NOU C;  1XX2 A;  3WS1 A;  4JGR A;  3MQQ A;  4Y7P A;  1DRM A;  4HP9 A;  2B5R A;  4QPR A;  4E3M A;  4O01 A;  4X1M A;  1ZTU A;  5CEB A;  1RP5 A;  4EET B;  1FOF A;  2W3D A;  1H8Y A;  2PHY A;  1JWZ A;  3FPV A;  3IXB A;  3H9W A;  2EA9 A;  1F9I A;  2V0U A;  1CEG A;  4BBU A;  5JYO A;  5F1F A;  3QNC A;  3FV7 A;  3CUE C;  4KQO A;  4YOF A;  5EOO A;  4PHT A;  2J80 A;  1S4S A;  1T1B A;  4U3T A;  3ZVW A;  2HZ5 A;  1QME A;  4HEF A;  3GTC A;  3C2W A;  3CZD A;  2ZMF A;  1ONG A;  5E2G A;  4B4X A;  5DJT A;  1ZG4 A;  3V67 A;  4P6B A;  5HAP A;  3OPH A;  4GD6 A;  1KGE A;  4WM9 A;  2Y2M A;  4JXV A;  4EEU A;  3R7W B;  1DP9 A;  3VSK A;  1I5Q A;  4ETZ A;  3AGF A;  4K0X A;  4RYE A;  1BTL A;  2H0T A;  4LV1 A;  5TBM A;  3V3R A;  2GZA A;  2UWX A;  5FL3 A;  4LV0 A;  5EUA A;  1YSQ A;  1A0K A;  5F68 A;  3BEC A;  4EW7 A;  4CLC D;  2C5W B;  4OKP A;  3S7P A;  1VQQ A;  2WAD A;  2PYR A;  3IWO A;  4R23 A;  2JHE A; 
#chains in the Genus database with same CATH homology
 5HAQ A;  5FQK A;  1PI4 A;  1BSG A;  5CHJ A;  5GHZ A;  4C75 A;  3ZDJ A;  1HVB A;  1YLW A;  4OPQ A;  1LL5 A;  5DVA A;  4NK3 A;  5HW3 A;  1IYO A;  5CHM A;  5EVI C;  2EX6 A;  1EWZ A;  3SS3 A;  3TSG A;  4HBT A;  5FI6 A;  4U0X A;  3RJU A;  2HDQ A;  4BQM A;  3MBZ A;  4E3J A;  4IED A;  3IXD A;  3RXW A;  1LI0 A;  1NJ4 A;  2HDS A;  2WUQ A;  3N7W A;  3PBR A;  3ITB A;  3Q81 A;  4OOM A;  1C3B A;  4EWF A;  4WEK A;  1ALQ A;  2HDU A;  3PBT A;  4GZB A;  1Q2Q A;  3UO9 A;  3W4Q A;  3VMA A;  2X02 A;  1LHY A;  2WKH A;  1G68 A;  4KZ4 A;  5CTM A;  2WKE A;  3S22 A;  2JBF A;  3NI9 A;  3WRT A;  3G31 A;  1MWU A;  3G4P A;  4GB7 A;  2IWB A;  4N1H A;  4NET A;  3HUO A;  1K6R A;  1WYC A;  2BLS A;  4WZ5 A;  3V5M A;  3OPP A;  3DWK A;  4R3J A;  4ZBE A;  5G18 A;  1MBL A;  3VFH A;  1W7F A;  4FH2 A;  5EVI D;  3VP2 A;  3PBS A;  2QZ6 A;  2Y2Q A;  1BLH A;  4OQI A;  4OLG A;  5EE8 A;  3Q07 A;  5AQ9 A;  3E2K A;  5HX9 A;  5I94 A;  4OVD A;  4KZ9 A;  2P9V A;  3BRM A;  3MZE A;  4WMC D;  3HBR A;  1FR1 A;  2A49 A;  4QY5 A;  4WZ5 C;  3PBO A;  4YFM A;  2OV5 A;  2XD5 A;  1KGG A;  3TG9 A;  4OLD A;  4X56 A;  2ZC7 A;  2WZX A;  1PI5 A;  4E3O A;  1ESU A;  4PM6 A;  5A91 A;  1MWS A;  1NYY A;  2PU4 A;  4JXW A;  3M2K A;  4P0M A;  1L0D A;  4S2N A;  2HP9 A;  4EBP A;  2XK1 A;  1JVJ A;  3SS4 A;  4B4Z A;  5DTT A;  1XKZ A;  3ZFZ A;  3JYI A;  3N8L A;  4K0W A;  1CEF A;  4JF5 A;  2ZMA A;  4KQR A;  3CJM A;  4OH0 A;  4FCF A;  1PIO A;  2FFF B;  2BG1 A;  2I72 A;  4KZ6 A;  4EBN A;  1FR6 A;  1HD8 A;  2WGW A;  2XLN A;  1H5X A;  4GDN A;  2CC1 A;  4DE1 A;  3ZNT A;  5A92 A;  3NIA A;  1QMF A;  1K54 A;  5JYP A;  3C4P A;  1G6A A;  2HPB A;  2DRW A;  4K91 A;  1YMX A;  4UA9 A;  1E3U A;  2Q9M A;  1GHM A;  5CTN A;  4PM8 A;  2OSU A;  4LCM A;  1GA9 A;  1LL9 A;  2WYX A;  3I7J A;  1PWD A;  5GLD A;  4E3K A;  1SKF A;  1K55 A;  3IXH A;  4WEJ A;  1K54 C;  5U47 A;  2Y2O A;  5FQ9 A;  3GRJ A;  4X6T A;  3UDF A;  3OCN A;  2IWC A;  2J9O A;  4KZ5 A;  5CED A;  1E25 A;  1BUL A;  3OCL A;  4M3K A;  5D3O A;  3PBQ A;  2Y2G A;  3GQZ A;  1K55 C;  4L0L A;  1W5D A;  3C7V A;  3HLE A;  1IYS A;  3ZVT A;  3EQV A;  1JWV A;  1PZO A;  3IHB A;  3LO7 A;  2Y2I A;  4C3Q A;  5DTS A;  4DRT A;  1FSW A;  3NY4 A;  3OPR A;  3MZD A;  4JF6 A;  5GLB A;  3CG5 A;  5FAO A;  1KGF A;  3HLB A;  2Z2M B;  1PW8 A;  2EX9 A;  2WKI A;  3VOY A;  2Q9N A;  3MXR A;  4IBR A;  2OLU A;  4N9L A;  3BLM A;  3A3F A;  1EI5 A;  2H10 A;  3P98 A;  1Y54 A;  1RGZ A;  1FCN A;  2X01 A;  4DE2 A;  2VGK A;  4QJG A;  3UNW A;  4Y0T A;  1NZU A;  2V20 A;  5EEC A;  2ZM0 A;  4IVK A;  3UY6 A;  2JC7 A;  2H5S A;  3G30 A;  2XH9 A;  3LY4 A;  4RA7 A;  2ZLY A;  3UN7 A;  3PTE A;  2XR0 A;  3M6H A;  1HTZ A;  4FD8 A;  3SS5 A;  2HP5 A;  2P9V B;  3EQU A;  5FDH A;  5M18 A;  1CI9 A;  1ERO A;  3IH9 A;  1DY6 A;  1PWG A;  3A3E A;  4MBF A;  4S2P A;  5GLA A;  5EVI A;  5FAS A;  3Q1F A;  4OPR A;  5GHY A;  1W8Q A;  1KE4 A;  1LI9 A;  1K57 A;  2WK0 A;  4KZ3 A;  1E4D A;  5DTK A;  1YLT A;  4KEN B;  4WMC A;  2XEP A;  4OOY A;  3SH9 A;  5AQA A;  1HZO A;  3DW0 A;  2JE5 A;  4DXC A;  3QNB A;  2ZQA A;  3ZG9 B;  4OQG A;  3ISG A;  2ZD8 A;  2IWD A;  3VFF A;  4MBH A;  1K57 C;  1ZG6 A;  1XXM A;  1GCE A;  2Z2L B;  3A3I A;  4P87 A;  4A5R A;  1DJA A;  2ZQ8 A;  1TDG A;  3IF6 A;  2WGW B;  2XFT A;  4BL2 A;  1W79 A;  1YQS A;  2DCF A;  3BFD A;  3VP0 A;  3S4X A;  4DDS A;  4Z9Q A;  4EUZ A;  3FZC A;  2H0Y A;  4KZB A;  2R9X A;  3ZG0 A;  4IVI A;  4DF6 A;  1KVM A;  1MKI A;  4B88 A;  5KZH A;  1CK3 A;  2Y2L A;  1YT4 A;  1ZC2 A;  5CXW A;  3HLG A;  5CEC A;  3WS2 A;  3IF6 C;  3QHY A;  5EPH A;  3ZGA B;  2G2U A;  4BD1 A;  3IWI A;  3MFD A;  4D2O A;  5FAT A;  1OME A;  1XP4 A;  1NZO A;  1Z6F A;  1ES2 A;  1BLP A;  1GHI A;  1GA0 A;  5DF9 A;  4GKU A;  2C6W B;  4JXG A;  4QD4 A;  1IYQ A;  5CGS A;  2QPN A;  2VGJ A;  1XPB A;  1I2S A;  2XFS A;  1Q2P A;  3Q7V A;  4R4R A;  1NRF A;  2G2W A;  3BFE A;  1MXO A;  3E2L A;  4OP5 A;  3O3V A;  1S0W A;  2HDR A;  4PPR A;  4OPY A;  1M6K A;  2E8I A;  1KVL A;  3UE1 A;  2WAE A;  3WRZ A;  1K4E A;  3NBL A;  3DTM A;  3G34 A;  1BT5 A;  4GOG A;  1MWT A;  1TEM A;  4EV4 A;  2EX2 A;  3BM6 A;  2V1Z A;  3W4P A;  3IXG A;  4GD8 A;  3HLW A;  3UDI A;  3UPN A;  4BJP A;  4MBK A;  3FKW A;  3UDX A;  1K6S A;  5KSH A;  1L2S A;  3NC8 A;  5GLC A;  2Y2H A;  4RX3 A;  3RXX A;  3SOI A;  3UE3 A;  4E3L A;  3VOZ A;  1KDW A;  4OP8 A;  4QU3 A;  5KSC A;  5E2E A;  1PYY A;  3BLS A;  3N4I A;  2JCH A;  3A3D A;  5A93 A;  2EXA A;  5FI2 A;  3W4O A;  4ZJ1 A;  4KG2 A;  3GV9 A;  4DDY A;  1L0G A;  5EVI B;  5GL9 A;  1KE0 A;  3Q82 A;  4KZA A;  1JWP A;  2ZC3 B;  1FCO A;  5CRF A;  2ZC5 B;  1ZKJ A;  4N9K A;  3C4O A;  2ZQ9 A;  4KQQ A;  4MEZ A;  3BYD A;  1PZP A;  1ERQ A;  3BEB A;  3TOI A;  3UPP A;  3ZHH A;  2WGV A;  4PM7 A;  3G2Y A;  4DE0 A;  3IHA A;  1NY0 A;  4UA6 A;  1YMS A;  4OOL A;  4H8R A;  3ZNY A;  2A3U A;  4BL3 A;  4F94 A;  2RCX A;  1L0F A;  1YLZ A;  3HRE A;  4X53 A;  2ZQD A;  1YLP A;  1DJB A;  1K25 A;  4Y0U A;  1CI8 A;  2Y2K A;  1SHV A;  2WAF A;  1L0E A;  1M40 A;  4Y0O A;  5FQQ A;  1O7E A;  3Q7Z A;  3V39 A;  3IF6 B;  4R1G A;  2R9W A;  1IKI A;  2ZM8 A;  4Q8I A;  4JKT A;  3SH8 A;  3BFG A;  4E3I A;  4EQI A;  3BFC A;  3WS0 A;  1IKG A;  4S2I A;  2Y2N A;  2WZZ A;  3BFF A;  5HAI A;  2Y55 A;  3VP1 A;  2ZM2 A;  4KZ7 A;  3G35 A;  5F82 A;  4XUZ A;  4LEN A;  3MKE A;  2FFY A;  5E2H A;  4ZJ3 A;  5FA7 A;  5E2F A;  3GSG A;  3MXS A;  3MKF A;  4OON A;  3HLC A;  1WYB A;  3GR2 A;  1RGY A;  4PM9 A;  3VSL A;  3V3S A;  5FQJ A;  4EBL A;  4IBX A;  1N4O A;  5F1G A;  3M6B A;  3OZH A;  3FYZ A;  5TFQ A;  3C7U A;  3G32 A;  3Q7V B;  4MLL A;  5FQI A;  1ERM A;  4GDB A;  3UPO A;  1SCW A;  3IQA A;  1AXB A;  5TGF A;  4KG6 A;  4BLM A;  3AGE A;  4P85 A;  1YM1 A;  3AGD A;  3FWL A;  4X55 A;  4ID4 A;  2PU2 A;  1K38 A;  4HBU A;  4N92 A;  1BZA A;  1K56 D;  3W8K A;  4WEL A;  1JTG A;  1NXY A;  5FQM A;  2X71 A;  1ES5 A;  1XGJ A;  2RL3 A;  2EFU A;  3LEZ A;  1U60 A;  4OQH A;  3HLF A;  4MNR A;  5FAP A;  3HL9 A;  5BOH A;  2Y4A A;  1I2W A;  3S1Y A;  3DWZ A;  5M1A A;  5E43 A;  4OPZ A;  1TVF A;  4O7D A;  3VP4 A;  3NCK A;  4S2L A;  1YLJ A;  1H8Z A;  3FKV A;  1MWR A;  1ES4 A;  1DJC A;  1MY8 A;  4LCL A;  4GNU A;  4QB8 A;  1J9M A;  1IYP A;  3IWQ A;  5AQ7 A;  4R3B A;  5J8X A;  4UA7 A;  5L2F A;  2ZJ9 A;  1IEM A;  4R4S A;  1XA1 A;  3WS4 A;  3GMW A;  2V2F F;  4GN2 A;  4S2K A;  3P09 A;  3V50 A;  3SH7 A;  4KG5 A;  4S2J A;  5TR7 A;  2XD1 A;  4PMA A;  3MZF A;  1KE3 A;  2XQZ A;  3PAE A;  4BD0 A;  3WS5 A;  2EX8 A;  4S2O A;  5AQB A;  4N1X A;  1XX2 A;  1W8Y A;  4RX2 A;  5CGX A;  2OLV A;  3ZCZ A;  4DKI A;  5EVL A;  1FCM A;  3WS1 A;  4ZDX A;  3M2J A;  2ZC4 B;  4HES A;  4PM5 A;  5CHU A;  1KDS A;  1RCJ A;  3PAG A;  4Y7P A;  4XXR A;  1K4F A;  2ZQ7 A;  2B5R A;  4XUX A;  1FQG A;  4C6Y A;  4E3M A;  5GHX A;  2ZC6 B;  1NYM A;  5DF7 A;  4UHU A;  1SDN A;  2ZQC A;  2EFX A;  4JF4 A;  5CEB A;  1RP5 A;  3VP3 A;  1FOF A;  3N8S A;  4UAA A;  5EOE A;  5A90 A;  1BUE A;  1FSY A;  1H8Y A;  1JWZ A;  3O88 A;  3D4F A;  4U0T A;  5F83 A;  3IXB A;  4ZAM A;  3HVF A;  1BLS A;  5HL1 A;  3WWX A;  3IH8 A;  1CEG A;  3C5A A;  4YIN A;  3G2Z A;  4ZJ2 A;  5JYO A;  3ITA A;  3NDG A;  4QHC A;  2XDM A;  3O86 A;  4DE3 A;  3QNC A;  5F1F A;  1XGI A;  3FV7 A;  2Y2P A;  4DXB A;  1ES3 A;  4KQO A;  3ZG5 A;  2Y2J A;  3A3J A;  3N8R A;  4S2N C;  1ESI A;  5EOO A;  1BLC A;  3ZG7 B;  1GHP A;  1VM1 A;  2WGI A;  1O07 A;  3B3X A;  2XF3 A;  4R0Q A;  5HAR A;  3ZG8 B;  3IT9 A;  4U3T A;  3HUM A;  3ZVW A;  1QME A;  4HEF A;  3GTC A;  3HLD A;  4JBF A;  3CZD A;  4WYY A;  4BEN A;  4JPM A;  3LY3 A;  4QY6 A;  1K56 A;  1ONG A;  1ONH A;  2J8Y A;  5E2G A;  4LV2 A;  5CGW A;  4B4X A;  3GVB A;  4OQ0 A;  5FSR A;  2P74 A;  2Y59 A;  4JXS A;  1ZG4 A;  1SDE A;  4P6B A;  1PW1 A;  3OPH A;  4X68 A;  5HAP A;  2XGN A;  3CMZ A;  1S6R A;  2PBY A;  2Y91 A;  1LLB A;  4GD6 A;  1N9B A;  1KGE A;  4WM9 A;  5FI7 A;  2Y2M A;  4JXV A;  4S2M A;  4E3N A;  3OPL A;  1TDL A;  2J9P A;  3VSK A;  1I5Q A;  3AGF A;  4E6X A;  4K0X A;  4RYE A;  4WZ4 A;  4FSF A;  1BTL A;  2H0T A;  4LV1 A;  4CPK A;  3V3R A;  2UWX A;  4LV3 A;  4RVA A;  2GDN A;  5M19 A;  1MPL A;  4LV0 A;  5EUA A;  1XA7 A;  4ZTK A;  3BEC A;  3NDE A;  2J7V A;  4FH4 A;  4WBG A;  4KZ8 A;  2EXB A;  3IF5 A;  3PBN A;  4JLF A;  4X69 A;  4CJN A;  1JTD A;  1E3U D;  5DF8 A;  5FAQ A;  5HFO A;  2C5W B;  2DNS A;  1IEL A;  4OKP A;  2HP6 A;  3N6I A;  1VQQ A;  2QMI A;  1PWC A;  5IHV A;  2WAD A;  3OC2 A;  1YLY A;  5CER A;  1WE4 A;  3HUN A;  3IWO A;  4R23 A;  5KMW A;  3UE0 A;  3O87 A;  4E6W A;  3LCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...