4BQMA

Crystal structure of human liver-type glutaminase, catalytic domain
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
318
structure length
296
Chain Sequence
b'LYFQSMIPDFEEFTGHVDRIFEDVKELPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHKFVGKEPSLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAGNEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGAILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMINASE LIVER ISOFORM, MITOCHONDRIAL
publication title Crystal Structure of Human Liver-Type Glutaminase, Catalytic Domain
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 104
structure length 296
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04960 Glutaminase Glutaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4bqmA00
2ZM0A 4X68A 1PI5A 3AGDA 2ZJ9A 1RGZA 1I5QA 4KQRA 1M40A 4KZ6A 4PMAA 2C6WB 3EQVA 4XXRA 3W4OA 5HARA 1O07A 2Y2PA 3ZNTA 5KZHA 4UHUA 4S2JA 2XEPA 1W5DA 2J9PA 4WBGA 4P6BA 1JWZA 3Q7VB 4KZ8A 1K4EA 3IH9A 1BSGA 5EVID 3UE3A 4JXSA 3UPPA 3OPHA 1KE3A 3NI9A 2ZQ8A 1E3UA 3IQAA 5GHXA 3RJUA 3G34A 4KZBA 3UO9A 3M2JA 2XF3A 3G2ZA 2XH9A 4L0LA 3VOZA 3VFHA 3OPLA 5M19A 2PU4A 2JE5A 5CHUA 3CZDA 4N1HA 3SS5A 1Q2PA 4X53A 2Y2MA 1KDWA 4B88A 4OQIA 3HVFA 3SH9A 4YINA 1XP4A 1Y54A 1YLJA 3G31A 4GKUA 2I72A 1K55A 3IWQA 4GB7A 4PM5A 1ALQA 3N8RA 1FCOA 1LLBA 4S2OA 1CI8A 2ZLYA 4JKTA 1XGJA 4JXGA 4N1XA 3DWZA 4QB8A 2J9OA 3SS3A 3PBRA 2WUQA 2QPNA 5U47A 2ZQAA 4KZAA 4OLDA 4Y0TA 1WYBA 5CEDA 1I2SA 4DDYA 1K38A 2P9VA 4IVIA 4OONA 2EFXA 2Q9MA 2X01A 4Z9QA 3RXXA 1QMEA 4EV4A 3CMZA 1L0EA 1IKGA 4HEFA 4OQGA 2HP9A 3PBQA 3VMAA 4XUXA 2Y2IA 5DTSA 3VOYA 3ZGAB 4LV3A 4BD1A 2A49A 3V50A 5HAIA 1IEMA 4X56A 1FOFA 2XFSA 2XD5A 2Q9NA 5GLDA 2ZC3B 5FI7A 2C5WB 3A3FA 4S2NC 3TOIA 1E25A 1HZOA 5E2HA 1SHVA 3EQUA 3NIAA 4DRTA 3O3VA 3GSGA 4FSFA 1NY0A 5A92A 2A3UA 3C7VA 3TG9A 5CTNA 4E3IA 3UDFA 4Q8IA 4S2MA 4P0MA 4HESA 4RYEA 5EECA 4KG2A 1BT5A 1JWVA 3WS1A 2HP5A 1PWGA 1J9MA 1Z6FA 4DE1A 1PW8A 4F94A 4ZJ1A 3ITBA 4QY5A 5E2GA 3HLDA 4K91A 2XGNA 4OPQA 1ZG4A 1C3BA 4OQ0A 5HFOA 2XK1A 1KE4A 4IEDA 3E2LA 1KGEA 4KENB 4KQQA 5CTMA 1XPBA 1FCMA 1HD8A 4BLMA 1H5XA 2JBFA 3M6BA 3ZVWA 3AGEA 3UE0A 1RP5A 4WMCD 3B3XA 3WS2A 4C75A 5A93A 3MKFA 4ZJ2A 5FAQA 3LCEA 1GCEA 4N92A 1JWPA 5JYOA 1FCNA 4MBKA 4OOLA 2B5RA 2OLVA 3M2KA 3IWIA 1BLHA 5GHYA 3PAEA 2WGIA 1K56D 4WZ5C 4RVAA 3GQZA 5EVIA 3WS4A 5EOOA 1LHYA 3O86A 2G2UA 5HAQA 3NBLA 3Q1FA 1CEGA 4EBPA 1NRFA 4UA7A 3IWOA 1PZOA 5A91A 5EOEA 4QY6A 3FKVA 5F82A 3A3DA 2RCXA 2WZXA 1L0FA 2Y2GA 3LY3A 4EUZA 3FV7A 4OKPA 5FSRA 3MZEA 4GNUA 3ZCZA 3P98A 2ZM2A 5FA7A 3ZG7B 1PZPA 3FYZA 4WEJA 1ES3A 2BG1A 4C6YA 4QHCA 1M6KA 5EVIB 4NETA 4R0QA 5JYPA 3G4PA 4Y0UA 3HLGA 3ZG8B 4E3MA 2Y4AA 4MEZA 5DF9A 2JC7A 3O88A 4JPMA 2WKEA 1H8YA 4S2IA 2ZM8A 3D4FA 5AQ7A 4Y0OA 4S2LA 1PWCA 1KE0A 2BLSA 1VQQA 4IBXA 1W79A 2H10A 2WADA 3VSLA 1YLWA 2WGWA 1DJAA 5GLCA 4CJNA 5CECA 2G2WA 3MZDA 3PBTA 4P85A 1XGIA 4B4XA 5L2FA 2ZC6B 5FDHA 3WS0A 1CI9A 2XD1A 3M6HA 4PM8A 3DWKA 3VP0A 1K55C 2FFYA 4E3LA 4FH4A 4QJGA 1K54A 2WAFA 1L0DA 1TVFA 2DRWA 4RX2A 1XKZA 2ZMAA 1S0WA 1BUEA 4GOGA 4OOYA 4QD4A 5M18A 4ZTKA 1HTZA 2HDSA 1XA7A 3LY4A 2WYXA 5CGSA 4MBFA 4KZ3A 4KZ4A 3UPOA 2WGWB 4R3JA 3IHAA 4OH0A 5AQ9A 2ZD8A 1PYYA 5GLBA 4UAAA 1KVLA 1N9BA 3LO7A 4KQOA 1S6RA 3BEBA 1SDNA 3N4IA 4ZBEA 3NDEA 5FI6A 4OLGA 3OZHA 4JBFA 4FCFA 1KGGA 2EX9A 5F83A 1IELA 2UWXA 3S22A 5BOHA 3GTCA 1QMFA 5CHJA 3HL9A 4KZ5A 1PWDA 3QHYA 2EX8A 2VGKA 2Y2QA 2WKIA 2XDMA 3C7UA 4OPRA 4RA7A 2DNSA 5KMWA 2QZ6A 2OV5A 3A3IA 1YM1A 3FWLA 3IF6A 3OPRA 3PBOA 1YLYA 1NJ4A 3DW0A 4WMCA 3W4PA 1LL9A 3LEZA 2P9VB 3OCLA 4BD0A 3PBNA 3ISGA 4X55A 1MWUA 3ITAA 3SS4A 5HW3A 4GDBA 3QNBA 1BLPA 4MNRA 3A3JA 4U0TA 1MY8A 4M3KA 1K56A 1MWTA 4BJPA 5KSHA 1FSWA 3AGFA 4JF5A 1ZC2A 1W7FA 2V1ZA 5F1FA 4MLLA 3PAGA 3IF6B 3BFFA 3PTEA 5FI2A 5G18A 1MKIA 4P87A 3WRZA 4BQMA 4O7DA 4KZ7A 2QMIA 3HUMA 3IXGA 3ZHHA 4LV1A 3GRJA 3VP2A 1TDGA 1JVJA 1BZAA 1ONHA 4JXWA 4R3BA 1RCJA 3UDIA 2Y91A 2IWBA 3W8KA 3IXBA 2Y2OA 1EWZA 5TGFA 1MXOA 3ZDJA 3E2KA 2P74A 5HL1A 4DF6A 3ZVTA 3WWXA 5EVIC 4GD6A 1KGFA 2H5SA 3HLFA 2OSUA 4WZ4A 2ZQCA 3TSGA 5KSCA 4A5RA 4WELA 4DXCA 2FFFB 2Y2NA 5FASA 3V39A 1PI4A 3NC8A 2RL3A 3HLEA 5FQIA 4S2KA 4BL3A 1YLPA 1BLSA 3G35A 4IBRA 4GN2A 1K4FA 4DE0A 3NDGA 3ZG5A 2E8IA 1TDLA 3UNWA 4EBLA 1K57C 2ZQ7A 1ES4A 3HLWA 3G30A 3BYDA 4ID4A 5TR7A 5I94A 1DJCA 1AXBA 1Q2QA 2EXBA 3IT9A 2DCFA 1NZOA 5HAPA 1EROA 5DTKA 4LENA 1BTLA 1DY6A 2J7VA 4OP5A 4R23A 1YLTA 5E2FA 2ZC5B 1K57A 4ZAMA 3ZNYA 4N9KA 3HUNA 4WYYA 5FAOA 4FD8A 4E6WA 4PM6A 2XLNA 1L2SA 1G6AA 3JYIA 3UPNA 4E3OA 2ZQ9A 3GVBA 2HPBA 5A90A 2VGJA 4PM9A 4EBNA 3V3SA 2WK0A 3HREA 1YMSA 4OPZA 1ZKJA 5CXWA 4BL2A 1IYPA 1K54C 4DE2A 2IWDA 4K0XA 4LCMA 3UE1A 4KZ9A 3UN7A 2HDQA 1G68A 3Q7ZA 3OC2A 3VFFA 4ZJ3A 4U3TA 1WYCA 4JLFA 3C5AA 4JF6A 3N7WA 5E43A 1SCWA 1JTGA 3Q07A 4DKIA 1ERQA 1I2WA 1ES5A 4CPKA 4E3JA 4DXBA 5GLAA 3BFDA 2HDUA 2Y55A 4D2OA 5FQ9A 4E3KA 2PBYA 1KVMA 1H8ZA 1K25A 1WE4A 2R9WA 3BM6A 2IWCA 1MWRA 1O7EA 5DF8A 2WAEA 2WGVA 4UA6A 3MXSA 2PU2A 1IYOA 2HDRA 5FQJA 2J8YA 3G32A 4E3NA 5FQQA 4LV2A 1W8YA 1PW1A 3UDXA 1XXMA 3BFCA 4BENA 1MBLA 3IXDA 4PPRA 3N6IA 1GA9A 1XX2A 1DJBA 1E4DA 2XFTA 3MZFA 3IF6C 5IHVA 1FQGA 3IF5A 2XR0A 4EQIA 1GHIA 4E6XA 3C4PA 4HBTA 4U0XA 4GZBA 3IXHA 3S1YA 2V20A 5HX9A 4EWFA 2GDNA 4OP8A 3HLCA 3V5MA 1LI0A 1YMXA 2X02A 2CC1A 3ZG9B 3HBRA 1FR6A 3VSKA 4DE3A 2EX6A 2WZZA 4B4ZA 1YT4A 4JF4A 5CEBA 1NXYA 4LV0A 3NCKA 5E2EA 2ZC4B 4R1GA 5CGWA 4YFMA 4QU3A 4OOMA 1N4OA 1BLCA 1GA0A 3WS5A 1E3UD 5CRFA 3P09A 3VP1A 1NYMA 5EPHA 4UA9A 2Z2MB 1OMEA 5F1GA 1ESUA 4ZDXA 4IVKA 3WRTA 1IYSA 3MXRA 3OCNA 3UY6A 5J8XA 5AQBA 3FZCA 4DDSA 4MBHA 3CG5A 1ES2A 2EXAA 5EVLA 1SKFA 5M1AA 4K0WA 1GHMA 1K6SA 2JCHA 4WEKA 3VP4A 2ZC7A 5FQMA 1PIOA 3MBZA 3ZG0A 3V3RA 3RXWA 1CEFA 1HVBA 3Q81A 4NK3A 1GHPA 3N8SA 3G2YA 4KG6A 1TEMA 3HLBA 4PM7A 4S2NA 2Y2JA 4X6TA 4OQHA 2EX2A 3BECA 2H0YA 3PBSA 3QNCA 4WM9A 5CERA 4Y7PA 3A3EA 2HP6A 3MKEA 3BFGA 1FR1A 3CJMA 3BLMA 4OPYA 2Y2LA 2Z2LB 4FH2A 1KDSA 1MPLA 3N8LA 5DF7A 4GDNA 4RX3A 5GL9A 5CGXA 2XQZA 3IHBA 3O87A 5TFQA 4LCLA 1BULA 1ERMA 2WKHA 2Y2KA 1FSYA 3GR2A 4GD8A 4HBUA 3Q82A 4C3QA 5D3OA 5DTTA 1ZG6A 1LI9A 4OVDA 3ZFZA 1ONGA 5EUAA 2R9XA 3SOIA 1CK3A 1JTDA 4XUZA 3GMWA 3VP3A 3FKWA 1W8QA 5CHMA 4KG5A 2Y2HA 4N9LA 3HUOA 1RGYA 2EFUA 4S2PA 3W4QA 1K6RA 1NYYA 3SH8A 1IYQA 5FQKA 1L0GA 3MFDA 3BRMA 1U60A 5AQAA 1YLZA 2X71A 1SDEA 1VM1A 2OLUA 5GHZA 3NY4A 2V2FF 3IH8A 5FAPA 2H0TA 3SH7A 1ESIA 1LL5A 3C4OA 2Y59A 5DVAA 3BFEA 1NZUA 3DTMA 3S4XA 3Q7VA 4WZ5A 3BLSA 3GV9A 4JXVA 1XA1A 2ZQDA 3I7JA 1IKIA 4H8RA 4R4RA 1YQSA 5FATA 5EE8A 1MWSA 1EI5A 4R4SA 4X69A 3OPPA
chains in the Genus database with same CATH superfamily
2ZM0A 4D60A 4LRYC 3F1OA 2W1RA 3W4OA 5KZHA 4NXFA 3F1NA 4WBGA 4O0PA 4K08A 4HJ6A 3UPPA 2Y8HA 2PRFA 2EWWA 4KZBA 3CWFA 5HWWA 3F1OB 3F1NB 4GLQA 2P7JA 3R4KA 4Y5FA 4GKUA 4GB7A 1ALQA 3N8RA 4FUWA 1TS8A 2J9OA 3CAXA 3SS3A 3PBRA 1ODVA 2QPNA 4Y0TA 5CEDA 4IVIA 2PR5A 2X01A 4EV4A 3CMZA 1IKGA 4OQGA 4XUXA 4L9FA 4X56A 2D02A 1FOFA 3A3FA 3TOIA 1S67L 1E25A 1HZOA 3KSGA 4G3KA 4DRTA 5A92A 4AFIA 3LIAA 4S2MA 4WF0A 3LIEA 1Z6FA 2HF6A 2JN7A 3ITBA 3HLDA 3T1RA 2XGNA 1KE4A 4KQQA 5CTMA 1XPBA 2PBDP 1FCMA 4BLMA 4CLCC 3M6BA 3UE0A 1RP5A 4WMCD 5A93A 4ZJ2A 2LB5A 4B93A 3LCEA 4OOLA 1XJ2A 5GHYA 2WGIA 5EOOA 3O86A 3GECA 3Q1FA 1CEGA 4EBPA 3UE6A 4UA7A 3IWOA 1L0FA 3UB7A 5FA7A 4MN7A 1ES3A 2BG1A 4QHCA 4Y0UA 1UWNX 4MEZA 5DF9A 2JC7A 3O88A 5AQ7A 4Y0OA 1PWCA 1KE0A 2BLSA 3RFBA 1VQQA 1TF1A 5CECA 1YLWA 4CJNA 2G2WA 1H8MA 1XGIA 1T1BA 1MKMA 1G28A 2WAFA 2DRWA 4QD4A 5M18A 3C30A 4FTXA 1XA7A 5CGSA 4R3JA 4OH0A 5AQ9A 2R78A 3U2AA 3LO7A 3BEBA 4I3AA 3N4IA 4R3AA 4FCFA 4X1MA 2P08A 4WUJA 3MMHA 3S22A 2VLGA 1OTBA 3TE8A 3LR4A 4Q0JA 2Y2QA 3C7UA 1LSVA 5KMWA 2DNSA 4NEED 4WMCA 2YKHA 3W4PA 1DP8A 4BD0A 1KOUA 4X55A 1MWUA 3ITAA 5HW3A 5LBRA 3EEAA 1BLPA 3A3JA 1TS0A 5KSHA 1FSWA 3AGFA 1ZC2A 1TS7A 4MLLA 2JKTM 4P87A 1N9LA 1WA9A 4BQMA 3KYEA 4KZ7A 3HUMA 3IXGA 1XJ6A 4LV1A 2Y91A 3IXBA 2Y2OA 5TGFA 5HL1A 3WWXA 4KUKA 4WZ4A 3TSGA 2ZQCA 5KSCA 3NC8A 2RL3A 4DE0A 3UNWA 3BYDA 5TR7A 5L10A 3IBRA 1OJ5A 2DCFA 3BW6A 4PKYG 4LENA 1BTLA 2J7VA 4HY8A 4EQ1A 1YLTA 3UB6A 2ZC5B 2INWA 2L0WA 4ZRRA 4GS9A 1G6AA 3GVBA 2HPBA 4PM9A 3V3SA 3V67A 1YMSA 1ZKJA 1P97A 3B33A 5IT5A 1K54C 4ETXA 3UE1A 3MFXA 2HDQA 3Q7ZA 3OC2A 4GS9B 4EETB 2GJ3A 3CUEC 1I2WA 2QWSA 3T4JA 4D2OA 4QPRA 1KVMA 1S1ZA 3UB9A 2IWCA 3GDIA 3T4LA 3LEQA 2WAEA 2WGVA 5FQJA 4LV2A 1W8YA 2WKRA 4PPRA 1DJBA 2XFTA 3IF6C 5IHVA 4EQIA 3KYZA 1GHIA 3C4PA 4EWFA 2W27A 3T50A 3H7WB 3V5MA 1LI0A 3VE3A 2X02A 3ZG9B 3HBRA 1FR6A 3FPWA 2EX6A 4JF4A 3P01A 4CLCE 1NXYA 1IFQA 4YWZA 1GA0A 3WS5A 1E3UD 2Z2MB 5F1GA 4LGWA 4IVKA 3MXRA 3OCNA 4DDSA 2W3DA 4KUOA 3ICYA 5EVLA 2EA9A 4WL9A 4K0WA 2JCHA 1PIOA 5HD5A 4X25A 3V3RA 1HVBA 1T1AA 3Q81A 2OAQ1 2Y2JA 2Z6DA 2EX2A 4WM9A 3A3EA 1ACFA 3BFGA 4ETZA 5DKLA 2Y2LA 2Z2LB 3N8LA 3QP4A 2BASA 4GDNA 2XQZA 2V1BA 1ERMA 2WKHA 3GR2A 1FSYA 4GD8A 5D3OA 1ZG6A 4JGPA 1ONGA 2AVXA 3VP3A 5CHMA 4N9LA 1RGYA 2D01A 2EFUA 2PAVP 1UWPX 2QYBA 3BRMA 1YLZA 4L9GA 3IH8A 2H0TA 1OTIA 3P7NA 2PDRA 2Y59A 3K3CA 3BFEA 3DTMA 3T12B 4WZ5A 4JXVA 2ZQDA 1IKIA 4H8RA 3S1YA 4X69A 4FH2A 4X68A 3AGDA 4KZ6A 2C6WB 3EQVA 4I38A 3TW8A 3ZNTA 2Y2PA 4LLOB 2J9PA 4KZ8A 1K4EA 3UE3A 4EEPA 3HJKA 1IOUA 1KE3A 1DRMA 3NI9A 1E3UA 5GHXA 3RJUA 3G34A 2J3TC 3EWKA 3UO9A 2PD8A 3VFHA 2QHKA 2JE5A 5CHUA 3CZDA 2W3EA 4N1HA 3SS5A 4X53A 2Y2MA 1KDWA 3O5YA 4NXGA 1YLJA 3G31A 1V9YA 1LLBA 4S2OA 2ZLYA 2I9VA 1XGJA 4N1XA 3TRCA 4KZAA 4OLDA 2VV6A 4MN6A 4DDYA 2P9VA 2EFXA 1AWIA 1L0EA 3CLOA 3PBQA 3VMAA 5DTSA 3OBFA 2A49A 2A24A 5HAIA 2XFSA 2XD5A 3LUQA 5GLDA 5FI7A 4WLAA 1X0OA 3DTIA 1NY0A 4E3IA 3UDFA 2A24B 4B9OA 3CITA 4HESA 4RYEA 4KG2A 3WS1A 4Q0HA 1G6OA 1PW8A 4OQ0A 1YSPA 5AVEA 3ZVWA 5L8MA 1XJ4A 1GSVA 2QJ7A 3MKFA 1ZTUA 5FAQA 5JYOA 2B5RA 4EERA 3IWIA 1BLHA 3W2ZA 1K56D 4RVAA 3WS4A 3NBLA 3D9YA 3C38A 1PZOA 4QY6A 5G4YA 1OT9A 2WZXA 4EUZA 3FV7A 2K31A 5FSRA 4GNUA 3CI6A 3P98A 2V8FA 3FYZA 3H82A 4WEJA 4C6YA 5F5YA 5JYPA 3ZG8B 1HLUP 2GX5A 4JPMA 1H8YA 4S2IA 5HL6A 4DJ2A 1W79A 2ZOHA 2WGWA 1DJAA 5GLCA 1F5MA 3PBTA 4P85A 2ZC6B 5FDHA 3WS0A 5EM0A 3DWKA 1K55C 2FFYA 1NWZA 5HD3A 1L0DA 4RX2A 1S0WA 1BUEA 1HTZA 3LICA 3E0YA 3LY4A 3LR0A 4KZ3A 4KZ4A 2WGWB 3KX0X 3IHAA 1D06A 3BQAA 4KQOA 1F98A 1SDNA 3MSHA 4HH2A 1ZHHB 3OZHA 2XRNA 1KGGA 3B47A 3KSFA 3PYPA 3OOVA 5CHJA 3QHYA 2VGKA 2WKIA 2XDMA 1N9NA 4OPRA 4RA7A 3OPRA 1YM1A 3FWLA 1NJ4A 4DMZA 1W63M 3LI8A 2BTFP 3PBNA 2V9AA 3ISGA 4GDBA 4M3KA 1K56A 1MWTA 3LGOA 3HJIA 4JF5A 2V1ZA 2VK3A 5F1FA 2IA2A 1MKIA 2QMIA 1TDGA 4EESA 4HQAA 2IWBA 4FOFA 4UQIM 4HI4A 1MXOA 3ZDJA 1S66L 2P74A 2B95A 3NOTC 1CF0A 3LFVA 5EVIC 4GD6A 2OSUA 4A5RA 4DXCA 2W3FA 3V39A 3HLEA 3PR6A 4XT2A 4GN2A 1K4FA 3BWLA 1PNEA 1TDLA 4EBLA 2ZQ7A 1ES4A 3HLWA 3G30A 2E8JA 4ID4A 5I94A 4WN5A 1S4SA 1NZOA 5HAPA 1EROA 5KIZA 1DY6A 2KDKA 4R23A 5HZHA 3HUNA 4XT2B 4FD8A 2XLNA 2FH5A 5DFXA 3T4TA 2ZQ9A 1L3LA 1N9OA 2PR6A 4P6ZM 3PXPA 4OPZA 1BYWA 1IYPA 3LIBA 4DE2A 4LCMA 1Y28A 1G68A 2J80A 4ZJ3A 4U3TA 1WYCA 2K2NA 4JF6A 5E43A 3NJAA 1JTGA 3NOUC 4GW9A 4DKIA 1ERQA 1ES5A 4DXBA 3BFDA 4EEUA 3JVUA 2PBYA 2R9WA 4BMWA 3RH8B 4CLCD 1MWRA 3FG8A 5DF8A 2V1AA 1OTDA 2HDRA 3IX8A 2J8YA 4BENA 3ZQ5A 3N6IA 1GA9A 4YNRA 2XR0A 4U0XA 2V20A 1TS6A 3HLCA 4YOFA 4JGOA 2QKPA 1YMXA 2CC1A 4DE3A 3E4QA 1YT4A 2VJWA 4LV0A 3NCKA 4YFMA 2A2LA 1N4OA 2G7UA 5HPIA 5CRFA 3P09A 5EPHA 5TBMA 2K7SA 5J8XA 5AQBA 5HDSA 3VP4A 1K6SA 4WEKA 5FQMA 1LT0A 3KSIA 3MBZA 1LSWA 5J4EA 5TBMB 3ZG0A 4NK3A 4LRXC 3LIDA 4PM7A 3BECA 3PBSA 3QNCA 4ESPA 3CJMA 3BLMA 3UB8A 1MPLA 2PYPA 5CGXA 3IHBA 3UMDA 5TFQA 5DTTA 3SOIA 1CK3A 2Y79A 4XUZA 3D72A 1W8QA 4ARZA 4S2PA 1NYYA 1IYQA 5FQKA 4CLCA 1U60A 3IS2A 2X71A 4I3JA 3TJZC 4HJ3A 3NY4A 2V2FF 3T1QB 1ESIA 1LL5A 2ZL1A 2JKRI 1NZUA 2GNXA 4ARZB 3I7JA 5FATA 1YQSA 5EE8A 1EI5A 3OPPA 1LSXA 1VB6A 1T18A 1PI5A 4CLCB 4DN0A 1I5QA 1M40A 3IS2B 1YKDA 2VGLM 5HARA 3NHQA 1W5DA 2ZL1B 3DTKA 1JWZA 3IH9A 1BSGA 2V0WA 2KLIA 1GSXA 4JGQA 3M2JA 5DJUA 4L0LA 2XH9A 3QP1A 4R38A 1JNUA 3F1PA 5M19A 2PU4A 2WKPA 4OQIA 3SH9A 4YINA 1XP4A 1Y54A 2I72A 3IWQA 4PM5A 1FCOA 2W3HA 1CI8A 4HOIA 4JXGA 3DWZA 3OLOA 4E04A 4UEYA 2WUQA 1K0KA 4I3IA 3F1PB 1WYBA 1UGUA 1K38A 4Z9QA 1QMEA 2Y2IA 3VOYA 3V50A 4G3WA 4NXEA 2ZC3B 4S2NC 2UV0E 5E2HA 2XSSA 3O3VA 4FSFA 5HWVA 2A3UA 3C7VA 2JKGA 5CTNA 2P04A 2W1TA 4Q8IA 4P0MA 5EECA 3C8CA 1F2KA 1BT5A 4LPZA 2B18A 2HP5A 4ZJ1A 1VETA 4K91A 4OPQA 1ZG4A 1C3BA 2EWVA 4HNBA 2XK1A 3UMEA 4IEDA 4BBVA 1STZA 4KENB 1H0MA 2VV8A 4Y17A 1LL8A 2JBFA 3EGXC 2OWHA 3B3XA 1SKOA 2VX8A 1GCEA 4N92A 1FCNA 3M2KA 1VETB 2G2UA 5HAQA 3NOPC 3D3OA 1NRFA 4MCWA 5EOEA 5F82A 3FKVA 3A3DA 2RCXA 1SKOB 5CX7A 3MF0A 3ZCZA 2ZM2A 3ZG7B 4I39A 4R0QA 3G4PA 3HLGA 3DAVA 2VEAA 2VV7A 2Y4AA 2V8CA 3D4FA 4S2LA 4IBXA 2PHYA 1P9RA 4PM8A 3VP0A 3S7QA 4E3LA 1K54A 1TVFA 1XKZA 1EW0A 1VHMA 4OOYA 1FIKA 4GOGA 2WYXA 3JPUA 3UPOA 1NLZA 3CUEA 1S1YA 3T1XA 3IX3A 2M7VA 1PYYA 5GLBA 4UAAA 1S6RA 3MQ0A 2LB9A 4ZBEA 3NDEA 5FI6A 4JBFA 2EX9A 3VOLA 5F83A 1IELA 3L7HA 3G6OA 3R7WA 5A8BA 2Z6CA 3GTCA 1QMFA 4O01A 4HH3A 3HL9A 4O8GA 2JHEA 4KZ5A 1P9WA 2EX8A 4HIAA 3U4LP 2ACGA 3PBOA 3IF6A 1YLYA 2KX6A 2ZBBA 3DW0A 1LL9A 3LEZA 2P9VB 3OCLA 4UQIS 3R7WB 4MNRA 3LIFA 4U0TA 1MY8A 4BJPA 5EFWA 5G18A 3IF6B 4O7DA 2OOLA 3EGDC 2J3TD 1JVJA 1BZAA 4JXWA 4R3BA 3UDIA 1PRQA 4PHTA 3W8KA 4Y2FA 1EWZA 3E4PA 1CJFA 4DF6A 3KO6A 3ZVTA 1FILA 2H5SA 3HLFA 4WELA 2FFFB 2Y2NA 1PI4A 5FQIA 4S2KA 1YLPA 1BLSA 3G35A 4IBRA 3NDGA 2ZMVA 3ZG5A 2E8IA 5HPFA 2EXBA 3IT9A 4P6ZS 2PYRA 5C5KA 2DMWA 4JGRA 4BBTA 4OP5A 5E2FA 3B42A 3BY8A 3S7OA 1K57A 2W3GA 3ULFA 3ZNYA 4LFUA 5FAOA 2PD7A 4E3OA 1L2SA 3JYIA 4PAUA 4EBNA 2WK0A 3HREA 1OJGA 2IWDA 2O99A 3FC7A 4QWOA 3UN7A 3VFFA 3H82B 3C5AA 2HV1A 3Q07A 4CPKA 4E3JA 3H9WA 2HDUA 4E3KA 1YPRA 1WE4A 4BBUA 3BM6A 1O7EA 4UA6A 3MXSA 1DP6A 3SW1A 1T1CA 1IYOA 1T19A 1XXMA 3BFCA 1MBLA 1XX2A 1E4DA 3QP5A 1FQGA 3MQQA 4E6XA 1XJ3A 2L1MA 4GZBA 5HX9A 4OP8A 3VV4A 5CEBA 5E2EA 2ZC4B 3KSHA 4R1GA 3VE4A 4QU3A 3K2NA 1S4RA 4UA9A 5G4ZA 1ESUA 3WRTA 3UY6A 3QP6A 4NXBA 1ES2A 2EXAA 4HP9A 1SKFA 4RQ9A 3IX4A 3S7PA 2O9BA 2H28A 1CEFA 2O0YA 3N8SA 3G2YA 1Y4OA 4KG6A 3HLBA 4OQHA 4G3VA 4Y7PA 5CERA 1FR1A 4OPYA 3NECA 4Z1WA 5IS1A 5FEFA 4LCLA 5MC7A 1LI9A 3ZFZA 4IUKA 4I5SA 5EUAA 3A0VA 2R9XA 3JVVA 3GMWA 3FKWA 1K6RA 3SH8A 1SDEA 1VM1A 2OLUA 2VGLS 5GHZA 1PFLA 5FAPA 5DVAA 3Q7VA 3BLSA 1MWSA 5GLAA 3MQOA 2ZJ9A 1RGZA 4KQRA 4PMAA 4XXRA 1V9ZA 1O07A 4UHUA 4S2JA 2XEPA 3LR5A 4P6BA 3Q7VB 1TD5A 5EVID 4JXSA 4NG2A 3OPHA 1P0ZA 2GZAA 2ZQ8A 3IQAA 4MMNA 5DJTA 2XF3A 3CPTA 3G2ZA 3VOZA 3OPLA 2JKRM 3T4SA 4EU0A 1Q2PA 4B88A 3HVFA 2VZWA 3EEHA 1K55A 4GJ4A 3EOIA 4JKTA 1YAXA 4QB8A 3CPTB 3MR0A 5U47A 2ZQAA 1I2SA 2XA7S 4OONA 2Q9MA 2YKFA 4GCZA 3RXXA 4HEFA 2HP9A 3ZGAB 4LV3A 4BD1A 1IEMA 4DJ3A 4HJ4A 2Q9NA 2C5WB 1SHVA 3EQUA 3NIAA 3GSGA 1H3QA 1GSWA 3E4OA 3TG9A 2O9CA 4HP4A 2OAP1 3SZTA 4BWIA 2FZ0A 1JWVA 1OT6A 1PWGA 1J9MA 4ME4A 4DE1A 4F94A 3NULA 4QY5A 5E2GA 5HFOA 2HGVA 1KGEA 3E2LA 4M4XA 3LI9A 1HD8A 3KYQA 2B02A 1H5XA 5F6AA 3AGEA 2O9AA 2KOIA 3BY9A 4C75A 3C2WA 5HSQA 1JWPA 4MBKA 2OLVA 4KQDA 5L09A 3PAEA 4WZ5C 3GQZA 5EVIA 5I5LA 1LHYA 3QP8A 5A91A 3RTYA 3BJNA 2Y2GA 3LY3A 4OKPA 3MZEA 1PZPA 1M6KA 5EVIB 4NETA 4MN5A 1OTEA 2HJEA 4E3MA 2XROA 2WKEA 1YSQA 2ZM8A 4IUHA 2H10A 2WADA 3VSLA 5F68A 3MZDA 4B4XA 5L2FA 1CI9A 2XD1A 3M6HA 1NRJA 4FH4A 4QJGA 2ZMAA 3A0SA 4X1LA 4ZTKA 1OTAA 2HDSA 3T1SA 3T4KA 4MBFA 1XFNA 3LYXA 4MDZA 4EW7A 3FPVA 4Y3IA 2J3WA 5FDSA 2ZD8A 3H7WA 1KVLA 1N9BA 4CQHA 5HDCA 2HJ9C 4OLGA 2HZ5A 2W0NA 3MXQA 3QP2A 2JKTI 2UWXA 1SZVA 5BOHA 5F69A 1PWDA 2QZ6A 2OV5A 3A3IA 3IBJA 1D1JA 3MJQA 1NLYA 2QJ5A 3PHYA 5EVEA 3S7NA 3T4QA 2XA7M 3SS4A 1D7EA 3QNBA 3E98A 3DBAA 1W7FA 3PAGA 3PTEA 3BFFA 4LRZE 5FI2A 3WRZA 4EUVA 3ZHHA 3GRJA 3VP2A 1ONHA 1RCJA 2NUPC 4R70A 5FL3A 3E2KA 2W1TB 1KGFA 2VA0A 3DTEA 2PT7A 4EXOA 1W63Q 5FASA 1XFQA 4BL3A 5AJGA 1K57C 1DJCA 1AXBA 4GHIA 1F9IA 1Q2QA 5DTKA 2ZOIA 2ZMFA 1G5UA 4Y13A 5K5BA 1J3WA 4II7A 4ZAMA 4N9KA 4WYYA 5J3WA 1Z09A 4E6WA 4PM6A 3UPNA 4GHIB 5A90A 2VGJA 2L4RA 4L9EA 5CXWA 4BL2A 5L07A 4K0XA 5AVFA 4KZ9A 5HDDA 5DFYA 4JLFA 2VKSA 1VEUA 3N7WA 1SCWA 2JKFA 2Y55A 5FQ9A 2M1CA 1H8ZA 1K25A 3BQ8A 5FEGA 2PU2A 1VEUB 1A0KA 2WKQA 3G32A 4E3NA 5FQQA 2OWJA 1PW1A 3UDXA 3IXDA 4PKYA 3MZFA 4IJGA 3IF5A 4HBTA 3IXHA 2V0UA 2GDNA 3L9KA 4NKPA 5HWTA 3VSKA 3LR3A 2WZZA 4B4ZA 3MS6A 5CGWA 4OOMA 4F3LA 1BLCA 4HHDA 3VP1A 1NYMA 1OMEA 4ZDXA 1IYSA 3FZCA 4R6LA 4MBHA 3CG5A 5M1AA 1GHMA 2ZC7A 4Y15A 3UB5P 2M7UA 4F3LB 3K3DA 3RXWA 1GHPA 5TJJA 1TEMA 4X6TA 4S2NA 5IU1A 3WS2A 4H6JA 2H0YA 4IHQA 2HP6A 3MKEA 5DF7A 5GL9A 1KDSA 2Q0OA 4RX3A 3CHWP 1DP9A 3O87A 5EM1A 1BULA 2Y2KA 5J7EA 4HBUA 3Q82A 4C3QA 4OVDA 3ZYTA 1MC0A 5DKKA 1JTDA 4H6JB 4KG5A 2Y2HA 3HUOA 3HCYA 3W4QA 2NUTC 1L0GA 3MFDA 5EV0A 1OPXA 1CQAA 5AQAA 3T4OA 2CMNA 3SH7A 3C4OA 3A0RA 3S4XA 1MZUA 3GV9A 1XA1A 2MJ6A 4R4RA 4Q0IA 4R4SA
chains in the Genus database with same CATH topology
2ZM0A 4X68A 1PI5A 3AGDA 2ZJ9A 1RGZA 1I5QA 4KQRA 1M40A 4KZ6A 4PMAA 2C6WB 3EQVA 4XXRA 3W4OA 5HARA 1O07A 2Y2PA 3ZNTA 5KZHA 4UHUA 4S2JA 2XEPA 1W5DA 2J9PA 4WBGA 4P6BA 1JWZA 3Q7VB 4KZ8A 1K4EA 3IH9A 1BSGA 5EVID 3UE3A 4JXSA 3UPPA 3OPHA 1KE3A 3NI9A 2ZQ8A 1E3UA 3IQAA 5GHXA 3RJUA 3G34A 4KZBA 3UO9A 3M2JA 2XF3A 3G2ZA 2XH9A 4L0LA 3VOZA 3VFHA 3OPLA 5M19A 2PU4A 2JE5A 5CHUA 3CZDA 4N1HA 3SS5A 1Q2PA 4X53A 2Y2MA 1KDWA 4B88A 4OQIA 3HVFA 3SH9A 4YINA 1XP4A 1Y54A 1YLJA 3G31A 4GKUA 2I72A 1K55A 3IWQA 4GB7A 4PM5A 1ALQA 3N8RA 1FCOA 1LLBA 4S2OA 1CI8A 2ZLYA 4JKTA 1XGJA 4JXGA 4N1XA 3DWZA 4QB8A 2J9OA 3SS3A 3PBRA 2WUQA 2QPNA 5U47A 2ZQAA 4KZAA 4OLDA 4Y0TA 1WYBA 5CEDA 1I2SA 4DDYA 1K38A 2P9VA 4IVIA 4OONA 2EFXA 2Q9MA 2X01A 4Z9QA 3RXXA 1QMEA 4EV4A 3CMZA 1L0EA 1IKGA 4HEFA 4OQGA 2HP9A 3PBQA 3VMAA 4XUXA 2Y2IA 5DTSA 3VOYA 3ZGAB 4LV3A 4BD1A 2A49A 3V50A 5HAIA 1IEMA 4X56A 1FOFA 2XFSA 2XD5A 2Q9NA 5GLDA 2ZC3B 5FI7A 2C5WB 3A3FA 4S2NC 3TOIA 1E25A 1HZOA 5E2HA 1SHVA 3EQUA 3NIAA 4DRTA 3O3VA 3GSGA 4FSFA 1NY0A 5A92A 2A3UA 3C7VA 3TG9A 5CTNA 4E3IA 3UDFA 4Q8IA 4S2MA 4P0MA 4HESA 4RYEA 5EECA 4KG2A 1BT5A 1JWVA 3WS1A 2HP5A 1PWGA 1J9MA 1Z6FA 4DE1A 1PW8A 4F94A 4ZJ1A 3ITBA 4QY5A 5E2GA 3HLDA 4K91A 2XGNA 4OPQA 1ZG4A 1C3BA 4OQ0A 5HFOA 2XK1A 1KE4A 4IEDA 3E2LA 1KGEA 4KENB 4KQQA 5CTMA 1XPBA 1FCMA 1HD8A 4BLMA 1H5XA 2JBFA 3M6BA 3ZVWA 3AGEA 3UE0A 1RP5A 4WMCD 3B3XA 3WS2A 4C75A 5A93A 3MKFA 4ZJ2A 5FAQA 3LCEA 1GCEA 4N92A 1JWPA 5JYOA 1FCNA 4MBKA 4OOLA 2B5RA 2OLVA 3M2KA 3IWIA 1BLHA 5GHYA 3PAEA 2WGIA 1K56D 4WZ5C 4RVAA 3GQZA 5EVIA 3WS4A 5EOOA 1LHYA 3O86A 2G2UA 5HAQA 3NBLA 3Q1FA 1CEGA 4EBPA 1NRFA 4UA7A 3IWOA 1PZOA 5A91A 5EOEA 4QY6A 3FKVA 5F82A 3A3DA 2RCXA 2WZXA 1L0FA 2Y2GA 3LY3A 4EUZA 3FV7A 4OKPA 5FSRA 3MZEA 4GNUA 3ZCZA 3P98A 2ZM2A 5FA7A 3ZG7B 1PZPA 3FYZA 4WEJA 1ES3A 2BG1A 4C6YA 4QHCA 1M6KA 5EVIB 4NETA 4R0QA 5JYPA 3G4PA 4Y0UA 3HLGA 3ZG8B 4E3MA 2Y4AA 4MEZA 5DF9A 2JC7A 3O88A 4JPMA 2WKEA 1H8YA 4S2IA 2ZM8A 3D4FA 5AQ7A 4Y0OA 4S2LA 1PWCA 1KE0A 2BLSA 1VQQA 4IBXA 1W79A 2H10A 2WADA 3VSLA 1YLWA 2WGWA 1DJAA 5GLCA 4CJNA 5CECA 2G2WA 3MZDA 3PBTA 4P85A 1XGIA 4B4XA 5L2FA 2ZC6B 5FDHA 3WS0A 1CI9A 2XD1A 3M6HA 4PM8A 3DWKA 3VP0A 1K55C 2FFYA 4E3LA 4FH4A 4QJGA 1K54A 2WAFA 1L0DA 1TVFA 2DRWA 4RX2A 1XKZA 2ZMAA 1S0WA 1BUEA 4GOGA 4OOYA 4QD4A 5M18A 4ZTKA 1HTZA 2HDSA 1XA7A 3LY4A 2WYXA 5CGSA 4MBFA 4KZ3A 4KZ4A 3UPOA 2WGWB 4R3JA 3IHAA 4OH0A 5AQ9A 2ZD8A 1PYYA 5GLBA 4UAAA 1KVLA 1N9BA 3LO7A 4KQOA 1S6RA 3BEBA 1SDNA 3N4IA 4ZBEA 3NDEA 5FI6A 4OLGA 3OZHA 4JBFA 4FCFA 1KGGA 2EX9A 5F83A 1IELA 2UWXA 3S22A 5BOHA 3GTCA 1QMFA 5CHJA 3HL9A 4KZ5A 1PWDA 3QHYA 2EX8A 2VGKA 2Y2QA 2WKIA 2XDMA 3C7UA 4OPRA 4RA7A 2DNSA 5KMWA 2QZ6A 2OV5A 3A3IA 1YM1A 3FWLA 3IF6A 3OPRA 3PBOA 1YLYA 1NJ4A 3DW0A 4WMCA 3W4PA 1LL9A 3LEZA 2P9VB 3OCLA 4BD0A 3PBNA 3ISGA 4X55A 1MWUA 3ITAA 3SS4A 5HW3A 4GDBA 3QNBA 1BLPA 4MNRA 3A3JA 4U0TA 1MY8A 4M3KA 1K56A 1MWTA 4BJPA 5KSHA 1FSWA 3AGFA 4JF5A 1ZC2A 1W7FA 2V1ZA 5F1FA 4MLLA 3PAGA 3IF6B 3BFFA 3PTEA 5FI2A 5G18A 1MKIA 4P87A 3WRZA 4BQMA 4O7DA 4KZ7A 2QMIA 3HUMA 3IXGA 3ZHHA 4LV1A 3GRJA 3VP2A 1TDGA 1JVJA 1BZAA 1ONHA 4JXWA 4R3BA 1RCJA 3UDIA 2Y91A 2IWBA 3W8KA 3IXBA 2Y2OA 1EWZA 5TGFA 1MXOA 3ZDJA 3E2KA 2P74A 5HL1A 4DF6A 3ZVTA 3WWXA 5EVIC 4GD6A 1KGFA 2H5SA 3HLFA 2OSUA 4WZ4A 2ZQCA 3TSGA 5KSCA 4A5RA 4WELA 4DXCA 2FFFB 2Y2NA 5FASA 3V39A 1PI4A 3NC8A 2RL3A 3HLEA 5FQIA 4S2KA 4BL3A 1YLPA 1BLSA 3G35A 4IBRA 4GN2A 1K4FA 4DE0A 3NDGA 3ZG5A 2E8IA 1TDLA 3UNWA 4EBLA 1K57C 2ZQ7A 1ES4A 3HLWA 3G30A 3BYDA 4ID4A 5TR7A 5I94A 1DJCA 1AXBA 1Q2QA 2EXBA 3IT9A 2DCFA 1NZOA 5HAPA 1EROA 5DTKA 4LENA 1BTLA 1DY6A 2J7VA 4OP5A 4R23A 1YLTA 5E2FA 2ZC5B 1K57A 4ZAMA 3ZNYA 4N9KA 3HUNA 4WYYA 5FAOA 4FD8A 4E6WA 4PM6A 2XLNA 1L2SA 1G6AA 3JYIA 3UPNA 4E3OA 2ZQ9A 3GVBA 2HPBA 5A90A 2VGJA 4PM9A 4EBNA 3V3SA 2WK0A 3HREA 1YMSA 4OPZA 1ZKJA 5CXWA 4BL2A 1IYPA 1K54C 4DE2A 2IWDA 4K0XA 4LCMA 3UE1A 4KZ9A 3UN7A 2HDQA 1G68A 3Q7ZA 3OC2A 3VFFA 4ZJ3A 4U3TA 1WYCA 4JLFA 3C5AA 4JF6A 3N7WA 5E43A 1SCWA 1JTGA 3Q07A 4DKIA 1ERQA 1I2WA 1ES5A 4CPKA 4E3JA 4DXBA 5GLAA 3BFDA 2HDUA 2Y55A 4D2OA 5FQ9A 4E3KA 2PBYA 1KVMA 1H8ZA 1K25A 1WE4A 2R9WA 3BM6A 2IWCA 1MWRA 1O7EA 5DF8A 2WAEA 2WGVA 4UA6A 3MXSA 2PU2A 1IYOA 2HDRA 5FQJA 2J8YA 3G32A 4E3NA 5FQQA 4LV2A 1W8YA 1PW1A 3UDXA 1XXMA 3BFCA 4BENA 1MBLA 3IXDA 4PPRA 3N6IA 1GA9A 1XX2A 1DJBA 1E4DA 2XFTA 3MZFA 3IF6C 5IHVA 1FQGA 3IF5A 2XR0A 4EQIA 1GHIA 4E6XA 3C4PA 4HBTA 4U0XA 4GZBA 3IXHA 3S1YA 2V20A 5HX9A 4EWFA 2GDNA 4OP8A 3HLCA 3V5MA 1LI0A 1YMXA 2X02A 2CC1A 3ZG9B 3HBRA 1FR6A 3VSKA 4DE3A 2EX6A 2WZZA 4B4ZA 1YT4A 4JF4A 5CEBA 1NXYA 4LV0A 3NCKA 5E2EA 2ZC4B 4R1GA 5CGWA 4YFMA 4QU3A 4OOMA 1N4OA 1BLCA 1GA0A 3WS5A 1E3UD 5CRFA 3P09A 3VP1A 1NYMA 5EPHA 4UA9A 2Z2MB 1OMEA 5F1GA 1ESUA 4ZDXA 4IVKA 3WRTA 1IYSA 3MXRA 3OCNA 3UY6A 5J8XA 5AQBA 3FZCA 4DDSA 4MBHA 3CG5A 1ES2A 2EXAA 5EVLA 1SKFA 5M1AA 4K0WA 1GHMA 1K6SA 2JCHA 4WEKA 3VP4A 2ZC7A 5FQMA 1PIOA 3MBZA 3ZG0A 3V3RA 3RXWA 1CEFA 1HVBA 3Q81A 4NK3A 1GHPA 3N8SA 3G2YA 4KG6A 1TEMA 3HLBA 4PM7A 4S2NA 2Y2JA 4X6TA 4OQHA 2EX2A 3BECA 2H0YA 3PBSA 3QNCA 4WM9A 5CERA 4Y7PA 3A3EA 2HP6A 3MKEA 3BFGA 1FR1A 3CJMA 3BLMA 4OPYA 2Y2LA 2Z2LB 4FH2A 1KDSA 1MPLA 3N8LA 5DF7A 4GDNA 4RX3A 5GL9A 5CGXA 2XQZA 3IHBA 3O87A 5TFQA 4LCLA 1BULA 1ERMA 2WKHA 2Y2KA 1FSYA 3GR2A 4GD8A 4HBUA 3Q82A 4C3QA 5D3OA 5DTTA 1ZG6A 1LI9A 4OVDA 3ZFZA 1ONGA 5EUAA 2R9XA 3SOIA 1CK3A 1JTDA 4XUZA 3GMWA 3VP3A 3FKWA 1W8QA 5CHMA 4KG5A 2Y2HA 4N9LA 3HUOA 1RGYA 2EFUA 4S2PA 3W4QA 1K6RA 1NYYA 3SH8A 1IYQA 5FQKA 1L0GA 3MFDA 3BRMA 1U60A 5AQAA 1YLZA 2X71A 1SDEA 1VM1A 2OLUA 5GHZA 3NY4A 2V2FF 3IH8A 5FAPA 2H0TA 3SH7A 1ESIA 1LL5A 3C4OA 2Y59A 5DVAA 3BFEA 1NZUA 3DTMA 3S4XA 3Q7VA 4WZ5A 3BLSA 3GV9A 4JXVA 1XA1A 2ZQDA 3I7JA 1IKIA 4H8RA 4R4RA 1YQSA 5FATA 5EE8A 1MWSA 1EI5A 4R4SA 4X69A 3OPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM0 A;  4X68 A;  1PI5 A;  3AGD A;  2ZJ9 A;  1RGZ A;  1I5Q A;  4KQR A;  1M40 A;  4KZ6 A;  4PMA A;  2C6W B;  3EQV A;  4XXR A;  3W4O A;  5HAR A;  1O07 A;  2Y2P A;  3ZNT A;  5KZH A;  4UHU A;  4S2J A;  2XEP A;  1W5D A;  2J9P A;  4WBG A;  4P6B A;  1JWZ A;  3Q7V B;  4KZ8 A;  1K4E A;  3IH9 A;  1BSG A;  5EVI D;  3UE3 A;  4JXS A;  3UPP A;  3OPH A;  1KE3 A;  3NI9 A;  2ZQ8 A;  1E3U A;  3IQA A;  5GHX A;  3RJU A;  3G34 A;  4KZB A;  3UO9 A;  3M2J A;  2XF3 A;  3G2Z A;  2XH9 A;  4L0L A;  3VOZ A;  3VFH A;  3OPL A;  5M19 A;  2PU4 A;  2JE5 A;  5CHU A;  3CZD A;  4N1H A;  3SS5 A;  1Q2P A;  4X53 A;  2Y2M A;  1KDW A;  4B88 A;  4OQI A;  3HVF A;  3SH9 A;  4YIN A;  1XP4 A;  1Y54 A;  1YLJ A;  3G31 A;  4GKU A;  2I72 A;  1K55 A;  3IWQ A;  4GB7 A;  4PM5 A;  1ALQ A;  3N8R A;  1FCO A;  1LLB A;  4S2O A;  1CI8 A;  2ZLY A;  4JKT A;  1XGJ A;  4JXG A;  4N1X A;  3DWZ A;  4QB8 A;  2J9O A;  3SS3 A;  3PBR A;  2WUQ A;  2QPN A;  5U47 A;  2ZQA A;  4KZA A;  4OLD A;  4Y0T A;  1WYB A;  5CED A;  1I2S A;  4DDY A;  1K38 A;  2P9V A;  4IVI A;  4OON A;  2EFX A;  2Q9M A;  2X01 A;  4Z9Q A;  3RXX A;  1QME A;  4EV4 A;  3CMZ A;  1L0E A;  1IKG A;  4HEF A;  4OQG A;  2HP9 A;  3PBQ A;  3VMA A;  4XUX A;  2Y2I A;  5DTS A;  3VOY A;  3ZGA B;  4LV3 A;  4BD1 A;  2A49 A;  3V50 A;  5HAI A;  1IEM A;  4X56 A;  1FOF A;  2XFS A;  2XD5 A;  2Q9N A;  5GLD A;  2ZC3 B;  5FI7 A;  2C5W B;  3A3F A;  4S2N C;  3TOI A;  1E25 A;  1HZO A;  5E2H A;  1SHV A;  3EQU A;  3NIA A;  4DRT A;  3O3V A;  3GSG A;  4FSF A;  1NY0 A;  5A92 A;  2A3U A;  3C7V A;  3TG9 A;  5CTN A;  4E3I A;  3UDF A;  4Q8I A;  4S2M A;  4P0M A;  4HES A;  4RYE A;  5EEC A;  4KG2 A;  1BT5 A;  1JWV A;  3WS1 A;  2HP5 A;  1PWG A;  1J9M A;  1Z6F A;  4DE1 A;  1PW8 A;  4F94 A;  4ZJ1 A;  3ITB A;  4QY5 A;  5E2G A;  3HLD A;  4K91 A;  2XGN A;  4OPQ A;  1ZG4 A;  1C3B A;  4OQ0 A;  5HFO A;  2XK1 A;  1KE4 A;  4IED A;  3E2L A;  1KGE A;  4KEN B;  4KQQ A;  5CTM A;  1XPB A;  1FCM A;  1HD8 A;  4BLM A;  1H5X A;  2JBF A;  3M6B A;  3ZVW A;  3AGE A;  3UE0 A;  1RP5 A;  4WMC D;  3B3X A;  3WS2 A;  4C75 A;  5A93 A;  3MKF A;  4ZJ2 A;  5FAQ A;  3LCE A;  1GCE A;  4N92 A;  1JWP A;  5JYO A;  1FCN A;  4MBK A;  4OOL A;  2B5R A;  2OLV A;  3M2K A;  3IWI A;  1BLH A;  5GHY A;  3PAE A;  2WGI A;  1K56 D;  4WZ5 C;  4RVA A;  3GQZ A;  5EVI A;  3WS4 A;  5EOO A;  1LHY A;  3O86 A;  2G2U A;  5HAQ A;  3NBL A;  3Q1F A;  1CEG A;  4EBP A;  1NRF A;  4UA7 A;  3IWO A;  1PZO A;  5A91 A;  5EOE A;  4QY6 A;  3FKV A;  5F82 A;  3A3D A;  2RCX A;  2WZX A;  1L0F A;  2Y2G A;  3LY3 A;  4EUZ A;  3FV7 A;  4OKP A;  5FSR A;  3MZE A;  4GNU A;  3ZCZ A;  3P98 A;  2ZM2 A;  5FA7 A;  3ZG7 B;  1PZP A;  3FYZ A;  4WEJ A;  1ES3 A;  2BG1 A;  4C6Y A;  4QHC A;  1M6K A;  5EVI B;  4NET A;  4R0Q A;  5JYP A;  3G4P A;  4Y0U A;  3HLG A;  3ZG8 B;  4E3M A;  2Y4A A;  4MEZ A;  5DF9 A;  2JC7 A;  3O88 A;  4JPM A;  2WKE A;  1H8Y A;  4S2I A;  2ZM8 A;  3D4F A;  5AQ7 A;  4Y0O A;  4S2L A;  1PWC A;  1KE0 A;  2BLS A;  1VQQ A;  4IBX A;  1W79 A;  2H10 A;  2WAD A;  3VSL A;  1YLW A;  2WGW A;  1DJA A;  5GLC A;  4CJN A;  5CEC A;  2G2W A;  3MZD A;  3PBT A;  4P85 A;  1XGI A;  4B4X A;  5L2F A;  2ZC6 B;  5FDH A;  3WS0 A;  1CI9 A;  2XD1 A;  3M6H A;  4PM8 A;  3DWK A;  3VP0 A;  1K55 C;  2FFY A;  4E3L A;  4FH4 A;  4QJG A;  1K54 A;  2WAF A;  1L0D A;  1TVF A;  2DRW A;  4RX2 A;  1XKZ A;  2ZMA A;  1S0W A;  1BUE A;  4GOG A;  4OOY A;  4QD4 A;  5M18 A;  4ZTK A;  1HTZ A;  2HDS A;  1XA7 A;  3LY4 A;  2WYX A;  5CGS A;  4MBF A;  4KZ3 A;  4KZ4 A;  3UPO A;  2WGW B;  4R3J A;  3IHA A;  4OH0 A;  5AQ9 A;  2ZD8 A;  1PYY A;  5GLB A;  4UAA A;  1KVL A;  1N9B A;  3LO7 A;  4KQO A;  1S6R A;  3BEB A;  1SDN A;  3N4I A;  4ZBE A;  3NDE A;  5FI6 A;  4OLG A;  3OZH A;  4JBF A;  4FCF A;  1KGG A;  2EX9 A;  5F83 A;  1IEL A;  2UWX A;  3S22 A;  5BOH A;  3GTC A;  1QMF A;  5CHJ A;  3HL9 A;  4KZ5 A;  1PWD A;  3QHY A;  2EX8 A;  2VGK A;  2Y2Q A;  2WKI A;  2XDM A;  3C7U A;  4OPR A;  4RA7 A;  2DNS A;  5KMW A;  2QZ6 A;  2OV5 A;  3A3I A;  1YM1 A;  3FWL A;  3IF6 A;  3OPR A;  3PBO A;  1YLY A;  1NJ4 A;  3DW0 A;  4WMC A;  3W4P A;  1LL9 A;  3LEZ A;  2P9V B;  3OCL A;  4BD0 A;  3PBN A;  3ISG A;  4X55 A;  1MWU A;  3ITA A;  3SS4 A;  5HW3 A;  4GDB A;  3QNB A;  1BLP A;  4MNR A;  3A3J A;  4U0T A;  1MY8 A;  4M3K A;  1K56 A;  1MWT A;  4BJP A;  5KSH A;  1FSW A;  3AGF A;  4JF5 A;  1ZC2 A;  1W7F A;  2V1Z A;  5F1F A;  4MLL A;  3PAG A;  3IF6 B;  3BFF A;  3PTE A;  5FI2 A;  5G18 A;  1MKI A;  4P87 A;  3WRZ A;  4BQM A;  4O7D A;  4KZ7 A;  2QMI A;  3HUM A;  3IXG A;  3ZHH A;  4LV1 A;  3GRJ A;  3VP2 A;  1TDG A;  1JVJ A;  1BZA A;  1ONH A;  4JXW A;  4R3B A;  1RCJ A;  3UDI A;  2Y91 A;  2IWB A;  3W8K A;  3IXB A;  2Y2O A;  1EWZ A;  5TGF A;  1MXO A;  3ZDJ A;  3E2K A;  2P74 A;  5HL1 A;  4DF6 A;  3ZVT A;  3WWX A;  5EVI C;  4GD6 A;  1KGF A;  2H5S A;  3HLF A;  2OSU A;  4WZ4 A;  2ZQC A;  3TSG A;  5KSC A;  4A5R A;  4WEL A;  4DXC A;  2FFF B;  2Y2N A;  5FAS A;  3V39 A;  1PI4 A;  3NC8 A;  2RL3 A;  3HLE A;  5FQI A;  4S2K A;  4BL3 A;  1YLP A;  1BLS A;  3G35 A;  4IBR A;  4GN2 A;  1K4F A;  4DE0 A;  3NDG A;  3ZG5 A;  2E8I A;  1TDL A;  3UNW A;  4EBL A;  1K57 C;  2ZQ7 A;  1ES4 A;  3HLW A;  3G30 A;  3BYD A;  4ID4 A;  5TR7 A;  5I94 A;  1DJC A;  1AXB A;  1Q2Q A;  2EXB A;  3IT9 A;  2DCF A;  1NZO A;  5HAP A;  1ERO A;  5DTK A;  4LEN A;  1BTL A;  1DY6 A;  2J7V A;  4OP5 A;  4R23 A;  1YLT A;  5E2F A;  2ZC5 B;  1K57 A;  4ZAM A;  3ZNY A;  4N9K A;  3HUN A;  4WYY A;  5FAO A;  4FD8 A;  4E6W A;  4PM6 A;  2XLN A;  1L2S A;  1G6A A;  3JYI A;  3UPN A;  4E3O A;  2ZQ9 A;  3GVB A;  2HPB A;  5A90 A;  2VGJ A;  4PM9 A;  4EBN A;  3V3S A;  2WK0 A;  3HRE A;  1YMS A;  4OPZ A;  1ZKJ A;  5CXW A;  4BL2 A;  1IYP A;  1K54 C;  4DE2 A;  2IWD A;  4K0X A;  4LCM A;  3UE1 A;  4KZ9 A;  3UN7 A;  2HDQ A;  1G68 A;  3Q7Z A;  3OC2 A;  3VFF A;  4ZJ3 A;  4U3T A;  1WYC A;  4JLF A;  3C5A A;  4JF6 A;  3N7W A;  5E43 A;  1SCW A;  1JTG A;  3Q07 A;  4DKI A;  1ERQ A;  1I2W A;  1ES5 A;  4CPK A;  4E3J A;  4DXB A;  5GLA A;  3BFD A;  2HDU A;  2Y55 A;  4D2O A;  5FQ9 A;  4E3K A;  2PBY A;  1KVM A;  1H8Z A;  1K25 A;  1WE4 A;  2R9W A;  3BM6 A;  2IWC A;  1MWR A;  1O7E A;  5DF8 A;  2WAE A;  2WGV A;  4UA6 A;  3MXS A;  2PU2 A;  1IYO A;  2HDR A;  5FQJ A;  2J8Y A;  3G32 A;  4E3N A;  5FQQ A;  4LV2 A;  1W8Y A;  1PW1 A;  3UDX A;  1XXM A;  3BFC A;  4BEN A;  1MBL A;  3IXD A;  4PPR A;  3N6I A;  1GA9 A;  1XX2 A;  1DJB A;  1E4D A;  2XFT A;  3MZF A;  3IF6 C;  5IHV A;  1FQG A;  3IF5 A;  2XR0 A;  4EQI A;  1GHI A;  4E6X A;  3C4P A;  4HBT A;  4U0X A;  4GZB A;  3IXH A;  3S1Y A;  2V20 A;  5HX9 A;  4EWF A;  2GDN A;  4OP8 A;  3HLC A;  3V5M A;  1LI0 A;  1YMX A;  2X02 A;  2CC1 A;  3ZG9 B;  3HBR A;  1FR6 A;  3VSK A;  4DE3 A;  2EX6 A;  2WZZ A;  4B4Z A;  1YT4 A;  4JF4 A;  5CEB A;  1NXY A;  4LV0 A;  3NCK A;  5E2E A;  2ZC4 B;  4R1G A;  5CGW A;  4YFM A;  4QU3 A;  4OOM A;  1N4O A;  1BLC A;  1GA0 A;  3WS5 A;  1E3U D;  5CRF A;  3P09 A;  3VP1 A;  1NYM A;  5EPH A;  4UA9 A;  2Z2M B;  1OME A;  5F1G A;  1ESU A;  4ZDX A;  4IVK A;  3WRT A;  1IYS A;  3MXR A;  3OCN A;  3UY6 A;  5J8X A;  5AQB A;  3FZC A;  4DDS A;  4MBH A;  3CG5 A;  1ES2 A;  2EXA A;  5EVL A;  1SKF A;  5M1A A;  4K0W A;  1GHM A;  1K6S A;  2JCH A;  4WEK A;  3VP4 A;  2ZC7 A;  5FQM A;  1PIO A;  3MBZ A;  3ZG0 A;  3V3R A;  3RXW A;  1CEF A;  1HVB A;  3Q81 A;  4NK3 A;  1GHP A;  3N8S A;  3G2Y A;  4KG6 A;  1TEM A;  3HLB A;  4PM7 A;  4S2N A;  2Y2J A;  4X6T A;  4OQH A;  2EX2 A;  3BEC A;  2H0Y A;  3PBS A;  3QNC A;  4WM9 A;  5CER A;  4Y7P A;  3A3E A;  2HP6 A;  3MKE A;  3BFG A;  1FR1 A;  3CJM A;  3BLM A;  4OPY A;  2Y2L A;  2Z2L B;  4FH2 A;  1KDS A;  1MPL A;  3N8L A;  5DF7 A;  4GDN A;  4RX3 A;  5GL9 A;  5CGX A;  2XQZ A;  3IHB A;  3O87 A;  5TFQ A;  4LCL A;  1BUL A;  1ERM A;  2WKH A;  2Y2K A;  1FSY A;  3GR2 A;  4GD8 A;  4HBU A;  3Q82 A;  4C3Q A;  5D3O A;  5DTT A;  1ZG6 A;  1LI9 A;  4OVD A;  3ZFZ A;  1ONG A;  5EUA A;  2R9X A;  3SOI A;  1CK3 A;  1JTD A;  4XUZ A;  3GMW A;  3VP3 A;  3FKW A;  1W8Q A;  5CHM A;  4KG5 A;  2Y2H A;  4N9L A;  3HUO A;  1RGY A;  2EFU A;  4S2P A;  3W4Q A;  1K6R A;  1NYY A;  3SH8 A;  1IYQ A;  5FQK A;  1L0G A;  3MFD A;  3BRM A;  1U60 A;  5AQA A;  1YLZ A;  2X71 A;  1SDE A;  1VM1 A;  2OLU A;  5GHZ A;  3NY4 A;  2V2F F;  3IH8 A;  5FAP A;  2H0T A;  3SH7 A;  1ESI A;  1LL5 A;  3C4O A;  2Y59 A;  5DVA A;  3BFE A;  1NZU A;  3DTM A;  3S4X A;  3Q7V A;  4WZ5 A;  3BLS A;  3GV9 A;  4JXV A;  1XA1 A;  2ZQD A;  3I7J A;  1IKI A;  4H8R A;  4R4R A;  1YQS A;  5FAT A;  5EE8 A;  1MWS A;  1EI5 A;  4R4S A;  4X69 A;  3OPP A; 
#chains in the Genus database with same CATH topology
 2ZM0 A;  4D60 A;  4LRY C;  3F1O A;  2W1R A;  3W4O A;  5KZH A;  4NXF A;  3F1N A;  4WBG A;  4O0P A;  4K08 A;  4HJ6 A;  3UPP A;  2Y8H A;  2PRF A;  2EWW A;  4KZB A;  3CWF A;  5HWW A;  3F1O B;  3F1N B;  4GLQ A;  2P7J A;  3R4K A;  4Y5F A;  4GKU A;  4GB7 A;  1ALQ A;  3N8R A;  4FUW A;  1TS8 A;  2J9O A;  3CAX A;  3SS3 A;  3PBR A;  1ODV A;  2QPN A;  4Y0T A;  5CED A;  4IVI A;  2PR5 A;  2X01 A;  4EV4 A;  3CMZ A;  1IKG A;  4OQG A;  4XUX A;  4L9F A;  4X56 A;  2D02 A;  1FOF A;  3A3F A;  3TOI A;  1S67 L;  1E25 A;  1HZO A;  3KSG A;  4G3K A;  4DRT A;  5A92 A;  4AFI A;  3LIA A;  4S2M A;  4WF0 A;  3LIE A;  1Z6F A;  2HF6 A;  2JN7 A;  3ITB A;  3HLD A;  3T1R A;  2XGN A;  1KE4 A;  4KQQ A;  5CTM A;  1XPB A;  2PBD P;  1FCM A;  4BLM A;  4CLC C;  3M6B A;  3UE0 A;  1RP5 A;  4WMC D;  5A93 A;  4ZJ2 A;  2LB5 A;  4B93 A;  3LCE A;  4OOL A;  1XJ2 A;  5GHY A;  2WGI A;  5EOO A;  3O86 A;  3GEC A;  3Q1F A;  1CEG A;  4EBP A;  3UE6 A;  4UA7 A;  3IWO A;  1L0F A;  3UB7 A;  5FA7 A;  4MN7 A;  1ES3 A;  2BG1 A;  4QHC A;  4Y0U A;  1UWN X;  4MEZ A;  5DF9 A;  2JC7 A;  3O88 A;  5AQ7 A;  4Y0O A;  1PWC A;  1KE0 A;  2BLS A;  3RFB A;  1VQQ A;  1TF1 A;  5CEC A;  1YLW A;  4CJN A;  2G2W A;  1H8M A;  1XGI A;  1T1B A;  1MKM A;  1G28 A;  2WAF A;  2DRW A;  4QD4 A;  5M18 A;  3C30 A;  4FTX A;  1XA7 A;  5CGS A;  4R3J A;  4OH0 A;  5AQ9 A;  2R78 A;  3U2A A;  3LO7 A;  3BEB A;  4I3A A;  3N4I A;  4R3A A;  4FCF A;  4X1M A;  2P08 A;  4WUJ A;  3MMH A;  3S22 A;  2VLG A;  1OTB A;  3TE8 A;  3LR4 A;  4Q0J A;  2Y2Q A;  3C7U A;  1LSV A;  5KMW A;  2DNS A;  4NEE D;  4WMC A;  2YKH A;  3W4P A;  1DP8 A;  4BD0 A;  1KOU A;  4X55 A;  1MWU A;  3ITA A;  5HW3 A;  5LBR A;  3EEA A;  1BLP A;  3A3J A;  1TS0 A;  5KSH A;  1FSW A;  3AGF A;  1ZC2 A;  1TS7 A;  4MLL A;  2JKT M;  4P87 A;  1N9L A;  1WA9 A;  4BQM A;  3KYE A;  4KZ7 A;  3HUM A;  3IXG A;  1XJ6 A;  4LV1 A;  2Y91 A;  3IXB A;  2Y2O A;  5TGF A;  5HL1 A;  3WWX A;  4KUK A;  4WZ4 A;  3TSG A;  2ZQC A;  5KSC A;  3NC8 A;  2RL3 A;  4DE0 A;  3UNW A;  3BYD A;  5TR7 A;  5L10 A;  3IBR A;  1OJ5 A;  2DCF A;  3BW6 A;  4PKY G;  4LEN A;  1BTL A;  2J7V A;  4HY8 A;  4EQ1 A;  1YLT A;  3UB6 A;  2ZC5 B;  2INW A;  2L0W A;  4ZRR A;  4GS9 A;  1G6A A;  3GVB A;  2HPB A;  4PM9 A;  3V3S A;  3V67 A;  1YMS A;  1ZKJ A;  1P97 A;  3B33 A;  5IT5 A;  1K54 C;  4ETX A;  3UE1 A;  3MFX A;  2HDQ A;  3Q7Z A;  3OC2 A;  4GS9 B;  4EET B;  2GJ3 A;  3CUE C;  1I2W A;  2QWS A;  3T4J A;  4D2O A;  4QPR A;  1KVM A;  1S1Z A;  3UB9 A;  2IWC A;  3GDI A;  3T4L A;  3LEQ A;  2WAE A;  2WGV A;  5FQJ A;  4LV2 A;  1W8Y A;  2WKR A;  4PPR A;  1DJB A;  2XFT A;  3IF6 C;  5IHV A;  4EQI A;  3KYZ A;  1GHI A;  3C4P A;  4EWF A;  2W27 A;  3T50 A;  3H7W B;  3V5M A;  1LI0 A;  3VE3 A;  2X02 A;  3ZG9 B;  3HBR A;  1FR6 A;  3FPW A;  2EX6 A;  4JF4 A;  3P01 A;  4CLC E;  1NXY A;  1IFQ A;  4YWZ A;  1GA0 A;  3WS5 A;  1E3U D;  2Z2M B;  5F1G A;  4LGW A;  4IVK A;  3MXR A;  3OCN A;  4DDS A;  2W3D A;  4KUO A;  3ICY A;  5EVL A;  2EA9 A;  4WL9 A;  4K0W A;  2JCH A;  1PIO A;  5HD5 A;  4X25 A;  3V3R A;  1HVB A;  1T1A A;  3Q81 A;  2OAQ 1;  2Y2J A;  2Z6D A;  2EX2 A;  4WM9 A;  3A3E A;  1ACF A;  3BFG A;  4ETZ A;  5DKL A;  2Y2L A;  2Z2L B;  3N8L A;  3QP4 A;  2BAS A;  4GDN A;  2XQZ A;  2V1B A;  1ERM A;  2WKH A;  3GR2 A;  1FSY A;  4GD8 A;  5D3O A;  1ZG6 A;  4JGP A;  1ONG A;  2AVX A;  3VP3 A;  5CHM A;  4N9L A;  1RGY A;  2D01 A;  2EFU A;  2PAV P;  1UWP X;  2QYB A;  3BRM A;  1YLZ A;  4L9G A;  3IH8 A;  2H0T A;  1OTI A;  3P7N A;  2PDR A;  2Y59 A;  3K3C A;  3BFE A;  3DTM A;  3T12 B;  4WZ5 A;  4JXV A;  2ZQD A;  1IKI A;  4H8R A;  3S1Y A;  4X69 A;  4FH2 A;  4X68 A;  3AGD A;  4KZ6 A;  2C6W B;  3EQV A;  4I38 A;  3TW8 A;  3ZNT A;  2Y2P A;  4LLO B;  2J9P A;  4KZ8 A;  1K4E A;  3UE3 A;  4EEP A;  3HJK A;  1IOU A;  1KE3 A;  1DRM A;  3NI9 A;  1E3U A;  5GHX A;  3RJU A;  3G34 A;  2J3T C;  3EWK A;  3UO9 A;  2PD8 A;  3VFH A;  2QHK A;  2JE5 A;  5CHU A;  3CZD A;  2W3E A;  4N1H A;  3SS5 A;  4X53 A;  2Y2M A;  1KDW A;  3O5Y A;  4NXG A;  1YLJ A;  3G31 A;  1V9Y A;  1LLB A;  4S2O A;  2ZLY A;  2I9V A;  1XGJ A;  4N1X A;  3TRC A;  4KZA A;  4OLD A;  2VV6 A;  4MN6 A;  4DDY A;  2P9V A;  2EFX A;  1AWI A;  1L0E A;  3CLO A;  3PBQ A;  3VMA A;  5DTS A;  3OBF A;  2A49 A;  2A24 A;  5HAI A;  2XFS A;  2XD5 A;  3LUQ A;  5GLD A;  5FI7 A;  4WLA A;  1X0O A;  3DTI A;  1NY0 A;  4E3I A;  3UDF A;  2A24 B;  4B9O A;  3CIT A;  4HES A;  4RYE A;  4KG2 A;  3WS1 A;  4Q0H A;  1G6O A;  1PW8 A;  4OQ0 A;  1YSP A;  5AVE A;  3ZVW A;  5L8M A;  1XJ4 A;  1GSV A;  2QJ7 A;  3MKF A;  1ZTU A;  5FAQ A;  5JYO A;  2B5R A;  4EER A;  3IWI A;  1BLH A;  3W2Z A;  1K56 D;  4RVA A;  3WS4 A;  3NBL A;  3D9Y A;  3C38 A;  1PZO A;  4QY6 A;  5G4Y A;  1OT9 A;  2WZX A;  4EUZ A;  3FV7 A;  2K31 A;  5FSR A;  4GNU A;  3CI6 A;  3P98 A;  2V8F A;  3FYZ A;  3H82 A;  4WEJ A;  4C6Y A;  5F5Y A;  5JYP A;  3ZG8 B;  1HLU P;  2GX5 A;  4JPM A;  1H8Y A;  4S2I A;  5HL6 A;  4DJ2 A;  1W79 A;  2ZOH A;  2WGW A;  1DJA A;  5GLC A;  1F5M A;  3PBT A;  4P85 A;  2ZC6 B;  5FDH A;  3WS0 A;  5EM0 A;  3DWK A;  1K55 C;  2FFY A;  1NWZ A;  5HD3 A;  1L0D A;  4RX2 A;  1S0W A;  1BUE A;  1HTZ A;  3LIC A;  3E0Y A;  3LY4 A;  3LR0 A;  4KZ3 A;  4KZ4 A;  2WGW B;  3KX0 X;  3IHA A;  1D06 A;  3BQA A;  4KQO A;  1F98 A;  1SDN A;  3MSH A;  4HH2 A;  1ZHH B;  3OZH A;  2XRN A;  1KGG A;  3B47 A;  3KSF A;  3PYP A;  3OOV A;  5CHJ A;  3QHY A;  2VGK A;  2WKI A;  2XDM A;  1N9N A;  4OPR A;  4RA7 A;  3OPR A;  1YM1 A;  3FWL A;  1NJ4 A;  4DMZ A;  1W63 M;  3LI8 A;  2BTF P;  3PBN A;  2V9A A;  3ISG A;  4GDB A;  4M3K A;  1K56 A;  1MWT A;  3LGO A;  3HJI A;  4JF5 A;  2V1Z A;  2VK3 A;  5F1F A;  2IA2 A;  1MKI A;  2QMI A;  1TDG A;  4EES A;  4HQA A;  2IWB A;  4FOF A;  4UQI M;  4HI4 A;  1MXO A;  3ZDJ A;  1S66 L;  2P74 A;  2B95 A;  3NOT C;  1CF0 A;  3LFV A;  5EVI C;  4GD6 A;  2OSU A;  4A5R A;  4DXC A;  2W3F A;  3V39 A;  3HLE A;  3PR6 A;  4XT2 A;  4GN2 A;  1K4F A;  3BWL A;  1PNE A;  1TDL A;  4EBL A;  2ZQ7 A;  1ES4 A;  3HLW A;  3G30 A;  2E8J A;  4ID4 A;  5I94 A;  4WN5 A;  1S4S A;  1NZO A;  5HAP A;  1ERO A;  5KIZ A;  1DY6 A;  2KDK A;  4R23 A;  5HZH A;  3HUN A;  4XT2 B;  4FD8 A;  2XLN A;  2FH5 A;  5DFX A;  3T4T A;  2ZQ9 A;  1L3L A;  1N9O A;  2PR6 A;  4P6Z M;  3PXP A;  4OPZ A;  1BYW A;  1IYP A;  3LIB A;  4DE2 A;  4LCM A;  1Y28 A;  1G68 A;  2J80 A;  4ZJ3 A;  4U3T A;  1WYC A;  2K2N A;  4JF6 A;  5E43 A;  3NJA A;  1JTG A;  3NOU C;  4GW9 A;  4DKI A;  1ERQ A;  1ES5 A;  4DXB A;  3BFD A;  4EEU A;  3JVU A;  2PBY A;  2R9W A;  4BMW A;  3RH8 B;  4CLC D;  1MWR A;  3FG8 A;  5DF8 A;  2V1A A;  1OTD A;  2HDR A;  3IX8 A;  2J8Y A;  4BEN A;  3ZQ5 A;  3N6I A;  1GA9 A;  4YNR A;  2XR0 A;  4U0X A;  2V20 A;  1TS6 A;  3HLC A;  4YOF A;  4JGO A;  2QKP A;  1YMX A;  2CC1 A;  4DE3 A;  3E4Q A;  1YT4 A;  2VJW A;  4LV0 A;  3NCK A;  4YFM A;  2A2L A;  1N4O A;  2G7U A;  5HPI A;  5CRF A;  3P09 A;  5EPH A;  5TBM A;  2K7S A;  5J8X A;  5AQB A;  5HDS A;  3VP4 A;  1K6S A;  4WEK A;  5FQM A;  1LT0 A;  3KSI A;  3MBZ A;  1LSW A;  5J4E A;  5TBM B;  3ZG0 A;  4NK3 A;  4LRX C;  3LID A;  4PM7 A;  3BEC A;  3PBS A;  3QNC A;  4ESP A;  3CJM A;  3BLM A;  3UB8 A;  1MPL A;  2PYP A;  5CGX A;  3IHB A;  3UMD A;  5TFQ A;  5DTT A;  3SOI A;  1CK3 A;  2Y79 A;  4XUZ A;  3D72 A;  1W8Q A;  4ARZ A;  4S2P A;  1NYY A;  1IYQ A;  5FQK A;  4CLC A;  1U60 A;  3IS2 A;  2X71 A;  4I3J A;  3TJZ C;  4HJ3 A;  3NY4 A;  2V2F F;  3T1Q B;  1ESI A;  1LL5 A;  2ZL1 A;  2JKR I;  1NZU A;  2GNX A;  4ARZ B;  3I7J A;  5FAT A;  1YQS A;  5EE8 A;  1EI5 A;  3OPP A;  1LSX A;  1VB6 A;  1T18 A;  1PI5 A;  4CLC B;  4DN0 A;  1I5Q A;  1M40 A;  3IS2 B;  1YKD A;  2VGL M;  5HAR A;  3NHQ A;  1W5D A;  2ZL1 B;  3DTK A;  1JWZ A;  3IH9 A;  1BSG A;  2V0W A;  2KLI A;  1GSX A;  4JGQ A;  3M2J A;  5DJU A;  4L0L A;  2XH9 A;  3QP1 A;  4R38 A;  1JNU A;  3F1P A;  5M19 A;  2PU4 A;  2WKP A;  4OQI A;  3SH9 A;  4YIN A;  1XP4 A;  1Y54 A;  2I72 A;  3IWQ A;  4PM5 A;  1FCO A;  2W3H A;  1CI8 A;  4HOI A;  4JXG A;  3DWZ A;  3OLO A;  4E04 A;  4UEY A;  2WUQ A;  1K0K A;  4I3I A;  3F1P B;  1WYB A;  1UGU A;  1K38 A;  4Z9Q A;  1QME A;  2Y2I A;  3VOY A;  3V50 A;  4G3W A;  4NXE A;  2ZC3 B;  4S2N C;  2UV0 E;  5E2H A;  2XSS A;  3O3V A;  4FSF A;  5HWV A;  2A3U A;  3C7V A;  2JKG A;  5CTN A;  2P04 A;  2W1T A;  4Q8I A;  4P0M A;  5EEC A;  3C8C A;  1F2K A;  1BT5 A;  4LPZ A;  2B18 A;  2HP5 A;  4ZJ1 A;  1VET A;  4K91 A;  4OPQ A;  1ZG4 A;  1C3B A;  2EWV A;  4HNB A;  2XK1 A;  3UME A;  4IED A;  4BBV A;  1STZ A;  4KEN B;  1H0M A;  2VV8 A;  4Y17 A;  1LL8 A;  2JBF A;  3EGX C;  2OWH A;  3B3X A;  1SKO A;  2VX8 A;  1GCE A;  4N92 A;  1FCN A;  3M2K A;  1VET B;  2G2U A;  5HAQ A;  3NOP C;  3D3O A;  1NRF A;  4MCW A;  5EOE A;  5F82 A;  3FKV A;  3A3D A;  2RCX A;  1SKO B;  5CX7 A;  3MF0 A;  3ZCZ A;  2ZM2 A;  3ZG7 B;  4I39 A;  4R0Q A;  3G4P A;  3HLG A;  3DAV A;  2VEA A;  2VV7 A;  2Y4A A;  2V8C A;  3D4F A;  4S2L A;  4IBX A;  2PHY A;  1P9R A;  4PM8 A;  3VP0 A;  3S7Q A;  4E3L A;  1K54 A;  1TVF A;  1XKZ A;  1EW0 A;  1VHM A;  4OOY A;  1FIK A;  4GOG A;  2WYX A;  3JPU A;  3UPO A;  1NLZ A;  3CUE A;  1S1Y A;  3T1X A;  3IX3 A;  2M7V A;  1PYY A;  5GLB A;  4UAA A;  1S6R A;  3MQ0 A;  2LB9 A;  4ZBE A;  3NDE A;  5FI6 A;  4JBF A;  2EX9 A;  3VOL A;  5F83 A;  1IEL A;  3L7H A;  3G6O A;  3R7W A;  5A8B A;  2Z6C A;  3GTC A;  1QMF A;  4O01 A;  4HH3 A;  3HL9 A;  4O8G A;  2JHE A;  4KZ5 A;  1P9W A;  2EX8 A;  4HIA A;  3U4L P;  2ACG A;  3PBO A;  3IF6 A;  1YLY A;  2KX6 A;  2ZBB A;  3DW0 A;  1LL9 A;  3LEZ A;  2P9V B;  3OCL A;  4UQI S;  3R7W B;  4MNR A;  3LIF A;  4U0T A;  1MY8 A;  4BJP A;  5EFW A;  5G18 A;  3IF6 B;  4O7D A;  2OOL A;  3EGD C;  2J3T D;  1JVJ A;  1BZA A;  4JXW A;  4R3B A;  3UDI A;  1PRQ A;  4PHT A;  3W8K A;  4Y2F A;  1EWZ A;  3E4P A;  1CJF A;  4DF6 A;  3KO6 A;  3ZVT A;  1FIL A;  2H5S A;  3HLF A;  4WEL A;  2FFF B;  2Y2N A;  1PI4 A;  5FQI A;  4S2K A;  1YLP A;  1BLS A;  3G35 A;  4IBR A;  3NDG A;  2ZMV A;  3ZG5 A;  2E8I A;  5HPF A;  2EXB A;  3IT9 A;  4P6Z S;  2PYR A;  5C5K A;  2DMW A;  4JGR A;  4BBT A;  4OP5 A;  5E2F A;  3B42 A;  3BY8 A;  3S7O A;  1K57 A;  2W3G A;  3ULF A;  3ZNY A;  4LFU A;  5FAO A;  2PD7 A;  4E3O A;  1L2S A;  3JYI A;  4PAU A;  4EBN A;  2WK0 A;  3HRE A;  1OJG A;  2IWD A;  2O99 A;  3FC7 A;  4QWO A;  3UN7 A;  3VFF A;  3H82 B;  3C5A A;  2HV1 A;  3Q07 A;  4CPK A;  4E3J A;  3H9W A;  2HDU A;  4E3K A;  1YPR A;  1WE4 A;  4BBU A;  3BM6 A;  1O7E A;  4UA6 A;  3MXS A;  1DP6 A;  3SW1 A;  1T1C A;  1IYO A;  1T19 A;  1XXM A;  3BFC A;  1MBL A;  1XX2 A;  1E4D A;  3QP5 A;  1FQG A;  3MQQ A;  4E6X A;  1XJ3 A;  2L1M A;  4GZB A;  5HX9 A;  4OP8 A;  3VV4 A;  5CEB A;  5E2E A;  2ZC4 B;  3KSH A;  4R1G A;  3VE4 A;  4QU3 A;  3K2N A;  1S4R A;  4UA9 A;  5G4Z A;  1ESU A;  3WRT A;  3UY6 A;  3QP6 A;  4NXB A;  1ES2 A;  2EXA A;  4HP9 A;  1SKF A;  4RQ9 A;  3IX4 A;  3S7P A;  2O9B A;  2H28 A;  1CEF A;  2O0Y A;  3N8S A;  3G2Y A;  1Y4O A;  4KG6 A;  3HLB A;  4OQH A;  4G3V A;  4Y7P A;  5CER A;  1FR1 A;  4OPY A;  3NEC A;  4Z1W A;  5IS1 A;  5FEF A;  4LCL A;  5MC7 A;  1LI9 A;  3ZFZ A;  4IUK A;  4I5S A;  5EUA A;  3A0V A;  2R9X A;  3JVV A;  3GMW A;  3FKW A;  1K6R A;  3SH8 A;  1SDE A;  1VM1 A;  2OLU A;  2VGL S;  5GHZ A;  1PFL A;  5FAP A;  5DVA A;  3Q7V A;  3BLS A;  1MWS A;  5GLA A;  3MQO A;  2ZJ9 A;  1RGZ A;  4KQR A;  4PMA A;  4XXR A;  1V9Z A;  1O07 A;  4UHU A;  4S2J A;  2XEP A;  3LR5 A;  4P6B A;  3Q7V B;  1TD5 A;  5EVI D;  4JXS A;  4NG2 A;  3OPH A;  1P0Z A;  2GZA A;  2ZQ8 A;  3IQA A;  4MMN A;  5DJT A;  2XF3 A;  3CPT A;  3G2Z A;  3VOZ A;  3OPL A;  2JKR M;  3T4S A;  4EU0 A;  1Q2P A;  4B88 A;  3HVF A;  2VZW A;  3EEH A;  1K55 A;  4GJ4 A;  3EOI A;  4JKT A;  1YAX A;  4QB8 A;  3CPT B;  3MR0 A;  5U47 A;  2ZQA A;  1I2S A;  2XA7 S;  4OON A;  2Q9M A;  2YKF A;  4GCZ A;  3RXX A;  4HEF A;  2HP9 A;  3ZGA B;  4LV3 A;  4BD1 A;  1IEM A;  4DJ3 A;  4HJ4 A;  2Q9N A;  2C5W B;  1SHV A;  3EQU A;  3NIA A;  3GSG A;  1H3Q A;  1GSW A;  3E4O A;  3TG9 A;  2O9C A;  4HP4 A;  2OAP 1;  3SZT A;  4BWI A;  2FZ0 A;  1JWV A;  1OT6 A;  1PWG A;  1J9M A;  4ME4 A;  4DE1 A;  4F94 A;  3NUL A;  4QY5 A;  5E2G A;  5HFO A;  2HGV A;  1KGE A;  3E2L A;  4M4X A;  3LI9 A;  1HD8 A;  3KYQ A;  2B02 A;  1H5X A;  5F6A A;  3AGE A;  2O9A A;  2KOI A;  3BY9 A;  4C75 A;  3C2W A;  5HSQ A;  1JWP A;  4MBK A;  2OLV A;  4KQD A;  5L09 A;  3PAE A;  4WZ5 C;  3GQZ A;  5EVI A;  5I5L A;  1LHY A;  3QP8 A;  5A91 A;  3RTY A;  3BJN A;  2Y2G A;  3LY3 A;  4OKP A;  3MZE A;  1PZP A;  1M6K A;  5EVI B;  4NET A;  4MN5 A;  1OTE A;  2HJE A;  4E3M A;  2XRO A;  2WKE A;  1YSQ A;  2ZM8 A;  4IUH A;  2H10 A;  2WAD A;  3VSL A;  5F68 A;  3MZD A;  4B4X A;  5L2F A;  1CI9 A;  2XD1 A;  3M6H A;  1NRJ A;  4FH4 A;  4QJG A;  2ZMA A;  3A0S A;  4X1L A;  4ZTK A;  1OTA A;  2HDS A;  3T1S A;  3T4K A;  4MBF A;  1XFN A;  3LYX A;  4MDZ A;  4EW7 A;  3FPV A;  4Y3I A;  2J3W A;  5FDS A;  2ZD8 A;  3H7W A;  1KVL A;  1N9B A;  4CQH A;  5HDC A;  2HJ9 C;  4OLG A;  2HZ5 A;  2W0N A;  3MXQ A;  3QP2 A;  2JKT I;  2UWX A;  1SZV A;  5BOH A;  5F69 A;  1PWD A;  2QZ6 A;  2OV5 A;  3A3I A;  3IBJ A;  1D1J A;  3MJQ A;  1NLY A;  2QJ5 A;  3PHY A;  5EVE A;  3S7N A;  3T4Q A;  2XA7 M;  3SS4 A;  1D7E A;  3QNB A;  3E98 A;  3DBA A;  1W7F A;  3PAG A;  3PTE A;  3BFF A;  4LRZ E;  5FI2 A;  3WRZ A;  4EUV A;  3ZHH A;  3GRJ A;  3VP2 A;  1ONH A;  1RCJ A;  2NUP C;  4R70 A;  5FL3 A;  3E2K A;  2W1T B;  1KGF A;  2VA0 A;  3DTE A;  2PT7 A;  4EXO A;  1W63 Q;  5FAS A;  1XFQ A;  4BL3 A;  5AJG A;  1K57 C;  1DJC A;  1AXB A;  4GHI A;  1F9I A;  1Q2Q A;  5DTK A;  2ZOI A;  2ZMF A;  1G5U A;  4Y13 A;  5K5B A;  1J3W A;  4II7 A;  4ZAM A;  4N9K A;  4WYY A;  5J3W A;  1Z09 A;  4E6W A;  4PM6 A;  3UPN A;  4GHI B;  5A90 A;  2VGJ A;  2L4R A;  4L9E A;  5CXW A;  4BL2 A;  5L07 A;  4K0X A;  5AVF A;  4KZ9 A;  5HDD A;  5DFY A;  4JLF A;  2VKS A;  1VEU A;  3N7W A;  1SCW A;  2JKF A;  2Y55 A;  5FQ9 A;  2M1C A;  1H8Z A;  1K25 A;  3BQ8 A;  5FEG A;  2PU2 A;  1VEU B;  1A0K A;  2WKQ A;  3G32 A;  4E3N A;  5FQQ A;  2OWJ A;  1PW1 A;  3UDX A;  3IXD A;  4PKY A;  3MZF A;  4IJG A;  3IF5 A;  4HBT A;  3IXH A;  2V0U A;  2GDN A;  3L9K A;  4NKP A;  5HWT A;  3VSK A;  3LR3 A;  2WZZ A;  4B4Z A;  3MS6 A;  5CGW A;  4OOM A;  4F3L A;  1BLC A;  4HHD A;  3VP1 A;  1NYM A;  1OME A;  4ZDX A;  1IYS A;  3FZC A;  4R6L A;  4MBH A;  3CG5 A;  5M1A A;  1GHM A;  2ZC7 A;  4Y15 A;  3UB5 P;  2M7U A;  4F3L B;  3K3D A;  3RXW A;  1GHP A;  5TJJ A;  1TEM A;  4X6T A;  4S2N A;  5IU1 A;  3WS2 A;  4H6J A;  2H0Y A;  4IHQ A;  2HP6 A;  3MKE A;  5DF7 A;  5GL9 A;  1KDS A;  2Q0O A;  4RX3 A;  3CHW P;  1DP9 A;  3O87 A;  5EM1 A;  1BUL A;  2Y2K A;  5J7E A;  4HBU A;  3Q82 A;  4C3Q A;  4OVD A;  3ZYT A;  1MC0 A;  5DKK A;  1JTD A;  4H6J B;  4KG5 A;  2Y2H A;  3HUO A;  3HCY A;  3W4Q A;  2NUT C;  1L0G A;  3MFD A;  5EV0 A;  1OPX A;  1CQA A;  5AQA A;  3T4O A;  2CMN A;  3SH7 A;  3C4O A;  3A0R A;  3S4X A;  1MZU A;  3GV9 A;  1XA1 A;  2MJ6 A;  4R4R A;  4Q0I A;  4R4S A; 
#chains in the Genus database with same CATH homology
 2ZM0 A;  4X68 A;  1PI5 A;  3AGD A;  2ZJ9 A;  1RGZ A;  1I5Q A;  4KQR A;  1M40 A;  4KZ6 A;  4PMA A;  2C6W B;  3EQV A;  4XXR A;  3W4O A;  5HAR A;  1O07 A;  2Y2P A;  3ZNT A;  5KZH A;  4UHU A;  4S2J A;  2XEP A;  1W5D A;  2J9P A;  4WBG A;  4P6B A;  1JWZ A;  3Q7V B;  4KZ8 A;  1K4E A;  3IH9 A;  1BSG A;  5EVI D;  3UE3 A;  4JXS A;  3UPP A;  3OPH A;  1KE3 A;  3NI9 A;  2ZQ8 A;  1E3U A;  3IQA A;  5GHX A;  3RJU A;  3G34 A;  4KZB A;  3UO9 A;  3M2J A;  2XF3 A;  3G2Z A;  2XH9 A;  4L0L A;  3VOZ A;  3VFH A;  3OPL A;  5M19 A;  2PU4 A;  2JE5 A;  5CHU A;  3CZD A;  4N1H A;  3SS5 A;  1Q2P A;  4X53 A;  2Y2M A;  1KDW A;  4B88 A;  4OQI A;  3HVF A;  3SH9 A;  4YIN A;  1XP4 A;  1Y54 A;  1YLJ A;  3G31 A;  4GKU A;  2I72 A;  1K55 A;  3IWQ A;  4GB7 A;  4PM5 A;  1ALQ A;  3N8R A;  1FCO A;  1LLB A;  4S2O A;  1CI8 A;  2ZLY A;  4JKT A;  1XGJ A;  4JXG A;  4N1X A;  3DWZ A;  4QB8 A;  2J9O A;  3SS3 A;  3PBR A;  2WUQ A;  2QPN A;  5U47 A;  2ZQA A;  4KZA A;  4OLD A;  4Y0T A;  1WYB A;  5CED A;  1I2S A;  4DDY A;  1K38 A;  2P9V A;  4IVI A;  4OON A;  2EFX A;  2Q9M A;  2X01 A;  4Z9Q A;  3RXX A;  1QME A;  4EV4 A;  3CMZ A;  1L0E A;  1IKG A;  4HEF A;  4OQG A;  2HP9 A;  3PBQ A;  3VMA A;  4XUX A;  2Y2I A;  5DTS A;  3VOY A;  3ZGA B;  4LV3 A;  4BD1 A;  2A49 A;  3V50 A;  5HAI A;  1IEM A;  4X56 A;  1FOF A;  2XFS A;  2XD5 A;  2Q9N A;  5GLD A;  2ZC3 B;  5FI7 A;  2C5W B;  3A3F A;  4S2N C;  3TOI A;  1E25 A;  1HZO A;  5E2H A;  1SHV A;  3EQU A;  3NIA A;  4DRT A;  3O3V A;  3GSG A;  4FSF A;  1NY0 A;  5A92 A;  2A3U A;  3C7V A;  3TG9 A;  5CTN A;  4E3I A;  3UDF A;  4Q8I A;  4S2M A;  4P0M A;  4HES A;  4RYE A;  5EEC A;  4KG2 A;  1BT5 A;  1JWV A;  3WS1 A;  2HP5 A;  1PWG A;  1J9M A;  1Z6F A;  4DE1 A;  1PW8 A;  4F94 A;  4ZJ1 A;  3ITB A;  4QY5 A;  5E2G A;  3HLD A;  4K91 A;  2XGN A;  4OPQ A;  1ZG4 A;  1C3B A;  4OQ0 A;  5HFO A;  2XK1 A;  1KE4 A;  4IED A;  3E2L A;  1KGE A;  4KEN B;  4KQQ A;  5CTM A;  1XPB A;  1FCM A;  1HD8 A;  4BLM A;  1H5X A;  2JBF A;  3M6B A;  3ZVW A;  3AGE A;  3UE0 A;  1RP5 A;  4WMC D;  3B3X A;  3WS2 A;  4C75 A;  5A93 A;  3MKF A;  4ZJ2 A;  5FAQ A;  3LCE A;  1GCE A;  4N92 A;  1JWP A;  5JYO A;  1FCN A;  4MBK A;  4OOL A;  2B5R A;  2OLV A;  3M2K A;  3IWI A;  1BLH A;  5GHY A;  3PAE A;  2WGI A;  1K56 D;  4WZ5 C;  4RVA A;  3GQZ A;  5EVI A;  3WS4 A;  5EOO A;  1LHY A;  3O86 A;  2G2U A;  5HAQ A;  3NBL A;  3Q1F A;  1CEG A;  4EBP A;  1NRF A;  4UA7 A;  3IWO A;  1PZO A;  5A91 A;  5EOE A;  4QY6 A;  3FKV A;  5F82 A;  3A3D A;  2RCX A;  2WZX A;  1L0F A;  2Y2G A;  3LY3 A;  4EUZ A;  3FV7 A;  4OKP A;  5FSR A;  3MZE A;  4GNU A;  3ZCZ A;  3P98 A;  2ZM2 A;  5FA7 A;  3ZG7 B;  1PZP A;  3FYZ A;  4WEJ A;  1ES3 A;  2BG1 A;  4C6Y A;  4QHC A;  1M6K A;  5EVI B;  4NET A;  4R0Q A;  5JYP A;  3G4P A;  4Y0U A;  3HLG A;  3ZG8 B;  4E3M A;  2Y4A A;  4MEZ A;  5DF9 A;  2JC7 A;  3O88 A;  4JPM A;  2WKE A;  1H8Y A;  4S2I A;  2ZM8 A;  3D4F A;  5AQ7 A;  4Y0O A;  4S2L A;  1PWC A;  1KE0 A;  2BLS A;  1VQQ A;  4IBX A;  1W79 A;  2H10 A;  2WAD A;  3VSL A;  1YLW A;  2WGW A;  1DJA A;  5GLC A;  4CJN A;  5CEC A;  2G2W A;  3MZD A;  3PBT A;  4P85 A;  1XGI A;  4B4X A;  5L2F A;  2ZC6 B;  5FDH A;  3WS0 A;  1CI9 A;  2XD1 A;  3M6H A;  4PM8 A;  3DWK A;  3VP0 A;  1K55 C;  2FFY A;  4E3L A;  4FH4 A;  4QJG A;  1K54 A;  2WAF A;  1L0D A;  1TVF A;  2DRW A;  4RX2 A;  1XKZ A;  2ZMA A;  1S0W A;  1BUE A;  4GOG A;  4OOY A;  4QD4 A;  5M18 A;  4ZTK A;  1HTZ A;  2HDS A;  1XA7 A;  3LY4 A;  2WYX A;  5CGS A;  4MBF A;  4KZ3 A;  4KZ4 A;  3UPO A;  2WGW B;  4R3J A;  3IHA A;  4OH0 A;  5AQ9 A;  2ZD8 A;  1PYY A;  5GLB A;  4UAA A;  1KVL A;  1N9B A;  3LO7 A;  4KQO A;  1S6R A;  3BEB A;  1SDN A;  3N4I A;  4ZBE A;  3NDE A;  5FI6 A;  4OLG A;  3OZH A;  4JBF A;  4FCF A;  1KGG A;  2EX9 A;  5F83 A;  1IEL A;  2UWX A;  3S22 A;  5BOH A;  3GTC A;  1QMF A;  5CHJ A;  3HL9 A;  4KZ5 A;  1PWD A;  3QHY A;  2EX8 A;  2VGK A;  2Y2Q A;  2WKI A;  2XDM A;  3C7U A;  4OPR A;  4RA7 A;  2DNS A;  5KMW A;  2QZ6 A;  2OV5 A;  3A3I A;  1YM1 A;  3FWL A;  3IF6 A;  3OPR A;  3PBO A;  1YLY A;  1NJ4 A;  3DW0 A;  4WMC A;  3W4P A;  1LL9 A;  3LEZ A;  2P9V B;  3OCL A;  4BD0 A;  3PBN A;  3ISG A;  4X55 A;  1MWU A;  3ITA A;  3SS4 A;  5HW3 A;  4GDB A;  3QNB A;  1BLP A;  4MNR A;  3A3J A;  4U0T A;  1MY8 A;  4M3K A;  1K56 A;  1MWT A;  4BJP A;  5KSH A;  1FSW A;  3AGF A;  4JF5 A;  1ZC2 A;  1W7F A;  2V1Z A;  5F1F A;  4MLL A;  3PAG A;  3IF6 B;  3BFF A;  3PTE A;  5FI2 A;  5G18 A;  1MKI A;  4P87 A;  3WRZ A;  4BQM A;  4O7D A;  4KZ7 A;  2QMI A;  3HUM A;  3IXG A;  3ZHH A;  4LV1 A;  3GRJ A;  3VP2 A;  1TDG A;  1JVJ A;  1BZA A;  1ONH A;  4JXW A;  4R3B A;  1RCJ A;  3UDI A;  2Y91 A;  2IWB A;  3W8K A;  3IXB A;  2Y2O A;  1EWZ A;  5TGF A;  1MXO A;  3ZDJ A;  3E2K A;  2P74 A;  5HL1 A;  4DF6 A;  3ZVT A;  3WWX A;  5EVI C;  4GD6 A;  1KGF A;  2H5S A;  3HLF A;  2OSU A;  4WZ4 A;  2ZQC A;  3TSG A;  5KSC A;  4A5R A;  4WEL A;  4DXC A;  2FFF B;  2Y2N A;  5FAS A;  3V39 A;  1PI4 A;  3NC8 A;  2RL3 A;  3HLE A;  5FQI A;  4S2K A;  4BL3 A;  1YLP A;  1BLS A;  3G35 A;  4IBR A;  4GN2 A;  1K4F A;  4DE0 A;  3NDG A;  3ZG5 A;  2E8I A;  1TDL A;  3UNW A;  4EBL A;  1K57 C;  2ZQ7 A;  1ES4 A;  3HLW A;  3G30 A;  3BYD A;  4ID4 A;  5TR7 A;  5I94 A;  1DJC A;  1AXB A;  1Q2Q A;  2EXB A;  3IT9 A;  2DCF A;  1NZO A;  5HAP A;  1ERO A;  5DTK A;  4LEN A;  1BTL A;  1DY6 A;  2J7V A;  4OP5 A;  4R23 A;  1YLT A;  5E2F A;  2ZC5 B;  1K57 A;  4ZAM A;  3ZNY A;  4N9K A;  3HUN A;  4WYY A;  5FAO A;  4FD8 A;  4E6W A;  4PM6 A;  2XLN A;  1L2S A;  1G6A A;  3JYI A;  3UPN A;  4E3O A;  2ZQ9 A;  3GVB A;  2HPB A;  5A90 A;  2VGJ A;  4PM9 A;  4EBN A;  3V3S A;  2WK0 A;  3HRE A;  1YMS A;  4OPZ A;  1ZKJ A;  5CXW A;  4BL2 A;  1IYP A;  1K54 C;  4DE2 A;  2IWD A;  4K0X A;  4LCM A;  3UE1 A;  4KZ9 A;  3UN7 A;  2HDQ A;  1G68 A;  3Q7Z A;  3OC2 A;  3VFF A;  4ZJ3 A;  4U3T A;  1WYC A;  4JLF A;  3C5A A;  4JF6 A;  3N7W A;  5E43 A;  1SCW A;  1JTG A;  3Q07 A;  4DKI A;  1ERQ A;  1I2W A;  1ES5 A;  4CPK A;  4E3J A;  4DXB A;  5GLA A;  3BFD A;  2HDU A;  2Y55 A;  4D2O A;  5FQ9 A;  4E3K A;  2PBY A;  1KVM A;  1H8Z A;  1K25 A;  1WE4 A;  2R9W A;  3BM6 A;  2IWC A;  1MWR A;  1O7E A;  5DF8 A;  2WAE A;  2WGV A;  4UA6 A;  3MXS A;  2PU2 A;  1IYO A;  2HDR A;  5FQJ A;  2J8Y A;  3G32 A;  4E3N A;  5FQQ A;  4LV2 A;  1W8Y A;  1PW1 A;  3UDX A;  1XXM A;  3BFC A;  4BEN A;  1MBL A;  3IXD A;  4PPR A;  3N6I A;  1GA9 A;  1XX2 A;  1DJB A;  1E4D A;  2XFT A;  3MZF A;  3IF6 C;  5IHV A;  1FQG A;  3IF5 A;  2XR0 A;  4EQI A;  1GHI A;  4E6X A;  3C4P A;  4HBT A;  4U0X A;  4GZB A;  3IXH A;  3S1Y A;  2V20 A;  5HX9 A;  4EWF A;  2GDN A;  4OP8 A;  3HLC A;  3V5M A;  1LI0 A;  1YMX A;  2X02 A;  2CC1 A;  3ZG9 B;  3HBR A;  1FR6 A;  3VSK A;  4DE3 A;  2EX6 A;  2WZZ A;  4B4Z A;  1YT4 A;  4JF4 A;  5CEB A;  1NXY A;  4LV0 A;  3NCK A;  5E2E A;  2ZC4 B;  4R1G A;  5CGW A;  4YFM A;  4QU3 A;  4OOM A;  1N4O A;  1BLC A;  1GA0 A;  3WS5 A;  1E3U D;  5CRF A;  3P09 A;  3VP1 A;  1NYM A;  5EPH A;  4UA9 A;  2Z2M B;  1OME A;  5F1G A;  1ESU A;  4ZDX A;  4IVK A;  3WRT A;  1IYS A;  3MXR A;  3OCN A;  3UY6 A;  5J8X A;  5AQB A;  3FZC A;  4DDS A;  4MBH A;  3CG5 A;  1ES2 A;  2EXA A;  5EVL A;  1SKF A;  5M1A A;  4K0W A;  1GHM A;  1K6S A;  2JCH A;  4WEK A;  3VP4 A;  2ZC7 A;  5FQM A;  1PIO A;  3MBZ A;  3ZG0 A;  3V3R A;  3RXW A;  1CEF A;  1HVB A;  3Q81 A;  4NK3 A;  1GHP A;  3N8S A;  3G2Y A;  4KG6 A;  1TEM A;  3HLB A;  4PM7 A;  4S2N A;  2Y2J A;  4X6T A;  4OQH A;  2EX2 A;  3BEC A;  2H0Y A;  3PBS A;  3QNC A;  4WM9 A;  5CER A;  4Y7P A;  3A3E A;  2HP6 A;  3MKE A;  3BFG A;  1FR1 A;  3CJM A;  3BLM A;  4OPY A;  2Y2L A;  2Z2L B;  4FH2 A;  1KDS A;  1MPL A;  3N8L A;  5DF7 A;  4GDN A;  4RX3 A;  5GL9 A;  5CGX A;  2XQZ A;  3IHB A;  3O87 A;  5TFQ A;  4LCL A;  1BUL A;  1ERM A;  2WKH A;  2Y2K A;  1FSY A;  3GR2 A;  4GD8 A;  4HBU A;  3Q82 A;  4C3Q A;  5D3O A;  5DTT A;  1ZG6 A;  1LI9 A;  4OVD A;  3ZFZ A;  1ONG A;  5EUA A;  2R9X A;  3SOI A;  1CK3 A;  1JTD A;  4XUZ A;  3GMW A;  3VP3 A;  3FKW A;  1W8Q A;  5CHM A;  4KG5 A;  2Y2H A;  4N9L A;  3HUO A;  1RGY A;  2EFU A;  4S2P A;  3W4Q A;  1K6R A;  1NYY A;  3SH8 A;  1IYQ A;  5FQK A;  1L0G A;  3MFD A;  3BRM A;  1U60 A;  5AQA A;  1YLZ A;  2X71 A;  1SDE A;  1VM1 A;  2OLU A;  5GHZ A;  3NY4 A;  2V2F F;  3IH8 A;  5FAP A;  2H0T A;  3SH7 A;  1ESI A;  1LL5 A;  3C4O A;  2Y59 A;  5DVA A;  3BFE A;  1NZU A;  3DTM A;  3S4X A;  3Q7V A;  4WZ5 A;  3BLS A;  3GV9 A;  4JXV A;  1XA1 A;  2ZQD A;  3I7J A;  1IKI A;  4H8R A;  4R4R A;  1YQS A;  5FAT A;  5EE8 A;  1MWS A;  1EI5 A;  4R4S A;  4X69 A;  3OPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...