3QP2A

Crystal structure of cvir ligand-binding domain bound to c8-hsl
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
MRPLPAGLTASQQWTLLEWIHMAGHIETENELKAFLDQVLSQAPSERLLLALGRLNNQNQIQRLERVLNVSYPSDWLDQYMKENYAQHDPILRIHLGQGPVMWEERFNRAKGAEEKRFIAEATQNGMGSGITFSAASERNNIGSILSIAGREPGRNAALVAMLNCLTPHLHQAAIRVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords CviR transcriptional regulator
publication title A strategy for antagonizing quorum sensing.
pubmed doi rcsb
source organism Chromobacterium violaceum
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3qp2A00
2AVXA 4Y13A 3IX3A 3IX4A 3JPUA 5L09A 3QP1A 4Y17A 2UV0E 3QP2A 3QP6A 2Q0OA 3QP5A 3QP4A 1H0MA 3IX8A 4LGWA 5L07A 1L3LA 3QP8A 3SZTA 5L10A 4LFUA 4Y15A 4NG2A
chains in the Genus database with same CATH superfamily
3VP1A 5J7EA 4HH2A 5DTTA 5KMWA 1OTEA 1Y4OA 4FH2A 2HV1A 3UB8A 1T1BA 5HWWA 4R4RA 2PYPA 1J9MA 3CG5A 3Q81A 3BRMA 2W3DA 1PFLA 2ZMAA 1NRJA 3BYDA 3MR0A 1VB6A 3KO6A 2XQZA 2RL3A 1LL9A 2ZC3B 1VM1A 4IVIA 2EXAA 1ESIA 2Y2PA 3RTYA 4ARZA 1AWIA 3K3DA 1F98A 4EV4A 4PKYA 2O0YA 4N9LA 4ID4A 4OPQA 3LY4A 3HLWA 2P74A 4EBPA 3BJNA 2EX2A 3UY6A 1YQSA 5G18A 3PBSA 4HEFA 2R9WA 1YMXA 2QJ5A 1UWNX 2Y2LA 2Y2MA 5CERA 1NWZA 4FCFA 3MZFA 5FI2A 5FQQA 3F1NA 2L0WA 2KDKA 1C3BA 4MMNA 4RA7A 3L9KA 5K5BA 1XA7A 2JKRI 2ZMFA 4IEDA 3WS0A 3DTMA 3UN7A 3UPNA 5EE8A 3M6HA 5HAPA 3F1OB 4KZ6A 2D02A 3VP0A 5GLAA 3VFFA 4P6ZS 4S2LA 1MWSA 1VETA 2PU4A 4XUXA 4HHDA 5FAQA 3LY3A 2L1MA 2V20A 3LICA 5FDHA 1TD5A 3UMEA 4KQOA 4OOLA 2QZ6A 2OLVA 3HCYA 1ZG6A 1DP6A 4GD8A 1TEMA 5FI7A 1IYOA 4E3LA 3MKEA 2ZOIA 2XFTA 2WKPA 2I72A 4E3MA 4OPRA 4DKIA 2QJ7A 1MKMA 3PYPA 3IWIA 2Y79A 5CGWA 5L09A 3DWZA 4L0LA 3T4KA 3ZGAB 3OBFA 1K55C 1M40A 4FH4A 2ZQ9A 4ZTKA 3ISGA 2PBYA 1ZG4A 1W7FA 3GTCA 3OPLA 2J8YA 4YFMA 5FQIA 3AGFA 5AQ7A 3GDIA 1P9WA 1SKOA 4R1GA 5CX7A 1XPBA 5TGFA 5F1FA 5FEGA 5FI6A 3VE4A 4HQAA 5EVIB 1VHMA 2JCHA 2PRFA 3AGEA 1MY8A 1K56A 4KZ9A 1GSWA 3RXXA 1IYSA 2PHYA 3NOUC 4XT2A 4MLLA 3TW8A 5TFQA 4FTXA 1NLYA 1ZTUA 5HD5A 2OWJA 4PKYG 2XRNA 5CGXA 3SS4A 3D9YA 3FYZA 3T1SA 1AXBA 3R4KA 2XLNA 3B47A 1MWUA 4C75A 2JKFA 2XF3A 4WZ5A 4C6YA 4YOFA 4B4XA 4PMAA 3N8LA 2EFUA 4BD1A 5CGSA 4NKPA 4QWOA 3ZG7B 3C2WA 2YKFA 2A24B 3T1RA 3BM6A 2O99A 4G3VA 5DTSA 3A0VA 2I9VA 3GSGA 4LV1A 3FPVA 5GHZA 4EW7A 4DJ2A 4E3OA 3D4FA 5DF8A 1G6AA 1W5DA 2PDRA 1G28A 3BW6A 3RFBA 2NUPC 3KYZA 3CUEC 3IT9A 1H8ZA 3ICYA 3CI6A 1BZAA 1T19A 3ZHHA 5GL9A 3LEQA 2CMNA 2VX8A 4IUKA 4WMCA 2ZQAA 3QP4A 2W3GA 1PI4A 1Q2PA 2XD1A 4UQIM 4NXFA 4LV0A 2XR0A 1IEMA 2EX6A 2X71A 2JHEA 1MKIA 3IWQA 2WKQA 5D3OA 2EWVA 4LLOB 3C4PA 1KGFA 1KDWA 4K91A 1LSWA 4FOFA 2H0TA 3MZEA 2V8CA 3O86A 4ZRRA 4ZJ3A 3W8KA 2KOIA 3GV9A 3HLFA 3QHYA 3G32A 1FIKA 2HDUA 1KOUA 3KSIA 2VA0A 4DE1A 3UE1A 3UMDA 1TF1A 1XJ3A 2W3FA 4EQ1A 3MXSA 2W27A 4DF6A 3KX0X 3T4LA 4KZ5A 3F1NB 4HH3A 2Y2IA 2GDNA 1E4DA 3PAGA 1SKFA 1L2SA 2EX9A 5EVLA 2HDRA 1T1CA 1BT5A 3QP1A 5G4ZA 4OP5A 3IF6C 1HD8A 3EQUA 3VSKA 4HBUA 4JGRA 5DJTA 4GZBA 5L07A 5U47A 4CJNA 3MKFA 1W63M 2XEPA 3HL9A 3LIEA 2VK3A 2ZM2A 1OT6A 4Y0TA 4OQHA 3WRTA 4E3NA 3V50A 2P7JA 2M7VA 3HJKA 5TR7A 5HFOA 2OAP1 1K25A 4G3WA 1ES5A 1BTLA 4S2OA 3QP5A 3UE6A 4CLCC 4O0PA 3F1OA 4P85A 4QHCA 4U0XA 3HUOA 3VMAA 1ERMA 3O88A 4HJ4A 5EOOA 3A3EA 1P9RA 4WL9A 1CI9A 3ULFA 2VV7A 5LBRA 4BMWA 2VGLM 5M18A 1OTIA 4UA9A 3F1PA 4HESA 4EESA 2HDQA 1F9IA 1JWVA 3U4LP 4BENA 5FAPA 1K38A 2XA7S 3IXDA 1RGYA 1N9LA 3WS2A 1G6OA 1LI9A 3MZDA 1K56D 4NXGA 3LFVA 1CK3A 3NHQA 2HP5A 3R7WA 1XJ4A 1V9YA 4O7DA 5EECA 1D06A 5F69A 4K0WA 4HNBA 4QY5A 1H8YA 3DAVA 1TDGA 2DNSA 1A0KA 3B42A 4WEJA 2R9XA 4JBFA 2FH5A 2ZLYA 5EM1A 2VGJA 3A3IA 4BBVA 1G68A 1LLBA 1RGZA 4PM7A 4JLFA 3RJUA 1KGGA 5KZHA 4N1XA 1NLZA 4DRTA 4HP4A 1J3WA 5M1AA 3EWKA 1IYPA 4QY6A 1S66L 4QD4A 3E98A 3C7UA 3IXGA 1V9ZA 2B95A 3HBRA 4S2IA 4CPKA 3HREA 1XJ2A 4O01A 4I3JA 3MSHA 4X68A 3BQ8A 3OZHA 4E04A 2Q9MA 5DKKA 3ZVWA 3H7WA 2J80A 3GQZA 1K0KA 5E2FA 1PRQA 2WGVA 3ZCZA 3W4OA 3H82A 2HJ9C 5EFWA 4RX2A 5F82A 5I94A 5DFXA 4ZBEA 3M6BA 2PD8A 4FSFA 4UAAA 4OP8A 2V9AA 1HVBA 1QMFA 4Z1WA 2O9BA 4BWIA 1ES4A 5CEBA 5TBMA 4IHQA 4P0MA 3FKVA 3VP4A 4E3JA 1OTDA 2W3EA 3QP2A 5CEDA 4L9EA 1K57A 1BLPA 1CF0A 1XA1A 3NECA 1NXYA 2ZQDA 2JBFA 1H8MA 2ZD8A 1LHYA 4GDBA 5G4YA 4HY8A 2WGWA 2RCXA 4IUHA 3ITAA 5MC7A 1QMEA 2OV5A 3G4PA 3IX4A 4E6WA 4X6TA 1LT0A 1RCJA 2L4RA 2HF6A 5GLDA 4KG6A 3UDIA 2HDSA 2FFFB 3N6IA 1Y28A 1PNEA 5DF9A 1YMSA 1HLUP 5JYPA 2V1ZA 4QJGA 3B3XA 3BFGA 2V0UA 3EQVA 4LRZE 4GN2A 1E25A 4FD8A 4IJGA 3FZCA 5FASA 2NUTC 3S7PA 4XXRA 2IA2A 1JWPA 3IXBA 3IXHA 4DN0A 4D2OA 4H6JA 5CXWA 5HDCA 1KVMA 3PBNA 1EI5A 2ZQ7A 5AJGA 1KE3A 1H0MA 3A0SA 3NDEA 4ME4A 4LGWA 4QU3A 3ZNTA 2BASA 5JYOA 2W1TA 5FQMA 1LL8A 4HIAA 1IOUA 4LCLA 3P01A 4WZ4A 1YLWA 2H0YA 3SH7A 3NBLA 1T1AA 3BFFA 3OPHA 4R3BA 2C6WB 1M6KA 4S2NA 2P04A 1F2KA 3BEBA 1PWCA 2A3UA 3S7OA 3IWOA 3G31A 3C8CA 5F68A 2GX5A 4RVAA 1DRMA 1FILA 4JPMA 3CPTA 3LEZA 1N9BA 3L7HA 3HJIA 3LYXA 1KDSA 3PXPA 4ZJ1A 1TS6A 2B02A 2Y2NA 2ZC7A 4XUZA 1ES3A 4GS9B 1OT9A 3F1PB 1K54C 5HDDA 4K08A 2PBDP 2Q9NA 4Y2FA 2Y2OA 3TOIA 4R6LA 2E8JA 5A8BA 2C5WB 1O7EA 2XFSA 3W4QA 2VZWA 2WKRA 3IQAA 5HAIA 4B88A 3DBAA 3R7WB 1T18A 1S1YA 4PPRA 5FEFA 1I5QA 3PBOA 3W2ZA 3NIAA 4E6XA 4YNRA 2OAQ1 5DFYA 3KSGA 5HX9A 1BSGA 4PM8A 3VE3A 1FQGA 5CHJA 3CITA 3TG9A 5KSCA 3UE0A 4GDNA 3WS1A 2IWDA 3Q1FA 3ZQ5A 4NETA 1VEUA 5L8MA 4DJ3A 5IHVA 2JE5A 5EM0A 3WRZA 5DJUA 3JPUA 4II7A 1FSYA 4OQGA 1E3UD 3C38A 4PHTA 4NEED 4OONA 3SS3A 4BLMA 3UDXA 2P9VA 1ZHHB 2W3HA 3B33A 4KZ8A 3HLBA 3TJZC 4DXCA 4KQQA 4KG2A 2V1BA 3H7WB 4JXWA 1Y54A 3OLOA 3CHWP 4Q0HA 2HP6A 1PWDA 3DW0A 1SDEA 2J7VA 3IS2B 3O5YA 2BTFP 3H82B 2A2LA 5FAOA 1ZKJA 3M2JA 4QB8A 2JKRM 1HZOA 4JGOA 2DRWA 2JKTI 3MQ0A 2V8FA 5F6AA 4I3IA 5TBMB 1MWTA 4IVKA 5EVIC 3ZNYA 1UGUA 2J9PA 5HDSA 1PIOA 1JWZA 4KUKA 3VOLA 4EQIA 1UWPX 4R3AA 4F94A 1EROA 4Q0JA 4BD0A 1NYYA 3G34A 3N4IA 4HOIA 3SW1A 2WGWB 3MF0A 1DJBA 3Q7VA 4OPZA 2P08A 3E4PA 3N7WA 4KZ7A 4D60A 3MXQA 2FFYA 2ZOHA 3WS4A 4X69A 4LCMA 4F3LA 1H5XA 3N8SA 3CZDA 4BJPA 1W79A 4LFUA 5FQKA 4NG2A 1LI0A 1CEGA 4PM5A 2E8IA 1Z09A 3ZVTA 5EUAA 2XGNA 4CLCD 4EUVA 1KVLA 1MC0A 4HJ6A 3MQQA 4KZBA 2XA7M 1BLCA 3G6OA 1S67L 3LGOA 5HPIA 1FR6A 4H6JB 3Q07A 1F5MA 1JTDA 2KLIA 5GLCA 5J3WA 5KSHA 4C3QA 2QWSA 2XDMA 2W1TB 3W4PA 2EX8A 2INWA 4MBFA 1YLPA 4ESPA 3HVFA 3UB7A 1NRFA 1YKDA 2Y55A 4S2KA 3FV7A 4I39A 4R0QA 4KQDA 2XH9A 4S2MA 5F5YA 5HD3A 4E3IA 3WWXA 3FWLA 2EFXA 3T4OA 1K55A 3JVVA 4HJ3A 3CPTB 3UO9A 3T12B 3KYEA 3MFXA 2ACGA 4Y5FA 5A90A 4Y0UA 4N92A 2K7SA 5CTNA 4OPYA 3SOIA 2WKEA 2HPBA 2OOLA 4WUJA 3G2YA 1JNUA 3UPPA 2ZM8A 3LR4A 3PR6A 1XXMA 5EVEA 2G2UA 4DDSA 2Y2HA 3P09A 4GS9A 5HW3A 4UQIS 4BL3A 1L3LA 4KZAA 3BQAA 4DE3A 3PTEA 1YLTA 1CEFA 3OOVA 1KE4A 2ZL1B 1GA9A 4LV3A 3LIDA 4Y15A 2WAEA 1WYBA 1PYYA 5EOEA 5C5KA 3HLCA 2EXBA 3T4QA 3BFCA 3T4TA 1FCOA 2GZAA 4X56A 5AQAA 3RXWA 3EEAA 2Z6CA 1NZOA 3CAXA 1BLSA 4OOMA 2VJWA 4GLQA 1WA9A 3OC2A 5AVEA 2V0WA 1VEUB 3PHYA 3A3DA 5E2HA 4HP9A 1XFQA 3MBZA 4WF0A 1YSQA 3WS5A 4I3AA 3IBJA 4LRYC 4Q8IA 5A91A 3NI9A 3MXRA 4WEKA 4JGPA 3Q7ZA 2P9VB 2WK0A 3N8RA 4CQHA 5EV0A 4AFIA 4S2JA 3OCLA 5GHYA 3CUEA 4JXVA 5E43A 2O9AA 1S4RA 3IF5A 2CC1A 3HLEA 3C7VA 5E2EA 3VP3A 1L0FA 1FR1A 3NULA 4NXBA 4GNUA 4MN5A 3K2NA 1MZUA 2XD5A 2Z2MB 1E3UA 3U2AA 1OJGA 1DJCA 3IS2A 1OTBA 4EBNA 2LB9A 1ONGA 3HLDA 1PW1A 2JN7A 3LI8A 2QYBA 1IKIA 4IBXA 3CLOA 3T4JA 5HARA 2WZXA 1OTAA 1LSXA 1MXOA 3LUQA 3GVBA 4EU0A 1CJFA 3V5MA 3QP6A 1BYWA 3NDGA 3Q82A 3Q7VB 1MWRA 2JKGA 5A93A 1BULA 3NC8A 3O3VA 4PAUA 3DTEA 1ODVA 4F3LB 4P6ZM 4R70A 2AVXA 2J9OA 2Y8HA 1SZVA 5GHXA 4HBTA 3UNWA 4WZ5C 2IWBA 2V1AA 1I2SA 2HP9A 2W1RA 1IYQA 4DE0A 1LSVA 4A5RA 2WZZA 3RH8B 4B93A 3LR0A 4X1MA 1O07A 3IF6A 4NK3A 1GSXA 3V39A 3T4SA 4KG5A 4KUOA 4EERA 3LR3A 2MJ6A 2WGIA 4KENB 3VOYA 3BFDA 2J3TC 4WBGA 5FSRA 1N9OA 3NOPC 4GHIA 1GHPA 1SDNA 4Y3IA 1DP8A 4CLCA 4OKPA 2BG1A 1H3QA 3ZG0A 4WELA 4GW9A 2WADA 4MN6A 3VP2A 5GLBA 1K6SA 2J3WA 5HAQA 4FUWA 2A49A 3BFEA 4UA6A 4R23A 2Y2QA 3T1XA 1KE0A 4RYEA 5FDSA 1SCWA 1MPLA 2Q0OA 3ZYTA 4P87A 2ZQ8A 4GJ4A 3MJQA 2QMIA 4OOYA 2G7UA 3EOIA 5CTMA 2K2NA 4P6BA 3C30A 1BLHA 1XKZA 1YM1A 4EXOA 1DP9A 4RX3A 2Y59A 1GHIA 3BWLA 4ZDXA 4MN7A 1TDLA 3CMZA 3ZDJA 4KZ4A 3UB5P 1XP4A 1ALQA 3QNCA 1JTGA 2PD7A 4GB7A 3NJAA 1GA0A 5AVFA 3E2KA 3LIAA 4M3KA 3V3SA 4BQMA 1YPRA 3HUNA 2PR6A 3LO7A 2H28A 1PZOA 4OVDA 5FATA 3CWFA 2B5RA 3ITBA 4I38A 5FL3A 3ZG9B 1W8QA 5AQBA 2JC7A 2YKHA 3T50A 4Y0OA 1W63Q 2GJ3A 1EW0A 3DTKA 4CLCE 4UA7A 2Y2JA 2ZL1A 1WYCA 5FQ9A 2HJEA 5E2GA 4I5SA 3NCKA 2PYRA 2BLSA 3LI9A 5DKLA 3V3RA 1HTZA 2M1CA 4OH0A 5TJJA 5DF7A 1PW8A 4E3KA 1KGEA 2PU2A 3SH8A 2K31A 5EVID 3VSLA 1DY6A 4DMZA 2LB5A 2VV8A 1PZPA 1PI5A 3VV4A 1XFNA 2R78A 4EBLA 3LR5A 3JYIA 3G30A 2Y2KA 4KZ3A 3UDFA 5BOHA 4U3TA 3TE8A 4ETZA 3BY9A 4MDZA 1L0DA 1FOFA 3E0YA 2ZC5B 4L9FA 1XJ6A 3OCNA 4DXBA 4HI4A 1FCMA 5CECA 2X02A 3G2ZA 3IHBA 4B4ZA 3PBQA 3IX3A 2O9CA 4UHUA 1VQQA 4QPRA 5KIZA 4WN5A 3P98A 4MBHA 3S7QA 2PR5A 3HLGA 4Z9QA 4OQ0A 1BUEA 1JVJA 3FKWA 4LPZA 3A3FA 3K3CA 4GD6A 3G35A 5HL1A 1TS8A 4JXSA 3HUMA 5DTKA 2EA9A 1L0EA 4X1LA 3E2LA 2QPNA 5HSQA 1S6RA 2GNXA 1SHVA 5IU1A 4IBRA 1IKGA 1K4FA 1GSVA 1S1ZA 3VFHA 1DJAA 3IX8A 2WAFA 4O8GA 4RQ9A 3S7NA 2WKIA 1IFQA 5EPHA 3BLMA 1EWZA 4ETXA 3EGXC 1GCEA 1S4SA 1TVFA 2ZC6B 2ZQCA 5HZHA 3IF6B 1U60A 3BECA 1D1JA 4GKUA 1L0GA 1G5UA 2VGKA 4BL2A 2H5SA 4GHIB 3C4OA 3GRJA 2M7UA 3UPOA 4X53A 1I2WA 4K0XA 4CLCB 1TS0A 2D01A 3GECA 5IT5A 3FPWA 1LL5A 2QHKA 3AGDA 3QP8A 2FZ0A 1P0ZA 4R4SA 1K57C 1Z6FA 4PM9A 4ARZB 4YINA 2WYXA 1ERQA 1MBLA 4GOGA 4JF4A 2VKSA 1NJ4A 1ACFA 3IH9A 3PBTA 3ZFZA 1YAXA 4JKTA 4LRXC 1K54A 2Y4AA 4N1HA 4JF5A 1K4EA 1CQAA 1K6RA 3SS5A 4NXEA 1PWGA 4JF6A 4N9KA 2VLGA 3S4XA 5HPFA 3E4OA 5J8XA 1N9NA 4S2PA 4BBTA 1FCNA 1X0OA 2Y91A 4Y7PA 1N4OA 1NYMA 5CRFA 4EUZA 4LV2A 3ZG5A 1ZC2A 4WYYA 2ZBBA 4WM9A 2PAVP 2B18A 4MBKA 4DDYA 4MEZA 1VETB 3A3JA 1ESUA 5F83A 2XROA 1YSPA 2JKTM 3MQOA 5CHUA 1NY0A 3BLSA 3LIFA 1S0WA 3FG8A 4U0TA 3GR2A 3NOTC 2XK1A 1YLYA 4Q0IA 5A92A 1YT4A 4OLGA 2Z2LB 5F1GA 1NZUA 3P7NA 3VOZA 2ZJ9A 2UV0E 3ZG8B 2WKHA 4YWZA 1CI8A 3DWKA 1WE4A 4GCZA 4UEYA 4R3JA 4OQIA 3D72A 3SH9A 2OSUA 2QKPA 4R38A 4S2NC 3UE3A 3UB6A 4M4XA 2DCFA 4LENA 4MNRA 1RP5A 2G2WA 2PT7A 5L2FA 3UB9A 1YLJA 3JVUA 4DE2A 4ZAMA 2W0NA 3V67A 3E4QA 2X01A 3S1YA 2XSSA 1GHMA 1ES2A 1SKOB 2OWHA 4JXGA 3O87A 4X25A 3TSGA 2KX6A 3OPPA 1OMEA 4KQRA 4B9OA 3D3OA 3I7JA 3DTIA 3KSFA 2UWXA 5L10A 1ONHA 1OJ5A 2HZ5A 3OPRA 4XT2B 5EVIA 3LCEA 4L9GA 5FA7A 5M19A 5DVAA 4MCWA 2EWWA 4X55A 2OLUA 2V2FF 4EWFA 5HWVA 2H10A 5AQ9A 2ZM0A 3S22A 1FSWA 1D7EA 2ZMVA 4H8RA 3GMWA 3KSHA 3CJMA 5FQJA 5CHMA 1W8YA 3NY4A 3FC7A 3IBRA 2Y2GA 2J3TD 1OPXA 3SZTA 3PAEA 1XX2A 4EETB 2ZC4B 2IWCA 1Q2QA 2DMWA 1STZA 1P97A 5HL6A 4EEUA 3TRCA 4EEPA 2WUQA 4JGQA 1TS7A 2VGLS 4Y17A 3C5AA 2A24A 3MMHA 3QNBA 4ZJ2A 2VV6A 5IS1A 4WMCD 2HGVA 3H9WA 3EGDC 4PM6A 5I5LA 1IELA 3BY8A 1YLZA 4G3KA 3KYQA 3MS6A 4Y13A 4OLDA 4BBUA 1XGJA 3T1QB 3IHAA 3MFDA 2Z6DA 3LIBA 3PBRA 3A0RA 3M2KA 2VEAA 5J4EA 1XGIA 5HWTA 3IH8A 3EEHA 4WLAA
chains in the Genus database with same CATH topology
2AVXA 4Y13A 3IX3A 3IX4A 3JPUA 5L09A 3QP1A 4Y17A 2UV0E 3QP2A 3QP6A 2Q0OA 3QP5A 3QP4A 1H0MA 3IX8A 4LGWA 5L07A 1L3LA 3QP8A 3SZTA 5L10A 4LFUA 4Y15A 4NG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVX A;  4Y13 A;  3IX3 A;  3IX4 A;  3JPU A;  5L09 A;  3QP1 A;  4Y17 A;  2UV0 E;  3QP2 A;  3QP6 A;  2Q0O A;  3QP5 A;  3QP4 A;  1H0M A;  3IX8 A;  4LGW A;  5L07 A;  1L3L A;  3QP8 A;  3SZT A;  5L10 A;  4LFU A;  4Y15 A;  4NG2 A; 
#chains in the Genus database with same CATH topology
 3VP1 A;  5J7E A;  4HH2 A;  5DTT A;  5KMW A;  1OTE A;  1Y4O A;  4FH2 A;  2HV1 A;  3UB8 A;  1T1B A;  5HWW A;  4R4R A;  2PYP A;  1J9M A;  3CG5 A;  3Q81 A;  3BRM A;  2W3D A;  1PFL A;  2ZMA A;  1NRJ A;  3BYD A;  3MR0 A;  1VB6 A;  3KO6 A;  2XQZ A;  2RL3 A;  1LL9 A;  2ZC3 B;  1VM1 A;  4IVI A;  2EXA A;  1ESI A;  2Y2P A;  3RTY A;  4ARZ A;  1AWI A;  3K3D A;  1F98 A;  4EV4 A;  4PKY A;  2O0Y A;  4N9L A;  4ID4 A;  4OPQ A;  3LY4 A;  3HLW A;  2P74 A;  4EBP A;  3BJN A;  2EX2 A;  3UY6 A;  1YQS A;  5G18 A;  3PBS A;  4HEF A;  2R9W A;  1YMX A;  2QJ5 A;  1UWN X;  2Y2L A;  2Y2M A;  5CER A;  1NWZ A;  4FCF A;  3MZF A;  5FI2 A;  5FQQ A;  3F1N A;  2L0W A;  2KDK A;  1C3B A;  4MMN A;  4RA7 A;  3L9K A;  5K5B A;  1XA7 A;  2JKR I;  2ZMF A;  4IED A;  3WS0 A;  3DTM A;  3UN7 A;  3UPN A;  5EE8 A;  3M6H A;  5HAP A;  3F1O B;  4KZ6 A;  2D02 A;  3VP0 A;  5GLA A;  3VFF A;  4P6Z S;  4S2L A;  1MWS A;  1VET A;  2PU4 A;  4XUX A;  4HHD A;  5FAQ A;  3LY3 A;  2L1M A;  2V20 A;  3LIC A;  5FDH A;  1TD5 A;  3UME A;  4KQO A;  4OOL A;  2QZ6 A;  2OLV A;  3HCY A;  1ZG6 A;  1DP6 A;  4GD8 A;  1TEM A;  5FI7 A;  1IYO A;  4E3L A;  3MKE A;  2ZOI A;  2XFT A;  2WKP A;  2I72 A;  4E3M A;  4OPR A;  4DKI A;  2QJ7 A;  1MKM A;  3PYP A;  3IWI A;  2Y79 A;  5CGW A;  5L09 A;  3DWZ A;  4L0L A;  3T4K A;  3ZGA B;  3OBF A;  1K55 C;  1M40 A;  4FH4 A;  2ZQ9 A;  4ZTK A;  3ISG A;  2PBY A;  1ZG4 A;  1W7F A;  3GTC A;  3OPL A;  2J8Y A;  4YFM A;  5FQI A;  3AGF A;  5AQ7 A;  3GDI A;  1P9W A;  1SKO A;  4R1G A;  5CX7 A;  1XPB A;  5TGF A;  5F1F A;  5FEG A;  5FI6 A;  3VE4 A;  4HQA A;  5EVI B;  1VHM A;  2JCH A;  2PRF A;  3AGE A;  1MY8 A;  1K56 A;  4KZ9 A;  1GSW A;  3RXX A;  1IYS A;  2PHY A;  3NOU C;  4XT2 A;  4MLL A;  3TW8 A;  5TFQ A;  4FTX A;  1NLY A;  1ZTU A;  5HD5 A;  2OWJ A;  4PKY G;  2XRN A;  5CGX A;  3SS4 A;  3D9Y A;  3FYZ A;  3T1S A;  1AXB A;  3R4K A;  2XLN A;  3B47 A;  1MWU A;  4C75 A;  2JKF A;  2XF3 A;  4WZ5 A;  4C6Y A;  4YOF A;  4B4X A;  4PMA A;  3N8L A;  2EFU A;  4BD1 A;  5CGS A;  4NKP A;  4QWO A;  3ZG7 B;  3C2W A;  2YKF A;  2A24 B;  3T1R A;  3BM6 A;  2O99 A;  4G3V A;  5DTS A;  3A0V A;  2I9V A;  3GSG A;  4LV1 A;  3FPV A;  5GHZ A;  4EW7 A;  4DJ2 A;  4E3O A;  3D4F A;  5DF8 A;  1G6A A;  1W5D A;  2PDR A;  1G28 A;  3BW6 A;  3RFB A;  2NUP C;  3KYZ A;  3CUE C;  3IT9 A;  1H8Z A;  3ICY A;  3CI6 A;  1BZA A;  1T19 A;  3ZHH A;  5GL9 A;  3LEQ A;  2CMN A;  2VX8 A;  4IUK A;  4WMC A;  2ZQA A;  3QP4 A;  2W3G A;  1PI4 A;  1Q2P A;  2XD1 A;  4UQI M;  4NXF A;  4LV0 A;  2XR0 A;  1IEM A;  2EX6 A;  2X71 A;  2JHE A;  1MKI A;  3IWQ A;  2WKQ A;  5D3O A;  2EWV A;  4LLO B;  3C4P A;  1KGF A;  1KDW A;  4K91 A;  1LSW A;  4FOF A;  2H0T A;  3MZE A;  2V8C A;  3O86 A;  4ZRR A;  4ZJ3 A;  3W8K A;  2KOI A;  3GV9 A;  3HLF A;  3QHY A;  3G32 A;  1FIK A;  2HDU A;  1KOU A;  3KSI A;  2VA0 A;  4DE1 A;  3UE1 A;  3UMD A;  1TF1 A;  1XJ3 A;  2W3F A;  4EQ1 A;  3MXS A;  2W27 A;  4DF6 A;  3KX0 X;  3T4L A;  4KZ5 A;  3F1N B;  4HH3 A;  2Y2I A;  2GDN A;  1E4D A;  3PAG A;  1SKF A;  1L2S A;  2EX9 A;  5EVL A;  2HDR A;  1T1C A;  1BT5 A;  3QP1 A;  5G4Z A;  4OP5 A;  3IF6 C;  1HD8 A;  3EQU A;  3VSK A;  4HBU A;  4JGR A;  5DJT A;  4GZB A;  5L07 A;  5U47 A;  4CJN A;  3MKF A;  1W63 M;  2XEP A;  3HL9 A;  3LIE A;  2VK3 A;  2ZM2 A;  1OT6 A;  4Y0T A;  4OQH A;  3WRT A;  4E3N A;  3V50 A;  2P7J A;  2M7V A;  3HJK A;  5TR7 A;  5HFO A;  2OAP 1;  1K25 A;  4G3W A;  1ES5 A;  1BTL A;  4S2O A;  3QP5 A;  3UE6 A;  4CLC C;  4O0P A;  3F1O A;  4P85 A;  4QHC A;  4U0X A;  3HUO A;  3VMA A;  1ERM A;  3O88 A;  4HJ4 A;  5EOO A;  3A3E A;  1P9R A;  4WL9 A;  1CI9 A;  3ULF A;  2VV7 A;  5LBR A;  4BMW A;  2VGL M;  5M18 A;  1OTI A;  4UA9 A;  3F1P A;  4HES A;  4EES A;  2HDQ A;  1F9I A;  1JWV A;  3U4L P;  4BEN A;  5FAP A;  1K38 A;  2XA7 S;  3IXD A;  1RGY A;  1N9L A;  3WS2 A;  1G6O A;  1LI9 A;  3MZD A;  1K56 D;  4NXG A;  3LFV A;  1CK3 A;  3NHQ A;  2HP5 A;  3R7W A;  1XJ4 A;  1V9Y A;  4O7D A;  5EEC A;  1D06 A;  5F69 A;  4K0W A;  4HNB A;  4QY5 A;  1H8Y A;  3DAV A;  1TDG A;  2DNS A;  1A0K A;  3B42 A;  4WEJ A;  2R9X A;  4JBF A;  2FH5 A;  2ZLY A;  5EM1 A;  2VGJ A;  3A3I A;  4BBV A;  1G68 A;  1LLB A;  1RGZ A;  4PM7 A;  4JLF A;  3RJU A;  1KGG A;  5KZH A;  4N1X A;  1NLZ A;  4DRT A;  4HP4 A;  1J3W A;  5M1A A;  3EWK A;  1IYP A;  4QY6 A;  1S66 L;  4QD4 A;  3E98 A;  3C7U A;  3IXG A;  1V9Z A;  2B95 A;  3HBR A;  4S2I A;  4CPK A;  3HRE A;  1XJ2 A;  4O01 A;  4I3J A;  3MSH A;  4X68 A;  3BQ8 A;  3OZH A;  4E04 A;  2Q9M A;  5DKK A;  3ZVW A;  3H7W A;  2J80 A;  3GQZ A;  1K0K A;  5E2F A;  1PRQ A;  2WGV A;  3ZCZ A;  3W4O A;  3H82 A;  2HJ9 C;  5EFW A;  4RX2 A;  5F82 A;  5I94 A;  5DFX A;  4ZBE A;  3M6B A;  2PD8 A;  4FSF A;  4UAA A;  4OP8 A;  2V9A A;  1HVB A;  1QMF A;  4Z1W A;  2O9B A;  4BWI A;  1ES4 A;  5CEB A;  5TBM A;  4IHQ A;  4P0M A;  3FKV A;  3VP4 A;  4E3J A;  1OTD A;  2W3E A;  3QP2 A;  5CED A;  4L9E A;  1K57 A;  1BLP A;  1CF0 A;  1XA1 A;  3NEC A;  1NXY A;  2ZQD A;  2JBF A;  1H8M A;  2ZD8 A;  1LHY A;  4GDB A;  5G4Y A;  4HY8 A;  2WGW A;  2RCX A;  4IUH A;  3ITA A;  5MC7 A;  1QME A;  2OV5 A;  3G4P A;  3IX4 A;  4E6W A;  4X6T A;  1LT0 A;  1RCJ A;  2L4R A;  2HF6 A;  5GLD A;  4KG6 A;  3UDI A;  2HDS A;  2FFF B;  3N6I A;  1Y28 A;  1PNE A;  5DF9 A;  1YMS A;  1HLU P;  5JYP A;  2V1Z A;  4QJG A;  3B3X A;  3BFG A;  2V0U A;  3EQV A;  4LRZ E;  4GN2 A;  1E25 A;  4FD8 A;  4IJG A;  3FZC A;  5FAS A;  2NUT C;  3S7P A;  4XXR A;  2IA2 A;  1JWP A;  3IXB A;  3IXH A;  4DN0 A;  4D2O A;  4H6J A;  5CXW A;  5HDC A;  1KVM A;  3PBN A;  1EI5 A;  2ZQ7 A;  5AJG A;  1KE3 A;  1H0M A;  3A0S A;  3NDE A;  4ME4 A;  4LGW A;  4QU3 A;  3ZNT A;  2BAS A;  5JYO A;  2W1T A;  5FQM A;  1LL8 A;  4HIA A;  1IOU A;  4LCL A;  3P01 A;  4WZ4 A;  1YLW A;  2H0Y A;  3SH7 A;  3NBL A;  1T1A A;  3BFF A;  3OPH A;  4R3B A;  2C6W B;  1M6K A;  4S2N A;  2P04 A;  1F2K A;  3BEB A;  1PWC A;  2A3U A;  3S7O A;  3IWO A;  3G31 A;  3C8C A;  5F68 A;  2GX5 A;  4RVA A;  1DRM A;  1FIL A;  4JPM A;  3CPT A;  3LEZ A;  1N9B A;  3L7H A;  3HJI A;  3LYX A;  1KDS A;  3PXP A;  4ZJ1 A;  1TS6 A;  2B02 A;  2Y2N A;  2ZC7 A;  4XUZ A;  1ES3 A;  4GS9 B;  1OT9 A;  3F1P B;  1K54 C;  5HDD A;  4K08 A;  2PBD P;  2Q9N A;  4Y2F A;  2Y2O A;  3TOI A;  4R6L A;  2E8J A;  5A8B A;  2C5W B;  1O7E A;  2XFS A;  3W4Q A;  2VZW A;  2WKR A;  3IQA A;  5HAI A;  4B88 A;  3DBA A;  3R7W B;  1T18 A;  1S1Y A;  4PPR A;  5FEF A;  1I5Q A;  3PBO A;  3W2Z A;  3NIA A;  4E6X A;  4YNR A;  2OAQ 1;  5DFY A;  3KSG A;  5HX9 A;  1BSG A;  4PM8 A;  3VE3 A;  1FQG A;  5CHJ A;  3CIT A;  3TG9 A;  5KSC A;  3UE0 A;  4GDN A;  3WS1 A;  2IWD A;  3Q1F A;  3ZQ5 A;  4NET A;  1VEU A;  5L8M A;  4DJ3 A;  5IHV A;  2JE5 A;  5EM0 A;  3WRZ A;  5DJU A;  3JPU A;  4II7 A;  1FSY A;  4OQG A;  1E3U D;  3C38 A;  4PHT A;  4NEE D;  4OON A;  3SS3 A;  4BLM A;  3UDX A;  2P9V A;  1ZHH B;  2W3H A;  3B33 A;  4KZ8 A;  3HLB A;  3TJZ C;  4DXC A;  4KQQ A;  4KG2 A;  2V1B A;  3H7W B;  4JXW A;  1Y54 A;  3OLO A;  3CHW P;  4Q0H A;  2HP6 A;  1PWD A;  3DW0 A;  1SDE A;  2J7V A;  3IS2 B;  3O5Y A;  2BTF P;  3H82 B;  2A2L A;  5FAO A;  1ZKJ A;  3M2J A;  4QB8 A;  2JKR M;  1HZO A;  4JGO A;  2DRW A;  2JKT I;  3MQ0 A;  2V8F A;  5F6A A;  4I3I A;  5TBM B;  1MWT A;  4IVK A;  5EVI C;  3ZNY A;  1UGU A;  2J9P A;  5HDS A;  1PIO A;  1JWZ A;  4KUK A;  3VOL A;  4EQI A;  1UWP X;  4R3A A;  4F94 A;  1ERO A;  4Q0J A;  4BD0 A;  1NYY A;  3G34 A;  3N4I A;  4HOI A;  3SW1 A;  2WGW B;  3MF0 A;  1DJB A;  3Q7V A;  4OPZ A;  2P08 A;  3E4P A;  3N7W A;  4KZ7 A;  4D60 A;  3MXQ A;  2FFY A;  2ZOH A;  3WS4 A;  4X69 A;  4LCM A;  4F3L A;  1H5X A;  3N8S A;  3CZD A;  4BJP A;  1W79 A;  4LFU A;  5FQK A;  4NG2 A;  1LI0 A;  1CEG A;  4PM5 A;  2E8I A;  1Z09 A;  3ZVT A;  5EUA A;  2XGN A;  4CLC D;  4EUV A;  1KVL A;  1MC0 A;  4HJ6 A;  3MQQ A;  4KZB A;  2XA7 M;  1BLC A;  3G6O A;  1S67 L;  3LGO A;  5HPI A;  1FR6 A;  4H6J B;  3Q07 A;  1F5M A;  1JTD A;  2KLI A;  5GLC A;  5J3W A;  5KSH A;  4C3Q A;  2QWS A;  2XDM A;  2W1T B;  3W4P A;  2EX8 A;  2INW A;  4MBF A;  1YLP A;  4ESP A;  3HVF A;  3UB7 A;  1NRF A;  1YKD A;  2Y55 A;  4S2K A;  3FV7 A;  4I39 A;  4R0Q A;  4KQD A;  2XH9 A;  4S2M A;  5F5Y A;  5HD3 A;  4E3I A;  3WWX A;  3FWL A;  2EFX A;  3T4O A;  1K55 A;  3JVV A;  4HJ3 A;  3CPT B;  3UO9 A;  3T12 B;  3KYE A;  3MFX A;  2ACG A;  4Y5F A;  5A90 A;  4Y0U A;  4N92 A;  2K7S A;  5CTN A;  4OPY A;  3SOI A;  2WKE A;  2HPB A;  2OOL A;  4WUJ A;  3G2Y A;  1JNU A;  3UPP A;  2ZM8 A;  3LR4 A;  3PR6 A;  1XXM A;  5EVE A;  2G2U A;  4DDS A;  2Y2H A;  3P09 A;  4GS9 A;  5HW3 A;  4UQI S;  4BL3 A;  1L3L A;  4KZA A;  3BQA A;  4DE3 A;  3PTE A;  1YLT A;  1CEF A;  3OOV A;  1KE4 A;  2ZL1 B;  1GA9 A;  4LV3 A;  3LID A;  4Y15 A;  2WAE A;  1WYB A;  1PYY A;  5EOE A;  5C5K A;  3HLC A;  2EXB A;  3T4Q A;  3BFC A;  3T4T A;  1FCO A;  2GZA A;  4X56 A;  5AQA A;  3RXW A;  3EEA A;  2Z6C A;  1NZO A;  3CAX A;  1BLS A;  4OOM A;  2VJW A;  4GLQ A;  1WA9 A;  3OC2 A;  5AVE A;  2V0W A;  1VEU B;  3PHY A;  3A3D A;  5E2H A;  4HP9 A;  1XFQ A;  3MBZ A;  4WF0 A;  1YSQ A;  3WS5 A;  4I3A A;  3IBJ A;  4LRY C;  4Q8I A;  5A91 A;  3NI9 A;  3MXR A;  4WEK A;  4JGP A;  3Q7Z A;  2P9V B;  2WK0 A;  3N8R A;  4CQH A;  5EV0 A;  4AFI A;  4S2J A;  3OCL A;  5GHY A;  3CUE A;  4JXV A;  5E43 A;  2O9A A;  1S4R A;  3IF5 A;  2CC1 A;  3HLE A;  3C7V A;  5E2E A;  3VP3 A;  1L0F A;  1FR1 A;  3NUL A;  4NXB A;  4GNU A;  4MN5 A;  3K2N A;  1MZU A;  2XD5 A;  2Z2M B;  1E3U A;  3U2A A;  1OJG A;  1DJC A;  3IS2 A;  1OTB A;  4EBN A;  2LB9 A;  1ONG A;  3HLD A;  1PW1 A;  2JN7 A;  3LI8 A;  2QYB A;  1IKI A;  4IBX A;  3CLO A;  3T4J A;  5HAR A;  2WZX A;  1OTA A;  1LSX A;  1MXO A;  3LUQ A;  3GVB A;  4EU0 A;  1CJF A;  3V5M A;  3QP6 A;  1BYW A;  3NDG A;  3Q82 A;  3Q7V B;  1MWR A;  2JKG A;  5A93 A;  1BUL A;  3NC8 A;  3O3V A;  4PAU A;  3DTE A;  1ODV A;  4F3L B;  4P6Z M;  4R70 A;  2AVX A;  2J9O A;  2Y8H A;  1SZV A;  5GHX A;  4HBT A;  3UNW A;  4WZ5 C;  2IWB A;  2V1A A;  1I2S A;  2HP9 A;  2W1R A;  1IYQ A;  4DE0 A;  1LSV A;  4A5R A;  2WZZ A;  3RH8 B;  4B93 A;  3LR0 A;  4X1M A;  1O07 A;  3IF6 A;  4NK3 A;  1GSX A;  3V39 A;  3T4S A;  4KG5 A;  4KUO A;  4EER A;  3LR3 A;  2MJ6 A;  2WGI A;  4KEN B;  3VOY A;  3BFD A;  2J3T C;  4WBG A;  5FSR A;  1N9O A;  3NOP C;  4GHI A;  1GHP A;  1SDN A;  4Y3I A;  1DP8 A;  4CLC A;  4OKP A;  2BG1 A;  1H3Q A;  3ZG0 A;  4WEL A;  4GW9 A;  2WAD A;  4MN6 A;  3VP2 A;  5GLB A;  1K6S A;  2J3W A;  5HAQ A;  4FUW A;  2A49 A;  3BFE A;  4UA6 A;  4R23 A;  2Y2Q A;  3T1X A;  1KE0 A;  4RYE A;  5FDS A;  1SCW A;  1MPL A;  2Q0O A;  3ZYT A;  4P87 A;  2ZQ8 A;  4GJ4 A;  3MJQ A;  2QMI A;  4OOY A;  2G7U A;  3EOI A;  5CTM A;  2K2N A;  4P6B A;  3C30 A;  1BLH A;  1XKZ A;  1YM1 A;  4EXO A;  1DP9 A;  4RX3 A;  2Y59 A;  1GHI A;  3BWL A;  4ZDX A;  4MN7 A;  1TDL A;  3CMZ A;  3ZDJ A;  4KZ4 A;  3UB5 P;  1XP4 A;  1ALQ A;  3QNC A;  1JTG A;  2PD7 A;  4GB7 A;  3NJA A;  1GA0 A;  5AVF A;  3E2K A;  3LIA A;  4M3K A;  3V3S A;  4BQM A;  1YPR A;  3HUN A;  2PR6 A;  3LO7 A;  2H28 A;  1PZO A;  4OVD A;  5FAT A;  3CWF A;  2B5R A;  3ITB A;  4I38 A;  5FL3 A;  3ZG9 B;  1W8Q A;  5AQB A;  2JC7 A;  2YKH A;  3T50 A;  4Y0O A;  1W63 Q;  2GJ3 A;  1EW0 A;  3DTK A;  4CLC E;  4UA7 A;  2Y2J A;  2ZL1 A;  1WYC A;  5FQ9 A;  2HJE A;  5E2G A;  4I5S A;  3NCK A;  2PYR A;  2BLS A;  3LI9 A;  5DKL A;  3V3R A;  1HTZ A;  2M1C A;  4OH0 A;  5TJJ A;  5DF7 A;  1PW8 A;  4E3K A;  1KGE A;  2PU2 A;  3SH8 A;  2K31 A;  5EVI D;  3VSL A;  1DY6 A;  4DMZ A;  2LB5 A;  2VV8 A;  1PZP A;  1PI5 A;  3VV4 A;  1XFN A;  2R78 A;  4EBL A;  3LR5 A;  3JYI A;  3G30 A;  2Y2K A;  4KZ3 A;  3UDF A;  5BOH A;  4U3T A;  3TE8 A;  4ETZ A;  3BY9 A;  4MDZ A;  1L0D A;  1FOF A;  3E0Y A;  2ZC5 B;  4L9F A;  1XJ6 A;  3OCN A;  4DXB A;  4HI4 A;  1FCM A;  5CEC A;  2X02 A;  3G2Z A;  3IHB A;  4B4Z A;  3PBQ A;  3IX3 A;  2O9C A;  4UHU A;  1VQQ A;  4QPR A;  5KIZ A;  4WN5 A;  3P98 A;  4MBH A;  3S7Q A;  2PR5 A;  3HLG A;  4Z9Q A;  4OQ0 A;  1BUE A;  1JVJ A;  3FKW A;  4LPZ A;  3A3F A;  3K3C A;  4GD6 A;  3G35 A;  5HL1 A;  1TS8 A;  4JXS A;  3HUM A;  5DTK A;  2EA9 A;  1L0E A;  4X1L A;  3E2L A;  2QPN A;  5HSQ A;  1S6R A;  2GNX A;  1SHV A;  5IU1 A;  4IBR A;  1IKG A;  1K4F A;  1GSV A;  1S1Z A;  3VFH A;  1DJA A;  3IX8 A;  2WAF A;  4O8G A;  4RQ9 A;  3S7N A;  2WKI A;  1IFQ A;  5EPH A;  3BLM A;  1EWZ A;  4ETX A;  3EGX C;  1GCE A;  1S4S A;  1TVF A;  2ZC6 B;  2ZQC A;  5HZH A;  3IF6 B;  1U60 A;  3BEC A;  1D1J A;  4GKU A;  1L0G A;  1G5U A;  2VGK A;  4BL2 A;  2H5S A;  4GHI B;  3C4O A;  3GRJ A;  2M7U A;  3UPO A;  4X53 A;  1I2W A;  4K0X A;  4CLC B;  1TS0 A;  2D01 A;  3GEC A;  5IT5 A;  3FPW A;  1LL5 A;  2QHK A;  3AGD A;  3QP8 A;  2FZ0 A;  1P0Z A;  4R4S A;  1K57 C;  1Z6F A;  4PM9 A;  4ARZ B;  4YIN A;  2WYX A;  1ERQ A;  1MBL A;  4GOG A;  4JF4 A;  2VKS A;  1NJ4 A;  1ACF A;  3IH9 A;  3PBT A;  3ZFZ A;  1YAX A;  4JKT A;  4LRX C;  1K54 A;  2Y4A A;  4N1H A;  4JF5 A;  1K4E A;  1CQA A;  1K6R A;  3SS5 A;  4NXE A;  1PWG A;  4JF6 A;  4N9K A;  2VLG A;  3S4X A;  5HPF A;  3E4O A;  5J8X A;  1N9N A;  4S2P A;  4BBT A;  1FCN A;  1X0O A;  2Y91 A;  4Y7P A;  1N4O A;  1NYM A;  5CRF A;  4EUZ A;  4LV2 A;  3ZG5 A;  1ZC2 A;  4WYY A;  2ZBB A;  4WM9 A;  2PAV P;  2B18 A;  4MBK A;  4DDY A;  4MEZ A;  1VET B;  3A3J A;  1ESU A;  5F83 A;  2XRO A;  1YSP A;  2JKT M;  3MQO A;  5CHU A;  1NY0 A;  3BLS A;  3LIF A;  1S0W A;  3FG8 A;  4U0T A;  3GR2 A;  3NOT C;  2XK1 A;  1YLY A;  4Q0I A;  5A92 A;  1YT4 A;  4OLG A;  2Z2L B;  5F1G A;  1NZU A;  3P7N A;  3VOZ A;  2ZJ9 A;  2UV0 E;  3ZG8 B;  2WKH A;  4YWZ A;  1CI8 A;  3DWK A;  1WE4 A;  4GCZ A;  4UEY A;  4R3J A;  4OQI A;  3D72 A;  3SH9 A;  2OSU A;  2QKP A;  4R38 A;  4S2N C;  3UE3 A;  3UB6 A;  4M4X A;  2DCF A;  4LEN A;  4MNR A;  1RP5 A;  2G2W A;  2PT7 A;  5L2F A;  3UB9 A;  1YLJ A;  3JVU A;  4DE2 A;  4ZAM A;  2W0N A;  3V67 A;  3E4Q A;  2X01 A;  3S1Y A;  2XSS A;  1GHM A;  1ES2 A;  1SKO B;  2OWH A;  4JXG A;  3O87 A;  4X25 A;  3TSG A;  2KX6 A;  3OPP A;  1OME A;  4KQR A;  4B9O A;  3D3O A;  3I7J A;  3DTI A;  3KSF A;  2UWX A;  5L10 A;  1ONH A;  1OJ5 A;  2HZ5 A;  3OPR A;  4XT2 B;  5EVI A;  3LCE A;  4L9G A;  5FA7 A;  5M19 A;  5DVA A;  4MCW A;  2EWW A;  4X55 A;  2OLU A;  2V2F F;  4EWF A;  5HWV A;  2H10 A;  5AQ9 A;  2ZM0 A;  3S22 A;  1FSW A;  1D7E A;  2ZMV A;  4H8R A;  3GMW A;  3KSH A;  3CJM A;  5FQJ A;  5CHM A;  1W8Y A;  3NY4 A;  3FC7 A;  3IBR A;  2Y2G A;  2J3T D;  1OPX A;  3SZT A;  3PAE A;  1XX2 A;  4EET B;  2ZC4 B;  2IWC A;  1Q2Q A;  2DMW A;  1STZ A;  1P97 A;  5HL6 A;  4EEU A;  3TRC A;  4EEP A;  2WUQ A;  4JGQ A;  1TS7 A;  2VGL S;  4Y17 A;  3C5A A;  2A24 A;  3MMH A;  3QNB A;  4ZJ2 A;  2VV6 A;  5IS1 A;  4WMC D;  2HGV A;  3H9W A;  3EGD C;  4PM6 A;  5I5L A;  1IEL A;  3BY8 A;  1YLZ A;  4G3K A;  3KYQ A;  3MS6 A;  4Y13 A;  4OLD A;  4BBU A;  1XGJ A;  3T1Q B;  3IHA A;  3MFD A;  2Z6D A;  3LIB A;  3PBR A;  3A0R A;  3M2K A;  2VEA A;  5J4E A;  1XGI A;  5HWT A;  3IH8 A;  3EEH A;  4WLA A; 
#chains in the Genus database with same CATH homology
 2AVX A;  4Y13 A;  3IX3 A;  3IX4 A;  3JPU A;  5L09 A;  3QP1 A;  4Y17 A;  2UV0 E;  3QP2 A;  3QP6 A;  2Q0O A;  3QP5 A;  3QP4 A;  1H0M A;  3IX8 A;  4LGW A;  5L07 A;  1L3L A;  3QP8 A;  3SZT A;  5L10 A;  4LFU A;  4Y15 A;  4NG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...