4A5RA

Crystal structure of class a beta-lactamase from bacillus licheniformis bs3 with tazobactam
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
257
structure length
257
Chain Sequence
KDDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVVKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Crystal Structure of Class a Beta-Lactamase from Bacillus Licheniformis Inhibited by Tazobactam
rcsb
total genus 88
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4a5rA00
1NJ4A 3GSGA 3UNWA 1RCJA 3QHYA 1PWCA 3N8SA 4KENB 3LCEA 1NXYA 1G6AA 1EROA 5DTTA 1GHPA 4IVIA 4MBHA 3C7VA 5GHYA 3IXBA 3A3DA 2XEPA 5FI7A 1KE3A 3BLMA 3DWZA 2XD1A 2ZC3B 2V20A 2XFTA 4R0QA 4N1XA 4JF4A 2XLNA 4R23A 2EFUA 4HEFA 5A92A 1K57C 2JC7A 2ZQCA 3VFHA 2XK1A 1S6RA 2IWCA 1FR6A 3Q1FA 1YLYA 1YLWA 3HLBA 4JPMA 3M2JA 5CHUA 4ZJ3A 4LV2A 1M40A 1XX2A 3GQZA 3ISGA 3UN7A 2ZLYA 1IYOA 5CEBA 2IWDA 3CMZA 1YMSA 4PM6A 1I5QA 4OP5A 4DKIA 4PM5A 1YMXA 2OSUA 5FQ9A 1M6KA 1IYPA 5CEDA 5CHMA 4B4ZA 1MKIA 2I72A 3C5AA 4KZ4A 2G2UA 4KZ9A 1H8ZA 3C7UA 2ZM2A 1ES3A 4OONA 1DY6A 2WGIA 5CGWA 3ZG8B 1SDNA 1JWPA 2BLSA 5AQ9A 1KGFA 3MBZA 3CG5A 3VFFA 1L0DA 4GDBA 2J7VA 3SH9A 4YINA 4BQMA 4E3JA 4E3LA 1L2SA 2WKEA 5TGFA 3FZCA 1E4DA 2DNSA 3N8RA 5A91A 3HLWA 3HUNA 3N7WA 3IF5A 3MXRA 4F94A 2PU4A 3IWIA 4ZBEA 3TSGA 4HBTA 1SHVA 4K0WA 4E6XA 3WS5A 4U0TA 2WKHA 3WS2A 3Q7VA 1J9MA 4KZBA 2Y2HA 1CI9A 4MNRA 5KMWA 5A90A 4OOYA 2V1ZA 1ZG6A 2HDQA 4HBUA 1K6RA 3G32A 5E2HA 2XR0A 3PBTA 1O07A 4JF5A 2WZXA 1IELA 1WYBA 4R1GA 4LV1A 5JYPA 3LO7A 4OOLA 1BSGA 3M2KA 4OPYA 3O3VA 5HAIA 2ZC7A 4B4XA 4WZ5C 1LI9A 3A3FA 4D2OA 1PZOA 3FKVA 1ES5A 2WUQA 1NZOA 4PM9A 3Q7VB 3ZG9B 3PAEA 5CXWA 5U47A 5CGXA 1IKIA 5EVIA 3ZVTA 3UDFA 1VM1A 1OMEA 2Q9MA 3C4OA 3W8KA 4S2MA 4S2JA 3AGFA 3UPPA 2Y55A 3FWLA 3M6HA 4WEKA 2XF3A 4WYYA 3UDXA 3ZNTA 1W7FA 5BOHA 1L0FA 4LV3A 4UA7A 1TDGA 1H5XA 4DRTA 1U60A 1XGIA 2XD5A 4FSFA 1K55A 2IWBA 2FFYA 4HESA 5E2FA 3EQUA 2ZQ8A 3O86A 4DDYA 1YLJA 5FDHA 2ZQ7A 1CEGA 5EVID 2HDRA 2Z2MB 4P85A 3G2ZA 3IH8A 1ONGA 4JXSA 3IWQA 4Q8IA 3VSKA 3VMAA 3IXHA 1K57A 4Y0OA 5EOOA 2RL3A 1HVBA 2PBYA 4PPRA 4EWFA 1ERMA 2XFSA 1TVFA 4FD8A 5E2EA 2ZJ9A 1ESIA 1FCMA 3V3SA 2WKIA 3BYDA 2WGWB 3BM6A 2VGJA 2EX2A 3IXDA 1FOFA 1BLSA 3PBQA 2B5RA 1GA9A 2H0TA 3BFGA 3A3JA 2XDMA 2G2WA 5FQIA 5KSHA 3SS3A 1MY8A 3HREA 3NBLA 4X69A 1ERQA 4WBGA 4GKUA 3IHAA 1G68A 4C3QA 2HDUA 2WGVA 1MPLA 2CC1A 3MKEA 1MWUA 3SH7A 2Y59A 3B3XA 2HPBA 3VP1A 3MKFA 1EWZA 1ES2A 3HUOA 3OCNA 3UE0A 2A49A 5HW3A 5DTKA 4DE0A 1H8YA 4Y0UA 4RX3A 5G18A 5HFOA 3WS4A 2Y2GA 1HZOA 1SDEA 1GHMA 5E43A 3V39A 3OPHA 1Q2QA 4DE2A 4P87A 2PU2A 1LLBA 1KVMA 4K0XA 1KGGA 4KG6A 1GCEA 2R9WA 4GD8A 1ZKJA 4EQIA 4S2NC 3BFCA 2ZC6B 1GA0A 5KZHA 3ZGAB 5CTMA 1K6SA 4L0LA 3NY4A 3Q7ZA 3RXXA 1LL5A 1PI5A 2XQZA 1MXOA 2ZM0A 4KQQA 3ZVWA 3IF6A 2EXBA 2VGKA 1K4EA 4BD1A 3JYIA 3PTEA 4LCMA 1KDWA 3P98A 2UWXA 1ZC2A 4RX2A 4N92A 1HTZA 4EV4A 5A93A 3PBNA 5FQMA 1W8YA 4KZ3A 1MWRA 4KQRA 3N4IA 3S1YA 3M6BA 1BULA 1NZUA 1PWDA 1W5DA 4O7DA 4KZ6A 4OQHA 1LL9A 4S2LA 1NRFA 3P09A 4MBFA 3MZDA 1I2SA 4WEJA 2X01A 1PZPA 3IF6B 3WRTA 4XUZA 2Y91A 3PBSA 3ITBA 1MBLA 1QMFA 1YT4A 3VP4A 4BD0A 2Y2KA 4XXRA 3OPLA 3N8LA 4QU3A 5EE8A 3NI9A 5GLDA 4JKTA 1YLPA 1L0GA 5F83A 3CJMA 4LV0A 4CPKA 2Z2LB 4IVKA 4LENA 3NDGA 4X56A 2ZC4B 3O87A 1Z6FA 4R4RA 5FATA 3RXWA 1HD8A 3A3IA 4OQIA 1XXMA 2Y2QA 3BFFA 3GVBA 4OVDA 1K54A 4DE3A 4KZ7A 4OOMA 4E6WA 5CGSA 1WYCA 1W8QA 3SS5A 2WAFA 2Q9NA 4GDNA 4RA7A 1JTDA 2E8IA 5GLCA 4KQOA 3G30A 4JXWA 3SH8A 2Y2OA 4M3KA 1JWVA 2BG1A 3ZG7B 4K91A 5EPHA 4KZ5A 4OPZA 5CHJA 3UDIA 1PW1A 2ZD8A 5DF8A 3W4OA 2R9XA 1FSYA 3NC8A 2GDNA 1YLTA 4DXBA 4U3TA 3VOZA 1K25A 3VSLA 2ZQDA 3Q81A 3ZDJA 4GN2A 1E3UA 2Y2MA 1RGZA 2HP5A 1KE0A 2JBFA 2P74A 2V2FF 1IEMA 2Y2NA 2Y2PA 5DF9A 3C4PA 2WGWA 2J8YA 4QY5A 2P9VA 1SKFA 3W4PA 1PIOA 3DWKA 2X02A 3G34A 1QMEA 4Z9QA 4QB8A 1FCOA 3WS1A 5FQJA 3HBRA 2OLVA 4OLGA 4P0MA 2RCXA 2EXAA 1XPBA 4QJGA 4UAAA 1XKZA 5FQKA 4WMCA 1BTLA 3TG9A 4MEZA 3VOYA 1L0EA 4E3KA 3OZHA 1GHIA 5TFQA 2Y2JA 3A3EA 3OCLA 5FAPA 4E3IA 1E3UD 4OQGA 1YQSA 2P9VB 1KVLA 4WZ4A 5FSRA 2HP9A 1N9BA 3WWXA 3DW0A 4R3BA 5M19A 3GMWA 4N1HA 4ZJ1A 4DF6A 3I7JA 5DVAA 5L2FA 4E3MA 3HL9A 1N4OA 4KZAA 5JYOA 5FA7A 2C5WB 3OC2A 3SOIA 1NYMA 3LEZA 2J9OA 4OPQA 5FASA 4XUXA 3E2KA 1AXBA 4EBNA 4WELA 4E3OA 2QZ6A 3ZFZA 3WS0A 3TOIA 4PMAA 3CZDA 1NY0A 1FSWA 3W4QA 5HL1A 1CEFA 1FCNA 5EVIC 1E25A 4B88A 1RP5A 2EFXA 3ZG5A 1PWGA 4R3JA 3V5MA 4OH0A 2DRWA 2WAEA 3Q07A 4H8RA 1IKGA 1Y54A 3IT9A 2X71A 3IWOA 5F1GA 3FYZA 4OKPA 1KGEA 4NETA 4ZDXA 5GLBA 5FAQA 5HX9A 4DE1A 5AQBA 4QY6A 3G35A 4NK3A 1CK3A 4BJPA 4LCLA 3HLCA 5HAPA 5M18A 1K55C 4YFMA 5AQ7A 3BEBA 3N6IA 1BLCA 3IQAA 5CERA 3S22A 2FFFB 2HDSA 3UE3A 1JTGA 3ZNYA 1YM1A 4A5RA 4R4SA 5KSCA 3ZG0A 3MXSA 3NCKA 4UHUA 3ZCZA 1BLPA 1JVJA 4WZ5A 4Y7PA 2HP6A 5E2GA 1CI8A 4FCFA 2ZM8A 2ZQAA 4KG5A 1PYYA 1IYSA 3LY3A 4FH2A 3GV9A 5FI6A 4EBPA 4QHCA 3G31A 3VP3A 4BENA 4GOGA 4GB7A 4EUZA 2JCHA 3S4XA 1LHYA 4JXGA 3IXGA 3GRJA 3BLSA 4MBKA 4IBXA 4UA9A 3QNBA 3IHBA 4KG2A 4N9LA 4ZJ2A 5D3OA 3OPPA 1ALQA 3D4FA 3MZFA 3PBRA 5J8XA 2H10A 4C6YA 1W79A 3ITAA 2ZQ9A 1ES4A 1BLHA 4JBFA 3FKWA 4GD6A 5EUAA 4S2IA 3GR2A 5HARA 2WADA 3O88A 4KZ8A 4E3NA 4X6TA 2Y4AA 5F82A 5FAOA 4BL2A 2Y2IA 3VP2A 3NIAA 2Y2LA 5FI2A 1DJAA 3LY4A 2OLUA 4EBLA 1WE4A 2DCFA 5CRFA 3QNCA 4RYEA 5IHVA 5EECA 1KDSA 4OQ0A 4JLFA 2QMIA 3UE1A 5GHZA 3HLEA 3WRZA 2XGNA 4WM9A 2EX8A 4P6BA 3ZHHA 1LI0A 3BRMA 2A3UA 1FQGA 3UPOA 5EOEA 3HLFA 2WYXA 2ZC5B 4UA6A 4DXCA 2XH9A 1TEMA 2H5SA 4BL3A 5HAQA 3BECA 2ZMAA 1XA1A 1BUEA 3IF6C 4IBRA 5DF7A 3IH9A 1MWSA 1S0WA 4DDSA 1XP4A 4GZBA 5M1AA 4N9KA 1PW8A 1ZG4A 1BZAA 3E2LA 2QPNA 4OLDA 4X68A 4JXVA 3V3RA 1RGYA 4PM7A 3V50A 4JF6A 1PI4A 4PM8A 3EQVA 3HUMA 4U0XA 3NDEA 2C6WB 4QD4A 5AQAA 4ZAMA 3HLGA 1K38A 5GHXA 3FV7A 4RVAA 1DJCA 5EVLA 1IYQA 2H0YA 1I2WA 4C75A 5F1FA 3G2YA 4S2NA 1C3BA 3UPNA 1Q2PA 4GNUA 3VP0A 5CTNA 4X55A 4S2KA 4OPRA 3BFDA 4CJNA 3UO9A 5EVIB 4BLMA 4IEDA 2EX9A 2WZZA 1JWZA 5DTSA 3PAGA 1K56A 1K4FA 3AGEA 2EX6A 3PBOA 3SS4A 1DJBA 5FQQA 3HLDA 4FH4A 1XGJA 2OV5A 1O7EA 4S2PA 5GLAA 4WMCD 3G4PA 3MFDA 1YLZA 4S2OA 1SCWA 2J9PA 2WK0A 3GTCA 1K54C 3HVFA 5GL9A 5CECA 1TDLA 4ZTKA 1EI5A 3AGDA 3MZEA 1ESUA 1VQQA 1FR1A 1BT5A 1MWTA 1XA7A 3UY6A 4MLLA 5I94A 4ID4A 4OP8A 3DTMA 1KE4A 3OPRA 4Y0TA 1K56D 2JE5A 3BFEA 1ONHA 3RJUA 4X53A 1NYYA 3Q82A 5TR7A
chains in the Genus database with same CATH superfamily
4HY8A 2W3EA 3QHYA 1PWCA 4KENB 3PR6A 1GHPA 3LYXA 4IVIA 4XT2B 5MC7A 3CPTA 2XEPA 3F1OA 5TBMB 2XD1A 2EFUA 3EEHA 2D02A 2JC7A 3VFHA 2IWCA 1FIKA 3Q1FA 5KIZA 3HLBA 1M40A 3GQZA 3ISGA 2PRFA 3LEQA 2ZLYA 1IYOA 3TW8A 1IYPA 5CHMA 2G2UA 5HDCA 4OONA 5CGWA 3T4OA 3HCYA 1L0DA 4E3JA 4BQMA 4YINA 1L2SA 5TGFA 3HLWA 2PU4A 4CQHA 4HBTA 3WS2A 4KZBA 5KMWA 4MN5A 3T4LA 2MJ6A 4R38A 3IS2A 4JF5A 1IELA 3LIDA 4EEUA 1BSGA 2ZC7A 1LI9A 4F3LA 3VE3A 5CGXA 1IKIA 3ICYA 3R4KA 3IS2B 4S2JA 3MJQA 4WEKA 2Q0OA 1H5XA 1T1CA 3T12B 1WA9A 4DDYA 1G28A 2HDRA 1OPXA 3UB5P 3VMAA 4EWFA 5E2EA 2ZJ9A 3E4OA 3MR0A 3T1XA 2B02A 2H0TA 2KX6A 3NBLA 4X69A 1G68A 2HDUA 3E0YA 5FL3A 1MPLA 2Y59A 3OCNA 5HW3A 3D72A 1K0KA 1H8YA 2Y2GA 1HZOA 3IBRA 5E43A 1XFQA 1Q2QA 4DE2A 4K0XA 3BQ8A 1KGGA 3T4SA 1GCEA 4MN6A 3LFVA 4EQIA 2ZC6B 3T1RA 3Q7ZA 1LSXA 2HGVA 3BY9A 2V9AA 3IF6A 2EXBA 4BD1A 3JYIA 4Y5FA 4GW9A 4Y17A 2V1BA 1MWRA 2L0WA 1NZUA 4OQHA 1VB6A 2X01A 3IF6B 2J3TD 2L1MA 3PBSA 3ITBA 2R78A 4BD0A 1VHMA 3CJMA 4UQIS 4CPKA 4IVKA 3RXWA 2W1TB 4RQ9A 4DE3A 2VV6A 2OAQ1 2JHEA 1WYCA 1W8QA 5CX7A 2Q9NA 4GDNA 4II7A 2E8IA 2BG1A 5EPHA 2W3DA 1PW1A 2ZD8A 1YLTA 1EW0A 1XJ3A 4IUHA 1E3UA 2Y2NA 2V2FF 2Y2PA 3W4PA 1HLUP 3UB6A 3WS1A 2PR5A 3HBRA 4EXOA 4OLGA 1DP8A 3H82A 2ZOHA 4LPZA 4WMCA 3TG9A 3OZHA 3SW1A 3OCLA 1E3UD 2K31A 1OT9A 5J3WA 2JKTI 1N9BA 4N1HA 2VEAA 3IBJA 4DF6A 5L2FA 1N4OA 4KZAA 2JKRI 2C5WB 5J4EA 4XUXA 4EBNA 1V9YA 3MFXA 5I5LA 2YKHA 3LIBA 3CZDA 3W4QA 2WKRA 1CEFA 2KOIA 3ZG5A 1PWGA 4R3JA 3V5MA 2DRWA 2WAEA 2PR6A 1Y54A 3IT9A 4H8RA 5F1GA 4NETA 4ZDXA 5GLBA 5FAQA 5HX9A 4QY6A 3HLCA 5M18A 5AVEA 3E4QA 5AQ7A 3NOTC 2HDSA 1JTGA 4FTXA 1S1ZA 2ZL1B 3NCKA 4UHUA 1JVJA 5K5BA 4DN0A 4O0PA 2YKFA 4KQDA 4JXGA 3IXGA 3LICA 4KG2A 3OPPA 1ALQA 1P9RA 4KUKA 2ZQ9A 4JBFA 5EUAA 4ETXA 4YWZA 4E3NA 2D01A 4NKPA 3NIAA 4LRXC 2OLUA 5IHVA 3UE1A 5HWTA 1N9NA 3BRMA 3UPOA 5EOEA 4R70A 2WYXA 2ZC5B 4DXCA 3NHQA 2H5SA 4BL3A 1OTIA 3BECA 1BUEA 1S0WA 2P08A 4JGRA 4DDSA 1ZG4A 2V8FA 3V3RA 2VZWA 2P04A 2PDRA 3JPUA 1OTDA 4JF6A 3EQVA 3HUMA 4U0XA 4GS9A 5F1FA 1I2WA 4AFIA 4GLQA 4OPRA 4IEDA 4H6JB 2B18A 1NRJA 3PBOA 4O01A 4HJ4A 2OV5A 4S2PA 5GLAA 4GS9B 1SZVA 3A0VA 5CECA 2PBDP 4NXEA 3VV4A 1EI5A 1FILA 3AGDA 1D7EA 1FR1A 2HJ9C 1MWTA 1XA7A 3UB8A 4MLLA 3JVVA 3OPRA 4Y0TA 5DFXA 3RJUA 2WKQA 1NJ4A 3GSGA 3N8SA 4HI4A 5GHYA 1KE3A 2ZC3B 4R0QA 2VK3A 3FPVA 4HEFA 5A92A 3KYEA 3CHWP 4EETB 1S6RA 2ZMVA 1FR6A 1YLYA 1YLWA 4JPMA 4ZJ3A 3IX4A 5F69A 4LV2A 5EVEA 1S4RA 1YMSA 2J3WA 3GDIA 4L9EA 4OP5A 4PM6A 4DKIA 2OSUA 5FQ9A 1OT6A 1OTBA 3C5AA 4JGPA 4KZ9A 1ES3A 4GCZA 2HZ5A 4PKYA 3OLOA 2J7VA 2NUPC 3FZCA 1E4DA 3N8RA 5LBRA 1YSPA 3MXRA 4F94A 3TSGA 1S67L 4NG2A 4BBUA 1XJ4A 1X0OA 5A90A 4OOYA 2V1ZA 2HDQA 4HBUA 2XR0A 1O07A 4R1GA 3LO7A 5F6AA 2M1CA 4OPYA 5HAIA 2QYBA 3A3FA 2WUQA 1SKOB 1NZOA 3ZG9B 3PAEA 5U47A 5EVIA 3ZVTA 3UDFA 4DMZA 4S2MA 3AGFA 3UPPA 5F68A 3FWLA 2VV8A 2GX5A 2JKFA 2XF3A 4WYYA 5DKLA 3ZNTA 4LV3A 2XRNA 4YOFA 4EQ1A 4DRTA 1U60A 1XGIA 3SZTA 1K55A 3L9KA 2O99A 2IWBA 2FFYA 2G7UA 3MMHA 4HESA 4K08A 2ZQ8A 3O86A 1YLJA 3KO6A 5EVID 1S1YA 3G2ZA 3IH8A 1ONGA 2PHYA 3IWQA 4JXSA 3EEAA 3VSKA 1DP6A 2RL3A 2PBYA 3QP4A 2XFSA 1FCMA 2WKIA 3BYDA 4IHQA 4R3AA 3E98A 2B5RA 3ZYTA 1GA9A 3BFGA 3A3JA 5TBMA 2G2WA 5KSHA 4WUJA 3KSFA 1MY8A 3HREA 2KDKA 2CC1A 3B3XA 2HPBA 3GECA 1F98A 5G18A 1SDEA 1YSQA 1LLBA 1XJ6A 3C8CA 3S7OA 4GD8A 4S2NC 4ARZA 4BMWA 1GA0A 3CAXA 2LB9A 5HDSA 1LL5A 4E04A 1MXOA 2ZM0A 4KQQA 2VGKA 2VGLM 3PTEA 2UWXA 3B33A 4ARZB 4MDZA 1PNEA 1ODVA 3EGDC 1LT0A 5AVFA 1NRFA 1I2SA 2Y91A 2W1RA 1YT4A 2FH5A 2Y2KA 4XXRA 3OPLA 3N8LA 4DJ2A 2PT7A 5EE8A 4JKTA 4LLOB 1P97A 2IA2A 3ZQ5A 2OAP1 3IX8A 1S66L 2ZC4B 4LGWA 2WKPA 3A3IA 4OQIA 4O8GA 1K54A 2CMNA 3H7WA 4KZ7A 5CGSA 5HWWA 2WAFA 5FDSA 4M3KA 1P0ZA 4GJ4A 4K91A 4KZ5A 4OPZA 1PFLA 3NC8A 4DXBA 4U3TA 2J3TC 3H7WB 5HL6A 1RGZA 3C4PA 4QY5A 1H8MA 1PIOA 1QMEA 3CUEC 4QB8A 1F2KA 4P0MA 2EXAA 4UAAA 5FQKA 1BTLA 4MEZA 3VOYA 1XFNA 1UGUA 2PYPA 3V67A 2HP9A 3WWXA 3DW0A 4E3MA 5JYOA 1DP9A 1NYMA 3UMDA 4E3OA 1BYWA 3BQAA 3C2WA 1FSWA 5HL1A 3BW6A 2EFXA 3UB9A 5AQBA 4LCLA 2V8CA 5HAPA 4I3JA 3LUQA 3N6IA 4UEYA 3S22A 4R4SA 1KOUA 5KSCA 3P01A 1ZTUA 2ZQAA 3C38A 4CLCC 1PYYA 3LIFA 4FH2A 1L3LA 2JCHA 5EFWA 2PYRA 4I3IA 4IBXA 2W1TA 4ZJ2A 1TS0A 2WADA 5FAOA 4ZRRA 3T4QA 2VKSA 1DJAA 5L8MA 2JKTM 2DCFA 5CRFA 4X1LA 2JKRM 2XGNA 2EX8A 2V0UA 3ZHHA 3MS6A 2A3UA 1FQGA 3HLFA 2PAVP 1H3QA 2HJEA 1S4SA 2HV1A 1MWSA 5M1AA 4OLDA 4Y2FA 3EGXC 4QWOA 3DAVA 3K3DA 4PM7A 3VOLA 3V50A 1PI4A 2W3HA 4CLCE 3HLGA 3FV7A 1OJ5A 3KSGA 3T4KA 2QJ5A 3BFDA 2OOLA 3UO9A 4BLMA 5DTSA 4ME4A 1K4FA 3A0RA 3SS4A 1DJBA 4BBVA 3HLDA 4WMCD 3MFDA 1YLZA 1SCWA 3GTCA 3HVFA 1TDLA 1BT5A 3TRCA 3UY6A 1KE4A 2ZL1A 1MC0A 4CLCB 5TR7A 3UNWA 1RCJA 5L09A 3MQQA 3LGOA 1NXYA 3R7WB 5L10A 1G6AA 1EROA 4MBHA 3C7VA 3IXBA 5FI7A 3BLMA 3KYZA 5G4YA 4Q0IA 2XLNA 1K57C 1CF0A 2ZQCA 3M2JA 5CHUA 1XX2A 3UN7A 5CEBA 2HF6A 2Y79A 1YMXA 4B9OA 1GSXA 4P6ZM 2V1AA 1DY6A 2WGIA 3U4LP 2BLSA 1JWPA 3S7QA 1KGFA 3MBZA 3CG5A 3QP2A 2JN7A 4LFUA 3MQ0A 2WKEA 2DNSA 3QP5A 3HUNA 1IOUA 3IF5A 4ZBEA 4K0WA 1SHVA 2W3FA 4U0TA 3Q7VA 2Y2HA 1ZG6A 2ZBBA 3KX0X 1K6RA 3G32A 3PBTA 4EERA 2WZXA 2OWHA 2QHKA 5JYPA 4OOLA 3HJIA 3M2KA 3O3VA 4B4XA 4WZ5C 3MXQA 1PZOA 3Q7VB 4G3KA 5CXWA 4H6JA 1OMEA 1OTEA 1T18A 3NOUC 2Y55A 3P7NA 1L0FA 3QP8A 2XD5A 4FSFA 2A24B 3EQUA 5HD3A 2ZQ7A 1CEGA 4P85A 1W63Q 3IXHA 1K57A 4Y0OA 4HJ6A 4FD8A 1TVFA 5HPFA 1ESIA 3V3SA 2WGWB 3BM6A 4WL9A 2VGJA 1W63M 3PBQA 2EWVA 2XDMA 1ZHHB 5FQIA 3OOVA 3IHAA 4HIAA 4EESA 4C3QA 2WGVA 3MKEA 3SH7A 1H0MA 4X25A 3VP1A 1EWZA 3UE0A 4EEPA 5DTKA 4Y0UA 3D9YA 4RX3A 1V9ZA 5HFOA 3WS4A 1Z09A 3V39A 5FEGA 4EUVA 3PXPA 3OPHA 2PU2A 1KVMA 2EWWA 1GSVA 5DKKA 5HDDA 2P7JA 1G6OA 1K6SA 4B93A 1PI5A 2XQZA 3VE4A 2H28A 1K4EA 4IJGA 1LSWA 2B95A 4RX2A 1HTZA 4EV4A 3S1YA 1D06A 3M6BA 1PWDA 1BULA 4KZ6A 3P09A 4WEJA 3MZDA 3BY8A 1YKDA 1MBLA 1QMFA 3MF0A 4EU0A 1SKOA 2AVXA 4Q0HA 3NI9A 1L0GA 3F1NB 5F83A 1DRMA 4LENA 3NDGA 4X56A 4R4RA 5FATA 1HD8A 4OVDA 3BFFA 1N9LA 2VLGA 4OOMA 4E6WA 3SS5A 4RA7A 1JTDA 4HOIA 4JXWA 3SH8A 1JWVA 1IFQA 3H9WA 3QP6A 3W4OA 1A0KA 2A2LA 3VSLA 3PYPA 4Y3IA 3CI6A 3LR5A 5L07A 3ZDJA 5IT5A 2Y2MA 3D3OA 2HP5A 2JBFA 1IEMA 1VETA 2J8YA 1CJFA 2LB5A 3L7HA 2J80A 2X02A 3G34A 1UWNX 5DFYA 2O9CA 1FCOA 2OLVA 2RCXA 1XPBA 4QJGA 1XKZA 1L0EA 5TFQA 3A3EA 5FAPA 1VETB 2E8JA 3LR3A 3UMEA 1YQSA 4WZ4A 5IS1A 2VJWA 4R3BA 4G3VA 4ZJ1A 3I7JA 5DVAA 3HL9A 5HSQA 5FA7A 3OC2A 3SOIA 4NXBA 5FASA 1TS6A 3E2KA 5C5KA 2QZ6A 3WS0A 3TOIA 5HWVA 3LR0A 2PD7A 1NY0A 2Z6CA 4HNBA 3T1QB 4HJ3A 1FCNA 3KSHA 5J7EA 1J3WA 1E25A 4B88A 1RP5A 3LI9A 1IKGA 2X71A 3IWOA 1AWIA 3FYZA 1KGEA 4OKPA 4I38A 4DE1A 3G35A 4NK3A 4L9GA 4YFMA 3BEBA 3IQAA 2FFFB 3UE3A 1JNUA 4A5RA 3ZCZA 1BLPA 5E2GA 2QWSA 2ZM8A 4KG5A 3A0SA 5EV0A 1IYSA 3LY3A 3GV9A 4EBPA 4QHCA 3VP3A 4GOGA 4EUZA 3S4XA 3K3CA 1LHYA 4MBKA 3BLSA 3CPTB 1LL8A 3F1OB 3IHBA 3MZFA 3T50A 4C6YA 1W79A 3ITAA 5EM1A 1ES4A 4GD6A 4S2IA 5HARA 3RH8B 4KZ8A 3LR4A 4BL2A 2Y4AA 3T4JA 4P6ZS 1T1BA 2Y2LA 5FI2A 3LY4A 2K2NA 1WE4A 2K7SA 3QNCA 4RYEA 5EECA 4OQ0A 4JLFA 2QMIA 3MSHA 3WRZA 4MCWA 4WM9A 1STZA 4P6BA 1LI0A 1TS8A 4UA6A 2BTFP 1TEMA 5HAQA 2ZMAA 4FUWA 3IF6C 4IBRA 5DF7A 3IH9A 2PD8A 4GZBA 3E2LA 4I5SA 1G5UA 4PM8A 2NUTC 4ZAMA 2EA9A 3BWLA 4QD4A 5AQAA 5GHXA 5EVLA 1DJCA 2L4RA 4GHIA 4C75A 1T19A 4S2NA 3UPNA 4GNUA 3VP0A 5CTNA 4F3LB 4S2KA 4L9FA 4CJNA 3RFBA 2EX9A 1PRQA 2M7UA 1CQAA 3AGEA 3NULA 4FH4A 1O7EA 1MKMA 3G4PA 4S2OA 2J9PA 4GHIB 1TD5A 3W2ZA 5HD5A 3MZEA 1VQQA 3DTKA 4ID4A 2OWJA 2XA7M 3BFEA 4X53A 1NYYA 3Q82A 2W3GA 2BASA 4D60A 3LCEA 5DTTA 4LRZE 3A3DA 1YPRA 4FOFA 3DWZA 2V20A 2XFTA 4N1XA 4JF4A 4R23A 4QPRA 2XK1A 5AJGA 4JGOA 4YNRA 2IWDA 3CMZA 4R6LA 1I5QA 4PM5A 1M6KA 5CEDA 4B4ZA 1MKIA 1LSVA 2I72A 4KZ4A 5DJUA 1H8ZA 3C7UA 2ZM2A 4IUKA 3CUEA 3ZG8B 1SDNA 5AQ9A 3VFFA 3KSIA 4GDBA 4HQAA 4E3LA 5G4ZA 2ZOIA 5A91A 3N7WA 1XJ2A 3B47A 3IWIA 4E6XA 3ULFA 3WS5A 2WKHA 3QP1A 1J9MA 3NJAA 1CI9A 4MNRA 1T1AA 5E2HA 1WYBA 4LV1A 4X1MA 3T1SA 4D2OA 3FKVA 1ES5A 4PM9A 2XROA 5IU1A 1P9WA 2ZMFA 2VX8A 4G3WA 1GSWA 1VM1A 2Q9MA 3C4OA 3W8KA 3CLOA 1UWPX 5DJTA 2GZAA 3M6HA 3UDXA 1W7FA 5BOHA 4UA7A 1TDGA 4MN7A 5E2FA 5FDHA 1YAXA 2Z2MB 4Y13A 4Q8IA 3LI8A 5EOOA 2JKGA 1F5MA 4CLCA 4WF0A 1HVBA 4PPRA 1ERMA 3R7WA 3IX3A 2EX2A 4MMNA 3IXDA 1FOFA 1BLSA 3LIAA 3SS3A 4DJ3A 3H82B 1ERQA 4WBGA 4GKUA 2M7VA 4NEED 4CLCD 1Y4OA 1MWUA 3UE6A 2W27A 3CWFA 3MKFA 1ES2A 3HUOA 5F5YA 2A49A 5HPIA 4DE0A 3RTYA 1NWZA 1GHMA 3T4TA 4P87A 4HHDA 4KG6A 3S7PA 4Y15A 2R9WA 1ZKJA 3BFCA 5KZHA 3ZGAB 5CTMA 4L0LA 3NY4A 1F9IA 3RXXA 3F1PA 3ZVWA 5FEFA 3TJZC 3U2AA 4LCMA 1KDWA 3P98A 1ZC2A 4N92A 3TE8A 1OJGA 2Z6DA 5A93A 3PBNA 5FQMA 2VGLS 1W8YA 4KZ3A 4KQRA 1Y28A 3N4IA 3C30A 1NLYA 4WLAA 4O7DA 1W5DA 3F1PB 1NLZA 1LL9A 4S2LA 4MBFA 4BJPA 3HJKA 1PZPA 3WRTA 4XUZA 3VP4A 4QU3A 3FPWA 3OBFA 5GLDA 1YLPA 3NOPC 4LV0A 2Z2LB 3O87A 1Z6FA 3G6OA 1XXMA 2Y2QA 3GVBA 4I3AA 2KLIA 3DTIA 2A24A 3CITA 3FC7A 5GLCA 4KQOA 3G30A 4JGQA 2Y2OA 3ZG7B 5CHJA 3UDIA 5DF8A 3FG8A 2R9XA 1FSYA 2GDNA 3VOZA 1K25A 2ZQDA 3DTEA 3Q81A 2I9VA 4GN2A 3ZG0A 2P74A 5DF9A 1KE0A 2WGWA 2P9VA 1SKFA 3DWKA 1OTAA 4PAUA 4Z9QA 1MZUA 5FQJA 2O9AA 2INWA 4E3KA 1GHIA 2Y2JA 4E3IA 4OQGA 2P9VB 1KVLA 5FSRA 5M19A 3GMWA 3LEZA 2J9OA 4OPQA 1AXBA 4WELA 2XSSA 3ZFZA 4PMAA 4HH2A 2VV7A 3PHYA 5EVIC 4NXGA 4Q0JA 4BWIA 4NXFA 3S7NA 4OH0A 3Q07A 2VA0A 2FZ0A 1CK3A 3DBAA 3E4PA 2XA7S 1K55C 1BLCA 5CERA 3ZNYA 1YM1A 4Z1WA 3MXSA 1ACFA 4KUOA 4WZ5A 4Y7PA 2HP6A 1CI8A 4FCFA 4I39A 2V0WA 4HH3A 2DMWA 3F1NA 5FI6A 3EOIA 3G31A 4BENA 4GB7A 3O5YA 2O9BA 3GRJA 4UA9A 3QNBA 4N9LA 1N9OA 3UB7A 5D3OA 3D4FA 4UQIM 4BBTA 3PBRA 5J8XA 2H10A 2GJ3A 4ETZA 1BLHA 3FKWA 5HZHA 3EWKA 3GR2A 3O88A 4EW7A 2ACGA 4X6TA 5F82A 4PHTA 2Y2IA 1TS7A 3VP2A 5A8BA 4EBLA 3JVUA 3LIEA 4PKYG 1KDSA 1VEUA 4M4XA 5GHZA 3HLEA 4ESPA 2QKPA 4HP9A 4LRYC 4HP4A 2XH9A 1XA1A 1VEUB 2O0YA 1XP4A 5TJJA 2UV0E 4N9KA 1PW8A 1BZAA 2QPNA 4X68A 3MQOA 4JXVA 3NECA 1RGYA 2Y8HA 3NDEA 2C6WB 1K38A 5EM0A 4RVAA 1IYQA 2H0YA 3G2YA 4WN5A 1C3BA 1Q2PA 3BJNA 3KYQA 4X55A 5EVIB 2WZZA 2QJ7A 1JWZA 3PAGA 1K56A 2EX6A 5FQQA 3K2NA 1XGJA 2GNXA 1TF1A 2WK0A 1K54C 5GL9A 4ZTKA 1ESUA 4XT2A 5I94A 1D1JA 3B42A 4OP8A 3DTMA 1K56D 2JE5A 2W0NA 1ONHA 3SH9A
chains in the Genus database with same CATH topology
1NJ4A 3GSGA 3UNWA 1RCJA 3QHYA 1PWCA 3N8SA 4KENB 3LCEA 1NXYA 1G6AA 1EROA 5DTTA 1GHPA 4IVIA 4MBHA 3C7VA 5GHYA 3IXBA 3A3DA 2XEPA 5FI7A 1KE3A 3BLMA 3DWZA 2XD1A 2ZC3B 2V20A 2XFTA 4R0QA 4N1XA 4JF4A 2XLNA 4R23A 2EFUA 4HEFA 5A92A 1K57C 2JC7A 2ZQCA 3VFHA 2XK1A 1S6RA 2IWCA 1FR6A 3Q1FA 1YLYA 1YLWA 3HLBA 4JPMA 3M2JA 5CHUA 4ZJ3A 4LV2A 1M40A 1XX2A 3GQZA 3ISGA 3UN7A 2ZLYA 1IYOA 5CEBA 2IWDA 3CMZA 1YMSA 4PM6A 1I5QA 4OP5A 4DKIA 4PM5A 1YMXA 2OSUA 5FQ9A 1M6KA 1IYPA 5CEDA 5CHMA 4B4ZA 1MKIA 2I72A 3C5AA 4KZ4A 2G2UA 4KZ9A 1H8ZA 3C7UA 2ZM2A 1ES3A 4OONA 1DY6A 2WGIA 5CGWA 3ZG8B 1SDNA 1JWPA 2BLSA 5AQ9A 1KGFA 3MBZA 3CG5A 3VFFA 1L0DA 4GDBA 2J7VA 3SH9A 4YINA 4BQMA 4E3JA 4E3LA 1L2SA 2WKEA 5TGFA 3FZCA 1E4DA 2DNSA 3N8RA 5A91A 3HLWA 3HUNA 3N7WA 3IF5A 3MXRA 4F94A 2PU4A 3IWIA 4ZBEA 3TSGA 4HBTA 1SHVA 4K0WA 4E6XA 3WS5A 4U0TA 2WKHA 3WS2A 3Q7VA 1J9MA 4KZBA 2Y2HA 1CI9A 4MNRA 5KMWA 5A90A 4OOYA 2V1ZA 1ZG6A 2HDQA 4HBUA 1K6RA 3G32A 5E2HA 2XR0A 3PBTA 1O07A 4JF5A 2WZXA 1IELA 1WYBA 4R1GA 4LV1A 5JYPA 3LO7A 4OOLA 1BSGA 3M2KA 4OPYA 3O3VA 5HAIA 2ZC7A 4B4XA 4WZ5C 1LI9A 3A3FA 4D2OA 1PZOA 3FKVA 1ES5A 2WUQA 1NZOA 4PM9A 3Q7VB 3ZG9B 3PAEA 5CXWA 5U47A 5CGXA 1IKIA 5EVIA 3ZVTA 3UDFA 1VM1A 1OMEA 2Q9MA 3C4OA 3W8KA 4S2MA 4S2JA 3AGFA 3UPPA 2Y55A 3FWLA 3M6HA 4WEKA 2XF3A 4WYYA 3UDXA 3ZNTA 1W7FA 5BOHA 1L0FA 4LV3A 4UA7A 1TDGA 1H5XA 4DRTA 1U60A 1XGIA 2XD5A 4FSFA 1K55A 2IWBA 2FFYA 4HESA 5E2FA 3EQUA 2ZQ8A 3O86A 4DDYA 1YLJA 5FDHA 2ZQ7A 1CEGA 5EVID 2HDRA 2Z2MB 4P85A 3G2ZA 3IH8A 1ONGA 4JXSA 3IWQA 4Q8IA 3VSKA 3VMAA 3IXHA 1K57A 4Y0OA 5EOOA 2RL3A 1HVBA 2PBYA 4PPRA 4EWFA 1ERMA 2XFSA 1TVFA 4FD8A 5E2EA 2ZJ9A 1ESIA 1FCMA 3V3SA 2WKIA 3BYDA 2WGWB 3BM6A 2VGJA 2EX2A 3IXDA 1FOFA 1BLSA 3PBQA 2B5RA 1GA9A 2H0TA 3BFGA 3A3JA 2XDMA 2G2WA 5FQIA 5KSHA 3SS3A 1MY8A 3HREA 3NBLA 4X69A 1ERQA 4WBGA 4GKUA 3IHAA 1G68A 4C3QA 2HDUA 2WGVA 1MPLA 2CC1A 3MKEA 1MWUA 3SH7A 2Y59A 3B3XA 2HPBA 3VP1A 3MKFA 1EWZA 1ES2A 3HUOA 3OCNA 3UE0A 2A49A 5HW3A 5DTKA 4DE0A 1H8YA 4Y0UA 4RX3A 5G18A 5HFOA 3WS4A 2Y2GA 1HZOA 1SDEA 1GHMA 5E43A 3V39A 3OPHA 1Q2QA 4DE2A 4P87A 2PU2A 1LLBA 1KVMA 4K0XA 1KGGA 4KG6A 1GCEA 2R9WA 4GD8A 1ZKJA 4EQIA 4S2NC 3BFCA 2ZC6B 1GA0A 5KZHA 3ZGAB 5CTMA 1K6SA 4L0LA 3NY4A 3Q7ZA 3RXXA 1LL5A 1PI5A 2XQZA 1MXOA 2ZM0A 4KQQA 3ZVWA 3IF6A 2EXBA 2VGKA 1K4EA 4BD1A 3JYIA 3PTEA 4LCMA 1KDWA 3P98A 2UWXA 1ZC2A 4RX2A 4N92A 1HTZA 4EV4A 5A93A 3PBNA 5FQMA 1W8YA 4KZ3A 1MWRA 4KQRA 3N4IA 3S1YA 3M6BA 1BULA 1NZUA 1PWDA 1W5DA 4O7DA 4KZ6A 4OQHA 1LL9A 4S2LA 1NRFA 3P09A 4MBFA 3MZDA 1I2SA 4WEJA 2X01A 1PZPA 3IF6B 3WRTA 4XUZA 2Y91A 3PBSA 3ITBA 1MBLA 1QMFA 1YT4A 3VP4A 4BD0A 2Y2KA 4XXRA 3OPLA 3N8LA 4QU3A 5EE8A 3NI9A 5GLDA 4JKTA 1YLPA 1L0GA 5F83A 3CJMA 4LV0A 4CPKA 2Z2LB 4IVKA 4LENA 3NDGA 4X56A 2ZC4B 3O87A 1Z6FA 4R4RA 5FATA 3RXWA 1HD8A 3A3IA 4OQIA 1XXMA 2Y2QA 3BFFA 3GVBA 4OVDA 1K54A 4DE3A 4KZ7A 4OOMA 4E6WA 5CGSA 1WYCA 1W8QA 3SS5A 2WAFA 2Q9NA 4GDNA 4RA7A 1JTDA 2E8IA 5GLCA 4KQOA 3G30A 4JXWA 3SH8A 2Y2OA 4M3KA 1JWVA 2BG1A 3ZG7B 4K91A 5EPHA 4KZ5A 4OPZA 5CHJA 3UDIA 1PW1A 2ZD8A 5DF8A 3W4OA 2R9XA 1FSYA 3NC8A 2GDNA 1YLTA 4DXBA 4U3TA 3VOZA 1K25A 3VSLA 2ZQDA 3Q81A 3ZDJA 4GN2A 1E3UA 2Y2MA 1RGZA 2HP5A 1KE0A 2JBFA 2P74A 2V2FF 1IEMA 2Y2NA 2Y2PA 5DF9A 3C4PA 2WGWA 2J8YA 4QY5A 2P9VA 1SKFA 3W4PA 1PIOA 3DWKA 2X02A 3G34A 1QMEA 4Z9QA 4QB8A 1FCOA 3WS1A 5FQJA 3HBRA 2OLVA 4OLGA 4P0MA 2RCXA 2EXAA 1XPBA 4QJGA 4UAAA 1XKZA 5FQKA 4WMCA 1BTLA 3TG9A 4MEZA 3VOYA 1L0EA 4E3KA 3OZHA 1GHIA 5TFQA 2Y2JA 3A3EA 3OCLA 5FAPA 4E3IA 1E3UD 4OQGA 1YQSA 2P9VB 1KVLA 4WZ4A 5FSRA 2HP9A 1N9BA 3WWXA 3DW0A 4R3BA 5M19A 3GMWA 4N1HA 4ZJ1A 4DF6A 3I7JA 5DVAA 5L2FA 4E3MA 3HL9A 1N4OA 4KZAA 5JYOA 5FA7A 2C5WB 3OC2A 3SOIA 1NYMA 3LEZA 2J9OA 4OPQA 5FASA 4XUXA 3E2KA 1AXBA 4EBNA 4WELA 4E3OA 2QZ6A 3ZFZA 3WS0A 3TOIA 4PMAA 3CZDA 1NY0A 1FSWA 3W4QA 5HL1A 1CEFA 1FCNA 5EVIC 1E25A 4B88A 1RP5A 2EFXA 3ZG5A 1PWGA 4R3JA 3V5MA 4OH0A 2DRWA 2WAEA 3Q07A 4H8RA 1IKGA 1Y54A 3IT9A 2X71A 3IWOA 5F1GA 3FYZA 4OKPA 1KGEA 4NETA 4ZDXA 5GLBA 5FAQA 5HX9A 4DE1A 5AQBA 4QY6A 3G35A 4NK3A 1CK3A 4BJPA 4LCLA 3HLCA 5HAPA 5M18A 1K55C 4YFMA 5AQ7A 3BEBA 3N6IA 1BLCA 3IQAA 5CERA 3S22A 2FFFB 2HDSA 3UE3A 1JTGA 3ZNYA 1YM1A 4A5RA 4R4SA 5KSCA 3ZG0A 3MXSA 3NCKA 4UHUA 3ZCZA 1BLPA 1JVJA 4WZ5A 4Y7PA 2HP6A 5E2GA 1CI8A 4FCFA 2ZM8A 2ZQAA 4KG5A 1PYYA 1IYSA 3LY3A 4FH2A 3GV9A 5FI6A 4EBPA 4QHCA 3G31A 3VP3A 4BENA 4GOGA 4GB7A 4EUZA 2JCHA 3S4XA 1LHYA 4JXGA 3IXGA 3GRJA 3BLSA 4MBKA 4IBXA 4UA9A 3QNBA 3IHBA 4KG2A 4N9LA 4ZJ2A 5D3OA 3OPPA 1ALQA 3D4FA 3MZFA 3PBRA 5J8XA 2H10A 4C6YA 1W79A 3ITAA 2ZQ9A 1ES4A 1BLHA 4JBFA 3FKWA 4GD6A 5EUAA 4S2IA 3GR2A 5HARA 2WADA 3O88A 4KZ8A 4E3NA 4X6TA 2Y4AA 5F82A 5FAOA 4BL2A 2Y2IA 3VP2A 3NIAA 2Y2LA 5FI2A 1DJAA 3LY4A 2OLUA 4EBLA 1WE4A 2DCFA 5CRFA 3QNCA 4RYEA 5IHVA 5EECA 1KDSA 4OQ0A 4JLFA 2QMIA 3UE1A 5GHZA 3HLEA 3WRZA 2XGNA 4WM9A 2EX8A 4P6BA 3ZHHA 1LI0A 3BRMA 2A3UA 1FQGA 3UPOA 5EOEA 3HLFA 2WYXA 2ZC5B 4UA6A 4DXCA 2XH9A 1TEMA 2H5SA 4BL3A 5HAQA 3BECA 2ZMAA 1XA1A 1BUEA 3IF6C 4IBRA 5DF7A 3IH9A 1MWSA 1S0WA 4DDSA 1XP4A 4GZBA 5M1AA 4N9KA 1PW8A 1ZG4A 1BZAA 3E2LA 2QPNA 4OLDA 4X68A 4JXVA 3V3RA 1RGYA 4PM7A 3V50A 4JF6A 1PI4A 4PM8A 3EQVA 3HUMA 4U0XA 3NDEA 2C6WB 4QD4A 5AQAA 4ZAMA 3HLGA 1K38A 5GHXA 3FV7A 4RVAA 1DJCA 5EVLA 1IYQA 2H0YA 1I2WA 4C75A 5F1FA 3G2YA 4S2NA 1C3BA 3UPNA 1Q2PA 4GNUA 3VP0A 5CTNA 4X55A 4S2KA 4OPRA 3BFDA 4CJNA 3UO9A 5EVIB 4BLMA 4IEDA 2EX9A 2WZZA 1JWZA 5DTSA 3PAGA 1K56A 1K4FA 3AGEA 2EX6A 3PBOA 3SS4A 1DJBA 5FQQA 3HLDA 4FH4A 1XGJA 2OV5A 1O7EA 4S2PA 5GLAA 4WMCD 3G4PA 3MFDA 1YLZA 4S2OA 1SCWA 2J9PA 2WK0A 3GTCA 1K54C 3HVFA 5GL9A 5CECA 1TDLA 4ZTKA 1EI5A 3AGDA 3MZEA 1ESUA 1VQQA 1FR1A 1BT5A 1MWTA 1XA7A 3UY6A 4MLLA 5I94A 4ID4A 4OP8A 3DTMA 1KE4A 3OPRA 4Y0TA 1K56D 2JE5A 3BFEA 1ONHA 3RJUA 4X53A 1NYYA 3Q82A 5TR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJ4 A;  3GSG A;  3UNW A;  1RCJ A;  3QHY A;  1PWC A;  3N8S A;  4KEN B;  3LCE A;  1NXY A;  1G6A A;  1ERO A;  5DTT A;  1GHP A;  4IVI A;  4MBH A;  3C7V A;  5GHY A;  3IXB A;  3A3D A;  2XEP A;  5FI7 A;  1KE3 A;  3BLM A;  3DWZ A;  2XD1 A;  2ZC3 B;  2V20 A;  2XFT A;  4R0Q A;  4N1X A;  4JF4 A;  2XLN A;  4R23 A;  2EFU A;  4HEF A;  5A92 A;  1K57 C;  2JC7 A;  2ZQC A;  3VFH A;  2XK1 A;  1S6R A;  2IWC A;  1FR6 A;  3Q1F A;  1YLY A;  1YLW A;  3HLB A;  4JPM A;  3M2J A;  5CHU A;  4ZJ3 A;  4LV2 A;  1M40 A;  1XX2 A;  3GQZ A;  3ISG A;  3UN7 A;  2ZLY A;  1IYO A;  5CEB A;  2IWD A;  3CMZ A;  1YMS A;  4PM6 A;  1I5Q A;  4OP5 A;  4DKI A;  4PM5 A;  1YMX A;  2OSU A;  5FQ9 A;  1M6K A;  1IYP A;  5CED A;  5CHM A;  4B4Z A;  1MKI A;  2I72 A;  3C5A A;  4KZ4 A;  2G2U A;  4KZ9 A;  1H8Z A;  3C7U A;  2ZM2 A;  1ES3 A;  4OON A;  1DY6 A;  2WGI A;  5CGW A;  3ZG8 B;  1SDN A;  1JWP A;  2BLS A;  5AQ9 A;  1KGF A;  3MBZ A;  3CG5 A;  3VFF A;  1L0D A;  4GDB A;  2J7V A;  3SH9 A;  4YIN A;  4BQM A;  4E3J A;  4E3L A;  1L2S A;  2WKE A;  5TGF A;  3FZC A;  1E4D A;  2DNS A;  3N8R A;  5A91 A;  3HLW A;  3HUN A;  3N7W A;  3IF5 A;  3MXR A;  4F94 A;  2PU4 A;  3IWI A;  4ZBE A;  3TSG A;  4HBT A;  1SHV A;  4K0W A;  4E6X A;  3WS5 A;  4U0T A;  2WKH A;  3WS2 A;  3Q7V A;  1J9M A;  4KZB A;  2Y2H A;  1CI9 A;  4MNR A;  5KMW A;  5A90 A;  4OOY A;  2V1Z A;  1ZG6 A;  2HDQ A;  4HBU A;  1K6R A;  3G32 A;  5E2H A;  2XR0 A;  3PBT A;  1O07 A;  4JF5 A;  2WZX A;  1IEL A;  1WYB A;  4R1G A;  4LV1 A;  5JYP A;  3LO7 A;  4OOL A;  1BSG A;  3M2K A;  4OPY A;  3O3V A;  5HAI A;  2ZC7 A;  4B4X A;  4WZ5 C;  1LI9 A;  3A3F A;  4D2O A;  1PZO A;  3FKV A;  1ES5 A;  2WUQ A;  1NZO A;  4PM9 A;  3Q7V B;  3ZG9 B;  3PAE A;  5CXW A;  5U47 A;  5CGX A;  1IKI A;  5EVI A;  3ZVT A;  3UDF A;  1VM1 A;  1OME A;  2Q9M A;  3C4O A;  3W8K A;  4S2M A;  4S2J A;  3AGF A;  3UPP A;  2Y55 A;  3FWL A;  3M6H A;  4WEK A;  2XF3 A;  4WYY A;  3UDX A;  3ZNT A;  1W7F A;  5BOH A;  1L0F A;  4LV3 A;  4UA7 A;  1TDG A;  1H5X A;  4DRT A;  1U60 A;  1XGI A;  2XD5 A;  4FSF A;  1K55 A;  2IWB A;  2FFY A;  4HES A;  5E2F A;  3EQU A;  2ZQ8 A;  3O86 A;  4DDY A;  1YLJ A;  5FDH A;  2ZQ7 A;  1CEG A;  5EVI D;  2HDR A;  2Z2M B;  4P85 A;  3G2Z A;  3IH8 A;  1ONG A;  4JXS A;  3IWQ A;  4Q8I A;  3VSK A;  3VMA A;  3IXH A;  1K57 A;  4Y0O A;  5EOO A;  2RL3 A;  1HVB A;  2PBY A;  4PPR A;  4EWF A;  1ERM A;  2XFS A;  1TVF A;  4FD8 A;  5E2E A;  2ZJ9 A;  1ESI A;  1FCM A;  3V3S A;  2WKI A;  3BYD A;  2WGW B;  3BM6 A;  2VGJ A;  2EX2 A;  3IXD A;  1FOF A;  1BLS A;  3PBQ A;  2B5R A;  1GA9 A;  2H0T A;  3BFG A;  3A3J A;  2XDM A;  2G2W A;  5FQI A;  5KSH A;  3SS3 A;  1MY8 A;  3HRE A;  3NBL A;  4X69 A;  1ERQ A;  4WBG A;  4GKU A;  3IHA A;  1G68 A;  4C3Q A;  2HDU A;  2WGV A;  1MPL A;  2CC1 A;  3MKE A;  1MWU A;  3SH7 A;  2Y59 A;  3B3X A;  2HPB A;  3VP1 A;  3MKF A;  1EWZ A;  1ES2 A;  3HUO A;  3OCN A;  3UE0 A;  2A49 A;  5HW3 A;  5DTK A;  4DE0 A;  1H8Y A;  4Y0U A;  4RX3 A;  5G18 A;  5HFO A;  3WS4 A;  2Y2G A;  1HZO A;  1SDE A;  1GHM A;  5E43 A;  3V39 A;  3OPH A;  1Q2Q A;  4DE2 A;  4P87 A;  2PU2 A;  1LLB A;  1KVM A;  4K0X A;  1KGG A;  4KG6 A;  1GCE A;  2R9W A;  4GD8 A;  1ZKJ A;  4EQI A;  4S2N C;  3BFC A;  2ZC6 B;  1GA0 A;  5KZH A;  3ZGA B;  5CTM A;  1K6S A;  4L0L A;  3NY4 A;  3Q7Z A;  3RXX A;  1LL5 A;  1PI5 A;  2XQZ A;  1MXO A;  2ZM0 A;  4KQQ A;  3ZVW A;  3IF6 A;  2EXB A;  2VGK A;  1K4E A;  4BD1 A;  3JYI A;  3PTE A;  4LCM A;  1KDW A;  3P98 A;  2UWX A;  1ZC2 A;  4RX2 A;  4N92 A;  1HTZ A;  4EV4 A;  5A93 A;  3PBN A;  5FQM A;  1W8Y A;  4KZ3 A;  1MWR A;  4KQR A;  3N4I A;  3S1Y A;  3M6B A;  1BUL A;  1NZU A;  1PWD A;  1W5D A;  4O7D A;  4KZ6 A;  4OQH A;  1LL9 A;  4S2L A;  1NRF A;  3P09 A;  4MBF A;  3MZD A;  1I2S A;  4WEJ A;  2X01 A;  1PZP A;  3IF6 B;  3WRT A;  4XUZ A;  2Y91 A;  3PBS A;  3ITB A;  1MBL A;  1QMF A;  1YT4 A;  3VP4 A;  4BD0 A;  2Y2K A;  4XXR A;  3OPL A;  3N8L A;  4QU3 A;  5EE8 A;  3NI9 A;  5GLD A;  4JKT A;  1YLP A;  1L0G A;  5F83 A;  3CJM A;  4LV0 A;  4CPK A;  2Z2L B;  4IVK A;  4LEN A;  3NDG A;  4X56 A;  2ZC4 B;  3O87 A;  1Z6F A;  4R4R A;  5FAT A;  3RXW A;  1HD8 A;  3A3I A;  4OQI A;  1XXM A;  2Y2Q A;  3BFF A;  3GVB A;  4OVD A;  1K54 A;  4DE3 A;  4KZ7 A;  4OOM A;  4E6W A;  5CGS A;  1WYC A;  1W8Q A;  3SS5 A;  2WAF A;  2Q9N A;  4GDN A;  4RA7 A;  1JTD A;  2E8I A;  5GLC A;  4KQO A;  3G30 A;  4JXW A;  3SH8 A;  2Y2O A;  4M3K A;  1JWV A;  2BG1 A;  3ZG7 B;  4K91 A;  5EPH A;  4KZ5 A;  4OPZ A;  5CHJ A;  3UDI A;  1PW1 A;  2ZD8 A;  5DF8 A;  3W4O A;  2R9X A;  1FSY A;  3NC8 A;  2GDN A;  1YLT A;  4DXB A;  4U3T A;  3VOZ A;  1K25 A;  3VSL A;  2ZQD A;  3Q81 A;  3ZDJ A;  4GN2 A;  1E3U A;  2Y2M A;  1RGZ A;  2HP5 A;  1KE0 A;  2JBF A;  2P74 A;  2V2F F;  1IEM A;  2Y2N A;  2Y2P A;  5DF9 A;  3C4P A;  2WGW A;  2J8Y A;  4QY5 A;  2P9V A;  1SKF A;  3W4P A;  1PIO A;  3DWK A;  2X02 A;  3G34 A;  1QME A;  4Z9Q A;  4QB8 A;  1FCO A;  3WS1 A;  5FQJ A;  3HBR A;  2OLV A;  4OLG A;  4P0M A;  2RCX A;  2EXA A;  1XPB A;  4QJG A;  4UAA A;  1XKZ A;  5FQK A;  4WMC A;  1BTL A;  3TG9 A;  4MEZ A;  3VOY A;  1L0E A;  4E3K A;  3OZH A;  1GHI A;  5TFQ A;  2Y2J A;  3A3E A;  3OCL A;  5FAP A;  4E3I A;  1E3U D;  4OQG A;  1YQS A;  2P9V B;  1KVL A;  4WZ4 A;  5FSR A;  2HP9 A;  1N9B A;  3WWX A;  3DW0 A;  4R3B A;  5M19 A;  3GMW A;  4N1H A;  4ZJ1 A;  4DF6 A;  3I7J A;  5DVA A;  5L2F A;  4E3M A;  3HL9 A;  1N4O A;  4KZA A;  5JYO A;  5FA7 A;  2C5W B;  3OC2 A;  3SOI A;  1NYM A;  3LEZ A;  2J9O A;  4OPQ A;  5FAS A;  4XUX A;  3E2K A;  1AXB A;  4EBN A;  4WEL A;  4E3O A;  2QZ6 A;  3ZFZ A;  3WS0 A;  3TOI A;  4PMA A;  3CZD A;  1NY0 A;  1FSW A;  3W4Q A;  5HL1 A;  1CEF A;  1FCN A;  5EVI C;  1E25 A;  4B88 A;  1RP5 A;  2EFX A;  3ZG5 A;  1PWG A;  4R3J A;  3V5M A;  4OH0 A;  2DRW A;  2WAE A;  3Q07 A;  4H8R A;  1IKG A;  1Y54 A;  3IT9 A;  2X71 A;  3IWO A;  5F1G A;  3FYZ A;  4OKP A;  1KGE A;  4NET A;  4ZDX A;  5GLB A;  5FAQ A;  5HX9 A;  4DE1 A;  5AQB A;  4QY6 A;  3G35 A;  4NK3 A;  1CK3 A;  4BJP A;  4LCL A;  3HLC A;  5HAP A;  5M18 A;  1K55 C;  4YFM A;  5AQ7 A;  3BEB A;  3N6I A;  1BLC A;  3IQA A;  5CER A;  3S22 A;  2FFF B;  2HDS A;  3UE3 A;  1JTG A;  3ZNY A;  1YM1 A;  4A5R A;  4R4S A;  5KSC A;  3ZG0 A;  3MXS A;  3NCK A;  4UHU A;  3ZCZ A;  1BLP A;  1JVJ A;  4WZ5 A;  4Y7P A;  2HP6 A;  5E2G A;  1CI8 A;  4FCF A;  2ZM8 A;  2ZQA A;  4KG5 A;  1PYY A;  1IYS A;  3LY3 A;  4FH2 A;  3GV9 A;  5FI6 A;  4EBP A;  4QHC A;  3G31 A;  3VP3 A;  4BEN A;  4GOG A;  4GB7 A;  4EUZ A;  2JCH A;  3S4X A;  1LHY A;  4JXG A;  3IXG A;  3GRJ A;  3BLS A;  4MBK A;  4IBX A;  4UA9 A;  3QNB A;  3IHB A;  4KG2 A;  4N9L A;  4ZJ2 A;  5D3O A;  3OPP A;  1ALQ A;  3D4F A;  3MZF A;  3PBR A;  5J8X A;  2H10 A;  4C6Y A;  1W79 A;  3ITA A;  2ZQ9 A;  1ES4 A;  1BLH A;  4JBF A;  3FKW A;  4GD6 A;  5EUA A;  4S2I A;  3GR2 A;  5HAR A;  2WAD A;  3O88 A;  4KZ8 A;  4E3N A;  4X6T A;  2Y4A A;  5F82 A;  5FAO A;  4BL2 A;  2Y2I A;  3VP2 A;  3NIA A;  2Y2L A;  5FI2 A;  1DJA A;  3LY4 A;  2OLU A;  4EBL A;  1WE4 A;  2DCF A;  5CRF A;  3QNC A;  4RYE A;  5IHV A;  5EEC A;  1KDS A;  4OQ0 A;  4JLF A;  2QMI A;  3UE1 A;  5GHZ A;  3HLE A;  3WRZ A;  2XGN A;  4WM9 A;  2EX8 A;  4P6B A;  3ZHH A;  1LI0 A;  3BRM A;  2A3U A;  1FQG A;  3UPO A;  5EOE A;  3HLF A;  2WYX A;  2ZC5 B;  4UA6 A;  4DXC A;  2XH9 A;  1TEM A;  2H5S A;  4BL3 A;  5HAQ A;  3BEC A;  2ZMA A;  1XA1 A;  1BUE A;  3IF6 C;  4IBR A;  5DF7 A;  3IH9 A;  1MWS A;  1S0W A;  4DDS A;  1XP4 A;  4GZB A;  5M1A A;  4N9K A;  1PW8 A;  1ZG4 A;  1BZA A;  3E2L A;  2QPN A;  4OLD A;  4X68 A;  4JXV A;  3V3R A;  1RGY A;  4PM7 A;  3V50 A;  4JF6 A;  1PI4 A;  4PM8 A;  3EQV A;  3HUM A;  4U0X A;  3NDE A;  2C6W B;  4QD4 A;  5AQA A;  4ZAM A;  3HLG A;  1K38 A;  5GHX A;  3FV7 A;  4RVA A;  1DJC A;  5EVL A;  1IYQ A;  2H0Y A;  1I2W A;  4C75 A;  5F1F A;  3G2Y A;  4S2N A;  1C3B A;  3UPN A;  1Q2P A;  4GNU A;  3VP0 A;  5CTN A;  4X55 A;  4S2K A;  4OPR A;  3BFD A;  4CJN A;  3UO9 A;  5EVI B;  4BLM A;  4IED A;  2EX9 A;  2WZZ A;  1JWZ A;  5DTS A;  3PAG A;  1K56 A;  1K4F A;  3AGE A;  2EX6 A;  3PBO A;  3SS4 A;  1DJB A;  5FQQ A;  3HLD A;  4FH4 A;  1XGJ A;  2OV5 A;  1O7E A;  4S2P A;  5GLA A;  4WMC D;  3G4P A;  3MFD A;  1YLZ A;  4S2O A;  1SCW A;  2J9P A;  2WK0 A;  3GTC A;  1K54 C;  3HVF A;  5GL9 A;  5CEC A;  1TDL A;  4ZTK A;  1EI5 A;  3AGD A;  3MZE A;  1ESU A;  1VQQ A;  1FR1 A;  1BT5 A;  1MWT A;  1XA7 A;  3UY6 A;  4MLL A;  5I94 A;  4ID4 A;  4OP8 A;  3DTM A;  1KE4 A;  3OPR A;  4Y0T A;  1K56 D;  2JE5 A;  3BFE A;  1ONH A;  3RJU A;  4X53 A;  1NYY A;  3Q82 A;  5TR7 A; 
#chains in the Genus database with same CATH topology
 4HY8 A;  2W3E A;  3QHY A;  1PWC A;  4KEN B;  3PR6 A;  1GHP A;  3LYX A;  4IVI A;  4XT2 B;  5MC7 A;  3CPT A;  2XEP A;  3F1O A;  5TBM B;  2XD1 A;  2EFU A;  3EEH A;  2D02 A;  2JC7 A;  3VFH A;  2IWC A;  1FIK A;  3Q1F A;  5KIZ A;  3HLB A;  1M40 A;  3GQZ A;  3ISG A;  2PRF A;  3LEQ A;  2ZLY A;  1IYO A;  3TW8 A;  1IYP A;  5CHM A;  2G2U A;  5HDC A;  4OON A;  5CGW A;  3T4O A;  3HCY A;  1L0D A;  4E3J A;  4BQM A;  4YIN A;  1L2S A;  5TGF A;  3HLW A;  2PU4 A;  4CQH A;  4HBT A;  3WS2 A;  4KZB A;  5KMW A;  4MN5 A;  3T4L A;  2MJ6 A;  4R38 A;  3IS2 A;  4JF5 A;  1IEL A;  3LID A;  4EEU A;  1BSG A;  2ZC7 A;  1LI9 A;  4F3L A;  3VE3 A;  5CGX A;  1IKI A;  3ICY A;  3R4K A;  3IS2 B;  4S2J A;  3MJQ A;  4WEK A;  2Q0O A;  1H5X A;  1T1C A;  3T12 B;  1WA9 A;  4DDY A;  1G28 A;  2HDR A;  1OPX A;  3UB5 P;  3VMA A;  4EWF A;  5E2E A;  2ZJ9 A;  3E4O A;  3MR0 A;  3T1X A;  2B02 A;  2H0T A;  2KX6 A;  3NBL A;  4X69 A;  1G68 A;  2HDU A;  3E0Y A;  5FL3 A;  1MPL A;  2Y59 A;  3OCN A;  5HW3 A;  3D72 A;  1K0K A;  1H8Y A;  2Y2G A;  1HZO A;  3IBR A;  5E43 A;  1XFQ A;  1Q2Q A;  4DE2 A;  4K0X A;  3BQ8 A;  1KGG A;  3T4S A;  1GCE A;  4MN6 A;  3LFV A;  4EQI A;  2ZC6 B;  3T1R A;  3Q7Z A;  1LSX A;  2HGV A;  3BY9 A;  2V9A A;  3IF6 A;  2EXB A;  4BD1 A;  3JYI A;  4Y5F A;  4GW9 A;  4Y17 A;  2V1B A;  1MWR A;  2L0W A;  1NZU A;  4OQH A;  1VB6 A;  2X01 A;  3IF6 B;  2J3T D;  2L1M A;  3PBS A;  3ITB A;  2R78 A;  4BD0 A;  1VHM A;  3CJM A;  4UQI S;  4CPK A;  4IVK A;  3RXW A;  2W1T B;  4RQ9 A;  4DE3 A;  2VV6 A;  2OAQ 1;  2JHE A;  1WYC A;  1W8Q A;  5CX7 A;  2Q9N A;  4GDN A;  4II7 A;  2E8I A;  2BG1 A;  5EPH A;  2W3D A;  1PW1 A;  2ZD8 A;  1YLT A;  1EW0 A;  1XJ3 A;  4IUH A;  1E3U A;  2Y2N A;  2V2F F;  2Y2P A;  3W4P A;  1HLU P;  3UB6 A;  3WS1 A;  2PR5 A;  3HBR A;  4EXO A;  4OLG A;  1DP8 A;  3H82 A;  2ZOH A;  4LPZ A;  4WMC A;  3TG9 A;  3OZH A;  3SW1 A;  3OCL A;  1E3U D;  2K31 A;  1OT9 A;  5J3W A;  2JKT I;  1N9B A;  4N1H A;  2VEA A;  3IBJ A;  4DF6 A;  5L2F A;  1N4O A;  4KZA A;  2JKR I;  2C5W B;  5J4E A;  4XUX A;  4EBN A;  1V9Y A;  3MFX A;  5I5L A;  2YKH A;  3LIB A;  3CZD A;  3W4Q A;  2WKR A;  1CEF A;  2KOI A;  3ZG5 A;  1PWG A;  4R3J A;  3V5M A;  2DRW A;  2WAE A;  2PR6 A;  1Y54 A;  3IT9 A;  4H8R A;  5F1G A;  4NET A;  4ZDX A;  5GLB A;  5FAQ A;  5HX9 A;  4QY6 A;  3HLC A;  5M18 A;  5AVE A;  3E4Q A;  5AQ7 A;  3NOT C;  2HDS A;  1JTG A;  4FTX A;  1S1Z A;  2ZL1 B;  3NCK A;  4UHU A;  1JVJ A;  5K5B A;  4DN0 A;  4O0P A;  2YKF A;  4KQD A;  4JXG A;  3IXG A;  3LIC A;  4KG2 A;  3OPP A;  1ALQ A;  1P9R A;  4KUK A;  2ZQ9 A;  4JBF A;  5EUA A;  4ETX A;  4YWZ A;  4E3N A;  2D01 A;  4NKP A;  3NIA A;  4LRX C;  2OLU A;  5IHV A;  3UE1 A;  5HWT A;  1N9N A;  3BRM A;  3UPO A;  5EOE A;  4R70 A;  2WYX A;  2ZC5 B;  4DXC A;  3NHQ A;  2H5S A;  4BL3 A;  1OTI A;  3BEC A;  1BUE A;  1S0W A;  2P08 A;  4JGR A;  4DDS A;  1ZG4 A;  2V8F A;  3V3R A;  2VZW A;  2P04 A;  2PDR A;  3JPU A;  1OTD A;  4JF6 A;  3EQV A;  3HUM A;  4U0X A;  4GS9 A;  5F1F A;  1I2W A;  4AFI A;  4GLQ A;  4OPR A;  4IED A;  4H6J B;  2B18 A;  1NRJ A;  3PBO A;  4O01 A;  4HJ4 A;  2OV5 A;  4S2P A;  5GLA A;  4GS9 B;  1SZV A;  3A0V A;  5CEC A;  2PBD P;  4NXE A;  3VV4 A;  1EI5 A;  1FIL A;  3AGD A;  1D7E A;  1FR1 A;  2HJ9 C;  1MWT A;  1XA7 A;  3UB8 A;  4MLL A;  3JVV A;  3OPR A;  4Y0T A;  5DFX A;  3RJU A;  2WKQ A;  1NJ4 A;  3GSG A;  3N8S A;  4HI4 A;  5GHY A;  1KE3 A;  2ZC3 B;  4R0Q A;  2VK3 A;  3FPV A;  4HEF A;  5A92 A;  3KYE A;  3CHW P;  4EET B;  1S6R A;  2ZMV A;  1FR6 A;  1YLY A;  1YLW A;  4JPM A;  4ZJ3 A;  3IX4 A;  5F69 A;  4LV2 A;  5EVE A;  1S4R A;  1YMS A;  2J3W A;  3GDI A;  4L9E A;  4OP5 A;  4PM6 A;  4DKI A;  2OSU A;  5FQ9 A;  1OT6 A;  1OTB A;  3C5A A;  4JGP A;  4KZ9 A;  1ES3 A;  4GCZ A;  2HZ5 A;  4PKY A;  3OLO A;  2J7V A;  2NUP C;  3FZC A;  1E4D A;  3N8R A;  5LBR A;  1YSP A;  3MXR A;  4F94 A;  3TSG A;  1S67 L;  4NG2 A;  4BBU A;  1XJ4 A;  1X0O A;  5A90 A;  4OOY A;  2V1Z A;  2HDQ A;  4HBU A;  2XR0 A;  1O07 A;  4R1G A;  3LO7 A;  5F6A A;  2M1C A;  4OPY A;  5HAI A;  2QYB A;  3A3F A;  2WUQ A;  1SKO B;  1NZO A;  3ZG9 B;  3PAE A;  5U47 A;  5EVI A;  3ZVT A;  3UDF A;  4DMZ A;  4S2M A;  3AGF A;  3UPP A;  5F68 A;  3FWL A;  2VV8 A;  2GX5 A;  2JKF A;  2XF3 A;  4WYY A;  5DKL A;  3ZNT A;  4LV3 A;  2XRN A;  4YOF A;  4EQ1 A;  4DRT A;  1U60 A;  1XGI A;  3SZT A;  1K55 A;  3L9K A;  2O99 A;  2IWB A;  2FFY A;  2G7U A;  3MMH A;  4HES A;  4K08 A;  2ZQ8 A;  3O86 A;  1YLJ A;  3KO6 A;  5EVI D;  1S1Y A;  3G2Z A;  3IH8 A;  1ONG A;  2PHY A;  3IWQ A;  4JXS A;  3EEA A;  3VSK A;  1DP6 A;  2RL3 A;  2PBY A;  3QP4 A;  2XFS A;  1FCM A;  2WKI A;  3BYD A;  4IHQ A;  4R3A A;  3E98 A;  2B5R A;  3ZYT A;  1GA9 A;  3BFG A;  3A3J A;  5TBM A;  2G2W A;  5KSH A;  4WUJ A;  3KSF A;  1MY8 A;  3HRE A;  2KDK A;  2CC1 A;  3B3X A;  2HPB A;  3GEC A;  1F98 A;  5G18 A;  1SDE A;  1YSQ A;  1LLB A;  1XJ6 A;  3C8C A;  3S7O A;  4GD8 A;  4S2N C;  4ARZ A;  4BMW A;  1GA0 A;  3CAX A;  2LB9 A;  5HDS A;  1LL5 A;  4E04 A;  1MXO A;  2ZM0 A;  4KQQ A;  2VGK A;  2VGL M;  3PTE A;  2UWX A;  3B33 A;  4ARZ B;  4MDZ A;  1PNE A;  1ODV A;  3EGD C;  1LT0 A;  5AVF A;  1NRF A;  1I2S A;  2Y91 A;  2W1R A;  1YT4 A;  2FH5 A;  2Y2K A;  4XXR A;  3OPL A;  3N8L A;  4DJ2 A;  2PT7 A;  5EE8 A;  4JKT A;  4LLO B;  1P97 A;  2IA2 A;  3ZQ5 A;  2OAP 1;  3IX8 A;  1S66 L;  2ZC4 B;  4LGW A;  2WKP A;  3A3I A;  4OQI A;  4O8G A;  1K54 A;  2CMN A;  3H7W A;  4KZ7 A;  5CGS A;  5HWW A;  2WAF A;  5FDS A;  4M3K A;  1P0Z A;  4GJ4 A;  4K91 A;  4KZ5 A;  4OPZ A;  1PFL A;  3NC8 A;  4DXB A;  4U3T A;  2J3T C;  3H7W B;  5HL6 A;  1RGZ A;  3C4P A;  4QY5 A;  1H8M A;  1PIO A;  1QME A;  3CUE C;  4QB8 A;  1F2K A;  4P0M A;  2EXA A;  4UAA A;  5FQK A;  1BTL A;  4MEZ A;  3VOY A;  1XFN A;  1UGU A;  2PYP A;  3V67 A;  2HP9 A;  3WWX A;  3DW0 A;  4E3M A;  5JYO A;  1DP9 A;  1NYM A;  3UMD A;  4E3O A;  1BYW A;  3BQA A;  3C2W A;  1FSW A;  5HL1 A;  3BW6 A;  2EFX A;  3UB9 A;  5AQB A;  4LCL A;  2V8C A;  5HAP A;  4I3J A;  3LUQ A;  3N6I A;  4UEY A;  3S22 A;  4R4S A;  1KOU A;  5KSC A;  3P01 A;  1ZTU A;  2ZQA A;  3C38 A;  4CLC C;  1PYY A;  3LIF A;  4FH2 A;  1L3L A;  2JCH A;  5EFW A;  2PYR A;  4I3I A;  4IBX A;  2W1T A;  4ZJ2 A;  1TS0 A;  2WAD A;  5FAO A;  4ZRR A;  3T4Q A;  2VKS A;  1DJA A;  5L8M A;  2JKT M;  2DCF A;  5CRF A;  4X1L A;  2JKR M;  2XGN A;  2EX8 A;  2V0U A;  3ZHH A;  3MS6 A;  2A3U A;  1FQG A;  3HLF A;  2PAV P;  1H3Q A;  2HJE A;  1S4S A;  2HV1 A;  1MWS A;  5M1A A;  4OLD A;  4Y2F A;  3EGX C;  4QWO A;  3DAV A;  3K3D A;  4PM7 A;  3VOL A;  3V50 A;  1PI4 A;  2W3H A;  4CLC E;  3HLG A;  3FV7 A;  1OJ5 A;  3KSG A;  3T4K A;  2QJ5 A;  3BFD A;  2OOL A;  3UO9 A;  4BLM A;  5DTS A;  4ME4 A;  1K4F A;  3A0R A;  3SS4 A;  1DJB A;  4BBV A;  3HLD A;  4WMC D;  3MFD A;  1YLZ A;  1SCW A;  3GTC A;  3HVF A;  1TDL A;  1BT5 A;  3TRC A;  3UY6 A;  1KE4 A;  2ZL1 A;  1MC0 A;  4CLC B;  5TR7 A;  3UNW A;  1RCJ A;  5L09 A;  3MQQ A;  3LGO A;  1NXY A;  3R7W B;  5L10 A;  1G6A A;  1ERO A;  4MBH A;  3C7V A;  3IXB A;  5FI7 A;  3BLM A;  3KYZ A;  5G4Y A;  4Q0I A;  2XLN A;  1K57 C;  1CF0 A;  2ZQC A;  3M2J A;  5CHU A;  1XX2 A;  3UN7 A;  5CEB A;  2HF6 A;  2Y79 A;  1YMX A;  4B9O A;  1GSX A;  4P6Z M;  2V1A A;  1DY6 A;  2WGI A;  3U4L P;  2BLS A;  1JWP A;  3S7Q A;  1KGF A;  3MBZ A;  3CG5 A;  3QP2 A;  2JN7 A;  4LFU A;  3MQ0 A;  2WKE A;  2DNS A;  3QP5 A;  3HUN A;  1IOU A;  3IF5 A;  4ZBE A;  4K0W A;  1SHV A;  2W3F A;  4U0T A;  3Q7V A;  2Y2H A;  1ZG6 A;  2ZBB A;  3KX0 X;  1K6R A;  3G32 A;  3PBT A;  4EER A;  2WZX A;  2OWH A;  2QHK A;  5JYP A;  4OOL A;  3HJI A;  3M2K A;  3O3V A;  4B4X A;  4WZ5 C;  3MXQ A;  1PZO A;  3Q7V B;  4G3K A;  5CXW A;  4H6J A;  1OME A;  1OTE A;  1T18 A;  3NOU C;  2Y55 A;  3P7N A;  1L0F A;  3QP8 A;  2XD5 A;  4FSF A;  2A24 B;  3EQU A;  5HD3 A;  2ZQ7 A;  1CEG A;  4P85 A;  1W63 Q;  3IXH A;  1K57 A;  4Y0O A;  4HJ6 A;  4FD8 A;  1TVF A;  5HPF A;  1ESI A;  3V3S A;  2WGW B;  3BM6 A;  4WL9 A;  2VGJ A;  1W63 M;  3PBQ A;  2EWV A;  2XDM A;  1ZHH B;  5FQI A;  3OOV A;  3IHA A;  4HIA A;  4EES A;  4C3Q A;  2WGV A;  3MKE A;  3SH7 A;  1H0M A;  4X25 A;  3VP1 A;  1EWZ A;  3UE0 A;  4EEP A;  5DTK A;  4Y0U A;  3D9Y A;  4RX3 A;  1V9Z A;  5HFO A;  3WS4 A;  1Z09 A;  3V39 A;  5FEG A;  4EUV A;  3PXP A;  3OPH A;  2PU2 A;  1KVM A;  2EWW A;  1GSV A;  5DKK A;  5HDD A;  2P7J A;  1G6O A;  1K6S A;  4B93 A;  1PI5 A;  2XQZ A;  3VE4 A;  2H28 A;  1K4E A;  4IJG A;  1LSW A;  2B95 A;  4RX2 A;  1HTZ A;  4EV4 A;  3S1Y A;  1D06 A;  3M6B A;  1PWD A;  1BUL A;  4KZ6 A;  3P09 A;  4WEJ A;  3MZD A;  3BY8 A;  1YKD A;  1MBL A;  1QMF A;  3MF0 A;  4EU0 A;  1SKO A;  2AVX A;  4Q0H A;  3NI9 A;  1L0G A;  3F1N B;  5F83 A;  1DRM A;  4LEN A;  3NDG A;  4X56 A;  4R4R A;  5FAT A;  1HD8 A;  4OVD A;  3BFF A;  1N9L A;  2VLG A;  4OOM A;  4E6W A;  3SS5 A;  4RA7 A;  1JTD A;  4HOI A;  4JXW A;  3SH8 A;  1JWV A;  1IFQ A;  3H9W A;  3QP6 A;  3W4O A;  1A0K A;  2A2L A;  3VSL A;  3PYP A;  4Y3I A;  3CI6 A;  3LR5 A;  5L07 A;  3ZDJ A;  5IT5 A;  2Y2M A;  3D3O A;  2HP5 A;  2JBF A;  1IEM A;  1VET A;  2J8Y A;  1CJF A;  2LB5 A;  3L7H A;  2J80 A;  2X02 A;  3G34 A;  1UWN X;  5DFY A;  2O9C A;  1FCO A;  2OLV A;  2RCX A;  1XPB A;  4QJG A;  1XKZ A;  1L0E A;  5TFQ A;  3A3E A;  5FAP A;  1VET B;  2E8J A;  3LR3 A;  3UME A;  1YQS A;  4WZ4 A;  5IS1 A;  2VJW A;  4R3B A;  4G3V A;  4ZJ1 A;  3I7J A;  5DVA A;  3HL9 A;  5HSQ A;  5FA7 A;  3OC2 A;  3SOI A;  4NXB A;  5FAS A;  1TS6 A;  3E2K A;  5C5K A;  2QZ6 A;  3WS0 A;  3TOI A;  5HWV A;  3LR0 A;  2PD7 A;  1NY0 A;  2Z6C A;  4HNB A;  3T1Q B;  4HJ3 A;  1FCN A;  3KSH A;  5J7E A;  1J3W A;  1E25 A;  4B88 A;  1RP5 A;  3LI9 A;  1IKG A;  2X71 A;  3IWO A;  1AWI A;  3FYZ A;  1KGE A;  4OKP A;  4I38 A;  4DE1 A;  3G35 A;  4NK3 A;  4L9G A;  4YFM A;  3BEB A;  3IQA A;  2FFF B;  3UE3 A;  1JNU A;  4A5R A;  3ZCZ A;  1BLP A;  5E2G A;  2QWS A;  2ZM8 A;  4KG5 A;  3A0S A;  5EV0 A;  1IYS A;  3LY3 A;  3GV9 A;  4EBP A;  4QHC A;  3VP3 A;  4GOG A;  4EUZ A;  3S4X A;  3K3C A;  1LHY A;  4MBK A;  3BLS A;  3CPT B;  1LL8 A;  3F1O B;  3IHB A;  3MZF A;  3T50 A;  4C6Y A;  1W79 A;  3ITA A;  5EM1 A;  1ES4 A;  4GD6 A;  4S2I A;  5HAR A;  3RH8 B;  4KZ8 A;  3LR4 A;  4BL2 A;  2Y4A A;  3T4J A;  4P6Z S;  1T1B A;  2Y2L A;  5FI2 A;  3LY4 A;  2K2N A;  1WE4 A;  2K7S A;  3QNC A;  4RYE A;  5EEC A;  4OQ0 A;  4JLF A;  2QMI A;  3MSH A;  3WRZ A;  4MCW A;  4WM9 A;  1STZ A;  4P6B A;  1LI0 A;  1TS8 A;  4UA6 A;  2BTF P;  1TEM A;  5HAQ A;  2ZMA A;  4FUW A;  3IF6 C;  4IBR A;  5DF7 A;  3IH9 A;  2PD8 A;  4GZB A;  3E2L A;  4I5S A;  1G5U A;  4PM8 A;  2NUT C;  4ZAM A;  2EA9 A;  3BWL A;  4QD4 A;  5AQA A;  5GHX A;  5EVL A;  1DJC A;  2L4R A;  4GHI A;  4C75 A;  1T19 A;  4S2N A;  3UPN A;  4GNU A;  3VP0 A;  5CTN A;  4F3L B;  4S2K A;  4L9F A;  4CJN A;  3RFB A;  2EX9 A;  1PRQ A;  2M7U A;  1CQA A;  3AGE A;  3NUL A;  4FH4 A;  1O7E A;  1MKM A;  3G4P A;  4S2O A;  2J9P A;  4GHI B;  1TD5 A;  3W2Z A;  5HD5 A;  3MZE A;  1VQQ A;  3DTK A;  4ID4 A;  2OWJ A;  2XA7 M;  3BFE A;  4X53 A;  1NYY A;  3Q82 A;  2W3G A;  2BAS A;  4D60 A;  3LCE A;  5DTT A;  4LRZ E;  3A3D A;  1YPR A;  4FOF A;  3DWZ A;  2V20 A;  2XFT A;  4N1X A;  4JF4 A;  4R23 A;  4QPR A;  2XK1 A;  5AJG A;  4JGO A;  4YNR A;  2IWD A;  3CMZ A;  4R6L A;  1I5Q A;  4PM5 A;  1M6K A;  5CED A;  4B4Z A;  1MKI A;  1LSV A;  2I72 A;  4KZ4 A;  5DJU A;  1H8Z A;  3C7U A;  2ZM2 A;  4IUK A;  3CUE A;  3ZG8 B;  1SDN A;  5AQ9 A;  3VFF A;  3KSI A;  4GDB A;  4HQA A;  4E3L A;  5G4Z A;  2ZOI A;  5A91 A;  3N7W A;  1XJ2 A;  3B47 A;  3IWI A;  4E6X A;  3ULF A;  3WS5 A;  2WKH A;  3QP1 A;  1J9M A;  3NJA A;  1CI9 A;  4MNR A;  1T1A A;  5E2H A;  1WYB A;  4LV1 A;  4X1M A;  3T1S A;  4D2O A;  3FKV A;  1ES5 A;  4PM9 A;  2XRO A;  5IU1 A;  1P9W A;  2ZMF A;  2VX8 A;  4G3W A;  1GSW A;  1VM1 A;  2Q9M A;  3C4O A;  3W8K A;  3CLO A;  1UWP X;  5DJT A;  2GZA A;  3M6H A;  3UDX A;  1W7F A;  5BOH A;  4UA7 A;  1TDG A;  4MN7 A;  5E2F A;  5FDH A;  1YAX A;  2Z2M B;  4Y13 A;  4Q8I A;  3LI8 A;  5EOO A;  2JKG A;  1F5M A;  4CLC A;  4WF0 A;  1HVB A;  4PPR A;  1ERM A;  3R7W A;  3IX3 A;  2EX2 A;  4MMN A;  3IXD A;  1FOF A;  1BLS A;  3LIA A;  3SS3 A;  4DJ3 A;  3H82 B;  1ERQ A;  4WBG A;  4GKU A;  2M7V A;  4NEE D;  4CLC D;  1Y4O A;  1MWU A;  3UE6 A;  2W27 A;  3CWF A;  3MKF A;  1ES2 A;  3HUO A;  5F5Y A;  2A49 A;  5HPI A;  4DE0 A;  3RTY A;  1NWZ A;  1GHM A;  3T4T A;  4P87 A;  4HHD A;  4KG6 A;  3S7P A;  4Y15 A;  2R9W A;  1ZKJ A;  3BFC A;  5KZH A;  3ZGA B;  5CTM A;  4L0L A;  3NY4 A;  1F9I A;  3RXX A;  3F1P A;  3ZVW A;  5FEF A;  3TJZ C;  3U2A A;  4LCM A;  1KDW A;  3P98 A;  1ZC2 A;  4N92 A;  3TE8 A;  1OJG A;  2Z6D A;  5A93 A;  3PBN A;  5FQM A;  2VGL S;  1W8Y A;  4KZ3 A;  4KQR A;  1Y28 A;  3N4I A;  3C30 A;  1NLY A;  4WLA A;  4O7D A;  1W5D A;  3F1P B;  1NLZ A;  1LL9 A;  4S2L A;  4MBF A;  4BJP A;  3HJK A;  1PZP A;  3WRT A;  4XUZ A;  3VP4 A;  4QU3 A;  3FPW A;  3OBF A;  5GLD A;  1YLP A;  3NOP C;  4LV0 A;  2Z2L B;  3O87 A;  1Z6F A;  3G6O A;  1XXM A;  2Y2Q A;  3GVB A;  4I3A A;  2KLI A;  3DTI A;  2A24 A;  3CIT A;  3FC7 A;  5GLC A;  4KQO A;  3G30 A;  4JGQ A;  2Y2O A;  3ZG7 B;  5CHJ A;  3UDI A;  5DF8 A;  3FG8 A;  2R9X A;  1FSY A;  2GDN A;  3VOZ A;  1K25 A;  2ZQD A;  3DTE A;  3Q81 A;  2I9V A;  4GN2 A;  3ZG0 A;  2P74 A;  5DF9 A;  1KE0 A;  2WGW A;  2P9V A;  1SKF A;  3DWK A;  1OTA A;  4PAU A;  4Z9Q A;  1MZU A;  5FQJ A;  2O9A A;  2INW A;  4E3K A;  1GHI A;  2Y2J A;  4E3I A;  4OQG A;  2P9V B;  1KVL A;  5FSR A;  5M19 A;  3GMW A;  3LEZ A;  2J9O A;  4OPQ A;  1AXB A;  4WEL A;  2XSS A;  3ZFZ A;  4PMA A;  4HH2 A;  2VV7 A;  3PHY A;  5EVI C;  4NXG A;  4Q0J A;  4BWI A;  4NXF A;  3S7N A;  4OH0 A;  3Q07 A;  2VA0 A;  2FZ0 A;  1CK3 A;  3DBA A;  3E4P A;  2XA7 S;  1K55 C;  1BLC A;  5CER A;  3ZNY A;  1YM1 A;  4Z1W A;  3MXS A;  1ACF A;  4KUO A;  4WZ5 A;  4Y7P A;  2HP6 A;  1CI8 A;  4FCF A;  4I39 A;  2V0W A;  4HH3 A;  2DMW A;  3F1N A;  5FI6 A;  3EOI A;  3G31 A;  4BEN A;  4GB7 A;  3O5Y A;  2O9B A;  3GRJ A;  4UA9 A;  3QNB A;  4N9L A;  1N9O A;  3UB7 A;  5D3O A;  3D4F A;  4UQI M;  4BBT A;  3PBR A;  5J8X A;  2H10 A;  2GJ3 A;  4ETZ A;  1BLH A;  3FKW A;  5HZH A;  3EWK A;  3GR2 A;  3O88 A;  4EW7 A;  2ACG A;  4X6T A;  5F82 A;  4PHT A;  2Y2I A;  1TS7 A;  3VP2 A;  5A8B A;  4EBL A;  3JVU A;  3LIE A;  4PKY G;  1KDS A;  1VEU A;  4M4X A;  5GHZ A;  3HLE A;  4ESP A;  2QKP A;  4HP9 A;  4LRY C;  4HP4 A;  2XH9 A;  1XA1 A;  1VEU B;  2O0Y A;  1XP4 A;  5TJJ A;  2UV0 E;  4N9K A;  1PW8 A;  1BZA A;  2QPN A;  4X68 A;  3MQO A;  4JXV A;  3NEC A;  1RGY A;  2Y8H A;  3NDE A;  2C6W B;  1K38 A;  5EM0 A;  4RVA A;  1IYQ A;  2H0Y A;  3G2Y A;  4WN5 A;  1C3B A;  1Q2P A;  3BJN A;  3KYQ A;  4X55 A;  5EVI B;  2WZZ A;  2QJ7 A;  1JWZ A;  3PAG A;  1K56 A;  2EX6 A;  5FQQ A;  3K2N A;  1XGJ A;  2GNX A;  1TF1 A;  2WK0 A;  1K54 C;  5GL9 A;  4ZTK A;  1ESU A;  4XT2 A;  5I94 A;  1D1J A;  3B42 A;  4OP8 A;  3DTM A;  1K56 D;  2JE5 A;  2W0N A;  1ONH A;  3SH9 A; 
#chains in the Genus database with same CATH homology
 1NJ4 A;  3GSG A;  3UNW A;  1RCJ A;  3QHY A;  1PWC A;  3N8S A;  4KEN B;  3LCE A;  1NXY A;  1G6A A;  1ERO A;  5DTT A;  1GHP A;  4IVI A;  4MBH A;  3C7V A;  5GHY A;  3IXB A;  3A3D A;  2XEP A;  5FI7 A;  1KE3 A;  3BLM A;  3DWZ A;  2XD1 A;  2ZC3 B;  2V20 A;  2XFT A;  4R0Q A;  4N1X A;  4JF4 A;  2XLN A;  4R23 A;  2EFU A;  4HEF A;  5A92 A;  1K57 C;  2JC7 A;  2ZQC A;  3VFH A;  2XK1 A;  1S6R A;  2IWC A;  1FR6 A;  3Q1F A;  1YLY A;  1YLW A;  3HLB A;  4JPM A;  3M2J A;  5CHU A;  4ZJ3 A;  4LV2 A;  1M40 A;  1XX2 A;  3GQZ A;  3ISG A;  3UN7 A;  2ZLY A;  1IYO A;  5CEB A;  2IWD A;  3CMZ A;  1YMS A;  4PM6 A;  1I5Q A;  4OP5 A;  4DKI A;  4PM5 A;  1YMX A;  2OSU A;  5FQ9 A;  1M6K A;  1IYP A;  5CED A;  5CHM A;  4B4Z A;  1MKI A;  2I72 A;  3C5A A;  4KZ4 A;  2G2U A;  4KZ9 A;  1H8Z A;  3C7U A;  2ZM2 A;  1ES3 A;  4OON A;  1DY6 A;  2WGI A;  5CGW A;  3ZG8 B;  1SDN A;  1JWP A;  2BLS A;  5AQ9 A;  1KGF A;  3MBZ A;  3CG5 A;  3VFF A;  1L0D A;  4GDB A;  2J7V A;  3SH9 A;  4YIN A;  4BQM A;  4E3J A;  4E3L A;  1L2S A;  2WKE A;  5TGF A;  3FZC A;  1E4D A;  2DNS A;  3N8R A;  5A91 A;  3HLW A;  3HUN A;  3N7W A;  3IF5 A;  3MXR A;  4F94 A;  2PU4 A;  3IWI A;  4ZBE A;  3TSG A;  4HBT A;  1SHV A;  4K0W A;  4E6X A;  3WS5 A;  4U0T A;  2WKH A;  3WS2 A;  3Q7V A;  1J9M A;  4KZB A;  2Y2H A;  1CI9 A;  4MNR A;  5KMW A;  5A90 A;  4OOY A;  2V1Z A;  1ZG6 A;  2HDQ A;  4HBU A;  1K6R A;  3G32 A;  5E2H A;  2XR0 A;  3PBT A;  1O07 A;  4JF5 A;  2WZX A;  1IEL A;  1WYB A;  4R1G A;  4LV1 A;  5JYP A;  3LO7 A;  4OOL A;  1BSG A;  3M2K A;  4OPY A;  3O3V A;  5HAI A;  2ZC7 A;  4B4X A;  4WZ5 C;  1LI9 A;  3A3F A;  4D2O A;  1PZO A;  3FKV A;  1ES5 A;  2WUQ A;  1NZO A;  4PM9 A;  3Q7V B;  3ZG9 B;  3PAE A;  5CXW A;  5U47 A;  5CGX A;  1IKI A;  5EVI A;  3ZVT A;  3UDF A;  1VM1 A;  1OME A;  2Q9M A;  3C4O A;  3W8K A;  4S2M A;  4S2J A;  3AGF A;  3UPP A;  2Y55 A;  3FWL A;  3M6H A;  4WEK A;  2XF3 A;  4WYY A;  3UDX A;  3ZNT A;  1W7F A;  5BOH A;  1L0F A;  4LV3 A;  4UA7 A;  1TDG A;  1H5X A;  4DRT A;  1U60 A;  1XGI A;  2XD5 A;  4FSF A;  1K55 A;  2IWB A;  2FFY A;  4HES A;  5E2F A;  3EQU A;  2ZQ8 A;  3O86 A;  4DDY A;  1YLJ A;  5FDH A;  2ZQ7 A;  1CEG A;  5EVI D;  2HDR A;  2Z2M B;  4P85 A;  3G2Z A;  3IH8 A;  1ONG A;  4JXS A;  3IWQ A;  4Q8I A;  3VSK A;  3VMA A;  3IXH A;  1K57 A;  4Y0O A;  5EOO A;  2RL3 A;  1HVB A;  2PBY A;  4PPR A;  4EWF A;  1ERM A;  2XFS A;  1TVF A;  4FD8 A;  5E2E A;  2ZJ9 A;  1ESI A;  1FCM A;  3V3S A;  2WKI A;  3BYD A;  2WGW B;  3BM6 A;  2VGJ A;  2EX2 A;  3IXD A;  1FOF A;  1BLS A;  3PBQ A;  2B5R A;  1GA9 A;  2H0T A;  3BFG A;  3A3J A;  2XDM A;  2G2W A;  5FQI A;  5KSH A;  3SS3 A;  1MY8 A;  3HRE A;  3NBL A;  4X69 A;  1ERQ A;  4WBG A;  4GKU A;  3IHA A;  1G68 A;  4C3Q A;  2HDU A;  2WGV A;  1MPL A;  2CC1 A;  3MKE A;  1MWU A;  3SH7 A;  2Y59 A;  3B3X A;  2HPB A;  3VP1 A;  3MKF A;  1EWZ A;  1ES2 A;  3HUO A;  3OCN A;  3UE0 A;  2A49 A;  5HW3 A;  5DTK A;  4DE0 A;  1H8Y A;  4Y0U A;  4RX3 A;  5G18 A;  5HFO A;  3WS4 A;  2Y2G A;  1HZO A;  1SDE A;  1GHM A;  5E43 A;  3V39 A;  3OPH A;  1Q2Q A;  4DE2 A;  4P87 A;  2PU2 A;  1LLB A;  1KVM A;  4K0X A;  1KGG A;  4KG6 A;  1GCE A;  2R9W A;  4GD8 A;  1ZKJ A;  4EQI A;  4S2N C;  3BFC A;  2ZC6 B;  1GA0 A;  5KZH A;  3ZGA B;  5CTM A;  1K6S A;  4L0L A;  3NY4 A;  3Q7Z A;  3RXX A;  1LL5 A;  1PI5 A;  2XQZ A;  1MXO A;  2ZM0 A;  4KQQ A;  3ZVW A;  3IF6 A;  2EXB A;  2VGK A;  1K4E A;  4BD1 A;  3JYI A;  3PTE A;  4LCM A;  1KDW A;  3P98 A;  2UWX A;  1ZC2 A;  4RX2 A;  4N92 A;  1HTZ A;  4EV4 A;  5A93 A;  3PBN A;  5FQM A;  1W8Y A;  4KZ3 A;  1MWR A;  4KQR A;  3N4I A;  3S1Y A;  3M6B A;  1BUL A;  1NZU A;  1PWD A;  1W5D A;  4O7D A;  4KZ6 A;  4OQH A;  1LL9 A;  4S2L A;  1NRF A;  3P09 A;  4MBF A;  3MZD A;  1I2S A;  4WEJ A;  2X01 A;  1PZP A;  3IF6 B;  3WRT A;  4XUZ A;  2Y91 A;  3PBS A;  3ITB A;  1MBL A;  1QMF A;  1YT4 A;  3VP4 A;  4BD0 A;  2Y2K A;  4XXR A;  3OPL A;  3N8L A;  4QU3 A;  5EE8 A;  3NI9 A;  5GLD A;  4JKT A;  1YLP A;  1L0G A;  5F83 A;  3CJM A;  4LV0 A;  4CPK A;  2Z2L B;  4IVK A;  4LEN A;  3NDG A;  4X56 A;  2ZC4 B;  3O87 A;  1Z6F A;  4R4R A;  5FAT A;  3RXW A;  1HD8 A;  3A3I A;  4OQI A;  1XXM A;  2Y2Q A;  3BFF A;  3GVB A;  4OVD A;  1K54 A;  4DE3 A;  4KZ7 A;  4OOM A;  4E6W A;  5CGS A;  1WYC A;  1W8Q A;  3SS5 A;  2WAF A;  2Q9N A;  4GDN A;  4RA7 A;  1JTD A;  2E8I A;  5GLC A;  4KQO A;  3G30 A;  4JXW A;  3SH8 A;  2Y2O A;  4M3K A;  1JWV A;  2BG1 A;  3ZG7 B;  4K91 A;  5EPH A;  4KZ5 A;  4OPZ A;  5CHJ A;  3UDI A;  1PW1 A;  2ZD8 A;  5DF8 A;  3W4O A;  2R9X A;  1FSY A;  3NC8 A;  2GDN A;  1YLT A;  4DXB A;  4U3T A;  3VOZ A;  1K25 A;  3VSL A;  2ZQD A;  3Q81 A;  3ZDJ A;  4GN2 A;  1E3U A;  2Y2M A;  1RGZ A;  2HP5 A;  1KE0 A;  2JBF A;  2P74 A;  2V2F F;  1IEM A;  2Y2N A;  2Y2P A;  5DF9 A;  3C4P A;  2WGW A;  2J8Y A;  4QY5 A;  2P9V A;  1SKF A;  3W4P A;  1PIO A;  3DWK A;  2X02 A;  3G34 A;  1QME A;  4Z9Q A;  4QB8 A;  1FCO A;  3WS1 A;  5FQJ A;  3HBR A;  2OLV A;  4OLG A;  4P0M A;  2RCX A;  2EXA A;  1XPB A;  4QJG A;  4UAA A;  1XKZ A;  5FQK A;  4WMC A;  1BTL A;  3TG9 A;  4MEZ A;  3VOY A;  1L0E A;  4E3K A;  3OZH A;  1GHI A;  5TFQ A;  2Y2J A;  3A3E A;  3OCL A;  5FAP A;  4E3I A;  1E3U D;  4OQG A;  1YQS A;  2P9V B;  1KVL A;  4WZ4 A;  5FSR A;  2HP9 A;  1N9B A;  3WWX A;  3DW0 A;  4R3B A;  5M19 A;  3GMW A;  4N1H A;  4ZJ1 A;  4DF6 A;  3I7J A;  5DVA A;  5L2F A;  4E3M A;  3HL9 A;  1N4O A;  4KZA A;  5JYO A;  5FA7 A;  2C5W B;  3OC2 A;  3SOI A;  1NYM A;  3LEZ A;  2J9O A;  4OPQ A;  5FAS A;  4XUX A;  3E2K A;  1AXB A;  4EBN A;  4WEL A;  4E3O A;  2QZ6 A;  3ZFZ A;  3WS0 A;  3TOI A;  4PMA A;  3CZD A;  1NY0 A;  1FSW A;  3W4Q A;  5HL1 A;  1CEF A;  1FCN A;  5EVI C;  1E25 A;  4B88 A;  1RP5 A;  2EFX A;  3ZG5 A;  1PWG A;  4R3J A;  3V5M A;  4OH0 A;  2DRW A;  2WAE A;  3Q07 A;  4H8R A;  1IKG A;  1Y54 A;  3IT9 A;  2X71 A;  3IWO A;  5F1G A;  3FYZ A;  4OKP A;  1KGE A;  4NET A;  4ZDX A;  5GLB A;  5FAQ A;  5HX9 A;  4DE1 A;  5AQB A;  4QY6 A;  3G35 A;  4NK3 A;  1CK3 A;  4BJP A;  4LCL A;  3HLC A;  5HAP A;  5M18 A;  1K55 C;  4YFM A;  5AQ7 A;  3BEB A;  3N6I A;  1BLC A;  3IQA A;  5CER A;  3S22 A;  2FFF B;  2HDS A;  3UE3 A;  1JTG A;  3ZNY A;  1YM1 A;  4A5R A;  4R4S A;  5KSC A;  3ZG0 A;  3MXS A;  3NCK A;  4UHU A;  3ZCZ A;  1BLP A;  1JVJ A;  4WZ5 A;  4Y7P A;  2HP6 A;  5E2G A;  1CI8 A;  4FCF A;  2ZM8 A;  2ZQA A;  4KG5 A;  1PYY A;  1IYS A;  3LY3 A;  4FH2 A;  3GV9 A;  5FI6 A;  4EBP A;  4QHC A;  3G31 A;  3VP3 A;  4BEN A;  4GOG A;  4GB7 A;  4EUZ A;  2JCH A;  3S4X A;  1LHY A;  4JXG A;  3IXG A;  3GRJ A;  3BLS A;  4MBK A;  4IBX A;  4UA9 A;  3QNB A;  3IHB A;  4KG2 A;  4N9L A;  4ZJ2 A;  5D3O A;  3OPP A;  1ALQ A;  3D4F A;  3MZF A;  3PBR A;  5J8X A;  2H10 A;  4C6Y A;  1W79 A;  3ITA A;  2ZQ9 A;  1ES4 A;  1BLH A;  4JBF A;  3FKW A;  4GD6 A;  5EUA A;  4S2I A;  3GR2 A;  5HAR A;  2WAD A;  3O88 A;  4KZ8 A;  4E3N A;  4X6T A;  2Y4A A;  5F82 A;  5FAO A;  4BL2 A;  2Y2I A;  3VP2 A;  3NIA A;  2Y2L A;  5FI2 A;  1DJA A;  3LY4 A;  2OLU A;  4EBL A;  1WE4 A;  2DCF A;  5CRF A;  3QNC A;  4RYE A;  5IHV A;  5EEC A;  1KDS A;  4OQ0 A;  4JLF A;  2QMI A;  3UE1 A;  5GHZ A;  3HLE A;  3WRZ A;  2XGN A;  4WM9 A;  2EX8 A;  4P6B A;  3ZHH A;  1LI0 A;  3BRM A;  2A3U A;  1FQG A;  3UPO A;  5EOE A;  3HLF A;  2WYX A;  2ZC5 B;  4UA6 A;  4DXC A;  2XH9 A;  1TEM A;  2H5S A;  4BL3 A;  5HAQ A;  3BEC A;  2ZMA A;  1XA1 A;  1BUE A;  3IF6 C;  4IBR A;  5DF7 A;  3IH9 A;  1MWS A;  1S0W A;  4DDS A;  1XP4 A;  4GZB A;  5M1A A;  4N9K A;  1PW8 A;  1ZG4 A;  1BZA A;  3E2L A;  2QPN A;  4OLD A;  4X68 A;  4JXV A;  3V3R A;  1RGY A;  4PM7 A;  3V50 A;  4JF6 A;  1PI4 A;  4PM8 A;  3EQV A;  3HUM A;  4U0X A;  3NDE A;  2C6W B;  4QD4 A;  5AQA A;  4ZAM A;  3HLG A;  1K38 A;  5GHX A;  3FV7 A;  4RVA A;  1DJC A;  5EVL A;  1IYQ A;  2H0Y A;  1I2W A;  4C75 A;  5F1F A;  3G2Y A;  4S2N A;  1C3B A;  3UPN A;  1Q2P A;  4GNU A;  3VP0 A;  5CTN A;  4X55 A;  4S2K A;  4OPR A;  3BFD A;  4CJN A;  3UO9 A;  5EVI B;  4BLM A;  4IED A;  2EX9 A;  2WZZ A;  1JWZ A;  5DTS A;  3PAG A;  1K56 A;  1K4F A;  3AGE A;  2EX6 A;  3PBO A;  3SS4 A;  1DJB A;  5FQQ A;  3HLD A;  4FH4 A;  1XGJ A;  2OV5 A;  1O7E A;  4S2P A;  5GLA A;  4WMC D;  3G4P A;  3MFD A;  1YLZ A;  4S2O A;  1SCW A;  2J9P A;  2WK0 A;  3GTC A;  1K54 C;  3HVF A;  5GL9 A;  5CEC A;  1TDL A;  4ZTK A;  1EI5 A;  3AGD A;  3MZE A;  1ESU A;  1VQQ A;  1FR1 A;  1BT5 A;  1MWT A;  1XA7 A;  3UY6 A;  4MLL A;  5I94 A;  4ID4 A;  4OP8 A;  3DTM A;  1KE4 A;  3OPR A;  4Y0T A;  1K56 D;  2JE5 A;  3BFE A;  1ONH A;  3RJU A;  4X53 A;  1NYY A;  3Q82 A;  5TR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...