4A5RA

Crystal structure of class a beta-lactamase from bacillus licheniformis bs3 with tazobactam
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
257
structure length
257
Chain Sequence
b'KDDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVVKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Crystal Structure of Class a Beta-Lactamase from Bacillus Licheniformis Inhibited by Tazobactam
rcsb
molecule tags Hydrolase
total genus 88
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4a5rA00
1KE4A 1DJCA 4FCFA 4BL3A 3DWKA 4H8RA 1E4DA 1H8ZA 4S2IA 5E2FA 4ZBEA 2HP5A 5J8XA 1YT4A 5FATA 1ZC2A 3VMAA 2A49A 3BLSA 2XH9A 4FH2A 5DF7A 3S1YA 2C5WB 3SOIA 4C3QA 4N9LA 3WRZA 4MEZA 4P87A 1Z6FA 3UDIA 1PWDA 3QNCA 4OQ0A 5HW3A 3IWIA 4GN2A 3RJUA 1K4FA 4JF4A 1GHPA 4LV0A 3ZG0A 1L2SA 3C5AA 1GCEA 1ES3A 3FKVA 4OP5A 1ESUA 5CTNA 1HVBA 4GB7A 5TR7A 3EQUA 3SS4A 2FFYA 3NIAA 2I72A 3OPPA 3BECA 3HREA 3ISGA 2XD5A 3G4PA 3G34A 3HLDA 1VQQA 4CPKA 5CTMA 3TSGA 2WZZA 1LI9A 2XFSA 5FQ9A 4S2PA 5DTKA 1ALQA 1QMFA 4EV4A 2XQZA 5AQ9A 1L0DA 2HDQA 1W8YA 1PI5A 4JXSA 2WAEA 1BULA 2Z2LB 2V1ZA 2ZC3B 4E3MA 4PM7A 4LCMA 1Y54A 4FSFA 1N4OA 2HP9A 3HLCA 1NYMA 2ZM2A 4GD6A 2ZD8A 2WKHA 3GVBA 4JXVA 4GOGA 4KZ7A 5EVIA 3BM6A 4A5RA 2HP6A 4JPMA 4OPRA 4UA9A 5EVIC 3NDGA 4OQIA 4OVDA 5A92A 4C6YA 1PWGA 1MY8A 1RGZA 2WGWA 3E2KA 3QNBA 2HDUA 2ZQDA 3UY6A 2Y2IA 4GKUA 3N8SA 1L0FA 3Q07A 5EE8A 3FYZA 1KDWA 2OLUA 1O7EA 5GHYA 2EX6A 1MWSA 3A3FA 4IVKA 5GL9A 5HAIA 4KZAA 2H10A 1BLHA 2ZLYA 2RCXA 3Q7VA 4BENA 1I2SA 3HUOA 3SH8A 3G31A 5D3OA 5F1FA 3OZHA 3WS0A 1AXBA 1E25A 1K54A 4BLMA 2HDSA 1KVLA 1KGEA 2ZQ7A 5FA7A 2WZXA 5BOHA 1K54C 2WADA 1DY6A 1YLTA 3MKFA 3MXRA 4S2NA 5CECA 2R9XA 3IXDA 1FCNA 4S2NC 1BSGA 4OQGA 2WGIA 4Q8IA 1ESIA 1NYYA 2H0TA 2XF3A 4X56A 3FKWA 4X55A 1DJBA 2Y2LA 5EVLA 3G2ZA 5AQBA 3OCLA 4MBHA 4S2JA 3PAGA 4WYYA 5FSRA 4CJNA 3G35A 1TVFA 2J7VA 4X69A 4Z9QA 4E3KA 3NDEA 5A90A 4KZ6A 1LL5A 1EI5A 2QMIA 3NY4A 4YINA 3ZG8B 5CERA 4M3KA 4QB8A 1ONGA 4UA6A 3HLGA 4LV1A 2BLSA 1RP5A 2Y2NA 2XGNA 3UDFA 3VFFA 1SKFA 2PU2A 3PBSA 4GZBA 4JBFA 4QY6A 1W8QA 1CI9A 2XFTA 1LLBA 4PM5A 2EX9A 2Y2KA 3BLMA 5FQIA 5FI6A 1FSYA 3D4FA 3S22A 2XDMA 4KG6A 5F82A 3PAEA 4BD0A 1YLPA 4E6XA 1C3BA 4KZBA 4L0LA 1QMEA 5TGFA 4GDNA 4JXGA 4KQRA 4ZJ3A 3UN7A 3VSKA 2WKEA 1XA1A 1XP4A 4NK3A 1E3UA 1NY0A 5U47A 1BTLA 3VP0A 3IF6A 5JYPA 3IHAA 3W4QA 4WMCD 1NZOA 1U60A 3UDXA 2RL3A 2X71A 1G6AA 3PBRA 1IYQA 1HD8A 3V5MA 3MBZA 4DE1A 4MLLA 1MKIA 2XR0A 5AQ7A 3Q7ZA 3I7JA 4N9KA 2G2UA 3HVFA 4UAAA 1K56A 3G30A 3WWXA 5CRFA 4E3OA 1YMXA 5DF8A 3M2JA 2Y2PA 3W8KA 5FASA 4KG5A 1I5QA 4OQHA 3UPPA 4PPRA 5CGXA 2ZMAA 2X02A 4P6BA 3C4PA 3O88A 3V3SA 2VGKA 3RXXA 4XUZA 3UNWA 3C7VA 4DXCA 2JC7A 4U0XA 3A3EA 5HARA 3MZFA 1W79A 4LENA 3WS5A 3N8LA 4BJPA 4K0WA 4C75A 4D2OA 4HBUA 2ZJ9A 5KSCA 4QY5A 4RX2A 1MPLA 1TDGA 2IWDA 2WYXA 4ZTKA 3PBNA 1GA0A 2V2FF 3ITBA 1EROA 1GA9A 1Q2PA 3P98A 4IVIA 3GQZA 4MBFA 4KENB 4OPZA 4LV3A 1KGGA 3LEZA 4R23A 4IBRA 4YFMA 4UHUA 4BL2A 4DE0A 3HUNA 2DCFA 2JBFA 4PM8A 2IWCA 3PBOA 2H0YA 5CGSA 1SDNA 4DDSA 4OP8A 4R4RA 4K0XA 4E3LA 1JWVA 4FH4A 2FFFB 5G18A 4N1XA 4RYEA 2X01A 2Y2OA 3HUMA 3VSLA 3V3RA 5HAQA 3A3IA 3ZG7B 1FR6A 5EECA 3OPLA 2XD1A 3W4OA 1ERQA 4OPYA 3VFHA 3FWLA 4HESA 2ZC5B 5CHUA 1G68A 1W5DA 1PYYA 3VP3A 5A93A 3IT9A 3IWOA 1Q2QA 1H8YA 2P9VB 5FQKA 4E3JA 4P85A 5HL1A 1SDEA 3SH7A 1BLPA 5DTTA 4GD8A 5FQQA 4E3IA 1GHIA 2JCHA 1HTZA 2XLNA 5CGWA 1MWRA 5EOEA 4QJGA 2Y91A 1O07A 3JYIA 4KZ3A 3AGFA 1XGIA 1BLCA 5AQAA 3ZG9B 4EQIA 1JWZA 2ZC6B 3ZDJA 1FCOA 1ONHA 1FCMA 4BD1A 4EBNA 2XK1A 4R0QA 3CG5A 3Q82A 2ZQ8A 3Q81A 3ZHHA 1PZOA 3DW0A 4OOYA 2Y2HA 3SS3A 1K57C 5HAPA 1FOFA 4Y0UA 2BG1A 2Q9MA 4JXWA 4MNRA 5HFOA 4DKIA 4E6WA 5FAQA 5EOOA 2UWXA 1YQSA 4PMAA 3TOIA 2DRWA 4LCLA 4DE3A 3ZVTA 3BFFA 4WZ4A 3BFEA 3WS4A 4IBXA 3Q1FA 4DF6A 4OOMA 4NETA 2J9OA 3MFDA 1JWPA 1S6RA 3VOZA 4K91A 1KDSA 3IWQA 1IELA 1YLYA 4OLGA 4S2MA 4U0TA 1TEMA 4B4ZA 2Y2GA 3GRJA 3UPNA 1YLJA 5EUAA 1LHYA 1PZPA 5M1AA 5KSHA 5FQMA 4DDYA 1YLWA 4RA7A 3HLEA 1GHMA 1ERMA 3P09A 3NBLA 4ZJ2A 3BEBA 4KZ8A 5GLBA 1WYBA 3UPOA 4JKTA 2WUQA 3LO7A 1SCWA 3BFCA 3WS1A 4Y7PA 1IEMA 2EX8A 3IXBA 3WRTA 5FI2A 3GR2A 3OPHA 1H5XA 3DWZA 2OV5A 1CEFA 1WYCA 3FZCA 1PW1A 5CXWA 3NI9A 3OCNA 5FDHA 3S4XA 3GSGA 4QU3A 4ZAMA 1IYPA 1XKZA 3LY3A 1I2WA 5CEDA 4U3TA 4OPQA 4JLFA 4JF6A 1CEGA 3N6IA 3BFGA 1K4EA 1BT5A 2V20A 3MXSA 2IWBA 4KG2A 3LY4A 3IXHA 5DF9A 1NRFA 2A3UA 4GNUA 3VP2A 3HLFA 3ZNYA 5GHXA 5EVIB 4WZ5A 4DE2A 1RGYA 4JF5A 2OLVA 4WZ5C 2R9WA 1L0EA 5CHJA 3C7UA 3O3VA 2WGWB 1N9BA 1XA7A 4ID4A 2B5RA 4S2OA 4WELA 3ZNTA 2E8IA 4ZJ1A 1M40A 1ES4A 1IKIA 1XGJA 3DTMA 3UO9A 2HDRA 3SS5A 2EFUA 1M6KA 4XUXA 1EWZA 2Y2QA 4IEDA 4KQOA 5EPHA 5FAPA 3IH9A 3VP4A 2CC1A 2WK0A 3Q7VB 3QHYA 3MKEA 3O86A 4KZ5A 3WS2A 2ZQCA 1YLZA 1K38A 4Y0TA 2P74A 3W4PA 5DVAA 1MWUA 3VOYA 3NCKA 1ES5A 4B88A 2Y2JA 5GLDA 1XXMA 4OONA 5E2HA 3BRMA 4P0MA 5E2EA 4EWFA 5EVID 2EXBA 5FQJA 2J9PA 4PM9A 5GHZA 1JVJA 5GLCA 1CK3A 3ZG5A 2ZQAA 3G2YA 1HZOA 1DJAA 4FD8A 3CJMA 5A91A 3ZCZA 5KMWA 3C4OA 3OPRA 1KVMA 2H5SA 3V39A 3A3JA 4WM9A 3IH8A 4B4XA 3N8RA 4OOLA 1PIOA 2Y59A 1FSWA 2QPNA 1BLSA 3E2LA 4S2KA 4WEJA 3VP1A 3RXWA 1NJ4A 3LCEA 4XXRA 4QD4A 3A3DA 4R1GA 4RX3A 3HLWA 1S0WA 5IHVA 2WAFA 2XEPA 4QHCA 3BFDA 2PBYA 4N92A 3ZGAB 1KE3A 5FAOA 1L0GA 3M6BA 4KZ4A 4S2LA 4LV2A 4HEFA 3UE0A 2EFXA 5E43A 2Y4AA 1K6SA 4R3JA 1FQGA 1RCJA 1K57A 3IF6B 3IQAA 3BYDA 1XX2A 1K6RA 4EBLA 4MBKA 2ZQ9A 3SH9A 1IKGA 3N4IA 1LI0A 5FI7A 4F94A 3PBQA 4OLDA 5CHMA 1OMEA 5TFQA 4UA7A 3GTCA 4OKPA 5HX9A 2Y55A 1KE0A 4RVAA 5M18A 3CZDA 2WKIA 4BQMA 3FV7A 3AGEA 3PTEA 4DRTA 3HBRA 1PW8A 3M2KA 1YMSA 4KQQA 3HL9A 2ZC4B 3GMWA 3CMZA 1YM1A 3IXGA 1MXOA 2EXAA 4PM6A 3UE3A 2J8YA 3V50A 3PBTA 1LL9A 3O87A 4X68A 1K55A 4EBPA 4KZ9A 1BUEA 3ZVWA 1SHVA 1K55C 1J9MA 3MZEA 1WE4A 4OH0A 5KZHA 1E3UD 1JTGA 1ZG4A 2Y2MA 3OC2A 1ZG6A 3TG9A 5CEBA 5L2FA 1ZKJA 1TDLA 1FR1A 1W7FA 1NZUA 1MWTA 4O7DA 3IF5A 1BZAA 2EX2A 4GDBA 4EUZA 2C6WB 2P9VA 1PI4A 4E3NA 2Z2MB 2VGJA 4ZDXA 4Y0OA 3GV9A 1JTDA 2ZM8A 1NXYA 4X6TA 3B3XA 4WEKA 5JYOA 5M19A 2DNSA 3M6HA 4N1HA 4HBTA 4DXBA 5DTSA 4WBGA 5F1GA 3G32A 3ZFZA 1K56D 1XPBA 5I94A 3UE1A 1ES2A 2HPBA 3N7WA 2G2WA 2Q9NA 2PU4A 3IHBA 1MBLA 2GDNA 3AGDA 1K25A 1IYOA 2ZC7A 2ZM0A 2WGVA 4R4SA 4X53A 5GLAA 3EQVA 3IF6C 1CI8A 2QZ6A 3ITAA 4WMCA 1KGFA 2OSUA 1PWCA 4R3BA 1VM1A 1IYSA 3MZDA 3NC8A 5E2GA 3HLBA 5F83A 2JE5A
chains in the Genus database with same CATH superfamily
1KE4A 1DJCA 4BL3A 1H3QA 2QWSA 4MN7A 5FATA 4ETXA 5DF7A 3S1YA 4C3QA 2AVXA 4MEZA 1Z6FA 4FTXA 3UDIA 3NHQA 3IWIA 3SZTA 1G5UA 2L4RA 3IX4A 4LV0A 3C5AA 1ES3A 3T12B 4WL9A 5CTNA 5TR7A 3SS4A 2FFYA 3NIAA 2I72A 3OPPA 3BECA 2QYBA 2XD5A 3HLDA 4CPKA 5CTMA 3TSGA 1LI9A 4S2PA 5DTKA 1QMFA 4EV4A 3H7WA 3IS2B 5J3WA 2ZC3B 4PM7A 1Y54A 3K3CA 3HLCA 2ZM2A 4GD6A 2ZD8A 3GVBA 4JXVA 3EEAA 4A5RA 2W1TB 2LB5A 4JPMA 2EA9A 5A92A 4F3LA 4C6YA 1MY8A 5AVFA 2XRNA 2Y2IA 3N8SA 1O7EA 2EX6A 3A3FA 4IVKA 4KZAA 2MJ6A 2VJWA 2RCXA 5HWVA 3HUOA 5D3OA 3OZHA 3WS0A 1AXBA 1K54A 5BOHA 1A0KA 5CECA 1FCNA 4S2NC 1BSGA 1DJBA 3G2ZA 4S2JA 5FSRA 3PAGA 3CITA 5J4EA 1VEUB 2PD7A 1S4SA 4GLQA 5DFXA 3ZG8B 3UB6A 2BTFP 2BLSA 4CLCB 2Y2NA 5HD5A 4R70A 1W8QA 2PR5A 3CPTB 2XFTA 3TRCA 4PM5A 2Y2KA 5FEGA 2O0YA 4KG6A 4LRZE 1C3BA 4KZBA 5J7EA 4KQRA 3CUEA 1XA1A 1XP4A 4YNRA 1NY0A 3IHAA 1NZOA 2O9CA 2RL3A 1G6AA 2XR0A 3I7JA 2PYPA 1YMXA 2ZBBA 3M2JA 5EFWA 4CLCE 3UPPA 4H6JA 4PPRA 5G4YA 5CGXA 4I3JA 2ZMAA 3V3SA 1H8MA 2JC7A 5EVEA 3LR0A 5HARA 2QHKA 4D2OA 4CLCC 3F1OA 2M1CA 4YOFA 3ICYA 2V0WA 4GS9B 2V2FF 4MBFA 4KENB 4LV3A 3LEZA 4IBRA 2Z6DA 4DE0A 1S66L 3RFBA 4DDSA 1YSQA 4GW9A 2FFFB 4RYEA 2Y2OA 5HAQA 1T19A 1W63M 1ERQA 1Z09A 4HESA 3UE6A 3VP3A 4JGRA 3T1RA 1Q2QA 4E3JA 4LFUA 5FQKA 4BBUA 3QP5A 3SH7A 3MS6A 2JHEA 1GHIA 5CGWA 3JYIA 1O07A 1TS0A 4KZ3A 4I5SA 2I9VA 2ZMVA 4NKPA 3U2AA 4R3AA 1FCOA 1FCMA 3PYPA 3CG5A 3Q81A 3ZHHA 3B33A 1LL8A 4GHIB 4DKIA 5EM0A 4JXWA 5EOOA 2DRWA 4DE3A 3BFFA 3BFEA 3WS4A 2QJ5A 4XT2A 1JWPA 2H28A 4OLGA 4B4ZA 1GSXA 5KIZA 3UPNA 3LYXA 1LHYA 1PZPA 5M1AA 4NEED 5FQMA 3P09A 3NBLA 3H82B 5GLBA 3UPOA 2XA7S 1IEMA 3WRTA 4HNBA 1H5XA 3LFVA 2OV5A 5HL6A 2KX6A 5FDHA 3S4XA 4QU3A 1IYPA 1XKZA 4U3TA 1CEGA 1BT5A 3TE8A 3MXSA 1PNEA 1NRFA 2B95A 5TJJA 1RGYA 4WZ5C 1L0EA 3PR6A 3C7UA 1XA7A 4ID4A 2HJ9C 5F69A 4S2OA 5F5YA 4ZJ1A 1S1YA 4MN6A 5DJTA 4WN5A 4JGOA 4IEDA 4O0PA 1AWIA 2VGLS 3VP4A 4KZ5A 3WS2A 2ZQCA 1YLZA 2P74A 3VOYA 1ES5A 2Y2JA 3QP4A 4L9FA 5E2HA 4BBTA 2J9PA 4PM9A 3FPWA 1JVJA 2ZQAA 5IU1A 3VV4A 2K2NA 5KMWA 3C4OA 3ZYTA 1KVMA 4I39A 3BY8A 2NUPC 3VP1A 2VZWA 2WAFA 2XEPA 4GCZA 2J3WA 1N9NA 2KDKA 4MDZA 4KZ4A 4S2LA 2PR6A 4HEFA 3LI9A 1RCJA 1K57A 3IF6B 3IQAA 1XX2A 4LPZA 4JGPA 4I3AA 1BYWA 4OLDA 3R4KA 4OKPA 2Y55A 5M18A 3GECA 3NOUC 3ZQ5A 3PTEA 1PW8A 4KQQA 3GMWA 3UB7A 1YM1A 3NULA 2V8CA 2J8YA 1D7EA 3PBTA 1K55A 4KZ9A 1OT6A 1SHVA 3MZEA 1WE4A 1E3UD 1JTGA 2Y2MA 3OC2A 2V1BA 4QWOA 5L2FA 2ZL1A 1TDLA 4GDBA 3A0VA 2Z2MB 3B47A 2QKPA 2ZM8A 3B3XA 4DXBA 5DTSA 1VETB 5F1GA 1OTEA 4CQHA 1PFLA 1ES2A 3N7WA 1K25A 1SKOA 1UWNX 3MMHA 4R4SA 4X53A 3EQVA 3IF6C 1K0KA 3ITAA 4Q0IA 1KGFA 2FZ0A 3S7PA 1PWCA 3T4LA 3HCYA 4R3BA 3MZDA 3NC8A 5E2GA 3OPRA 4ARZB 1NRJA 1XJ3A 2A2LA 2OWHA 1H8ZA 2KOIA 3QP1A 2XSSA 3VMAA 3BLSA 4WUJA 2XH9A 4FH2A 3RJUA 4JF4A 1GHPA 4B93A 4B9OA 2PRFA 4KUKA 1YPRA 1VQQA 1ALQA 3MXQA 5AQ9A 1L0DA 2JKTM 1P9RA 5DKKA 2Y79A 4JXSA 4LCMA 1V9YA 2HP9A 2EWWA 3CHWP 4GOGA 4KZ7A 3T1SA 4OPRA 4UA9A 5EVIC 3NDGA 3EGXC 4UQIS 2WGWA 2ZQDA 3FYZA 1KDWA 2NUTC 2A24A 3UB5P 4BENA 1I2SA 2INWA 3SH8A 2O99A 5FEFA 4UEYA 1TD5A 4BLMA 2HDSA 1KGEA 2ZQ7A 1OPXA 4S2NA 2R9XA 1ESIA 1NYYA 2H0TA 3FKWA 5AQBA 4NXFA 3OCLA 2WKPA 3MQOA 1TVFA 2J7VA 4X69A 4E3KA 2UV0E 2B18A 3S7NA 1ONGA 3LI8A 5AVEA 3HLGA 4LV1A 1RP5A 2XGNA 3UDFA 3VFFA 1SKFA 1D1JA 4GZBA 2PBDP 1EW0A 3A0RA 2EX9A 2DMWA 3EGDC 3T1XA 2XDMA 5F82A 3LUQA 3PAEA 4BD0A 1YLPA 4E6XA 4I38A 2P04A 3KX0X 1QMEA 5TGFA 4LRXC 4D60A 5JYPA 3DTIA 1U60A 2X71A 3IX8A 5AJGA 3PBRA 1HD8A 4HP9A 3V5MA 1D06A 2ZOIA 5AQ7A 2G2UA 3T4QA 4UAAA 3S7QA 3T1QB 2J3TD 4E3OA 5DF8A 2GX5A 1CF0A 3MQQA 4KG5A 2X02A 3C4PA 3RXXA 1N9OA 3UNWA 4U0XA 3MZFA 4BJPA 2P7JA 5EV0A 1TF1A 4R6LA 5KSCA 3CPTA 1MPLA 1TDGA 5L8MA 3O5YA 1XJ4A 1DP6A 4MN5A 4P6ZM 4UHUA 4BL2A 2DCFA 2JBFA 3H9WA 4PM8A 4OP8A 4E3LA 4ME4A 1JWVA 3HUMA 3A3IA 3ZG7B 5EECA 3OPLA 4HY8A 3VFHA 3OBFA 3FWLA 5CHUA 1W5DA 1PYYA 5A93A 2P9VB 1SDEA 2VEAA 4BWIA 5DTTA 5FQQA 4E3IA 1MWRA 4EESA 1XGIA 1BLCA 3ZG9B 4EQIA 3B42A 3Q82A 1FIKA 1PZOA 3KSHA 3SS3A 4Y0UA 2BG1A 5HFOA 4E6WA 3A0SA 2UWXA 1YQSA 4LCLA 3ZVTA 1YKDA 5HZHA 4WZ4A 4GS9A 5G4ZA 3FG8A 4DF6A 3MFDA 1S6RA 2HZ5A 1DP8A 3IWQA 4S2MA 4U0TA 3R7WA 2Y2GA 1YLJA 1T1CA 1YLWA 3BEBA 4KZ8A 5TBMB 3VE4A 3LO7A 4PAUA 3BFCA 3WS1A 2XA7M 4Y7PA 3IXBA 3OPHA 4IHQA 3DWZA 2VX8A 3FZCA 5CXWA 3NI9A 3OCNA 2QJ7A 5F68A 5CEDA 1XJ2A 3H7WB 3BFGA 2VV6A 2V20A 2IWBA 1ACFA 3LY4A 2A3UA 4GNUA 3ZNYA 4WZ5A 4ETZA 4DE2A 4GHIA 3O3VA 5DKLA 2P08A 1M40A 4XUXA 5EPHA 1EWZA 5FAPA 3FPVA 3MKEA 3O86A 3SW1A 1PRQA 2VKSA 2W0NA 4P0MA 5E2EA 5FQJA 1CK3A 3ZG5A 1HZOA 1LSWA 3ZCZA 4Z1WA 3A3JA 3LR3A 1PIOA 2PD8A 2Y59A 2PHYA 3E2LA 4WEJA 1NJ4A 4MMNA 4XXRA 1S0WA 4IUHA 4WF0A 3BFDA 3ZGAB 4LV2A 3MQ0A 3P01A 3UE0A 2Y4AA 1FQGA 4MBKA 1N9LA 3P7NA 1YAXA 5CHMA 2V0UA 5TFQA 4UA7A 4RVAA 2WKIA 4BQMA 3FV7A 3HBRA 3M2KA 1YMSA 3HL9A 3DTEA 3IXGA 4HIAA 2JKTI 4H6JB 3ZVWA 4I3IA 1STZA 3G6OA 3TG9A 2VK3A 4EQ1A 1JNUA 1MWTA 3IF5A 2EX2A 4EUZA 4E3NA 2VGJA 4ZDXA 1JTDA 3IBRA 4WEKA 5M19A 3G32A 1NLYA 2JKRM 3CUEC 2GDNA 2ZM0A 2Q0OA 1CI8A 2OSUA 4NXEA 2PDRA 1IYSA 3T4JA 1Y28A 1IFQA 5F83A 4FCFA 4H8RA 4S2IA 4ZBEA 4O8GA 2HP5A 1YT4A 5FDSA 1ZC2A 1MKMA 3WRZA 4P87A 2GNXA 3T50A 3EOIA 2BASA 3QNCA 4OQ0A 4GN2A 4FOFA 5HW3A 3ZG0A 1VHMA 1GCEA 4OP5A 3LICA 1ODVA 4GB7A 2LB9A 2V9AA 3ISGA 3LIEA 3G34A 1MZUA 4GJ4A 2WZZA 4BMWA 5FQ9A 4XT2B 1DRMA 1PI5A 1VETA 2WAEA 1BULA 2Z2LB 2V1ZA 1P9WA 1N4OA 1NYMA 2W3EA 3MSHA 5EVIA 3BM6A 3MR0A 2OOLA 1PWGA 3E2KA 4UQIM 4NXBA 5EE8A 5GHYA 5HAIA 1L3LA 4HJ6A 3Q7VA 1G6OA 2L0WA 3G31A 2YKFA 3PHYA 4Y13A 1H0MA 1KVLA 4K08A 2WADA 1F9IA 1YLTA 3MKFA 3MXRA 3IXDA 4HJ3A 4Y3IA 2XF3A 3CAXA 4PHTA 2IA2A 5EVLA 4MBHA 4CJNA 3G35A 4Z9QA 2FH5A 4KZ6A 2QMIA 4YINA 2GZAA 4M3KA 5CERA 1S67L 4QB8A 4UA6A 2VV7A 1X0OA 3HJIA 2PU2A 4JBFA 2XROA 4QY6A 3QP6A 1TS6A 1VB6A 3BLMA 4HJ4A 5HD3A 3S22A 3KYEA 4GDNA 4JXGA 4WLAA 4ZJ3A 2HJEA 4NK3A 3BQAA 3UMDA 3UDXA 2W1RA 3NJAA 3MBZA 3Q7ZA 4N9KA 3HVFA 1K56A 3WWXA 4X1LA 2VLGA 2Y2PA 3W8KA 1I5QA 2WKQA 4R38A 4OQHA 5L09A 4P6BA 3O88A 3MF0A 3C7VA 1J3WA 3F1PA 3N8LA 4K0WA 3CWFA 4HP4A 2IWDA 2WYXA 4ZTKA 5HWTA 4IVIA 3D9YA 4HOIA 3GQZA 3FC7A 2O9BA 1KGGA 2CMNA 3HUNA 1OT9A 2H0YA 4X25A 5CGSA 1G28A 5G18A 2E8JA 2X01A 3VSLA 3PXPA 3V3RA 3QP8A 5HDSA 4OPYA 2ZC5B 3E4QA 2ZL1B 4Y17A 4ZRRA 1XJ6A 3IWOA 4P85A 5HL1A 4EU0A 3KSIA 2JCHA 1HTZA 2XLNA 5AQAA 1S4RA 1F98A 4FUWA 4HHDA 2ZC6B 1ONHA 4EBNA 2XK1A 4R0QA 1SKOB 3DW0A 4OOYA 2Y2HA 1K57C 1FOFA 2Q9MA 5FAQA 4PMAA 4OOMA 3VOZA 2R78A 3IS2A 1IELA 1YLYA 5KSHA 3DTKA 4RA7A 1ERMA 2W1TA 2ACGA 4ZJ2A 4NG2A 2L1MA 4JKTA 2WUQA 3UMEA 3LR5A 5FI2A 1CEFA 1WYCA 4EERA 3LY3A 3HJKA 3NECA 4LGWA 4JLFA 4Y2FA 2YKHA 5HDDA 1P0ZA 3KSFA 2V8FA 2OAP1 5I5LA 3IXHA 5DF9A 4Q0JA 5GHXA 4DJ2A 5HPIA 2OLVA 1VEUA 2WGWB 2B5RA 4WELA 3ZNTA 3C38A 1ES4A 1IKIA 3DTMA 4CLCA 2A24B 3UO9A 2HDRA 3SS5A 1M6KA 4KQOA 4Y5FA 2WK0A 3QHYA 4L9EA 4DMZA 4X1MA 1GSVA 2J3TC 4Y0TA 1XFNA 5TBMA 1OTBA 4OONA 3BRMA 4EWFA 4KUOA 2EXBA 5GHZA 1V9ZA 2HV1A 3E4OA 3G2YA 4FD8A 3CJMA 2JKRI 2H5SA 2HF6A 4B4XA 4OOLA 1FSWA 4IUKA 2QPNA 3DBAA 4S2KA 3LGOA 3RXWA 4R1GA 3A3DA 4RX3A 3HLWA 2GJ3A 5IHVA 5IT5A 3KYZA 4QHCA 3V67A 2KLIA 3C8CA 3KYQA 1KE3A 3F1NB 3K2NA 3RTYA 4RQ9A 2EFXA 4HH3A 5E43A 1K6SA 3TW8A 3BWLA 1K6RA 3SH9A 4PKYG 1IKGA 3N4IA 4F94A 1LSVA 1OMEA 3GTCA 5HX9A 1KE0A 3AGEA 2ZC4B 3CMZA 3K3DA 1MXOA 2EXAA 4PM6A 2Y8HA 5EM1A 3UE3A 3VOLA 3V50A 1LL9A 4EBPA 4G3WA 1J9MA 4OH0A 3OLOA 3NOTC 5CEBA 1ZKJA 1FR1A 1W7FA 1NZUA 4O7DA 1BZAA 4YWZA 4Y0OA 3GV9A 1LSXA 4X6TA 1SZVA 4HBTA 5HPFA 1NLZA 4MCWA 2HPBA 2PU4A 3IHBA 3AGDA 2ZC7A 2WGVA 5GLAA 4F3LB 4WMCA 3KSGA 1VM1A 3HLBA 4CLCD 5LBRA 3DWKA 5FL3A 1E4DA 1NWZA 5E2FA 2VGLM 5J8XA 5DFYA 4DJ3A 2A49A 3SOIA 2C5WB 3VE3A 4N9LA 3UB9A 5L07A 3H82A 1PWDA 1K4FA 1L2SA 3FKVA 1ESUA 1HVBA 3EQUA 1OTIA 3HREA 1F5MA 2B02A 3G4PA 2XFSA 2XQZA 2HDQA 1W8YA 4P6ZS 5HWWA 4E3MA 3R7WB 1CQAA 4FSFA 1W63Q 2WKHA 1Y4OA 2HP6A 4OQIA 4OVDA 4HH2A 3DAVA 1RGZA 3QNBA 2HDUA 3UY6A 4GKUA 1L0FA 3Q07A 4QPRA 2OLUA 5GL9A 1MWSA 1TS8A 2H10A 1BLHA 2ZLYA 5F1FA 1E25A 5FA7A 2WZXA 1K54C 1DY6A 3KO6A 5IS1A 4OQGA 2WGIA 4Q8IA 4X56A 2Z6CA 2Y2LA 4X55A 4ESPA 4WYYA 3NDEA 5A90A 1LL5A 1EI5A 5K5BA 2OAQ1 3NY4A 4LRYC 3PBSA 4G3VA 1CI9A 1LLBA 3F1OB 1OTAA 2ZOHA 5FQIA 5FI6A 1FSYA 3D4FA 1ZTUA 4EUVA 4L0LA 3UN7A 1TS7A 1DP9A 5CX7A 3VSKA 2WKEA 1E3UA 5U47A 1BTLA 4L9GA 3VP0A 3IF6A 2K7SA 3W4QA 4WMCD 1IYQA 4DE1A 4MLLA 3D72A 1MKIA 3MJQA 1CJFA 2EWVA 3G30A 5CRFA 2W3GA 1GSWA 5FASA 3BY9A 2VGKA 1WA9A 4XUZA 4DXCA 1MC0A 3A3EA 1W79A 4LENA 3WS5A 1IOUA 1OJ5A 4C75A 4HBUA 1HLUP 2ZJ9A 4DN0A 4QY5A 3E4PA 1P97A 4RX2A 2W3DA 3PBNA 5L10A 1GA0A 3ITBA 3P98A 1EROA 1GA9A 1Q2PA 3W2ZA 3ULFA 4OPZA 3T4TA 4R23A 3T4KA 2PAVP 3BW6A 4YFMA 4EEUA 3CLOA 2IWCA 3PBOA 3MFXA 1SDNA 4R4RA 4K0XA 4EEPA 3BJNA 4FH4A 3JVVA 4N1XA 2J80A 1FR6A 2XD1A 3W4OA 4IJGA 4ARZA 3S7OA 1G68A 2V1AA 3IT9A 5HDCA 4AFIA 1H8YA 3TJZC 4II7A 3L9KA 2K31A 4Y15A 1BLPA 4GD8A 5F6AA 5EOEA 4QJGA 2Y91A 3C30A 3AGFA 1JWZA 3ZDJA 4BD1A 2ZQ8A 5HAPA 1T1AA 3RH8B 1KOUA 4MNRA 3TOIA 3LIDA 4IBXA 3U4LP 3Q1FA 4NETA 2J9OA 2G7UA 3OOVA 1OJGA 4K91A 1KDSA 3LEQA 4E04A 5A8BA 1TEMA 3GRJA 4Q0HA 5EUAA 4DDYA 3HLEA 1GHMA 2M7UA 2JN7A 2O9AA 1WYBA 3IX3A 1SCWA 2WKRA 1FILA 1YSPA 3QP2A 4HQAA 2EX8A 3GR2A 1PW1A 2W3FA 3GSGA 4ZAMA 2OWJA 1I2WA 1XFQA 4OPQA 4JF6A 3N6IA 1K4EA 4KG2A 4O01A 3VP2A 3HLFA 5EVIB 4EETB 3LIBA 4JF5A 2R9WA 5HSQA 5CHJA 1N9BA 3LR4A 4G3KA 2E8IA 4EW7A 2JKGA 1XGJA 2EFUA 4EXOA 2Y2QA 3IH9A 2CC1A 3Q7VB 3D3OA 3EEHA 3IBJA 3NOPC 1K38A 3W4PA 5DVAA 5MC7A 1MWUA 1ZHHB 3NCKA 4B88A 5GLDA 1XXMA 3T4OA 5EVID 5GLCA 3UB8A 2HGVA 3C2WA 3JVUA 4KQDA 1DJAA 5A91A 1F2KA 2M7VA 3V39A 4WM9A 2JKFA 3IH8A 3N8RA 4BBVA 1BLSA 3L7HA 3E98A 3LCEA 4JGQA 4QD4A 2PYRA 1UGUA 3BQ8A 2PBYA 4N92A 5FAOA 1L0GA 3M6BA 2ZMFA 3JPUA 4LLOB 4R3JA 3BYDA 4EBLA 2ZQ9A 3CI6A 3GDIA 1T1BA 1LI0A 2W3HA 2W27A 3PBQA 5FI7A 3T4SA 3EWKA 2VA0A 5C5KA 3CZDA 3E0YA 4DRTA 3O87A 4X68A 1BUEA 1K55C 2VV8A 5KZHA 1ZG4A 1ZG6A 3F1PB 1S1ZA 4PKYA 4M4XA 2D01A 2PT7A 2C6WB 2P9VA 1PI4A 1UWPX 5DJUA 1NXYA 1T18A 1OTDA 5JYOA 2DNSA 3M6HA 3LIAA 4N1HA 4WBGA 4NXGA 3ZFZA 1K56D 1XPBA 5I94A 3F1NA 3UE1A 2G2WA 2Q9NA 2D02A 1MBLA 1IYOA 1LT0A 2QZ6A 3LIFA 4HI4A 2JE5A
chains in the Genus database with same CATH topology
1KE4A 1DJCA 4FCFA 4BL3A 3DWKA 4H8RA 1E4DA 1H8ZA 4S2IA 5E2FA 4ZBEA 2HP5A 5J8XA 1YT4A 5FATA 1ZC2A 3VMAA 2A49A 3BLSA 2XH9A 4FH2A 5DF7A 3S1YA 2C5WB 3SOIA 4C3QA 4N9LA 3WRZA 4MEZA 4P87A 1Z6FA 3UDIA 1PWDA 3QNCA 4OQ0A 5HW3A 3IWIA 4GN2A 3RJUA 1K4FA 4JF4A 1GHPA 4LV0A 3ZG0A 1L2SA 3C5AA 1GCEA 1ES3A 3FKVA 4OP5A 1ESUA 5CTNA 1HVBA 4GB7A 5TR7A 3EQUA 3SS4A 2FFYA 3NIAA 2I72A 3OPPA 3BECA 3HREA 3ISGA 2XD5A 3G4PA 3G34A 3HLDA 1VQQA 4CPKA 5CTMA 3TSGA 2WZZA 1LI9A 2XFSA 5FQ9A 4S2PA 5DTKA 1ALQA 1QMFA 4EV4A 2XQZA 5AQ9A 1L0DA 2HDQA 1W8YA 1PI5A 4JXSA 2WAEA 1BULA 2Z2LB 2V1ZA 2ZC3B 4E3MA 4PM7A 4LCMA 1Y54A 4FSFA 1N4OA 2HP9A 3HLCA 1NYMA 2ZM2A 4GD6A 2ZD8A 2WKHA 3GVBA 4JXVA 4GOGA 4KZ7A 5EVIA 3BM6A 4A5RA 2HP6A 4JPMA 4OPRA 4UA9A 5EVIC 3NDGA 4OQIA 4OVDA 5A92A 4C6YA 1PWGA 1MY8A 1RGZA 2WGWA 3E2KA 3QNBA 2HDUA 2ZQDA 3UY6A 2Y2IA 4GKUA 3N8SA 1L0FA 3Q07A 5EE8A 3FYZA 1KDWA 2OLUA 1O7EA 5GHYA 2EX6A 1MWSA 3A3FA 4IVKA 5GL9A 5HAIA 4KZAA 2H10A 1BLHA 2ZLYA 2RCXA 3Q7VA 4BENA 1I2SA 3HUOA 3SH8A 3G31A 5D3OA 5F1FA 3OZHA 3WS0A 1AXBA 1E25A 1K54A 4BLMA 2HDSA 1KVLA 1KGEA 2ZQ7A 5FA7A 2WZXA 5BOHA 1K54C 2WADA 1DY6A 1YLTA 3MKFA 3MXRA 4S2NA 5CECA 2R9XA 3IXDA 1FCNA 4S2NC 1BSGA 4OQGA 2WGIA 4Q8IA 1ESIA 1NYYA 2H0TA 2XF3A 4X56A 3FKWA 4X55A 1DJBA 2Y2LA 5EVLA 3G2ZA 5AQBA 3OCLA 4MBHA 4S2JA 3PAGA 4WYYA 5FSRA 4CJNA 3G35A 1TVFA 2J7VA 4X69A 4Z9QA 4E3KA 3NDEA 5A90A 4KZ6A 1LL5A 1EI5A 2QMIA 3NY4A 4YINA 3ZG8B 5CERA 4M3KA 4QB8A 1ONGA 4UA6A 3HLGA 4LV1A 2BLSA 1RP5A 2Y2NA 2XGNA 3UDFA 3VFFA 1SKFA 2PU2A 3PBSA 4GZBA 4JBFA 4QY6A 1W8QA 1CI9A 2XFTA 1LLBA 4PM5A 2EX9A 2Y2KA 3BLMA 5FQIA 5FI6A 1FSYA 3D4FA 3S22A 2XDMA 4KG6A 5F82A 3PAEA 4BD0A 1YLPA 4E6XA 1C3BA 4KZBA 4L0LA 1QMEA 5TGFA 4GDNA 4JXGA 4KQRA 4ZJ3A 3UN7A 3VSKA 2WKEA 1XA1A 1XP4A 4NK3A 1E3UA 1NY0A 5U47A 1BTLA 3VP0A 3IF6A 5JYPA 3IHAA 3W4QA 4WMCD 1NZOA 1U60A 3UDXA 2RL3A 2X71A 1G6AA 3PBRA 1IYQA 1HD8A 3V5MA 3MBZA 4DE1A 4MLLA 1MKIA 2XR0A 5AQ7A 3Q7ZA 3I7JA 4N9KA 2G2UA 3HVFA 4UAAA 1K56A 3G30A 3WWXA 5CRFA 4E3OA 1YMXA 5DF8A 3M2JA 2Y2PA 3W8KA 5FASA 4KG5A 1I5QA 4OQHA 3UPPA 4PPRA 5CGXA 2ZMAA 2X02A 4P6BA 3C4PA 3O88A 3V3SA 2VGKA 3RXXA 4XUZA 3UNWA 3C7VA 4DXCA 2JC7A 4U0XA 3A3EA 5HARA 3MZFA 1W79A 4LENA 3WS5A 3N8LA 4BJPA 4K0WA 4C75A 4D2OA 4HBUA 2ZJ9A 5KSCA 4QY5A 4RX2A 1MPLA 1TDGA 2IWDA 2WYXA 4ZTKA 3PBNA 1GA0A 2V2FF 3ITBA 1EROA 1GA9A 1Q2PA 3P98A 4IVIA 3GQZA 4MBFA 4KENB 4OPZA 4LV3A 1KGGA 3LEZA 4R23A 4IBRA 4YFMA 4UHUA 4BL2A 4DE0A 3HUNA 2DCFA 2JBFA 4PM8A 2IWCA 3PBOA 2H0YA 5CGSA 1SDNA 4DDSA 4OP8A 4R4RA 4K0XA 4E3LA 1JWVA 4FH4A 2FFFB 5G18A 4N1XA 4RYEA 2X01A 2Y2OA 3HUMA 3VSLA 3V3RA 5HAQA 3A3IA 3ZG7B 1FR6A 5EECA 3OPLA 2XD1A 3W4OA 1ERQA 4OPYA 3VFHA 3FWLA 4HESA 2ZC5B 5CHUA 1G68A 1W5DA 1PYYA 3VP3A 5A93A 3IT9A 3IWOA 1Q2QA 1H8YA 2P9VB 5FQKA 4E3JA 4P85A 5HL1A 1SDEA 3SH7A 1BLPA 5DTTA 4GD8A 5FQQA 4E3IA 1GHIA 2JCHA 1HTZA 2XLNA 5CGWA 1MWRA 5EOEA 4QJGA 2Y91A 1O07A 3JYIA 4KZ3A 3AGFA 1XGIA 1BLCA 5AQAA 3ZG9B 4EQIA 1JWZA 2ZC6B 3ZDJA 1FCOA 1ONHA 1FCMA 4BD1A 4EBNA 2XK1A 4R0QA 3CG5A 3Q82A 2ZQ8A 3Q81A 3ZHHA 1PZOA 3DW0A 4OOYA 2Y2HA 3SS3A 1K57C 5HAPA 1FOFA 4Y0UA 2BG1A 2Q9MA 4JXWA 4MNRA 5HFOA 4DKIA 4E6WA 5FAQA 5EOOA 2UWXA 1YQSA 4PMAA 3TOIA 2DRWA 4LCLA 4DE3A 3ZVTA 3BFFA 4WZ4A 3BFEA 3WS4A 4IBXA 3Q1FA 4DF6A 4OOMA 4NETA 2J9OA 3MFDA 1JWPA 1S6RA 3VOZA 4K91A 1KDSA 3IWQA 1IELA 1YLYA 4OLGA 4S2MA 4U0TA 1TEMA 4B4ZA 2Y2GA 3GRJA 3UPNA 1YLJA 5EUAA 1LHYA 1PZPA 5M1AA 5KSHA 5FQMA 4DDYA 1YLWA 4RA7A 3HLEA 1GHMA 1ERMA 3P09A 3NBLA 4ZJ2A 3BEBA 4KZ8A 5GLBA 1WYBA 3UPOA 4JKTA 2WUQA 3LO7A 1SCWA 3BFCA 3WS1A 4Y7PA 1IEMA 2EX8A 3IXBA 3WRTA 5FI2A 3GR2A 3OPHA 1H5XA 3DWZA 2OV5A 1CEFA 1WYCA 3FZCA 1PW1A 5CXWA 3NI9A 3OCNA 5FDHA 3S4XA 3GSGA 4QU3A 4ZAMA 1IYPA 1XKZA 3LY3A 1I2WA 5CEDA 4U3TA 4OPQA 4JLFA 4JF6A 1CEGA 3N6IA 3BFGA 1K4EA 1BT5A 2V20A 3MXSA 2IWBA 4KG2A 3LY4A 3IXHA 5DF9A 1NRFA 2A3UA 4GNUA 3VP2A 3HLFA 3ZNYA 5GHXA 5EVIB 4WZ5A 4DE2A 1RGYA 4JF5A 2OLVA 4WZ5C 2R9WA 1L0EA 5CHJA 3C7UA 3O3VA 2WGWB 1N9BA 1XA7A 4ID4A 2B5RA 4S2OA 4WELA 3ZNTA 2E8IA 4ZJ1A 1M40A 1ES4A 1IKIA 1XGJA 3DTMA 3UO9A 2HDRA 3SS5A 2EFUA 1M6KA 4XUXA 1EWZA 2Y2QA 4IEDA 4KQOA 5EPHA 5FAPA 3IH9A 3VP4A 2CC1A 2WK0A 3Q7VB 3QHYA 3MKEA 3O86A 4KZ5A 3WS2A 2ZQCA 1YLZA 1K38A 4Y0TA 2P74A 3W4PA 5DVAA 1MWUA 3VOYA 3NCKA 1ES5A 4B88A 2Y2JA 5GLDA 1XXMA 4OONA 5E2HA 3BRMA 4P0MA 5E2EA 4EWFA 5EVID 2EXBA 5FQJA 2J9PA 4PM9A 5GHZA 1JVJA 5GLCA 1CK3A 3ZG5A 2ZQAA 3G2YA 1HZOA 1DJAA 4FD8A 3CJMA 5A91A 3ZCZA 5KMWA 3C4OA 3OPRA 1KVMA 2H5SA 3V39A 3A3JA 4WM9A 3IH8A 4B4XA 3N8RA 4OOLA 1PIOA 2Y59A 1FSWA 2QPNA 1BLSA 3E2LA 4S2KA 4WEJA 3VP1A 3RXWA 1NJ4A 3LCEA 4XXRA 4QD4A 3A3DA 4R1GA 4RX3A 3HLWA 1S0WA 5IHVA 2WAFA 2XEPA 4QHCA 3BFDA 2PBYA 4N92A 3ZGAB 1KE3A 5FAOA 1L0GA 3M6BA 4KZ4A 4S2LA 4LV2A 4HEFA 3UE0A 2EFXA 5E43A 2Y4AA 1K6SA 4R3JA 1FQGA 1RCJA 1K57A 3IF6B 3IQAA 3BYDA 1XX2A 1K6RA 4EBLA 4MBKA 2ZQ9A 3SH9A 1IKGA 3N4IA 1LI0A 5FI7A 4F94A 3PBQA 4OLDA 5CHMA 1OMEA 5TFQA 4UA7A 3GTCA 4OKPA 5HX9A 2Y55A 1KE0A 4RVAA 5M18A 3CZDA 2WKIA 4BQMA 3FV7A 3AGEA 3PTEA 4DRTA 3HBRA 1PW8A 3M2KA 1YMSA 4KQQA 3HL9A 2ZC4B 3GMWA 3CMZA 1YM1A 3IXGA 1MXOA 2EXAA 4PM6A 3UE3A 2J8YA 3V50A 3PBTA 1LL9A 3O87A 4X68A 1K55A 4EBPA 4KZ9A 1BUEA 3ZVWA 1SHVA 1K55C 1J9MA 3MZEA 1WE4A 4OH0A 5KZHA 1E3UD 1JTGA 1ZG4A 2Y2MA 3OC2A 1ZG6A 3TG9A 5CEBA 5L2FA 1ZKJA 1TDLA 1FR1A 1W7FA 1NZUA 1MWTA 4O7DA 3IF5A 1BZAA 2EX2A 4GDBA 4EUZA 2C6WB 2P9VA 1PI4A 4E3NA 2Z2MB 2VGJA 4ZDXA 4Y0OA 3GV9A 1JTDA 2ZM8A 1NXYA 4X6TA 3B3XA 4WEKA 5JYOA 5M19A 2DNSA 3M6HA 4N1HA 4HBTA 4DXBA 5DTSA 4WBGA 5F1GA 3G32A 3ZFZA 1K56D 1XPBA 5I94A 3UE1A 1ES2A 2HPBA 3N7WA 2G2WA 2Q9NA 2PU4A 3IHBA 1MBLA 2GDNA 3AGDA 1K25A 1IYOA 2ZC7A 2ZM0A 2WGVA 4R4SA 4X53A 5GLAA 3EQVA 3IF6C 1CI8A 2QZ6A 3ITAA 4WMCA 1KGFA 2OSUA 1PWCA 4R3BA 1VM1A 1IYSA 3MZDA 3NC8A 5E2GA 3HLBA 5F83A 2JE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KE4 A;  1DJC A;  4FCF A;  4BL3 A;  3DWK A;  4H8R A;  1E4D A;  1H8Z A;  4S2I A;  5E2F A;  4ZBE A;  2HP5 A;  5J8X A;  1YT4 A;  5FAT A;  1ZC2 A;  3VMA A;  2A49 A;  3BLS A;  2XH9 A;  4FH2 A;  5DF7 A;  3S1Y A;  2C5W B;  3SOI A;  4C3Q A;  4N9L A;  3WRZ A;  4MEZ A;  4P87 A;  1Z6F A;  3UDI A;  1PWD A;  3QNC A;  4OQ0 A;  5HW3 A;  3IWI A;  4GN2 A;  3RJU A;  1K4F A;  4JF4 A;  1GHP A;  4LV0 A;  3ZG0 A;  1L2S A;  3C5A A;  1GCE A;  1ES3 A;  3FKV A;  4OP5 A;  1ESU A;  5CTN A;  1HVB A;  4GB7 A;  5TR7 A;  3EQU A;  3SS4 A;  2FFY A;  3NIA A;  2I72 A;  3OPP A;  3BEC A;  3HRE A;  3ISG A;  2XD5 A;  3G4P A;  3G34 A;  3HLD A;  1VQQ A;  4CPK A;  5CTM A;  3TSG A;  2WZZ A;  1LI9 A;  2XFS A;  5FQ9 A;  4S2P A;  5DTK A;  1ALQ A;  1QMF A;  4EV4 A;  2XQZ A;  5AQ9 A;  1L0D A;  2HDQ A;  1W8Y A;  1PI5 A;  4JXS A;  2WAE A;  1BUL A;  2Z2L B;  2V1Z A;  2ZC3 B;  4E3M A;  4PM7 A;  4LCM A;  1Y54 A;  4FSF A;  1N4O A;  2HP9 A;  3HLC A;  1NYM A;  2ZM2 A;  4GD6 A;  2ZD8 A;  2WKH A;  3GVB A;  4JXV A;  4GOG A;  4KZ7 A;  5EVI A;  3BM6 A;  4A5R A;  2HP6 A;  4JPM A;  4OPR A;  4UA9 A;  5EVI C;  3NDG A;  4OQI A;  4OVD A;  5A92 A;  4C6Y A;  1PWG A;  1MY8 A;  1RGZ A;  2WGW A;  3E2K A;  3QNB A;  2HDU A;  2ZQD A;  3UY6 A;  2Y2I A;  4GKU A;  3N8S A;  1L0F A;  3Q07 A;  5EE8 A;  3FYZ A;  1KDW A;  2OLU A;  1O7E A;  5GHY A;  2EX6 A;  1MWS A;  3A3F A;  4IVK A;  5GL9 A;  5HAI A;  4KZA A;  2H10 A;  1BLH A;  2ZLY A;  2RCX A;  3Q7V A;  4BEN A;  1I2S A;  3HUO A;  3SH8 A;  3G31 A;  5D3O A;  5F1F A;  3OZH A;  3WS0 A;  1AXB A;  1E25 A;  1K54 A;  4BLM A;  2HDS A;  1KVL A;  1KGE A;  2ZQ7 A;  5FA7 A;  2WZX A;  5BOH A;  1K54 C;  2WAD A;  1DY6 A;  1YLT A;  3MKF A;  3MXR A;  4S2N A;  5CEC A;  2R9X A;  3IXD A;  1FCN A;  4S2N C;  1BSG A;  4OQG A;  2WGI A;  4Q8I A;  1ESI A;  1NYY A;  2H0T A;  2XF3 A;  4X56 A;  3FKW A;  4X55 A;  1DJB A;  2Y2L A;  5EVL A;  3G2Z A;  5AQB A;  3OCL A;  4MBH A;  4S2J A;  3PAG A;  4WYY A;  5FSR A;  4CJN A;  3G35 A;  1TVF A;  2J7V A;  4X69 A;  4Z9Q A;  4E3K A;  3NDE A;  5A90 A;  4KZ6 A;  1LL5 A;  1EI5 A;  2QMI A;  3NY4 A;  4YIN A;  3ZG8 B;  5CER A;  4M3K A;  4QB8 A;  1ONG A;  4UA6 A;  3HLG A;  4LV1 A;  2BLS A;  1RP5 A;  2Y2N A;  2XGN A;  3UDF A;  3VFF A;  1SKF A;  2PU2 A;  3PBS A;  4GZB A;  4JBF A;  4QY6 A;  1W8Q A;  1CI9 A;  2XFT A;  1LLB A;  4PM5 A;  2EX9 A;  2Y2K A;  3BLM A;  5FQI A;  5FI6 A;  1FSY A;  3D4F A;  3S22 A;  2XDM A;  4KG6 A;  5F82 A;  3PAE A;  4BD0 A;  1YLP A;  4E6X A;  1C3B A;  4KZB A;  4L0L A;  1QME A;  5TGF A;  4GDN A;  4JXG A;  4KQR A;  4ZJ3 A;  3UN7 A;  3VSK A;  2WKE A;  1XA1 A;  1XP4 A;  4NK3 A;  1E3U A;  1NY0 A;  5U47 A;  1BTL A;  3VP0 A;  3IF6 A;  5JYP A;  3IHA A;  3W4Q A;  4WMC D;  1NZO A;  1U60 A;  3UDX A;  2RL3 A;  2X71 A;  1G6A A;  3PBR A;  1IYQ A;  1HD8 A;  3V5M A;  3MBZ A;  4DE1 A;  4MLL A;  1MKI A;  2XR0 A;  5AQ7 A;  3Q7Z A;  3I7J A;  4N9K A;  2G2U A;  3HVF A;  4UAA A;  1K56 A;  3G30 A;  3WWX A;  5CRF A;  4E3O A;  1YMX A;  5DF8 A;  3M2J A;  2Y2P A;  3W8K A;  5FAS A;  4KG5 A;  1I5Q A;  4OQH A;  3UPP A;  4PPR A;  5CGX A;  2ZMA A;  2X02 A;  4P6B A;  3C4P A;  3O88 A;  3V3S A;  2VGK A;  3RXX A;  4XUZ A;  3UNW A;  3C7V A;  4DXC A;  2JC7 A;  4U0X A;  3A3E A;  5HAR A;  3MZF A;  1W79 A;  4LEN A;  3WS5 A;  3N8L A;  4BJP A;  4K0W A;  4C75 A;  4D2O A;  4HBU A;  2ZJ9 A;  5KSC A;  4QY5 A;  4RX2 A;  1MPL A;  1TDG A;  2IWD A;  2WYX A;  4ZTK A;  3PBN A;  1GA0 A;  2V2F F;  3ITB A;  1ERO A;  1GA9 A;  1Q2P A;  3P98 A;  4IVI A;  3GQZ A;  4MBF A;  4KEN B;  4OPZ A;  4LV3 A;  1KGG A;  3LEZ A;  4R23 A;  4IBR A;  4YFM A;  4UHU A;  4BL2 A;  4DE0 A;  3HUN A;  2DCF A;  2JBF A;  4PM8 A;  2IWC A;  3PBO A;  2H0Y A;  5CGS A;  1SDN A;  4DDS A;  4OP8 A;  4R4R A;  4K0X A;  4E3L A;  1JWV A;  4FH4 A;  2FFF B;  5G18 A;  4N1X A;  4RYE A;  2X01 A;  2Y2O A;  3HUM A;  3VSL A;  3V3R A;  5HAQ A;  3A3I A;  3ZG7 B;  1FR6 A;  5EEC A;  3OPL A;  2XD1 A;  3W4O A;  1ERQ A;  4OPY A;  3VFH A;  3FWL A;  4HES A;  2ZC5 B;  5CHU A;  1G68 A;  1W5D A;  1PYY A;  3VP3 A;  5A93 A;  3IT9 A;  3IWO A;  1Q2Q A;  1H8Y A;  2P9V B;  5FQK A;  4E3J A;  4P85 A;  5HL1 A;  1SDE A;  3SH7 A;  1BLP A;  5DTT A;  4GD8 A;  5FQQ A;  4E3I A;  1GHI A;  2JCH A;  1HTZ A;  2XLN A;  5CGW A;  1MWR A;  5EOE A;  4QJG A;  2Y91 A;  1O07 A;  3JYI A;  4KZ3 A;  3AGF A;  1XGI A;  1BLC A;  5AQA A;  3ZG9 B;  4EQI A;  1JWZ A;  2ZC6 B;  3ZDJ A;  1FCO A;  1ONH A;  1FCM A;  4BD1 A;  4EBN A;  2XK1 A;  4R0Q A;  3CG5 A;  3Q82 A;  2ZQ8 A;  3Q81 A;  3ZHH A;  1PZO A;  3DW0 A;  4OOY A;  2Y2H A;  3SS3 A;  1K57 C;  5HAP A;  1FOF A;  4Y0U A;  2BG1 A;  2Q9M A;  4JXW A;  4MNR A;  5HFO A;  4DKI A;  4E6W A;  5FAQ A;  5EOO A;  2UWX A;  1YQS A;  4PMA A;  3TOI A;  2DRW A;  4LCL A;  4DE3 A;  3ZVT A;  3BFF A;  4WZ4 A;  3BFE A;  3WS4 A;  4IBX A;  3Q1F A;  4DF6 A;  4OOM A;  4NET A;  2J9O A;  3MFD A;  1JWP A;  1S6R A;  3VOZ A;  4K91 A;  1KDS A;  3IWQ A;  1IEL A;  1YLY A;  4OLG A;  4S2M A;  4U0T A;  1TEM A;  4B4Z A;  2Y2G A;  3GRJ A;  3UPN A;  1YLJ A;  5EUA A;  1LHY A;  1PZP A;  5M1A A;  5KSH A;  5FQM A;  4DDY A;  1YLW A;  4RA7 A;  3HLE A;  1GHM A;  1ERM A;  3P09 A;  3NBL A;  4ZJ2 A;  3BEB A;  4KZ8 A;  5GLB A;  1WYB A;  3UPO A;  4JKT A;  2WUQ A;  3LO7 A;  1SCW A;  3BFC A;  3WS1 A;  4Y7P A;  1IEM A;  2EX8 A;  3IXB A;  3WRT A;  5FI2 A;  3GR2 A;  3OPH A;  1H5X A;  3DWZ A;  2OV5 A;  1CEF A;  1WYC A;  3FZC A;  1PW1 A;  5CXW A;  3NI9 A;  3OCN A;  5FDH A;  3S4X A;  3GSG A;  4QU3 A;  4ZAM A;  1IYP A;  1XKZ A;  3LY3 A;  1I2W A;  5CED A;  4U3T A;  4OPQ A;  4JLF A;  4JF6 A;  1CEG A;  3N6I A;  3BFG A;  1K4E A;  1BT5 A;  2V20 A;  3MXS A;  2IWB A;  4KG2 A;  3LY4 A;  3IXH A;  5DF9 A;  1NRF A;  2A3U A;  4GNU A;  3VP2 A;  3HLF A;  3ZNY A;  5GHX A;  5EVI B;  4WZ5 A;  4DE2 A;  1RGY A;  4JF5 A;  2OLV A;  4WZ5 C;  2R9W A;  1L0E A;  5CHJ A;  3C7U A;  3O3V A;  2WGW B;  1N9B A;  1XA7 A;  4ID4 A;  2B5R A;  4S2O A;  4WEL A;  3ZNT A;  2E8I A;  4ZJ1 A;  1M40 A;  1ES4 A;  1IKI A;  1XGJ A;  3DTM A;  3UO9 A;  2HDR A;  3SS5 A;  2EFU A;  1M6K A;  4XUX A;  1EWZ A;  2Y2Q A;  4IED A;  4KQO A;  5EPH A;  5FAP A;  3IH9 A;  3VP4 A;  2CC1 A;  2WK0 A;  3Q7V B;  3QHY A;  3MKE A;  3O86 A;  4KZ5 A;  3WS2 A;  2ZQC A;  1YLZ A;  1K38 A;  4Y0T A;  2P74 A;  3W4P A;  5DVA A;  1MWU A;  3VOY A;  3NCK A;  1ES5 A;  4B88 A;  2Y2J A;  5GLD A;  1XXM A;  4OON A;  5E2H A;  3BRM A;  4P0M A;  5E2E A;  4EWF A;  5EVI D;  2EXB A;  5FQJ A;  2J9P A;  4PM9 A;  5GHZ A;  1JVJ A;  5GLC A;  1CK3 A;  3ZG5 A;  2ZQA A;  3G2Y A;  1HZO A;  1DJA A;  4FD8 A;  3CJM A;  5A91 A;  3ZCZ A;  5KMW A;  3C4O A;  3OPR A;  1KVM A;  2H5S A;  3V39 A;  3A3J A;  4WM9 A;  3IH8 A;  4B4X A;  3N8R A;  4OOL A;  1PIO A;  2Y59 A;  1FSW A;  2QPN A;  1BLS A;  3E2L A;  4S2K A;  4WEJ A;  3VP1 A;  3RXW A;  1NJ4 A;  3LCE A;  4XXR A;  4QD4 A;  3A3D A;  4R1G A;  4RX3 A;  3HLW A;  1S0W A;  5IHV A;  2WAF A;  2XEP A;  4QHC A;  3BFD A;  2PBY A;  4N92 A;  3ZGA B;  1KE3 A;  5FAO A;  1L0G A;  3M6B A;  4KZ4 A;  4S2L A;  4LV2 A;  4HEF A;  3UE0 A;  2EFX A;  5E43 A;  2Y4A A;  1K6S A;  4R3J A;  1FQG A;  1RCJ A;  1K57 A;  3IF6 B;  3IQA A;  3BYD A;  1XX2 A;  1K6R A;  4EBL A;  4MBK A;  2ZQ9 A;  3SH9 A;  1IKG A;  3N4I A;  1LI0 A;  5FI7 A;  4F94 A;  3PBQ A;  4OLD A;  5CHM A;  1OME A;  5TFQ A;  4UA7 A;  3GTC A;  4OKP A;  5HX9 A;  2Y55 A;  1KE0 A;  4RVA A;  5M18 A;  3CZD A;  2WKI A;  4BQM A;  3FV7 A;  3AGE A;  3PTE A;  4DRT A;  3HBR A;  1PW8 A;  3M2K A;  1YMS A;  4KQQ A;  3HL9 A;  2ZC4 B;  3GMW A;  3CMZ A;  1YM1 A;  3IXG A;  1MXO A;  2EXA A;  4PM6 A;  3UE3 A;  2J8Y A;  3V50 A;  3PBT A;  1LL9 A;  3O87 A;  4X68 A;  1K55 A;  4EBP A;  4KZ9 A;  1BUE A;  3ZVW A;  1SHV A;  1K55 C;  1J9M A;  3MZE A;  1WE4 A;  4OH0 A;  5KZH A;  1E3U D;  1JTG A;  1ZG4 A;  2Y2M A;  3OC2 A;  1ZG6 A;  3TG9 A;  5CEB A;  5L2F A;  1ZKJ A;  1TDL A;  1FR1 A;  1W7F A;  1NZU A;  1MWT A;  4O7D A;  3IF5 A;  1BZA A;  2EX2 A;  4GDB A;  4EUZ A;  2C6W B;  2P9V A;  1PI4 A;  4E3N A;  2Z2M B;  2VGJ A;  4ZDX A;  4Y0O A;  3GV9 A;  1JTD A;  2ZM8 A;  1NXY A;  4X6T A;  3B3X A;  4WEK A;  5JYO A;  5M19 A;  2DNS A;  3M6H A;  4N1H A;  4HBT A;  4DXB A;  5DTS A;  4WBG A;  5F1G A;  3G32 A;  3ZFZ A;  1K56 D;  1XPB A;  5I94 A;  3UE1 A;  1ES2 A;  2HPB A;  3N7W A;  2G2W A;  2Q9N A;  2PU4 A;  3IHB A;  1MBL A;  2GDN A;  3AGD A;  1K25 A;  1IYO A;  2ZC7 A;  2ZM0 A;  2WGV A;  4R4S A;  4X53 A;  5GLA A;  3EQV A;  3IF6 C;  1CI8 A;  2QZ6 A;  3ITA A;  4WMC A;  1KGF A;  2OSU A;  1PWC A;  4R3B A;  1VM1 A;  1IYS A;  3MZD A;  3NC8 A;  5E2G A;  3HLB A;  5F83 A;  2JE5 A; 
#chains in the Genus database with same CATH topology
 1KE4 A;  1DJC A;  4BL3 A;  1H3Q A;  2QWS A;  4MN7 A;  5FAT A;  4ETX A;  5DF7 A;  3S1Y A;  4C3Q A;  2AVX A;  4MEZ A;  1Z6F A;  4FTX A;  3UDI A;  3NHQ A;  3IWI A;  3SZT A;  1G5U A;  2L4R A;  3IX4 A;  4LV0 A;  3C5A A;  1ES3 A;  3T12 B;  4WL9 A;  5CTN A;  5TR7 A;  3SS4 A;  2FFY A;  3NIA A;  2I72 A;  3OPP A;  3BEC A;  2QYB A;  2XD5 A;  3HLD A;  4CPK A;  5CTM A;  3TSG A;  1LI9 A;  4S2P A;  5DTK A;  1QMF A;  4EV4 A;  3H7W A;  3IS2 B;  5J3W A;  2ZC3 B;  4PM7 A;  1Y54 A;  3K3C A;  3HLC A;  2ZM2 A;  4GD6 A;  2ZD8 A;  3GVB A;  4JXV A;  3EEA A;  4A5R A;  2W1T B;  2LB5 A;  4JPM A;  2EA9 A;  5A92 A;  4F3L A;  4C6Y A;  1MY8 A;  5AVF A;  2XRN A;  2Y2I A;  3N8S A;  1O7E A;  2EX6 A;  3A3F A;  4IVK A;  4KZA A;  2MJ6 A;  2VJW A;  2RCX A;  5HWV A;  3HUO A;  5D3O A;  3OZH A;  3WS0 A;  1AXB A;  1K54 A;  5BOH A;  1A0K A;  5CEC A;  1FCN A;  4S2N C;  1BSG A;  1DJB A;  3G2Z A;  4S2J A;  5FSR A;  3PAG A;  3CIT A;  5J4E A;  1VEU B;  2PD7 A;  1S4S A;  4GLQ A;  5DFX A;  3ZG8 B;  3UB6 A;  2BTF P;  2BLS A;  4CLC B;  2Y2N A;  5HD5 A;  4R70 A;  1W8Q A;  2PR5 A;  3CPT B;  2XFT A;  3TRC A;  4PM5 A;  2Y2K A;  5FEG A;  2O0Y A;  4KG6 A;  4LRZ E;  1C3B A;  4KZB A;  5J7E A;  4KQR A;  3CUE A;  1XA1 A;  1XP4 A;  4YNR A;  1NY0 A;  3IHA A;  1NZO A;  2O9C A;  2RL3 A;  1G6A A;  2XR0 A;  3I7J A;  2PYP A;  1YMX A;  2ZBB A;  3M2J A;  5EFW A;  4CLC E;  3UPP A;  4H6J A;  4PPR A;  5G4Y A;  5CGX A;  4I3J A;  2ZMA A;  3V3S A;  1H8M A;  2JC7 A;  5EVE A;  3LR0 A;  5HAR A;  2QHK A;  4D2O A;  4CLC C;  3F1O A;  2M1C A;  4YOF A;  3ICY A;  2V0W A;  4GS9 B;  2V2F F;  4MBF A;  4KEN B;  4LV3 A;  3LEZ A;  4IBR A;  2Z6D A;  4DE0 A;  1S66 L;  3RFB A;  4DDS A;  1YSQ A;  4GW9 A;  2FFF B;  4RYE A;  2Y2O A;  5HAQ A;  1T19 A;  1W63 M;  1ERQ A;  1Z09 A;  4HES A;  3UE6 A;  3VP3 A;  4JGR A;  3T1R A;  1Q2Q A;  4E3J A;  4LFU A;  5FQK A;  4BBU A;  3QP5 A;  3SH7 A;  3MS6 A;  2JHE A;  1GHI A;  5CGW A;  3JYI A;  1O07 A;  1TS0 A;  4KZ3 A;  4I5S A;  2I9V A;  2ZMV A;  4NKP A;  3U2A A;  4R3A A;  1FCO A;  1FCM A;  3PYP A;  3CG5 A;  3Q81 A;  3ZHH A;  3B33 A;  1LL8 A;  4GHI B;  4DKI A;  5EM0 A;  4JXW A;  5EOO A;  2DRW A;  4DE3 A;  3BFF A;  3BFE A;  3WS4 A;  2QJ5 A;  4XT2 A;  1JWP A;  2H28 A;  4OLG A;  4B4Z A;  1GSX A;  5KIZ A;  3UPN A;  3LYX A;  1LHY A;  1PZP A;  5M1A A;  4NEE D;  5FQM A;  3P09 A;  3NBL A;  3H82 B;  5GLB A;  3UPO A;  2XA7 S;  1IEM A;  3WRT A;  4HNB A;  1H5X A;  3LFV A;  2OV5 A;  5HL6 A;  2KX6 A;  5FDH A;  3S4X A;  4QU3 A;  1IYP A;  1XKZ A;  4U3T A;  1CEG A;  1BT5 A;  3TE8 A;  3MXS A;  1PNE A;  1NRF A;  2B95 A;  5TJJ A;  1RGY A;  4WZ5 C;  1L0E A;  3PR6 A;  3C7U A;  1XA7 A;  4ID4 A;  2HJ9 C;  5F69 A;  4S2O A;  5F5Y A;  4ZJ1 A;  1S1Y A;  4MN6 A;  5DJT A;  4WN5 A;  4JGO A;  4IED A;  4O0P A;  1AWI A;  2VGL S;  3VP4 A;  4KZ5 A;  3WS2 A;  2ZQC A;  1YLZ A;  2P74 A;  3VOY A;  1ES5 A;  2Y2J A;  3QP4 A;  4L9F A;  5E2H A;  4BBT A;  2J9P A;  4PM9 A;  3FPW A;  1JVJ A;  2ZQA A;  5IU1 A;  3VV4 A;  2K2N A;  5KMW A;  3C4O A;  3ZYT A;  1KVM A;  4I39 A;  3BY8 A;  2NUP C;  3VP1 A;  2VZW A;  2WAF A;  2XEP A;  4GCZ A;  2J3W A;  1N9N A;  2KDK A;  4MDZ A;  4KZ4 A;  4S2L A;  2PR6 A;  4HEF A;  3LI9 A;  1RCJ A;  1K57 A;  3IF6 B;  3IQA A;  1XX2 A;  4LPZ A;  4JGP A;  4I3A A;  1BYW A;  4OLD A;  3R4K A;  4OKP A;  2Y55 A;  5M18 A;  3GEC A;  3NOU C;  3ZQ5 A;  3PTE A;  1PW8 A;  4KQQ A;  3GMW A;  3UB7 A;  1YM1 A;  3NUL A;  2V8C A;  2J8Y A;  1D7E A;  3PBT A;  1K55 A;  4KZ9 A;  1OT6 A;  1SHV A;  3MZE A;  1WE4 A;  1E3U D;  1JTG A;  2Y2M A;  3OC2 A;  2V1B A;  4QWO A;  5L2F A;  2ZL1 A;  1TDL A;  4GDB A;  3A0V A;  2Z2M B;  3B47 A;  2QKP A;  2ZM8 A;  3B3X A;  4DXB A;  5DTS A;  1VET B;  5F1G A;  1OTE A;  4CQH A;  1PFL A;  1ES2 A;  3N7W A;  1K25 A;  1SKO A;  1UWN X;  3MMH A;  4R4S A;  4X53 A;  3EQV A;  3IF6 C;  1K0K A;  3ITA A;  4Q0I A;  1KGF A;  2FZ0 A;  3S7P A;  1PWC A;  3T4L A;  3HCY A;  4R3B A;  3MZD A;  3NC8 A;  5E2G A;  3OPR A;  4ARZ B;  1NRJ A;  1XJ3 A;  2A2L A;  2OWH A;  1H8Z A;  2KOI A;  3QP1 A;  2XSS A;  3VMA A;  3BLS A;  4WUJ A;  2XH9 A;  4FH2 A;  3RJU A;  4JF4 A;  1GHP A;  4B93 A;  4B9O A;  2PRF A;  4KUK A;  1YPR A;  1VQQ A;  1ALQ A;  3MXQ A;  5AQ9 A;  1L0D A;  2JKT M;  1P9R A;  5DKK A;  2Y79 A;  4JXS A;  4LCM A;  1V9Y A;  2HP9 A;  2EWW A;  3CHW P;  4GOG A;  4KZ7 A;  3T1S A;  4OPR A;  4UA9 A;  5EVI C;  3NDG A;  3EGX C;  4UQI S;  2WGW A;  2ZQD A;  3FYZ A;  1KDW A;  2NUT C;  2A24 A;  3UB5 P;  4BEN A;  1I2S A;  2INW A;  3SH8 A;  2O99 A;  5FEF A;  4UEY A;  1TD5 A;  4BLM A;  2HDS A;  1KGE A;  2ZQ7 A;  1OPX A;  4S2N A;  2R9X A;  1ESI A;  1NYY A;  2H0T A;  3FKW A;  5AQB A;  4NXF A;  3OCL A;  2WKP A;  3MQO A;  1TVF A;  2J7V A;  4X69 A;  4E3K A;  2UV0 E;  2B18 A;  3S7N A;  1ONG A;  3LI8 A;  5AVE A;  3HLG A;  4LV1 A;  1RP5 A;  2XGN A;  3UDF A;  3VFF A;  1SKF A;  1D1J A;  4GZB A;  2PBD P;  1EW0 A;  3A0R A;  2EX9 A;  2DMW A;  3EGD C;  3T1X A;  2XDM A;  5F82 A;  3LUQ A;  3PAE A;  4BD0 A;  1YLP A;  4E6X A;  4I38 A;  2P04 A;  3KX0 X;  1QME A;  5TGF A;  4LRX C;  4D60 A;  5JYP A;  3DTI A;  1U60 A;  2X71 A;  3IX8 A;  5AJG A;  3PBR A;  1HD8 A;  4HP9 A;  3V5M A;  1D06 A;  2ZOI A;  5AQ7 A;  2G2U A;  3T4Q A;  4UAA A;  3S7Q A;  3T1Q B;  2J3T D;  4E3O A;  5DF8 A;  2GX5 A;  1CF0 A;  3MQQ A;  4KG5 A;  2X02 A;  3C4P A;  3RXX A;  1N9O A;  3UNW A;  4U0X A;  3MZF A;  4BJP A;  2P7J A;  5EV0 A;  1TF1 A;  4R6L A;  5KSC A;  3CPT A;  1MPL A;  1TDG A;  5L8M A;  3O5Y A;  1XJ4 A;  1DP6 A;  4MN5 A;  4P6Z M;  4UHU A;  4BL2 A;  2DCF A;  2JBF A;  3H9W A;  4PM8 A;  4OP8 A;  4E3L A;  4ME4 A;  1JWV A;  3HUM A;  3A3I A;  3ZG7 B;  5EEC A;  3OPL A;  4HY8 A;  3VFH A;  3OBF A;  3FWL A;  5CHU A;  1W5D A;  1PYY A;  5A93 A;  2P9V B;  1SDE A;  2VEA A;  4BWI A;  5DTT A;  5FQQ A;  4E3I A;  1MWR A;  4EES A;  1XGI A;  1BLC A;  3ZG9 B;  4EQI A;  3B42 A;  3Q82 A;  1FIK A;  1PZO A;  3KSH A;  3SS3 A;  4Y0U A;  2BG1 A;  5HFO A;  4E6W A;  3A0S A;  2UWX A;  1YQS A;  4LCL A;  3ZVT A;  1YKD A;  5HZH A;  4WZ4 A;  4GS9 A;  5G4Z A;  3FG8 A;  4DF6 A;  3MFD A;  1S6R A;  2HZ5 A;  1DP8 A;  3IWQ A;  4S2M A;  4U0T A;  3R7W A;  2Y2G A;  1YLJ A;  1T1C A;  1YLW A;  3BEB A;  4KZ8 A;  5TBM B;  3VE4 A;  3LO7 A;  4PAU A;  3BFC A;  3WS1 A;  2XA7 M;  4Y7P A;  3IXB A;  3OPH A;  4IHQ A;  3DWZ A;  2VX8 A;  3FZC A;  5CXW A;  3NI9 A;  3OCN A;  2QJ7 A;  5F68 A;  5CED A;  1XJ2 A;  3H7W B;  3BFG A;  2VV6 A;  2V20 A;  2IWB A;  1ACF A;  3LY4 A;  2A3U A;  4GNU A;  3ZNY A;  4WZ5 A;  4ETZ A;  4DE2 A;  4GHI A;  3O3V A;  5DKL A;  2P08 A;  1M40 A;  4XUX A;  5EPH A;  1EWZ A;  5FAP A;  3FPV A;  3MKE A;  3O86 A;  3SW1 A;  1PRQ A;  2VKS A;  2W0N A;  4P0M A;  5E2E A;  5FQJ A;  1CK3 A;  3ZG5 A;  1HZO A;  1LSW A;  3ZCZ A;  4Z1W A;  3A3J A;  3LR3 A;  1PIO A;  2PD8 A;  2Y59 A;  2PHY A;  3E2L A;  4WEJ A;  1NJ4 A;  4MMN A;  4XXR A;  1S0W A;  4IUH A;  4WF0 A;  3BFD A;  3ZGA B;  4LV2 A;  3MQ0 A;  3P01 A;  3UE0 A;  2Y4A A;  1FQG A;  4MBK A;  1N9L A;  3P7N A;  1YAX A;  5CHM A;  2V0U A;  5TFQ A;  4UA7 A;  4RVA A;  2WKI A;  4BQM A;  3FV7 A;  3HBR A;  3M2K A;  1YMS A;  3HL9 A;  3DTE A;  3IXG A;  4HIA A;  2JKT I;  4H6J B;  3ZVW A;  4I3I A;  1STZ A;  3G6O A;  3TG9 A;  2VK3 A;  4EQ1 A;  1JNU A;  1MWT A;  3IF5 A;  2EX2 A;  4EUZ A;  4E3N A;  2VGJ A;  4ZDX A;  1JTD A;  3IBR A;  4WEK A;  5M19 A;  3G32 A;  1NLY A;  2JKR M;  3CUE C;  2GDN A;  2ZM0 A;  2Q0O A;  1CI8 A;  2OSU A;  4NXE A;  2PDR A;  1IYS A;  3T4J A;  1Y28 A;  1IFQ A;  5F83 A;  4FCF A;  4H8R A;  4S2I A;  4ZBE A;  4O8G A;  2HP5 A;  1YT4 A;  5FDS A;  1ZC2 A;  1MKM A;  3WRZ A;  4P87 A;  2GNX A;  3T50 A;  3EOI A;  2BAS A;  3QNC A;  4OQ0 A;  4GN2 A;  4FOF A;  5HW3 A;  3ZG0 A;  1VHM A;  1GCE A;  4OP5 A;  3LIC A;  1ODV A;  4GB7 A;  2LB9 A;  2V9A A;  3ISG A;  3LIE A;  3G34 A;  1MZU A;  4GJ4 A;  2WZZ A;  4BMW A;  5FQ9 A;  4XT2 B;  1DRM A;  1PI5 A;  1VET A;  2WAE A;  1BUL A;  2Z2L B;  2V1Z A;  1P9W A;  1N4O A;  1NYM A;  2W3E A;  3MSH A;  5EVI A;  3BM6 A;  3MR0 A;  2OOL A;  1PWG A;  3E2K A;  4UQI M;  4NXB A;  5EE8 A;  5GHY A;  5HAI A;  1L3L A;  4HJ6 A;  3Q7V A;  1G6O A;  2L0W A;  3G31 A;  2YKF A;  3PHY A;  4Y13 A;  1H0M A;  1KVL A;  4K08 A;  2WAD A;  1F9I A;  1YLT A;  3MKF A;  3MXR A;  3IXD A;  4HJ3 A;  4Y3I A;  2XF3 A;  3CAX A;  4PHT A;  2IA2 A;  5EVL A;  4MBH A;  4CJN A;  3G35 A;  4Z9Q A;  2FH5 A;  4KZ6 A;  2QMI A;  4YIN A;  2GZA A;  4M3K A;  5CER A;  1S67 L;  4QB8 A;  4UA6 A;  2VV7 A;  1X0O A;  3HJI A;  2PU2 A;  4JBF A;  2XRO A;  4QY6 A;  3QP6 A;  1TS6 A;  1VB6 A;  3BLM A;  4HJ4 A;  5HD3 A;  3S22 A;  3KYE A;  4GDN A;  4JXG A;  4WLA A;  4ZJ3 A;  2HJE A;  4NK3 A;  3BQA A;  3UMD A;  3UDX A;  2W1R A;  3NJA A;  3MBZ A;  3Q7Z A;  4N9K A;  3HVF A;  1K56 A;  3WWX A;  4X1L A;  2VLG A;  2Y2P A;  3W8K A;  1I5Q A;  2WKQ A;  4R38 A;  4OQH A;  5L09 A;  4P6B A;  3O88 A;  3MF0 A;  3C7V A;  1J3W A;  3F1P A;  3N8L A;  4K0W A;  3CWF A;  4HP4 A;  2IWD A;  2WYX A;  4ZTK A;  5HWT A;  4IVI A;  3D9Y A;  4HOI A;  3GQZ A;  3FC7 A;  2O9B A;  1KGG A;  2CMN A;  3HUN A;  1OT9 A;  2H0Y A;  4X25 A;  5CGS A;  1G28 A;  5G18 A;  2E8J A;  2X01 A;  3VSL A;  3PXP A;  3V3R A;  3QP8 A;  5HDS A;  4OPY A;  2ZC5 B;  3E4Q A;  2ZL1 B;  4Y17 A;  4ZRR A;  1XJ6 A;  3IWO A;  4P85 A;  5HL1 A;  4EU0 A;  3KSI A;  2JCH A;  1HTZ A;  2XLN A;  5AQA A;  1S4R A;  1F98 A;  4FUW A;  4HHD A;  2ZC6 B;  1ONH A;  4EBN A;  2XK1 A;  4R0Q A;  1SKO B;  3DW0 A;  4OOY A;  2Y2H A;  1K57 C;  1FOF A;  2Q9M A;  5FAQ A;  4PMA A;  4OOM A;  3VOZ A;  2R78 A;  3IS2 A;  1IEL A;  1YLY A;  5KSH A;  3DTK A;  4RA7 A;  1ERM A;  2W1T A;  2ACG A;  4ZJ2 A;  4NG2 A;  2L1M A;  4JKT A;  2WUQ A;  3UME A;  3LR5 A;  5FI2 A;  1CEF A;  1WYC A;  4EER A;  3LY3 A;  3HJK A;  3NEC A;  4LGW A;  4JLF A;  4Y2F A;  2YKH A;  5HDD A;  1P0Z A;  3KSF A;  2V8F A;  2OAP 1;  5I5L A;  3IXH A;  5DF9 A;  4Q0J A;  5GHX A;  4DJ2 A;  5HPI A;  2OLV A;  1VEU A;  2WGW B;  2B5R A;  4WEL A;  3ZNT A;  3C38 A;  1ES4 A;  1IKI A;  3DTM A;  4CLC A;  2A24 B;  3UO9 A;  2HDR A;  3SS5 A;  1M6K A;  4KQO A;  4Y5F A;  2WK0 A;  3QHY A;  4L9E A;  4DMZ A;  4X1M A;  1GSV A;  2J3T C;  4Y0T A;  1XFN A;  5TBM A;  1OTB A;  4OON A;  3BRM A;  4EWF A;  4KUO A;  2EXB A;  5GHZ A;  1V9Z A;  2HV1 A;  3E4O A;  3G2Y A;  4FD8 A;  3CJM A;  2JKR I;  2H5S A;  2HF6 A;  4B4X A;  4OOL A;  1FSW A;  4IUK A;  2QPN A;  3DBA A;  4S2K A;  3LGO A;  3RXW A;  4R1G A;  3A3D A;  4RX3 A;  3HLW A;  2GJ3 A;  5IHV A;  5IT5 A;  3KYZ A;  4QHC A;  3V67 A;  2KLI A;  3C8C A;  3KYQ A;  1KE3 A;  3F1N B;  3K2N A;  3RTY A;  4RQ9 A;  2EFX A;  4HH3 A;  5E43 A;  1K6S A;  3TW8 A;  3BWL A;  1K6R A;  3SH9 A;  4PKY G;  1IKG A;  3N4I A;  4F94 A;  1LSV A;  1OME A;  3GTC A;  5HX9 A;  1KE0 A;  3AGE A;  2ZC4 B;  3CMZ A;  3K3D A;  1MXO A;  2EXA A;  4PM6 A;  2Y8H A;  5EM1 A;  3UE3 A;  3VOL A;  3V50 A;  1LL9 A;  4EBP A;  4G3W A;  1J9M A;  4OH0 A;  3OLO A;  3NOT C;  5CEB A;  1ZKJ A;  1FR1 A;  1W7F A;  1NZU A;  4O7D A;  1BZA A;  4YWZ A;  4Y0O A;  3GV9 A;  1LSX A;  4X6T A;  1SZV A;  4HBT A;  5HPF A;  1NLZ A;  4MCW A;  2HPB A;  2PU4 A;  3IHB A;  3AGD A;  2ZC7 A;  2WGV A;  5GLA A;  4F3L B;  4WMC A;  3KSG A;  1VM1 A;  3HLB A;  4CLC D;  5LBR A;  3DWK A;  5FL3 A;  1E4D A;  1NWZ A;  5E2F A;  2VGL M;  5J8X A;  5DFY A;  4DJ3 A;  2A49 A;  3SOI A;  2C5W B;  3VE3 A;  4N9L A;  3UB9 A;  5L07 A;  3H82 A;  1PWD A;  1K4F A;  1L2S A;  3FKV A;  1ESU A;  1HVB A;  3EQU A;  1OTI A;  3HRE A;  1F5M A;  2B02 A;  3G4P A;  2XFS A;  2XQZ A;  2HDQ A;  1W8Y A;  4P6Z S;  5HWW A;  4E3M A;  3R7W B;  1CQA A;  4FSF A;  1W63 Q;  2WKH A;  1Y4O A;  2HP6 A;  4OQI A;  4OVD A;  4HH2 A;  3DAV A;  1RGZ A;  3QNB A;  2HDU A;  3UY6 A;  4GKU A;  1L0F A;  3Q07 A;  4QPR A;  2OLU A;  5GL9 A;  1MWS A;  1TS8 A;  2H10 A;  1BLH A;  2ZLY A;  5F1F A;  1E25 A;  5FA7 A;  2WZX A;  1K54 C;  1DY6 A;  3KO6 A;  5IS1 A;  4OQG A;  2WGI A;  4Q8I A;  4X56 A;  2Z6C A;  2Y2L A;  4X55 A;  4ESP A;  4WYY A;  3NDE A;  5A90 A;  1LL5 A;  1EI5 A;  5K5B A;  2OAQ 1;  3NY4 A;  4LRY C;  3PBS A;  4G3V A;  1CI9 A;  1LLB A;  3F1O B;  1OTA A;  2ZOH A;  5FQI A;  5FI6 A;  1FSY A;  3D4F A;  1ZTU A;  4EUV A;  4L0L A;  3UN7 A;  1TS7 A;  1DP9 A;  5CX7 A;  3VSK A;  2WKE A;  1E3U A;  5U47 A;  1BTL A;  4L9G A;  3VP0 A;  3IF6 A;  2K7S A;  3W4Q A;  4WMC D;  1IYQ A;  4DE1 A;  4MLL A;  3D72 A;  1MKI A;  3MJQ A;  1CJF A;  2EWV A;  3G30 A;  5CRF A;  2W3G A;  1GSW A;  5FAS A;  3BY9 A;  2VGK A;  1WA9 A;  4XUZ A;  4DXC A;  1MC0 A;  3A3E A;  1W79 A;  4LEN A;  3WS5 A;  1IOU A;  1OJ5 A;  4C75 A;  4HBU A;  1HLU P;  2ZJ9 A;  4DN0 A;  4QY5 A;  3E4P A;  1P97 A;  4RX2 A;  2W3D A;  3PBN A;  5L10 A;  1GA0 A;  3ITB A;  3P98 A;  1ERO A;  1GA9 A;  1Q2P A;  3W2Z A;  3ULF A;  4OPZ A;  3T4T A;  4R23 A;  3T4K A;  2PAV P;  3BW6 A;  4YFM A;  4EEU A;  3CLO A;  2IWC A;  3PBO A;  3MFX A;  1SDN A;  4R4R A;  4K0X A;  4EEP A;  3BJN A;  4FH4 A;  3JVV A;  4N1X A;  2J80 A;  1FR6 A;  2XD1 A;  3W4O A;  4IJG A;  4ARZ A;  3S7O A;  1G68 A;  2V1A A;  3IT9 A;  5HDC A;  4AFI A;  1H8Y A;  3TJZ C;  4II7 A;  3L9K A;  2K31 A;  4Y15 A;  1BLP A;  4GD8 A;  5F6A A;  5EOE A;  4QJG A;  2Y91 A;  3C30 A;  3AGF A;  1JWZ A;  3ZDJ A;  4BD1 A;  2ZQ8 A;  5HAP A;  1T1A A;  3RH8 B;  1KOU A;  4MNR A;  3TOI A;  3LID A;  4IBX A;  3U4L P;  3Q1F A;  4NET A;  2J9O A;  2G7U A;  3OOV A;  1OJG A;  4K91 A;  1KDS A;  3LEQ A;  4E04 A;  5A8B A;  1TEM A;  3GRJ A;  4Q0H A;  5EUA A;  4DDY A;  3HLE A;  1GHM A;  2M7U A;  2JN7 A;  2O9A A;  1WYB A;  3IX3 A;  1SCW A;  2WKR A;  1FIL A;  1YSP A;  3QP2 A;  4HQA A;  2EX8 A;  3GR2 A;  1PW1 A;  2W3F A;  3GSG A;  4ZAM A;  2OWJ A;  1I2W A;  1XFQ A;  4OPQ A;  4JF6 A;  3N6I A;  1K4E A;  4KG2 A;  4O01 A;  3VP2 A;  3HLF A;  5EVI B;  4EET B;  3LIB A;  4JF5 A;  2R9W A;  5HSQ A;  5CHJ A;  1N9B A;  3LR4 A;  4G3K A;  2E8I A;  4EW7 A;  2JKG A;  1XGJ A;  2EFU A;  4EXO A;  2Y2Q A;  3IH9 A;  2CC1 A;  3Q7V B;  3D3O A;  3EEH A;  3IBJ A;  3NOP C;  1K38 A;  3W4P A;  5DVA A;  5MC7 A;  1MWU A;  1ZHH B;  3NCK A;  4B88 A;  5GLD A;  1XXM A;  3T4O A;  5EVI D;  5GLC A;  3UB8 A;  2HGV A;  3C2W A;  3JVU A;  4KQD A;  1DJA A;  5A91 A;  1F2K A;  2M7V A;  3V39 A;  4WM9 A;  2JKF A;  3IH8 A;  3N8R A;  4BBV A;  1BLS A;  3L7H A;  3E98 A;  3LCE A;  4JGQ A;  4QD4 A;  2PYR A;  1UGU A;  3BQ8 A;  2PBY A;  4N92 A;  5FAO A;  1L0G A;  3M6B A;  2ZMF A;  3JPU A;  4LLO B;  4R3J A;  3BYD A;  4EBL A;  2ZQ9 A;  3CI6 A;  3GDI A;  1T1B A;  1LI0 A;  2W3H A;  2W27 A;  3PBQ A;  5FI7 A;  3T4S A;  3EWK A;  2VA0 A;  5C5K A;  3CZD A;  3E0Y A;  4DRT A;  3O87 A;  4X68 A;  1BUE A;  1K55 C;  2VV8 A;  5KZH A;  1ZG4 A;  1ZG6 A;  3F1P B;  1S1Z A;  4PKY A;  4M4X A;  2D01 A;  2PT7 A;  2C6W B;  2P9V A;  1PI4 A;  1UWP X;  5DJU A;  1NXY A;  1T18 A;  1OTD A;  5JYO A;  2DNS A;  3M6H A;  3LIA A;  4N1H A;  4WBG A;  4NXG A;  3ZFZ A;  1K56 D;  1XPB A;  5I94 A;  3F1N A;  3UE1 A;  2G2W A;  2Q9N A;  2D02 A;  1MBL A;  1IYO A;  1LT0 A;  2QZ6 A;  3LIF A;  4HI4 A;  2JE5 A; 
#chains in the Genus database with same CATH homology
 1KE4 A;  1DJC A;  4FCF A;  4BL3 A;  3DWK A;  4H8R A;  1E4D A;  1H8Z A;  4S2I A;  5E2F A;  4ZBE A;  2HP5 A;  5J8X A;  1YT4 A;  5FAT A;  1ZC2 A;  3VMA A;  2A49 A;  3BLS A;  2XH9 A;  4FH2 A;  5DF7 A;  3S1Y A;  2C5W B;  3SOI A;  4C3Q A;  4N9L A;  3WRZ A;  4MEZ A;  4P87 A;  1Z6F A;  3UDI A;  1PWD A;  3QNC A;  4OQ0 A;  5HW3 A;  3IWI A;  4GN2 A;  3RJU A;  1K4F A;  4JF4 A;  1GHP A;  4LV0 A;  3ZG0 A;  1L2S A;  3C5A A;  1GCE A;  1ES3 A;  3FKV A;  4OP5 A;  1ESU A;  5CTN A;  1HVB A;  4GB7 A;  5TR7 A;  3EQU A;  3SS4 A;  2FFY A;  3NIA A;  2I72 A;  3OPP A;  3BEC A;  3HRE A;  3ISG A;  2XD5 A;  3G4P A;  3G34 A;  3HLD A;  1VQQ A;  4CPK A;  5CTM A;  3TSG A;  2WZZ A;  1LI9 A;  2XFS A;  5FQ9 A;  4S2P A;  5DTK A;  1ALQ A;  1QMF A;  4EV4 A;  2XQZ A;  5AQ9 A;  1L0D A;  2HDQ A;  1W8Y A;  1PI5 A;  4JXS A;  2WAE A;  1BUL A;  2Z2L B;  2V1Z A;  2ZC3 B;  4E3M A;  4PM7 A;  4LCM A;  1Y54 A;  4FSF A;  1N4O A;  2HP9 A;  3HLC A;  1NYM A;  2ZM2 A;  4GD6 A;  2ZD8 A;  2WKH A;  3GVB A;  4JXV A;  4GOG A;  4KZ7 A;  5EVI A;  3BM6 A;  4A5R A;  2HP6 A;  4JPM A;  4OPR A;  4UA9 A;  5EVI C;  3NDG A;  4OQI A;  4OVD A;  5A92 A;  4C6Y A;  1PWG A;  1MY8 A;  1RGZ A;  2WGW A;  3E2K A;  3QNB A;  2HDU A;  2ZQD A;  3UY6 A;  2Y2I A;  4GKU A;  3N8S A;  1L0F A;  3Q07 A;  5EE8 A;  3FYZ A;  1KDW A;  2OLU A;  1O7E A;  5GHY A;  2EX6 A;  1MWS A;  3A3F A;  4IVK A;  5GL9 A;  5HAI A;  4KZA A;  2H10 A;  1BLH A;  2ZLY A;  2RCX A;  3Q7V A;  4BEN A;  1I2S A;  3HUO A;  3SH8 A;  3G31 A;  5D3O A;  5F1F A;  3OZH A;  3WS0 A;  1AXB A;  1E25 A;  1K54 A;  4BLM A;  2HDS A;  1KVL A;  1KGE A;  2ZQ7 A;  5FA7 A;  2WZX A;  5BOH A;  1K54 C;  2WAD A;  1DY6 A;  1YLT A;  3MKF A;  3MXR A;  4S2N A;  5CEC A;  2R9X A;  3IXD A;  1FCN A;  4S2N C;  1BSG A;  4OQG A;  2WGI A;  4Q8I A;  1ESI A;  1NYY A;  2H0T A;  2XF3 A;  4X56 A;  3FKW A;  4X55 A;  1DJB A;  2Y2L A;  5EVL A;  3G2Z A;  5AQB A;  3OCL A;  4MBH A;  4S2J A;  3PAG A;  4WYY A;  5FSR A;  4CJN A;  3G35 A;  1TVF A;  2J7V A;  4X69 A;  4Z9Q A;  4E3K A;  3NDE A;  5A90 A;  4KZ6 A;  1LL5 A;  1EI5 A;  2QMI A;  3NY4 A;  4YIN A;  3ZG8 B;  5CER A;  4M3K A;  4QB8 A;  1ONG A;  4UA6 A;  3HLG A;  4LV1 A;  2BLS A;  1RP5 A;  2Y2N A;  2XGN A;  3UDF A;  3VFF A;  1SKF A;  2PU2 A;  3PBS A;  4GZB A;  4JBF A;  4QY6 A;  1W8Q A;  1CI9 A;  2XFT A;  1LLB A;  4PM5 A;  2EX9 A;  2Y2K A;  3BLM A;  5FQI A;  5FI6 A;  1FSY A;  3D4F A;  3S22 A;  2XDM A;  4KG6 A;  5F82 A;  3PAE A;  4BD0 A;  1YLP A;  4E6X A;  1C3B A;  4KZB A;  4L0L A;  1QME A;  5TGF A;  4GDN A;  4JXG A;  4KQR A;  4ZJ3 A;  3UN7 A;  3VSK A;  2WKE A;  1XA1 A;  1XP4 A;  4NK3 A;  1E3U A;  1NY0 A;  5U47 A;  1BTL A;  3VP0 A;  3IF6 A;  5JYP A;  3IHA A;  3W4Q A;  4WMC D;  1NZO A;  1U60 A;  3UDX A;  2RL3 A;  2X71 A;  1G6A A;  3PBR A;  1IYQ A;  1HD8 A;  3V5M A;  3MBZ A;  4DE1 A;  4MLL A;  1MKI A;  2XR0 A;  5AQ7 A;  3Q7Z A;  3I7J A;  4N9K A;  2G2U A;  3HVF A;  4UAA A;  1K56 A;  3G30 A;  3WWX A;  5CRF A;  4E3O A;  1YMX A;  5DF8 A;  3M2J A;  2Y2P A;  3W8K A;  5FAS A;  4KG5 A;  1I5Q A;  4OQH A;  3UPP A;  4PPR A;  5CGX A;  2ZMA A;  2X02 A;  4P6B A;  3C4P A;  3O88 A;  3V3S A;  2VGK A;  3RXX A;  4XUZ A;  3UNW A;  3C7V A;  4DXC A;  2JC7 A;  4U0X A;  3A3E A;  5HAR A;  3MZF A;  1W79 A;  4LEN A;  3WS5 A;  3N8L A;  4BJP A;  4K0W A;  4C75 A;  4D2O A;  4HBU A;  2ZJ9 A;  5KSC A;  4QY5 A;  4RX2 A;  1MPL A;  1TDG A;  2IWD A;  2WYX A;  4ZTK A;  3PBN A;  1GA0 A;  2V2F F;  3ITB A;  1ERO A;  1GA9 A;  1Q2P A;  3P98 A;  4IVI A;  3GQZ A;  4MBF A;  4KEN B;  4OPZ A;  4LV3 A;  1KGG A;  3LEZ A;  4R23 A;  4IBR A;  4YFM A;  4UHU A;  4BL2 A;  4DE0 A;  3HUN A;  2DCF A;  2JBF A;  4PM8 A;  2IWC A;  3PBO A;  2H0Y A;  5CGS A;  1SDN A;  4DDS A;  4OP8 A;  4R4R A;  4K0X A;  4E3L A;  1JWV A;  4FH4 A;  2FFF B;  5G18 A;  4N1X A;  4RYE A;  2X01 A;  2Y2O A;  3HUM A;  3VSL A;  3V3R A;  5HAQ A;  3A3I A;  3ZG7 B;  1FR6 A;  5EEC A;  3OPL A;  2XD1 A;  3W4O A;  1ERQ A;  4OPY A;  3VFH A;  3FWL A;  4HES A;  2ZC5 B;  5CHU A;  1G68 A;  1W5D A;  1PYY A;  3VP3 A;  5A93 A;  3IT9 A;  3IWO A;  1Q2Q A;  1H8Y A;  2P9V B;  5FQK A;  4E3J A;  4P85 A;  5HL1 A;  1SDE A;  3SH7 A;  1BLP A;  5DTT A;  4GD8 A;  5FQQ A;  4E3I A;  1GHI A;  2JCH A;  1HTZ A;  2XLN A;  5CGW A;  1MWR A;  5EOE A;  4QJG A;  2Y91 A;  1O07 A;  3JYI A;  4KZ3 A;  3AGF A;  1XGI A;  1BLC A;  5AQA A;  3ZG9 B;  4EQI A;  1JWZ A;  2ZC6 B;  3ZDJ A;  1FCO A;  1ONH A;  1FCM A;  4BD1 A;  4EBN A;  2XK1 A;  4R0Q A;  3CG5 A;  3Q82 A;  2ZQ8 A;  3Q81 A;  3ZHH A;  1PZO A;  3DW0 A;  4OOY A;  2Y2H A;  3SS3 A;  1K57 C;  5HAP A;  1FOF A;  4Y0U A;  2BG1 A;  2Q9M A;  4JXW A;  4MNR A;  5HFO A;  4DKI A;  4E6W A;  5FAQ A;  5EOO A;  2UWX A;  1YQS A;  4PMA A;  3TOI A;  2DRW A;  4LCL A;  4DE3 A;  3ZVT A;  3BFF A;  4WZ4 A;  3BFE A;  3WS4 A;  4IBX A;  3Q1F A;  4DF6 A;  4OOM A;  4NET A;  2J9O A;  3MFD A;  1JWP A;  1S6R A;  3VOZ A;  4K91 A;  1KDS A;  3IWQ A;  1IEL A;  1YLY A;  4OLG A;  4S2M A;  4U0T A;  1TEM A;  4B4Z A;  2Y2G A;  3GRJ A;  3UPN A;  1YLJ A;  5EUA A;  1LHY A;  1PZP A;  5M1A A;  5KSH A;  5FQM A;  4DDY A;  1YLW A;  4RA7 A;  3HLE A;  1GHM A;  1ERM A;  3P09 A;  3NBL A;  4ZJ2 A;  3BEB A;  4KZ8 A;  5GLB A;  1WYB A;  3UPO A;  4JKT A;  2WUQ A;  3LO7 A;  1SCW A;  3BFC A;  3WS1 A;  4Y7P A;  1IEM A;  2EX8 A;  3IXB A;  3WRT A;  5FI2 A;  3GR2 A;  3OPH A;  1H5X A;  3DWZ A;  2OV5 A;  1CEF A;  1WYC A;  3FZC A;  1PW1 A;  5CXW A;  3NI9 A;  3OCN A;  5FDH A;  3S4X A;  3GSG A;  4QU3 A;  4ZAM A;  1IYP A;  1XKZ A;  3LY3 A;  1I2W A;  5CED A;  4U3T A;  4OPQ A;  4JLF A;  4JF6 A;  1CEG A;  3N6I A;  3BFG A;  1K4E A;  1BT5 A;  2V20 A;  3MXS A;  2IWB A;  4KG2 A;  3LY4 A;  3IXH A;  5DF9 A;  1NRF A;  2A3U A;  4GNU A;  3VP2 A;  3HLF A;  3ZNY A;  5GHX A;  5EVI B;  4WZ5 A;  4DE2 A;  1RGY A;  4JF5 A;  2OLV A;  4WZ5 C;  2R9W A;  1L0E A;  5CHJ A;  3C7U A;  3O3V A;  2WGW B;  1N9B A;  1XA7 A;  4ID4 A;  2B5R A;  4S2O A;  4WEL A;  3ZNT A;  2E8I A;  4ZJ1 A;  1M40 A;  1ES4 A;  1IKI A;  1XGJ A;  3DTM A;  3UO9 A;  2HDR A;  3SS5 A;  2EFU A;  1M6K A;  4XUX A;  1EWZ A;  2Y2Q A;  4IED A;  4KQO A;  5EPH A;  5FAP A;  3IH9 A;  3VP4 A;  2CC1 A;  2WK0 A;  3Q7V B;  3QHY A;  3MKE A;  3O86 A;  4KZ5 A;  3WS2 A;  2ZQC A;  1YLZ A;  1K38 A;  4Y0T A;  2P74 A;  3W4P A;  5DVA A;  1MWU A;  3VOY A;  3NCK A;  1ES5 A;  4B88 A;  2Y2J A;  5GLD A;  1XXM A;  4OON A;  5E2H A;  3BRM A;  4P0M A;  5E2E A;  4EWF A;  5EVI D;  2EXB A;  5FQJ A;  2J9P A;  4PM9 A;  5GHZ A;  1JVJ A;  5GLC A;  1CK3 A;  3ZG5 A;  2ZQA A;  3G2Y A;  1HZO A;  1DJA A;  4FD8 A;  3CJM A;  5A91 A;  3ZCZ A;  5KMW A;  3C4O A;  3OPR A;  1KVM A;  2H5S A;  3V39 A;  3A3J A;  4WM9 A;  3IH8 A;  4B4X A;  3N8R A;  4OOL A;  1PIO A;  2Y59 A;  1FSW A;  2QPN A;  1BLS A;  3E2L A;  4S2K A;  4WEJ A;  3VP1 A;  3RXW A;  1NJ4 A;  3LCE A;  4XXR A;  4QD4 A;  3A3D A;  4R1G A;  4RX3 A;  3HLW A;  1S0W A;  5IHV A;  2WAF A;  2XEP A;  4QHC A;  3BFD A;  2PBY A;  4N92 A;  3ZGA B;  1KE3 A;  5FAO A;  1L0G A;  3M6B A;  4KZ4 A;  4S2L A;  4LV2 A;  4HEF A;  3UE0 A;  2EFX A;  5E43 A;  2Y4A A;  1K6S A;  4R3J A;  1FQG A;  1RCJ A;  1K57 A;  3IF6 B;  3IQA A;  3BYD A;  1XX2 A;  1K6R A;  4EBL A;  4MBK A;  2ZQ9 A;  3SH9 A;  1IKG A;  3N4I A;  1LI0 A;  5FI7 A;  4F94 A;  3PBQ A;  4OLD A;  5CHM A;  1OME A;  5TFQ A;  4UA7 A;  3GTC A;  4OKP A;  5HX9 A;  2Y55 A;  1KE0 A;  4RVA A;  5M18 A;  3CZD A;  2WKI A;  4BQM A;  3FV7 A;  3AGE A;  3PTE A;  4DRT A;  3HBR A;  1PW8 A;  3M2K A;  1YMS A;  4KQQ A;  3HL9 A;  2ZC4 B;  3GMW A;  3CMZ A;  1YM1 A;  3IXG A;  1MXO A;  2EXA A;  4PM6 A;  3UE3 A;  2J8Y A;  3V50 A;  3PBT A;  1LL9 A;  3O87 A;  4X68 A;  1K55 A;  4EBP A;  4KZ9 A;  1BUE A;  3ZVW A;  1SHV A;  1K55 C;  1J9M A;  3MZE A;  1WE4 A;  4OH0 A;  5KZH A;  1E3U D;  1JTG A;  1ZG4 A;  2Y2M A;  3OC2 A;  1ZG6 A;  3TG9 A;  5CEB A;  5L2F A;  1ZKJ A;  1TDL A;  1FR1 A;  1W7F A;  1NZU A;  1MWT A;  4O7D A;  3IF5 A;  1BZA A;  2EX2 A;  4GDB A;  4EUZ A;  2C6W B;  2P9V A;  1PI4 A;  4E3N A;  2Z2M B;  2VGJ A;  4ZDX A;  4Y0O A;  3GV9 A;  1JTD A;  2ZM8 A;  1NXY A;  4X6T A;  3B3X A;  4WEK A;  5JYO A;  5M19 A;  2DNS A;  3M6H A;  4N1H A;  4HBT A;  4DXB A;  5DTS A;  4WBG A;  5F1G A;  3G32 A;  3ZFZ A;  1K56 D;  1XPB A;  5I94 A;  3UE1 A;  1ES2 A;  2HPB A;  3N7W A;  2G2W A;  2Q9N A;  2PU4 A;  3IHB A;  1MBL A;  2GDN A;  3AGD A;  1K25 A;  1IYO A;  2ZC7 A;  2ZM0 A;  2WGV A;  4R4S A;  4X53 A;  5GLA A;  3EQV A;  3IF6 C;  1CI8 A;  2QZ6 A;  3ITA A;  4WMC A;  1KGF A;  2OSU A;  1PWC A;  4R3B A;  1VM1 A;  1IYS A;  3MZD A;  3NC8 A;  5E2G A;  3HLB A;  5F83 A;  2JE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...