4A5RA

Crystal structure of class a beta-lactamase from bacillus licheniformis bs3 with tazobactam
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
257
structure length
257
Chain Sequence
KDDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVVKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Crystal Structure of Class a Beta-Lactamase from Bacillus Licheniformis Inhibited by Tazobactam
rcsb
molecule tags Hydrolase
total genus 88
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4a5rA00
4EWFA 3O87A 1KGEA 5FQIA 4JXWA 3SS3A 2BLSA 2DRWA 4H8RA 5DTTA 1IKGA 5EPHA 4BL3A 1KDSA 4QY6A 5E2EA 4B88A 4EUZA 1PYYA 3I7JA 1PW1A 4E3KA 3ZG5A 1YLWA 2PU2A 4XUZA 3NBLA 4BQMA 4DE3A 5F82A 4HBUA 3BECA 4KZ7A 3N4IA 2ZMAA 4QD4A 1XPBA 1GCEA 2V2FF 3IHAA 1IYQA 4ZTKA 5TR7A 3SH9A 3W4PA 1XA7A 1MXOA 1W7FA 3QNCA 4RYEA 5TGFA 3UPOA 1ZG6A 3SH7A 4X56A 2XD1A 4UA9A 1YQSA 5CGSA 3HLGA 3A3JA 4ZDXA 2X01A 1K55A 2XFSA 4KQRA 4MEZA 4QB8A 1PW8A 4Q8IA 3HUOA 3N6IA 4WMCA 3EQUA 1K57A 4DE1A 5EOOA 3MKFA 3S22A 2HP6A 1K4FA 2WGIA 5KSHA 2OLVA 2WAFA 3MZFA 3HUNA 2ZC7A 3B3XA 3HBRA 3LO7A 3Q7ZA 3IH8A 4ZAMA 2ZM8A 1LI9A 1SKFA 2XGNA 1ZG4A 5JYPA 5A91A 3CMZA 2Z2MB 5CTMA 4E3MA 4EV4A 1FCOA 3LY3A 1GHMA 5EVIC 3OPLA 4K91A 2QPNA 4EQIA 1BLHA 1W8YA 2RL3A 3A3DA 3GRJA 5E2FA 3TOIA 5GLAA 1K56D 4KZBA 2ZQ9A 4JBFA 2ZD8A 4KZ5A 4R1GA 4YFMA 4LCMA 5E2HA 4OPZA 2Y2GA 4L0LA 1L0GA 3G32A 1BUEA 2HPBA 1MBLA 1KE3A 3DWZA 2R9XA 3NY4A 1BLSA 3PAEA 4GNUA 3BFGA 4S2MA 2WZZA 3C7UA 2IWDA 4P0MA 4KZ8A 1C3BA 3BFCA 4U3TA 3TG9A 1JWZA 3Q7VA 5FAOA 5FAQA 2Q9MA 4WEJA 3VOYA 3VMAA 3LEZA 2ZQ8A 1BTLA 5FSRA 1MPLA 2Y2LA 5FI6A 1K25A 1FCNA 5DF9A 2ZC3B 3V3SA 3OPRA 3P98A 4XUXA 2Y91A 1YMSA 3BRMA 4OQGA 1G6AA 1N4OA 4KZ6A 3CZDA 1ES4A 4Y0TA 1DJCA 1K54A 3HLCA 1MWUA 3IXBA 1VM1A 3NDGA 5HFOA 4PM9A 3GR2A 4S2IA 5DF8A 3IF6C 3W4QA 3Q81A 4YINA 1QMFA 5IHVA 5GHZA 2JCHA 4OOYA 1MY8A 3WWXA 1E4DA 4B4ZA 3BFDA 2X71A 4M3KA 1H5XA 4HEFA 3S1YA 3PBTA 4WYYA 1ES2A 1CEFA 4WZ4A 1SCWA 2EX9A 1EWZA 3V5MA 4GDBA 4KENB 3BM6A 5AQBA 2EFXA 2IWBA 4DE0A 4PMAA 1Q2QA 1NXYA 2V1ZA 1PWCA 2Y2NA 3HLDA 5GHYA 3WS2A 5JYOA 1BT5A 5EUAA 4OLDA 2C5WB 4ZJ3A 4ZJ1A 2EXAA 1YLJA 2P9VB 4Z9QA 1H8YA 1SDEA 4IBXA 5HAIA 4OP5A 1ZKJA 1O7EA 4LV0A 4MBFA 1BSGA 2DNSA 2J7VA 1HTZA 3O3VA 4A5RA 3MXRA 5KMWA 1ESUA 4X55A 3HREA 5M18A 1XXMA 4OLGA 1L0FA 3VSKA 2WKIA 1L0EA 2EFUA 4WBGA 2XDMA 2ZQAA 5CHUA 1VQQA 2HDQA 3O86A 5FAPA 4MBHA 2WAEA 3V39A 4R23A 2RCXA 2PU4A 1EROA 3G2ZA 4S2NC 5FQQA 5F1GA 2J8YA 3FKVA 3HLWA 4KZ9A 1K4EA 2QMIA 3BYDA 1E3UD 4S2PA 1NYMA 1WYBA 3RJUA 3ZHHA 5U47A 1CI8A 4BJPA 4NK3A 3DW0A 3IWQA 1TDLA 1G68A 3MZDA 5FQMA 5GL9A 1M6KA 4RX2A 1FR1A 3NCKA 5FA7A 3ZVWA 5TFQA 3N7WA 2FFYA 2XQZA 4QY5A 5EVIB 4E3OA 4KZ3A 4OONA 3N8SA 1DY6A 1FR6A 3C4PA 1YLYA 5FQKA 1TVFA 3UE1A 1LHYA 2DCFA 3DTMA 4JXSA 3IQAA 2XH9A 2WK0A 1RGZA 4RX3A 3PBOA 2R9WA 1KVMA 1NZOA 2ZM0A 1XX2A 4OOMA 4OVDA 4WZ5A 4DRTA 4EBNA 1L0DA 2XF3A 2XR0A 3V3RA 3W8KA 5GLBA 1LI0A 3G30A 1QMEA 4OQIA 5E2GA 4E3IA 1DJAA 4E3NA 3HLEA 3UN7A 3E2LA 4IBRA 3E2KA 1YMXA 3WS1A 2HDSA 3QHYA 4NETA 2A3UA 5EVLA 3WRZA 2E8IA 3W4OA 3GQZA 5GHXA 3RXWA 4KG5A 4DXCA 5J8XA 3PTEA 3S4XA 1MWTA 4JLFA 3UPNA 3ZCZA 3OCNA 4KQOA 4K0WA 3M2JA 2WADA 4JPMA 4OKPA 4Y7PA 5FDHA 2X02A 4S2OA 5AQ9A 4HESA 1Y54A 1BULA 1YLTA 3IF6B 4KZ4A 1K6RA 4WEKA 1KE4A 3ZG0A 3HUMA 1SHVA 5CGWA 2P9VA 2JC7A 3SS4A 3UY6A 5A92A 3NC8A 3NDEA 5FQJA 4OP8A 2A49A 3ZNTA 3G34A 3FV7A 3QNBA 4WMCD 2J9OA 2ZC6B 5GLDA 5A93A 1TDGA 5BOHA 3AGEA 4JXVA 3IXDA 4S2KA 1YT4A 3PBSA 1JTGA 4U0XA 4ZJ2A 2OV5A 1IYSA 2ZJ9A 1XKZA 4FD8A 2G2UA 1PI5A 3SS5A 2FFFB 4UHUA 2WKHA 1Q2PA 2HDRA 4R0QA 2HP5A 4CJNA 1PWDA 4Y0UA 4X6TA 3C5AA 3ZDJA 3UPPA 1NY0A 4WELA 1YLZA 4PM7A 4XXRA 4N1XA 3C7VA 5M19A 5CEDA 5KSCA 4EBPA 5F1FA 3HLBA 1CI9A 2XFTA 3G4PA 3WRTA 5F83A 4LENA 1I2WA 3ITBA 3UDFA 3RXXA 3BLMA 1MWRA 3G2YA 4RA7A 3JYIA 4Y0OA 2BG1A 1CEGA 2B5RA 5EVIA 5CTNA 3VSLA 1YM1A 4IEDA 1O07A 3D4FA 3NIAA 3FYZA 4FH4A 1ONHA 1LLBA 4QHCA 2Q9NA 2Y2MA 3FKWA 2WUQA 2XEPA 5A90A 3VP0A 1BLCA 2V20A 4U0TA 4OH0A 3Q82A 3ZGAB 1N9BA 1NYYA 4DE2A 5EE8A 1PZPA 4C6YA 5DTSA 4BD0A 2HDUA 1K55C 5L2FA 3P09A 3WS0A 1HD8A 4OPQA 1K57C 5KZHA 2OSUA 3ZG7B 3GVBA 4F94A 2OLUA 5AQ7A 1NRFA 3MZEA 2HP9A 5DTKA 2ZC5B 1W8QA 3M6BA 3Q1FA 4WZ5C 1J9MA 3PAGA 2XLNA 4IVKA 3Q07A 4N9KA 1OMEA 1ES3A 2Y2PA 3IWOA 5CXWA 4BD1A 1S6RA 3BLSA 4P6BA 1IYPA 3TSGA 4R3JA 1ZC2A 3IXGA 4EBLA 3GV9A 4GDNA 1FQGA 1WE4A 5CERA 3PBRA 3IF6A 4O7DA 5I94A 3ZFZA 2WGWB 3VFFA 4KG2A 2EX2A 3IF5A 2Y2IA 4OPYA 4OOLA 4PPRA 2WKEA 3EQVA 3LY4A 3MFDA 3DWKA 2EX6A 4PM8A 3UE0A 4S2JA 1K38A 4C75A 1XGJA 2QZ6A 3M2KA 4KG6A 4DDYA 2JE5A 4GKUA 1XP4A 4OQ0A 3ZVTA 3BEBA 1K56A 4N9LA 5FI2A 1GHIA 1HVBA 1CK3A 3O88A 1ESIA 5DVAA 3VOZA 4ID4A 2G2WA 3NI9A 5AQAA 2ZC4B 3AGDA 3UE3A 4JF6A 1GA9A 2ZQDA 4IVIA 4GB7A 3M6HA 3ZNYA 1JWVA 1EI5A 1H8ZA 4GOGA 4B4XA 1ALQA 2Y2OA 1WYCA 4PM5A 3IT9A 5G18A 3ITAA 4E3LA 5FATA 2UWXA 3A3EA 1K54C 5FQ9A 2VGJA 2EX8A 4R4SA 5HAPA 3N8LA 4X68A 1AXBA 5HX9A 4BENA 5EOEA 4UA7A 1KE0A 4E6WA 3SH8A 3ISGA 1BLPA 4OQHA 3BFFA 3ZG9B 3SOIA 1RGYA 3WS5A 1PIOA 4GD8A 4S2NA 3GTCA 5FI7A 1U60A 4MBKA 5CRFA 1I2SA 3FZCA 5E43A 3UO9A 4BL2A 2J9PA 1JVJA 3GMWA 5CHJA 2H5SA 1JWPA 1ERMA 4JF5A 1LL5A 3LCEA 3UDIA 3HLFA 1HZOA 2H0YA 3V50A 1ONGA 3OZHA 4FH2A 1KVLA 4OPRA 1PZOA 1SDNA 4P87A 5DF7A 2ZLYA 2ZQCA 5HAQA 2WGVA 4DDSA 5HL1A 3IH9A 4LCLA 5CEBA 3C4OA 3G31A 4GD6A 4D2OA 2JBFA 5GLCA 3PBNA 4E6XA 4X69A 1JTDA 4UAAA 5M1AA 3UNWA 3N8RA 1GHPA 5D3OA 1MKIA 4KQQA 4BLMA 2Z2LB 1BZAA 4MLLA 4DKIA 1FSWA 4CPKA 4UA6A 1MWSA 1NJ4A 4DF6A 1K6SA 4K0XA 1KGFA 1PWGA 4WM9A 4GN2A 2WGWA 3VFHA 4FSFA 2Y55A 3IHBA 1L2SA 1W79A 1FCMA 1RP5A 1M40A 4JF4A 1FSYA 2ZM2A 1RCJA 5HARA 2WZXA 2ZQ7A 4DXBA 3VP4A 3VP1A 4QU3A 5CGXA 4MNRA 3CJMA 3OPHA 2XK1A 2XD5A 2P74A 3OPPA 4R3BA 4PM6A 1DJBA 1TEMA 2C6WB 1ERQA 4LV3A 3MXSA 2GDNA 5CHMA 1S0WA 3VP3A 1IKIA 4JKTA 1E25A 1I5QA 3CG5A 1XA1A 4FCFA 3WS4A 3G35A 2CC1A 1E3UA 1PI4A 3OCLA 2VGKA 4KZAA 3OC2A 2Y2QA 2Y2HA 1FOFA 1Z6FA 2I72A 1XGIA 3UDXA 1NZUA 4E3JA 1IYOA 4QJGA 3AGFA 5CECA 4RVAA 2Y59A 4C3QA 4N1HA 1IELA 3A3IA 2H10A 1GA0A 5HW3A 2Y4AA 3IWIA 4ZBEA 4N92A 3PBQA 2IWCA 2WYXA 3IXHA 4HBTA 4P85A 1KGGA 1KDWA 2Y2KA 1YLPA 2Y2JA 3Q7VB 5FASA 4LV2A 3GSGA 3MKEA 5EVID 1ES5A 4R4RA 3ZG8B 3BFEA 4X53A 3VP2A 1IEMA 2EXBA 5EECA 1LL9A 3HL9A 4LV1A 1W5DA 3FWLA 4GZBA 2PBYA 3HVFA 2H0TA 3A3FA 4JXGA 4S2LA 3MBZA
chains in the Genus database with same CATH superfamily
4JXWA 1OT9A 2W3EA 2BLSA 2DRWA 2W1RA 2JKFA 1KDSA 4QY6A 4EUZA 1PYYA 3ZG5A 2O9AA 5F82A 4KZ7A 4ZTKA 3SH9A 1MXOA 4RYEA 3QNCA 2P08A 5EM0A 3FC7A 3S7QA 3MXQA 3U4LP 4UA9A 1G6OA 5CGSA 2XFSA 3KSFA 3EWKA 3HUOA 3N6IA 4DE1A 3MKFA 1S67L 1UGUA 5DJTA 2ZC7A 3HBRA 1OJGA 1A0KA 3NJAA 1T18A 4E3MA 1FCOA 2K7SA 1W8YA 4IUKA 3S7NA 4KZBA 4KZ5A 4R1GA 1G5UA 1BUEA 2VKSA 1MBLA 1KE3A 3H7WB 2WZZA 3C7UA 2W3FA 1C3BA 4YNRA 1JWZA 5HWWA 3LEZA 5F6AA 2Y2LA 1FCNA 4XUXA 2Y91A 1G6AA 4KZ6A 1ES4A 2V9AA 4HJ6A 1DJCA 3NDGA 5HFOA 1VM1A 2EWVA 5DF8A 3W4QA 4GCZA 4YINA 1E4DA 2W3DA 2O99A 4HEFA 1F98A 4KENB 1OPXA 4MDZA 1OTAA 4PMAA 1F5MA 1Q2QA 2XSSA 2V1ZA 1PWCA 4LFUA 5GHYA 5JYOA 2BASA 2C5WB 3DBAA 4O01A 1H8YA 1SDEA 1ZKJA 1BSGA 2DNSA 4WLAA 4OLGA 2P7JA 2EFUA 1VQQA 2HDQA 2WKQA 2WAEA 2PU4A 2J8YA 3FKVA 3HLWA 2FZ0A 4O0PA 1E3UD 1NYMA 1WYBA 3CPTA 5U47A 4O8GA 3IWQA 3MZDA 1G68A 3K2NA 4RX2A 1FR1A 1S4SA 3N7WA 2XQZA 1ODVA 5EVIB 4EUVA 4KZ3A 5HPFA 3N8SA 1DY6A 3C4PA 1TVFA 5EM1A 1XFQA 2PAVP 2AVXA 3DTMA 3IQAA 1DP8A 1T1CA 4L9FA 1NZOA 4Y15A 4NKPA 4OVDA 4DRTA 1L0DA 5HD3A 3CLOA 1QMEA 2Z6DA 3UE6A 3UMEA 3LFVA 2J3TC 3WS1A 1P9RA 2HDSA 4BWIA 4GW9A 2E8IA 3RXWA 4JGQA 3VV4A 3D72A 5FDHA 2X02A 1Y54A 4KZ4A 3IF6B 4WEKA 1K6RA 2JC7A 3NC8A 2A49A 5A93A 3FV7A 4NEED 2ZC6B 5GLDA 4U0XA 1IYSA 1LL8A 4FD8A 3NOPC 2WKHA 2HGVA 3NULA 3MMHA 3HJKA 3UPPA 3TE8A 4II7A 4RQ9A 4PM7A 3C7VA 4EBPA 5F1FA 2OWJA 5F83A 1I2WA 2PD7A 5MC7A 1P97A 3G2YA 1MWRA 1LT0A 4Y0OA 1D7EA 2B5RA 5CTNA 3VSLA 4IEDA 2M1CA 3FKWA 2WUQA 5A90A 2GJ3A 1JNUA 3VP0A 2JHEA 2V20A 4OH0A 3KYEA 4C6YA 4I3AA 1HD8A 4I5SA 2OSUA 1F2KA 3MZEA 2HP9A 4Y3IA 4N9KA 3UB8A 2ACGA 1ES3A 3IWOA 5CXWA 1XJ3A 2M7UA 1IYPA 4R3JA 4EBLA 3CI6A 2WKRA 4GHIA 5I94A 2WGWB 1CJFA 2EX2A 4OOLA 4PPRA 3C2WA 3LY4A 4EEPA 1K38A 2VEAA 5HDCA 5G4YA 1XGJA 4KG6A 2JKRM 1XP4A 3F1PB 4OQ0A 2VX8A 5HL6A 2PBDP 5FI2A 1HVBA 3O88A 3NI9A 4Q0HA 4PKYA 3ZNYA 2W3GA 3MF0A 2Y2OA 4E3LA 5G18A 5FQ9A 3PXPA 5HX9A 4UA7A 3UB9A 4E6WA 4MN6A 1RGYA 5F69A 1TF1A 2A2LA 4Q0IA 4BBTA 4ETXA 5CHJA 1JWPA 1ERMA 3LCEA 1IOUA 3OZHA 4FH2A 4OPRA 3IBJA 2ZLYA 2ZQCA 4YOFA 3T50A 5I5LA 5M1AA 3OBFA 5D3OA 1BZAA 3BW6A 1FSWA 1NJ4A 4K0XA 4WM9A 4GN2A 2INWA 4FSFA 2Y55A 1RP5A 1RCJA 2XROA 5HARA 4QU3A 4JGOA 5CGXA 4MNRA 2XD5A 2P74A 4R3BA 4LPZA 4NXFA 3NOTC 1TEMA 2EWWA 5CHMA 1S0WA 4JKTA 2O9BA 1E25A 1XA1A 4FCFA 2W1TB 4ESPA 2R78A 2HF6A 2VGKA 1FOFA 5F68A 1IYOA 5AVFA 4RVAA 4C3QA 4N1HA 3VE3A 3PBQA 4NXGA 1FILA 4I39A 3LUQA 4HI4A 4LV2A 2KDKA 5HWTA 4R4RA 1IEMA 3FPWA 1LL9A 1ZTUA 3FWLA 5EFWA 3MBZA 4HNBA 1KGEA 5FQIA 2V8FA 4P6ZM 1IKGA 1GSVA 4B88A 4E3KA 1YLWA 2PU2A 4XUZA 3NBLA 4BQMA 5FEFA 3F1OB 2Q0OA 4HBUA 3N4IA 3BQAA 2ZMAA 5AVEA 3W4PA 1XA7A 2VA0A 3SH7A 3CUEC 3A3JA 3H82B 2X01A 1K55A 3T4JA 3FPVA 4JGRA 1K57A 4XT2A 5A8BA 5EOOA 3S22A 5KSHA 2WAFA 3G6OA 3HUNA 3Q7ZA 4ZAMA 2ZM8A 2XGNA 1MZUA 2D01A 5JYPA 3CMZA 4GS9A 5EVIC 4EQIA 3A3DA 3GRJA 1TS7A 4QWOA 3TOIA 5GLAA 1K56D 4X1MA 4MMNA 4R38A 3RTYA 3EGDC 4LCMA 4ARZA 2L4RA 4OPZA 2Y2GA 1L0GA 2HPBA 1TS0A 3LIEA 3DWZA 1VB6A 3NY4A 3A0SA 3BFGA 4S2MA 4P0MA 5HSQA 4U3TA 2HJEA 3ULFA 3Q7VA 5FAOA 5FAQA 2Q9MA 3VMAA 2ZQ8A 3RFBA 5FI6A 5DF9A 2PR6A 3V3SA 4EERA 4B93A 4OQGA 5K5BA 1V9ZA 1MWUA 4CLCA 4S2IA 1OT6A 3IF6C 4NG2A 3Q81A 1GSXA 3QP6A 5IHVA 5GHZA 1MY8A 3UB5P 3KYQA 4B4ZA 1TD5A 1S66L 1H5XA 3PBTA 4E04A 1EWZA 3V5MA 2VV7A 4DE0A 1XJ6A 2Y2NA 3WS2A 4OLDA 4G3WA 4ZJ3A 4ZJ1A 3IX4A 1LSXA 1YLJA 4Z9QA 1J3WA 4OP5A 1O7EA 4LV0A 1SKOA 4MBFA 2J7VA 1HTZA 4A5RA 5KMWA 5M18A 2ZL1B 4DN0A 3VE4A 2WKIA 2ZQAA 3O86A 5FAPA 3V39A 5F1GA 2QMIA 4R70A 1CI8A 4BJPA 4BBUA 3DW0A 5FQMA 3BJNA 5GL9A 3QP2A 3ZVWA 3MFXA 2FFYA 3CHWP 4E3OA 4HJ4A 2O0YA 2QYBA 4RX3A 3PBOA 2R9WA 3IS2A 1KVMA 4M4XA 3LR4A 4EBNA 2XF3A 2XR0A 3JVVA 3V3RA 4OQIA 4E3IA 4F3LB 4E3NA 3UN7A 3E2LA 3E2KA 1YMXA 3LIAA 5FL3A 2ZMFA 2A3UA 5EVLA 3W4OA 5GHXA 4KG5A 2LB5A 4EXOA 3KX0X 4KQOA 1W63M 4K0WA 2WADA 4OKPA 4Y7PA 1KE4A 3ZG0A 5CGWA 1SHVA 3UY6A 2P9VA 3SS4A 2PHYA 2J9OA 3AGEA 3ZQ5A 4S2KA 3IXDA 4JXVA 1CF0A 1VETB 1XKZA 1VEUB 2LB9A 4UHUA 1S4RA 4R0QA 1P9WA 3S7OA 4Y0UA 3C5AA 3ZDJA 4X1LA 5CEDA 5KSCA 2NUPC 3VOLA 1F9IA 3HLBA 3G4PA 2L1MA 2ZOHA 3RXXA 4RA7A 3JYIA 1O07A 3D4FA 3NIAA 4FOFA 3FYZA 4FH4A 1LLBA 4QHCA 2Q9NA 2Y2MA 2XEPA 2PDRA 5DTSA 4MN5A 4OPQA 5DFXA 3EEAA 3ZG7B 4G3VA 5DTKA 3M6BA 2XLNA 1OMEA 2XRNA 3TSGA 2QWSA 1ZC2A 3T1RA 1FQGA 4HH3A 3C30A 3PYPA 3B47A 3PBRA 5HDDA 3VFFA 3IF5A 5IU1A 1Y4OA 2WKEA 3MFDA 3KYZA 2EX6A 1N9NA 1PFLA 3T4OA 4EW7A 2JE5A 3A0VA 4LGWA 1CK3A 3VOZA 1ESIA 2ZC4B 4JF6A 1GA9A 3U2AA 3SW1A 2O9CA 4H6JA 3PR6A 5HWVA 3IT9A 3ITAA 5FATA 1K54C 3ICYA 4NXBA 3E0YA 4R4SA 4BENA 4L9GA 5EOEA 1TS8A 1KE0A 3SOIA 2BTFP 4Y13A 3BWLA 3T1XA 5CRFA 3FZCA 4D60A 3UO9A 2J9PA 1JVJA 3GMWA 3O5YA 1LL5A 3UDIA 3T1SA 1HZOA 2H0YA 1H3QA 3E4OA 1SDNA 1T1AA 5HAQA 3LIBA 2B02A 2HV1A 3QP8A 3T4KA 4UEYA 2JBFA 5L07A 2VV8A 4X25A 4I38A 4MLLA 3V67A 4UA6A 1KGFA 2I9VA 3VFHA 3IHBA 1L2SA 1SZVA 1M40A 4JF4A 2WZXA 3VP1A 1YAXA 3OPHA 4LRZE 4P6ZS 2VGLM 2CC1A 1OTDA 4KZAA 3OC2A 2Y2QA 1Z6FA 2A24B 3P7NA 3AGFA 5CX7A 3A3IA 2JKTM 1GA0A 4ZBEA 4N92A 1N9OA 2IWCA 4P85A 1KGGA 1EW0A 3LR3A 1W63Q 5EV0A 5L09A 3BFEA 3VP2A 2EXBA 5EECA 3HL9A 1W5DA 2ZMVA 3A3FA 4EWFA 3O87A 3SS3A 1XJ2A 5EPHA 4BL3A 1PW1A 3QP5A 5FEGA 2V2FF 2OAP1 3UPOA 5TGFA 3FG8A 3KO6A 5IS1A 4ZDXA 2ZOIA 4QB8A 1PW8A 4Q8IA 2PYPA 3E4PA 3LIDA 4WMCA 1DRMA 4KQDA 3LI8A 2V8CA 2HP6A 2P04A 2WGIA 3BQ8A 3MZFA 4FTXA 3B3XA 5TBMA 3LO7A 5C5KA 3IH8A 1SKFA 1ZG4A 2Z2MB 2Z6CA 1GHMA 4K91A 3F1NA 2RL3A 3BY9A 2ZQ9A 2KX6A 2OAQ1 2QJ7A 4YFMA 5E2HA 2YKHA 3CPTB 3G32A 3IBRA 2GZAA 2IWDA 3JVUA 2J3WA 4EU0A 3VOYA 3OLOA 4GJ4A 1BTLA 5FSRA 1MPLA 2DMWA 2ZC3B 3OPRA 1YMSA 4ME4A 4Y5FA 3B42A 3HLCA 3GR2A 4QPRA 5HDSA 1UWPX 2JCHA 3WWXA 3TJZC 2W3HA 2X71A 3S1YA 4WYYA 1ES2A 1CEFA 1FIKA 1VHMA 2EFXA 1H8MA 5AQBA 2IWBA 4HOIA 3UMDA 1NXYA 3HLDA 5EUAA 2GX5A 5EVEA 4GLQA 2MJ6A 4LRXC 3CAXA 2H28A 5HAIA 1WA9A 3O3VA 4DMZA 3MXRA 3HREA 3UB7A 2W0NA 1L0FA 2QJ5A 5J4EA 1PNEA 2XDMA 3T4TA 1Z09A 3LI9A 3LYXA 1EROA 4S2NC 3UB6A 1CQAA 1K4EA 4S2PA 3RJUA 1TDLA 2OOLA 1M6KA 3H7WA 3NCKA 3W2ZA 1S1YA 4BBVA 1YLYA 5FQKA 3CITA 2XH9A 1RGZA 3BY8A 1XX2A 4OOMA 4WZ5A 1LI0A 3G30A 3MJQA 2K31A 1XFNA 1NWZA 3HLEA 3QP4A 4NETA 5IT5A 3GQZA 4DXCA 1V9YA 5J8XA 3PTEA 3UPNA 3ZCZA 3OCNA 3MQQA 4GHIB 4HESA 1YLTA 1BULA 3HUMA 4WL9A 3ZNTA 5BOHA 5J3WA 1N9LA 1YT4A 3PBSA 4R6LA 3LR0A 4ZJ2A 2OV5A 2ZJ9A 2Y8HA 2FFFB 4HY8A 3CUEA 1Q2PA 2HDRA 1NLZA 2PT7A 4ZRRA 2WKPA 4X6TA 1NY0A 3MR0A 4WELA 1YLZA 5M19A 2XFTA 3ITBA 4Y17A 3UDFA 2VLGA 2BG1A 1CEGA 5EVIA 1NLYA 3H9WA 1YM1A 5HZHA 4YWZA 1ONHA 5KIZA 2YKFA 3ZGAB 4U0TA 1N9BA 2VJWA 5EE8A 1PRQA 1LSVA 4BD0A 3GVBA 1NRFA 3E4QA 2NUTC 3TRCA 4Q0JA 2ZC5B 1W8QA 3LGOA 4IVKA 4LLOB 1UWNX 2Y2PA 4BD1A 1S6RA 3BLSA 5F5YA 3IXGA 4MCWA 3GV9A 3HJIA 3IF6A 3DTEA 4OPYA 2Y2IA 4G3KA 3EQVA 4HP9A 3UE0A 2Y79A 4PAUA 2QZ6A 4Y2FA 4DDYA 4GKUA 3ZVTA 3BEBA 2V1AA 3EGXC 2QKPA 4HP4A 5DVAA 1L3LA 3LEQA 5AQAA 3UE3A 2ZQDA 3M6HA 1EI5A 4GOGA 4B4XA 1ALQA 1LSWA 1WYCA 3A3EA 2VGJA 2EX8A 4X68A 1AXBA 1BLPA 4OQHA 3BFFA 3ZG9B 3DAVA 3WS5A 2ZBBA 4GD8A 3GTCA 4MBKA 3NHQA 1I2SA 3A0RA 2H5SA 1DP6A 2PYRA 4PKYG 3HLFA 4IHQA 2VGLS 1KVLA 3E98A 1PZOA 3PHYA 4P87A 3T12B 3RH8B 2L0WA 5HD5A 4DDSA 2A24A 2W27A 3EEHA 4LCLA 5CEBA 3C4OA 2VZWA 2PRFA 3PBNA 3IX8A 4E6XA 4UAAA 1D06A 1GHPA 3N8RA 4EETB 1MKIA 4KQQA 2Z2LB 4DKIA 3DTKA 4DF6A 2VK3A 4JGPA 2WGWA 1STZA 4XT2B 3NECA 1H0MA 1FCMA 1FSYA 3L7HA 4DXBA 2ZQ7A 3VP4A 1OTBA 1HLUP 2XK1A 4PM6A 1ERQA 3F1PA 3KSIA 4GS9B 1I5QA 3C8CA 3G35A 1E3UA 3S7PA 3HCYA 4ARZB 1NZUA 1YPRA 5CECA 1IELA 2H10A 4IJGA 3R7WB 4I3IA 3IX3A 2WYXA 1T19A 3IXHA 3P01A 1KDWA 2Y2KA 1YLPA 2Y2JA 3Q7VB 3GSGA 3MKEA 3ZG8B 4LV1A 1AWIA 2PBYA 2H0TA 4ID4A 4H8RA 5DTTA 4CLCB 5E2EA 3MS6A 3I7JA 2V0WA 3D3OA 3MQ0A 2XA7M 4DE3A 4R3AA 3R4KA 3BECA 5G4ZA 4QD4A 1XPBA 1GCEA 3IHAA 1IYQA 5TR7A 1W7FA 1ZG6A 4X56A 2XD1A 1YQSA 3HLGA 1TS6A 4MEZA 4KQRA 2GNXA 3EQUA 4UQIM 1K4FA 2OLVA 3NOUC 1ZHHB 1SKOB 1LI9A 5A91A 5CTMA 4EV4A 3LY3A 2V1BA 3OPLA 5L8MA 2QPNA 2W1TA 1BLHA 5E2FA 2PD8A 4JBFA 5HPIA 2ZD8A 2D02A 4HJ3A 4L0LA 2EA9A 2R9XA 1BLSA 3PAEA 4GNUA 4PHTA 4KZ8A 3BFCA 3TG9A 3GECA 4WEJA 1K25A 1OTIA 3P98A 3IS2B 3BRMA 4CLCE 1N4OA 3LICA 3CZDA 4Y0TA 1K54A 3IXBA 2CMNA 3K3DA 4PM9A 3MSHA 5L10A 4FUWA 4HQAA 1QMFA 3DTIA 4OOYA 3F1OA 3CWFA 1YSPA 3BFDA 4M3KA 4WZ4A 1SCWA 2EX9A 4GDBA 4WN5A 3BM6A 1Y28A 1ACFA 1IFQA 3H82A 1BT5A 2JN7A 3LR5A 2UV0E 2EXAA 2P9VB 4IBXA 2J3TD 1ESUA 4X55A 1XXMA 4KUKA 3VSKA 1L0EA 4WBGA 5CHUA 1XJ4A 2JKGA 4MBHA 4R23A 2RCXA 4WF0A 5FQQA 3G2ZA 4NXEA 4KZ9A 3BYDA 3ZHHA 4NK3A 2J80A 5FA7A 5TFQA 4QY5A 4OONA 1FR6A 1T1BA 3UE1A 1LHYA 1S1ZA 2DCFA 4JXSA 2WK0A 3EOIA 2ZM0A 4DJ3A 5FDSA 3GDIA 3L9KA 3W8KA 5GLBA 5E2GA 1DJAA 4BMWA 4IBRA 4MN7A 3LIFA 4I3JA 2HJ9C 3QHYA 1BYWA 3WRZA 4Z1WA 1GSWA 3S4XA 1MWTA 4JLFA 5TJJA 3T4LA 1P0ZA 3M2JA 4JPMA 4S2OA 5AQ9A 5A92A 3NDEA 5FQJA 1OJ5A 4OP8A 3G34A 3QNBA 4WMCD 1TDGA 3OOVA 1JTGA 1YSQA 2ZL1A 2G2UA 1G28A 1OTEA 1PI5A 3SS5A 2HP5A 4CJNA 2G7UA 1PWDA 2FH5A 4XXRA 4N1XA 4H6JB 1CI9A 3WRTA 4LENA 3BLMA 2KLIA 4ETZA 3ZYTA 3T1QB 2QHKA 1BLCA 3Q82A 5DFYA 3KSHA 1NYYA 4DE2A 1PZPA 1MKMA 2HDUA 3C38A 1K55C 5L2FA 3P09A 3WS0A 4F3LA 1YKDA 1K57C 1K0KA 5KZHA 4F94A 2OLUA 5AQ7A 3Q1FA 4WZ5C 1J9MA 3PAGA 3Q07A 4WUJA 5DKLA 4P6BA 3QP1A 4GDNA 1WE4A 5CERA 3TW8A 4O7DA 3ZFZA 4KG2A 2KOIA 4KUOA 4EQ1A 3DWKA 2VV6A 4PM8A 4S2JA 1VETA 4C75A 2V0UA 3M2KA 1VEUA 2HZ5A 4HH2A 4N9LA 1K56A 4IUHA 1GHIA 4K08A 2G2WA 3AGDA 3B33A 4IVIA 4GB7A 2PR5A 1JWVA 5AJGA 1H8ZA 4DJ2A 4PM5A 2UWXA 4CLCC 5J7EA 5HAPA 3N8LA 1X0OA 3SH8A 3ISGA 3MQOA 3K3CA 1PIOA 4S2NA 5FI7A 1U60A 5E43A 4BL2A 4JF5A 4EEUA 3V50A 1ONGA 5DF7A 1NRJA 2WGVA 5HL1A 3IH9A 4L9EA 1D1JA 4LRYC 2K2NA 2B18A 3G31A 4GD6A 4D2OA 5GLCA 3R7WA 4HIAA 4X69A 1JTDA 3UNWA 1DP9A 4BLMA 2IA2A 5DJUA 4CPKA 3KSGA 1MWSA 1K6SA 1PWGA 4HHDA 1W79A 4EESA 2ZM2A 5LBRA 5TBMB 3CJMA 1MC0A 3OPPA 2OWHA 1DJBA 2C6WB 4LV3A 3MXSA 2GDNA 3VP3A 1IKIA 3CG5A 3D9YA 3F1NB 2JKTI 2XA7S 3WS4A 1PI4A 3OCLA 3T4QA 2B95A 1KOUA 2Y2HA 2I72A 1XGIA 4B9OA 4CLCD 3UDXA 4E3JA 3SZTA 4QJGA 2Y59A 5HW3A 2Y4AA 3IWIA 4HBTA 4CQHA 5FASA 4UQIS 2E8JA 5EVID 1ES5A 4X53A 2JKRI 5DKKA 4AFIA 3T4SA 2M7VA 3JPUA 4GZBA 3HVFA 4JXGA 4S2LA
chains in the Genus database with same CATH topology
4EWFA 3O87A 1KGEA 5FQIA 4JXWA 3SS3A 2BLSA 2DRWA 4H8RA 5DTTA 1IKGA 5EPHA 4BL3A 1KDSA 4QY6A 5E2EA 4B88A 4EUZA 1PYYA 3I7JA 1PW1A 4E3KA 3ZG5A 1YLWA 2PU2A 4XUZA 3NBLA 4BQMA 4DE3A 5F82A 4HBUA 3BECA 4KZ7A 3N4IA 2ZMAA 4QD4A 1XPBA 1GCEA 2V2FF 3IHAA 1IYQA 4ZTKA 5TR7A 3SH9A 3W4PA 1XA7A 1MXOA 1W7FA 3QNCA 4RYEA 5TGFA 3UPOA 1ZG6A 3SH7A 4X56A 2XD1A 4UA9A 1YQSA 5CGSA 3HLGA 3A3JA 4ZDXA 2X01A 1K55A 2XFSA 4KQRA 4MEZA 4QB8A 1PW8A 4Q8IA 3HUOA 3N6IA 4WMCA 3EQUA 1K57A 4DE1A 5EOOA 3MKFA 3S22A 2HP6A 1K4FA 2WGIA 5KSHA 2OLVA 2WAFA 3MZFA 3HUNA 2ZC7A 3B3XA 3HBRA 3LO7A 3Q7ZA 3IH8A 4ZAMA 2ZM8A 1LI9A 1SKFA 2XGNA 1ZG4A 5JYPA 5A91A 3CMZA 2Z2MB 5CTMA 4E3MA 4EV4A 1FCOA 3LY3A 1GHMA 5EVIC 3OPLA 4K91A 2QPNA 4EQIA 1BLHA 1W8YA 2RL3A 3A3DA 3GRJA 5E2FA 3TOIA 5GLAA 1K56D 4KZBA 2ZQ9A 4JBFA 2ZD8A 4KZ5A 4R1GA 4YFMA 4LCMA 5E2HA 4OPZA 2Y2GA 4L0LA 1L0GA 3G32A 1BUEA 2HPBA 1MBLA 1KE3A 3DWZA 2R9XA 3NY4A 1BLSA 3PAEA 4GNUA 3BFGA 4S2MA 2WZZA 3C7UA 2IWDA 4P0MA 4KZ8A 1C3BA 3BFCA 4U3TA 3TG9A 1JWZA 3Q7VA 5FAOA 5FAQA 2Q9MA 4WEJA 3VOYA 3VMAA 3LEZA 2ZQ8A 1BTLA 5FSRA 1MPLA 2Y2LA 5FI6A 1K25A 1FCNA 5DF9A 2ZC3B 3V3SA 3OPRA 3P98A 4XUXA 2Y91A 1YMSA 3BRMA 4OQGA 1G6AA 1N4OA 4KZ6A 3CZDA 1ES4A 4Y0TA 1DJCA 1K54A 3HLCA 1MWUA 3IXBA 1VM1A 3NDGA 5HFOA 4PM9A 3GR2A 4S2IA 5DF8A 3IF6C 3W4QA 3Q81A 4YINA 1QMFA 5IHVA 5GHZA 2JCHA 4OOYA 1MY8A 3WWXA 1E4DA 4B4ZA 3BFDA 2X71A 4M3KA 1H5XA 4HEFA 3S1YA 3PBTA 4WYYA 1ES2A 1CEFA 4WZ4A 1SCWA 2EX9A 1EWZA 3V5MA 4GDBA 4KENB 3BM6A 5AQBA 2EFXA 2IWBA 4DE0A 4PMAA 1Q2QA 1NXYA 2V1ZA 1PWCA 2Y2NA 3HLDA 5GHYA 3WS2A 5JYOA 1BT5A 5EUAA 4OLDA 2C5WB 4ZJ3A 4ZJ1A 2EXAA 1YLJA 2P9VB 4Z9QA 1H8YA 1SDEA 4IBXA 5HAIA 4OP5A 1ZKJA 1O7EA 4LV0A 4MBFA 1BSGA 2DNSA 2J7VA 1HTZA 3O3VA 4A5RA 3MXRA 5KMWA 1ESUA 4X55A 3HREA 5M18A 1XXMA 4OLGA 1L0FA 3VSKA 2WKIA 1L0EA 2EFUA 4WBGA 2XDMA 2ZQAA 5CHUA 1VQQA 2HDQA 3O86A 5FAPA 4MBHA 2WAEA 3V39A 4R23A 2RCXA 2PU4A 1EROA 3G2ZA 4S2NC 5FQQA 5F1GA 2J8YA 3FKVA 3HLWA 4KZ9A 1K4EA 2QMIA 3BYDA 1E3UD 4S2PA 1NYMA 1WYBA 3RJUA 3ZHHA 5U47A 1CI8A 4BJPA 4NK3A 3DW0A 3IWQA 1TDLA 1G68A 3MZDA 5FQMA 5GL9A 1M6KA 4RX2A 1FR1A 3NCKA 5FA7A 3ZVWA 5TFQA 3N7WA 2FFYA 2XQZA 4QY5A 5EVIB 4E3OA 4KZ3A 4OONA 3N8SA 1DY6A 1FR6A 3C4PA 1YLYA 5FQKA 1TVFA 3UE1A 1LHYA 2DCFA 3DTMA 4JXSA 3IQAA 2XH9A 2WK0A 1RGZA 4RX3A 3PBOA 2R9WA 1KVMA 1NZOA 2ZM0A 1XX2A 4OOMA 4OVDA 4WZ5A 4DRTA 4EBNA 1L0DA 2XF3A 2XR0A 3V3RA 3W8KA 5GLBA 1LI0A 3G30A 1QMEA 4OQIA 5E2GA 4E3IA 1DJAA 4E3NA 3HLEA 3UN7A 3E2LA 4IBRA 3E2KA 1YMXA 3WS1A 2HDSA 3QHYA 4NETA 2A3UA 5EVLA 3WRZA 2E8IA 3W4OA 3GQZA 5GHXA 3RXWA 4KG5A 4DXCA 5J8XA 3PTEA 3S4XA 1MWTA 4JLFA 3UPNA 3ZCZA 3OCNA 4KQOA 4K0WA 3M2JA 2WADA 4JPMA 4OKPA 4Y7PA 5FDHA 2X02A 4S2OA 5AQ9A 4HESA 1Y54A 1BULA 1YLTA 3IF6B 4KZ4A 1K6RA 4WEKA 1KE4A 3ZG0A 3HUMA 1SHVA 5CGWA 2P9VA 2JC7A 3SS4A 3UY6A 5A92A 3NC8A 3NDEA 5FQJA 4OP8A 2A49A 3ZNTA 3G34A 3FV7A 3QNBA 4WMCD 2J9OA 2ZC6B 5GLDA 5A93A 1TDGA 5BOHA 3AGEA 4JXVA 3IXDA 4S2KA 1YT4A 3PBSA 1JTGA 4U0XA 4ZJ2A 2OV5A 1IYSA 2ZJ9A 1XKZA 4FD8A 2G2UA 1PI5A 3SS5A 2FFFB 4UHUA 2WKHA 1Q2PA 2HDRA 4R0QA 2HP5A 4CJNA 1PWDA 4Y0UA 4X6TA 3C5AA 3ZDJA 3UPPA 1NY0A 4WELA 1YLZA 4PM7A 4XXRA 4N1XA 3C7VA 5M19A 5CEDA 5KSCA 4EBPA 5F1FA 3HLBA 1CI9A 2XFTA 3G4PA 3WRTA 5F83A 4LENA 1I2WA 3ITBA 3UDFA 3RXXA 3BLMA 1MWRA 3G2YA 4RA7A 3JYIA 4Y0OA 2BG1A 1CEGA 2B5RA 5EVIA 5CTNA 3VSLA 1YM1A 4IEDA 1O07A 3D4FA 3NIAA 3FYZA 4FH4A 1ONHA 1LLBA 4QHCA 2Q9NA 2Y2MA 3FKWA 2WUQA 2XEPA 5A90A 3VP0A 1BLCA 2V20A 4U0TA 4OH0A 3Q82A 3ZGAB 1N9BA 1NYYA 4DE2A 5EE8A 1PZPA 4C6YA 5DTSA 4BD0A 2HDUA 1K55C 5L2FA 3P09A 3WS0A 1HD8A 4OPQA 1K57C 5KZHA 2OSUA 3ZG7B 3GVBA 4F94A 2OLUA 5AQ7A 1NRFA 3MZEA 2HP9A 5DTKA 2ZC5B 1W8QA 3M6BA 3Q1FA 4WZ5C 1J9MA 3PAGA 2XLNA 4IVKA 3Q07A 4N9KA 1OMEA 1ES3A 2Y2PA 3IWOA 5CXWA 4BD1A 1S6RA 3BLSA 4P6BA 1IYPA 3TSGA 4R3JA 1ZC2A 3IXGA 4EBLA 3GV9A 4GDNA 1FQGA 1WE4A 5CERA 3PBRA 3IF6A 4O7DA 5I94A 3ZFZA 2WGWB 3VFFA 4KG2A 2EX2A 3IF5A 2Y2IA 4OPYA 4OOLA 4PPRA 2WKEA 3EQVA 3LY4A 3MFDA 3DWKA 2EX6A 4PM8A 3UE0A 4S2JA 1K38A 4C75A 1XGJA 2QZ6A 3M2KA 4KG6A 4DDYA 2JE5A 4GKUA 1XP4A 4OQ0A 3ZVTA 3BEBA 1K56A 4N9LA 5FI2A 1GHIA 1HVBA 1CK3A 3O88A 1ESIA 5DVAA 3VOZA 4ID4A 2G2WA 3NI9A 5AQAA 2ZC4B 3AGDA 3UE3A 4JF6A 1GA9A 2ZQDA 4IVIA 4GB7A 3M6HA 3ZNYA 1JWVA 1EI5A 1H8ZA 4GOGA 4B4XA 1ALQA 2Y2OA 1WYCA 4PM5A 3IT9A 5G18A 3ITAA 4E3LA 5FATA 2UWXA 3A3EA 1K54C 5FQ9A 2VGJA 2EX8A 4R4SA 5HAPA 3N8LA 4X68A 1AXBA 5HX9A 4BENA 5EOEA 4UA7A 1KE0A 4E6WA 3SH8A 3ISGA 1BLPA 4OQHA 3BFFA 3ZG9B 3SOIA 1RGYA 3WS5A 1PIOA 4GD8A 4S2NA 3GTCA 5FI7A 1U60A 4MBKA 5CRFA 1I2SA 3FZCA 5E43A 3UO9A 4BL2A 2J9PA 1JVJA 3GMWA 5CHJA 2H5SA 1JWPA 1ERMA 4JF5A 1LL5A 3LCEA 3UDIA 3HLFA 1HZOA 2H0YA 3V50A 1ONGA 3OZHA 4FH2A 1KVLA 4OPRA 1PZOA 1SDNA 4P87A 5DF7A 2ZLYA 2ZQCA 5HAQA 2WGVA 4DDSA 5HL1A 3IH9A 4LCLA 5CEBA 3C4OA 3G31A 4GD6A 4D2OA 2JBFA 5GLCA 3PBNA 4E6XA 4X69A 1JTDA 4UAAA 5M1AA 3UNWA 3N8RA 1GHPA 5D3OA 1MKIA 4KQQA 4BLMA 2Z2LB 1BZAA 4MLLA 4DKIA 1FSWA 4CPKA 4UA6A 1MWSA 1NJ4A 4DF6A 1K6SA 4K0XA 1KGFA 1PWGA 4WM9A 4GN2A 2WGWA 3VFHA 4FSFA 2Y55A 3IHBA 1L2SA 1W79A 1FCMA 1RP5A 1M40A 4JF4A 1FSYA 2ZM2A 1RCJA 5HARA 2WZXA 2ZQ7A 4DXBA 3VP4A 3VP1A 4QU3A 5CGXA 4MNRA 3CJMA 3OPHA 2XK1A 2XD5A 2P74A 3OPPA 4R3BA 4PM6A 1DJBA 1TEMA 2C6WB 1ERQA 4LV3A 3MXSA 2GDNA 5CHMA 1S0WA 3VP3A 1IKIA 4JKTA 1E25A 1I5QA 3CG5A 1XA1A 4FCFA 3WS4A 3G35A 2CC1A 1E3UA 1PI4A 3OCLA 2VGKA 4KZAA 3OC2A 2Y2QA 2Y2HA 1FOFA 1Z6FA 2I72A 1XGIA 3UDXA 1NZUA 4E3JA 1IYOA 4QJGA 3AGFA 5CECA 4RVAA 2Y59A 4C3QA 4N1HA 1IELA 3A3IA 2H10A 1GA0A 5HW3A 2Y4AA 3IWIA 4ZBEA 4N92A 3PBQA 2IWCA 2WYXA 3IXHA 4HBTA 4P85A 1KGGA 1KDWA 2Y2KA 1YLPA 2Y2JA 3Q7VB 5FASA 4LV2A 3GSGA 3MKEA 5EVID 1ES5A 4R4RA 3ZG8B 3BFEA 4X53A 3VP2A 1IEMA 2EXBA 5EECA 1LL9A 3HL9A 4LV1A 1W5DA 3FWLA 4GZBA 2PBYA 3HVFA 2H0TA 3A3FA 4JXGA 4S2LA 3MBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EWF A;  3O87 A;  1KGE A;  5FQI A;  4JXW A;  3SS3 A;  2BLS A;  2DRW A;  4H8R A;  5DTT A;  1IKG A;  5EPH A;  4BL3 A;  1KDS A;  4QY6 A;  5E2E A;  4B88 A;  4EUZ A;  1PYY A;  3I7J A;  1PW1 A;  4E3K A;  3ZG5 A;  1YLW A;  2PU2 A;  4XUZ A;  3NBL A;  4BQM A;  4DE3 A;  5F82 A;  4HBU A;  3BEC A;  4KZ7 A;  3N4I A;  2ZMA A;  4QD4 A;  1XPB A;  1GCE A;  2V2F F;  3IHA A;  1IYQ A;  4ZTK A;  5TR7 A;  3SH9 A;  3W4P A;  1XA7 A;  1MXO A;  1W7F A;  3QNC A;  4RYE A;  5TGF A;  3UPO A;  1ZG6 A;  3SH7 A;  4X56 A;  2XD1 A;  4UA9 A;  1YQS A;  5CGS A;  3HLG A;  3A3J A;  4ZDX A;  2X01 A;  1K55 A;  2XFS A;  4KQR A;  4MEZ A;  4QB8 A;  1PW8 A;  4Q8I A;  3HUO A;  3N6I A;  4WMC A;  3EQU A;  1K57 A;  4DE1 A;  5EOO A;  3MKF A;  3S22 A;  2HP6 A;  1K4F A;  2WGI A;  5KSH A;  2OLV A;  2WAF A;  3MZF A;  3HUN A;  2ZC7 A;  3B3X A;  3HBR A;  3LO7 A;  3Q7Z A;  3IH8 A;  4ZAM A;  2ZM8 A;  1LI9 A;  1SKF A;  2XGN A;  1ZG4 A;  5JYP A;  5A91 A;  3CMZ A;  2Z2M B;  5CTM A;  4E3M A;  4EV4 A;  1FCO A;  3LY3 A;  1GHM A;  5EVI C;  3OPL A;  4K91 A;  2QPN A;  4EQI A;  1BLH A;  1W8Y A;  2RL3 A;  3A3D A;  3GRJ A;  5E2F A;  3TOI A;  5GLA A;  1K56 D;  4KZB A;  2ZQ9 A;  4JBF A;  2ZD8 A;  4KZ5 A;  4R1G A;  4YFM A;  4LCM A;  5E2H A;  4OPZ A;  2Y2G A;  4L0L A;  1L0G A;  3G32 A;  1BUE A;  2HPB A;  1MBL A;  1KE3 A;  3DWZ A;  2R9X A;  3NY4 A;  1BLS A;  3PAE A;  4GNU A;  3BFG A;  4S2M A;  2WZZ A;  3C7U A;  2IWD A;  4P0M A;  4KZ8 A;  1C3B A;  3BFC A;  4U3T A;  3TG9 A;  1JWZ A;  3Q7V A;  5FAO A;  5FAQ A;  2Q9M A;  4WEJ A;  3VOY A;  3VMA A;  3LEZ A;  2ZQ8 A;  1BTL A;  5FSR A;  1MPL A;  2Y2L A;  5FI6 A;  1K25 A;  1FCN A;  5DF9 A;  2ZC3 B;  3V3S A;  3OPR A;  3P98 A;  4XUX A;  2Y91 A;  1YMS A;  3BRM A;  4OQG A;  1G6A A;  1N4O A;  4KZ6 A;  3CZD A;  1ES4 A;  4Y0T A;  1DJC A;  1K54 A;  3HLC A;  1MWU A;  3IXB A;  1VM1 A;  3NDG A;  5HFO A;  4PM9 A;  3GR2 A;  4S2I A;  5DF8 A;  3IF6 C;  3W4Q A;  3Q81 A;  4YIN A;  1QMF A;  5IHV A;  5GHZ A;  2JCH A;  4OOY A;  1MY8 A;  3WWX A;  1E4D A;  4B4Z A;  3BFD A;  2X71 A;  4M3K A;  1H5X A;  4HEF A;  3S1Y A;  3PBT A;  4WYY A;  1ES2 A;  1CEF A;  4WZ4 A;  1SCW A;  2EX9 A;  1EWZ A;  3V5M A;  4GDB A;  4KEN B;  3BM6 A;  5AQB A;  2EFX A;  2IWB A;  4DE0 A;  4PMA A;  1Q2Q A;  1NXY A;  2V1Z A;  1PWC A;  2Y2N A;  3HLD A;  5GHY A;  3WS2 A;  5JYO A;  1BT5 A;  5EUA A;  4OLD A;  2C5W B;  4ZJ3 A;  4ZJ1 A;  2EXA A;  1YLJ A;  2P9V B;  4Z9Q A;  1H8Y A;  1SDE A;  4IBX A;  5HAI A;  4OP5 A;  1ZKJ A;  1O7E A;  4LV0 A;  4MBF A;  1BSG A;  2DNS A;  2J7V A;  1HTZ A;  3O3V A;  4A5R A;  3MXR A;  5KMW A;  1ESU A;  4X55 A;  3HRE A;  5M18 A;  1XXM A;  4OLG A;  1L0F A;  3VSK A;  2WKI A;  1L0E A;  2EFU A;  4WBG A;  2XDM A;  2ZQA A;  5CHU A;  1VQQ A;  2HDQ A;  3O86 A;  5FAP A;  4MBH A;  2WAE A;  3V39 A;  4R23 A;  2RCX A;  2PU4 A;  1ERO A;  3G2Z A;  4S2N C;  5FQQ A;  5F1G A;  2J8Y A;  3FKV A;  3HLW A;  4KZ9 A;  1K4E A;  2QMI A;  3BYD A;  1E3U D;  4S2P A;  1NYM A;  1WYB A;  3RJU A;  3ZHH A;  5U47 A;  1CI8 A;  4BJP A;  4NK3 A;  3DW0 A;  3IWQ A;  1TDL A;  1G68 A;  3MZD A;  5FQM A;  5GL9 A;  1M6K A;  4RX2 A;  1FR1 A;  3NCK A;  5FA7 A;  3ZVW A;  5TFQ A;  3N7W A;  2FFY A;  2XQZ A;  4QY5 A;  5EVI B;  4E3O A;  4KZ3 A;  4OON A;  3N8S A;  1DY6 A;  1FR6 A;  3C4P A;  1YLY A;  5FQK A;  1TVF A;  3UE1 A;  1LHY A;  2DCF A;  3DTM A;  4JXS A;  3IQA A;  2XH9 A;  2WK0 A;  1RGZ A;  4RX3 A;  3PBO A;  2R9W A;  1KVM A;  1NZO A;  2ZM0 A;  1XX2 A;  4OOM A;  4OVD A;  4WZ5 A;  4DRT A;  4EBN A;  1L0D A;  2XF3 A;  2XR0 A;  3V3R A;  3W8K A;  5GLB A;  1LI0 A;  3G30 A;  1QME A;  4OQI A;  5E2G A;  4E3I A;  1DJA A;  4E3N A;  3HLE A;  3UN7 A;  3E2L A;  4IBR A;  3E2K A;  1YMX A;  3WS1 A;  2HDS A;  3QHY A;  4NET A;  2A3U A;  5EVL A;  3WRZ A;  2E8I A;  3W4O A;  3GQZ A;  5GHX A;  3RXW A;  4KG5 A;  4DXC A;  5J8X A;  3PTE A;  3S4X A;  1MWT A;  4JLF A;  3UPN A;  3ZCZ A;  3OCN A;  4KQO A;  4K0W A;  3M2J A;  2WAD A;  4JPM A;  4OKP A;  4Y7P A;  5FDH A;  2X02 A;  4S2O A;  5AQ9 A;  4HES A;  1Y54 A;  1BUL A;  1YLT A;  3IF6 B;  4KZ4 A;  1K6R A;  4WEK A;  1KE4 A;  3ZG0 A;  3HUM A;  1SHV A;  5CGW A;  2P9V A;  2JC7 A;  3SS4 A;  3UY6 A;  5A92 A;  3NC8 A;  3NDE A;  5FQJ A;  4OP8 A;  2A49 A;  3ZNT A;  3G34 A;  3FV7 A;  3QNB A;  4WMC D;  2J9O A;  2ZC6 B;  5GLD A;  5A93 A;  1TDG A;  5BOH A;  3AGE A;  4JXV A;  3IXD A;  4S2K A;  1YT4 A;  3PBS A;  1JTG A;  4U0X A;  4ZJ2 A;  2OV5 A;  1IYS A;  2ZJ9 A;  1XKZ A;  4FD8 A;  2G2U A;  1PI5 A;  3SS5 A;  2FFF B;  4UHU A;  2WKH A;  1Q2P A;  2HDR A;  4R0Q A;  2HP5 A;  4CJN A;  1PWD A;  4Y0U A;  4X6T A;  3C5A A;  3ZDJ A;  3UPP A;  1NY0 A;  4WEL A;  1YLZ A;  4PM7 A;  4XXR A;  4N1X A;  3C7V A;  5M19 A;  5CED A;  5KSC A;  4EBP A;  5F1F A;  3HLB A;  1CI9 A;  2XFT A;  3G4P A;  3WRT A;  5F83 A;  4LEN A;  1I2W A;  3ITB A;  3UDF A;  3RXX A;  3BLM A;  1MWR A;  3G2Y A;  4RA7 A;  3JYI A;  4Y0O A;  2BG1 A;  1CEG A;  2B5R A;  5EVI A;  5CTN A;  3VSL A;  1YM1 A;  4IED A;  1O07 A;  3D4F A;  3NIA A;  3FYZ A;  4FH4 A;  1ONH A;  1LLB A;  4QHC A;  2Q9N A;  2Y2M A;  3FKW A;  2WUQ A;  2XEP A;  5A90 A;  3VP0 A;  1BLC A;  2V20 A;  4U0T A;  4OH0 A;  3Q82 A;  3ZGA B;  1N9B A;  1NYY A;  4DE2 A;  5EE8 A;  1PZP A;  4C6Y A;  5DTS A;  4BD0 A;  2HDU A;  1K55 C;  5L2F A;  3P09 A;  3WS0 A;  1HD8 A;  4OPQ A;  1K57 C;  5KZH A;  2OSU A;  3ZG7 B;  3GVB A;  4F94 A;  2OLU A;  5AQ7 A;  1NRF A;  3MZE A;  2HP9 A;  5DTK A;  2ZC5 B;  1W8Q A;  3M6B A;  3Q1F A;  4WZ5 C;  1J9M A;  3PAG A;  2XLN A;  4IVK A;  3Q07 A;  4N9K A;  1OME A;  1ES3 A;  2Y2P A;  3IWO A;  5CXW A;  4BD1 A;  1S6R A;  3BLS A;  4P6B A;  1IYP A;  3TSG A;  4R3J A;  1ZC2 A;  3IXG A;  4EBL A;  3GV9 A;  4GDN A;  1FQG A;  1WE4 A;  5CER A;  3PBR A;  3IF6 A;  4O7D A;  5I94 A;  3ZFZ A;  2WGW B;  3VFF A;  4KG2 A;  2EX2 A;  3IF5 A;  2Y2I A;  4OPY A;  4OOL A;  4PPR A;  2WKE A;  3EQV A;  3LY4 A;  3MFD A;  3DWK A;  2EX6 A;  4PM8 A;  3UE0 A;  4S2J A;  1K38 A;  4C75 A;  1XGJ A;  2QZ6 A;  3M2K A;  4KG6 A;  4DDY A;  2JE5 A;  4GKU A;  1XP4 A;  4OQ0 A;  3ZVT A;  3BEB A;  1K56 A;  4N9L A;  5FI2 A;  1GHI A;  1HVB A;  1CK3 A;  3O88 A;  1ESI A;  5DVA A;  3VOZ A;  4ID4 A;  2G2W A;  3NI9 A;  5AQA A;  2ZC4 B;  3AGD A;  3UE3 A;  4JF6 A;  1GA9 A;  2ZQD A;  4IVI A;  4GB7 A;  3M6H A;  3ZNY A;  1JWV A;  1EI5 A;  1H8Z A;  4GOG A;  4B4X A;  1ALQ A;  2Y2O A;  1WYC A;  4PM5 A;  3IT9 A;  5G18 A;  3ITA A;  4E3L A;  5FAT A;  2UWX A;  3A3E A;  1K54 C;  5FQ9 A;  2VGJ A;  2EX8 A;  4R4S A;  5HAP A;  3N8L A;  4X68 A;  1AXB A;  5HX9 A;  4BEN A;  5EOE A;  4UA7 A;  1KE0 A;  4E6W A;  3SH8 A;  3ISG A;  1BLP A;  4OQH A;  3BFF A;  3ZG9 B;  3SOI A;  1RGY A;  3WS5 A;  1PIO A;  4GD8 A;  4S2N A;  3GTC A;  5FI7 A;  1U60 A;  4MBK A;  5CRF A;  1I2S A;  3FZC A;  5E43 A;  3UO9 A;  4BL2 A;  2J9P A;  1JVJ A;  3GMW A;  5CHJ A;  2H5S A;  1JWP A;  1ERM A;  4JF5 A;  1LL5 A;  3LCE A;  3UDI A;  3HLF A;  1HZO A;  2H0Y A;  3V50 A;  1ONG A;  3OZH A;  4FH2 A;  1KVL A;  4OPR A;  1PZO A;  1SDN A;  4P87 A;  5DF7 A;  2ZLY A;  2ZQC A;  5HAQ A;  2WGV A;  4DDS A;  5HL1 A;  3IH9 A;  4LCL A;  5CEB A;  3C4O A;  3G31 A;  4GD6 A;  4D2O A;  2JBF A;  5GLC A;  3PBN A;  4E6X A;  4X69 A;  1JTD A;  4UAA A;  5M1A A;  3UNW A;  3N8R A;  1GHP A;  5D3O A;  1MKI A;  4KQQ A;  4BLM A;  2Z2L B;  1BZA A;  4MLL A;  4DKI A;  1FSW A;  4CPK A;  4UA6 A;  1MWS A;  1NJ4 A;  4DF6 A;  1K6S A;  4K0X A;  1KGF A;  1PWG A;  4WM9 A;  4GN2 A;  2WGW A;  3VFH A;  4FSF A;  2Y55 A;  3IHB A;  1L2S A;  1W79 A;  1FCM A;  1RP5 A;  1M40 A;  4JF4 A;  1FSY A;  2ZM2 A;  1RCJ A;  5HAR A;  2WZX A;  2ZQ7 A;  4DXB A;  3VP4 A;  3VP1 A;  4QU3 A;  5CGX A;  4MNR A;  3CJM A;  3OPH A;  2XK1 A;  2XD5 A;  2P74 A;  3OPP A;  4R3B A;  4PM6 A;  1DJB A;  1TEM A;  2C6W B;  1ERQ A;  4LV3 A;  3MXS A;  2GDN A;  5CHM A;  1S0W A;  3VP3 A;  1IKI A;  4JKT A;  1E25 A;  1I5Q A;  3CG5 A;  1XA1 A;  4FCF A;  3WS4 A;  3G35 A;  2CC1 A;  1E3U A;  1PI4 A;  3OCL A;  2VGK A;  4KZA A;  3OC2 A;  2Y2Q A;  2Y2H A;  1FOF A;  1Z6F A;  2I72 A;  1XGI A;  3UDX A;  1NZU A;  4E3J A;  1IYO A;  4QJG A;  3AGF A;  5CEC A;  4RVA A;  2Y59 A;  4C3Q A;  4N1H A;  1IEL A;  3A3I A;  2H10 A;  1GA0 A;  5HW3 A;  2Y4A A;  3IWI A;  4ZBE A;  4N92 A;  3PBQ A;  2IWC A;  2WYX A;  3IXH A;  4HBT A;  4P85 A;  1KGG A;  1KDW A;  2Y2K A;  1YLP A;  2Y2J A;  3Q7V B;  5FAS A;  4LV2 A;  3GSG A;  3MKE A;  5EVI D;  1ES5 A;  4R4R A;  3ZG8 B;  3BFE A;  4X53 A;  3VP2 A;  1IEM A;  2EXB A;  5EEC A;  1LL9 A;  3HL9 A;  4LV1 A;  1W5D A;  3FWL A;  4GZB A;  2PBY A;  3HVF A;  2H0T A;  3A3F A;  4JXG A;  4S2L A;  3MBZ A; 
#chains in the Genus database with same CATH topology
 4JXW A;  1OT9 A;  2W3E A;  2BLS A;  2DRW A;  2W1R A;  2JKF A;  1KDS A;  4QY6 A;  4EUZ A;  1PYY A;  3ZG5 A;  2O9A A;  5F82 A;  4KZ7 A;  4ZTK A;  3SH9 A;  1MXO A;  4RYE A;  3QNC A;  2P08 A;  5EM0 A;  3FC7 A;  3S7Q A;  3MXQ A;  3U4L P;  4UA9 A;  1G6O A;  5CGS A;  2XFS A;  3KSF A;  3EWK A;  3HUO A;  3N6I A;  4DE1 A;  3MKF A;  1S67 L;  1UGU A;  5DJT A;  2ZC7 A;  3HBR A;  1OJG A;  1A0K A;  3NJA A;  1T18 A;  4E3M A;  1FCO A;  2K7S A;  1W8Y A;  4IUK A;  3S7N A;  4KZB A;  4KZ5 A;  4R1G A;  1G5U A;  1BUE A;  2VKS A;  1MBL A;  1KE3 A;  3H7W B;  2WZZ A;  3C7U A;  2W3F A;  1C3B A;  4YNR A;  1JWZ A;  5HWW A;  3LEZ A;  5F6A A;  2Y2L A;  1FCN A;  4XUX A;  2Y91 A;  1G6A A;  4KZ6 A;  1ES4 A;  2V9A A;  4HJ6 A;  1DJC A;  3NDG A;  5HFO A;  1VM1 A;  2EWV A;  5DF8 A;  3W4Q A;  4GCZ A;  4YIN A;  1E4D A;  2W3D A;  2O99 A;  4HEF A;  1F98 A;  4KEN B;  1OPX A;  4MDZ A;  1OTA A;  4PMA A;  1F5M A;  1Q2Q A;  2XSS A;  2V1Z A;  1PWC A;  4LFU A;  5GHY A;  5JYO A;  2BAS A;  2C5W B;  3DBA A;  4O01 A;  1H8Y A;  1SDE A;  1ZKJ A;  1BSG A;  2DNS A;  4WLA A;  4OLG A;  2P7J A;  2EFU A;  1VQQ A;  2HDQ A;  2WKQ A;  2WAE A;  2PU4 A;  2J8Y A;  3FKV A;  3HLW A;  2FZ0 A;  4O0P A;  1E3U D;  1NYM A;  1WYB A;  3CPT A;  5U47 A;  4O8G A;  3IWQ A;  3MZD A;  1G68 A;  3K2N A;  4RX2 A;  1FR1 A;  1S4S A;  3N7W A;  2XQZ A;  1ODV A;  5EVI B;  4EUV A;  4KZ3 A;  5HPF A;  3N8S A;  1DY6 A;  3C4P A;  1TVF A;  5EM1 A;  1XFQ A;  2PAV P;  2AVX A;  3DTM A;  3IQA A;  1DP8 A;  1T1C A;  4L9F A;  1NZO A;  4Y15 A;  4NKP A;  4OVD A;  4DRT A;  1L0D A;  5HD3 A;  3CLO A;  1QME A;  2Z6D A;  3UE6 A;  3UME A;  3LFV A;  2J3T C;  3WS1 A;  1P9R A;  2HDS A;  4BWI A;  4GW9 A;  2E8I A;  3RXW A;  4JGQ A;  3VV4 A;  3D72 A;  5FDH A;  2X02 A;  1Y54 A;  4KZ4 A;  3IF6 B;  4WEK A;  1K6R A;  2JC7 A;  3NC8 A;  2A49 A;  5A93 A;  3FV7 A;  4NEE D;  2ZC6 B;  5GLD A;  4U0X A;  1IYS A;  1LL8 A;  4FD8 A;  3NOP C;  2WKH A;  2HGV A;  3NUL A;  3MMH A;  3HJK A;  3UPP A;  3TE8 A;  4II7 A;  4RQ9 A;  4PM7 A;  3C7V A;  4EBP A;  5F1F A;  2OWJ A;  5F83 A;  1I2W A;  2PD7 A;  5MC7 A;  1P97 A;  3G2Y A;  1MWR A;  1LT0 A;  4Y0O A;  1D7E A;  2B5R A;  5CTN A;  3VSL A;  4IED A;  2M1C A;  3FKW A;  2WUQ A;  5A90 A;  2GJ3 A;  1JNU A;  3VP0 A;  2JHE A;  2V20 A;  4OH0 A;  3KYE A;  4C6Y A;  4I3A A;  1HD8 A;  4I5S A;  2OSU A;  1F2K A;  3MZE A;  2HP9 A;  4Y3I A;  4N9K A;  3UB8 A;  2ACG A;  1ES3 A;  3IWO A;  5CXW A;  1XJ3 A;  2M7U A;  1IYP A;  4R3J A;  4EBL A;  3CI6 A;  2WKR A;  4GHI A;  5I94 A;  2WGW B;  1CJF A;  2EX2 A;  4OOL A;  4PPR A;  3C2W A;  3LY4 A;  4EEP A;  1K38 A;  2VEA A;  5HDC A;  5G4Y A;  1XGJ A;  4KG6 A;  2JKR M;  1XP4 A;  3F1P B;  4OQ0 A;  2VX8 A;  5HL6 A;  2PBD P;  5FI2 A;  1HVB A;  3O88 A;  3NI9 A;  4Q0H A;  4PKY A;  3ZNY A;  2W3G A;  3MF0 A;  2Y2O A;  4E3L A;  5G18 A;  5FQ9 A;  3PXP A;  5HX9 A;  4UA7 A;  3UB9 A;  4E6W A;  4MN6 A;  1RGY A;  5F69 A;  1TF1 A;  2A2L A;  4Q0I A;  4BBT A;  4ETX A;  5CHJ A;  1JWP A;  1ERM A;  3LCE A;  1IOU A;  3OZH A;  4FH2 A;  4OPR A;  3IBJ A;  2ZLY A;  2ZQC A;  4YOF A;  3T50 A;  5I5L A;  5M1A A;  3OBF A;  5D3O A;  1BZA A;  3BW6 A;  1FSW A;  1NJ4 A;  4K0X A;  4WM9 A;  4GN2 A;  2INW A;  4FSF A;  2Y55 A;  1RP5 A;  1RCJ A;  2XRO A;  5HAR A;  4QU3 A;  4JGO A;  5CGX A;  4MNR A;  2XD5 A;  2P74 A;  4R3B A;  4LPZ A;  4NXF A;  3NOT C;  1TEM A;  2EWW A;  5CHM A;  1S0W A;  4JKT A;  2O9B A;  1E25 A;  1XA1 A;  4FCF A;  2W1T B;  4ESP A;  2R78 A;  2HF6 A;  2VGK A;  1FOF A;  5F68 A;  1IYO A;  5AVF A;  4RVA A;  4C3Q A;  4N1H A;  3VE3 A;  3PBQ A;  4NXG A;  1FIL A;  4I39 A;  3LUQ A;  4HI4 A;  4LV2 A;  2KDK A;  5HWT A;  4R4R A;  1IEM A;  3FPW A;  1LL9 A;  1ZTU A;  3FWL A;  5EFW A;  3MBZ A;  4HNB A;  1KGE A;  5FQI A;  2V8F A;  4P6Z M;  1IKG A;  1GSV A;  4B88 A;  4E3K A;  1YLW A;  2PU2 A;  4XUZ A;  3NBL A;  4BQM A;  5FEF A;  3F1O B;  2Q0O A;  4HBU A;  3N4I A;  3BQA A;  2ZMA A;  5AVE A;  3W4P A;  1XA7 A;  2VA0 A;  3SH7 A;  3CUE C;  3A3J A;  3H82 B;  2X01 A;  1K55 A;  3T4J A;  3FPV A;  4JGR A;  1K57 A;  4XT2 A;  5A8B A;  5EOO A;  3S22 A;  5KSH A;  2WAF A;  3G6O A;  3HUN A;  3Q7Z A;  4ZAM A;  2ZM8 A;  2XGN A;  1MZU A;  2D01 A;  5JYP A;  3CMZ A;  4GS9 A;  5EVI C;  4EQI A;  3A3D A;  3GRJ A;  1TS7 A;  4QWO A;  3TOI A;  5GLA A;  1K56 D;  4X1M A;  4MMN A;  4R38 A;  3RTY A;  3EGD C;  4LCM A;  4ARZ A;  2L4R A;  4OPZ A;  2Y2G A;  1L0G A;  2HPB A;  1TS0 A;  3LIE A;  3DWZ A;  1VB6 A;  3NY4 A;  3A0S A;  3BFG A;  4S2M A;  4P0M A;  5HSQ A;  4U3T A;  2HJE A;  3ULF A;  3Q7V A;  5FAO A;  5FAQ A;  2Q9M A;  3VMA A;  2ZQ8 A;  3RFB A;  5FI6 A;  5DF9 A;  2PR6 A;  3V3S A;  4EER A;  4B93 A;  4OQG A;  5K5B A;  1V9Z A;  1MWU A;  4CLC A;  4S2I A;  1OT6 A;  3IF6 C;  4NG2 A;  3Q81 A;  1GSX A;  3QP6 A;  5IHV A;  5GHZ A;  1MY8 A;  3UB5 P;  3KYQ A;  4B4Z A;  1TD5 A;  1S66 L;  1H5X A;  3PBT A;  4E04 A;  1EWZ A;  3V5M A;  2VV7 A;  4DE0 A;  1XJ6 A;  2Y2N A;  3WS2 A;  4OLD A;  4G3W A;  4ZJ3 A;  4ZJ1 A;  3IX4 A;  1LSX A;  1YLJ A;  4Z9Q A;  1J3W A;  4OP5 A;  1O7E A;  4LV0 A;  1SKO A;  4MBF A;  2J7V A;  1HTZ A;  4A5R A;  5KMW A;  5M18 A;  2ZL1 B;  4DN0 A;  3VE4 A;  2WKI A;  2ZQA A;  3O86 A;  5FAP A;  3V39 A;  5F1G A;  2QMI A;  4R70 A;  1CI8 A;  4BJP A;  4BBU A;  3DW0 A;  5FQM A;  3BJN A;  5GL9 A;  3QP2 A;  3ZVW A;  3MFX A;  2FFY A;  3CHW P;  4E3O A;  4HJ4 A;  2O0Y A;  2QYB A;  4RX3 A;  3PBO A;  2R9W A;  3IS2 A;  1KVM A;  4M4X A;  3LR4 A;  4EBN A;  2XF3 A;  2XR0 A;  3JVV A;  3V3R A;  4OQI A;  4E3I A;  4F3L B;  4E3N A;  3UN7 A;  3E2L A;  3E2K A;  1YMX A;  3LIA A;  5FL3 A;  2ZMF A;  2A3U A;  5EVL A;  3W4O A;  5GHX A;  4KG5 A;  2LB5 A;  4EXO A;  3KX0 X;  4KQO A;  1W63 M;  4K0W A;  2WAD A;  4OKP A;  4Y7P A;  1KE4 A;  3ZG0 A;  5CGW A;  1SHV A;  3UY6 A;  2P9V A;  3SS4 A;  2PHY A;  2J9O A;  3AGE A;  3ZQ5 A;  4S2K A;  3IXD A;  4JXV A;  1CF0 A;  1VET B;  1XKZ A;  1VEU B;  2LB9 A;  4UHU A;  1S4R A;  4R0Q A;  1P9W A;  3S7O A;  4Y0U A;  3C5A A;  3ZDJ A;  4X1L A;  5CED A;  5KSC A;  2NUP C;  3VOL A;  1F9I A;  3HLB A;  3G4P A;  2L1M A;  2ZOH A;  3RXX A;  4RA7 A;  3JYI A;  1O07 A;  3D4F A;  3NIA A;  4FOF A;  3FYZ A;  4FH4 A;  1LLB A;  4QHC A;  2Q9N A;  2Y2M A;  2XEP A;  2PDR A;  5DTS A;  4MN5 A;  4OPQ A;  5DFX A;  3EEA A;  3ZG7 B;  4G3V A;  5DTK A;  3M6B A;  2XLN A;  1OME A;  2XRN A;  3TSG A;  2QWS A;  1ZC2 A;  3T1R A;  1FQG A;  4HH3 A;  3C30 A;  3PYP A;  3B47 A;  3PBR A;  5HDD A;  3VFF A;  3IF5 A;  5IU1 A;  1Y4O A;  2WKE A;  3MFD A;  3KYZ A;  2EX6 A;  1N9N A;  1PFL A;  3T4O A;  4EW7 A;  2JE5 A;  3A0V A;  4LGW A;  1CK3 A;  3VOZ A;  1ESI A;  2ZC4 B;  4JF6 A;  1GA9 A;  3U2A A;  3SW1 A;  2O9C A;  4H6J A;  3PR6 A;  5HWV A;  3IT9 A;  3ITA A;  5FAT A;  1K54 C;  3ICY A;  4NXB A;  3E0Y A;  4R4S A;  4BEN A;  4L9G A;  5EOE A;  1TS8 A;  1KE0 A;  3SOI A;  2BTF P;  4Y13 A;  3BWL A;  3T1X A;  5CRF A;  3FZC A;  4D60 A;  3UO9 A;  2J9P A;  1JVJ A;  3GMW A;  3O5Y A;  1LL5 A;  3UDI A;  3T1S A;  1HZO A;  2H0Y A;  1H3Q A;  3E4O A;  1SDN A;  1T1A A;  5HAQ A;  3LIB A;  2B02 A;  2HV1 A;  3QP8 A;  3T4K A;  4UEY A;  2JBF A;  5L07 A;  2VV8 A;  4X25 A;  4I38 A;  4MLL A;  3V67 A;  4UA6 A;  1KGF A;  2I9V A;  3VFH A;  3IHB A;  1L2S A;  1SZV A;  1M40 A;  4JF4 A;  2WZX A;  3VP1 A;  1YAX A;  3OPH A;  4LRZ E;  4P6Z S;  2VGL M;  2CC1 A;  1OTD A;  4KZA A;  3OC2 A;  2Y2Q A;  1Z6F A;  2A24 B;  3P7N A;  3AGF A;  5CX7 A;  3A3I A;  2JKT M;  1GA0 A;  4ZBE A;  4N92 A;  1N9O A;  2IWC A;  4P85 A;  1KGG A;  1EW0 A;  3LR3 A;  1W63 Q;  5EV0 A;  5L09 A;  3BFE A;  3VP2 A;  2EXB A;  5EEC A;  3HL9 A;  1W5D A;  2ZMV A;  3A3F A;  4EWF A;  3O87 A;  3SS3 A;  1XJ2 A;  5EPH A;  4BL3 A;  1PW1 A;  3QP5 A;  5FEG A;  2V2F F;  2OAP 1;  3UPO A;  5TGF A;  3FG8 A;  3KO6 A;  5IS1 A;  4ZDX A;  2ZOI A;  4QB8 A;  1PW8 A;  4Q8I A;  2PYP A;  3E4P A;  3LID A;  4WMC A;  1DRM A;  4KQD A;  3LI8 A;  2V8C A;  2HP6 A;  2P04 A;  2WGI A;  3BQ8 A;  3MZF A;  4FTX A;  3B3X A;  5TBM A;  3LO7 A;  5C5K A;  3IH8 A;  1SKF A;  1ZG4 A;  2Z2M B;  2Z6C A;  1GHM A;  4K91 A;  3F1N A;  2RL3 A;  3BY9 A;  2ZQ9 A;  2KX6 A;  2OAQ 1;  2QJ7 A;  4YFM A;  5E2H A;  2YKH A;  3CPT B;  3G32 A;  3IBR A;  2GZA A;  2IWD A;  3JVU A;  2J3W A;  4EU0 A;  3VOY A;  3OLO A;  4GJ4 A;  1BTL A;  5FSR A;  1MPL A;  2DMW A;  2ZC3 B;  3OPR A;  1YMS A;  4ME4 A;  4Y5F A;  3B42 A;  3HLC A;  3GR2 A;  4QPR A;  5HDS A;  1UWP X;  2JCH A;  3WWX A;  3TJZ C;  2W3H A;  2X71 A;  3S1Y A;  4WYY A;  1ES2 A;  1CEF A;  1FIK A;  1VHM A;  2EFX A;  1H8M A;  5AQB A;  2IWB A;  4HOI A;  3UMD A;  1NXY A;  3HLD A;  5EUA A;  2GX5 A;  5EVE A;  4GLQ A;  2MJ6 A;  4LRX C;  3CAX A;  2H28 A;  5HAI A;  1WA9 A;  3O3V A;  4DMZ A;  3MXR A;  3HRE A;  3UB7 A;  2W0N A;  1L0F A;  2QJ5 A;  5J4E A;  1PNE A;  2XDM A;  3T4T A;  1Z09 A;  3LI9 A;  3LYX A;  1ERO A;  4S2N C;  3UB6 A;  1CQA A;  1K4E A;  4S2P A;  3RJU A;  1TDL A;  2OOL A;  1M6K A;  3H7W A;  3NCK A;  3W2Z A;  1S1Y A;  4BBV A;  1YLY A;  5FQK A;  3CIT A;  2XH9 A;  1RGZ A;  3BY8 A;  1XX2 A;  4OOM A;  4WZ5 A;  1LI0 A;  3G30 A;  3MJQ A;  2K31 A;  1XFN A;  1NWZ A;  3HLE A;  3QP4 A;  4NET A;  5IT5 A;  3GQZ A;  4DXC A;  1V9Y A;  5J8X A;  3PTE A;  3UPN A;  3ZCZ A;  3OCN A;  3MQQ A;  4GHI B;  4HES A;  1YLT A;  1BUL A;  3HUM A;  4WL9 A;  3ZNT A;  5BOH A;  5J3W A;  1N9L A;  1YT4 A;  3PBS A;  4R6L A;  3LR0 A;  4ZJ2 A;  2OV5 A;  2ZJ9 A;  2Y8H A;  2FFF B;  4HY8 A;  3CUE A;  1Q2P A;  2HDR A;  1NLZ A;  2PT7 A;  4ZRR A;  2WKP A;  4X6T A;  1NY0 A;  3MR0 A;  4WEL A;  1YLZ A;  5M19 A;  2XFT A;  3ITB A;  4Y17 A;  3UDF A;  2VLG A;  2BG1 A;  1CEG A;  5EVI A;  1NLY A;  3H9W A;  1YM1 A;  5HZH A;  4YWZ A;  1ONH A;  5KIZ A;  2YKF A;  3ZGA B;  4U0T A;  1N9B A;  2VJW A;  5EE8 A;  1PRQ A;  1LSV A;  4BD0 A;  3GVB A;  1NRF A;  3E4Q A;  2NUT C;  3TRC A;  4Q0J A;  2ZC5 B;  1W8Q A;  3LGO A;  4IVK A;  4LLO B;  1UWN X;  2Y2P A;  4BD1 A;  1S6R A;  3BLS A;  5F5Y A;  3IXG A;  4MCW A;  3GV9 A;  3HJI A;  3IF6 A;  3DTE A;  4OPY A;  2Y2I A;  4G3K A;  3EQV A;  4HP9 A;  3UE0 A;  2Y79 A;  4PAU A;  2QZ6 A;  4Y2F A;  4DDY A;  4GKU A;  3ZVT A;  3BEB A;  2V1A A;  3EGX C;  2QKP A;  4HP4 A;  5DVA A;  1L3L A;  3LEQ A;  5AQA A;  3UE3 A;  2ZQD A;  3M6H A;  1EI5 A;  4GOG A;  4B4X A;  1ALQ A;  1LSW A;  1WYC A;  3A3E A;  2VGJ A;  2EX8 A;  4X68 A;  1AXB A;  1BLP A;  4OQH A;  3BFF A;  3ZG9 B;  3DAV A;  3WS5 A;  2ZBB A;  4GD8 A;  3GTC A;  4MBK A;  3NHQ A;  1I2S A;  3A0R A;  2H5S A;  1DP6 A;  2PYR A;  4PKY G;  3HLF A;  4IHQ A;  2VGL S;  1KVL A;  3E98 A;  1PZO A;  3PHY A;  4P87 A;  3T12 B;  3RH8 B;  2L0W A;  5HD5 A;  4DDS A;  2A24 A;  2W27 A;  3EEH A;  4LCL A;  5CEB A;  3C4O A;  2VZW A;  2PRF A;  3PBN A;  3IX8 A;  4E6X A;  4UAA A;  1D06 A;  1GHP A;  3N8R A;  4EET B;  1MKI A;  4KQQ A;  2Z2L B;  4DKI A;  3DTK A;  4DF6 A;  2VK3 A;  4JGP A;  2WGW A;  1STZ A;  4XT2 B;  3NEC A;  1H0M A;  1FCM A;  1FSY A;  3L7H A;  4DXB A;  2ZQ7 A;  3VP4 A;  1OTB A;  1HLU P;  2XK1 A;  4PM6 A;  1ERQ A;  3F1P A;  3KSI A;  4GS9 B;  1I5Q A;  3C8C A;  3G35 A;  1E3U A;  3S7P A;  3HCY A;  4ARZ B;  1NZU A;  1YPR A;  5CEC A;  1IEL A;  2H10 A;  4IJG A;  3R7W B;  4I3I A;  3IX3 A;  2WYX A;  1T19 A;  3IXH A;  3P01 A;  1KDW A;  2Y2K A;  1YLP A;  2Y2J A;  3Q7V B;  3GSG A;  3MKE A;  3ZG8 B;  4LV1 A;  1AWI A;  2PBY A;  2H0T A;  4ID4 A;  4H8R A;  5DTT A;  4CLC B;  5E2E A;  3MS6 A;  3I7J A;  2V0W A;  3D3O A;  3MQ0 A;  2XA7 M;  4DE3 A;  4R3A A;  3R4K A;  3BEC A;  5G4Z A;  4QD4 A;  1XPB A;  1GCE A;  3IHA A;  1IYQ A;  5TR7 A;  1W7F A;  1ZG6 A;  4X56 A;  2XD1 A;  1YQS A;  3HLG A;  1TS6 A;  4MEZ A;  4KQR A;  2GNX A;  3EQU A;  4UQI M;  1K4F A;  2OLV A;  3NOU C;  1ZHH B;  1SKO B;  1LI9 A;  5A91 A;  5CTM A;  4EV4 A;  3LY3 A;  2V1B A;  3OPL A;  5L8M A;  2QPN A;  2W1T A;  1BLH A;  5E2F A;  2PD8 A;  4JBF A;  5HPI A;  2ZD8 A;  2D02 A;  4HJ3 A;  4L0L A;  2EA9 A;  2R9X A;  1BLS A;  3PAE A;  4GNU A;  4PHT A;  4KZ8 A;  3BFC A;  3TG9 A;  3GEC A;  4WEJ A;  1K25 A;  1OTI A;  3P98 A;  3IS2 B;  3BRM A;  4CLC E;  1N4O A;  3LIC A;  3CZD A;  4Y0T A;  1K54 A;  3IXB A;  2CMN A;  3K3D A;  4PM9 A;  3MSH A;  5L10 A;  4FUW A;  4HQA A;  1QMF A;  3DTI A;  4OOY A;  3F1O A;  3CWF A;  1YSP A;  3BFD A;  4M3K A;  4WZ4 A;  1SCW A;  2EX9 A;  4GDB A;  4WN5 A;  3BM6 A;  1Y28 A;  1ACF A;  1IFQ A;  3H82 A;  1BT5 A;  2JN7 A;  3LR5 A;  2UV0 E;  2EXA A;  2P9V B;  4IBX A;  2J3T D;  1ESU A;  4X55 A;  1XXM A;  4KUK A;  3VSK A;  1L0E A;  4WBG A;  5CHU A;  1XJ4 A;  2JKG A;  4MBH A;  4R23 A;  2RCX A;  4WF0 A;  5FQQ A;  3G2Z A;  4NXE A;  4KZ9 A;  3BYD A;  3ZHH A;  4NK3 A;  2J80 A;  5FA7 A;  5TFQ A;  4QY5 A;  4OON A;  1FR6 A;  1T1B A;  3UE1 A;  1LHY A;  1S1Z A;  2DCF A;  4JXS A;  2WK0 A;  3EOI A;  2ZM0 A;  4DJ3 A;  5FDS A;  3GDI A;  3L9K A;  3W8K A;  5GLB A;  5E2G A;  1DJA A;  4BMW A;  4IBR A;  4MN7 A;  3LIF A;  4I3J A;  2HJ9 C;  3QHY A;  1BYW A;  3WRZ A;  4Z1W A;  1GSW A;  3S4X A;  1MWT A;  4JLF A;  5TJJ A;  3T4L A;  1P0Z A;  3M2J A;  4JPM A;  4S2O A;  5AQ9 A;  5A92 A;  3NDE A;  5FQJ A;  1OJ5 A;  4OP8 A;  3G34 A;  3QNB A;  4WMC D;  1TDG A;  3OOV A;  1JTG A;  1YSQ A;  2ZL1 A;  2G2U A;  1G28 A;  1OTE A;  1PI5 A;  3SS5 A;  2HP5 A;  4CJN A;  2G7U A;  1PWD A;  2FH5 A;  4XXR A;  4N1X A;  4H6J B;  1CI9 A;  3WRT A;  4LEN A;  3BLM A;  2KLI A;  4ETZ A;  3ZYT A;  3T1Q B;  2QHK A;  1BLC A;  3Q82 A;  5DFY A;  3KSH A;  1NYY A;  4DE2 A;  1PZP A;  1MKM A;  2HDU A;  3C38 A;  1K55 C;  5L2F A;  3P09 A;  3WS0 A;  4F3L A;  1YKD A;  1K57 C;  1K0K A;  5KZH A;  4F94 A;  2OLU A;  5AQ7 A;  3Q1F A;  4WZ5 C;  1J9M A;  3PAG A;  3Q07 A;  4WUJ A;  5DKL A;  4P6B A;  3QP1 A;  4GDN A;  1WE4 A;  5CER A;  3TW8 A;  4O7D A;  3ZFZ A;  4KG2 A;  2KOI A;  4KUO A;  4EQ1 A;  3DWK A;  2VV6 A;  4PM8 A;  4S2J A;  1VET A;  4C75 A;  2V0U A;  3M2K A;  1VEU A;  2HZ5 A;  4HH2 A;  4N9L A;  1K56 A;  4IUH A;  1GHI A;  4K08 A;  2G2W A;  3AGD A;  3B33 A;  4IVI A;  4GB7 A;  2PR5 A;  1JWV A;  5AJG A;  1H8Z A;  4DJ2 A;  4PM5 A;  2UWX A;  4CLC C;  5J7E A;  5HAP A;  3N8L A;  1X0O A;  3SH8 A;  3ISG A;  3MQO A;  3K3C A;  1PIO A;  4S2N A;  5FI7 A;  1U60 A;  5E43 A;  4BL2 A;  4JF5 A;  4EEU A;  3V50 A;  1ONG A;  5DF7 A;  1NRJ A;  2WGV A;  5HL1 A;  3IH9 A;  4L9E A;  1D1J A;  4LRY C;  2K2N A;  2B18 A;  3G31 A;  4GD6 A;  4D2O A;  5GLC A;  3R7W A;  4HIA A;  4X69 A;  1JTD A;  3UNW A;  1DP9 A;  4BLM A;  2IA2 A;  5DJU A;  4CPK A;  3KSG A;  1MWS A;  1K6S A;  1PWG A;  4HHD A;  1W79 A;  4EES A;  2ZM2 A;  5LBR A;  5TBM B;  3CJM A;  1MC0 A;  3OPP A;  2OWH A;  1DJB A;  2C6W B;  4LV3 A;  3MXS A;  2GDN A;  3VP3 A;  1IKI A;  3CG5 A;  3D9Y A;  3F1N B;  2JKT I;  2XA7 S;  3WS4 A;  1PI4 A;  3OCL A;  3T4Q A;  2B95 A;  1KOU A;  2Y2H A;  2I72 A;  1XGI A;  4B9O A;  4CLC D;  3UDX A;  4E3J A;  3SZT A;  4QJG A;  2Y59 A;  5HW3 A;  2Y4A A;  3IWI A;  4HBT A;  4CQH A;  5FAS A;  4UQI S;  2E8J A;  5EVI D;  1ES5 A;  4X53 A;  2JKR I;  5DKK A;  4AFI A;  3T4S A;  2M7V A;  3JPU A;  4GZB A;  3HVF A;  4JXG A;  4S2L A; 
#chains in the Genus database with same CATH homology
 4EWF A;  3O87 A;  1KGE A;  5FQI A;  4JXW A;  3SS3 A;  2BLS A;  2DRW A;  4H8R A;  5DTT A;  1IKG A;  5EPH A;  4BL3 A;  1KDS A;  4QY6 A;  5E2E A;  4B88 A;  4EUZ A;  1PYY A;  3I7J A;  1PW1 A;  4E3K A;  3ZG5 A;  1YLW A;  2PU2 A;  4XUZ A;  3NBL A;  4BQM A;  4DE3 A;  5F82 A;  4HBU A;  3BEC A;  4KZ7 A;  3N4I A;  2ZMA A;  4QD4 A;  1XPB A;  1GCE A;  2V2F F;  3IHA A;  1IYQ A;  4ZTK A;  5TR7 A;  3SH9 A;  3W4P A;  1XA7 A;  1MXO A;  1W7F A;  3QNC A;  4RYE A;  5TGF A;  3UPO A;  1ZG6 A;  3SH7 A;  4X56 A;  2XD1 A;  4UA9 A;  1YQS A;  5CGS A;  3HLG A;  3A3J A;  4ZDX A;  2X01 A;  1K55 A;  2XFS A;  4KQR A;  4MEZ A;  4QB8 A;  1PW8 A;  4Q8I A;  3HUO A;  3N6I A;  4WMC A;  3EQU A;  1K57 A;  4DE1 A;  5EOO A;  3MKF A;  3S22 A;  2HP6 A;  1K4F A;  2WGI A;  5KSH A;  2OLV A;  2WAF A;  3MZF A;  3HUN A;  2ZC7 A;  3B3X A;  3HBR A;  3LO7 A;  3Q7Z A;  3IH8 A;  4ZAM A;  2ZM8 A;  1LI9 A;  1SKF A;  2XGN A;  1ZG4 A;  5JYP A;  5A91 A;  3CMZ A;  2Z2M B;  5CTM A;  4E3M A;  4EV4 A;  1FCO A;  3LY3 A;  1GHM A;  5EVI C;  3OPL A;  4K91 A;  2QPN A;  4EQI A;  1BLH A;  1W8Y A;  2RL3 A;  3A3D A;  3GRJ A;  5E2F A;  3TOI A;  5GLA A;  1K56 D;  4KZB A;  2ZQ9 A;  4JBF A;  2ZD8 A;  4KZ5 A;  4R1G A;  4YFM A;  4LCM A;  5E2H A;  4OPZ A;  2Y2G A;  4L0L A;  1L0G A;  3G32 A;  1BUE A;  2HPB A;  1MBL A;  1KE3 A;  3DWZ A;  2R9X A;  3NY4 A;  1BLS A;  3PAE A;  4GNU A;  3BFG A;  4S2M A;  2WZZ A;  3C7U A;  2IWD A;  4P0M A;  4KZ8 A;  1C3B A;  3BFC A;  4U3T A;  3TG9 A;  1JWZ A;  3Q7V A;  5FAO A;  5FAQ A;  2Q9M A;  4WEJ A;  3VOY A;  3VMA A;  3LEZ A;  2ZQ8 A;  1BTL A;  5FSR A;  1MPL A;  2Y2L A;  5FI6 A;  1K25 A;  1FCN A;  5DF9 A;  2ZC3 B;  3V3S A;  3OPR A;  3P98 A;  4XUX A;  2Y91 A;  1YMS A;  3BRM A;  4OQG A;  1G6A A;  1N4O A;  4KZ6 A;  3CZD A;  1ES4 A;  4Y0T A;  1DJC A;  1K54 A;  3HLC A;  1MWU A;  3IXB A;  1VM1 A;  3NDG A;  5HFO A;  4PM9 A;  3GR2 A;  4S2I A;  5DF8 A;  3IF6 C;  3W4Q A;  3Q81 A;  4YIN A;  1QMF A;  5IHV A;  5GHZ A;  2JCH A;  4OOY A;  1MY8 A;  3WWX A;  1E4D A;  4B4Z A;  3BFD A;  2X71 A;  4M3K A;  1H5X A;  4HEF A;  3S1Y A;  3PBT A;  4WYY A;  1ES2 A;  1CEF A;  4WZ4 A;  1SCW A;  2EX9 A;  1EWZ A;  3V5M A;  4GDB A;  4KEN B;  3BM6 A;  5AQB A;  2EFX A;  2IWB A;  4DE0 A;  4PMA A;  1Q2Q A;  1NXY A;  2V1Z A;  1PWC A;  2Y2N A;  3HLD A;  5GHY A;  3WS2 A;  5JYO A;  1BT5 A;  5EUA A;  4OLD A;  2C5W B;  4ZJ3 A;  4ZJ1 A;  2EXA A;  1YLJ A;  2P9V B;  4Z9Q A;  1H8Y A;  1SDE A;  4IBX A;  5HAI A;  4OP5 A;  1ZKJ A;  1O7E A;  4LV0 A;  4MBF A;  1BSG A;  2DNS A;  2J7V A;  1HTZ A;  3O3V A;  4A5R A;  3MXR A;  5KMW A;  1ESU A;  4X55 A;  3HRE A;  5M18 A;  1XXM A;  4OLG A;  1L0F A;  3VSK A;  2WKI A;  1L0E A;  2EFU A;  4WBG A;  2XDM A;  2ZQA A;  5CHU A;  1VQQ A;  2HDQ A;  3O86 A;  5FAP A;  4MBH A;  2WAE A;  3V39 A;  4R23 A;  2RCX A;  2PU4 A;  1ERO A;  3G2Z A;  4S2N C;  5FQQ A;  5F1G A;  2J8Y A;  3FKV A;  3HLW A;  4KZ9 A;  1K4E A;  2QMI A;  3BYD A;  1E3U D;  4S2P A;  1NYM A;  1WYB A;  3RJU A;  3ZHH A;  5U47 A;  1CI8 A;  4BJP A;  4NK3 A;  3DW0 A;  3IWQ A;  1TDL A;  1G68 A;  3MZD A;  5FQM A;  5GL9 A;  1M6K A;  4RX2 A;  1FR1 A;  3NCK A;  5FA7 A;  3ZVW A;  5TFQ A;  3N7W A;  2FFY A;  2XQZ A;  4QY5 A;  5EVI B;  4E3O A;  4KZ3 A;  4OON A;  3N8S A;  1DY6 A;  1FR6 A;  3C4P A;  1YLY A;  5FQK A;  1TVF A;  3UE1 A;  1LHY A;  2DCF A;  3DTM A;  4JXS A;  3IQA A;  2XH9 A;  2WK0 A;  1RGZ A;  4RX3 A;  3PBO A;  2R9W A;  1KVM A;  1NZO A;  2ZM0 A;  1XX2 A;  4OOM A;  4OVD A;  4WZ5 A;  4DRT A;  4EBN A;  1L0D A;  2XF3 A;  2XR0 A;  3V3R A;  3W8K A;  5GLB A;  1LI0 A;  3G30 A;  1QME A;  4OQI A;  5E2G A;  4E3I A;  1DJA A;  4E3N A;  3HLE A;  3UN7 A;  3E2L A;  4IBR A;  3E2K A;  1YMX A;  3WS1 A;  2HDS A;  3QHY A;  4NET A;  2A3U A;  5EVL A;  3WRZ A;  2E8I A;  3W4O A;  3GQZ A;  5GHX A;  3RXW A;  4KG5 A;  4DXC A;  5J8X A;  3PTE A;  3S4X A;  1MWT A;  4JLF A;  3UPN A;  3ZCZ A;  3OCN A;  4KQO A;  4K0W A;  3M2J A;  2WAD A;  4JPM A;  4OKP A;  4Y7P A;  5FDH A;  2X02 A;  4S2O A;  5AQ9 A;  4HES A;  1Y54 A;  1BUL A;  1YLT A;  3IF6 B;  4KZ4 A;  1K6R A;  4WEK A;  1KE4 A;  3ZG0 A;  3HUM A;  1SHV A;  5CGW A;  2P9V A;  2JC7 A;  3SS4 A;  3UY6 A;  5A92 A;  3NC8 A;  3NDE A;  5FQJ A;  4OP8 A;  2A49 A;  3ZNT A;  3G34 A;  3FV7 A;  3QNB A;  4WMC D;  2J9O A;  2ZC6 B;  5GLD A;  5A93 A;  1TDG A;  5BOH A;  3AGE A;  4JXV A;  3IXD A;  4S2K A;  1YT4 A;  3PBS A;  1JTG A;  4U0X A;  4ZJ2 A;  2OV5 A;  1IYS A;  2ZJ9 A;  1XKZ A;  4FD8 A;  2G2U A;  1PI5 A;  3SS5 A;  2FFF B;  4UHU A;  2WKH A;  1Q2P A;  2HDR A;  4R0Q A;  2HP5 A;  4CJN A;  1PWD A;  4Y0U A;  4X6T A;  3C5A A;  3ZDJ A;  3UPP A;  1NY0 A;  4WEL A;  1YLZ A;  4PM7 A;  4XXR A;  4N1X A;  3C7V A;  5M19 A;  5CED A;  5KSC A;  4EBP A;  5F1F A;  3HLB A;  1CI9 A;  2XFT A;  3G4P A;  3WRT A;  5F83 A;  4LEN A;  1I2W A;  3ITB A;  3UDF A;  3RXX A;  3BLM A;  1MWR A;  3G2Y A;  4RA7 A;  3JYI A;  4Y0O A;  2BG1 A;  1CEG A;  2B5R A;  5EVI A;  5CTN A;  3VSL A;  1YM1 A;  4IED A;  1O07 A;  3D4F A;  3NIA A;  3FYZ A;  4FH4 A;  1ONH A;  1LLB A;  4QHC A;  2Q9N A;  2Y2M A;  3FKW A;  2WUQ A;  2XEP A;  5A90 A;  3VP0 A;  1BLC A;  2V20 A;  4U0T A;  4OH0 A;  3Q82 A;  3ZGA B;  1N9B A;  1NYY A;  4DE2 A;  5EE8 A;  1PZP A;  4C6Y A;  5DTS A;  4BD0 A;  2HDU A;  1K55 C;  5L2F A;  3P09 A;  3WS0 A;  1HD8 A;  4OPQ A;  1K57 C;  5KZH A;  2OSU A;  3ZG7 B;  3GVB A;  4F94 A;  2OLU A;  5AQ7 A;  1NRF A;  3MZE A;  2HP9 A;  5DTK A;  2ZC5 B;  1W8Q A;  3M6B A;  3Q1F A;  4WZ5 C;  1J9M A;  3PAG A;  2XLN A;  4IVK A;  3Q07 A;  4N9K A;  1OME A;  1ES3 A;  2Y2P A;  3IWO A;  5CXW A;  4BD1 A;  1S6R A;  3BLS A;  4P6B A;  1IYP A;  3TSG A;  4R3J A;  1ZC2 A;  3IXG A;  4EBL A;  3GV9 A;  4GDN A;  1FQG A;  1WE4 A;  5CER A;  3PBR A;  3IF6 A;  4O7D A;  5I94 A;  3ZFZ A;  2WGW B;  3VFF A;  4KG2 A;  2EX2 A;  3IF5 A;  2Y2I A;  4OPY A;  4OOL A;  4PPR A;  2WKE A;  3EQV A;  3LY4 A;  3MFD A;  3DWK A;  2EX6 A;  4PM8 A;  3UE0 A;  4S2J A;  1K38 A;  4C75 A;  1XGJ A;  2QZ6 A;  3M2K A;  4KG6 A;  4DDY A;  2JE5 A;  4GKU A;  1XP4 A;  4OQ0 A;  3ZVT A;  3BEB A;  1K56 A;  4N9L A;  5FI2 A;  1GHI A;  1HVB A;  1CK3 A;  3O88 A;  1ESI A;  5DVA A;  3VOZ A;  4ID4 A;  2G2W A;  3NI9 A;  5AQA A;  2ZC4 B;  3AGD A;  3UE3 A;  4JF6 A;  1GA9 A;  2ZQD A;  4IVI A;  4GB7 A;  3M6H A;  3ZNY A;  1JWV A;  1EI5 A;  1H8Z A;  4GOG A;  4B4X A;  1ALQ A;  2Y2O A;  1WYC A;  4PM5 A;  3IT9 A;  5G18 A;  3ITA A;  4E3L A;  5FAT A;  2UWX A;  3A3E A;  1K54 C;  5FQ9 A;  2VGJ A;  2EX8 A;  4R4S A;  5HAP A;  3N8L A;  4X68 A;  1AXB A;  5HX9 A;  4BEN A;  5EOE A;  4UA7 A;  1KE0 A;  4E6W A;  3SH8 A;  3ISG A;  1BLP A;  4OQH A;  3BFF A;  3ZG9 B;  3SOI A;  1RGY A;  3WS5 A;  1PIO A;  4GD8 A;  4S2N A;  3GTC A;  5FI7 A;  1U60 A;  4MBK A;  5CRF A;  1I2S A;  3FZC A;  5E43 A;  3UO9 A;  4BL2 A;  2J9P A;  1JVJ A;  3GMW A;  5CHJ A;  2H5S A;  1JWP A;  1ERM A;  4JF5 A;  1LL5 A;  3LCE A;  3UDI A;  3HLF A;  1HZO A;  2H0Y A;  3V50 A;  1ONG A;  3OZH A;  4FH2 A;  1KVL A;  4OPR A;  1PZO A;  1SDN A;  4P87 A;  5DF7 A;  2ZLY A;  2ZQC A;  5HAQ A;  2WGV A;  4DDS A;  5HL1 A;  3IH9 A;  4LCL A;  5CEB A;  3C4O A;  3G31 A;  4GD6 A;  4D2O A;  2JBF A;  5GLC A;  3PBN A;  4E6X A;  4X69 A;  1JTD A;  4UAA A;  5M1A A;  3UNW A;  3N8R A;  1GHP A;  5D3O A;  1MKI A;  4KQQ A;  4BLM A;  2Z2L B;  1BZA A;  4MLL A;  4DKI A;  1FSW A;  4CPK A;  4UA6 A;  1MWS A;  1NJ4 A;  4DF6 A;  1K6S A;  4K0X A;  1KGF A;  1PWG A;  4WM9 A;  4GN2 A;  2WGW A;  3VFH A;  4FSF A;  2Y55 A;  3IHB A;  1L2S A;  1W79 A;  1FCM A;  1RP5 A;  1M40 A;  4JF4 A;  1FSY A;  2ZM2 A;  1RCJ A;  5HAR A;  2WZX A;  2ZQ7 A;  4DXB A;  3VP4 A;  3VP1 A;  4QU3 A;  5CGX A;  4MNR A;  3CJM A;  3OPH A;  2XK1 A;  2XD5 A;  2P74 A;  3OPP A;  4R3B A;  4PM6 A;  1DJB A;  1TEM A;  2C6W B;  1ERQ A;  4LV3 A;  3MXS A;  2GDN A;  5CHM A;  1S0W A;  3VP3 A;  1IKI A;  4JKT A;  1E25 A;  1I5Q A;  3CG5 A;  1XA1 A;  4FCF A;  3WS4 A;  3G35 A;  2CC1 A;  1E3U A;  1PI4 A;  3OCL A;  2VGK A;  4KZA A;  3OC2 A;  2Y2Q A;  2Y2H A;  1FOF A;  1Z6F A;  2I72 A;  1XGI A;  3UDX A;  1NZU A;  4E3J A;  1IYO A;  4QJG A;  3AGF A;  5CEC A;  4RVA A;  2Y59 A;  4C3Q A;  4N1H A;  1IEL A;  3A3I A;  2H10 A;  1GA0 A;  5HW3 A;  2Y4A A;  3IWI A;  4ZBE A;  4N92 A;  3PBQ A;  2IWC A;  2WYX A;  3IXH A;  4HBT A;  4P85 A;  1KGG A;  1KDW A;  2Y2K A;  1YLP A;  2Y2J A;  3Q7V B;  5FAS A;  4LV2 A;  3GSG A;  3MKE A;  5EVI D;  1ES5 A;  4R4R A;  3ZG8 B;  3BFE A;  4X53 A;  3VP2 A;  1IEM A;  2EXB A;  5EEC A;  1LL9 A;  3HL9 A;  4LV1 A;  1W5D A;  3FWL A;  4GZB A;  2PBY A;  3HVF A;  2H0T A;  3A3F A;  4JXG A;  4S2L A;  3MBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...