4BQMA

Crystal structure of human liver-type glutaminase, catalytic domain
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
318
structure length
296
Chain Sequence
LYFQSMIPDFEEFTGHVDRIFEDVKELPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHKFVGKEPSLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAGNEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGAILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GLUTAMINASE LIVER ISOFORM, MITOCHONDRIAL
publication title Crystal Structure of Human Liver-Type Glutaminase, Catalytic Domain
rcsb
source organism Homo sapiens
total genus 104
structure length 296
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04960 Glutaminase Glutaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4bqmA00
3PBNA 2E8IA 1NJ4A 2GDNA 3D4FA 4K0WA 4S2LA 1BLHA 1BT5A 1SKFA 3ZG8B 4BJPA 1FOFA 1YQSA 2Z2MB 4KG5A 1EI5A 4DXCA 3WRZA 3UE0A 4DDYA 1JVJA 3N8SA 1EROA 4QY5A 4BD0A 4GDNA 3UDFA 1OMEA 4PMAA 5EVIB 1YMSA 1Q2QA 4S2NC 1ES2A 4FSFA 5GLCA 5F1FA 3MXRA 5GL9A 5EVLA 4WEKA 2WZXA 3GR2A 2HPBA 1NYMA 5DTTA 3S4XA 1FCMA 1IEMA 3PAGA 3G4PA 3V50A 3NCKA 3GSGA 2WGWA 4S2IA 5CGWA 2Y2PA 3W4QA 1M40A 1XGJA 1W7FA 1IKGA 4WM9A 4E6WA 1I2WA 4PM9A 1BLPA 3ZFZA 4YFMA 3NDGA 1AXBA 3UPPA 4OVDA 4IVKA 2WGIA 5HW3A 5I94A 2Y4AA 5HFOA 2C6WB 3BRMA 1XKZA 5CHMA 4A5RA 5E2HA 4X53A 3ZGAB 4RX3A 4OP8A 2B5RA 3A3DA 5AQBA 3LY4A 3Q81A 3AGDA 1CI9A 3QHYA 1O7EA 4EWFA 2ZMAA 1BSGA 2OV5A 4EQIA 2Q9MA 3NBLA 3A3FA 4B4ZA 4U0XA 2HP6A 3ZNTA 2Y59A 3UN7A 3VSKA 1DJCA 1NY0A 4DKIA 1CEGA 2OLUA 4R23A 2XGNA 1Q2PA 4DE2A 1FSWA 4P85A 3IHBA 3VOZA 2J9OA 4E3MA 1GHPA 4PM6A 5KMWA 4ZDXA 2Y2MA 2ZM2A 3HLDA 3V5MA 3ZVWA 4X6TA 3OCNA 3MBZA 3MXSA 2HP5A 3MFDA 3C7VA 5EVIC 3AGEA 4KQOA 4OQGA 5FI7A 3W4OA 5A90A 3IH8A 1GHMA 2ZQDA 5A91A 2HP9A 2X02A 2PU2A 1GCEA 3P98A 2WAEA 4JXGA 3UE3A 1KE0A 4BQMA 3W8KA 5CTNA 2DNSA 1K6SA 1NRFA 1YLYA 1L0EA 1XX2A 3GTCA 4RYEA 4X69A 3IF6B 3E2KA 1JWZA 2WZZA 4Y7PA 4H8RA 5FI6A 5HAPA 4KZBA 1NYYA 5G18A 3ZVTA 4EUZA 3BEBA 3C5AA 1PWCA 2DRWA 3CMZA 1Z6FA 4M3KA 3BYDA 1VQQA 3GV9A 1MXOA 4PPRA 1VM1A 1ERMA 2H10A 4C3QA 1ERQA 4OOYA 5FASA 4GB7A 4JXWA 1K38A 5HL1A 3VFHA 3IWQA 3BECA 5DF7A 5FATA 2UWXA 1XP4A 1ZKJA 1MKIA 3Q7VB 4LV2A 1BLCA 2XFSA 3HLBA 4X55A 4JF5A 4N9LA 2XD5A 3NY4A 4JF6A 4GOGA 1H8ZA 2RCXA 3FWLA 5FQQA 3A3JA 3GQZA 1FR1A 1YLJA 4E3IA 4LCLA 4UA9A 1L2SA 1MWTA 4JKTA 3ZDJA 3ZCZA 1CEFA 5CHUA 2QZ6A 3QNBA 4P87A 5DTKA 1ONGA 1E3UD 4KQQA 3G32A 4WZ5A 1GA0A 1XA7A 1PW8A 3PBRA 5M18A 4KZ5A 3MZEA 4HBTA 4KG2A 5L2FA 4LENA 5A92A 3C4PA 1BULA 5E2GA 1MY8A 1W5DA 2ZJ9A 3IXBA 1JWVA 4U3TA 3IF6C 4YINA 5D3OA 2G2UA 1HTZA 1E4DA 3OC2A 4IBRA 1KE4A 3V3RA 4KZ7A 1K55A 2H0YA 3VP2A 4KG6A 1XPBA 3G35A 2Y2HA 5CECA 3SH7A 5HAQA 2Q9NA 1G6AA 4Y0TA 3IF5A 3GMWA 5FAOA 1KVLA 3NIAA 4FH4A 1ONHA 2Y91A 4KZ3A 4MBKA 4N92A 3E2LA 3VP1A 3DWZA 1O07A 3HREA 4P6BA 5CXWA 5EUAA 1DJAA 4K91A 3UDIA 5HARA 3OZHA 4PM8A 5GHXA 2Z2LB 4E6XA 2G2WA 4L0LA 4Y0UA 2J7VA 1YLTA 4F94A 2C5WB 5AQ9A 3IWIA 2EFXA 4ZJ1A 1GHIA 3PBSA 4OQHA 4IEDA 4S2KA 2PU4A 2EXBA 5E2EA 2ZC4B 1TDGA 4E3JA 3ZNYA 1XGIA 2Y2KA 4BL2A 1KGEA 1KE3A 1PW1A 1RGZA 3VFFA 3MZFA 4S2NA 1XXMA 5FSRA 4NETA 1PWGA 5FQKA 1BZAA 5E43A 3IQAA 4R4SA 3BFGA 2IWBA 3G2YA 4OLDA 5F82A 4GNUA 4R3BA 3M2KA 2A49A 5JYPA 3HLWA 3MZDA 4NK3A 1K56D 2IWDA 3C4OA 4HEFA 3O86A 2QPNA 4CJNA 4ZTKA 1PWDA 5FA7A 3UY6A 4GKUA 2EX9A 4JLFA 1CI8A 5CEBA 4QU3A 2HDRA 3LCEA 1JTDA 1LL5A 3HVFA 5CTMA 5DF8A 5IHVA 2R9XA 3S22A 3Q1FA 5BOHA 3IH9A 1FCNA 3Q07A 3A3IA 1KGFA 3WRTA 1G68A 3UDXA 4RX2A 1FR6A 1IYOA 1HD8A 2XEPA 1WE4A 2P9VB 1IYQA 1ESIA 4EV4A 4KQRA 1DJBA 1I2SA 4QHCA 2ZQ9A 2PBYA 1SDNA 4O7DA 1IELA 2WKHA 4E3LA 2I72A 4KZ9A 5CEDA 1L0DA 3PBOA 1IYSA 1W8YA 2XLNA 4JPMA 5EVIA 1HVBA 1XA1A 3P09A 4KENB 1KVMA 4C75A 4D2OA 4EBNA 4E3KA 1N9BA 3IHAA 3O3VA 4K0XA 4LV1A 4N1HA 4OOMA 2ZQAA 2IWCA 4GN2A 3VP3A 1U60A 1W79A 2WAFA 3OPLA 5CERA 1ESUA 1RCJA 3BFEA 1YLPA 1M6KA 2ZC3B 4JBFA 4Y0OA 3VMAA 2WKEA 1H8YA 4WEJA 4C6YA 1BUEA 3EQVA 3FV7A 5HAIA 1LL9A 1J9MA 3G34A 5CGXA 3WS5A 4DE1A 2V20A 3LEZA 5E2FA 1SDEA 2JBFA 4IBXA 5A93A 1EWZA 3BFDA 4S2JA 4FD8A 2DCFA 3UNWA 3G31A 3RXXA 2V2FF 3PBQA 4R0QA 4S2MA 1WYCA 3IXGA 3ZG0A 1K4EA 3V39A 4FH2A 4DXBA 1LLBA 3MKEA 3RXWA 4XUXA 3IT9A 2ZQ7A 2EX2A 3ZHHA 4DE0A 2ZQCA 1ES4A 3BFFA 4ID4A 1I5QA 2P9VA 1NZUA 1K57C 1S0WA 1K6RA 3Q82A 4IVIA 2OLVA 3ZG9B 3A3EA 2J9PA 4GZBA 3TOIA 2JC7A 2EX6A 5EOEA 3TSGA 1MPLA 4HESA 3C7UA 2HDSA 5FQIA 1DY6A 1ES5A 2R9WA 3WS2A 1PYYA 4KZ8A 3OPRA 3HUMA 3IF6A 3HLCA 1YT4A 1BTLA 3CJMA 3ZG5A 4OONA 5KSHA 5DTSA 4KZ4A 2Y2NA 4RA7A 3B3XA 2CC1A 3BLMA 2XK1A 3IXHA 5FQ9A 4PM7A 4X68A 3BM6A 5FAQA 5FQMA 3FYZA 4WYYA 5TFQA 3VP4A 4OH0A 3S1YA 4DF6A 4EBPA 1SCWA 1Y54A 5GLDA 1RP5A 1K54C 2Y2IA 3Q7VA 3FKWA 1K25A 3HUNA 3LO7A 1RGYA 3N7WA 3SS5A 1N4OA 3WS1A 1BLSA 2Y55A 2WUQA 2X01A 2QMIA 2X71A 4OPZA 4XXRA 5EE8A 4R4RA 5EOOA 2FFYA 5FDHA 5FQJA 4PM5A 2Y2GA 2H0TA 3IWOA 2ZM8A 4OPRA 4GDBA 4MEZA 3SH8A 5GHYA 3FZCA 3OCLA 4BLMA 1K54A 2Y2QA 1IYPA 1TEMA 2ZLYA 3HBRA 1LHYA 4KZAA 4WMCD 2HDUA 1PI4A 4JXVA 4WELA 3PAEA 5EPHA 2Y2LA 5AQAA 5HX9A 3WWXA 4Q8IA 2JCHA 3MKFA 5TR7A 3EQUA 4QB8A 3UE1A 4BD1A 1MWRA 4UHUA 1YM1A 3ITAA 2A3UA 4WBGA 3HLFA 1E3UA 2ZC7A 5F1GA 1L0GA 1JWPA 4QJGA 4ZJ3A 4S2PA 1S6RA 4RVAA 4CPKA 2ZC6B 5FI2A 2BLSA 5CGSA 3IXDA 5TGFA 1ALQA 3HLEA 3W4PA 3ISGA 3N4IA 3M2JA 3PBTA 2ZD8A 2XR0A 4B4XA 1PI5A 5JYOA 5M19A 1H5XA 4QD4A 4MBHA 2XD1A 3ITBA 3NI9A 1KGGA 4BL3A 2P74A 3TG9A 1FCOA 4LV3A 2XQZA 4WZ4A 3SH9A 3UPNA 4DRTA 5KSCA 1IKIA 4B88A 2RL3A 4HBUA 4MBFA 1PZPA 1YLZA 4OKPA 1QMFA 1SHVA 5DF9A 3V3SA 4MNRA 4QY6A 4OQ0A 4E3NA 3VOYA 3JYIA 5GLBA 4GD6A 1TDLA 4OPYA 4UA7A 1E25A 1MBLA 5GHZA 2WGVA 4JF4A 2FFFB 3GVBA 2XDMA 4MLLA 1W8QA 3OPHA 1FSYA 3I7JA 3LY3A 1L0FA 1LI0A 1CK3A 2WADA 1YMXA 3NC8A 1GA9A 4R1GA 1ZG4A 3BLSA 4LV0A 2OSUA 3WS0A 2WKIA 3O87A 3SS3A 4EBLA 2Y2OA 1C3BA 1LI9A 3M6BA 3HUOA 4OP5A 3G30A 4GD8A 5KZHA 3N8LA 4FCFA 3CZDA 1QMEA 1ZG6A 3O88A 3N8RA 3HL9A 3QNCA 4OQIA 2EX8A 3VSLA 5U47A 4UA6A 3SOIA 2Y2JA 4Z9QA 4P0MA 3G2ZA 5CHJA 5F83A 4N1XA 5GLAA 4WMCA 3HLGA 1ES3A 1K56A 5DVAA 4WZ5C 1KDSA 2VGKA 3DTMA 4BENA 2HDQA 5M1AA 1K57A 5EECA 4KZ6A 4OOLA 2WGWB 1FQGA 3Q7ZA 5AQ7A 3ZG7B 1MWUA 1WYBA 1TVFA 4DE3A 2EFUA 3M6HA 4ZAMA 1PZOA 2ZM0A 3AGFA 3BFCA 1K55C 1PIOA 3GRJA 1HZOA 1NXYA 1NZOA 4N9KA 3DWKA 3RJUA 4DDSA 1MWSA 2H5SA 2ZC5B 3N6IA 5CRFA 3SS4A 3OPPA 3FKVA 1YLWA 2VGJA 4X56A 2BG1A 4XUZA 3CG5A 5FAPA 2J8YA 2XH9A 2XFTA 4LCMA 3UO9A 4OLGA 4OPQA 4ZBEA 2JE5A 4ZJ2A 5EVID 3WS4A 2EXAA 4JXSA 5J8XA 3DW0A 3UPOA 1ZC2A 2V1ZA 2XF3A 4UAAA 4R3JA 2ZQ8A 3VP0A 2WYXA 3NDEA 4E3OA 2WK0A 1JTGA 4S2OA 1K4FA 4U0TA 3PTEA 1KDWA
chains in the Genus database with same CATH superfamily
2BASA 3U2AA 4BJPA 1Z09A 4WLAA 1FOFA 4I5SA 4H6JB 1EI5A 3UE0A 4QY5A 2Q0OA 4WN5A 3LR5A 1Q2QA 1ES2A 1YKDA 3K2NA 3GR2A 5DTTA 2ZOHA 1S67L 5CX7A 1J3WA 3SW1A 4WM9A 4E6WA 1I2WA 5HW3A 4JGQA 5E2HA 4X53A 1VEUA 4RX3A 2B5RA 3H82B 4EXOA 2A24B 4EQIA 5G4YA 3A3FA 4DKIA 4U0XA 2PAVP 3ZNTA 3VSKA 1NY0A 1CEGA 1T18A 2OLUA 3QP2A 4E3MA 5KMWA 3MQ0A 1LSWA 2ZM2A 3OCNA 3W4OA 5DKKA 2ZQDA 2X02A 3P98A 1GCEA 4Q0IA 2WAEA 3UE3A 1S1YA 1XX2A 3VE3A 4RYEA 2WZZA 3K3DA 2XSSA 3R4KA 3GV9A 4CLCC 4C3QA 1ERQA 4BWIA 3LIDA 1K38A 3VFHA 3IWQA 3CLOA 1MKIA 4LV2A 1BLCA 2XFSA 4X55A 4N9LA 5FQQA 4UA9A 4JKTA 2ZMVA 4YWZA 3QNBA 5IU1A 1XJ2A 5M18A 3G6OA 3S7OA 4HY8A 3KSHA 5A92A 1W5DA 4WF0A 1JWVA 3JVVA 3LR4A 1E4DA 1KE4A 4KZ7A 1K55A 1S4SA 3VP2A 3P7NA 5HDSA 2Q9NA 3IF5A 3H7WA 5FAOA 4MBKA 4O0PA 3VP1A 3E2LA 3T12B 5CXWA 5EUAA 4ETZA 3C30A 3UDIA 5K5BA 4LRYC 4Y0UA 2J7VA 1SKOB 2VGLM 1LSXA 1GHIA 3PBSA 3TRCA 2EXBA 2WKPA 3MQOA 4LRZE 5TBMA 2JKRM 4EETB 3ZNYA 3P01A 1RGZA 1KE3A 4S2NA 1XXMA 4NETA 3F1PA 2IWBA 4OLDA 3OOVA 1H3QA 2A49A 2KDKA 5JYPA 3MZDA 1K56D 2XA7M 3O86A 4CJNA 3JVUA 2YKFA 5I5LA 3LCEA 1JTDA 1VHMA 2R9XA 5IHVA 1FCNA 3Q07A 4G3WA 3A0VA 1G28A 1G68A 3UDXA 3WRTA 1IYOA 4EV4A 4KQRA 1DJBA 1X0OA 1IELA 2WKHA 2I72A 5EVIA 2PD7A 3PYPA 4C75A 4D2OA 4ETXA 3IHAA 3O3VA 4K0XA 4N1HA 3F1NA 2ZQAA 5CERA 4D60A 4Y0OA 1YAXA 4JBFA 5EFWA 2WKEA 5HAIA 4DE1A 4X1MA 2W1TB 5EV0A 3BFDA 1IFQA 1NWZA 3T4JA 3MFXA 4S2MA 4DXBA 4LFUA 3BY8A 3MKEA 4IUKA 4XUXA 2ZQ7A 5TJJA 3ZHHA 3T4QA 4GS9B 4ID4A 3ZQ5A 3KX0X 1K6RA 3A3EA 5EOEA 4HESA 4L9GA 2R9WA 1PYYA 3IF6A 2W0NA 3CJMA 3BY9A 1N9LA 4KZ4A 2CC1A 4PM7A 4X68A 3VV4A 4OH0A 3S1YA 4EBPA 2HJ9C 1SCWA 2V0WA 4EU0A 1K54C 2Y2IA 3FKWA 3EOIA 3SS5A 3N7WA 2NUTC 5F6AA 3W2ZA 2Y55A 2WUQA 2QMIA 4P6ZS 5HWWA 1YSPA 2H0TA 3IWOA 3SH8A 5GHYA 3FZCA 3OCLA 3CUEC 5HD3A 3QP5A 3KYZA 3LI8A 3WWXA 3EQUA 4EW7A 4QB8A 3KYQA 3UE1A 4BD1A 4UHUA 1YM1A 2A3UA 2A2LA 3HLFA 1E3UA 5F1GA 4M4XA 4ZJ3A 4CPKA 5AVFA 2BLSA 3IX3A 3IXDA 5TGFA 2FH5A 3ISGA 3PBTA 2ZD8A 3IX8A 5JYOA 2Z6DA 2V8CA 1N9OA 4AFIA 1FCOA 2EWWA 4XT2A 4ARZA 2V0UA 1IKIA 2PYRA 1PZPA 4QY6A 1VETB 1E25A 1MBLA 4DMZA 2FFFB 4MLLA 1CK3A 3NC8A 4R1GA 1ZG4A 3WS0A 4EBLA 1KOUA 1LI9A 3HUOA 1XJ4A 5KZHA 3O88A 3N8RA 3QNCA 4OQIA 5HDCA 2PBDP 2OOLA 4UA6A 4HNBA 4Z9QA 5CHJA 4CLCE 5F83A 1ES3A 4G3VA 2GZAA 4BENA 1K57A 2PYPA 2WGWB 3Q7ZA 1V9ZA 4PKYG 3QP4A 1WYBA 3EEAA 4DE3A 1F9IA 3IS2A 1W63Q 3BFCA 2PT7A 1PIOA 1FILA 1HZOA 3RJUA 3T4TA 3LI9A 3N6IA 2VV8A 3R7WB 2BG1A 4QWOA 5FAPA 3KO6A 4OLGA 2JE5A 4GW9A 4JXSA 3UPOA 3VP0A 2GJ3A 2WYXA 2EA9A 4NXFA 2WK0A 4S2OA 3IBJA 2E8IA 1NJ4A 2GDNA 3D4FA 1BT5A 1SKFA 3ZG8B 4BBVA 1YQSA 2Z2MB 4DXCA 3N8SA 4BD0A 4GDNA 4PMAA 2PDRA 1YMSA 1UWNX 4FSFA 1EW0A 5HWTA 3S4XA 1FCMA 4I3AA 4NG2A 3GSGA 5CGWA 3W4QA 1M40A 1IKGA 1BLPA 4I38A 4IVKA 2WGIA 2P04A 2Y4AA 2C6WB 3BRMA 3H9WA 3ZGAB 1CQAA 1CI9A 4EWFA 1BSGA 4UEYA 2HGVA 1DJCA 1S66L 2VV7A 1FSWA 3VOZA 1GHPA 4ZDXA 2Y2MA 1OJ5A 3ZVWA 5FEGA 3UB7A 3CI6A 3AGEA 5A90A 3IH8A 1GHMA 4H6JA 3F1OB 5A91A 2PU2A 4JXGA 2VLGA 1OTEA 1P9WA 3W8KA 5CTNA 1L0EA 3CWFA 2QJ7A 2W1RA 2JKTI 3E2KA 3UE6A 5HAPA 2V1AA 4KZBA 1NYYA 5A8BA 3ULFA 4EUZA 1PWCA 2D02A 4M3KA 1MXOA 1ERMA 1ZHHB 1D06A 4JXWA 4Y5FA 4F3LA 4R3AA 2UWXA 2VK3A 3Q7VB 5DFYA 2XD5A 3NY4A 4GOGA 5HZHA 2WKQA 3T4SA 3A3JA 1FR1A 2A24A 4LCLA 1CEFA 5CHUA 3MMHA 4WZ5A 1GA0A 2I9VA 3PBRA 2OAP1 3MZEA 4HBTA 4KG2A 5L07A 4LENA 2V9AA 5E2GA 1MY8A 3IXBA 4U3TA 4YINA 2KX6A 1HTZA 3OC2A 2H0YA 4KG6A 5L8MA 5CECA 5HAQA 1ONHA 4KZ3A 3BQ8A 3DTKA 1MC0A 3T4KA 2H28A 5HARA 4I3JA 2G2WA 4L0LA 1YLTA 1DP8A 5FEFA 3IWIA 4CLCD 3KSGA 4O8GA 3PXPA 4IEDA 4HH3A 5E2EA 3LIFA 1W63M 4IHQA 1TDGA 4R70A 2Y2KA 4IJGA 4BL2A 1Y28A 4GLQA 3MZFA 2K31A 1PWGA 2DMWA 2JKFA 1BZAA 1CJFA 2B02A 3G2YA 2VKSA 4GNUA 2ZOIA 3EGXC 3QP8A 4CLCB 2INWA 4GHIA 2O99A 3HLWA 2IWDA 2QPNA 5L09A 5FA7A 4Y13A 2EX9A 4JLFA 1CI8A 5CEBA 4QU3A 2HDRA 1LL5A 3S22A 3Q1FA 5BOHA 3A3IA 4RX2A 3A0SA 1FR6A 4QHCA 3CPTB 3PBOA 2XLNA 4JPMA 4NKPA 3P09A 5DFXA 2VX8A 1KVMA 4OOMA 1TS7A 1M6KA 4MN5A 3VMAA 1UGUA 4WEJA 4C6YA 3BW6A 3WS5A 3EGDC 2GNXA 5E2FA 5A93A 4IBXA 2J3WA 2PRFA 3NULA 4S2JA 4Q0HA 3G31A 2V2FF 3PBQA 4R0QA 4EUVA 3IXGA 2QWSA 2KLIA 3RXWA 4DE0A 3BFFA 2JKTM 1S0WA 4IVIA 4HHDA 4GZBA 1MPLA 1DY6A 1ES5A 3E98A 3HUMA 1YT4A 1BTLA 3ZG5A 1G6OA 2K7SA 4RA7A 3B3XA 1VB6A 2XK1A 3LYXA 5HWVA 1YPRA 1VEUB 5FQMA 4WYYA 3EEHA 1RGYA 2HJEA 5AJGA 3WS1A 2QJ5A 3L7HA 2X01A 1STZA 1HLUP 2X71A 4XXRA 5EOOA 2FFYA 3HJIA 3K3CA 3LR3A 4GDBA 4MEZA 3UB8A 4LGWA 3C2WA 4GS9A 1P97A 3HBRA 4KZAA 2OWHA 2HDUA 4GJ4A 5HX9A 3B33A 2JCHA 5TR7A 1MWRA 3DAVA 3ITAA 4WBGA 2ZC7A 5HPFA 1JWPA 4QJGA 4HJ3A 4RVAA 4HIAA 3DBAA 4QD4A 3NI9A 4BL3A 2XQZA 3MF0A 4MBFA 1YLZA 4OKPA 1QMFA 2QYBA 3HJKA 5GLBA 1TDLA 2WGVA 1W8QA 3OPHA 4DN0A 2WADA 2D01A 3KYEA 3BLSA 4LV0A 3H7WB 2PD8A 4R38A 3BQAA 2J80A 2WKIA 3SS3A 2Y2OA 1C3BA 3M6BA 4GD8A 1ZG6A 2V8FA 4P0MA 4N1XA 2NUPC 5DVAA 1GSVA 2VGKA 3DTMA 5M1AA 2G7UA 3F1PB 3FG8A 1FQGA 5AQ7A 3PHYA 3RTYA 3NOUC 2EFUA 4ESPA 1PZOA 3AGFA 1TD5A 4HP4A 1K55C 3GRJA 3KSFA 4Y15A 2ZC5B 2H5SA 3SS4A 3OPPA 1YLWA 4XUZA 2L0WA 3VE4A 5EM1A 2XRNA 5J7EA 2ZMFA 2XH9A 2XFTA 3UO9A 4ZJ2A 3D3OA 5EVID 3WS4A 2EXAA 3DW0A 3QP6A 2EWVA 4UAAA 1T1BA 3NDEA 4UQIM 4E3OA 1K4FA 2W3DA 4Z1WA 1LSVA 4S2LA 1BLHA 1JVJA 1FIKA 3GECA 4LRXC 1EROA 3UDFA 3MSHA 3LEQA 1OMEA 5G4ZA 5EVIB 4S2NC 5GLCA 5F1FA 2XROA 2B18A 1LT0A 1NYMA 3F1NB 3G4PA 4S2IA 2WGWA 2Y2PA 4YFMA 3NDGA 1AXBA 1TF1A 1XKZA 5CHMA 4A5RA 3FPWA 4OP8A 3AGDA 2W3HA 3QHYA 2ZMAA 4EQ1A 1NLZA 2OV5A 3NBLA 2OAQ1 4R23A 1LL8A 2XGNA 4JGOA 3MJQA 4P85A 3IHBA 2J9OA 4PM6A 1H8MA 3HLDA 2W3FA 3MBZA 3MXSA 5FI7A 1TS0A 5EVIC 3UB5P 2HP9A 5C5KA 4BQMA 1NRFA 2YKHA 1D1JA 3E4QA 4HOIA 3GTCA 4X69A 3IF6B 2CMNA 4H8RA 4Y7PA 5G18A 5J3WA 3C5AA 2DRWA 3B47A 3CHWP 1Z6FA 1VQQA 1ZTUA 1A0KA 2H10A 2WKRA 4OOYA 5FASA 4FUWA 3BECA 5DF7A 5FATA 1XP4A 1ZKJA 1V9YA 4JF5A 2RCXA 3GQZA 4E3IA 5DJTA 1L2SA 3ZCZA 2QZ6A 5DTKA 1ONGA 1E3UD 4KQQA 1XA7A 5L2FA 4MCWA 3C4PA 1BULA 1JNUA 5FI6A 3IF6C 2UV0E 2G2UA 1BYWA 3F1OA 4NXEA 2P08A 3G35A 2M7UA 3SH7A 1KVLA 3NIAA 2B95A 1ODVA 3DWZA 4P6BA 1DJAA 2M1CA 4K91A 3CITA 4K08A 5HL6A 2Z6CA 2VGLS 5GHXA 5KIZA 5F68A 1NLYA 2C5WB 2EFXA 4ZJ1A 3S7PA 4XT2B 4OQHA 4ARZB 2PU4A 1KGEA 1PW1A 3LGOA 3IQAA 4R4SA 3BFGA 2XA7S 3S7QA 1T1CA 3M2KA 4G3KA 2OWJA 4NK3A 3C4OA 1F5MA 2VEAA 3DTEA 4GKUA 3HVFA 5HSQA 1HD8A 2XEPA 2P9VB 4FOFA 4HP9A 1I2SA 1SDNA 4O7DA 4E3LA 4KZ9A 5IS1A 1L0DA 1IYSA 1W8YA 3E4OA 1N9NA 4NEED 1G5UA 4LV1A 3VP3A 4FTXA 1U60A 3FPVA 1W79A 1ESUA 5AVEA 1RCJA 3BFEA 1YLPA 3TE8A 3LUQA 3FV7A 1J9MA 3G34A 2V20A 1SDEA 3H82A 1EWZA 3UNWA 3D9YA 3RXXA 1WYCA 2W27A 3ZG0A 3V39A 1GSWA 4KUKA 2QHKA 3IT9A 2VA0A 1I5QA 1T1AA 1K57C 3Q82A 4NXGA 4DJ3A 2OLVA 3TOIA 2JC7A 3ZYTA 3C7UA 2HDSA 1T19A 1PRQA 3CPTA 3S7NA 3WS2A 4KZ8A 3OPRA 3HLCA 4HH2A 4OONA 5KSHA 4I39A 3JPUA 5LBRA 5FAQA 3FYZA 5TFQA 1D7EA 4DF6A 2O0YA 2P7JA 5GLDA 4YNRA 2JN7A 1RP5A 3HUNA 1K25A 3LO7A 2O9BA 3IBRA 1BLSA 4DJ2A 3LICA 2ZL1B 1DP6A 4OPRA 4P6ZM 4BLMA 4MDZA 2Y2QA 1IYPA 1TEMA 2ZLYA 1F98A 4WMCD 2W3EA 4WELA 4L9FA 5EPHA 4Q8IA 1AWIA 3MKFA 1H0MA 1L0GA 3T50A 4S2PA 3SZTA 5FI2A 4F3LB 5CGSA 1ALQA 3HLEA 3NOPC 2KOIA 3W4PA 4PKYA 3TJZC 2XR0A 5M19A 4MBHA 1SKOA 3ITBA 5DJUA 1KGGA 3TG9A 3T4LA 2Y79A 3SH9A 3UPNA 4DRTA 5KSCA 4HBUA 2JKGA 1S4RA 3ICYA 1SHVA 5DF9A 2E8JA 4MNRA 4L9EA 4OQ0A 3A0RA 4GD6A 4OPYA 4UA7A 5F69A 5GHZA 3GVBA 3I7JA 3LY3A 5FL3A 1LI0A 3NJAA 1GA9A 2OSUA 3T1QB 3FC7A 4OP5A 2PHYA 3G30A 4FCFA 3CZDA 2Y8HA 5U47A 1DP9A 4B93A 3SOIA 3LIAA 3G2ZA 3E0YA 1K56A 4KUOA 4WZ5C 1KDSA 2HDQA 5EECA 4OOLA 4Q0JA 2ZBBA 3LIEA 1TVFA 4PAUA 3M6HA 3LR0A 2ZM0A 4GHIB 3E4PA 1NZOA 4DDSA 1MWSA 5CRFA 3U4LP 2HV1A 3FKVA 2VGJA 5IT5A 2M7VA 3CG5A 2J8YA 4ZBEA 4OPQA 5MC7A 3HCYA 1K0KA 3UB9A 4R6LA 2V1ZA 2XF3A 2W1TA 2ZQ8A 2V1BA 3RFBA 4MN7A 4U0TA 1K54A 3PBNA 4K0WA 2W3GA 4EESA 4II7A 3LFVA 4KG5A 3DTIA 3WRZA 4DDYA 1XJ6A 3GDIA 4HJ6A 4E04A 1P0ZA 1F2KA 2BTFP 3MXRA 5GL9A 5EVLA 4WEKA 2WZXA 2HPBA 3PR6A 1IEMA 3CUEA 3PAGA 3V50A 3NCKA 3MS6A 3LIBA 1XGJA 1W7FA 4PM9A 3ZFZA 3UPPA 4OVDA 1Y4OA 5I94A 3KSIA 5HFOA 3A3DA 5AQBA 3LY4A 3Q81A 4Y3IA 3VOLA 1O7EA 1OT9A 1YSQA 2O9CA 2Q9MA 4B4ZA 2HP6A 2Y59A 3UN7A 1Q2PA 4DE2A 2L4RA 5F5YA 3V5MA 4X6TA 2HP5A 3MFDA 3C7VA 4KQOA 4OQGA 3MQQA 1KE0A 2R78A 2DNSA 1YLYA 1K6SA 4JGRA 1JWZA 2PR5A 3ZVTA 3BEBA 3CMZA 4NXBA 3BYDA 4PPRA 1VM1A 5EM0A 4GB7A 5HL1A 4WUJA 3HLBA 4JF6A 1H8ZA 5TBMB 3FWLA 3C38A 1YLJA 4PHTA 5L10A 4Y2FA 3ZDJA 1MWTA 2LB5A 4P87A 3O5YA 2LB9A 4HQAA 3G32A 1PW8A 2L1MA 4KZ5A 3T1RA 1VETA 2ZJ9A 5D3OA 1UWPX 4GCZA 3OBFA 4IBRA 3V3RA 1XPBA 2Y2HA 4Y0TA 1G6AA 3GMWA 4FH4A 2Y91A 4N92A 2AVXA 1O07A 3HREA 2GX5A 3OZHA 4PM8A 2Z2LB 4E6XA 1ACFA 4F94A 4YOFA 5AQ9A 3RH8B 1XFQA 4S2KA 4IUHA 2ZC4B 4E3JA 1XGIA 1OTBA 3TW8A 1PFLA 3VFFA 5FSRA 1XJ3A 5FQKA 4WL9A 5E43A 1TS6A 5F82A 4R3BA 3R7WA 4HEFA 5J4EA 4ZTKA 1PWDA 5EVEA 3UY6A 3D72A 5CTMA 3V67A 5DF8A 2O9AA 3IH9A 1GSXA 1KGFA 4BBTA 4ME4A 1WE4A 1IYQA 1ESIA 2ZQ9A 2PBYA 5CEDA 4O01A 4HI4A 1HVBA 1XA1A 4KENB 3C8CA 4EBNA 3UMDA 4E3KA 1N9BA 5DKLA 2IWCA 4GN2A 1DRMA 3QP1A 2WAFA 4EEUA 4MMNA 3OPLA 2ZC3B 4LPZA 4X25A 2FZ0A 4QPRA 1H8YA 3NECA 1BUEA 3EQVA 1LL9A 5CGXA 1OJGA 3LEZA 2JBFA 1PNEA 4BBUA 4FD8A 2DCFA 1OPXA 1OTDA 3L9KA 1K4EA 1OTAA 3NOTC 4CQHA 4FH2A 2HZ5A 1LLBA 4BMWA 2EX2A 2ZQCA 1ES4A 2P9VA 1NZUA 3ZG9B 2J9PA 4JGPA 2EX6A 3TSGA 4EERA 5FQIA 3EWKA 5DTSA 3T1XA 2Y2NA 3BLMA 3IXHA 5FQ9A 3MR0A 3BM6A 3VP4A 2VZWA 4RQ9A 4HJ4A 1Y54A 3Q7VA 1N4OA 2VJWA 4I3IA 4OPZA 5EE8A 1L3LA 4LLOB 4R4RA 4KQDA 2ACGA 5FDHA 5FQJA 4PM5A 2Y2GA 2ZM8A 4X1LA 1P9RA 1S1ZA 2QKPA 1LHYA 4ZRRA 1NRJA 1PI4A 4JXVA 3PAEA 5AQAA 2Y2LA 1XFNA 2J3TD 1S6RA 1MKMA 2ZC6B 3N4IA 3M2JA 4B4XA 1PI5A 1H5XA 3NHQA 2XD1A 2P74A 4LV3A 5HPIA 4WZ4A 4B88A 2RL3A 3MXQA 3V3SA 3IS2B 4E3NA 3VOYA 3JYIA 3CAXA 2ZL1A 1OTIA 4JF4A 2MJ6A 2XDMA 1FSYA 1L0FA 2K2NA 4CLCA 4B9OA 1YMXA 4MN6A 3UB6A 2VV6A 4Y17A 1IOUA 1OT6A 3O87A 3T1SA 4EEPA 2IA2A 3N8LA 1QMEA 1SZVA 3HL9A 2EX8A 3VSLA 2Y2JA 5GLAA 4WMCA 3HLGA 2J3TC 1MZUA 5FDSA 5HDDA 4KZ6A 2JHEA 2JKRI 3ZG7B 1MWUA 4ZAMA 1TS8A 2HF6A 1CF0A 1NXYA 4N9KA 3DWKA 3BJNA 4X56A 3OLOA 3T4OA 4UQIS 3BWLA 4LCMA 5HD5A 3UMEA 5J8XA 1ZC2A 3IX4A 4R3JA 1WA9A 3B42A 1JTGA 2PR6A 3PTEA 1KDWA
chains in the Genus database with same CATH topology
3PBNA 2E8IA 1NJ4A 2GDNA 3D4FA 4K0WA 4S2LA 1BLHA 1BT5A 1SKFA 3ZG8B 4BJPA 1FOFA 1YQSA 2Z2MB 4KG5A 1EI5A 4DXCA 3WRZA 3UE0A 4DDYA 1JVJA 3N8SA 1EROA 4QY5A 4BD0A 4GDNA 3UDFA 1OMEA 4PMAA 5EVIB 1YMSA 1Q2QA 4S2NC 1ES2A 4FSFA 5GLCA 5F1FA 3MXRA 5GL9A 5EVLA 4WEKA 2WZXA 3GR2A 2HPBA 1NYMA 5DTTA 3S4XA 1FCMA 1IEMA 3PAGA 3G4PA 3V50A 3NCKA 3GSGA 2WGWA 4S2IA 5CGWA 2Y2PA 3W4QA 1M40A 1XGJA 1W7FA 1IKGA 4WM9A 4E6WA 1I2WA 4PM9A 1BLPA 3ZFZA 4YFMA 3NDGA 1AXBA 3UPPA 4OVDA 4IVKA 2WGIA 5HW3A 5I94A 2Y4AA 5HFOA 2C6WB 3BRMA 1XKZA 5CHMA 4A5RA 5E2HA 4X53A 3ZGAB 4RX3A 4OP8A 2B5RA 3A3DA 5AQBA 3LY4A 3Q81A 3AGDA 1CI9A 3QHYA 1O7EA 4EWFA 2ZMAA 1BSGA 2OV5A 4EQIA 2Q9MA 3NBLA 3A3FA 4B4ZA 4U0XA 2HP6A 3ZNTA 2Y59A 3UN7A 3VSKA 1DJCA 1NY0A 4DKIA 1CEGA 2OLUA 4R23A 2XGNA 1Q2PA 4DE2A 1FSWA 4P85A 3IHBA 3VOZA 2J9OA 4E3MA 1GHPA 4PM6A 5KMWA 4ZDXA 2Y2MA 2ZM2A 3HLDA 3V5MA 3ZVWA 4X6TA 3OCNA 3MBZA 3MXSA 2HP5A 3MFDA 3C7VA 5EVIC 3AGEA 4KQOA 4OQGA 5FI7A 3W4OA 5A90A 3IH8A 1GHMA 2ZQDA 5A91A 2HP9A 2X02A 2PU2A 1GCEA 3P98A 2WAEA 4JXGA 3UE3A 1KE0A 4BQMA 3W8KA 5CTNA 2DNSA 1K6SA 1NRFA 1YLYA 1L0EA 1XX2A 3GTCA 4RYEA 4X69A 3IF6B 3E2KA 1JWZA 2WZZA 4Y7PA 4H8RA 5FI6A 5HAPA 4KZBA 1NYYA 5G18A 3ZVTA 4EUZA 3BEBA 3C5AA 1PWCA 2DRWA 3CMZA 1Z6FA 4M3KA 3BYDA 1VQQA 3GV9A 1MXOA 4PPRA 1VM1A 1ERMA 2H10A 4C3QA 1ERQA 4OOYA 5FASA 4GB7A 4JXWA 1K38A 5HL1A 3VFHA 3IWQA 3BECA 5DF7A 5FATA 2UWXA 1XP4A 1ZKJA 1MKIA 3Q7VB 4LV2A 1BLCA 2XFSA 3HLBA 4X55A 4JF5A 4N9LA 2XD5A 3NY4A 4JF6A 4GOGA 1H8ZA 2RCXA 3FWLA 5FQQA 3A3JA 3GQZA 1FR1A 1YLJA 4E3IA 4LCLA 4UA9A 1L2SA 1MWTA 4JKTA 3ZDJA 3ZCZA 1CEFA 5CHUA 2QZ6A 3QNBA 4P87A 5DTKA 1ONGA 1E3UD 4KQQA 3G32A 4WZ5A 1GA0A 1XA7A 1PW8A 3PBRA 5M18A 4KZ5A 3MZEA 4HBTA 4KG2A 5L2FA 4LENA 5A92A 3C4PA 1BULA 5E2GA 1MY8A 1W5DA 2ZJ9A 3IXBA 1JWVA 4U3TA 3IF6C 4YINA 5D3OA 2G2UA 1HTZA 1E4DA 3OC2A 4IBRA 1KE4A 3V3RA 4KZ7A 1K55A 2H0YA 3VP2A 4KG6A 1XPBA 3G35A 2Y2HA 5CECA 3SH7A 5HAQA 2Q9NA 1G6AA 4Y0TA 3IF5A 3GMWA 5FAOA 1KVLA 3NIAA 4FH4A 1ONHA 2Y91A 4KZ3A 4MBKA 4N92A 3E2LA 3VP1A 3DWZA 1O07A 3HREA 4P6BA 5CXWA 5EUAA 1DJAA 4K91A 3UDIA 5HARA 3OZHA 4PM8A 5GHXA 2Z2LB 4E6XA 2G2WA 4L0LA 4Y0UA 2J7VA 1YLTA 4F94A 2C5WB 5AQ9A 3IWIA 2EFXA 4ZJ1A 1GHIA 3PBSA 4OQHA 4IEDA 4S2KA 2PU4A 2EXBA 5E2EA 2ZC4B 1TDGA 4E3JA 3ZNYA 1XGIA 2Y2KA 4BL2A 1KGEA 1KE3A 1PW1A 1RGZA 3VFFA 3MZFA 4S2NA 1XXMA 5FSRA 4NETA 1PWGA 5FQKA 1BZAA 5E43A 3IQAA 4R4SA 3BFGA 2IWBA 3G2YA 4OLDA 5F82A 4GNUA 4R3BA 3M2KA 2A49A 5JYPA 3HLWA 3MZDA 4NK3A 1K56D 2IWDA 3C4OA 4HEFA 3O86A 2QPNA 4CJNA 4ZTKA 1PWDA 5FA7A 3UY6A 4GKUA 2EX9A 4JLFA 1CI8A 5CEBA 4QU3A 2HDRA 3LCEA 1JTDA 1LL5A 3HVFA 5CTMA 5DF8A 5IHVA 2R9XA 3S22A 3Q1FA 5BOHA 3IH9A 1FCNA 3Q07A 3A3IA 1KGFA 3WRTA 1G68A 3UDXA 4RX2A 1FR6A 1IYOA 1HD8A 2XEPA 1WE4A 2P9VB 1IYQA 1ESIA 4EV4A 4KQRA 1DJBA 1I2SA 4QHCA 2ZQ9A 2PBYA 1SDNA 4O7DA 1IELA 2WKHA 4E3LA 2I72A 4KZ9A 5CEDA 1L0DA 3PBOA 1IYSA 1W8YA 2XLNA 4JPMA 5EVIA 1HVBA 1XA1A 3P09A 4KENB 1KVMA 4C75A 4D2OA 4EBNA 4E3KA 1N9BA 3IHAA 3O3VA 4K0XA 4LV1A 4N1HA 4OOMA 2ZQAA 2IWCA 4GN2A 3VP3A 1U60A 1W79A 2WAFA 3OPLA 5CERA 1ESUA 1RCJA 3BFEA 1YLPA 1M6KA 2ZC3B 4JBFA 4Y0OA 3VMAA 2WKEA 1H8YA 4WEJA 4C6YA 1BUEA 3EQVA 3FV7A 5HAIA 1LL9A 1J9MA 3G34A 5CGXA 3WS5A 4DE1A 2V20A 3LEZA 5E2FA 1SDEA 2JBFA 4IBXA 5A93A 1EWZA 3BFDA 4S2JA 4FD8A 2DCFA 3UNWA 3G31A 3RXXA 2V2FF 3PBQA 4R0QA 4S2MA 1WYCA 3IXGA 3ZG0A 1K4EA 3V39A 4FH2A 4DXBA 1LLBA 3MKEA 3RXWA 4XUXA 3IT9A 2ZQ7A 2EX2A 3ZHHA 4DE0A 2ZQCA 1ES4A 3BFFA 4ID4A 1I5QA 2P9VA 1NZUA 1K57C 1S0WA 1K6RA 3Q82A 4IVIA 2OLVA 3ZG9B 3A3EA 2J9PA 4GZBA 3TOIA 2JC7A 2EX6A 5EOEA 3TSGA 1MPLA 4HESA 3C7UA 2HDSA 5FQIA 1DY6A 1ES5A 2R9WA 3WS2A 1PYYA 4KZ8A 3OPRA 3HUMA 3IF6A 3HLCA 1YT4A 1BTLA 3CJMA 3ZG5A 4OONA 5KSHA 5DTSA 4KZ4A 2Y2NA 4RA7A 3B3XA 2CC1A 3BLMA 2XK1A 3IXHA 5FQ9A 4PM7A 4X68A 3BM6A 5FAQA 5FQMA 3FYZA 4WYYA 5TFQA 3VP4A 4OH0A 3S1YA 4DF6A 4EBPA 1SCWA 1Y54A 5GLDA 1RP5A 1K54C 2Y2IA 3Q7VA 3FKWA 1K25A 3HUNA 3LO7A 1RGYA 3N7WA 3SS5A 1N4OA 3WS1A 1BLSA 2Y55A 2WUQA 2X01A 2QMIA 2X71A 4OPZA 4XXRA 5EE8A 4R4RA 5EOOA 2FFYA 5FDHA 5FQJA 4PM5A 2Y2GA 2H0TA 3IWOA 2ZM8A 4OPRA 4GDBA 4MEZA 3SH8A 5GHYA 3FZCA 3OCLA 4BLMA 1K54A 2Y2QA 1IYPA 1TEMA 2ZLYA 3HBRA 1LHYA 4KZAA 4WMCD 2HDUA 1PI4A 4JXVA 4WELA 3PAEA 5EPHA 2Y2LA 5AQAA 5HX9A 3WWXA 4Q8IA 2JCHA 3MKFA 5TR7A 3EQUA 4QB8A 3UE1A 4BD1A 1MWRA 4UHUA 1YM1A 3ITAA 2A3UA 4WBGA 3HLFA 1E3UA 2ZC7A 5F1GA 1L0GA 1JWPA 4QJGA 4ZJ3A 4S2PA 1S6RA 4RVAA 4CPKA 2ZC6B 5FI2A 2BLSA 5CGSA 3IXDA 5TGFA 1ALQA 3HLEA 3W4PA 3ISGA 3N4IA 3M2JA 3PBTA 2ZD8A 2XR0A 4B4XA 1PI5A 5JYOA 5M19A 1H5XA 4QD4A 4MBHA 2XD1A 3ITBA 3NI9A 1KGGA 4BL3A 2P74A 3TG9A 1FCOA 4LV3A 2XQZA 4WZ4A 3SH9A 3UPNA 4DRTA 5KSCA 1IKIA 4B88A 2RL3A 4HBUA 4MBFA 1PZPA 1YLZA 4OKPA 1QMFA 1SHVA 5DF9A 3V3SA 4MNRA 4QY6A 4OQ0A 4E3NA 3VOYA 3JYIA 5GLBA 4GD6A 1TDLA 4OPYA 4UA7A 1E25A 1MBLA 5GHZA 2WGVA 4JF4A 2FFFB 3GVBA 2XDMA 4MLLA 1W8QA 3OPHA 1FSYA 3I7JA 3LY3A 1L0FA 1LI0A 1CK3A 2WADA 1YMXA 3NC8A 1GA9A 4R1GA 1ZG4A 3BLSA 4LV0A 2OSUA 3WS0A 2WKIA 3O87A 3SS3A 4EBLA 2Y2OA 1C3BA 1LI9A 3M6BA 3HUOA 4OP5A 3G30A 4GD8A 5KZHA 3N8LA 4FCFA 3CZDA 1QMEA 1ZG6A 3O88A 3N8RA 3HL9A 3QNCA 4OQIA 2EX8A 3VSLA 5U47A 4UA6A 3SOIA 2Y2JA 4Z9QA 4P0MA 3G2ZA 5CHJA 5F83A 4N1XA 5GLAA 4WMCA 3HLGA 1ES3A 1K56A 5DVAA 4WZ5C 1KDSA 2VGKA 3DTMA 4BENA 2HDQA 5M1AA 1K57A 5EECA 4KZ6A 4OOLA 2WGWB 1FQGA 3Q7ZA 5AQ7A 3ZG7B 1MWUA 1WYBA 1TVFA 4DE3A 2EFUA 3M6HA 4ZAMA 1PZOA 2ZM0A 3AGFA 3BFCA 1K55C 1PIOA 3GRJA 1HZOA 1NXYA 1NZOA 4N9KA 3DWKA 3RJUA 4DDSA 1MWSA 2H5SA 2ZC5B 3N6IA 5CRFA 3SS4A 3OPPA 3FKVA 1YLWA 2VGJA 4X56A 2BG1A 4XUZA 3CG5A 5FAPA 2J8YA 2XH9A 2XFTA 4LCMA 3UO9A 4OLGA 4OPQA 4ZBEA 2JE5A 4ZJ2A 5EVID 3WS4A 2EXAA 4JXSA 5J8XA 3DW0A 3UPOA 1ZC2A 2V1ZA 2XF3A 4UAAA 4R3JA 2ZQ8A 3VP0A 2WYXA 3NDEA 4E3OA 2WK0A 1JTGA 4S2OA 1K4FA 4U0TA 3PTEA 1KDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PBN A;  2E8I A;  1NJ4 A;  2GDN A;  3D4F A;  4K0W A;  4S2L A;  1BLH A;  1BT5 A;  1SKF A;  3ZG8 B;  4BJP A;  1FOF A;  1YQS A;  2Z2M B;  4KG5 A;  1EI5 A;  4DXC A;  3WRZ A;  3UE0 A;  4DDY A;  1JVJ A;  3N8S A;  1ERO A;  4QY5 A;  4BD0 A;  4GDN A;  3UDF A;  1OME A;  4PMA A;  5EVI B;  1YMS A;  1Q2Q A;  4S2N C;  1ES2 A;  4FSF A;  5GLC A;  5F1F A;  3MXR A;  5GL9 A;  5EVL A;  4WEK A;  2WZX A;  3GR2 A;  2HPB A;  1NYM A;  5DTT A;  3S4X A;  1FCM A;  1IEM A;  3PAG A;  3G4P A;  3V50 A;  3NCK A;  3GSG A;  2WGW A;  4S2I A;  5CGW A;  2Y2P A;  3W4Q A;  1M40 A;  1XGJ A;  1W7F A;  1IKG A;  4WM9 A;  4E6W A;  1I2W A;  4PM9 A;  1BLP A;  3ZFZ A;  4YFM A;  3NDG A;  1AXB A;  3UPP A;  4OVD A;  4IVK A;  2WGI A;  5HW3 A;  5I94 A;  2Y4A A;  5HFO A;  2C6W B;  3BRM A;  1XKZ A;  5CHM A;  4A5R A;  5E2H A;  4X53 A;  3ZGA B;  4RX3 A;  4OP8 A;  2B5R A;  3A3D A;  5AQB A;  3LY4 A;  3Q81 A;  3AGD A;  1CI9 A;  3QHY A;  1O7E A;  4EWF A;  2ZMA A;  1BSG A;  2OV5 A;  4EQI A;  2Q9M A;  3NBL A;  3A3F A;  4B4Z A;  4U0X A;  2HP6 A;  3ZNT A;  2Y59 A;  3UN7 A;  3VSK A;  1DJC A;  1NY0 A;  4DKI A;  1CEG A;  2OLU A;  4R23 A;  2XGN A;  1Q2P A;  4DE2 A;  1FSW A;  4P85 A;  3IHB A;  3VOZ A;  2J9O A;  4E3M A;  1GHP A;  4PM6 A;  5KMW A;  4ZDX A;  2Y2M A;  2ZM2 A;  3HLD A;  3V5M A;  3ZVW A;  4X6T A;  3OCN A;  3MBZ A;  3MXS A;  2HP5 A;  3MFD A;  3C7V A;  5EVI C;  3AGE A;  4KQO A;  4OQG A;  5FI7 A;  3W4O A;  5A90 A;  3IH8 A;  1GHM A;  2ZQD A;  5A91 A;  2HP9 A;  2X02 A;  2PU2 A;  1GCE A;  3P98 A;  2WAE A;  4JXG A;  3UE3 A;  1KE0 A;  4BQM A;  3W8K A;  5CTN A;  2DNS A;  1K6S A;  1NRF A;  1YLY A;  1L0E A;  1XX2 A;  3GTC A;  4RYE A;  4X69 A;  3IF6 B;  3E2K A;  1JWZ A;  2WZZ A;  4Y7P A;  4H8R A;  5FI6 A;  5HAP A;  4KZB A;  1NYY A;  5G18 A;  3ZVT A;  4EUZ A;  3BEB A;  3C5A A;  1PWC A;  2DRW A;  3CMZ A;  1Z6F A;  4M3K A;  3BYD A;  1VQQ A;  3GV9 A;  1MXO A;  4PPR A;  1VM1 A;  1ERM A;  2H10 A;  4C3Q A;  1ERQ A;  4OOY A;  5FAS A;  4GB7 A;  4JXW A;  1K38 A;  5HL1 A;  3VFH A;  3IWQ A;  3BEC A;  5DF7 A;  5FAT A;  2UWX A;  1XP4 A;  1ZKJ A;  1MKI A;  3Q7V B;  4LV2 A;  1BLC A;  2XFS A;  3HLB A;  4X55 A;  4JF5 A;  4N9L A;  2XD5 A;  3NY4 A;  4JF6 A;  4GOG A;  1H8Z A;  2RCX A;  3FWL A;  5FQQ A;  3A3J A;  3GQZ A;  1FR1 A;  1YLJ A;  4E3I A;  4LCL A;  4UA9 A;  1L2S A;  1MWT A;  4JKT A;  3ZDJ A;  3ZCZ A;  1CEF A;  5CHU A;  2QZ6 A;  3QNB A;  4P87 A;  5DTK A;  1ONG A;  1E3U D;  4KQQ A;  3G32 A;  4WZ5 A;  1GA0 A;  1XA7 A;  1PW8 A;  3PBR A;  5M18 A;  4KZ5 A;  3MZE A;  4HBT A;  4KG2 A;  5L2F A;  4LEN A;  5A92 A;  3C4P A;  1BUL A;  5E2G A;  1MY8 A;  1W5D A;  2ZJ9 A;  3IXB A;  1JWV A;  4U3T A;  3IF6 C;  4YIN A;  5D3O A;  2G2U A;  1HTZ A;  1E4D A;  3OC2 A;  4IBR A;  1KE4 A;  3V3R A;  4KZ7 A;  1K55 A;  2H0Y A;  3VP2 A;  4KG6 A;  1XPB A;  3G35 A;  2Y2H A;  5CEC A;  3SH7 A;  5HAQ A;  2Q9N A;  1G6A A;  4Y0T A;  3IF5 A;  3GMW A;  5FAO A;  1KVL A;  3NIA A;  4FH4 A;  1ONH A;  2Y91 A;  4KZ3 A;  4MBK A;  4N92 A;  3E2L A;  3VP1 A;  3DWZ A;  1O07 A;  3HRE A;  4P6B A;  5CXW A;  5EUA A;  1DJA A;  4K91 A;  3UDI A;  5HAR A;  3OZH A;  4PM8 A;  5GHX A;  2Z2L B;  4E6X A;  2G2W A;  4L0L A;  4Y0U A;  2J7V A;  1YLT A;  4F94 A;  2C5W B;  5AQ9 A;  3IWI A;  2EFX A;  4ZJ1 A;  1GHI A;  3PBS A;  4OQH A;  4IED A;  4S2K A;  2PU4 A;  2EXB A;  5E2E A;  2ZC4 B;  1TDG A;  4E3J A;  3ZNY A;  1XGI A;  2Y2K A;  4BL2 A;  1KGE A;  1KE3 A;  1PW1 A;  1RGZ A;  3VFF A;  3MZF A;  4S2N A;  1XXM A;  5FSR A;  4NET A;  1PWG A;  5FQK A;  1BZA A;  5E43 A;  3IQA A;  4R4S A;  3BFG A;  2IWB A;  3G2Y A;  4OLD A;  5F82 A;  4GNU A;  4R3B A;  3M2K A;  2A49 A;  5JYP A;  3HLW A;  3MZD A;  4NK3 A;  1K56 D;  2IWD A;  3C4O A;  4HEF A;  3O86 A;  2QPN A;  4CJN A;  4ZTK A;  1PWD A;  5FA7 A;  3UY6 A;  4GKU A;  2EX9 A;  4JLF A;  1CI8 A;  5CEB A;  4QU3 A;  2HDR A;  3LCE A;  1JTD A;  1LL5 A;  3HVF A;  5CTM A;  5DF8 A;  5IHV A;  2R9X A;  3S22 A;  3Q1F A;  5BOH A;  3IH9 A;  1FCN A;  3Q07 A;  3A3I A;  1KGF A;  3WRT A;  1G68 A;  3UDX A;  4RX2 A;  1FR6 A;  1IYO A;  1HD8 A;  2XEP A;  1WE4 A;  2P9V B;  1IYQ A;  1ESI A;  4EV4 A;  4KQR A;  1DJB A;  1I2S A;  4QHC A;  2ZQ9 A;  2PBY A;  1SDN A;  4O7D A;  1IEL A;  2WKH A;  4E3L A;  2I72 A;  4KZ9 A;  5CED A;  1L0D A;  3PBO A;  1IYS A;  1W8Y A;  2XLN A;  4JPM A;  5EVI A;  1HVB A;  1XA1 A;  3P09 A;  4KEN B;  1KVM A;  4C75 A;  4D2O A;  4EBN A;  4E3K A;  1N9B A;  3IHA A;  3O3V A;  4K0X A;  4LV1 A;  4N1H A;  4OOM A;  2ZQA A;  2IWC A;  4GN2 A;  3VP3 A;  1U60 A;  1W79 A;  2WAF A;  3OPL A;  5CER A;  1ESU A;  1RCJ A;  3BFE A;  1YLP A;  1M6K A;  2ZC3 B;  4JBF A;  4Y0O A;  3VMA A;  2WKE A;  1H8Y A;  4WEJ A;  4C6Y A;  1BUE A;  3EQV A;  3FV7 A;  5HAI A;  1LL9 A;  1J9M A;  3G34 A;  5CGX A;  3WS5 A;  4DE1 A;  2V20 A;  3LEZ A;  5E2F A;  1SDE A;  2JBF A;  4IBX A;  5A93 A;  1EWZ A;  3BFD A;  4S2J A;  4FD8 A;  2DCF A;  3UNW A;  3G31 A;  3RXX A;  2V2F F;  3PBQ A;  4R0Q A;  4S2M A;  1WYC A;  3IXG A;  3ZG0 A;  1K4E A;  3V39 A;  4FH2 A;  4DXB A;  1LLB A;  3MKE A;  3RXW A;  4XUX A;  3IT9 A;  2ZQ7 A;  2EX2 A;  3ZHH A;  4DE0 A;  2ZQC A;  1ES4 A;  3BFF A;  4ID4 A;  1I5Q A;  2P9V A;  1NZU A;  1K57 C;  1S0W A;  1K6R A;  3Q82 A;  4IVI A;  2OLV A;  3ZG9 B;  3A3E A;  2J9P A;  4GZB A;  3TOI A;  2JC7 A;  2EX6 A;  5EOE A;  3TSG A;  1MPL A;  4HES A;  3C7U A;  2HDS A;  5FQI A;  1DY6 A;  1ES5 A;  2R9W A;  3WS2 A;  1PYY A;  4KZ8 A;  3OPR A;  3HUM A;  3IF6 A;  3HLC A;  1YT4 A;  1BTL A;  3CJM A;  3ZG5 A;  4OON A;  5KSH A;  5DTS A;  4KZ4 A;  2Y2N A;  4RA7 A;  3B3X A;  2CC1 A;  3BLM A;  2XK1 A;  3IXH A;  5FQ9 A;  4PM7 A;  4X68 A;  3BM6 A;  5FAQ A;  5FQM A;  3FYZ A;  4WYY A;  5TFQ A;  3VP4 A;  4OH0 A;  3S1Y A;  4DF6 A;  4EBP A;  1SCW A;  1Y54 A;  5GLD A;  1RP5 A;  1K54 C;  2Y2I A;  3Q7V A;  3FKW A;  1K25 A;  3HUN A;  3LO7 A;  1RGY A;  3N7W A;  3SS5 A;  1N4O A;  3WS1 A;  1BLS A;  2Y55 A;  2WUQ A;  2X01 A;  2QMI A;  2X71 A;  4OPZ A;  4XXR A;  5EE8 A;  4R4R A;  5EOO A;  2FFY A;  5FDH A;  5FQJ A;  4PM5 A;  2Y2G A;  2H0T A;  3IWO A;  2ZM8 A;  4OPR A;  4GDB A;  4MEZ A;  3SH8 A;  5GHY A;  3FZC A;  3OCL A;  4BLM A;  1K54 A;  2Y2Q A;  1IYP A;  1TEM A;  2ZLY A;  3HBR A;  1LHY A;  4KZA A;  4WMC D;  2HDU A;  1PI4 A;  4JXV A;  4WEL A;  3PAE A;  5EPH A;  2Y2L A;  5AQA A;  5HX9 A;  3WWX A;  4Q8I A;  2JCH A;  3MKF A;  5TR7 A;  3EQU A;  4QB8 A;  3UE1 A;  4BD1 A;  1MWR A;  4UHU A;  1YM1 A;  3ITA A;  2A3U A;  4WBG A;  3HLF A;  1E3U A;  2ZC7 A;  5F1G A;  1L0G A;  1JWP A;  4QJG A;  4ZJ3 A;  4S2P A;  1S6R A;  4RVA A;  4CPK A;  2ZC6 B;  5FI2 A;  2BLS A;  5CGS A;  3IXD A;  5TGF A;  1ALQ A;  3HLE A;  3W4P A;  3ISG A;  3N4I A;  3M2J A;  3PBT A;  2ZD8 A;  2XR0 A;  4B4X A;  1PI5 A;  5JYO A;  5M19 A;  1H5X A;  4QD4 A;  4MBH A;  2XD1 A;  3ITB A;  3NI9 A;  1KGG A;  4BL3 A;  2P74 A;  3TG9 A;  1FCO A;  4LV3 A;  2XQZ A;  4WZ4 A;  3SH9 A;  3UPN A;  4DRT A;  5KSC A;  1IKI A;  4B88 A;  2RL3 A;  4HBU A;  4MBF A;  1PZP A;  1YLZ A;  4OKP A;  1QMF A;  1SHV A;  5DF9 A;  3V3S A;  4MNR A;  4QY6 A;  4OQ0 A;  4E3N A;  3VOY A;  3JYI A;  5GLB A;  4GD6 A;  1TDL A;  4OPY A;  4UA7 A;  1E25 A;  1MBL A;  5GHZ A;  2WGV A;  4JF4 A;  2FFF B;  3GVB A;  2XDM A;  4MLL A;  1W8Q A;  3OPH A;  1FSY A;  3I7J A;  3LY3 A;  1L0F A;  1LI0 A;  1CK3 A;  2WAD A;  1YMX A;  3NC8 A;  1GA9 A;  4R1G A;  1ZG4 A;  3BLS A;  4LV0 A;  2OSU A;  3WS0 A;  2WKI A;  3O87 A;  3SS3 A;  4EBL A;  2Y2O A;  1C3B A;  1LI9 A;  3M6B A;  3HUO A;  4OP5 A;  3G30 A;  4GD8 A;  5KZH A;  3N8L A;  4FCF A;  3CZD A;  1QME A;  1ZG6 A;  3O88 A;  3N8R A;  3HL9 A;  3QNC A;  4OQI A;  2EX8 A;  3VSL A;  5U47 A;  4UA6 A;  3SOI A;  2Y2J A;  4Z9Q A;  4P0M A;  3G2Z A;  5CHJ A;  5F83 A;  4N1X A;  5GLA A;  4WMC A;  3HLG A;  1ES3 A;  1K56 A;  5DVA A;  4WZ5 C;  1KDS A;  2VGK A;  3DTM A;  4BEN A;  2HDQ A;  5M1A A;  1K57 A;  5EEC A;  4KZ6 A;  4OOL A;  2WGW B;  1FQG A;  3Q7Z A;  5AQ7 A;  3ZG7 B;  1MWU A;  1WYB A;  1TVF A;  4DE3 A;  2EFU A;  3M6H A;  4ZAM A;  1PZO A;  2ZM0 A;  3AGF A;  3BFC A;  1K55 C;  1PIO A;  3GRJ A;  1HZO A;  1NXY A;  1NZO A;  4N9K A;  3DWK A;  3RJU A;  4DDS A;  1MWS A;  2H5S A;  2ZC5 B;  3N6I A;  5CRF A;  3SS4 A;  3OPP A;  3FKV A;  1YLW A;  2VGJ A;  4X56 A;  2BG1 A;  4XUZ A;  3CG5 A;  5FAP A;  2J8Y A;  2XH9 A;  2XFT A;  4LCM A;  3UO9 A;  4OLG A;  4OPQ A;  4ZBE A;  2JE5 A;  4ZJ2 A;  5EVI D;  3WS4 A;  2EXA A;  4JXS A;  5J8X A;  3DW0 A;  3UPO A;  1ZC2 A;  2V1Z A;  2XF3 A;  4UAA A;  4R3J A;  2ZQ8 A;  3VP0 A;  2WYX A;  3NDE A;  4E3O A;  2WK0 A;  1JTG A;  4S2O A;  1K4F A;  4U0T A;  3PTE A;  1KDW A; 
#chains in the Genus database with same CATH topology
 2BAS A;  3U2A A;  4BJP A;  1Z09 A;  4WLA A;  1FOF A;  4I5S A;  4H6J B;  1EI5 A;  3UE0 A;  4QY5 A;  2Q0O A;  4WN5 A;  3LR5 A;  1Q2Q A;  1ES2 A;  1YKD A;  3K2N A;  3GR2 A;  5DTT A;  2ZOH A;  1S67 L;  5CX7 A;  1J3W A;  3SW1 A;  4WM9 A;  4E6W A;  1I2W A;  5HW3 A;  4JGQ A;  5E2H A;  4X53 A;  1VEU A;  4RX3 A;  2B5R A;  3H82 B;  4EXO A;  2A24 B;  4EQI A;  5G4Y A;  3A3F A;  4DKI A;  4U0X A;  2PAV P;  3ZNT A;  3VSK A;  1NY0 A;  1CEG A;  1T18 A;  2OLU A;  3QP2 A;  4E3M A;  5KMW A;  3MQ0 A;  1LSW A;  2ZM2 A;  3OCN A;  3W4O A;  5DKK A;  2ZQD A;  2X02 A;  3P98 A;  1GCE A;  4Q0I A;  2WAE A;  3UE3 A;  1S1Y A;  1XX2 A;  3VE3 A;  4RYE A;  2WZZ A;  3K3D A;  2XSS A;  3R4K A;  3GV9 A;  4CLC C;  4C3Q A;  1ERQ A;  4BWI A;  3LID A;  1K38 A;  3VFH A;  3IWQ A;  3CLO A;  1MKI A;  4LV2 A;  1BLC A;  2XFS A;  4X55 A;  4N9L A;  5FQQ A;  4UA9 A;  4JKT A;  2ZMV A;  4YWZ A;  3QNB A;  5IU1 A;  1XJ2 A;  5M18 A;  3G6O A;  3S7O A;  4HY8 A;  3KSH A;  5A92 A;  1W5D A;  4WF0 A;  1JWV A;  3JVV A;  3LR4 A;  1E4D A;  1KE4 A;  4KZ7 A;  1K55 A;  1S4S A;  3VP2 A;  3P7N A;  5HDS A;  2Q9N A;  3IF5 A;  3H7W A;  5FAO A;  4MBK A;  4O0P A;  3VP1 A;  3E2L A;  3T12 B;  5CXW A;  5EUA A;  4ETZ A;  3C30 A;  3UDI A;  5K5B A;  4LRY C;  4Y0U A;  2J7V A;  1SKO B;  2VGL M;  1LSX A;  1GHI A;  3PBS A;  3TRC A;  2EXB A;  2WKP A;  3MQO A;  4LRZ E;  5TBM A;  2JKR M;  4EET B;  3ZNY A;  3P01 A;  1RGZ A;  1KE3 A;  4S2N A;  1XXM A;  4NET A;  3F1P A;  2IWB A;  4OLD A;  3OOV A;  1H3Q A;  2A49 A;  2KDK A;  5JYP A;  3MZD A;  1K56 D;  2XA7 M;  3O86 A;  4CJN A;  3JVU A;  2YKF A;  5I5L A;  3LCE A;  1JTD A;  1VHM A;  2R9X A;  5IHV A;  1FCN A;  3Q07 A;  4G3W A;  3A0V A;  1G28 A;  1G68 A;  3UDX A;  3WRT A;  1IYO A;  4EV4 A;  4KQR A;  1DJB A;  1X0O A;  1IEL A;  2WKH A;  2I72 A;  5EVI A;  2PD7 A;  3PYP A;  4C75 A;  4D2O A;  4ETX A;  3IHA A;  3O3V A;  4K0X A;  4N1H A;  3F1N A;  2ZQA A;  5CER A;  4D60 A;  4Y0O A;  1YAX A;  4JBF A;  5EFW A;  2WKE A;  5HAI A;  4DE1 A;  4X1M A;  2W1T B;  5EV0 A;  3BFD A;  1IFQ A;  1NWZ A;  3T4J A;  3MFX A;  4S2M A;  4DXB A;  4LFU A;  3BY8 A;  3MKE A;  4IUK A;  4XUX A;  2ZQ7 A;  5TJJ A;  3ZHH A;  3T4Q A;  4GS9 B;  4ID4 A;  3ZQ5 A;  3KX0 X;  1K6R A;  3A3E A;  5EOE A;  4HES A;  4L9G A;  2R9W A;  1PYY A;  3IF6 A;  2W0N A;  3CJM A;  3BY9 A;  1N9L A;  4KZ4 A;  2CC1 A;  4PM7 A;  4X68 A;  3VV4 A;  4OH0 A;  3S1Y A;  4EBP A;  2HJ9 C;  1SCW A;  2V0W A;  4EU0 A;  1K54 C;  2Y2I A;  3FKW A;  3EOI A;  3SS5 A;  3N7W A;  2NUT C;  5F6A A;  3W2Z A;  2Y55 A;  2WUQ A;  2QMI A;  4P6Z S;  5HWW A;  1YSP A;  2H0T A;  3IWO A;  3SH8 A;  5GHY A;  3FZC A;  3OCL A;  3CUE C;  5HD3 A;  3QP5 A;  3KYZ A;  3LI8 A;  3WWX A;  3EQU A;  4EW7 A;  4QB8 A;  3KYQ A;  3UE1 A;  4BD1 A;  4UHU A;  1YM1 A;  2A3U A;  2A2L A;  3HLF A;  1E3U A;  5F1G A;  4M4X A;  4ZJ3 A;  4CPK A;  5AVF A;  2BLS A;  3IX3 A;  3IXD A;  5TGF A;  2FH5 A;  3ISG A;  3PBT A;  2ZD8 A;  3IX8 A;  5JYO A;  2Z6D A;  2V8C A;  1N9O A;  4AFI A;  1FCO A;  2EWW A;  4XT2 A;  4ARZ A;  2V0U A;  1IKI A;  2PYR A;  1PZP A;  4QY6 A;  1VET B;  1E25 A;  1MBL A;  4DMZ A;  2FFF B;  4MLL A;  1CK3 A;  3NC8 A;  4R1G A;  1ZG4 A;  3WS0 A;  4EBL A;  1KOU A;  1LI9 A;  3HUO A;  1XJ4 A;  5KZH A;  3O88 A;  3N8R A;  3QNC A;  4OQI A;  5HDC A;  2PBD P;  2OOL A;  4UA6 A;  4HNB A;  4Z9Q A;  5CHJ A;  4CLC E;  5F83 A;  1ES3 A;  4G3V A;  2GZA A;  4BEN A;  1K57 A;  2PYP A;  2WGW B;  3Q7Z A;  1V9Z A;  4PKY G;  3QP4 A;  1WYB A;  3EEA A;  4DE3 A;  1F9I A;  3IS2 A;  1W63 Q;  3BFC A;  2PT7 A;  1PIO A;  1FIL A;  1HZO A;  3RJU A;  3T4T A;  3LI9 A;  3N6I A;  2VV8 A;  3R7W B;  2BG1 A;  4QWO A;  5FAP A;  3KO6 A;  4OLG A;  2JE5 A;  4GW9 A;  4JXS A;  3UPO A;  3VP0 A;  2GJ3 A;  2WYX A;  2EA9 A;  4NXF A;  2WK0 A;  4S2O A;  3IBJ A;  2E8I A;  1NJ4 A;  2GDN A;  3D4F A;  1BT5 A;  1SKF A;  3ZG8 B;  4BBV A;  1YQS A;  2Z2M B;  4DXC A;  3N8S A;  4BD0 A;  4GDN A;  4PMA A;  2PDR A;  1YMS A;  1UWN X;  4FSF A;  1EW0 A;  5HWT A;  3S4X A;  1FCM A;  4I3A A;  4NG2 A;  3GSG A;  5CGW A;  3W4Q A;  1M40 A;  1IKG A;  1BLP A;  4I38 A;  4IVK A;  2WGI A;  2P04 A;  2Y4A A;  2C6W B;  3BRM A;  3H9W A;  3ZGA B;  1CQA A;  1CI9 A;  4EWF A;  1BSG A;  4UEY A;  2HGV A;  1DJC A;  1S66 L;  2VV7 A;  1FSW A;  3VOZ A;  1GHP A;  4ZDX A;  2Y2M A;  1OJ5 A;  3ZVW A;  5FEG A;  3UB7 A;  3CI6 A;  3AGE A;  5A90 A;  3IH8 A;  1GHM A;  4H6J A;  3F1O B;  5A91 A;  2PU2 A;  4JXG A;  2VLG A;  1OTE A;  1P9W A;  3W8K A;  5CTN A;  1L0E A;  3CWF A;  2QJ7 A;  2W1R A;  2JKT I;  3E2K A;  3UE6 A;  5HAP A;  2V1A A;  4KZB A;  1NYY A;  5A8B A;  3ULF A;  4EUZ A;  1PWC A;  2D02 A;  4M3K A;  1MXO A;  1ERM A;  1ZHH B;  1D06 A;  4JXW A;  4Y5F A;  4F3L A;  4R3A A;  2UWX A;  2VK3 A;  3Q7V B;  5DFY A;  2XD5 A;  3NY4 A;  4GOG A;  5HZH A;  2WKQ A;  3T4S A;  3A3J A;  1FR1 A;  2A24 A;  4LCL A;  1CEF A;  5CHU A;  3MMH A;  4WZ5 A;  1GA0 A;  2I9V A;  3PBR A;  2OAP 1;  3MZE A;  4HBT A;  4KG2 A;  5L07 A;  4LEN A;  2V9A A;  5E2G A;  1MY8 A;  3IXB A;  4U3T A;  4YIN A;  2KX6 A;  1HTZ A;  3OC2 A;  2H0Y A;  4KG6 A;  5L8M A;  5CEC A;  5HAQ A;  1ONH A;  4KZ3 A;  3BQ8 A;  3DTK A;  1MC0 A;  3T4K A;  2H28 A;  5HAR A;  4I3J A;  2G2W A;  4L0L A;  1YLT A;  1DP8 A;  5FEF A;  3IWI A;  4CLC D;  3KSG A;  4O8G A;  3PXP A;  4IED A;  4HH3 A;  5E2E A;  3LIF A;  1W63 M;  4IHQ A;  1TDG A;  4R70 A;  2Y2K A;  4IJG A;  4BL2 A;  1Y28 A;  4GLQ A;  3MZF A;  2K31 A;  1PWG A;  2DMW A;  2JKF A;  1BZA A;  1CJF A;  2B02 A;  3G2Y A;  2VKS A;  4GNU A;  2ZOI A;  3EGX C;  3QP8 A;  4CLC B;  2INW A;  4GHI A;  2O99 A;  3HLW A;  2IWD A;  2QPN A;  5L09 A;  5FA7 A;  4Y13 A;  2EX9 A;  4JLF A;  1CI8 A;  5CEB A;  4QU3 A;  2HDR A;  1LL5 A;  3S22 A;  3Q1F A;  5BOH A;  3A3I A;  4RX2 A;  3A0S A;  1FR6 A;  4QHC A;  3CPT B;  3PBO A;  2XLN A;  4JPM A;  4NKP A;  3P09 A;  5DFX A;  2VX8 A;  1KVM A;  4OOM A;  1TS7 A;  1M6K A;  4MN5 A;  3VMA A;  1UGU A;  4WEJ A;  4C6Y A;  3BW6 A;  3WS5 A;  3EGD C;  2GNX A;  5E2F A;  5A93 A;  4IBX A;  2J3W A;  2PRF A;  3NUL A;  4S2J A;  4Q0H A;  3G31 A;  2V2F F;  3PBQ A;  4R0Q A;  4EUV A;  3IXG A;  2QWS A;  2KLI A;  3RXW A;  4DE0 A;  3BFF A;  2JKT M;  1S0W A;  4IVI A;  4HHD A;  4GZB A;  1MPL A;  1DY6 A;  1ES5 A;  3E98 A;  3HUM A;  1YT4 A;  1BTL A;  3ZG5 A;  1G6O A;  2K7S A;  4RA7 A;  3B3X A;  1VB6 A;  2XK1 A;  3LYX A;  5HWV A;  1YPR A;  1VEU B;  5FQM A;  4WYY A;  3EEH A;  1RGY A;  2HJE A;  5AJG A;  3WS1 A;  2QJ5 A;  3L7H A;  2X01 A;  1STZ A;  1HLU P;  2X71 A;  4XXR A;  5EOO A;  2FFY A;  3HJI A;  3K3C A;  3LR3 A;  4GDB A;  4MEZ A;  3UB8 A;  4LGW A;  3C2W A;  4GS9 A;  1P97 A;  3HBR A;  4KZA A;  2OWH A;  2HDU A;  4GJ4 A;  5HX9 A;  3B33 A;  2JCH A;  5TR7 A;  1MWR A;  3DAV A;  3ITA A;  4WBG A;  2ZC7 A;  5HPF A;  1JWP A;  4QJG A;  4HJ3 A;  4RVA A;  4HIA A;  3DBA A;  4QD4 A;  3NI9 A;  4BL3 A;  2XQZ A;  3MF0 A;  4MBF A;  1YLZ A;  4OKP A;  1QMF A;  2QYB A;  3HJK A;  5GLB A;  1TDL A;  2WGV A;  1W8Q A;  3OPH A;  4DN0 A;  2WAD A;  2D01 A;  3KYE A;  3BLS A;  4LV0 A;  3H7W B;  2PD8 A;  4R38 A;  3BQA A;  2J80 A;  2WKI A;  3SS3 A;  2Y2O A;  1C3B A;  3M6B A;  4GD8 A;  1ZG6 A;  2V8F A;  4P0M A;  4N1X A;  2NUP C;  5DVA A;  1GSV A;  2VGK A;  3DTM A;  5M1A A;  2G7U A;  3F1P B;  3FG8 A;  1FQG A;  5AQ7 A;  3PHY A;  3RTY A;  3NOU C;  2EFU A;  4ESP A;  1PZO A;  3AGF A;  1TD5 A;  4HP4 A;  1K55 C;  3GRJ A;  3KSF A;  4Y15 A;  2ZC5 B;  2H5S A;  3SS4 A;  3OPP A;  1YLW A;  4XUZ A;  2L0W A;  3VE4 A;  5EM1 A;  2XRN A;  5J7E A;  2ZMF A;  2XH9 A;  2XFT A;  3UO9 A;  4ZJ2 A;  3D3O A;  5EVI D;  3WS4 A;  2EXA A;  3DW0 A;  3QP6 A;  2EWV A;  4UAA A;  1T1B A;  3NDE A;  4UQI M;  4E3O A;  1K4F A;  2W3D A;  4Z1W A;  1LSV A;  4S2L A;  1BLH A;  1JVJ A;  1FIK A;  3GEC A;  4LRX C;  1ERO A;  3UDF A;  3MSH A;  3LEQ A;  1OME A;  5G4Z A;  5EVI B;  4S2N C;  5GLC A;  5F1F A;  2XRO A;  2B18 A;  1LT0 A;  1NYM A;  3F1N B;  3G4P A;  4S2I A;  2WGW A;  2Y2P A;  4YFM A;  3NDG A;  1AXB A;  1TF1 A;  1XKZ A;  5CHM A;  4A5R A;  3FPW A;  4OP8 A;  3AGD A;  2W3H A;  3QHY A;  2ZMA A;  4EQ1 A;  1NLZ A;  2OV5 A;  3NBL A;  2OAQ 1;  4R23 A;  1LL8 A;  2XGN A;  4JGO A;  3MJQ A;  4P85 A;  3IHB A;  2J9O A;  4PM6 A;  1H8M A;  3HLD A;  2W3F A;  3MBZ A;  3MXS A;  5FI7 A;  1TS0 A;  5EVI C;  3UB5 P;  2HP9 A;  5C5K A;  4BQM A;  1NRF A;  2YKH A;  1D1J A;  3E4Q A;  4HOI A;  3GTC A;  4X69 A;  3IF6 B;  2CMN A;  4H8R A;  4Y7P A;  5G18 A;  5J3W A;  3C5A A;  2DRW A;  3B47 A;  3CHW P;  1Z6F A;  1VQQ A;  1ZTU A;  1A0K A;  2H10 A;  2WKR A;  4OOY A;  5FAS A;  4FUW A;  3BEC A;  5DF7 A;  5FAT A;  1XP4 A;  1ZKJ A;  1V9Y A;  4JF5 A;  2RCX A;  3GQZ A;  4E3I A;  5DJT A;  1L2S A;  3ZCZ A;  2QZ6 A;  5DTK A;  1ONG A;  1E3U D;  4KQQ A;  1XA7 A;  5L2F A;  4MCW A;  3C4P A;  1BUL A;  1JNU A;  5FI6 A;  3IF6 C;  2UV0 E;  2G2U A;  1BYW A;  3F1O A;  4NXE A;  2P08 A;  3G35 A;  2M7U A;  3SH7 A;  1KVL A;  3NIA A;  2B95 A;  1ODV A;  3DWZ A;  4P6B A;  1DJA A;  2M1C A;  4K91 A;  3CIT A;  4K08 A;  5HL6 A;  2Z6C A;  2VGL S;  5GHX A;  5KIZ A;  5F68 A;  1NLY A;  2C5W B;  2EFX A;  4ZJ1 A;  3S7P A;  4XT2 B;  4OQH A;  4ARZ B;  2PU4 A;  1KGE A;  1PW1 A;  3LGO A;  3IQA A;  4R4S A;  3BFG A;  2XA7 S;  3S7Q A;  1T1C A;  3M2K A;  4G3K A;  2OWJ A;  4NK3 A;  3C4O A;  1F5M A;  2VEA A;  3DTE A;  4GKU A;  3HVF A;  5HSQ A;  1HD8 A;  2XEP A;  2P9V B;  4FOF A;  4HP9 A;  1I2S A;  1SDN A;  4O7D A;  4E3L A;  4KZ9 A;  5IS1 A;  1L0D A;  1IYS A;  1W8Y A;  3E4O A;  1N9N A;  4NEE D;  1G5U A;  4LV1 A;  3VP3 A;  4FTX A;  1U60 A;  3FPV A;  1W79 A;  1ESU A;  5AVE A;  1RCJ A;  3BFE A;  1YLP A;  3TE8 A;  3LUQ A;  3FV7 A;  1J9M A;  3G34 A;  2V20 A;  1SDE A;  3H82 A;  1EWZ A;  3UNW A;  3D9Y A;  3RXX A;  1WYC A;  2W27 A;  3ZG0 A;  3V39 A;  1GSW A;  4KUK A;  2QHK A;  3IT9 A;  2VA0 A;  1I5Q A;  1T1A A;  1K57 C;  3Q82 A;  4NXG A;  4DJ3 A;  2OLV A;  3TOI A;  2JC7 A;  3ZYT A;  3C7U A;  2HDS A;  1T19 A;  1PRQ A;  3CPT A;  3S7N A;  3WS2 A;  4KZ8 A;  3OPR A;  3HLC A;  4HH2 A;  4OON A;  5KSH A;  4I39 A;  3JPU A;  5LBR A;  5FAQ A;  3FYZ A;  5TFQ A;  1D7E A;  4DF6 A;  2O0Y A;  2P7J A;  5GLD A;  4YNR A;  2JN7 A;  1RP5 A;  3HUN A;  1K25 A;  3LO7 A;  2O9B A;  3IBR A;  1BLS A;  4DJ2 A;  3LIC A;  2ZL1 B;  1DP6 A;  4OPR A;  4P6Z M;  4BLM A;  4MDZ A;  2Y2Q A;  1IYP A;  1TEM A;  2ZLY A;  1F98 A;  4WMC D;  2W3E A;  4WEL A;  4L9F A;  5EPH A;  4Q8I A;  1AWI A;  3MKF A;  1H0M A;  1L0G A;  3T50 A;  4S2P A;  3SZT A;  5FI2 A;  4F3L B;  5CGS A;  1ALQ A;  3HLE A;  3NOP C;  2KOI A;  3W4P A;  4PKY A;  3TJZ C;  2XR0 A;  5M19 A;  4MBH A;  1SKO A;  3ITB A;  5DJU A;  1KGG A;  3TG9 A;  3T4L A;  2Y79 A;  3SH9 A;  3UPN A;  4DRT A;  5KSC A;  4HBU A;  2JKG A;  1S4R A;  3ICY A;  1SHV A;  5DF9 A;  2E8J A;  4MNR A;  4L9E A;  4OQ0 A;  3A0R A;  4GD6 A;  4OPY A;  4UA7 A;  5F69 A;  5GHZ A;  3GVB A;  3I7J A;  3LY3 A;  5FL3 A;  1LI0 A;  3NJA A;  1GA9 A;  2OSU A;  3T1Q B;  3FC7 A;  4OP5 A;  2PHY A;  3G30 A;  4FCF A;  3CZD A;  2Y8H A;  5U47 A;  1DP9 A;  4B93 A;  3SOI A;  3LIA A;  3G2Z A;  3E0Y A;  1K56 A;  4KUO A;  4WZ5 C;  1KDS A;  2HDQ A;  5EEC A;  4OOL A;  4Q0J A;  2ZBB A;  3LIE A;  1TVF A;  4PAU A;  3M6H A;  3LR0 A;  2ZM0 A;  4GHI B;  3E4P A;  1NZO A;  4DDS A;  1MWS A;  5CRF A;  3U4L P;  2HV1 A;  3FKV A;  2VGJ A;  5IT5 A;  2M7V A;  3CG5 A;  2J8Y A;  4ZBE A;  4OPQ A;  5MC7 A;  3HCY A;  1K0K A;  3UB9 A;  4R6L A;  2V1Z A;  2XF3 A;  2W1T A;  2ZQ8 A;  2V1B A;  3RFB A;  4MN7 A;  4U0T A;  1K54 A;  3PBN A;  4K0W A;  2W3G A;  4EES A;  4II7 A;  3LFV A;  4KG5 A;  3DTI A;  3WRZ A;  4DDY A;  1XJ6 A;  3GDI A;  4HJ6 A;  4E04 A;  1P0Z A;  1F2K A;  2BTF P;  3MXR A;  5GL9 A;  5EVL A;  4WEK A;  2WZX A;  2HPB A;  3PR6 A;  1IEM A;  3CUE A;  3PAG A;  3V50 A;  3NCK A;  3MS6 A;  3LIB A;  1XGJ A;  1W7F A;  4PM9 A;  3ZFZ A;  3UPP A;  4OVD A;  1Y4O A;  5I94 A;  3KSI A;  5HFO A;  3A3D A;  5AQB A;  3LY4 A;  3Q81 A;  4Y3I A;  3VOL A;  1O7E A;  1OT9 A;  1YSQ A;  2O9C A;  2Q9M A;  4B4Z A;  2HP6 A;  2Y59 A;  3UN7 A;  1Q2P A;  4DE2 A;  2L4R A;  5F5Y A;  3V5M A;  4X6T A;  2HP5 A;  3MFD A;  3C7V A;  4KQO A;  4OQG A;  3MQQ A;  1KE0 A;  2R78 A;  2DNS A;  1YLY A;  1K6S A;  4JGR A;  1JWZ A;  2PR5 A;  3ZVT A;  3BEB A;  3CMZ A;  4NXB A;  3BYD A;  4PPR A;  1VM1 A;  5EM0 A;  4GB7 A;  5HL1 A;  4WUJ A;  3HLB A;  4JF6 A;  1H8Z A;  5TBM B;  3FWL A;  3C38 A;  1YLJ A;  4PHT A;  5L10 A;  4Y2F A;  3ZDJ A;  1MWT A;  2LB5 A;  4P87 A;  3O5Y A;  2LB9 A;  4HQA A;  3G32 A;  1PW8 A;  2L1M A;  4KZ5 A;  3T1R A;  1VET A;  2ZJ9 A;  5D3O A;  1UWP X;  4GCZ A;  3OBF A;  4IBR A;  3V3R A;  1XPB A;  2Y2H A;  4Y0T A;  1G6A A;  3GMW A;  4FH4 A;  2Y91 A;  4N92 A;  2AVX A;  1O07 A;  3HRE A;  2GX5 A;  3OZH A;  4PM8 A;  2Z2L B;  4E6X A;  1ACF A;  4F94 A;  4YOF A;  5AQ9 A;  3RH8 B;  1XFQ A;  4S2K A;  4IUH A;  2ZC4 B;  4E3J A;  1XGI A;  1OTB A;  3TW8 A;  1PFL A;  3VFF A;  5FSR A;  1XJ3 A;  5FQK A;  4WL9 A;  5E43 A;  1TS6 A;  5F82 A;  4R3B A;  3R7W A;  4HEF A;  5J4E A;  4ZTK A;  1PWD A;  5EVE A;  3UY6 A;  3D72 A;  5CTM A;  3V67 A;  5DF8 A;  2O9A A;  3IH9 A;  1GSX A;  1KGF A;  4BBT A;  4ME4 A;  1WE4 A;  1IYQ A;  1ESI A;  2ZQ9 A;  2PBY A;  5CED A;  4O01 A;  4HI4 A;  1HVB A;  1XA1 A;  4KEN B;  3C8C A;  4EBN A;  3UMD A;  4E3K A;  1N9B A;  5DKL A;  2IWC A;  4GN2 A;  1DRM A;  3QP1 A;  2WAF A;  4EEU A;  4MMN A;  3OPL A;  2ZC3 B;  4LPZ A;  4X25 A;  2FZ0 A;  4QPR A;  1H8Y A;  3NEC A;  1BUE A;  3EQV A;  1LL9 A;  5CGX A;  1OJG A;  3LEZ A;  2JBF A;  1PNE A;  4BBU A;  4FD8 A;  2DCF A;  1OPX A;  1OTD A;  3L9K A;  1K4E A;  1OTA A;  3NOT C;  4CQH A;  4FH2 A;  2HZ5 A;  1LLB A;  4BMW A;  2EX2 A;  2ZQC A;  1ES4 A;  2P9V A;  1NZU A;  3ZG9 B;  2J9P A;  4JGP A;  2EX6 A;  3TSG A;  4EER A;  5FQI A;  3EWK A;  5DTS A;  3T1X A;  2Y2N A;  3BLM A;  3IXH A;  5FQ9 A;  3MR0 A;  3BM6 A;  3VP4 A;  2VZW A;  4RQ9 A;  4HJ4 A;  1Y54 A;  3Q7V A;  1N4O A;  2VJW A;  4I3I A;  4OPZ A;  5EE8 A;  1L3L A;  4LLO B;  4R4R A;  4KQD A;  2ACG A;  5FDH A;  5FQJ A;  4PM5 A;  2Y2G A;  2ZM8 A;  4X1L A;  1P9R A;  1S1Z A;  2QKP A;  1LHY A;  4ZRR A;  1NRJ A;  1PI4 A;  4JXV A;  3PAE A;  5AQA A;  2Y2L A;  1XFN A;  2J3T D;  1S6R A;  1MKM A;  2ZC6 B;  3N4I A;  3M2J A;  4B4X A;  1PI5 A;  1H5X A;  3NHQ A;  2XD1 A;  2P74 A;  4LV3 A;  5HPI A;  4WZ4 A;  4B88 A;  2RL3 A;  3MXQ A;  3V3S A;  3IS2 B;  4E3N A;  3VOY A;  3JYI A;  3CAX A;  2ZL1 A;  1OTI A;  4JF4 A;  2MJ6 A;  2XDM A;  1FSY A;  1L0F A;  2K2N A;  4CLC A;  4B9O A;  1YMX A;  4MN6 A;  3UB6 A;  2VV6 A;  4Y17 A;  1IOU A;  1OT6 A;  3O87 A;  3T1S A;  4EEP A;  2IA2 A;  3N8L A;  1QME A;  1SZV A;  3HL9 A;  2EX8 A;  3VSL A;  2Y2J A;  5GLA A;  4WMC A;  3HLG A;  2J3T C;  1MZU A;  5FDS A;  5HDD A;  4KZ6 A;  2JHE A;  2JKR I;  3ZG7 B;  1MWU A;  4ZAM A;  1TS8 A;  2HF6 A;  1CF0 A;  1NXY A;  4N9K A;  3DWK A;  3BJN A;  4X56 A;  3OLO A;  3T4O A;  4UQI S;  3BWL A;  4LCM A;  5HD5 A;  3UME A;  5J8X A;  1ZC2 A;  3IX4 A;  4R3J A;  1WA9 A;  3B42 A;  1JTG A;  2PR6 A;  3PTE A;  1KDW A; 
#chains in the Genus database with same CATH homology
 3PBN A;  2E8I A;  1NJ4 A;  2GDN A;  3D4F A;  4K0W A;  4S2L A;  1BLH A;  1BT5 A;  1SKF A;  3ZG8 B;  4BJP A;  1FOF A;  1YQS A;  2Z2M B;  4KG5 A;  1EI5 A;  4DXC A;  3WRZ A;  3UE0 A;  4DDY A;  1JVJ A;  3N8S A;  1ERO A;  4QY5 A;  4BD0 A;  4GDN A;  3UDF A;  1OME A;  4PMA A;  5EVI B;  1YMS A;  1Q2Q A;  4S2N C;  1ES2 A;  4FSF A;  5GLC A;  5F1F A;  3MXR A;  5GL9 A;  5EVL A;  4WEK A;  2WZX A;  3GR2 A;  2HPB A;  1NYM A;  5DTT A;  3S4X A;  1FCM A;  1IEM A;  3PAG A;  3G4P A;  3V50 A;  3NCK A;  3GSG A;  2WGW A;  4S2I A;  5CGW A;  2Y2P A;  3W4Q A;  1M40 A;  1XGJ A;  1W7F A;  1IKG A;  4WM9 A;  4E6W A;  1I2W A;  4PM9 A;  1BLP A;  3ZFZ A;  4YFM A;  3NDG A;  1AXB A;  3UPP A;  4OVD A;  4IVK A;  2WGI A;  5HW3 A;  5I94 A;  2Y4A A;  5HFO A;  2C6W B;  3BRM A;  1XKZ A;  5CHM A;  4A5R A;  5E2H A;  4X53 A;  3ZGA B;  4RX3 A;  4OP8 A;  2B5R A;  3A3D A;  5AQB A;  3LY4 A;  3Q81 A;  3AGD A;  1CI9 A;  3QHY A;  1O7E A;  4EWF A;  2ZMA A;  1BSG A;  2OV5 A;  4EQI A;  2Q9M A;  3NBL A;  3A3F A;  4B4Z A;  4U0X A;  2HP6 A;  3ZNT A;  2Y59 A;  3UN7 A;  3VSK A;  1DJC A;  1NY0 A;  4DKI A;  1CEG A;  2OLU A;  4R23 A;  2XGN A;  1Q2P A;  4DE2 A;  1FSW A;  4P85 A;  3IHB A;  3VOZ A;  2J9O A;  4E3M A;  1GHP A;  4PM6 A;  5KMW A;  4ZDX A;  2Y2M A;  2ZM2 A;  3HLD A;  3V5M A;  3ZVW A;  4X6T A;  3OCN A;  3MBZ A;  3MXS A;  2HP5 A;  3MFD A;  3C7V A;  5EVI C;  3AGE A;  4KQO A;  4OQG A;  5FI7 A;  3W4O A;  5A90 A;  3IH8 A;  1GHM A;  2ZQD A;  5A91 A;  2HP9 A;  2X02 A;  2PU2 A;  1GCE A;  3P98 A;  2WAE A;  4JXG A;  3UE3 A;  1KE0 A;  4BQM A;  3W8K A;  5CTN A;  2DNS A;  1K6S A;  1NRF A;  1YLY A;  1L0E A;  1XX2 A;  3GTC A;  4RYE A;  4X69 A;  3IF6 B;  3E2K A;  1JWZ A;  2WZZ A;  4Y7P A;  4H8R A;  5FI6 A;  5HAP A;  4KZB A;  1NYY A;  5G18 A;  3ZVT A;  4EUZ A;  3BEB A;  3C5A A;  1PWC A;  2DRW A;  3CMZ A;  1Z6F A;  4M3K A;  3BYD A;  1VQQ A;  3GV9 A;  1MXO A;  4PPR A;  1VM1 A;  1ERM A;  2H10 A;  4C3Q A;  1ERQ A;  4OOY A;  5FAS A;  4GB7 A;  4JXW A;  1K38 A;  5HL1 A;  3VFH A;  3IWQ A;  3BEC A;  5DF7 A;  5FAT A;  2UWX A;  1XP4 A;  1ZKJ A;  1MKI A;  3Q7V B;  4LV2 A;  1BLC A;  2XFS A;  3HLB A;  4X55 A;  4JF5 A;  4N9L A;  2XD5 A;  3NY4 A;  4JF6 A;  4GOG A;  1H8Z A;  2RCX A;  3FWL A;  5FQQ A;  3A3J A;  3GQZ A;  1FR1 A;  1YLJ A;  4E3I A;  4LCL A;  4UA9 A;  1L2S A;  1MWT A;  4JKT A;  3ZDJ A;  3ZCZ A;  1CEF A;  5CHU A;  2QZ6 A;  3QNB A;  4P87 A;  5DTK A;  1ONG A;  1E3U D;  4KQQ A;  3G32 A;  4WZ5 A;  1GA0 A;  1XA7 A;  1PW8 A;  3PBR A;  5M18 A;  4KZ5 A;  3MZE A;  4HBT A;  4KG2 A;  5L2F A;  4LEN A;  5A92 A;  3C4P A;  1BUL A;  5E2G A;  1MY8 A;  1W5D A;  2ZJ9 A;  3IXB A;  1JWV A;  4U3T A;  3IF6 C;  4YIN A;  5D3O A;  2G2U A;  1HTZ A;  1E4D A;  3OC2 A;  4IBR A;  1KE4 A;  3V3R A;  4KZ7 A;  1K55 A;  2H0Y A;  3VP2 A;  4KG6 A;  1XPB A;  3G35 A;  2Y2H A;  5CEC A;  3SH7 A;  5HAQ A;  2Q9N A;  1G6A A;  4Y0T A;  3IF5 A;  3GMW A;  5FAO A;  1KVL A;  3NIA A;  4FH4 A;  1ONH A;  2Y91 A;  4KZ3 A;  4MBK A;  4N92 A;  3E2L A;  3VP1 A;  3DWZ A;  1O07 A;  3HRE A;  4P6B A;  5CXW A;  5EUA A;  1DJA A;  4K91 A;  3UDI A;  5HAR A;  3OZH A;  4PM8 A;  5GHX A;  2Z2L B;  4E6X A;  2G2W A;  4L0L A;  4Y0U A;  2J7V A;  1YLT A;  4F94 A;  2C5W B;  5AQ9 A;  3IWI A;  2EFX A;  4ZJ1 A;  1GHI A;  3PBS A;  4OQH A;  4IED A;  4S2K A;  2PU4 A;  2EXB A;  5E2E A;  2ZC4 B;  1TDG A;  4E3J A;  3ZNY A;  1XGI A;  2Y2K A;  4BL2 A;  1KGE A;  1KE3 A;  1PW1 A;  1RGZ A;  3VFF A;  3MZF A;  4S2N A;  1XXM A;  5FSR A;  4NET A;  1PWG A;  5FQK A;  1BZA A;  5E43 A;  3IQA A;  4R4S A;  3BFG A;  2IWB A;  3G2Y A;  4OLD A;  5F82 A;  4GNU A;  4R3B A;  3M2K A;  2A49 A;  5JYP A;  3HLW A;  3MZD A;  4NK3 A;  1K56 D;  2IWD A;  3C4O A;  4HEF A;  3O86 A;  2QPN A;  4CJN A;  4ZTK A;  1PWD A;  5FA7 A;  3UY6 A;  4GKU A;  2EX9 A;  4JLF A;  1CI8 A;  5CEB A;  4QU3 A;  2HDR A;  3LCE A;  1JTD A;  1LL5 A;  3HVF A;  5CTM A;  5DF8 A;  5IHV A;  2R9X A;  3S22 A;  3Q1F A;  5BOH A;  3IH9 A;  1FCN A;  3Q07 A;  3A3I A;  1KGF A;  3WRT A;  1G68 A;  3UDX A;  4RX2 A;  1FR6 A;  1IYO A;  1HD8 A;  2XEP A;  1WE4 A;  2P9V B;  1IYQ A;  1ESI A;  4EV4 A;  4KQR A;  1DJB A;  1I2S A;  4QHC A;  2ZQ9 A;  2PBY A;  1SDN A;  4O7D A;  1IEL A;  2WKH A;  4E3L A;  2I72 A;  4KZ9 A;  5CED A;  1L0D A;  3PBO A;  1IYS A;  1W8Y A;  2XLN A;  4JPM A;  5EVI A;  1HVB A;  1XA1 A;  3P09 A;  4KEN B;  1KVM A;  4C75 A;  4D2O A;  4EBN A;  4E3K A;  1N9B A;  3IHA A;  3O3V A;  4K0X A;  4LV1 A;  4N1H A;  4OOM A;  2ZQA A;  2IWC A;  4GN2 A;  3VP3 A;  1U60 A;  1W79 A;  2WAF A;  3OPL A;  5CER A;  1ESU A;  1RCJ A;  3BFE A;  1YLP A;  1M6K A;  2ZC3 B;  4JBF A;  4Y0O A;  3VMA A;  2WKE A;  1H8Y A;  4WEJ A;  4C6Y A;  1BUE A;  3EQV A;  3FV7 A;  5HAI A;  1LL9 A;  1J9M A;  3G34 A;  5CGX A;  3WS5 A;  4DE1 A;  2V20 A;  3LEZ A;  5E2F A;  1SDE A;  2JBF A;  4IBX A;  5A93 A;  1EWZ A;  3BFD A;  4S2J A;  4FD8 A;  2DCF A;  3UNW A;  3G31 A;  3RXX A;  2V2F F;  3PBQ A;  4R0Q A;  4S2M A;  1WYC A;  3IXG A;  3ZG0 A;  1K4E A;  3V39 A;  4FH2 A;  4DXB A;  1LLB A;  3MKE A;  3RXW A;  4XUX A;  3IT9 A;  2ZQ7 A;  2EX2 A;  3ZHH A;  4DE0 A;  2ZQC A;  1ES4 A;  3BFF A;  4ID4 A;  1I5Q A;  2P9V A;  1NZU A;  1K57 C;  1S0W A;  1K6R A;  3Q82 A;  4IVI A;  2OLV A;  3ZG9 B;  3A3E A;  2J9P A;  4GZB A;  3TOI A;  2JC7 A;  2EX6 A;  5EOE A;  3TSG A;  1MPL A;  4HES A;  3C7U A;  2HDS A;  5FQI A;  1DY6 A;  1ES5 A;  2R9W A;  3WS2 A;  1PYY A;  4KZ8 A;  3OPR A;  3HUM A;  3IF6 A;  3HLC A;  1YT4 A;  1BTL A;  3CJM A;  3ZG5 A;  4OON A;  5KSH A;  5DTS A;  4KZ4 A;  2Y2N A;  4RA7 A;  3B3X A;  2CC1 A;  3BLM A;  2XK1 A;  3IXH A;  5FQ9 A;  4PM7 A;  4X68 A;  3BM6 A;  5FAQ A;  5FQM A;  3FYZ A;  4WYY A;  5TFQ A;  3VP4 A;  4OH0 A;  3S1Y A;  4DF6 A;  4EBP A;  1SCW A;  1Y54 A;  5GLD A;  1RP5 A;  1K54 C;  2Y2I A;  3Q7V A;  3FKW A;  1K25 A;  3HUN A;  3LO7 A;  1RGY A;  3N7W A;  3SS5 A;  1N4O A;  3WS1 A;  1BLS A;  2Y55 A;  2WUQ A;  2X01 A;  2QMI A;  2X71 A;  4OPZ A;  4XXR A;  5EE8 A;  4R4R A;  5EOO A;  2FFY A;  5FDH A;  5FQJ A;  4PM5 A;  2Y2G A;  2H0T A;  3IWO A;  2ZM8 A;  4OPR A;  4GDB A;  4MEZ A;  3SH8 A;  5GHY A;  3FZC A;  3OCL A;  4BLM A;  1K54 A;  2Y2Q A;  1IYP A;  1TEM A;  2ZLY A;  3HBR A;  1LHY A;  4KZA A;  4WMC D;  2HDU A;  1PI4 A;  4JXV A;  4WEL A;  3PAE A;  5EPH A;  2Y2L A;  5AQA A;  5HX9 A;  3WWX A;  4Q8I A;  2JCH A;  3MKF A;  5TR7 A;  3EQU A;  4QB8 A;  3UE1 A;  4BD1 A;  1MWR A;  4UHU A;  1YM1 A;  3ITA A;  2A3U A;  4WBG A;  3HLF A;  1E3U A;  2ZC7 A;  5F1G A;  1L0G A;  1JWP A;  4QJG A;  4ZJ3 A;  4S2P A;  1S6R A;  4RVA A;  4CPK A;  2ZC6 B;  5FI2 A;  2BLS A;  5CGS A;  3IXD A;  5TGF A;  1ALQ A;  3HLE A;  3W4P A;  3ISG A;  3N4I A;  3M2J A;  3PBT A;  2ZD8 A;  2XR0 A;  4B4X A;  1PI5 A;  5JYO A;  5M19 A;  1H5X A;  4QD4 A;  4MBH A;  2XD1 A;  3ITB A;  3NI9 A;  1KGG A;  4BL3 A;  2P74 A;  3TG9 A;  1FCO A;  4LV3 A;  2XQZ A;  4WZ4 A;  3SH9 A;  3UPN A;  4DRT A;  5KSC A;  1IKI A;  4B88 A;  2RL3 A;  4HBU A;  4MBF A;  1PZP A;  1YLZ A;  4OKP A;  1QMF A;  1SHV A;  5DF9 A;  3V3S A;  4MNR A;  4QY6 A;  4OQ0 A;  4E3N A;  3VOY A;  3JYI A;  5GLB A;  4GD6 A;  1TDL A;  4OPY A;  4UA7 A;  1E25 A;  1MBL A;  5GHZ A;  2WGV A;  4JF4 A;  2FFF B;  3GVB A;  2XDM A;  4MLL A;  1W8Q A;  3OPH A;  1FSY A;  3I7J A;  3LY3 A;  1L0F A;  1LI0 A;  1CK3 A;  2WAD A;  1YMX A;  3NC8 A;  1GA9 A;  4R1G A;  1ZG4 A;  3BLS A;  4LV0 A;  2OSU A;  3WS0 A;  2WKI A;  3O87 A;  3SS3 A;  4EBL A;  2Y2O A;  1C3B A;  1LI9 A;  3M6B A;  3HUO A;  4OP5 A;  3G30 A;  4GD8 A;  5KZH A;  3N8L A;  4FCF A;  3CZD A;  1QME A;  1ZG6 A;  3O88 A;  3N8R A;  3HL9 A;  3QNC A;  4OQI A;  2EX8 A;  3VSL A;  5U47 A;  4UA6 A;  3SOI A;  2Y2J A;  4Z9Q A;  4P0M A;  3G2Z A;  5CHJ A;  5F83 A;  4N1X A;  5GLA A;  4WMC A;  3HLG A;  1ES3 A;  1K56 A;  5DVA A;  4WZ5 C;  1KDS A;  2VGK A;  3DTM A;  4BEN A;  2HDQ A;  5M1A A;  1K57 A;  5EEC A;  4KZ6 A;  4OOL A;  2WGW B;  1FQG A;  3Q7Z A;  5AQ7 A;  3ZG7 B;  1MWU A;  1WYB A;  1TVF A;  4DE3 A;  2EFU A;  3M6H A;  4ZAM A;  1PZO A;  2ZM0 A;  3AGF A;  3BFC A;  1K55 C;  1PIO A;  3GRJ A;  1HZO A;  1NXY A;  1NZO A;  4N9K A;  3DWK A;  3RJU A;  4DDS A;  1MWS A;  2H5S A;  2ZC5 B;  3N6I A;  5CRF A;  3SS4 A;  3OPP A;  3FKV A;  1YLW A;  2VGJ A;  4X56 A;  2BG1 A;  4XUZ A;  3CG5 A;  5FAP A;  2J8Y A;  2XH9 A;  2XFT A;  4LCM A;  3UO9 A;  4OLG A;  4OPQ A;  4ZBE A;  2JE5 A;  4ZJ2 A;  5EVI D;  3WS4 A;  2EXA A;  4JXS A;  5J8X A;  3DW0 A;  3UPO A;  1ZC2 A;  2V1Z A;  2XF3 A;  4UAA A;  4R3J A;  2ZQ8 A;  3VP0 A;  2WYX A;  3NDE A;  4E3O A;  2WK0 A;  1JTG A;  4S2O A;  1K4F A;  4U0T A;  3PTE A;  1KDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...