4A5RA

Crystal structure of class a beta-lactamase from bacillus licheniformis bs3 with tazobactam
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
257
structure length
257
Chain Sequence
KDDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVVKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Class a Beta-Lactamase from Bacillus Licheniformis Inhibited by Tazobactam
rcsb
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
total genus 88
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4a5rA00
3M2JA 2ZM2A 4IBXA 1XPBA 5CTNA 4HBUA 2G2UA 2UWXA 4KZ5A 1K57C 2VGJA 3UDXA 4LV2A 1GA0A 4KQRA 1G6AA 2P9VB 3C4PA 4GN2A 4JXGA 3ZG0A 1YQSA 1ESUA 4D2OA 4FD8A 1K4FA 1XKZA 1TDGA 3GQZA 1BT5A 3OCLA 1XA1A 3HUMA 3SH7A 2Y2JA 2ZM0A 5M18A 2PBYA 4NK3A 4OPRA 4WZ4A 5DF7A 5FAOA 4WELA 3V5MA 1LI9A 4U0XA 3VOZA 3W4OA 5EVLA 3UE3A 3ZG8B 3OPLA 1JWVA 4X53A 2Q9NA 3WS4A 3ZNTA 4BQMA 4PM7A 2XK1A 2ZD8A 3C4OA 4S2LA 3MBZA 4JKTA 2Y2MA 5FI6A 4OH0A 3VFHA 5KMWA 4LV0A 3M6HA 2Y55A 5FQMA 5CXWA 3UN7A 4ID4A 1HZOA 4N92A 1E3UD 2ZQ9A 3DTMA 3O3VA 1IELA 3NCKA 2H10A 2V1ZA 5JYPA 4QD4A 1VM1A 3GRJA 3NIAA 4NETA 2X71A 5E43A 1KVLA 5TFQA 1EWZA 1YMXA 5TGFA 3IF6A 3BFDA 5A93A 1Q2PA 1BLCA 2WAFA 1XP4A 3OC2A 1IYQA 2EFXA 4P85A 4ZBEA 4KG6A 4ZAMA 3V3RA 1HVBA 4DF6A 3GTCA 5F82A 4HBTA 1XX2A 1G68A 5GLAA 1YLTA 3HBRA 3OPPA 3LY4A 3IXHA 4FH4A 1IYOA 4MNRA 4C6YA 4JF4A 2ZC3B 4KG2A 4X55A 5CHJA 5FAQA 4OOLA 5CGSA 1KGFA 4QU3A 1W7FA 1YMSA 4Y0OA 3TOIA 3G2ZA 4IBRA 1ERQA 4R1GA 5FASA 3NBLA 2WADA 3DWKA 3CG5A 1PZOA 1O07A 1DJBA 2EX8A 4ZTKA 2GDNA 3BLMA 1W5DA 1K38A 4HEFA 4L0LA 1JTDA 4CPKA 4OVDA 4S2NA 5DVAA 2G2WA 2PU2A 3CJMA 3O87A 5F1FA 1JWPA 2JBFA 4OP8A 4XXRA 5E2FA 2Y2NA 5EVIC 1KDSA 2WK0A 2Z2LB 2ZM8A 1MPLA 1GCEA 4XUXA 2WKIA 4QB8A 1M6KA 4DE3A 2XR0A 3TSGA 4LCLA 1NXYA 1MWUA 1I2WA 1EI5A 4LCMA 2EX2A 1Y54A 1K55C 2WUQA 4S2OA 3MZDA 3Q7VA 4UHUA 5EVIA 2H0TA 3M2KA 3LY3A 1MKIA 2XFTA 1GHIA 3MFDA 1TEMA 4JF6A 4UAAA 5FQJA 5KZHA 2R9WA 5U47A 4O7DA 3E2KA 1FSWA 2XFSA 2XGNA 1NY0A 2ZC6B 4ZJ2A 3OPHA 3VP4A 1K4EA 3PBOA 5A90A 2OV5A 5J8XA 4B4XA 4GKUA 4JPMA 3Q82A 4N1HA 3S4XA 3SS5A 2Y2QA 3G31A 4E3OA 3WWXA 2WKEA 3RXWA 4ZJ3A 4DXCA 1PWDA 4K91A 3WS2A 3MKFA 2V20A 1H8ZA 1PIOA 3FKWA 4PM8A 1XXMA 1MWTA 2ZQCA 2J9PA 3D4FA 4P0MA 4E3JA 2B5RA 1ESIA 4GDNA 4RA7A 4RX2A 4GOGA 4QHCA 2R9XA 4R0QA 4N9LA 3HLEA 4LENA 4GD6A 1Z6FA 1YT4A 3IH9A 3UE1A 3VP3A 1XGIA 1KDWA 4S2NC 3VFFA 3N6IA 3G30A 2Y2LA 4KZ7A 5A92A 1PW1A 3A3EA 3B3XA 5IHVA 1EROA 1K55A 2OLUA 3W8KA 4E3IA 4LV1A 5G18A 4C75A 2QMIA 2Z2MB 3V39A 1HD8A 2E8IA 4PM9A 5CEDA 1KVMA 3WS0A 2ZC5B 4PM5A 3W4QA 2C6WB 2EXAA 1N4OA 2HDUA 1AXBA 5GL9A 2HP5A 5DF9A 5DF8A 3VSKA 4K0XA 4OPYA 1ZC2A 5AQBA 5CECA 4GNUA 2Y2IA 1MBLA 2HP6A 4LV3A 4A5RA 3CMZA 1ES4A 1H8YA 4IVKA 1LLBA 4YFMA 4OLDA 3WS5A 4N1XA 1KE4A 1K57A 1MWRA 2QPNA 3ZCZA 1ZG6A 4K0WA 4WZ5C 3IF6C 4OONA 1SDEA 1YLJA 3IWIA 3W4PA 4M3KA 3A3JA 4WEJA 2C5WB 3PTEA 2IWDA 3FZCA 5JYOA 2ZJ9A 4UA9A 3IT9A 5L2FA 2Y2KA 3ISGA 4WZ5A 5A91A 4DKIA 4EBPA 4UA6A 3M6BA 2DCFA 4OPZA 1IYPA 2IWBA 1YLPA 3G4PA 4QY6A 4EWFA 3NI9A 5FQIA 3ZHHA 1L2SA 4Z9QA 1FCMA 3G34A 3BRMA 1CI8A 3ZG5A 1GHMA 5FQKA 4KQQA 5F83A 2WAEA 4JXWA 1PYYA 4E3NA 4ZJ1A 2Y4AA 3FYZA 5E2GA 4S2PA 3IXBA 1BTLA 1YM1A 3MKEA 4MBFA 4QJGA 3SS4A 4ZDXA 4WMCD 1WYBA 3EQVA 3C7VA 1NRFA 3MZFA 3BM6A 1MWSA 2EFUA 2XD1A 3HLBA 4R4SA 3A3IA 4X56A 1OMEA 4R4RA 2OLVA 4WBGA 3LEZA 4BL2A 3LCEA 3GR2A 3QHYA 1RCJA 4EQIA 4S2JA 3JYIA 3GMWA 3N7WA 2QZ6A 3VP2A 1PI4A 5HX9A 2OSUA 4EBLA 3AGFA 3DWZA 1M40A 2P9VA 4IVIA 1CK3A 2JE5A 4MBHA 3IHAA 1HTZA 4EUZA 2ZC4B 4OPQA 4WMCA 1ZG4A 3S1YA 4PM6A 1S6RA 1GHPA 3HLFA 1SCWA 1BUEA 5AQ7A 1WYCA 5HFOA 1GA9A 2VGKA 2XLNA 4S2IA 1IKIA 1K6RA 5GHYA 1K56A 3VSLA 5TR7A 1FQGA 3UPOA 2WGIA 1FSYA 5EVID 1ONHA 1K54C 3V3SA 5HL1A 2XD5A 3BECA 1ES5A 1L0DA 1NJ4A 2H5SA 2V2FF 3I7JA 1ERMA 2Y2OA 3P09A 2WKHA 2JCHA 4KZBA 3SOIA 3UDFA 3IWQA 2J8YA 4JF5A 4BJPA 2ZLYA 3O88A 3HLWA 5E2EA 1LHYA 3IXDA 1E3UA 5CERA 3IF6B 3IF5A 5EOEA 3IWOA 3SH8A 5KSCA 5CHMA 3ZG7B 2X01A 5GHXA 2I72A 5I94A 3A3FA 5CHUA 3UY6A 1FOFA 3P98A 1U60A 1N9BA 2Y2PA 3HLCA 3G32A 3Q81A 4WEKA 3DW0A 3TG9A 2WZZA 1NZOA 2HPBA 4Q8IA 1QMFA 1FR1A 4DDSA 3E2LA 1E4DA 4C3QA 2DRWA 1SHVA 5FAPA 2BG1A 5EE8A 2Y91A 4KENB 3VMAA 2FFYA 4KZAA 3UE0A 2JC7A 5CRFA 1H5XA 2Y59A 3SS3A 5HW3A 3UPPA 3BFCA 4PMAA 4E3LA 2IWCA 3PBQA 1KE3A 1PW8A 3PBNA 4R3BA 4WYYA 2Y2GA 3OZHA 3ZGAB 1K6SA 3N8LA 4FCFA 4GD8A 2EX9A 1DJAA 4OP5A 1DJCA 2XH9A 1WE4A 5D3OA 4BL3A 1ONGA 1Q2QA 1J9MA 2X02A 3HLGA 3OPRA 4EBNA 4RVAA 3BEBA 5FA7A 4KZ4A 2FFFB 3N4IA 4OLGA 1L0GA 3NDEA 4GB7A 5DTTA 3O86A 3MZEA 4S2MA 4U0TA 2ZQDA 2EX6A 1K25A 2DNSA 3VOYA 1O7EA 4KZ9A 5CGXA 5F1GA 1CI9A 4OQGA 4OOMA 4FH2A 4DDYA 4QY5A 2BLSA 4BENA 1C3BA 4E3KA 1E25A 1IEMA 3FWLA 5AQAA 4KZ6A 3UPNA 4RYEA 3GSGA 4X6TA 2H0YA 3AGDA 3NDGA 1QMEA 4IEDA 4EV4A 1BLPA 1FCOA 4KZ8A 3OCNA 2J7VA 4S2KA 4E6XA 1ES2A 3PBSA 4OQIA 5DTSA 3Q7VB 5EVIB 2XDMA 5EPHA 3PAEA 2WGVA 1DY6A 2CC1A 1IKGA 2A49A 3Q7ZA 4P6BA 2Q9MA 4JXVA 5E2HA 5FQ9A 2RCXA 2P74A 1CEGA 3IXGA 2A3UA 4BD0A 1IYSA 2HDSA 1RGZA 4GDBA 5CGWA 2PU4A 1CEFA 3ZG9B 5AQ9A 3BLSA 3NC8A 2WGWB 1RGYA 3BFGA 1JWZA 4KQOA 5EECA 3SH9A 3WRZA 1W8QA 4E3MA 4KG5A 1LI0A 3PBRA 4PPRA 3CZDA 4JLFA 3WS1A 1ES3A 4OQHA 1XGJA 2ZC7A 3FKVA 1YLZA 4WM9A 5GLCA 2ZQ7A 4JXSA 3ZNYA 1BZAA 3PAGA 4GZBA 2HDQA 2WZXA 4MEZA 4MLLA 4Y7PA 3NY4A 1I2SA 3ZVTA 4DXBA 2J9OA 1PWCA 2ZQAA 5HARA 3EQUA 3ZFZA 3FV7A 4R3JA 1KGGA 1NYMA 4DE1A 3GVBA 1PI5A 4X69A 2XF3A 2ZMAA 3HVFA 3G35A 5HAPA 1ZKJA 1YLYA 3UO9A 5DTKA 3BFFA 4XUZA 1BLHA 3ZDJA 1PZPA 1YLWA 4R23A 5HAQA 3HREA 2EXBA 4YINA 1XA7A 4BD1A 5FATA 2WGWA 1SDNA 1NYYA 3IH8A 5M1AA 3PBTA 3VP0A 1NZUA 1JTGA 1PWGA 4E6WA 5CTMA 3GV9A 5FQQA 4F94A 1BSGA 4Y0TA 4BLMA 3IQAA 1MXOA 4OOYA 5BOHA 4X68A 4DE0A 2Y2HA 4FSFA 2HDRA 5GHZA 3QNBA 3BFEA 3RJUA 3V50A 1KE0A 3MXSA 5KSHA 2ZQ8A 5EUAA 3UDIA 1BULA 1MY8A 3A3DA 4H8RA 4JBFA 3MXRA 1BLSA 1K56D 1W79A 1L0FA 4N9KA 3RXXA 2XEPA 3C5AA 4DE2A 3IHBA 4P87A 1VQQA 3C7UA 1LL5A 1TDLA 5FI2A 1S0WA 1SKFA 4B4ZA 4HESA 5HAIA 3Q07A 3HL9A 5EOOA 1JVJA 1FR6A 2HP9A 3BYDA 1I5QA 3ITBA 4RX3A 1ALQA 2XQZA 3WRTA 4Y0UA 5M19A 4U3TA 1L0EA 3AGEA 4KZ3A 4CJNA 3HUNA 1FCNA 1KGEA 3N8SA 4MBKA 4OQ0A 4B88A 1K54A 4OKPA 3QNCA 1RP5A 3N8RA 3Q1FA 3G2YA 5GLBA 5FI7A 2WYXA 3VP1A 1W8YA 5FDHA 3HUOA 3ITAA 3UNWA 3ZVWA 3LO7A 5GLDA 4DRTA 2RL3A 1LL9A 4UA7A 5FSRA 5CEBA 3S22A 1TVFA 3HLDA
chains in the Genus database with same CATH superfamily
1JNUA 2ZM2A 4IBXA 4HBUA 2G2UA 3DTKA 2VGJA 2GZAA 2P9VB 3ZG0A 4HOIA 1YQSA 3KYZA 5IU1A 4GJ4A 1K4FA 1OTEA 1XA1A 3SH7A 2ZM0A 2PBYA 4HHDA 5DF7A 2QJ5A 3W4OA 4WELA 3VOZA 2M7UA 3NOTC 4Q0JA 2GNXA 3UE3A 5G4ZA 3WS4A 2Z6CA 4PM7A 3MBZA 5KMWA 4OH0A 1PNEA 2Y55A 3LIBA 1HZOA 4N92A 3EEAA 3T1SA 1IELA 3C8CA 2H10A 1ZHHB 2WKRA 4QD4A 3NIAA 2X71A 5E43A 1EWZA 1YMXA 5TGFA 3OC2A 2EFXA 4P85A 3V3RA 1HVBA 1XX2A 5A8BA 5GLAA 3VOLA 4YNRA 4C6YA 4NXGA 2ZC3B 5FAQA 5CGSA 1W7FA 1YMSA 5AVFA 3TOIA 2P08A 1ERQA 4R1GA 5FASA 1N9OA 2INWA 3CG5A 1PZOA 1O07A 4WF0A 3OLOA 1W5DA 4CPKA 2G2WA 2PU2A 2JBFA 5EVIC 2Y2NA 4E3MA 2WK0A 1F9IA 1MPLA 3UB8A 4DE3A 2XR0A 4LCLA 1NXYA 1I2WA 1K55C 5F5YA 2H0TA 3KO6A 3M2KA 3C2WA 1GHIA 3MFDA 2J80A 5U47A 1NY0A 2ZC6B 4ZJ2A 1K4EA 2Y79A 3S4XA 2Y2QA 4E3OA 1S66L 2WKEA 1PWDA 3WS2A 3FKWA 2J9PA 4P0MA 1ESIA 3CITA 4CLCE 4QHCA 1NWZA 3HLEA 4N9LA 1P9RA 1N9LA 3C30A 3VP3A 1XGIA 1XFQA 4KZ7A 1PW1A 3CUEC 3B3XA 3S7OA 2OLUA 3ZQ5A 4E3IA 3V39A 2E8IA 4PM9A 5CEDA 2VX8A 5FEGA 1KVMA 3WS0A 2C6WB 2HP5A 4K08A 2KLIA 4K0XA 4OPYA 1TS7A 4GNUA 2Y2IA 1MBLA 1T1CA 4LV3A 4IHQA 3ZCZA 1ZG6A 4K0WA 5EM0A 5EVEA 5JYOA 4UA9A 3MQQA 4LRXC 3ISGA 4UA6A 3R4KA 4OPZA 3E98A 3ZHHA 3KSFA 3H82B 2O99A 2XRNA 3BRMA 1CI8A 4LFUA 1GHMA 4KQQA 5F83A 4CLCA 3LR4A 1BTLA 1YM1A 3RH8B 3SS4A 4ZDXA 2GX5A 3MZFA 4R4SA 4EETB 2VV6A 3A3IA 4PKYA 2OLVA 3LEZA 3LCEA 3GR2A 4Q0IA 4ETZA 5HWWA 2QKPA 2J3TC 3VP2A 4LGWA 2QWSA 1M40A 2P9VA 1D06A 4UQIM 2ZC4B 3S1YA 1NLZA 2ZL1A 1IKIA 1GSXA 1FSYA 1VETA 3EEHA 2Y8HA 4CLCC 4KZBA 1D1JA 4HP4A 2ZLYA 2K2NA 1LHYA 5CERA 1T19A 3IWOA 3VE4A 5KSCA 3ZG7B 3KX0X 2Q0OA 3MR0A 3HLCA 3DW0A 3UB9A 4ARZA 2WZZA 1QMFA 2QJ7A 4DJ3A 3C38A 4KENB 3UPPA 3BFCA 1W63Q 2EWVA 1KE3A 4R3BA 3MMHA 3LIEA 3OZHA 3JVUA 3N8LA 5L09A 2EX9A 4P6ZS 1DJAA 3L9KA 1OTAA 4OP5A 2XH9A 3K3DA 3HLGA 3OPRA 4WUJA 1CQAA 2ACGA 4GB7A 2LB5A 3PHYA 2W3DA 4HNBA 1IFQA 3E4QA 1O7EA 5CGXA 5F1GA 4DDYA 2W1TB 3IX3A 4E3KA 1IEMA 3FWLA 5AQAA 1VEUA 2W27A 4X6TA 3BJNA 3BQAA 3NDGA 1QMEA 4X1MA 3TJZC 5HPIA 3OCNA 2BTFP 2J7VA 3QP4A 3KSIA 4E6XA 5EVIB 5EPHA 2GJ3A 4RQ9A 1IKGA 5E2HA 1LL8A 3H7WB 5EFWA 2RCXA 5FQ9A 3V67A 1IYSA 2K31A 2PU4A 1CEFA 3ZG9B 3A0SA 2WGWB 5IT5A 4JGRA 4PPRA 2V1BA 3WS1A 4HJ4A 4WM9A 5GLCA 3ZNYA 1BZAA 4GZBA 2HDQA 2WZXA 3K3CA 4DXBA 4DJ2A 1NYMA 1PI5A 2OWJA 2XF3A 3HVFA 3G35A 4GLQA 1YLWA 2FZ0A 2XA7M 1TS6A 5DKLA 3VP0A 3PBTA 1JTGA 1DP6A 3GV9A 4F94A 4Y0TA 5TJJA 1DRMA 2HV1A 3IQAA 1MXOA 5HD3A 3T12B 1S1YA 4FSFA 1VEUB 2D01A 3MXSA 3A0VA 5KSHA 3A3DA 3W2ZA 3UB7A 1BLSA 1OTIA 4F3LA 1YSQA 1UWPX 4B4ZA 4ME4A 3LIAA 3HL9A 1LSXA 1JVJA 1FR6A 4LRZE 3H82A 4U3TA 4MCWA 1P0ZA 3HUNA 4MBKA 4B88A 2JKFA 2WYXA 1W8YA 3HUOA 3HCYA 5GLDA 4UA7A 5F6AA 4HJ3A 5CTNA 5I5LA 4O01A 4LV2A 3HJKA 1GA0A 3KSGA 1ESUA 3UB6A 4FD8A 4BBVA 3HUMA 5EM1A 3CLOA 4WZ4A 4NK3A 4OPRA 5HDSA 1L3LA 4U0XA 4QWOA 5EVLA 3F1OA 3OPLA 1JWVA 2Q9NA 4BQMA 2M7VA 4S2LA 3VFHA 2Y2MA 4LV0A 3LR5A 3IS2B 5FQMA 2VKSA 3MF0A 1E3UD 3O3VA 1WA9A 3HJIA 4MN5A 2G7UA 1VM1A 3GRJA 4NETA 3BY8A 5TFQA 2VZWA 4O8GA 3LIDA 4Y5FA 5F82A 3FPVA 3HBRA 3OPPA 3IXHA 1IYOA 3CWFA 4Y15A 2K7SA 1KGFA 4Y0OA 2VJWA 3G2ZA 4IBRA 1S4RA 1GSVA 5J4EA 2EX8A 2GDNA 4R38A 3BLMA 1UGUA 4BBTA 3NOPC 5DVAA 1SKOA 3BWLA 2P7JA 4OP8A 4XXRA 5E2FA 1L0GA 1GCEA 4I3IA 3NULA 3TSGA 4EERA 1EI5A 3RFBA 2EX2A 1Y54A 4L9EA 4UHUA 4UEYA 5EVIA 3NECA 2XFTA 5KZHA 4M4XA 1FSWA 3OPHA 2OV5A 4JPMA 4G3WA 4EQ1A 4Y17A 4D60A 2V0UA 5DKKA 1H8ZA 2W1TA 1XXMA 4E3JA 3E4OA 1IOUA 3ICYA 2R9XA 1TS8A 4MN6A 1XJ6A 3VFFA 3N6IA 2Y2LA 3LUQA 3QP1A 3W8KA 5G18A 2QMIA 2CMNA 1HD8A 4HIAA 2HDUA 1N4OA 2EWWA 1AXBA 5GL9A 3JPUA 5AQBA 4EU0A 2VEAA 2HP6A 4A5RA 1LLBA 4KQDA 1MWRA 3IF6C 4PHTA 1SDEA 1YLJA 2WKQA 3A3JA 1VHMA 3FZCA 2ZJ9A 3T4KA 3IT9A 3LICA 4HH3A 2KX6A 4EBPA 3M6BA 2DCFA 2O9AA 2OAQ1 1YLPA 4EWFA 3NI9A 4Z9QA 5FQKA 1PYYA 2PBDP 3MKEA 2ZOIA 3EQVA 3C7VA 3E4PA 1CF0A 4HJ6A 2KDKA 1ODVA 1OMEA 4R4RA 4WBGA 1RCJA 1PI4A 3UB5P 4EBLA 3AGFA 2UV0E 4DMZA 4IVIA 3IHAA 3NHQA 4WMCA 4PM6A 3SW1A 3HLFA 1BUEA 5AQ7A 4Y13A 5HFOA 5GHYA 4YWZA 4S2IA 3QP2A 1K6RA 1K56A 2YKHA 1V9ZA 3VSLA 1OPXA 2WGIA 3CPTB 1TF1A 3E0YA 1K54C 5HL1A 1L0DA 3GDIA 3I7JA 2Y2OA 2WKHA 2JCHA 3O88A 3IXDA 3IF5A 3UE6A 2L4RA 1OTBA 2QHKA 3SH8A 2X01A 5GHXA 1MKMA 2I72A 4BWIA 3UY6A 1ACFA 1FOFA 3CUEA 4WEKA 5DJTA 1FILA 3E2LA 3MFXA 1G28A 4C3QA 2DRWA 2BG1A 5KIZA 2Y91A 3UE0A 4PMAA 4E3LA 3PBQA 3KYQA 1K6SA 1P97A 4FCFA 4B9OA 4HY8A 1J9MA 4EEPA 3BEBA 5FA7A 4KZ4A 2FFFB 2JN7A 5DTTA 4U0TA 1LT0A 2ZQDA 5F68A 3VOYA 2A24B 2VGLM 4FH2A 3GECA 5DJUA 2BLSA 3IBRA 1E25A 2DMWA 3UPNA 3GSGA 4CLCD 5FDSA 4GS9B 1BLPA 1FCOA 2O0YA 4OQIA 3PBSA 3Q7VB 2XDMA 2WGVA 1EW0A 1STZA 4P6BA 3T4TA 3Q7ZA 2Q9MA 4JXVA 2A3UA 1NRJA 2JHEA 4GDBA 5CGWA 1Z09A 3NC8A 4UQIS 4ETXA 3PBRA 4G3KA 4H6JB 3LYXA 2P04A 2ZC7A 1YLZA 4NXFA 3T1RA 1I2SA 2J9OA 2ZQAA 5HARA 3EQUA 1KGGA 4X69A 3QP6A 3B33A 3PYPA 1BLHA 1H3QA 4YINA 1XA7A 2WGWA 3RTYA 5M1AA 5CTMA 3F1OB 4CLCB 4X68A 4HI4A 5GHZA 1KE0A 5EUAA 3TRCA 3MXRA 4GS9A 1K56D 3RXXA 2XEPA 4R6LA 4P87A 4FTXA 3EWKA 1LL5A 3JVVA 4HESA 4MMNA 1ALQA 3BW6A 2OOLA 2XQZA 3AGEA 1FCNA 3CHWP 5GLBA 1XFNA 5FDHA 3UNWA 4DRTA 5CEBA 4FOFA 2UWXA 3UDXA 4KQRA 3H9WA 1G6AA 3C4PA 4GN2A 5IS1A 3D72A 1TDGA 3GQZA 1BT5A 3OCLA 3V5MA 3ZG8B 4B93A 4X53A 3ZNTA 3C4OA 2ZD8A 3G6OA 3M6HA 3UN7A 4ID4A 3DTMA 3NCKA 2W3EA 3MS6A 3IF6A 2JKTM 3BFDA 1Q2PA 5J3WA 2WAFA 3LR3A 1IYQA 3T4OA 1FIKA 4ZBEA 4ZAMA 4DF6A 3GTCA 4HBTA 3MQOA 3LY4A 4KG2A 4X55A 2PRFA 4OOLA 3T50A 4NG2A 1S67L 2R78A 2PDRA 2WADA 2FH5A 3DWKA 1DJBA 3S7PA 4ZTKA 1K38A 4L0LA 1NLYA 1JTDA 4XT2A 4OVDA 4S2NA 3D9YA 1BYWA 1LSWA 4QPRA 1KDSA 4XUXA 2V0WA 2WKIA 3F1NA 3NOUC 4G3VA 1S4SA 2JKRI 2WUQA 3MZDA 3Q7VA 1XJ3A 1MKIA 1TEMA 5FQJA 2R9WA 4O7DA 2XGNA 3DAVA 3EGDC 4X1LA 2PD7A 5EV0A 1T1AA 3T4JA 5DFYA 2ZBBA 4B4XA 4GKUA 4N1HA 4FUWA 3SS5A 1H0MA 2O9CA 3IX8A 3RXWA 4BMWA 4DXCA 3A0RA 1YSPA 1SZVA 4BBUA 1PIOA 4PM8A 1MWTA 2ZQCA 4GDNA 4ZRRA 2XSSA 4RX2A 4GOGA 2IA2A 4GD6A 4I3AA 1Z6FA 3IH9A 1LSVA 3UE1A 1KDWA 3EGXC 4S2NC 5A92A 3A3EA 1EROA 4E04A 1K55A 3KSHA 4LV1A 4LPZA 2A2LA 2W3GA 3W4QA 2EXAA 5DF8A 5DF9A 3VSKA 4DN0A 1ZC2A 4EUVA 3TW8A 1ES4A 4IVKA 1MZUA 1KE4A 2QPNA 4WZ5C 4OONA 3IWIA 1XJ2A 4M3KA 2C5WB 5L07A 3FPWA 3R7WB 2V9AA 5L2FA 2KOIA 2Y2KA 5A91A 5F69A 1IYPA 2IWBA 3G4PA 1FCMA 3G34A 3MXQA 5E2GA 4S2PA 2O9BA 2EA9A 1WYBA 4II7A 4MDZA 2J3WA 1NRFA 3T4SA 3BM6A 3LR0A 1MWSA 1H8MA 2EFUA 2JKTI 3QHYA 5HWTA 4IJGA 4EQIA 3JYIA 3N7WA 5FEFA 2B95A 2JE5A 4MBHA 1HTZA 2B02A 4OPQA 3QP5A 1OJGA 1GA9A 2XLNA 1G5UA 5HWVA 2LB9A 1FQGA 4R3AA 3UMEA 5EVID 3IS2A 3V3SA 2XD5A 3BECA 1NJ4A 1P9WA 1ERMA 2M1CA 3P09A 2J8YA 5CX7A 4JF5A 3VV4A 4GHIA 4BJPA 3HLWA 5FL3A 5EOEA 5CHMA 5I94A 5CHUA 1U60A 1N9BA 3QP8A 3MJQA 4HQAA 3Q81A 1NZOA 2HPBA 2PT7A 4Q8IA 4YOFA 4DDSA 4WN5A 1SHVA 5FAPA 5EE8A 2FFYA 5CRFA 1H5XA 2Y59A 3SS3A 5HW3A 1SKOB 3L7HA 1UWNX 3PBNA 4WYYA 2Y2GA 4PKYG 4GHIB 3F1NB 1YKDA 1DJCA 4X25A 1WE4A 3B42A 2D02A 4BL3A 1ONGA 1Q2QA 2B18A 4Q0HA 3P01A 3TE8A 4OLGA 3O86A 3MZEA 1A0KA 1K25A 2MJ6A 1CI9A 4OQGA 2W1RA 2L1MA 1XJ4A 4NEED 1F2KA 4KZ6A 3LIFA 1N9NA 3AGDA 4EV4A 4S2KA 1ES2A 3PAEA 2A49A 4BD0A 1RGZA 5AQ9A 1TS0A 3BLSA 1RGYA 1JWZA 3WRZA 3SH9A 4KG5A 1LI0A 3SZTA 4EW7A 1ES3A 1XGJA 3BQ8A 2ZQ7A 3IX4A 4MEZA 4MLLA 4Y7PA 4I38A 1PWCA 3ZFZA 4DE1A 4R3JA 3GVBA 2ZMAA 1ZKJA 3KYEA 1YLYA 4KUKA 3ZYTA 4XUZA 1PZPA 4R23A 3UMDA 1DP9A 2E8JA 5L10A 5FATA 3IH8A 1NZUA 4E6WA 1PWGA 1TVFA 1BSGA 4BLMA 2VGLS 4AFIA 4OOYA 3FC7A 5BOHA 4JGQA 4EESA 2Y2HA 2HDRA 3RJUA 3BFEA 1MC0A 2BASA 2ZQ8A 1VETB 1BULA 3U4LP 1MY8A 1W79A 2I9VA 4N9KA 2PHYA 3C5AA 2AVXA 2XROA 2XA7S 5FI2A 1S0WA 1SKFA 1OTDA 2VV7A 5HAIA 3Q07A 5EOOA 3BYDA 1I5QA 3ITBA 1OT9A 4RX3A 4Y0UA 5M19A 4CJNA 5L8MA 1OJ5A 4OKPA 3QNCA 1RP5A 5FI7A 3ITAA 3ZVWA 2V1AA 3LI9A 4CQHA 1J3WA 3HLDA 1GSWA 3M2JA 1XPBA 4KZ5A 1K57C 1W63M 4JXGA 3O5YA 2ZMVA 1CJFA 4D2OA 1XKZA 1HLUP 2Y2JA 5M18A 5FAOA 1LI9A 4ESPA 3DTIA 2XK1A 5FI6A 4JKTA 5CXWA 4KUOA 5HSQA 3LEQA 4EXOA 2ZQ9A 3U2AA 2V1ZA 5JYPA 5HDCA 1OT6A 5HDDA 1KVLA 4I5SA 3R7WA 5A93A 3T4LA 1BLCA 1XP4A 3NJAA 4KG6A 2VK3A 1G68A 1YLTA 1F5MA 4FH4A 4MNRA 4JF4A 4MN7A 5CHJA 4QU3A 3NBLA 4JGOA 4HEFA 4GCZA 3CJMA 3O87A 5F1FA 1JWPA 2PYPA 2Z2LB 2ZM8A 4QB8A 4NXBA 1M6KA 4F3LB 1MWUA 4LCMA 4S2OA 2J3TD 3LY3A 4UAAA 4JF6A 3E2KA 2XFSA 2QYBA 4LRYC 3VP4A 1PRQA 3PBOA 5A90A 5J8XA 3Q82A 2JKGA 3G31A 2HZ5A 3WWXA 4ZJ3A 4K91A 3MKFA 2V20A 2ZMFA 2VLGA 4XT2B 3D4FA 2B5RA 3T1QB 1ZTUA 4RA7A 4R0QA 4LENA 2ZOHA 1YT4A 1YPRA 4I3JA 3G30A 2W3FA 5TBMB 5IHVA 2Z6DA 3MSHA 4P6ZM 4C75A 2Z2MB 1AWIA 2ZC5B 5LBRA 4PM5A 2A24A 5CECA 3CMZA 1H8YA 4YFMA 4OLDA 3WS5A 4N1XA 1K57A 4IUHA 3VE3A 3LGOA 3W4PA 4WEJA 3PTEA 2IWDA 5C5KA 4WZ5A 4DKIA 5G4YA 2PR6A 4L9GA 4QY6A 4I39A 5FQIA 1L2SA 2W3HA 2V8FA 2ZL1B 5HL6A 3DTEA 3ZG5A 2WAEA 4H6JA 4JXWA 4E3NA 4ZJ1A 2Y4AA 3FYZA 2HJEA 3IXBA 3K2NA 3CPTA 3DBAA 4L9FA 4MBFA 4QJGA 1Y4OA 4WMCD 5MC7A 2PR5A 3S7QA 3PXPA 1T18A 4WL9A 3T4QA 2XD1A 3HLBA 4X56A 4BL2A 2HF6A 1TD5A 4S2JA 3GMWA 2QZ6A 5HX9A 2OSUA 3T1XA 3DWZA 4Y2FA 1CK3A 3OBFA 4ARZB 4EUZA 1ZG4A 2OWHA 1S6RA 1GHPA 1SCWA 4PAUA 1WYCA 2VGKA 4NKPA 1Y28A 5TR7A 3UPOA 1ONHA 4O0PA 1ES5A 2V2FF 2H5SA 2JKRM 3B47A 3SOIA 3UDFA 3IWQA 5HZHA 5E2EA 3S7NA 1E3UA 3IF6B 3A3FA 2WKPA 3P98A 2Y2PA 3G32A 4JGPA 3TG9A 2W0NA 1FR1A 2HGVA 5AVEA 1E4DA 4IUKA 4WLAA 3VMAA 4KZAA 2JC7A 3BY9A 3CI6A 1S1ZA 2IWCA 5K5BA 1PW8A 3ZGAB 4GD8A 1X0OA 3CAXA 4EEUA 5D3OA 2X02A 4EBNA 4RVAA 5AJGA 3N4IA 2V8CA 3NDEA 4S2MA 2H28A 1G6OA 2EX6A 2PYRA 2DNSA 4KZ9A 3FG8A 4OOMA 4QY5A 4BENA 1C3BA 2NUTC 3P7NA 4RYEA 4Y3IA 2H0YA 3LFVA 1DP8A 1YAXA 4IEDA 2PAVP 4GW9A 4KZ8A 4NXEA 5DTSA 1DY6A 2CC1A 2P74A 1CEGA 3IXGA 3H7WA 2HDSA 5TBMA 4Z1WA 1PFLA 3BFGA 2L0WA 5EECA 4KQOA 1W8QA 3CZDA 4JLFA 5HPFA 4OQHA 3FKVA 3OOVA 4JXSA 3PAGA 3EOIA 3NY4A 4HH2A 3ULFA 5J7EA 3ZVTA 3FV7A 1KOUA 5HAPA 3UO9A 4HP9A 3D3OA 5DTKA 3BFFA 2HJ9C 3ZDJA 3F1PB 2NUPC 5HAQA 3HREA 2EXBA 4BD1A 1SDNA 1NYYA 1K0KA 5FQQA 2VA0A 4DE0A 3QNBA 3PR6A 4R70A 3V50A 3UDIA 4H8RA 4JBFA 1F98A 1L0FA 4DE2A 3IHBA 1VB6A 1VQQA 3C7UA 1D7EA 1TDLA 3F1PA 1V9YA 3IBJA 2HP9A 2VV8A 3WRTA 5DFXA 1L0EA 4KZ3A 5HD5A 1KGEA 3N8SA 4OQ0A 1K54A 3N8RA 3Q1FA 2YKFA 3G2YA 1T1BA 3VP1A 2PD8A 3MQ0A 3LO7A 2OAP1 1LL9A 2RL3A 5FSRA 3LI8A 3S22A 4LLOB
chains in the Genus database with same CATH topology
3M2JA 2ZM2A 4IBXA 1XPBA 5CTNA 4HBUA 2G2UA 2UWXA 4KZ5A 1K57C 2VGJA 3UDXA 4LV2A 1GA0A 4KQRA 1G6AA 2P9VB 3C4PA 4GN2A 4JXGA 3ZG0A 1YQSA 1ESUA 4D2OA 4FD8A 1K4FA 1XKZA 1TDGA 3GQZA 1BT5A 3OCLA 1XA1A 3HUMA 3SH7A 2Y2JA 2ZM0A 5M18A 2PBYA 4NK3A 4OPRA 4WZ4A 5DF7A 5FAOA 4WELA 3V5MA 1LI9A 4U0XA 3VOZA 3W4OA 5EVLA 3UE3A 3ZG8B 3OPLA 1JWVA 4X53A 2Q9NA 3WS4A 3ZNTA 4BQMA 4PM7A 2XK1A 2ZD8A 3C4OA 4S2LA 3MBZA 4JKTA 2Y2MA 5FI6A 4OH0A 3VFHA 5KMWA 4LV0A 3M6HA 2Y55A 5FQMA 5CXWA 3UN7A 4ID4A 1HZOA 4N92A 1E3UD 2ZQ9A 3DTMA 3O3VA 1IELA 3NCKA 2H10A 2V1ZA 5JYPA 4QD4A 1VM1A 3GRJA 3NIAA 4NETA 2X71A 5E43A 1KVLA 5TFQA 1EWZA 1YMXA 5TGFA 3IF6A 3BFDA 5A93A 1Q2PA 1BLCA 2WAFA 1XP4A 3OC2A 1IYQA 2EFXA 4P85A 4ZBEA 4KG6A 4ZAMA 3V3RA 1HVBA 4DF6A 3GTCA 5F82A 4HBTA 1XX2A 1G68A 5GLAA 1YLTA 3HBRA 3OPPA 3LY4A 3IXHA 4FH4A 1IYOA 4MNRA 4C6YA 4JF4A 2ZC3B 4KG2A 4X55A 5CHJA 5FAQA 4OOLA 5CGSA 1KGFA 4QU3A 1W7FA 1YMSA 4Y0OA 3TOIA 3G2ZA 4IBRA 1ERQA 4R1GA 5FASA 3NBLA 2WADA 3DWKA 3CG5A 1PZOA 1O07A 1DJBA 2EX8A 4ZTKA 2GDNA 3BLMA 1W5DA 1K38A 4HEFA 4L0LA 1JTDA 4CPKA 4OVDA 4S2NA 5DVAA 2G2WA 2PU2A 3CJMA 3O87A 5F1FA 1JWPA 2JBFA 4OP8A 4XXRA 5E2FA 2Y2NA 5EVIC 1KDSA 2WK0A 2Z2LB 2ZM8A 1MPLA 1GCEA 4XUXA 2WKIA 4QB8A 1M6KA 4DE3A 2XR0A 3TSGA 4LCLA 1NXYA 1MWUA 1I2WA 1EI5A 4LCMA 2EX2A 1Y54A 1K55C 2WUQA 4S2OA 3MZDA 3Q7VA 4UHUA 5EVIA 2H0TA 3M2KA 3LY3A 1MKIA 2XFTA 1GHIA 3MFDA 1TEMA 4JF6A 4UAAA 5FQJA 5KZHA 2R9WA 5U47A 4O7DA 3E2KA 1FSWA 2XFSA 2XGNA 1NY0A 2ZC6B 4ZJ2A 3OPHA 3VP4A 1K4EA 3PBOA 5A90A 2OV5A 5J8XA 4B4XA 4GKUA 4JPMA 3Q82A 4N1HA 3S4XA 3SS5A 2Y2QA 3G31A 4E3OA 3WWXA 2WKEA 3RXWA 4ZJ3A 4DXCA 1PWDA 4K91A 3WS2A 3MKFA 2V20A 1H8ZA 1PIOA 3FKWA 4PM8A 1XXMA 1MWTA 2ZQCA 2J9PA 3D4FA 4P0MA 4E3JA 2B5RA 1ESIA 4GDNA 4RA7A 4RX2A 4GOGA 4QHCA 2R9XA 4R0QA 4N9LA 3HLEA 4LENA 4GD6A 1Z6FA 1YT4A 3IH9A 3UE1A 3VP3A 1XGIA 1KDWA 4S2NC 3VFFA 3N6IA 3G30A 2Y2LA 4KZ7A 5A92A 1PW1A 3A3EA 3B3XA 5IHVA 1EROA 1K55A 2OLUA 3W8KA 4E3IA 4LV1A 5G18A 4C75A 2QMIA 2Z2MB 3V39A 1HD8A 2E8IA 4PM9A 5CEDA 1KVMA 3WS0A 2ZC5B 4PM5A 3W4QA 2C6WB 2EXAA 1N4OA 2HDUA 1AXBA 5GL9A 2HP5A 5DF9A 5DF8A 3VSKA 4K0XA 4OPYA 1ZC2A 5AQBA 5CECA 4GNUA 2Y2IA 1MBLA 2HP6A 4LV3A 4A5RA 3CMZA 1ES4A 1H8YA 4IVKA 1LLBA 4YFMA 4OLDA 3WS5A 4N1XA 1KE4A 1K57A 1MWRA 2QPNA 3ZCZA 1ZG6A 4K0WA 4WZ5C 3IF6C 4OONA 1SDEA 1YLJA 3IWIA 3W4PA 4M3KA 3A3JA 4WEJA 2C5WB 3PTEA 2IWDA 3FZCA 5JYOA 2ZJ9A 4UA9A 3IT9A 5L2FA 2Y2KA 3ISGA 4WZ5A 5A91A 4DKIA 4EBPA 4UA6A 3M6BA 2DCFA 4OPZA 1IYPA 2IWBA 1YLPA 3G4PA 4QY6A 4EWFA 3NI9A 5FQIA 3ZHHA 1L2SA 4Z9QA 1FCMA 3G34A 3BRMA 1CI8A 3ZG5A 1GHMA 5FQKA 4KQQA 5F83A 2WAEA 4JXWA 1PYYA 4E3NA 4ZJ1A 2Y4AA 3FYZA 5E2GA 4S2PA 3IXBA 1BTLA 1YM1A 3MKEA 4MBFA 4QJGA 3SS4A 4ZDXA 4WMCD 1WYBA 3EQVA 3C7VA 1NRFA 3MZFA 3BM6A 1MWSA 2EFUA 2XD1A 3HLBA 4R4SA 3A3IA 4X56A 1OMEA 4R4RA 2OLVA 4WBGA 3LEZA 4BL2A 3LCEA 3GR2A 3QHYA 1RCJA 4EQIA 4S2JA 3JYIA 3GMWA 3N7WA 2QZ6A 3VP2A 1PI4A 5HX9A 2OSUA 4EBLA 3AGFA 3DWZA 1M40A 2P9VA 4IVIA 1CK3A 2JE5A 4MBHA 3IHAA 1HTZA 4EUZA 2ZC4B 4OPQA 4WMCA 1ZG4A 3S1YA 4PM6A 1S6RA 1GHPA 3HLFA 1SCWA 1BUEA 5AQ7A 1WYCA 5HFOA 1GA9A 2VGKA 2XLNA 4S2IA 1IKIA 1K6RA 5GHYA 1K56A 3VSLA 5TR7A 1FQGA 3UPOA 2WGIA 1FSYA 5EVID 1ONHA 1K54C 3V3SA 5HL1A 2XD5A 3BECA 1ES5A 1L0DA 1NJ4A 2H5SA 2V2FF 3I7JA 1ERMA 2Y2OA 3P09A 2WKHA 2JCHA 4KZBA 3SOIA 3UDFA 3IWQA 2J8YA 4JF5A 4BJPA 2ZLYA 3O88A 3HLWA 5E2EA 1LHYA 3IXDA 1E3UA 5CERA 3IF6B 3IF5A 5EOEA 3IWOA 3SH8A 5KSCA 5CHMA 3ZG7B 2X01A 5GHXA 2I72A 5I94A 3A3FA 5CHUA 3UY6A 1FOFA 3P98A 1U60A 1N9BA 2Y2PA 3HLCA 3G32A 3Q81A 4WEKA 3DW0A 3TG9A 2WZZA 1NZOA 2HPBA 4Q8IA 1QMFA 1FR1A 4DDSA 3E2LA 1E4DA 4C3QA 2DRWA 1SHVA 5FAPA 2BG1A 5EE8A 2Y91A 4KENB 3VMAA 2FFYA 4KZAA 3UE0A 2JC7A 5CRFA 1H5XA 2Y59A 3SS3A 5HW3A 3UPPA 3BFCA 4PMAA 4E3LA 2IWCA 3PBQA 1KE3A 1PW8A 3PBNA 4R3BA 4WYYA 2Y2GA 3OZHA 3ZGAB 1K6SA 3N8LA 4FCFA 4GD8A 2EX9A 1DJAA 4OP5A 1DJCA 2XH9A 1WE4A 5D3OA 4BL3A 1ONGA 1Q2QA 1J9MA 2X02A 3HLGA 3OPRA 4EBNA 4RVAA 3BEBA 5FA7A 4KZ4A 2FFFB 3N4IA 4OLGA 1L0GA 3NDEA 4GB7A 5DTTA 3O86A 3MZEA 4S2MA 4U0TA 2ZQDA 2EX6A 1K25A 2DNSA 3VOYA 1O7EA 4KZ9A 5CGXA 5F1GA 1CI9A 4OQGA 4OOMA 4FH2A 4DDYA 4QY5A 2BLSA 4BENA 1C3BA 4E3KA 1E25A 1IEMA 3FWLA 5AQAA 4KZ6A 3UPNA 4RYEA 3GSGA 4X6TA 2H0YA 3AGDA 3NDGA 1QMEA 4IEDA 4EV4A 1BLPA 1FCOA 4KZ8A 3OCNA 2J7VA 4S2KA 4E6XA 1ES2A 3PBSA 4OQIA 5DTSA 3Q7VB 5EVIB 2XDMA 5EPHA 3PAEA 2WGVA 1DY6A 2CC1A 1IKGA 2A49A 3Q7ZA 4P6BA 2Q9MA 4JXVA 5E2HA 5FQ9A 2RCXA 2P74A 1CEGA 3IXGA 2A3UA 4BD0A 1IYSA 2HDSA 1RGZA 4GDBA 5CGWA 2PU4A 1CEFA 3ZG9B 5AQ9A 3BLSA 3NC8A 2WGWB 1RGYA 3BFGA 1JWZA 4KQOA 5EECA 3SH9A 3WRZA 1W8QA 4E3MA 4KG5A 1LI0A 3PBRA 4PPRA 3CZDA 4JLFA 3WS1A 1ES3A 4OQHA 1XGJA 2ZC7A 3FKVA 1YLZA 4WM9A 5GLCA 2ZQ7A 4JXSA 3ZNYA 1BZAA 3PAGA 4GZBA 2HDQA 2WZXA 4MEZA 4MLLA 4Y7PA 3NY4A 1I2SA 3ZVTA 4DXBA 2J9OA 1PWCA 2ZQAA 5HARA 3EQUA 3ZFZA 3FV7A 4R3JA 1KGGA 1NYMA 4DE1A 3GVBA 1PI5A 4X69A 2XF3A 2ZMAA 3HVFA 3G35A 5HAPA 1ZKJA 1YLYA 3UO9A 5DTKA 3BFFA 4XUZA 1BLHA 3ZDJA 1PZPA 1YLWA 4R23A 5HAQA 3HREA 2EXBA 4YINA 1XA7A 4BD1A 5FATA 2WGWA 1SDNA 1NYYA 3IH8A 5M1AA 3PBTA 3VP0A 1NZUA 1JTGA 1PWGA 4E6WA 5CTMA 3GV9A 5FQQA 4F94A 1BSGA 4Y0TA 4BLMA 3IQAA 1MXOA 4OOYA 5BOHA 4X68A 4DE0A 2Y2HA 4FSFA 2HDRA 5GHZA 3QNBA 3BFEA 3RJUA 3V50A 1KE0A 3MXSA 5KSHA 2ZQ8A 5EUAA 3UDIA 1BULA 1MY8A 3A3DA 4H8RA 4JBFA 3MXRA 1BLSA 1K56D 1W79A 1L0FA 4N9KA 3RXXA 2XEPA 3C5AA 4DE2A 3IHBA 4P87A 1VQQA 3C7UA 1LL5A 1TDLA 5FI2A 1S0WA 1SKFA 4B4ZA 4HESA 5HAIA 3Q07A 3HL9A 5EOOA 1JVJA 1FR6A 2HP9A 3BYDA 1I5QA 3ITBA 4RX3A 1ALQA 2XQZA 3WRTA 4Y0UA 5M19A 4U3TA 1L0EA 3AGEA 4KZ3A 4CJNA 3HUNA 1FCNA 1KGEA 3N8SA 4MBKA 4OQ0A 4B88A 1K54A 4OKPA 3QNCA 1RP5A 3N8RA 3Q1FA 3G2YA 5GLBA 5FI7A 2WYXA 3VP1A 1W8YA 5FDHA 3HUOA 3ITAA 3UNWA 3ZVWA 3LO7A 5GLDA 4DRTA 2RL3A 1LL9A 4UA7A 5FSRA 5CEBA 3S22A 1TVFA 3HLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M2J A;  2ZM2 A;  4IBX A;  1XPB A;  5CTN A;  4HBU A;  2G2U A;  2UWX A;  4KZ5 A;  1K57 C;  2VGJ A;  3UDX A;  4LV2 A;  1GA0 A;  4KQR A;  1G6A A;  2P9V B;  3C4P A;  4GN2 A;  4JXG A;  3ZG0 A;  1YQS A;  1ESU A;  4D2O A;  4FD8 A;  1K4F A;  1XKZ A;  1TDG A;  3GQZ A;  1BT5 A;  3OCL A;  1XA1 A;  3HUM A;  3SH7 A;  2Y2J A;  2ZM0 A;  5M18 A;  2PBY A;  4NK3 A;  4OPR A;  4WZ4 A;  5DF7 A;  5FAO A;  4WEL A;  3V5M A;  1LI9 A;  4U0X A;  3VOZ A;  3W4O A;  5EVL A;  3UE3 A;  3ZG8 B;  3OPL A;  1JWV A;  4X53 A;  2Q9N A;  3WS4 A;  3ZNT A;  4BQM A;  4PM7 A;  2XK1 A;  2ZD8 A;  3C4O A;  4S2L A;  3MBZ A;  4JKT A;  2Y2M A;  5FI6 A;  4OH0 A;  3VFH A;  5KMW A;  4LV0 A;  3M6H A;  2Y55 A;  5FQM A;  5CXW A;  3UN7 A;  4ID4 A;  1HZO A;  4N92 A;  1E3U D;  2ZQ9 A;  3DTM A;  3O3V A;  1IEL A;  3NCK A;  2H10 A;  2V1Z A;  5JYP A;  4QD4 A;  1VM1 A;  3GRJ A;  3NIA A;  4NET A;  2X71 A;  5E43 A;  1KVL A;  5TFQ A;  1EWZ A;  1YMX A;  5TGF A;  3IF6 A;  3BFD A;  5A93 A;  1Q2P A;  1BLC A;  2WAF A;  1XP4 A;  3OC2 A;  1IYQ A;  2EFX A;  4P85 A;  4ZBE A;  4KG6 A;  4ZAM A;  3V3R A;  1HVB A;  4DF6 A;  3GTC A;  5F82 A;  4HBT A;  1XX2 A;  1G68 A;  5GLA A;  1YLT A;  3HBR A;  3OPP A;  3LY4 A;  3IXH A;  4FH4 A;  1IYO A;  4MNR A;  4C6Y A;  4JF4 A;  2ZC3 B;  4KG2 A;  4X55 A;  5CHJ A;  5FAQ A;  4OOL A;  5CGS A;  1KGF A;  4QU3 A;  1W7F A;  1YMS A;  4Y0O A;  3TOI A;  3G2Z A;  4IBR A;  1ERQ A;  4R1G A;  5FAS A;  3NBL A;  2WAD A;  3DWK A;  3CG5 A;  1PZO A;  1O07 A;  1DJB A;  2EX8 A;  4ZTK A;  2GDN A;  3BLM A;  1W5D A;  1K38 A;  4HEF A;  4L0L A;  1JTD A;  4CPK A;  4OVD A;  4S2N A;  5DVA A;  2G2W A;  2PU2 A;  3CJM A;  3O87 A;  5F1F A;  1JWP A;  2JBF A;  4OP8 A;  4XXR A;  5E2F A;  2Y2N A;  5EVI C;  1KDS A;  2WK0 A;  2Z2L B;  2ZM8 A;  1MPL A;  1GCE A;  4XUX A;  2WKI A;  4QB8 A;  1M6K A;  4DE3 A;  2XR0 A;  3TSG A;  4LCL A;  1NXY A;  1MWU A;  1I2W A;  1EI5 A;  4LCM A;  2EX2 A;  1Y54 A;  1K55 C;  2WUQ A;  4S2O A;  3MZD A;  3Q7V A;  4UHU A;  5EVI A;  2H0T A;  3M2K A;  3LY3 A;  1MKI A;  2XFT A;  1GHI A;  3MFD A;  1TEM A;  4JF6 A;  4UAA A;  5FQJ A;  5KZH A;  2R9W A;  5U47 A;  4O7D A;  3E2K A;  1FSW A;  2XFS A;  2XGN A;  1NY0 A;  2ZC6 B;  4ZJ2 A;  3OPH A;  3VP4 A;  1K4E A;  3PBO A;  5A90 A;  2OV5 A;  5J8X A;  4B4X A;  4GKU A;  4JPM A;  3Q82 A;  4N1H A;  3S4X A;  3SS5 A;  2Y2Q A;  3G31 A;  4E3O A;  3WWX A;  2WKE A;  3RXW A;  4ZJ3 A;  4DXC A;  1PWD A;  4K91 A;  3WS2 A;  3MKF A;  2V20 A;  1H8Z A;  1PIO A;  3FKW A;  4PM8 A;  1XXM A;  1MWT A;  2ZQC A;  2J9P A;  3D4F A;  4P0M A;  4E3J A;  2B5R A;  1ESI A;  4GDN A;  4RA7 A;  4RX2 A;  4GOG A;  4QHC A;  2R9X A;  4R0Q A;  4N9L A;  3HLE A;  4LEN A;  4GD6 A;  1Z6F A;  1YT4 A;  3IH9 A;  3UE1 A;  3VP3 A;  1XGI A;  1KDW A;  4S2N C;  3VFF A;  3N6I A;  3G30 A;  2Y2L A;  4KZ7 A;  5A92 A;  1PW1 A;  3A3E A;  3B3X A;  5IHV A;  1ERO A;  1K55 A;  2OLU A;  3W8K A;  4E3I A;  4LV1 A;  5G18 A;  4C75 A;  2QMI A;  2Z2M B;  3V39 A;  1HD8 A;  2E8I A;  4PM9 A;  5CED A;  1KVM A;  3WS0 A;  2ZC5 B;  4PM5 A;  3W4Q A;  2C6W B;  2EXA A;  1N4O A;  2HDU A;  1AXB A;  5GL9 A;  2HP5 A;  5DF9 A;  5DF8 A;  3VSK A;  4K0X A;  4OPY A;  1ZC2 A;  5AQB A;  5CEC A;  4GNU A;  2Y2I A;  1MBL A;  2HP6 A;  4LV3 A;  4A5R A;  3CMZ A;  1ES4 A;  1H8Y A;  4IVK A;  1LLB A;  4YFM A;  4OLD A;  3WS5 A;  4N1X A;  1KE4 A;  1K57 A;  1MWR A;  2QPN A;  3ZCZ A;  1ZG6 A;  4K0W A;  4WZ5 C;  3IF6 C;  4OON A;  1SDE A;  1YLJ A;  3IWI A;  3W4P A;  4M3K A;  3A3J A;  4WEJ A;  2C5W B;  3PTE A;  2IWD A;  3FZC A;  5JYO A;  2ZJ9 A;  4UA9 A;  3IT9 A;  5L2F A;  2Y2K A;  3ISG A;  4WZ5 A;  5A91 A;  4DKI A;  4EBP A;  4UA6 A;  3M6B A;  2DCF A;  4OPZ A;  1IYP A;  2IWB A;  1YLP A;  3G4P A;  4QY6 A;  4EWF A;  3NI9 A;  5FQI A;  3ZHH A;  1L2S A;  4Z9Q A;  1FCM A;  3G34 A;  3BRM A;  1CI8 A;  3ZG5 A;  1GHM A;  5FQK A;  4KQQ A;  5F83 A;  2WAE A;  4JXW A;  1PYY A;  4E3N A;  4ZJ1 A;  2Y4A A;  3FYZ A;  5E2G A;  4S2P A;  3IXB A;  1BTL A;  1YM1 A;  3MKE A;  4MBF A;  4QJG A;  3SS4 A;  4ZDX A;  4WMC D;  1WYB A;  3EQV A;  3C7V A;  1NRF A;  3MZF A;  3BM6 A;  1MWS A;  2EFU A;  2XD1 A;  3HLB A;  4R4S A;  3A3I A;  4X56 A;  1OME A;  4R4R A;  2OLV A;  4WBG A;  3LEZ A;  4BL2 A;  3LCE A;  3GR2 A;  3QHY A;  1RCJ A;  4EQI A;  4S2J A;  3JYI A;  3GMW A;  3N7W A;  2QZ6 A;  3VP2 A;  1PI4 A;  5HX9 A;  2OSU A;  4EBL A;  3AGF A;  3DWZ A;  1M40 A;  2P9V A;  4IVI A;  1CK3 A;  2JE5 A;  4MBH A;  3IHA A;  1HTZ A;  4EUZ A;  2ZC4 B;  4OPQ A;  4WMC A;  1ZG4 A;  3S1Y A;  4PM6 A;  1S6R A;  1GHP A;  3HLF A;  1SCW A;  1BUE A;  5AQ7 A;  1WYC A;  5HFO A;  1GA9 A;  2VGK A;  2XLN A;  4S2I A;  1IKI A;  1K6R A;  5GHY A;  1K56 A;  3VSL A;  5TR7 A;  1FQG A;  3UPO A;  2WGI A;  1FSY A;  5EVI D;  1ONH A;  1K54 C;  3V3S A;  5HL1 A;  2XD5 A;  3BEC A;  1ES5 A;  1L0D A;  1NJ4 A;  2H5S A;  2V2F F;  3I7J A;  1ERM A;  2Y2O A;  3P09 A;  2WKH A;  2JCH A;  4KZB A;  3SOI A;  3UDF A;  3IWQ A;  2J8Y A;  4JF5 A;  4BJP A;  2ZLY A;  3O88 A;  3HLW A;  5E2E A;  1LHY A;  3IXD A;  1E3U A;  5CER A;  3IF6 B;  3IF5 A;  5EOE A;  3IWO A;  3SH8 A;  5KSC A;  5CHM A;  3ZG7 B;  2X01 A;  5GHX A;  2I72 A;  5I94 A;  3A3F A;  5CHU A;  3UY6 A;  1FOF A;  3P98 A;  1U60 A;  1N9B A;  2Y2P A;  3HLC A;  3G32 A;  3Q81 A;  4WEK A;  3DW0 A;  3TG9 A;  2WZZ A;  1NZO A;  2HPB A;  4Q8I A;  1QMF A;  1FR1 A;  4DDS A;  3E2L A;  1E4D A;  4C3Q A;  2DRW A;  1SHV A;  5FAP A;  2BG1 A;  5EE8 A;  2Y91 A;  4KEN B;  3VMA A;  2FFY A;  4KZA A;  3UE0 A;  2JC7 A;  5CRF A;  1H5X A;  2Y59 A;  3SS3 A;  5HW3 A;  3UPP A;  3BFC A;  4PMA A;  4E3L A;  2IWC A;  3PBQ A;  1KE3 A;  1PW8 A;  3PBN A;  4R3B A;  4WYY A;  2Y2G A;  3OZH A;  3ZGA B;  1K6S A;  3N8L A;  4FCF A;  4GD8 A;  2EX9 A;  1DJA A;  4OP5 A;  1DJC A;  2XH9 A;  1WE4 A;  5D3O A;  4BL3 A;  1ONG A;  1Q2Q A;  1J9M A;  2X02 A;  3HLG A;  3OPR A;  4EBN A;  4RVA A;  3BEB A;  5FA7 A;  4KZ4 A;  2FFF B;  3N4I A;  4OLG A;  1L0G A;  3NDE A;  4GB7 A;  5DTT A;  3O86 A;  3MZE A;  4S2M A;  4U0T A;  2ZQD A;  2EX6 A;  1K25 A;  2DNS A;  3VOY A;  1O7E A;  4KZ9 A;  5CGX A;  5F1G A;  1CI9 A;  4OQG A;  4OOM A;  4FH2 A;  4DDY A;  4QY5 A;  2BLS A;  4BEN A;  1C3B A;  4E3K A;  1E25 A;  1IEM A;  3FWL A;  5AQA A;  4KZ6 A;  3UPN A;  4RYE A;  3GSG A;  4X6T A;  2H0Y A;  3AGD A;  3NDG A;  1QME A;  4IED A;  4EV4 A;  1BLP A;  1FCO A;  4KZ8 A;  3OCN A;  2J7V A;  4S2K A;  4E6X A;  1ES2 A;  3PBS A;  4OQI A;  5DTS A;  3Q7V B;  5EVI B;  2XDM A;  5EPH A;  3PAE A;  2WGV A;  1DY6 A;  2CC1 A;  1IKG A;  2A49 A;  3Q7Z A;  4P6B A;  2Q9M A;  4JXV A;  5E2H A;  5FQ9 A;  2RCX A;  2P74 A;  1CEG A;  3IXG A;  2A3U A;  4BD0 A;  1IYS A;  2HDS A;  1RGZ A;  4GDB A;  5CGW A;  2PU4 A;  1CEF A;  3ZG9 B;  5AQ9 A;  3BLS A;  3NC8 A;  2WGW B;  1RGY A;  3BFG A;  1JWZ A;  4KQO A;  5EEC A;  3SH9 A;  3WRZ A;  1W8Q A;  4E3M A;  4KG5 A;  1LI0 A;  3PBR A;  4PPR A;  3CZD A;  4JLF A;  3WS1 A;  1ES3 A;  4OQH A;  1XGJ A;  2ZC7 A;  3FKV A;  1YLZ A;  4WM9 A;  5GLC A;  2ZQ7 A;  4JXS A;  3ZNY A;  1BZA A;  3PAG A;  4GZB A;  2HDQ A;  2WZX A;  4MEZ A;  4MLL A;  4Y7P A;  3NY4 A;  1I2S A;  3ZVT A;  4DXB A;  2J9O A;  1PWC A;  2ZQA A;  5HAR A;  3EQU A;  3ZFZ A;  3FV7 A;  4R3J A;  1KGG A;  1NYM A;  4DE1 A;  3GVB A;  1PI5 A;  4X69 A;  2XF3 A;  2ZMA A;  3HVF A;  3G35 A;  5HAP A;  1ZKJ A;  1YLY A;  3UO9 A;  5DTK A;  3BFF A;  4XUZ A;  1BLH A;  3ZDJ A;  1PZP A;  1YLW A;  4R23 A;  5HAQ A;  3HRE A;  2EXB A;  4YIN A;  1XA7 A;  4BD1 A;  5FAT A;  2WGW A;  1SDN A;  1NYY A;  3IH8 A;  5M1A A;  3PBT A;  3VP0 A;  1NZU A;  1JTG A;  1PWG A;  4E6W A;  5CTM A;  3GV9 A;  5FQQ A;  4F94 A;  1BSG A;  4Y0T A;  4BLM A;  3IQA A;  1MXO A;  4OOY A;  5BOH A;  4X68 A;  4DE0 A;  2Y2H A;  4FSF A;  2HDR A;  5GHZ A;  3QNB A;  3BFE A;  3RJU A;  3V50 A;  1KE0 A;  3MXS A;  5KSH A;  2ZQ8 A;  5EUA A;  3UDI A;  1BUL A;  1MY8 A;  3A3D A;  4H8R A;  4JBF A;  3MXR A;  1BLS A;  1K56 D;  1W79 A;  1L0F A;  4N9K A;  3RXX A;  2XEP A;  3C5A A;  4DE2 A;  3IHB A;  4P87 A;  1VQQ A;  3C7U A;  1LL5 A;  1TDL A;  5FI2 A;  1S0W A;  1SKF A;  4B4Z A;  4HES A;  5HAI A;  3Q07 A;  3HL9 A;  5EOO A;  1JVJ A;  1FR6 A;  2HP9 A;  3BYD A;  1I5Q A;  3ITB A;  4RX3 A;  1ALQ A;  2XQZ A;  3WRT A;  4Y0U A;  5M19 A;  4U3T A;  1L0E A;  3AGE A;  4KZ3 A;  4CJN A;  3HUN A;  1FCN A;  1KGE A;  3N8S A;  4MBK A;  4OQ0 A;  4B88 A;  1K54 A;  4OKP A;  3QNC A;  1RP5 A;  3N8R A;  3Q1F A;  3G2Y A;  5GLB A;  5FI7 A;  2WYX A;  3VP1 A;  1W8Y A;  5FDH A;  3HUO A;  3ITA A;  3UNW A;  3ZVW A;  3LO7 A;  5GLD A;  4DRT A;  2RL3 A;  1LL9 A;  4UA7 A;  5FSR A;  5CEB A;  3S22 A;  1TVF A;  3HLD A; 
#chains in the Genus database with same CATH topology
 1JNU A;  2ZM2 A;  4IBX A;  4HBU A;  2G2U A;  3DTK A;  2VGJ A;  2GZA A;  2P9V B;  3ZG0 A;  4HOI A;  1YQS A;  3KYZ A;  5IU1 A;  4GJ4 A;  1K4F A;  1OTE A;  1XA1 A;  3SH7 A;  2ZM0 A;  2PBY A;  4HHD A;  5DF7 A;  2QJ5 A;  3W4O A;  4WEL A;  3VOZ A;  2M7U A;  3NOT C;  4Q0J A;  2GNX A;  3UE3 A;  5G4Z A;  3WS4 A;  2Z6C A;  4PM7 A;  3MBZ A;  5KMW A;  4OH0 A;  1PNE A;  2Y55 A;  3LIB A;  1HZO A;  4N92 A;  3EEA A;  3T1S A;  1IEL A;  3C8C A;  2H10 A;  1ZHH B;  2WKR A;  4QD4 A;  3NIA A;  2X71 A;  5E43 A;  1EWZ A;  1YMX A;  5TGF A;  3OC2 A;  2EFX A;  4P85 A;  3V3R A;  1HVB A;  1XX2 A;  5A8B A;  5GLA A;  3VOL A;  4YNR A;  4C6Y A;  4NXG A;  2ZC3 B;  5FAQ A;  5CGS A;  1W7F A;  1YMS A;  5AVF A;  3TOI A;  2P08 A;  1ERQ A;  4R1G A;  5FAS A;  1N9O A;  2INW A;  3CG5 A;  1PZO A;  1O07 A;  4WF0 A;  3OLO A;  1W5D A;  4CPK A;  2G2W A;  2PU2 A;  2JBF A;  5EVI C;  2Y2N A;  4E3M A;  2WK0 A;  1F9I A;  1MPL A;  3UB8 A;  4DE3 A;  2XR0 A;  4LCL A;  1NXY A;  1I2W A;  1K55 C;  5F5Y A;  2H0T A;  3KO6 A;  3M2K A;  3C2W A;  1GHI A;  3MFD A;  2J80 A;  5U47 A;  1NY0 A;  2ZC6 B;  4ZJ2 A;  1K4E A;  2Y79 A;  3S4X A;  2Y2Q A;  4E3O A;  1S66 L;  2WKE A;  1PWD A;  3WS2 A;  3FKW A;  2J9P A;  4P0M A;  1ESI A;  3CIT A;  4CLC E;  4QHC A;  1NWZ A;  3HLE A;  4N9L A;  1P9R A;  1N9L A;  3C30 A;  3VP3 A;  1XGI A;  1XFQ A;  4KZ7 A;  1PW1 A;  3CUE C;  3B3X A;  3S7O A;  2OLU A;  3ZQ5 A;  4E3I A;  3V39 A;  2E8I A;  4PM9 A;  5CED A;  2VX8 A;  5FEG A;  1KVM A;  3WS0 A;  2C6W B;  2HP5 A;  4K08 A;  2KLI A;  4K0X A;  4OPY A;  1TS7 A;  4GNU A;  2Y2I A;  1MBL A;  1T1C A;  4LV3 A;  4IHQ A;  3ZCZ A;  1ZG6 A;  4K0W A;  5EM0 A;  5EVE A;  5JYO A;  4UA9 A;  3MQQ A;  4LRX C;  3ISG A;  4UA6 A;  3R4K A;  4OPZ A;  3E98 A;  3ZHH A;  3KSF A;  3H82 B;  2O99 A;  2XRN A;  3BRM A;  1CI8 A;  4LFU A;  1GHM A;  4KQQ A;  5F83 A;  4CLC A;  3LR4 A;  1BTL A;  1YM1 A;  3RH8 B;  3SS4 A;  4ZDX A;  2GX5 A;  3MZF A;  4R4S A;  4EET B;  2VV6 A;  3A3I A;  4PKY A;  2OLV A;  3LEZ A;  3LCE A;  3GR2 A;  4Q0I A;  4ETZ A;  5HWW A;  2QKP A;  2J3T C;  3VP2 A;  4LGW A;  2QWS A;  1M40 A;  2P9V A;  1D06 A;  4UQI M;  2ZC4 B;  3S1Y A;  1NLZ A;  2ZL1 A;  1IKI A;  1GSX A;  1FSY A;  1VET A;  3EEH A;  2Y8H A;  4CLC C;  4KZB A;  1D1J A;  4HP4 A;  2ZLY A;  2K2N A;  1LHY A;  5CER A;  1T19 A;  3IWO A;  3VE4 A;  5KSC A;  3ZG7 B;  3KX0 X;  2Q0O A;  3MR0 A;  3HLC A;  3DW0 A;  3UB9 A;  4ARZ A;  2WZZ A;  1QMF A;  2QJ7 A;  4DJ3 A;  3C38 A;  4KEN B;  3UPP A;  3BFC A;  1W63 Q;  2EWV A;  1KE3 A;  4R3B A;  3MMH A;  3LIE A;  3OZH A;  3JVU A;  3N8L A;  5L09 A;  2EX9 A;  4P6Z S;  1DJA A;  3L9K A;  1OTA A;  4OP5 A;  2XH9 A;  3K3D A;  3HLG A;  3OPR A;  4WUJ A;  1CQA A;  2ACG A;  4GB7 A;  2LB5 A;  3PHY A;  2W3D A;  4HNB A;  1IFQ A;  3E4Q A;  1O7E A;  5CGX A;  5F1G A;  4DDY A;  2W1T B;  3IX3 A;  4E3K A;  1IEM A;  3FWL A;  5AQA A;  1VEU A;  2W27 A;  4X6T A;  3BJN A;  3BQA A;  3NDG A;  1QME A;  4X1M A;  3TJZ C;  5HPI A;  3OCN A;  2BTF P;  2J7V A;  3QP4 A;  3KSI A;  4E6X A;  5EVI B;  5EPH A;  2GJ3 A;  4RQ9 A;  1IKG A;  5E2H A;  1LL8 A;  3H7W B;  5EFW A;  2RCX A;  5FQ9 A;  3V67 A;  1IYS A;  2K31 A;  2PU4 A;  1CEF A;  3ZG9 B;  3A0S A;  2WGW B;  5IT5 A;  4JGR A;  4PPR A;  2V1B A;  3WS1 A;  4HJ4 A;  4WM9 A;  5GLC A;  3ZNY A;  1BZA A;  4GZB A;  2HDQ A;  2WZX A;  3K3C A;  4DXB A;  4DJ2 A;  1NYM A;  1PI5 A;  2OWJ A;  2XF3 A;  3HVF A;  3G35 A;  4GLQ A;  1YLW A;  2FZ0 A;  2XA7 M;  1TS6 A;  5DKL A;  3VP0 A;  3PBT A;  1JTG A;  1DP6 A;  3GV9 A;  4F94 A;  4Y0T A;  5TJJ A;  1DRM A;  2HV1 A;  3IQA A;  1MXO A;  5HD3 A;  3T12 B;  1S1Y A;  4FSF A;  1VEU B;  2D01 A;  3MXS A;  3A0V A;  5KSH A;  3A3D A;  3W2Z A;  3UB7 A;  1BLS A;  1OTI A;  4F3L A;  1YSQ A;  1UWP X;  4B4Z A;  4ME4 A;  3LIA A;  3HL9 A;  1LSX A;  1JVJ A;  1FR6 A;  4LRZ E;  3H82 A;  4U3T A;  4MCW A;  1P0Z A;  3HUN A;  4MBK A;  4B88 A;  2JKF A;  2WYX A;  1W8Y A;  3HUO A;  3HCY A;  5GLD A;  4UA7 A;  5F6A A;  4HJ3 A;  5CTN A;  5I5L A;  4O01 A;  4LV2 A;  3HJK A;  1GA0 A;  3KSG A;  1ESU A;  3UB6 A;  4FD8 A;  4BBV A;  3HUM A;  5EM1 A;  3CLO A;  4WZ4 A;  4NK3 A;  4OPR A;  5HDS A;  1L3L A;  4U0X A;  4QWO A;  5EVL A;  3F1O A;  3OPL A;  1JWV A;  2Q9N A;  4BQM A;  2M7V A;  4S2L A;  3VFH A;  2Y2M A;  4LV0 A;  3LR5 A;  3IS2 B;  5FQM A;  2VKS A;  3MF0 A;  1E3U D;  3O3V A;  1WA9 A;  3HJI A;  4MN5 A;  2G7U A;  1VM1 A;  3GRJ A;  4NET A;  3BY8 A;  5TFQ A;  2VZW A;  4O8G A;  3LID A;  4Y5F A;  5F82 A;  3FPV A;  3HBR A;  3OPP A;  3IXH A;  1IYO A;  3CWF A;  4Y15 A;  2K7S A;  1KGF A;  4Y0O A;  2VJW A;  3G2Z A;  4IBR A;  1S4R A;  1GSV A;  5J4E A;  2EX8 A;  2GDN A;  4R38 A;  3BLM A;  1UGU A;  4BBT A;  3NOP C;  5DVA A;  1SKO A;  3BWL A;  2P7J A;  4OP8 A;  4XXR A;  5E2F A;  1L0G A;  1GCE A;  4I3I A;  3NUL A;  3TSG A;  4EER A;  1EI5 A;  3RFB A;  2EX2 A;  1Y54 A;  4L9E A;  4UHU A;  4UEY A;  5EVI A;  3NEC A;  2XFT A;  5KZH A;  4M4X A;  1FSW A;  3OPH A;  2OV5 A;  4JPM A;  4G3W A;  4EQ1 A;  4Y17 A;  4D60 A;  2V0U A;  5DKK A;  1H8Z A;  2W1T A;  1XXM A;  4E3J A;  3E4O A;  1IOU A;  3ICY A;  2R9X A;  1TS8 A;  4MN6 A;  1XJ6 A;  3VFF A;  3N6I A;  2Y2L A;  3LUQ A;  3QP1 A;  3W8K A;  5G18 A;  2QMI A;  2CMN A;  1HD8 A;  4HIA A;  2HDU A;  1N4O A;  2EWW A;  1AXB A;  5GL9 A;  3JPU A;  5AQB A;  4EU0 A;  2VEA A;  2HP6 A;  4A5R A;  1LLB A;  4KQD A;  1MWR A;  3IF6 C;  4PHT A;  1SDE A;  1YLJ A;  2WKQ A;  3A3J A;  1VHM A;  3FZC A;  2ZJ9 A;  3T4K A;  3IT9 A;  3LIC A;  4HH3 A;  2KX6 A;  4EBP A;  3M6B A;  2DCF A;  2O9A A;  2OAQ 1;  1YLP A;  4EWF A;  3NI9 A;  4Z9Q A;  5FQK A;  1PYY A;  2PBD P;  3MKE A;  2ZOI A;  3EQV A;  3C7V A;  3E4P A;  1CF0 A;  4HJ6 A;  2KDK A;  1ODV A;  1OME A;  4R4R A;  4WBG A;  1RCJ A;  1PI4 A;  3UB5 P;  4EBL A;  3AGF A;  2UV0 E;  4DMZ A;  4IVI A;  3IHA A;  3NHQ A;  4WMC A;  4PM6 A;  3SW1 A;  3HLF A;  1BUE A;  5AQ7 A;  4Y13 A;  5HFO A;  5GHY A;  4YWZ A;  4S2I A;  3QP2 A;  1K6R A;  1K56 A;  2YKH A;  1V9Z A;  3VSL A;  1OPX A;  2WGI A;  3CPT B;  1TF1 A;  3E0Y A;  1K54 C;  5HL1 A;  1L0D A;  3GDI A;  3I7J A;  2Y2O A;  2WKH A;  2JCH A;  3O88 A;  3IXD A;  3IF5 A;  3UE6 A;  2L4R A;  1OTB A;  2QHK A;  3SH8 A;  2X01 A;  5GHX A;  1MKM A;  2I72 A;  4BWI A;  3UY6 A;  1ACF A;  1FOF A;  3CUE A;  4WEK A;  5DJT A;  1FIL A;  3E2L A;  3MFX A;  1G28 A;  4C3Q A;  2DRW A;  2BG1 A;  5KIZ A;  2Y91 A;  3UE0 A;  4PMA A;  4E3L A;  3PBQ A;  3KYQ A;  1K6S A;  1P97 A;  4FCF A;  4B9O A;  4HY8 A;  1J9M A;  4EEP A;  3BEB A;  5FA7 A;  4KZ4 A;  2FFF B;  2JN7 A;  5DTT A;  4U0T A;  1LT0 A;  2ZQD A;  5F68 A;  3VOY A;  2A24 B;  2VGL M;  4FH2 A;  3GEC A;  5DJU A;  2BLS A;  3IBR A;  1E25 A;  2DMW A;  3UPN A;  3GSG A;  4CLC D;  5FDS A;  4GS9 B;  1BLP A;  1FCO A;  2O0Y A;  4OQI A;  3PBS A;  3Q7V B;  2XDM A;  2WGV A;  1EW0 A;  1STZ A;  4P6B A;  3T4T A;  3Q7Z A;  2Q9M A;  4JXV A;  2A3U A;  1NRJ A;  2JHE A;  4GDB A;  5CGW A;  1Z09 A;  3NC8 A;  4UQI S;  4ETX A;  3PBR A;  4G3K A;  4H6J B;  3LYX A;  2P04 A;  2ZC7 A;  1YLZ A;  4NXF A;  3T1R A;  1I2S A;  2J9O A;  2ZQA A;  5HAR A;  3EQU A;  1KGG A;  4X69 A;  3QP6 A;  3B33 A;  3PYP A;  1BLH A;  1H3Q A;  4YIN A;  1XA7 A;  2WGW A;  3RTY A;  5M1A A;  5CTM A;  3F1O B;  4CLC B;  4X68 A;  4HI4 A;  5GHZ A;  1KE0 A;  5EUA A;  3TRC A;  3MXR A;  4GS9 A;  1K56 D;  3RXX A;  2XEP A;  4R6L A;  4P87 A;  4FTX A;  3EWK A;  1LL5 A;  3JVV A;  4HES A;  4MMN A;  1ALQ A;  3BW6 A;  2OOL A;  2XQZ A;  3AGE A;  1FCN A;  3CHW P;  5GLB A;  1XFN A;  5FDH A;  3UNW A;  4DRT A;  5CEB A;  4FOF A;  2UWX A;  3UDX A;  4KQR A;  3H9W A;  1G6A A;  3C4P A;  4GN2 A;  5IS1 A;  3D72 A;  1TDG A;  3GQZ A;  1BT5 A;  3OCL A;  3V5M A;  3ZG8 B;  4B93 A;  4X53 A;  3ZNT A;  3C4O A;  2ZD8 A;  3G6O A;  3M6H A;  3UN7 A;  4ID4 A;  3DTM A;  3NCK A;  2W3E A;  3MS6 A;  3IF6 A;  2JKT M;  3BFD A;  1Q2P A;  5J3W A;  2WAF A;  3LR3 A;  1IYQ A;  3T4O A;  1FIK A;  4ZBE A;  4ZAM A;  4DF6 A;  3GTC A;  4HBT A;  3MQO A;  3LY4 A;  4KG2 A;  4X55 A;  2PRF A;  4OOL A;  3T50 A;  4NG2 A;  1S67 L;  2R78 A;  2PDR A;  2WAD A;  2FH5 A;  3DWK A;  1DJB A;  3S7P A;  4ZTK A;  1K38 A;  4L0L A;  1NLY A;  1JTD A;  4XT2 A;  4OVD A;  4S2N A;  3D9Y A;  1BYW A;  1LSW A;  4QPR A;  1KDS A;  4XUX A;  2V0W A;  2WKI A;  3F1N A;  3NOU C;  4G3V A;  1S4S A;  2JKR I;  2WUQ A;  3MZD A;  3Q7V A;  1XJ3 A;  1MKI A;  1TEM A;  5FQJ A;  2R9W A;  4O7D A;  2XGN A;  3DAV A;  3EGD C;  4X1L A;  2PD7 A;  5EV0 A;  1T1A A;  3T4J A;  5DFY A;  2ZBB A;  4B4X A;  4GKU A;  4N1H A;  4FUW A;  3SS5 A;  1H0M A;  2O9C A;  3IX8 A;  3RXW A;  4BMW A;  4DXC A;  3A0R A;  1YSP A;  1SZV A;  4BBU A;  1PIO A;  4PM8 A;  1MWT A;  2ZQC A;  4GDN A;  4ZRR A;  2XSS A;  4RX2 A;  4GOG A;  2IA2 A;  4GD6 A;  4I3A A;  1Z6F A;  3IH9 A;  1LSV A;  3UE1 A;  1KDW A;  3EGX C;  4S2N C;  5A92 A;  3A3E A;  1ERO A;  4E04 A;  1K55 A;  3KSH A;  4LV1 A;  4LPZ A;  2A2L A;  2W3G A;  3W4Q A;  2EXA A;  5DF8 A;  5DF9 A;  3VSK A;  4DN0 A;  1ZC2 A;  4EUV A;  3TW8 A;  1ES4 A;  4IVK A;  1MZU A;  1KE4 A;  2QPN A;  4WZ5 C;  4OON A;  3IWI A;  1XJ2 A;  4M3K A;  2C5W B;  5L07 A;  3FPW A;  3R7W B;  2V9A A;  5L2F A;  2KOI A;  2Y2K A;  5A91 A;  5F69 A;  1IYP A;  2IWB A;  3G4P A;  1FCM A;  3G34 A;  3MXQ A;  5E2G A;  4S2P A;  2O9B A;  2EA9 A;  1WYB A;  4II7 A;  4MDZ A;  2J3W A;  1NRF A;  3T4S A;  3BM6 A;  3LR0 A;  1MWS A;  1H8M A;  2EFU A;  2JKT I;  3QHY A;  5HWT A;  4IJG A;  4EQI A;  3JYI A;  3N7W A;  5FEF A;  2B95 A;  2JE5 A;  4MBH A;  1HTZ A;  2B02 A;  4OPQ A;  3QP5 A;  1OJG A;  1GA9 A;  2XLN A;  1G5U A;  5HWV A;  2LB9 A;  1FQG A;  4R3A A;  3UME A;  5EVI D;  3IS2 A;  3V3S A;  2XD5 A;  3BEC A;  1NJ4 A;  1P9W A;  1ERM A;  2M1C A;  3P09 A;  2J8Y A;  5CX7 A;  4JF5 A;  3VV4 A;  4GHI A;  4BJP A;  3HLW A;  5FL3 A;  5EOE A;  5CHM A;  5I94 A;  5CHU A;  1U60 A;  1N9B A;  3QP8 A;  3MJQ A;  4HQA A;  3Q81 A;  1NZO A;  2HPB A;  2PT7 A;  4Q8I A;  4YOF A;  4DDS A;  4WN5 A;  1SHV A;  5FAP A;  5EE8 A;  2FFY A;  5CRF A;  1H5X A;  2Y59 A;  3SS3 A;  5HW3 A;  1SKO B;  3L7H A;  1UWN X;  3PBN A;  4WYY A;  2Y2G A;  4PKY G;  4GHI B;  3F1N B;  1YKD A;  1DJC A;  4X25 A;  1WE4 A;  3B42 A;  2D02 A;  4BL3 A;  1ONG A;  1Q2Q A;  2B18 A;  4Q0H A;  3P01 A;  3TE8 A;  4OLG A;  3O86 A;  3MZE A;  1A0K A;  1K25 A;  2MJ6 A;  1CI9 A;  4OQG A;  2W1R A;  2L1M A;  1XJ4 A;  4NEE D;  1F2K A;  4KZ6 A;  3LIF A;  1N9N A;  3AGD A;  4EV4 A;  4S2K A;  1ES2 A;  3PAE A;  2A49 A;  4BD0 A;  1RGZ A;  5AQ9 A;  1TS0 A;  3BLS A;  1RGY A;  1JWZ A;  3WRZ A;  3SH9 A;  4KG5 A;  1LI0 A;  3SZT A;  4EW7 A;  1ES3 A;  1XGJ A;  3BQ8 A;  2ZQ7 A;  3IX4 A;  4MEZ A;  4MLL A;  4Y7P A;  4I38 A;  1PWC A;  3ZFZ A;  4DE1 A;  4R3J A;  3GVB A;  2ZMA A;  1ZKJ A;  3KYE A;  1YLY A;  4KUK A;  3ZYT A;  4XUZ A;  1PZP A;  4R23 A;  3UMD A;  1DP9 A;  2E8J A;  5L10 A;  5FAT A;  3IH8 A;  1NZU A;  4E6W A;  1PWG A;  1TVF A;  1BSG A;  4BLM A;  2VGL S;  4AFI A;  4OOY A;  3FC7 A;  5BOH A;  4JGQ A;  4EES A;  2Y2H A;  2HDR A;  3RJU A;  3BFE A;  1MC0 A;  2BAS A;  2ZQ8 A;  1VET B;  1BUL A;  3U4L P;  1MY8 A;  1W79 A;  2I9V A;  4N9K A;  2PHY A;  3C5A A;  2AVX A;  2XRO A;  2XA7 S;  5FI2 A;  1S0W A;  1SKF A;  1OTD A;  2VV7 A;  5HAI A;  3Q07 A;  5EOO A;  3BYD A;  1I5Q A;  3ITB A;  1OT9 A;  4RX3 A;  4Y0U A;  5M19 A;  4CJN A;  5L8M A;  1OJ5 A;  4OKP A;  3QNC A;  1RP5 A;  5FI7 A;  3ITA A;  3ZVW A;  2V1A A;  3LI9 A;  4CQH A;  1J3W A;  3HLD A;  1GSW A;  3M2J A;  1XPB A;  4KZ5 A;  1K57 C;  1W63 M;  4JXG A;  3O5Y A;  2ZMV A;  1CJF A;  4D2O A;  1XKZ A;  1HLU P;  2Y2J A;  5M18 A;  5FAO A;  1LI9 A;  4ESP A;  3DTI A;  2XK1 A;  5FI6 A;  4JKT A;  5CXW A;  4KUO A;  5HSQ A;  3LEQ A;  4EXO A;  2ZQ9 A;  3U2A A;  2V1Z A;  5JYP A;  5HDC A;  1OT6 A;  5HDD A;  1KVL A;  4I5S A;  3R7W A;  5A93 A;  3T4L A;  1BLC A;  1XP4 A;  3NJA A;  4KG6 A;  2VK3 A;  1G68 A;  1YLT A;  1F5M A;  4FH4 A;  4MNR A;  4JF4 A;  4MN7 A;  5CHJ A;  4QU3 A;  3NBL A;  4JGO A;  4HEF A;  4GCZ A;  3CJM A;  3O87 A;  5F1F A;  1JWP A;  2PYP A;  2Z2L B;  2ZM8 A;  4QB8 A;  4NXB A;  1M6K A;  4F3L B;  1MWU A;  4LCM A;  4S2O A;  2J3T D;  3LY3 A;  4UAA A;  4JF6 A;  3E2K A;  2XFS A;  2QYB A;  4LRY C;  3VP4 A;  1PRQ A;  3PBO A;  5A90 A;  5J8X A;  3Q82 A;  2JKG A;  3G31 A;  2HZ5 A;  3WWX A;  4ZJ3 A;  4K91 A;  3MKF A;  2V20 A;  2ZMF A;  2VLG A;  4XT2 B;  3D4F A;  2B5R A;  3T1Q B;  1ZTU A;  4RA7 A;  4R0Q A;  4LEN A;  2ZOH A;  1YT4 A;  1YPR A;  4I3J A;  3G30 A;  2W3F A;  5TBM B;  5IHV A;  2Z6D A;  3MSH A;  4P6Z M;  4C75 A;  2Z2M B;  1AWI A;  2ZC5 B;  5LBR A;  4PM5 A;  2A24 A;  5CEC A;  3CMZ A;  1H8Y A;  4YFM A;  4OLD A;  3WS5 A;  4N1X A;  1K57 A;  4IUH A;  3VE3 A;  3LGO A;  3W4P A;  4WEJ A;  3PTE A;  2IWD A;  5C5K A;  4WZ5 A;  4DKI A;  5G4Y A;  2PR6 A;  4L9G A;  4QY6 A;  4I39 A;  5FQI A;  1L2S A;  2W3H A;  2V8F A;  2ZL1 B;  5HL6 A;  3DTE A;  3ZG5 A;  2WAE A;  4H6J A;  4JXW A;  4E3N A;  4ZJ1 A;  2Y4A A;  3FYZ A;  2HJE A;  3IXB A;  3K2N A;  3CPT A;  3DBA A;  4L9F A;  4MBF A;  4QJG A;  1Y4O A;  4WMC D;  5MC7 A;  2PR5 A;  3S7Q A;  3PXP A;  1T18 A;  4WL9 A;  3T4Q A;  2XD1 A;  3HLB A;  4X56 A;  4BL2 A;  2HF6 A;  1TD5 A;  4S2J A;  3GMW A;  2QZ6 A;  5HX9 A;  2OSU A;  3T1X A;  3DWZ A;  4Y2F A;  1CK3 A;  3OBF A;  4ARZ B;  4EUZ A;  1ZG4 A;  2OWH A;  1S6R A;  1GHP A;  1SCW A;  4PAU A;  1WYC A;  2VGK A;  4NKP A;  1Y28 A;  5TR7 A;  3UPO A;  1ONH A;  4O0P A;  1ES5 A;  2V2F F;  2H5S A;  2JKR M;  3B47 A;  3SOI A;  3UDF A;  3IWQ A;  5HZH A;  5E2E A;  3S7N A;  1E3U A;  3IF6 B;  3A3F A;  2WKP A;  3P98 A;  2Y2P A;  3G32 A;  4JGP A;  3TG9 A;  2W0N A;  1FR1 A;  2HGV A;  5AVE A;  1E4D A;  4IUK A;  4WLA A;  3VMA A;  4KZA A;  2JC7 A;  3BY9 A;  3CI6 A;  1S1Z A;  2IWC A;  5K5B A;  1PW8 A;  3ZGA B;  4GD8 A;  1X0O A;  3CAX A;  4EEU A;  5D3O A;  2X02 A;  4EBN A;  4RVA A;  5AJG A;  3N4I A;  2V8C A;  3NDE A;  4S2M A;  2H28 A;  1G6O A;  2EX6 A;  2PYR A;  2DNS A;  4KZ9 A;  3FG8 A;  4OOM A;  4QY5 A;  4BEN A;  1C3B A;  2NUT C;  3P7N A;  4RYE A;  4Y3I A;  2H0Y A;  3LFV A;  1DP8 A;  1YAX A;  4IED A;  2PAV P;  4GW9 A;  4KZ8 A;  4NXE A;  5DTS A;  1DY6 A;  2CC1 A;  2P74 A;  1CEG A;  3IXG A;  3H7W A;  2HDS A;  5TBM A;  4Z1W A;  1PFL A;  3BFG A;  2L0W A;  5EEC A;  4KQO A;  1W8Q A;  3CZD A;  4JLF A;  5HPF A;  4OQH A;  3FKV A;  3OOV A;  4JXS A;  3PAG A;  3EOI A;  3NY4 A;  4HH2 A;  3ULF A;  5J7E A;  3ZVT A;  3FV7 A;  1KOU A;  5HAP A;  3UO9 A;  4HP9 A;  3D3O A;  5DTK A;  3BFF A;  2HJ9 C;  3ZDJ A;  3F1P B;  2NUP C;  5HAQ A;  3HRE A;  2EXB A;  4BD1 A;  1SDN A;  1NYY A;  1K0K A;  5FQQ A;  2VA0 A;  4DE0 A;  3QNB A;  3PR6 A;  4R70 A;  3V50 A;  3UDI A;  4H8R A;  4JBF A;  1F98 A;  1L0F A;  4DE2 A;  3IHB A;  1VB6 A;  1VQQ A;  3C7U A;  1D7E A;  1TDL A;  3F1P A;  1V9Y A;  3IBJ A;  2HP9 A;  2VV8 A;  3WRT A;  5DFX A;  1L0E A;  4KZ3 A;  5HD5 A;  1KGE A;  3N8S A;  4OQ0 A;  1K54 A;  3N8R A;  3Q1F A;  2YKF A;  3G2Y A;  1T1B A;  3VP1 A;  2PD8 A;  3MQ0 A;  3LO7 A;  2OAP 1;  1LL9 A;  2RL3 A;  5FSR A;  3LI8 A;  3S22 A;  4LLO B; 
#chains in the Genus database with same CATH homology
 3M2J A;  2ZM2 A;  4IBX A;  1XPB A;  5CTN A;  4HBU A;  2G2U A;  2UWX A;  4KZ5 A;  1K57 C;  2VGJ A;  3UDX A;  4LV2 A;  1GA0 A;  4KQR A;  1G6A A;  2P9V B;  3C4P A;  4GN2 A;  4JXG A;  3ZG0 A;  1YQS A;  1ESU A;  4D2O A;  4FD8 A;  1K4F A;  1XKZ A;  1TDG A;  3GQZ A;  1BT5 A;  3OCL A;  1XA1 A;  3HUM A;  3SH7 A;  2Y2J A;  2ZM0 A;  5M18 A;  2PBY A;  4NK3 A;  4OPR A;  4WZ4 A;  5DF7 A;  5FAO A;  4WEL A;  3V5M A;  1LI9 A;  4U0X A;  3VOZ A;  3W4O A;  5EVL A;  3UE3 A;  3ZG8 B;  3OPL A;  1JWV A;  4X53 A;  2Q9N A;  3WS4 A;  3ZNT A;  4BQM A;  4PM7 A;  2XK1 A;  2ZD8 A;  3C4O A;  4S2L A;  3MBZ A;  4JKT A;  2Y2M A;  5FI6 A;  4OH0 A;  3VFH A;  5KMW A;  4LV0 A;  3M6H A;  2Y55 A;  5FQM A;  5CXW A;  3UN7 A;  4ID4 A;  1HZO A;  4N92 A;  1E3U D;  2ZQ9 A;  3DTM A;  3O3V A;  1IEL A;  3NCK A;  2H10 A;  2V1Z A;  5JYP A;  4QD4 A;  1VM1 A;  3GRJ A;  3NIA A;  4NET A;  2X71 A;  5E43 A;  1KVL A;  5TFQ A;  1EWZ A;  1YMX A;  5TGF A;  3IF6 A;  3BFD A;  5A93 A;  1Q2P A;  1BLC A;  2WAF A;  1XP4 A;  3OC2 A;  1IYQ A;  2EFX A;  4P85 A;  4ZBE A;  4KG6 A;  4ZAM A;  3V3R A;  1HVB A;  4DF6 A;  3GTC A;  5F82 A;  4HBT A;  1XX2 A;  1G68 A;  5GLA A;  1YLT A;  3HBR A;  3OPP A;  3LY4 A;  3IXH A;  4FH4 A;  1IYO A;  4MNR A;  4C6Y A;  4JF4 A;  2ZC3 B;  4KG2 A;  4X55 A;  5CHJ A;  5FAQ A;  4OOL A;  5CGS A;  1KGF A;  4QU3 A;  1W7F A;  1YMS A;  4Y0O A;  3TOI A;  3G2Z A;  4IBR A;  1ERQ A;  4R1G A;  5FAS A;  3NBL A;  2WAD A;  3DWK A;  3CG5 A;  1PZO A;  1O07 A;  1DJB A;  2EX8 A;  4ZTK A;  2GDN A;  3BLM A;  1W5D A;  1K38 A;  4HEF A;  4L0L A;  1JTD A;  4CPK A;  4OVD A;  4S2N A;  5DVA A;  2G2W A;  2PU2 A;  3CJM A;  3O87 A;  5F1F A;  1JWP A;  2JBF A;  4OP8 A;  4XXR A;  5E2F A;  2Y2N A;  5EVI C;  1KDS A;  2WK0 A;  2Z2L B;  2ZM8 A;  1MPL A;  1GCE A;  4XUX A;  2WKI A;  4QB8 A;  1M6K A;  4DE3 A;  2XR0 A;  3TSG A;  4LCL A;  1NXY A;  1MWU A;  1I2W A;  1EI5 A;  4LCM A;  2EX2 A;  1Y54 A;  1K55 C;  2WUQ A;  4S2O A;  3MZD A;  3Q7V A;  4UHU A;  5EVI A;  2H0T A;  3M2K A;  3LY3 A;  1MKI A;  2XFT A;  1GHI A;  3MFD A;  1TEM A;  4JF6 A;  4UAA A;  5FQJ A;  5KZH A;  2R9W A;  5U47 A;  4O7D A;  3E2K A;  1FSW A;  2XFS A;  2XGN A;  1NY0 A;  2ZC6 B;  4ZJ2 A;  3OPH A;  3VP4 A;  1K4E A;  3PBO A;  5A90 A;  2OV5 A;  5J8X A;  4B4X A;  4GKU A;  4JPM A;  3Q82 A;  4N1H A;  3S4X A;  3SS5 A;  2Y2Q A;  3G31 A;  4E3O A;  3WWX A;  2WKE A;  3RXW A;  4ZJ3 A;  4DXC A;  1PWD A;  4K91 A;  3WS2 A;  3MKF A;  2V20 A;  1H8Z A;  1PIO A;  3FKW A;  4PM8 A;  1XXM A;  1MWT A;  2ZQC A;  2J9P A;  3D4F A;  4P0M A;  4E3J A;  2B5R A;  1ESI A;  4GDN A;  4RA7 A;  4RX2 A;  4GOG A;  4QHC A;  2R9X A;  4R0Q A;  4N9L A;  3HLE A;  4LEN A;  4GD6 A;  1Z6F A;  1YT4 A;  3IH9 A;  3UE1 A;  3VP3 A;  1XGI A;  1KDW A;  4S2N C;  3VFF A;  3N6I A;  3G30 A;  2Y2L A;  4KZ7 A;  5A92 A;  1PW1 A;  3A3E A;  3B3X A;  5IHV A;  1ERO A;  1K55 A;  2OLU A;  3W8K A;  4E3I A;  4LV1 A;  5G18 A;  4C75 A;  2QMI A;  2Z2M B;  3V39 A;  1HD8 A;  2E8I A;  4PM9 A;  5CED A;  1KVM A;  3WS0 A;  2ZC5 B;  4PM5 A;  3W4Q A;  2C6W B;  2EXA A;  1N4O A;  2HDU A;  1AXB A;  5GL9 A;  2HP5 A;  5DF9 A;  5DF8 A;  3VSK A;  4K0X A;  4OPY A;  1ZC2 A;  5AQB A;  5CEC A;  4GNU A;  2Y2I A;  1MBL A;  2HP6 A;  4LV3 A;  4A5R A;  3CMZ A;  1ES4 A;  1H8Y A;  4IVK A;  1LLB A;  4YFM A;  4OLD A;  3WS5 A;  4N1X A;  1KE4 A;  1K57 A;  1MWR A;  2QPN A;  3ZCZ A;  1ZG6 A;  4K0W A;  4WZ5 C;  3IF6 C;  4OON A;  1SDE A;  1YLJ A;  3IWI A;  3W4P A;  4M3K A;  3A3J A;  4WEJ A;  2C5W B;  3PTE A;  2IWD A;  3FZC A;  5JYO A;  2ZJ9 A;  4UA9 A;  3IT9 A;  5L2F A;  2Y2K A;  3ISG A;  4WZ5 A;  5A91 A;  4DKI A;  4EBP A;  4UA6 A;  3M6B A;  2DCF A;  4OPZ A;  1IYP A;  2IWB A;  1YLP A;  3G4P A;  4QY6 A;  4EWF A;  3NI9 A;  5FQI A;  3ZHH A;  1L2S A;  4Z9Q A;  1FCM A;  3G34 A;  3BRM A;  1CI8 A;  3ZG5 A;  1GHM A;  5FQK A;  4KQQ A;  5F83 A;  2WAE A;  4JXW A;  1PYY A;  4E3N A;  4ZJ1 A;  2Y4A A;  3FYZ A;  5E2G A;  4S2P A;  3IXB A;  1BTL A;  1YM1 A;  3MKE A;  4MBF A;  4QJG A;  3SS4 A;  4ZDX A;  4WMC D;  1WYB A;  3EQV A;  3C7V A;  1NRF A;  3MZF A;  3BM6 A;  1MWS A;  2EFU A;  2XD1 A;  3HLB A;  4R4S A;  3A3I A;  4X56 A;  1OME A;  4R4R A;  2OLV A;  4WBG A;  3LEZ A;  4BL2 A;  3LCE A;  3GR2 A;  3QHY A;  1RCJ A;  4EQI A;  4S2J A;  3JYI A;  3GMW A;  3N7W A;  2QZ6 A;  3VP2 A;  1PI4 A;  5HX9 A;  2OSU A;  4EBL A;  3AGF A;  3DWZ A;  1M40 A;  2P9V A;  4IVI A;  1CK3 A;  2JE5 A;  4MBH A;  3IHA A;  1HTZ A;  4EUZ A;  2ZC4 B;  4OPQ A;  4WMC A;  1ZG4 A;  3S1Y A;  4PM6 A;  1S6R A;  1GHP A;  3HLF A;  1SCW A;  1BUE A;  5AQ7 A;  1WYC A;  5HFO A;  1GA9 A;  2VGK A;  2XLN A;  4S2I A;  1IKI A;  1K6R A;  5GHY A;  1K56 A;  3VSL A;  5TR7 A;  1FQG A;  3UPO A;  2WGI A;  1FSY A;  5EVI D;  1ONH A;  1K54 C;  3V3S A;  5HL1 A;  2XD5 A;  3BEC A;  1ES5 A;  1L0D A;  1NJ4 A;  2H5S A;  2V2F F;  3I7J A;  1ERM A;  2Y2O A;  3P09 A;  2WKH A;  2JCH A;  4KZB A;  3SOI A;  3UDF A;  3IWQ A;  2J8Y A;  4JF5 A;  4BJP A;  2ZLY A;  3O88 A;  3HLW A;  5E2E A;  1LHY A;  3IXD A;  1E3U A;  5CER A;  3IF6 B;  3IF5 A;  5EOE A;  3IWO A;  3SH8 A;  5KSC A;  5CHM A;  3ZG7 B;  2X01 A;  5GHX A;  2I72 A;  5I94 A;  3A3F A;  5CHU A;  3UY6 A;  1FOF A;  3P98 A;  1U60 A;  1N9B A;  2Y2P A;  3HLC A;  3G32 A;  3Q81 A;  4WEK A;  3DW0 A;  3TG9 A;  2WZZ A;  1NZO A;  2HPB A;  4Q8I A;  1QMF A;  1FR1 A;  4DDS A;  3E2L A;  1E4D A;  4C3Q A;  2DRW A;  1SHV A;  5FAP A;  2BG1 A;  5EE8 A;  2Y91 A;  4KEN B;  3VMA A;  2FFY A;  4KZA A;  3UE0 A;  2JC7 A;  5CRF A;  1H5X A;  2Y59 A;  3SS3 A;  5HW3 A;  3UPP A;  3BFC A;  4PMA A;  4E3L A;  2IWC A;  3PBQ A;  1KE3 A;  1PW8 A;  3PBN A;  4R3B A;  4WYY A;  2Y2G A;  3OZH A;  3ZGA B;  1K6S A;  3N8L A;  4FCF A;  4GD8 A;  2EX9 A;  1DJA A;  4OP5 A;  1DJC A;  2XH9 A;  1WE4 A;  5D3O A;  4BL3 A;  1ONG A;  1Q2Q A;  1J9M A;  2X02 A;  3HLG A;  3OPR A;  4EBN A;  4RVA A;  3BEB A;  5FA7 A;  4KZ4 A;  2FFF B;  3N4I A;  4OLG A;  1L0G A;  3NDE A;  4GB7 A;  5DTT A;  3O86 A;  3MZE A;  4S2M A;  4U0T A;  2ZQD A;  2EX6 A;  1K25 A;  2DNS A;  3VOY A;  1O7E A;  4KZ9 A;  5CGX A;  5F1G A;  1CI9 A;  4OQG A;  4OOM A;  4FH2 A;  4DDY A;  4QY5 A;  2BLS A;  4BEN A;  1C3B A;  4E3K A;  1E25 A;  1IEM A;  3FWL A;  5AQA A;  4KZ6 A;  3UPN A;  4RYE A;  3GSG A;  4X6T A;  2H0Y A;  3AGD A;  3NDG A;  1QME A;  4IED A;  4EV4 A;  1BLP A;  1FCO A;  4KZ8 A;  3OCN A;  2J7V A;  4S2K A;  4E6X A;  1ES2 A;  3PBS A;  4OQI A;  5DTS A;  3Q7V B;  5EVI B;  2XDM A;  5EPH A;  3PAE A;  2WGV A;  1DY6 A;  2CC1 A;  1IKG A;  2A49 A;  3Q7Z A;  4P6B A;  2Q9M A;  4JXV A;  5E2H A;  5FQ9 A;  2RCX A;  2P74 A;  1CEG A;  3IXG A;  2A3U A;  4BD0 A;  1IYS A;  2HDS A;  1RGZ A;  4GDB A;  5CGW A;  2PU4 A;  1CEF A;  3ZG9 B;  5AQ9 A;  3BLS A;  3NC8 A;  2WGW B;  1RGY A;  3BFG A;  1JWZ A;  4KQO A;  5EEC A;  3SH9 A;  3WRZ A;  1W8Q A;  4E3M A;  4KG5 A;  1LI0 A;  3PBR A;  4PPR A;  3CZD A;  4JLF A;  3WS1 A;  1ES3 A;  4OQH A;  1XGJ A;  2ZC7 A;  3FKV A;  1YLZ A;  4WM9 A;  5GLC A;  2ZQ7 A;  4JXS A;  3ZNY A;  1BZA A;  3PAG A;  4GZB A;  2HDQ A;  2WZX A;  4MEZ A;  4MLL A;  4Y7P A;  3NY4 A;  1I2S A;  3ZVT A;  4DXB A;  2J9O A;  1PWC A;  2ZQA A;  5HAR A;  3EQU A;  3ZFZ A;  3FV7 A;  4R3J A;  1KGG A;  1NYM A;  4DE1 A;  3GVB A;  1PI5 A;  4X69 A;  2XF3 A;  2ZMA A;  3HVF A;  3G35 A;  5HAP A;  1ZKJ A;  1YLY A;  3UO9 A;  5DTK A;  3BFF A;  4XUZ A;  1BLH A;  3ZDJ A;  1PZP A;  1YLW A;  4R23 A;  5HAQ A;  3HRE A;  2EXB A;  4YIN A;  1XA7 A;  4BD1 A;  5FAT A;  2WGW A;  1SDN A;  1NYY A;  3IH8 A;  5M1A A;  3PBT A;  3VP0 A;  1NZU A;  1JTG A;  1PWG A;  4E6W A;  5CTM A;  3GV9 A;  5FQQ A;  4F94 A;  1BSG A;  4Y0T A;  4BLM A;  3IQA A;  1MXO A;  4OOY A;  5BOH A;  4X68 A;  4DE0 A;  2Y2H A;  4FSF A;  2HDR A;  5GHZ A;  3QNB A;  3BFE A;  3RJU A;  3V50 A;  1KE0 A;  3MXS A;  5KSH A;  2ZQ8 A;  5EUA A;  3UDI A;  1BUL A;  1MY8 A;  3A3D A;  4H8R A;  4JBF A;  3MXR A;  1BLS A;  1K56 D;  1W79 A;  1L0F A;  4N9K A;  3RXX A;  2XEP A;  3C5A A;  4DE2 A;  3IHB A;  4P87 A;  1VQQ A;  3C7U A;  1LL5 A;  1TDL A;  5FI2 A;  1S0W A;  1SKF A;  4B4Z A;  4HES A;  5HAI A;  3Q07 A;  3HL9 A;  5EOO A;  1JVJ A;  1FR6 A;  2HP9 A;  3BYD A;  1I5Q A;  3ITB A;  4RX3 A;  1ALQ A;  2XQZ A;  3WRT A;  4Y0U A;  5M19 A;  4U3T A;  1L0E A;  3AGE A;  4KZ3 A;  4CJN A;  3HUN A;  1FCN A;  1KGE A;  3N8S A;  4MBK A;  4OQ0 A;  4B88 A;  1K54 A;  4OKP A;  3QNC A;  1RP5 A;  3N8R A;  3Q1F A;  3G2Y A;  5GLB A;  5FI7 A;  2WYX A;  3VP1 A;  1W8Y A;  5FDH A;  3HUO A;  3ITA A;  3UNW A;  3ZVW A;  3LO7 A;  5GLD A;  4DRT A;  2RL3 A;  1LL9 A;  4UA7 A;  5FSR A;  5CEB A;  3S22 A;  1TVF A;  3HLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...