4H6JA

Identification of cys 255 in hif-1 as a novel site for development of covalent inhibitors of hif-1 /arnt pasb domain protein-protein interaction.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
DSKTFLSEHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords HYPOXIA INDUCIBLE FACTOR 1-ALPHA
publication title Identification of Cys255 in HIF-1 alpha as a novel site for development of covalent inhibitors of HIF-1 alpha /ARNT PasB domain protein-protein interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4h6jA00
1F9IA 2PR6A 2OWHA 4YWZA 1TS7A 3F1PB 1LL8A 3C8CA 2GJ3A 3OLOA 3ICYA 3H7WA 4GHIB 2K7SA 4EEUA 1N9NA 4I39A 2ZOHA 3EWKA 5HZHA 4HH3A 3E4OA 2M1CA 5A8BA 3B33A 4HP4A 4GCZA 2PYRA 3UMDA 4WL9A 4HNBA 4PKYG 4LLOB 3RTYA 4MN5A 2VEAA 5HD5A 3LICA 1T18A 2YKFA 2ZBBA 3LIDA 3LIEA 5TBMB 2PYPA 1DP8A 4LPZA 3LYXA 1XFQA 1OTDA 1T1BA 3VE3A 1OTBA 5EFWA 2QKPA 4LRZE 1LSVA 1D06A 1UGUA 4HJ4A 4H6JB 1T1CA 1V9ZA 5DKKA 3F1NA 3KX0X 4JGOA 5G4ZA 2V1BA 1S1ZA 3K3CA 1TS8A 1X0OA 4L9GA 3UE6A 2PHYA 4I5SA 4EXOA 4BBVA 2QWSA 3BWLA 3P7NA 2WKRA 3ULFA 2Z6CA 3F1OA 3H7WB 3VE4A 4GS9A 4I3AA 2L1MA 3CLOA 3T50A 1BYWA 3MXQA 1JNUA 4LRYC 2ZOIA 4HY8A 2I9VA 1OTEA 1DP6A 3IBRA 3MQOA 4DJ3A 1F98A 3NJAA 4KUOA 4KUKA 2L0WA 4WN5A 4L9EA 3LUQA 3K3DA 4I3JA 4NXEA 5HD3A 3GECA 3EEHA 5F68A 3IS2A 4K08A 1GSXA 3ZQ5A 3NHQA 5J3WA 5HSQA 3A0RA 1NWZA 5F6AA 3RH8B 4HOIA 3MJQA 2H28A 4EETB 4I3IA 4HJ6A 3NOPC 1LT0A 3MQQA 4EESA 1T19A 5IU1A 5HDSA 3D72A 1GSWA 2EA9A 5F69A 3BY9A 5I5LA 1WA9A 4JGPA 4EW7A 2L4RA 4DJ2A 3SW1A 2BASA 3UB7A 3F1NB 4HI4A 4F3LA 1DP9A 2D02A 2P7JA 3LI9A 1OT9A 4WLAA 2JHEA 4WF0A 2V0WA 3UMEA 4PKYA 1N9OA 3F1OB 4GS9B 2PD8A 5J7EA 4XT2A 3PHYA 5DJTA 2B02A 3HJIA 3BY8A 4EERA 4R38A 2R78A 3LIFA 1OJ5A 2QJ5A 4R70A 3A0SA 2PD7A 3FC7A 2JN7A 2WKQA 1S4SA 2CMNA 1GSVA 3H9WA 1XFNA 2VV7A 1P0ZA 3LIAA 1Y28A 3CAXA 3HJKA 5J4EA 5KIZA 1OTAA 3IS2B 2VLGA 1P97A 4HH2A 2KX6A 4HQAA 3H82A 3NOTC 1OT6A 4HJ3A 5HDCA 1MZUA 4JGQA 5AVFA 3A0VA 2W0NA 2J80A 1ODVA 4LRXC 2V9AA 3GDIA 1LSXA 2V0UA 1S1YA 1D7EA 3FG8A 4F3LB 3E4QA 1XJ4A 2KDKA 3LIBA 3G6OA 3C2WA 1UWPX 5HWVA 1N9LA 4NXBA 3NOUC 4EEPA 2WKPA 3E4PA 4BBUA 3LI8A 2OOLA 1DRMA 2A24A 4XT2B 4RQ9A 4I38A 1XJ3A 2QHKA 2Z6DA 4L9FA 3PYPA 1S4RA 3CWFA 5HWWA 1LSWA 1KOUA 2PR5A 4HP9A 4NXGA 3F1PA 1S66L 4R6LA 5F5YA 5G4YA 4GHIA 1S67L 1OTIA 2V1AA 1TS6A 4B9OA 3H82B 5DJUA 1G28A 4NXFA 5IS1A 4JGRA 5AVEA 1XJ6A 4MN6A 4WUJA 3UB8A 4R3AA 1XJ2A 2PDRA 2HV1A 4BBTA 4HHDA 4HIAA 5TBMA 3UB6A 3MFXA 2D01A 1VB6A 2VV6A 3UB9A 1OJGA 4E04A 2OWJA 2YKHA 5HWTA 2VV8A 4KQDA 1T1AA 3MR0A 4GW9A 5HDDA 1V9YA 4M4XA 2A24B 4H6JA 4EQ1A 1TS0A 2INWA 2W27A 2QJ7A 1UWNX 3VOLA 5DKLA 1EW0A
chains in the Genus database with same CATH superfamily
3IXGA 4GD8A 4ZDXA 2EX2A 4F94A 3N8RA 3OLOA 4X25A 4BJPA 4DXCA 5A92A 4YOFA 3RXWA 2Y2IA 4ZJ1A 4MMNA 2V2FF 3H7WA 3LY3A 4PM7A 3UY6A 2K7SA 5C5KA 3HVFA 4K0WA 5HW3A 2X02A 1LL9A 4G3KA 3CJMA 1TVFA 1E3UA 2OSUA 3ZG8B 5A8BA 4MCWA 3ZFZA 1W7FA 3DAVA 5IT5A 3GR2A 4PKYG 4LLOB 2Y8HA 4M3KA 3IT9A 2IWCA 3LIEA 4OOMA 2Y2QA 4P6BA 1Q2QA 2O9BA 1XFQA 1XGJA 3AGDA 1T1BA 1BT5A 4BENA 2W1RA 5EFWA 2ZC3B 4JF5A 2QKPA 3N8LA 2XEPA 2WAEA 1LLBA 3G35A 3ZGAB 3ZCZA 4XUZA 2V8FA 5HPFA 1ES3A 1NY0A 1XXMA 3PBTA 4LV1A 3F1NA 5GHXA 5G4ZA 2HP9A 3K3CA 2C6WB 4L9GA 3UE6A 3KYQA 4I5SA 3R4KA 4BBVA 4GB7A 4DF6A 1PI4A 4AFIA 2XR0A 3ULFA 2Z6CA 4DXBA 4NEED 3HBRA 1HTZA 4R3BA 3VV4A 4OPYA 3CLOA 4RYEA 4B88A 4LRYC 3R7WA 4PM5A 2AVXA 2I9VA 5TJJA 4ARZB 2ZM0A 1OTEA 2EX6A 3SS3A 3NJAA 3IH8A 3IQAA 3EOIA 2NUTC 4LV0A 3JVUA 5F68A 4U0XA 2A3UA 1M40A 3ZQ5A 1GSXA 2B5RA 4UA6A 5F6AA 3RH8B 3V3RA 5KSCA 2HZ5A 3IWQA 4MN7A 4JXVA 3QP2A 2H28A 4QPRA 1Z09A 4I3IA 1HVBA 3LR3A 2ZLYA 2BLSA 3O88A 4NG2A 2ACGA 4UA9A 3D72A 1OPXA 5FAPA 2EA9A 4KZBA 5DTSA 4UAAA 4X1LA 4BD0A 5I5LA 4EW7A 4P85A 2L4RA 5DF8A 3E2LA 4CLCE 2KOIA 3N4IA 2BASA 1N9BA 5AQBA 3BFCA 5FAOA 2HPBA 4DE0A 1Z6FA 5K5BA 1CJFA 1DP9A 4Q0JA 1MC0A 3IBJA 4CLCD 5EUAA 4BLMA 4MEZA 3S7OA 2Z2MB 4Z9QA 2JHEA 4X56A 2V0WA 4QU3A 1SHVA 4N9LA 3EGXC 3UE1A 1I2SA 5DF7A 5AQ7A 2ZC7A 4B93A 4XT2A 5KSHA 3NDEA 3B3XA 1U60A 3VFFA 2QZ6A 2QJ5A 4Y5FA 5IHVA 5CTMA 3A0SA 2Y59A 2PD7A 2ZMVA 2HDSA 2J3WA 3L9KA 2JN7A 2ZQ7A 4N1XA 1GSVA 5G18A 4EBPA 2VV7A 4KG5A 5D3OA 3KSGA 3CAXA 3PBNA 3I7JA 4BQMA 1MPLA 4EUVA 2XROA 2WGWA 2JC7A 5A90A 1KVLA 2XQZA 1P97A 2WZZA 2KX6A 1H5XA 3H82A 1JWPA 3LEZA 5F83A 5HDCA 1MZUA 2XFSA 5L09A 3Q82A 5L07A 4EUZA 2PU2A 1HD8A 3G31A 4WZ5A 1N4OA 2W0NA 2HJ9C 5M1AA 1XPBA 4OLDA 1SCWA 4LRXC 3CG5A 1M6KA 2V9AA 3GDIA 3BECA 1EI5A 3HLWA 4XUXA 3IWOA 3T4JA 3PBRA 3QNCA 3E4QA 1IKGA 3OPPA 3T4KA 4E3MA 1NJ4A 2P9VB 3LR0A 3UO9A 3LIBA 3MZDA 3IX3A 2FZ0A 3ZNYA 1UWPX 5HWVA 3QHYA 4DE1A 2XA7S 2Y55A 1IEMA 1KE3A 3LI8A 2WGVA 1DRMA 2A24A 4RQ9A 4OPRA 1W5DA 2M7VA 4LV2A 5EOOA 2Y79A 3PYPA 5CGXA 3SH9A 5MC7A 1W63Q 4WMCA 2P04A 3GSGA 1VHMA 3C38A 3LO7A 2I72A 4ZJ3A 1CK3A 5CHUA 1SKFA 1CF0A 1H0MA 2O9CA 4OONA 5U47A 3B47A 2LB5A 4BL3A 3HREA 4WZ4A 3T1XA 5CEDA 4OP8A 2NUPC 3UPPA 1TS6A 1FCOA 4B9OA 1W8QA 4DN0A 1MWSA 5DJUA 2ZM8A 3GTCA 1K4EA 4KQQA 5CEBA 4CJNA 4GD6A 1ERQA 3IH9A 2HV1A 2XK1A 1KDSA 1LL5A 1MWTA 2FFYA 3NDGA 4OH0A 4KG6A 4HHDA 4DE3A 5FQQA 5EE8A 4HIAA 3M6HA 4KQRA 2D01A 1SDNA 1VB6A 2VV6A 2O0YA 4E04A 5EVID 3B42A 4KZ8A 1QMFA 5HWTA 4C3QA 3DWZA 4P6ZM 1L2SA 4MBHA 4E6XA 5DTKA 2W27A 2QJ7A 1UWNX 5HL6A 3NC8A 2Y2OA 2XGNA 1FCNA 1WYBA 4CPKA 2J9OA 2O99A 3NI9A 5GHZA 3F1PB 3V5MA 3ZVTA 3C8CA 2GJ3A 1F2KA 3IF6B 3ICYA 5FASA 3BLMA 5EPHA 3UPOA 2VKSA 4X6TA 5FSRA 1N9NA 4I39A 4Y2FA 4X55A 2XA7M 2ZQDA 2EWWA 5HZHA 3V67A 5HAQA 4ARZA 4MBFA 4HH3A 4OQHA 5GLBA 1Q2PA 4E3IA 2JKRM 1PI5A 3O5YA 2Q0OA 3DW0A 4EBLA 4MN5A 4ZJ2A 3ZYTA 1YT4A 4JXWA 3FKVA 1PZPA 3LICA 4HBTA 4WELA 3C4OA 1T18A 5HD5A 2VX8A 1DJCA 2YKFA 3N7WA 5CTNA 2EWVA 3CPTB 3RXXA 1CI8A 3BQAA 2EX9A 3D9YA 4LPZA 2C5WB 2EX8A 1OTDA 3VE3A 3SH8A 1SDEA 3ZG7B 1ES2A 2XD1A 3UE3A 2DNSA 2WUQA 4LRZE 3MKEA 1KVMA 4O7DA 4IBXA 4HJ4A 4JF4A 2K31A 2V20A 5GLCA 3O87A 4Y0TA 3DTEA 4LV3A 3SZTA 4Y13A 1IYSA 4O01A 2HJEA 4ME4A 1KGEA 4OVDA 3QP8A 4GKUA 1PW1A 3DTKA 3SH7A 3TE8A 2PHYA 3NULA 3P7NA 4S2LA 3G4PA 3WS2A 2OAP1 3VE4A 2K2NA 2VA0A 5DFYA 5DVAA 5CECA 1I5QA 1VEUB 2L1MA 3T4QA 3TRCA 1BYWA 2PAVP 4HY8A 4IEDA 3HLFA 2Y2LA 3IHAA 5A91A 1DP6A 3IBRA 2UWXA 3PBSA 1F98A 4KUOA 3GV9A 5E2HA 2ZMFA 2ZM2A 2L0WA 3HCYA 2W3GA 1YLZA 3LUQA 2X01A 3UB5P 2WKHA 2Y2KA 4I3JA 3ZNTA 1PW8A 4JXGA 5DF9A 1ONGA 4KZAA 1BLHA 2HGVA 2EXBA 3NHQA 4CQHA 5HSQA 1NWZA 3W2ZA 4Y7PA 1EROA 5M19A 3E2KA 4JF6A 5EVLA 3CZDA 5FI2A 4E6WA 2W1TB 3WWXA 1LT0A 3MQQA 1K6RA 3MSHA 2Y2HA 1S0WA 1OMEA 1WYCA 2IWDA 3WS4A 5TFQA 2ZMAA 5CGWA 3PAEA 5LBRA 1WA9A 4JGPA 4O8GA 3UB7A 4HI4A 4P87A 2P9VA 5E43A 5BOHA 4PPRA 3LR4A 2D02A 1PRQA 2HDUA 3LI9A 4MDZA 4R0QA 4WF0A 4ZBEA 4ESPA 2MJ6A 4DDYA 2VGLM 5EVIB 2PBYA 1ZHHB 2PD8A 3C7UA 1VQQA 4S2OA 5DJTA 2B02A 1IYQA 1KE0A 2XDMA 4N9KA 3LIFA 5FI7A 4DRTA 5FDSA 4DDSA 3OOVA 3V39A 4E3OA 1J9MA 3KO6A 1S4SA 1K56D 3LIAA 1P0ZA 1ZG6A 3G32A 1YLPA 3HJKA 1OTAA 3IS2B 5F82A 3RFBA 3BFGA 1XGIA 2OV5A 1HZOA 3FZCA 2H0YA 4E3JA 4PAUA 2Z2LB 4IUHA 1IYOA 1SKOB 3HUMA 2E8JA 1IELA 4KZ4A 1S6RA 4JKTA 3IWIA 1ODVA 1KE4A 5HAIA 4UQIS 1LI0A 4NETA 2Y91A 5FQMA 1LSXA 2V0UA 2XSSA 3A3FA 2UV0E 5F1GA 1D7EA 1YLWA 1EWZA 2Y2GA 4WEKA 5KMWA 5L10A 3OBFA 2KDKA 3T1SA 4Z1WA 5EM1A 3C2WA 3UE0A 1N9LA 4G3WA 4JLFA 4NXBA 3NOUC 3ITAA 5FQJA 2WKPA 3E4PA 3MXSA 1TDLA 4I38A 4YNRA 3AGEA 3KYZA 4L9FA 4A5RA 3CWFA 1KOUA 2G2WA 4QWOA 4HP9A 4NXGA 3F1PA 4K91A 1K25A 4OOLA 4R6LA 2R9WA 3IF6A 4OP5A 5FQ9A 1P9WA 1IOUA 3U2AA 3MFDA 3S22A 4FH2A 2WKEA 1ZKJA 1XX2A 2RCXA 3PTEA 3M2JA 1W79A 4JPMA 4C6YA 1ONHA 5EECA 3WRZA 1GHPA 5IS1A 2WAFA 3K2NA 4S2KA 3G2YA 4JGRA 5AVEA 1XJ6A 4LENA 4MN6A 2P74A 5EV0A 3MMHA 3GMWA 3CPTA 3GQZA 2E8IA 3KSHA 4IHQA 2GZAA 4OQ0A 2WKIA 1BLCA 3E0YA 3UB6A 1FR6A 3PXPA 4II7A 3P98A 3MFXA 1STZA 2XFTA 3QNBA 1G6AA 3ZHHA 2RL3A 4P6ZS 4X1MA 4R23A 2VV8A 4KQDA 3MKFA 1H8MA 3M2KA 5HDDA 1V9YA 4M4XA 2G2UA 2XRNA 4OKPA 4GN2A 5TR7A 1K38A 3FYZA 4O0PA 3VOLA 5DKLA 4UQIM 3LY4A 3UNWA 2PR6A 2OWHA 4FSFA 4C75A 3TG9A 3D3OA 1GA9A 1LL8A 4KZ3A 4DKIA 3L7HA 1CEFA 4IUKA 2P08A 2GNXA 3OCLA 1VEUA 1BLPA 1G5UA 1FSWA 5HPIA 2ZOHA 2JKTM 3EWKA 3T4TA 3G2ZA 4ETXA 2ZQ9A 3HUNA 1IKIA 4QHCA 3DTIA 3VP1A 3C4PA 4GCZA 2PYRA 1BUEA 3UMDA 3NBLA 4P0MA 4RX3A 4HNBA 3T1QB 1NZOA 4UEYA 4WMCD 1FCMA 4LFUA 3MS6A 5L2FA 4QJGA 3LIDA 3W4QA 1RP5A 5TBMB 5A93A 1RGZA 3LYXA 4LCMA 3N6IA 4L0LA 1MBLA 5CRFA 2J9PA 4JXSA 2W1TA 4IVIA 1L0FA 3Q1FA 1LSVA 1BULA 2KLIA 3S7NA 1UGUA 2H0TA 2B95A 3W8KA 1ALQA 3BJNA 5GL9A 4QD4A 4KZ5A 1S1ZA 3DBAA 1WE4A 3IX4A 2ZC5B 1A0KA 3DWKA 1ESIA 1X0OA 3WS1A 4EBNA 5GHYA 4EXOA 5FDHA 4BWIA 2QWSA 3BWLA 4OOYA 4HEFA 4H8RA 4KQOA 4S2MA 5EVIA 1CQAA 4UHUA 2BTFP 5F1FA 3T50A 2Y4AA 3MXQA 1JNUA 4S2NA 3ZG5A 1KGFA 2VZWA 3ITBA 4D60A 4PM9A 3MQOA 4U0TA 3VFHA 2WK0A 3NECA 3BW6A 1PFLA 2Q9NA 3FV7A 4WN5A 3K3DA 4FUWA 1JTDA 1FIKA 4UA7A 1CEGA 3KYEA 5CX7A 3UPNA 1NRFA 4CLCB 4NXEA 5HD3A 3GECA 2WZXA 3SOIA 3ISGA 3VP3A 2HF6A 4OLGA 3IS2A 4K08A 3S4XA 1AWIA 3A0RA 1NZUA 3C7VA 1YKDA 4EETB 1SKOA 4HJ6A 3NOPC 2GX5A 2W3HA 4GOGA 1SZVA 4RVAA 3S7PA 3KSFA 5F69A 1E25A 1YLJA 3S7QA 1GHMA 1LI9A 3A3DA 3BEBA 2Y2NA 1FSYA 3BLSA 5DTTA 2Y2MA 4PM8A 2P7JA 2VGLS 1OT9A 5CHJA 1FOFA 1K54A 5CXWA 3UMEA 3T4LA 4PKYA 4G3VA 1N9OA 3F1OB 4GS9B 3MBZA 3V3SA 5J7EA 2IWBA 3UDXA 2VGJA 1ES4A 1FILA 2ZL1B 3PHYA 2X71A 3IF6C 3NIAA 3HJIA 3BY8A 1C3BA 4U3TA 1NYYA 3RJUA 1OJ5A 1LHYA 1YMSA 4R70A 5FA7A 2XLNA 3FC7A 5EOEA 3S1YA 1AXBA 1XFNA 3H9WA 3UDFA 5J8XA 1Y54A 1TDGA 4WEJA 1RGYA 4EV4A 3EEAA 2VJWA 5J4EA 2ZJ9A 2EFUA 5KIZA 2EFXA 2VLGA 1H8YA 4HH2A 5L8MA 4HQAA 2J7VA 4IBRA 4HJ3A 1VM1A 2FH5A 4YINA 3BFEA 5HAPA 3HUOA 3A0VA 1TF1A 3VSLA 2J80A 5E2FA 1VETB 1D1JA 4FD8A 1JTGA 1NRJA 5GLAA 3QP6A 1S1YA 2IA2A 3NCKA 4R4SA 3FG8A 4EQIA 4WZ5C 4F3LB 1CI9A 3LGOA 2HP6A 3M6BA 3ZG0A 1PWCA 1GHIA 3ZG9B 3FKWA 4ZTKA 3CUEA 3MXRA 4BBUA 2OOLA 4GNUA 3QP1A 1XA7A 1XJ3A 3JVVA 1E3UD 2QHKA 2Z6DA 1ESUA 4KZ7A 5HFOA 3N8SA 1S4RA 4MBKA 5HWWA 3OC2A 4ETZA 1XKZA 4FTXA 2PR5A 1Y4OA 2WGIA 3IF5A 5AQ9A 1KGGA 1S66L 1YPRA 1KDWA 2HP5A 5E2EA 5G4YA 2ZQCA 1ZTUA 1YM1A 1S67L 1OTIA 3IX8A 5JYPA 2DCFA 1PWDA 1K55A 3FWLA 2DMWA 2BG1A 3HLEA 4DMZA 1G6OA 1PYYA 2V1ZA 4R4RA 2JKGA 4YFMA 1ES5A 4DE2A 3VSKA 4ZRRA 2W3DA 4WUJA 3UB8A 1K56A 4E3LA 3Q7VA 3IHBA 3TSGA 2JKRI 4Q0HA 4NK3A 5TBMA 4BL2A 4MNRA 2ZQ8A 2G7UA 3UB9A 4KZ6A 1OJGA 2YKHA 2FFFB 3OCNA 4RX2A 1T1AA 1F5MA 4GW9A 1MWRA 3UN7A 3VMAA 2GDNA 3HLDA 4GJ4A 1EW0A 3A3JA 1F9IA 1FQGA 4RA7A 1NYMA 5EVIC 3OPLA 4YWZA 3QP4A 3T4SA 2PRFA 1TS7A 5FQKA 1K57A 4PHTA 4S2NC 5FQIA 1MKIA 2A2LA 3VP2A 2Y2PA 3TW8A 4GHIB 4EEUA 1MWUA 3U4LP 3BM6A 3SS5A 1NLYA 3CI6A 3E4OA 2M1CA 3B33A 5HL1A 4HP4A 3E98A 3MF0A 4WL9A 3VOYA 3A3IA 3AGFA 4OPQA 3RTYA 1YLTA 4CLCA 2VEAA 4ID4A 5CERA 4NKPA 3P01A 4LCLA 2QPNA 4KENB 2VGKA 2ZBBA 3T12B 4E3NA 2PYPA 1JVJA 1DP8A 3LCEA 5FAQA 2XF3A 1FR1A 1OTBA 4OQGA 3OPHA 4KZ9A 2PU4A 3PR6A 3A3EA 2XH9A 1PIOA 2Y2JA 1GCEA 1D06A 1IFQA 4H6JB 2JE5A 3VP0A 3IXHA 1YMXA 5FL3A 1T1CA 3EQUA 3LFVA 1V9ZA 3BYDA 1K54C 5DKKA 2VK3A 3KX0X 4R3JA 4JGOA 2V1BA 1YSQA 5AJGA 1ZC2A 1J3WA 1TS8A 4GZBA 3WRTA 4Y3IA 1NLZA 2J3TC 5TGFA 2WKRA 2B18A 3F1OA 3H7WB 3QP5A 4X53A 4GS9A 4I3AA 1TD5A 2O9AA 4K0XA 1HLUP 3KSIA 4EWFA 2ZOIA 4ZAMA 2ZL1A 5FI6A 1DY6A 3BFDA 4DJ3A 4WM9A 2EXAA 5FATA 2JKFA 4KUKA 3JYIA 4S2JA 1MY8A 4L9EA 1G68A 3PAGA 3T4OA 5HARA 1GA0A 3FPWA 3EEHA 3V50A 1H3QA 5CHMA 3HL9A 4WBGA 1YAXA 5J3WA 3ZDJA 3MQ0A 4HOIA 1L0GA 2Q9MA 3MJQA 4EU0A 3ZVWA 4EESA 1T19A 5IU1A 1VETA 4QY5A 3NY4A 4LGWA 5HDSA 1GSWA 2WADA 2XD5A 4Y0UA 3BY9A 3WS0A 3PBOA 3W4OA 3O86A 3Q7VB 4DJ2A 3SW1A 1O07A 3F1NB 4F3LA 4Q8IA 3P09A 4FH4A 3CUEC 5E2GA 4B4XA 2H5SA 3GVBA 1BTLA 2OAQ1 4MLLA 4WLAA 2HDQA 4PMAA 3BRMA 3Q81A 4JBFA 1O7EA 1RCJA 3Q7ZA 1IYPA 3R7WB 1P9RA 1PWGA 3LEQA 4EERA 3G34A 2R78A 4R38A 4OPZA 3C5AA 3MZFA 1W63M 2ZQAA 2M7UA 2OLVA 3GRJA 3T1RA 2WKQA 2CMNA 1K55C 5EVEA 1Y28A 3CMZA 5AQAA 3BQ8A 1YLYA 3HLGA 5FEGA 3NOTC 1OT6A 5M18A 4PM6A 2PT7A 2ZC4B 5EM0A 4JGQA 5AVFA 3O3VA 4HESA 4WYYA 5GLDA 5HX9A 2W3FA 1BLSA 2W3EA 1MXOA 5DFXA 4BMWA 1ERMA 3G30A 4XXRA 1K6SA 3WS5A 1K0KA 2JCHA 4BD1A 1XJ4A 4N1HA 5I94A 2V8CA 1JWVA 3VP4A 1DJBA 3G6OA 3JPUA 3CHWP 2WYXA 2OLUA 3HLCA 4EEPA 1I2WA 3OZHA 3EGDC 3BFFA 2CC1A 4XT2B 2ZD8A 2J8YA 1L0DA 1PZOA 4IVKA 4N92A 1L3LA 3VOZA 1K57C 3TOIA 2R9XA 1L0EA 3D4FA 1E4DA 2QMIA 1BZAA 1LSWA 1XP4A 3HLBA 1PNEA 4R1GA 1QMEA 4FCFA 4B4ZA 4E3KA 3Q07A 1NXYA 4FOFA 5F5YA 4Y0OA 1YSPA 4GDBA 4KG2A 1MKMA 4GHIA 2WGWB 3UDIA 1BSGA 2PBDP 2V1AA 2HDRA 3W4PA 2DRWA 3H82B 3EQVA 4CLCC 4Y15A 3MZEA 3IXDA 2H10A 4QY6A 4X68A 1G28A 4NXFA 4OQIA 2JKTI 3SS4A 3OPRA 4Q0IA 2J3TD 3DTMA 4R3AA 1XJ2A 2PDRA 3C30A 4BBTA 4X69A 5CGSA 1JWZA 2JBFA 1ACFA 4S2PA 1H8ZA 4IJGA 1XA1A 4D2OA 3LR5A 3PBQA 1W8YA 2QYBA 1YQSA 4GLQA 3CITA 3IXBA 4GDNA 2OWJA 1K4FA 4QB8A 4S2IA 5KZHA 3MR0A 4HBUA 3TJZC 3FPVA 5FEFA 2A24B 4H6JA 4EQ1A 1DJAA 1TS0A 1ZG4A 5JYOA 2INWA 2ZC6B 1TEMA 4Y17A 2A49A 2LB9A
chains in the Genus database with same CATH topology
4UQIM 1F9IA 2O99A 2OWHA 2PR6A 4YWZA 4FSFA 3T4SA 1TS7A 3D3OA 3F1PB 1LL8A 3C8CA 4PHTA 2GJ3A 3OLOA 3ICYA 4BJPA 2A2LA 4YOFA 4MMNA 3H7WA 3TW8A 4GHIB 2K7SA 4IUKA 4EEUA 5C5KA 2P08A 2GNXA 3OCLA 2VKSA 1NLYA 1N9NA 4I39A 4Y2FA 2XA7M 5HPIA 2ZOHA 2EWWA 2JKTM 3EWKA 3T4TA 5HZHA 3V67A 4G3KA 4ARZA 4ETXA 4HH3A 3CI6A 3E4OA 2M1CA 5A8BA 3B33A 4MCWA 4HP4A 4GCZA 2JKRM 2PYRA 5IT5A 3O5YA 3UMDA 3E98A 3MF0A 4WL9A 4HNBA 4PKYG 4LLOB 3RTYA 2Y8HA 4MN5A 4CLCA 2VEAA 3ZYTA 4UEYA 5HD5A 3LICA 4WELA 1T18A 2VX8A 4NKPA 3P01A 2YKFA 2EWVA 2ZBBA 3LIDA 3LIEA 5TBMB 4OOMA 3BQAA 2PYPA 1DP8A 4LPZA 3LYXA 2O9BA 1XFQA 4L0LA 1OTDA 1T1BA 2W1RA 3VE3A 1OTBA 5EFWA 3UE3A 2QKPA 2W1TA 4LRZE 1LSVA 3PR6A 2KLIA 3S7NA 1D06A 1UGUA 4HJ4A 2K31A 1IFQA 4H6JB 3BJNA 5HPFA 5FL3A 1T1CA 3EQUA 3LFVA 3PBTA 1V9ZA 5DKKA 3F1NA 3KX0X 4JGOA 5G4ZA 2V1BA 1S1ZA 4O01A 1YSQA 3K3CA 5AJGA 2HJEA 4ME4A 3DBAA 1TS8A 1X0OA 4L9GA 4Y3IA 3UE6A 3TE8A 2PHYA 3KYQA 4I5SA 3R4KA 4EXOA 4BBVA 4BWIA 2QWSA 3BWLA 4AFIA 3P7NA 1NLZA 2J3TC 2WKRA 3ULFA 2B18A 2Z6CA 4NEED 3F1OA 3H7WB 4KQOA 2OAP1 3VE4A 2K2NA 4GS9A 4I3AA 1TD5A 3VV4A 2VA0A 5DFYA 2O9AA 2L1MA 3CLOA 3T50A 3T4QA 3TRCA 1BYWA 3MXQA 1JNUA 3KSIA 4LRYC 2ZOIA 4HY8A 3R7WA 2I9VA 2VZWA 5TJJA 4ARZB 1OTEA 1DP6A 3IBRA 3MQOA 4DJ3A 3PBSA 1F98A 3NJAA 4KUOA 4KUKA 3BW6A 2ZMFA 2L0WA 3HCYA 2W3GA 4WN5A 4L9EA 3LUQA 3K3DA 3EOIA 4I3JA 5CX7A 3T4OA 4CLCB 5DF9A 4NXEA 5HD3A 2NUTC 3FPWA 3GECA 3EEHA 1H3QA 3JVUA 5F68A 2HF6A 3IS2A 2HGVA 4K08A 1GSXA 3ZQ5A 3NHQA 1YAXA 5J3WA 4CQHA 5HSQA 3A0RA 1NWZA 5F6AA 3RH8B 3W2ZA 1YKDA 3MQ0A 4HOIA 3MJQA 4MN7A 4QPRA 2H28A 4EETB 4EU0A 4I3IA 3LR3A 4HJ6A 2W1TB 3NOPC 1LT0A 3MQQA 2GX5A 2W3HA 4EESA 1T19A 5IU1A 5HDSA 3S7PA 3KSFA 3D72A 1OPXA 1GSWA 2EA9A 5F69A 3BY9A 5LBRA 5I5LA 1WA9A 4JGPA 4EW7A 2L4RA 3PBOA 4CLCE 2KOIA 4DJ2A 3SW1A 2BASA 4O8GA 3UB7A 3F1NB 4HI4A 3S7QA 4F3LA 1EW0A 3CUEC 5K5BA 1DP9A 4Q0JA 1MC0A 3IBJA 2OAQ1 3LR4A 4CLCD 2D02A 2P7JA 2VGLS 1OT9A 3LI9A 4MDZA 4WLAA 3S7OA 2JHEA 4WF0A 2V0WA 3UMEA 3T4LA 4PKYA 4G3VA 1N9OA 3EGXC 2MJ6A 3F1OB 2VGLM 4GS9B 1ZHHB 2PD8A 4B93A 5J7EA 4XT2A 3R7WB 3PHYA 1P9RA 5KSHA 5DJTA 2B02A 3HJIA 3BY8A 4EERA 4R38A 2R78A 3LIFA 1OJ5A 2QJ5A 4R70A 4Y5FA 3A0SA 1W63M 2PD7A 2ZMVA 3OOVA 2M7UA 2J3WA 3KO6A 3FC7A 2JN7A 2WKQA 1S4SA 2CMNA 1GSVA 3H9WA 1XFNA 2VV7A 1P0ZA 3LIAA 4WEJA 3EEAA 3KSGA 1Y28A 3CAXA 2VJWA 3HJKA 3PBNA 5J4EA 5KIZA 4EUVA 2XROA 1OTAA 3IS2B 2VLGA 1P97A 3RFBA 3BQ8A 4HH2A 2KX6A 5L8MA 4HQAA 3H82A 3NOTC 1OT6A 4HJ3A 5HDCA 1MZUA 4PAUA 2PT7A 2FH5A 4IUHA 4JGQA 5AVFA 3A0VA 1TF1A 2W0NA 2HJ9C 2J80A 1ODVA 4LRXC 2W3FA 4UQIS 2W3EA 5DFXA 2V9AA 3GDIA 1NRJA 4BMWA 1LSXA 2V0UA 2XSSA 1S1YA 1D7EA 2IA2A 3T4JA 3PBRA 3FG8A 4F3LB 3E4QA 3T4KA 4WEKA 1XJ4A 3LR0A 2KDKA 3OBFA 3LIBA 4Z1WA 3G6OA 2FZ0A 3C2WA 1UWPX 5HWVA 1N9LA 4G3WA 2XA7S 4NXBA 3NOUC 4EEPA 2WKPA 3CUEA 3EGDC 3E4PA 4BBUA 3LI8A 2OOLA 1DRMA 2A24A 4XT2B 4RQ9A 4I38A 4YNRA 3JVVA 1XJ3A 2QHKA 2Z6DA 3KYZA 2M7VA 4L9FA 2Y79A 3PYPA 1S4RA 5MC7A 1W63Q 3CWFA 5HWWA 3OC2A 4ETZA 1LSWA 1KOUA 2PR5A 4HP9A 2P04A 1VHMA 4NXGA 3F1PA 1S66L 4OOLA 4R6LA 3C38A 1P9WA 4FOFA 5F5YA 1IOUA 3U2AA 1YSPA 5G4YA 2O9CA 1ZTUA 3B47A 1MKMA 4GHIA 2LB5A 1S67L 1OTIA 2V1AA 2NUPC 1TS6A 2DMWA 3H82B 4B9OA 3EQVA 4CLCC 4DN0A 4DMZA 1G6OA 5DJUA 1G28A 4NXFA 5IS1A 3K2NA 2JKTI 4JGRA 5AVEA 1XJ6A 4MN6A 4ZRRA 2W3DA 3MMHA 4Q0IA 2J3TD 4WUJA 3UB8A 4R3AA 1XJ2A 2PDRA 3C30A 2HV1A 4BBTA 2JKRI 4Q0HA 4HHDA 3KSHA 4IJGA 4IHQA 2GZAA 4HIAA 5TBMA 3E0YA 3UB6A 3PXPA 4II7A 3LR5A 3MFXA 1STZA 2D01A 3PBQA 1VB6A 2VV6A 2G7UA 2QYBA 2O0YA 3UB9A 1OJGA 4GLQA 3CITA 4E04A 4P6ZS 2OWJA 2YKHA 3B42A 3OCNA 5HWTA 2VV8A 4KQDA 1T1AA 1F5MA 3MR0A 4GW9A 1H8MA 5HDDA 4P6ZM 1V9YA 3TJZC 3FPVA 4M4XA 2A24B 4H6JA 4EQ1A 2XRNA 1TS0A 2INWA 2W27A 4GJ4A 2QJ7A 1UWNX 4O0PA 5HL6A 3VOLA 5DKLA 2LB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9I A;  2PR6 A;  2OWH A;  4YWZ A;  1TS7 A;  3F1P B;  1LL8 A;  3C8C A;  2GJ3 A;  3OLO A;  3ICY A;  3H7W A;  4GHI B;  2K7S A;  4EEU A;  1N9N A;  4I39 A;  2ZOH A;  3EWK A;  5HZH A;  4HH3 A;  3E4O A;  2M1C A;  5A8B A;  3B33 A;  4HP4 A;  4GCZ A;  2PYR A;  3UMD A;  4WL9 A;  4HNB A;  4PKY G;  4LLO B;  3RTY A;  4MN5 A;  2VEA A;  5HD5 A;  3LIC A;  1T18 A;  2YKF A;  2ZBB A;  3LID A;  3LIE A;  5TBM B;  2PYP A;  1DP8 A;  4LPZ A;  3LYX A;  1XFQ A;  1OTD A;  1T1B A;  3VE3 A;  1OTB A;  5EFW A;  2QKP A;  4LRZ E;  1LSV A;  1D06 A;  1UGU A;  4HJ4 A;  4H6J B;  1T1C A;  1V9Z A;  5DKK A;  3F1N A;  3KX0 X;  4JGO A;  5G4Z A;  2V1B A;  1S1Z A;  3K3C A;  1TS8 A;  1X0O A;  4L9G A;  3UE6 A;  2PHY A;  4I5S A;  4EXO A;  4BBV A;  2QWS A;  3BWL A;  3P7N A;  2WKR A;  3ULF A;  2Z6C A;  3F1O A;  3H7W B;  3VE4 A;  4GS9 A;  4I3A A;  2L1M A;  3CLO A;  3T50 A;  1BYW A;  3MXQ A;  1JNU A;  4LRY C;  2ZOI A;  4HY8 A;  2I9V A;  1OTE A;  1DP6 A;  3IBR A;  3MQO A;  4DJ3 A;  1F98 A;  3NJA A;  4KUO A;  4KUK A;  2L0W A;  4WN5 A;  4L9E A;  3LUQ A;  3K3D A;  4I3J A;  4NXE A;  5HD3 A;  3GEC A;  3EEH A;  5F68 A;  3IS2 A;  4K08 A;  1GSX A;  3ZQ5 A;  3NHQ A;  5J3W A;  5HSQ A;  3A0R A;  1NWZ A;  5F6A A;  3RH8 B;  4HOI A;  3MJQ A;  2H28 A;  4EET B;  4I3I A;  4HJ6 A;  3NOP C;  1LT0 A;  3MQQ A;  4EES A;  1T19 A;  5IU1 A;  5HDS A;  3D72 A;  1GSW A;  2EA9 A;  5F69 A;  3BY9 A;  5I5L A;  1WA9 A;  4JGP A;  4EW7 A;  2L4R A;  4DJ2 A;  3SW1 A;  2BAS A;  3UB7 A;  3F1N B;  4HI4 A;  4F3L A;  1DP9 A;  2D02 A;  2P7J A;  3LI9 A;  1OT9 A;  4WLA A;  2JHE A;  4WF0 A;  2V0W A;  3UME A;  4PKY A;  1N9O A;  3F1O B;  4GS9 B;  2PD8 A;  5J7E A;  4XT2 A;  3PHY A;  5DJT A;  2B02 A;  3HJI A;  3BY8 A;  4EER A;  4R38 A;  2R78 A;  3LIF A;  1OJ5 A;  2QJ5 A;  4R70 A;  3A0S A;  2PD7 A;  3FC7 A;  2JN7 A;  2WKQ A;  1S4S A;  2CMN A;  1GSV A;  3H9W A;  1XFN A;  2VV7 A;  1P0Z A;  3LIA A;  1Y28 A;  3CAX A;  3HJK A;  5J4E A;  5KIZ A;  1OTA A;  3IS2 B;  2VLG A;  1P97 A;  4HH2 A;  2KX6 A;  4HQA A;  3H82 A;  3NOT C;  1OT6 A;  4HJ3 A;  5HDC A;  1MZU A;  4JGQ A;  5AVF A;  3A0V A;  2W0N A;  2J80 A;  1ODV A;  4LRX C;  2V9A A;  3GDI A;  1LSX A;  2V0U A;  1S1Y A;  1D7E A;  3FG8 A;  4F3L B;  3E4Q A;  1XJ4 A;  2KDK A;  3LIB A;  3G6O A;  3C2W A;  1UWP X;  5HWV A;  1N9L A;  4NXB A;  3NOU C;  4EEP A;  2WKP A;  3E4P A;  4BBU A;  3LI8 A;  2OOL A;  1DRM A;  2A24 A;  4XT2 B;  4RQ9 A;  4I38 A;  1XJ3 A;  2QHK A;  2Z6D A;  4L9F A;  3PYP A;  1S4R A;  3CWF A;  5HWW A;  1LSW A;  1KOU A;  2PR5 A;  4HP9 A;  4NXG A;  3F1P A;  1S66 L;  4R6L A;  5F5Y A;  5G4Y A;  4GHI A;  1S67 L;  1OTI A;  2V1A A;  1TS6 A;  4B9O A;  3H82 B;  5DJU A;  1G28 A;  4NXF A;  5IS1 A;  4JGR A;  5AVE A;  1XJ6 A;  4MN6 A;  4WUJ A;  3UB8 A;  4R3A A;  1XJ2 A;  2PDR A;  2HV1 A;  4BBT A;  4HHD A;  4HIA A;  5TBM A;  3UB6 A;  3MFX A;  2D01 A;  1VB6 A;  2VV6 A;  3UB9 A;  1OJG A;  4E04 A;  2OWJ A;  2YKH A;  5HWT A;  2VV8 A;  4KQD A;  1T1A A;  3MR0 A;  4GW9 A;  5HDD A;  1V9Y A;  4M4X A;  2A24 B;  4H6J A;  4EQ1 A;  1TS0 A;  2INW A;  2W27 A;  2QJ7 A;  1UWN X;  3VOL A;  5DKL A;  1EW0 A; 
#chains in the Genus database with same CATH topology
 3IXG A;  4GD8 A;  4ZDX A;  2EX2 A;  4F94 A;  3N8R A;  3OLO A;  4X25 A;  4BJP A;  4DXC A;  5A92 A;  4YOF A;  3RXW A;  2Y2I A;  4ZJ1 A;  4MMN A;  2V2F F;  3H7W A;  3LY3 A;  4PM7 A;  3UY6 A;  2K7S A;  5C5K A;  3HVF A;  4K0W A;  5HW3 A;  2X02 A;  1LL9 A;  4G3K A;  3CJM A;  1TVF A;  1E3U A;  2OSU A;  3ZG8 B;  5A8B A;  4MCW A;  3ZFZ A;  1W7F A;  3DAV A;  5IT5 A;  3GR2 A;  4PKY G;  4LLO B;  2Y8H A;  4M3K A;  3IT9 A;  2IWC A;  3LIE A;  4OOM A;  2Y2Q A;  4P6B A;  1Q2Q A;  2O9B A;  1XFQ A;  1XGJ A;  3AGD A;  1T1B A;  1BT5 A;  4BEN A;  2W1R A;  5EFW A;  2ZC3 B;  4JF5 A;  2QKP A;  3N8L A;  2XEP A;  2WAE A;  1LLB A;  3G35 A;  3ZGA B;  3ZCZ A;  4XUZ A;  2V8F A;  5HPF A;  1ES3 A;  1NY0 A;  1XXM A;  3PBT A;  4LV1 A;  3F1N A;  5GHX A;  5G4Z A;  2HP9 A;  3K3C A;  2C6W B;  4L9G A;  3UE6 A;  3KYQ A;  4I5S A;  3R4K A;  4BBV A;  4GB7 A;  4DF6 A;  1PI4 A;  4AFI A;  2XR0 A;  3ULF A;  2Z6C A;  4DXB A;  4NEE D;  3HBR A;  1HTZ A;  4R3B A;  3VV4 A;  4OPY A;  3CLO A;  4RYE A;  4B88 A;  4LRY C;  3R7W A;  4PM5 A;  2AVX A;  2I9V A;  5TJJ A;  4ARZ B;  2ZM0 A;  1OTE A;  2EX6 A;  3SS3 A;  3NJA A;  3IH8 A;  3IQA A;  3EOI A;  2NUT C;  4LV0 A;  3JVU A;  5F68 A;  4U0X A;  2A3U A;  1M40 A;  3ZQ5 A;  1GSX A;  2B5R A;  4UA6 A;  5F6A A;  3RH8 B;  3V3R A;  5KSC A;  2HZ5 A;  3IWQ A;  4MN7 A;  4JXV A;  3QP2 A;  2H28 A;  4QPR A;  1Z09 A;  4I3I A;  1HVB A;  3LR3 A;  2ZLY A;  2BLS A;  3O88 A;  4NG2 A;  2ACG A;  4UA9 A;  3D72 A;  1OPX A;  5FAP A;  2EA9 A;  4KZB A;  5DTS A;  4UAA A;  4X1L A;  4BD0 A;  5I5L A;  4EW7 A;  4P85 A;  2L4R A;  5DF8 A;  3E2L A;  4CLC E;  2KOI A;  3N4I A;  2BAS A;  1N9B A;  5AQB A;  3BFC A;  5FAO A;  2HPB A;  4DE0 A;  1Z6F A;  5K5B A;  1CJF A;  1DP9 A;  4Q0J A;  1MC0 A;  3IBJ A;  4CLC D;  5EUA A;  4BLM A;  4MEZ A;  3S7O A;  2Z2M B;  4Z9Q A;  2JHE A;  4X56 A;  2V0W A;  4QU3 A;  1SHV A;  4N9L A;  3EGX C;  3UE1 A;  1I2S A;  5DF7 A;  5AQ7 A;  2ZC7 A;  4B93 A;  4XT2 A;  5KSH A;  3NDE A;  3B3X A;  1U60 A;  3VFF A;  2QZ6 A;  2QJ5 A;  4Y5F A;  5IHV A;  5CTM A;  3A0S A;  2Y59 A;  2PD7 A;  2ZMV A;  2HDS A;  2J3W A;  3L9K A;  2JN7 A;  2ZQ7 A;  4N1X A;  1GSV A;  5G18 A;  4EBP A;  2VV7 A;  4KG5 A;  5D3O A;  3KSG A;  3CAX A;  3PBN A;  3I7J A;  4BQM A;  1MPL A;  4EUV A;  2XRO A;  2WGW A;  2JC7 A;  5A90 A;  1KVL A;  2XQZ A;  1P97 A;  2WZZ A;  2KX6 A;  1H5X A;  3H82 A;  1JWP A;  3LEZ A;  5F83 A;  5HDC A;  1MZU A;  2XFS A;  5L09 A;  3Q82 A;  5L07 A;  4EUZ A;  2PU2 A;  1HD8 A;  3G31 A;  4WZ5 A;  1N4O A;  2W0N A;  2HJ9 C;  5M1A A;  1XPB A;  4OLD A;  1SCW A;  4LRX C;  3CG5 A;  1M6K A;  2V9A A;  3GDI A;  3BEC A;  1EI5 A;  3HLW A;  4XUX A;  3IWO A;  3T4J A;  3PBR A;  3QNC A;  3E4Q A;  1IKG A;  3OPP A;  3T4K A;  4E3M A;  1NJ4 A;  2P9V B;  3LR0 A;  3UO9 A;  3LIB A;  3MZD A;  3IX3 A;  2FZ0 A;  3ZNY A;  1UWP X;  5HWV A;  3QHY A;  4DE1 A;  2XA7 S;  2Y55 A;  1IEM A;  1KE3 A;  3LI8 A;  2WGV A;  1DRM A;  2A24 A;  4RQ9 A;  4OPR A;  1W5D A;  2M7V A;  4LV2 A;  5EOO A;  2Y79 A;  3PYP A;  5CGX A;  3SH9 A;  5MC7 A;  1W63 Q;  4WMC A;  2P04 A;  3GSG A;  1VHM A;  3C38 A;  3LO7 A;  2I72 A;  4ZJ3 A;  1CK3 A;  5CHU A;  1SKF A;  1CF0 A;  1H0M A;  2O9C A;  4OON A;  5U47 A;  3B47 A;  2LB5 A;  4BL3 A;  3HRE A;  4WZ4 A;  3T1X A;  5CED A;  4OP8 A;  2NUP C;  3UPP A;  1TS6 A;  1FCO A;  4B9O A;  1W8Q A;  4DN0 A;  1MWS A;  5DJU A;  2ZM8 A;  3GTC A;  1K4E A;  4KQQ A;  5CEB A;  4CJN A;  4GD6 A;  1ERQ A;  3IH9 A;  2HV1 A;  2XK1 A;  1KDS A;  1LL5 A;  1MWT A;  2FFY A;  3NDG A;  4OH0 A;  4KG6 A;  4HHD A;  4DE3 A;  5FQQ A;  5EE8 A;  4HIA A;  3M6H A;  4KQR A;  2D01 A;  1SDN A;  1VB6 A;  2VV6 A;  2O0Y A;  4E04 A;  5EVI D;  3B42 A;  4KZ8 A;  1QMF A;  5HWT A;  4C3Q A;  3DWZ A;  4P6Z M;  1L2S A;  4MBH A;  4E6X A;  5DTK A;  2W27 A;  2QJ7 A;  1UWN X;  5HL6 A;  3NC8 A;  2Y2O A;  2XGN A;  1FCN A;  1WYB A;  4CPK A;  2J9O A;  2O99 A;  3NI9 A;  5GHZ A;  3F1P B;  3V5M A;  3ZVT A;  3C8C A;  2GJ3 A;  1F2K A;  3IF6 B;  3ICY A;  5FAS A;  3BLM A;  5EPH A;  3UPO A;  2VKS A;  4X6T A;  5FSR A;  1N9N A;  4I39 A;  4Y2F A;  4X55 A;  2XA7 M;  2ZQD A;  2EWW A;  5HZH A;  3V67 A;  5HAQ A;  4ARZ A;  4MBF A;  4HH3 A;  4OQH A;  5GLB A;  1Q2P A;  4E3I A;  2JKR M;  1PI5 A;  3O5Y A;  2Q0O A;  3DW0 A;  4EBL A;  4MN5 A;  4ZJ2 A;  3ZYT A;  1YT4 A;  4JXW A;  3FKV A;  1PZP A;  3LIC A;  4HBT A;  4WEL A;  3C4O A;  1T18 A;  5HD5 A;  2VX8 A;  1DJC A;  2YKF A;  3N7W A;  5CTN A;  2EWV A;  3CPT B;  3RXX A;  1CI8 A;  3BQA A;  2EX9 A;  3D9Y A;  4LPZ A;  2C5W B;  2EX8 A;  1OTD A;  3VE3 A;  3SH8 A;  1SDE A;  3ZG7 B;  1ES2 A;  2XD1 A;  3UE3 A;  2DNS A;  2WUQ A;  4LRZ E;  3MKE A;  1KVM A;  4O7D A;  4IBX A;  4HJ4 A;  4JF4 A;  2K31 A;  2V20 A;  5GLC A;  3O87 A;  4Y0T A;  3DTE A;  4LV3 A;  3SZT A;  4Y13 A;  1IYS A;  4O01 A;  2HJE A;  4ME4 A;  1KGE A;  4OVD A;  3QP8 A;  4GKU A;  1PW1 A;  3DTK A;  3SH7 A;  3TE8 A;  2PHY A;  3NUL A;  3P7N A;  4S2L A;  3G4P A;  3WS2 A;  2OAP 1;  3VE4 A;  2K2N A;  2VA0 A;  5DFY A;  5DVA A;  5CEC A;  1I5Q A;  1VEU B;  2L1M A;  3T4Q A;  3TRC A;  1BYW A;  2PAV P;  4HY8 A;  4IED A;  3HLF A;  2Y2L A;  3IHA A;  5A91 A;  1DP6 A;  3IBR A;  2UWX A;  3PBS A;  1F98 A;  4KUO A;  3GV9 A;  5E2H A;  2ZMF A;  2ZM2 A;  2L0W A;  3HCY A;  2W3G A;  1YLZ A;  3LUQ A;  2X01 A;  3UB5 P;  2WKH A;  2Y2K A;  4I3J A;  3ZNT A;  1PW8 A;  4JXG A;  5DF9 A;  1ONG A;  4KZA A;  1BLH A;  2HGV A;  2EXB A;  3NHQ A;  4CQH A;  5HSQ A;  1NWZ A;  3W2Z A;  4Y7P A;  1ERO A;  5M19 A;  3E2K A;  4JF6 A;  5EVL A;  3CZD A;  5FI2 A;  4E6W A;  2W1T B;  3WWX A;  1LT0 A;  3MQQ A;  1K6R A;  3MSH A;  2Y2H A;  1S0W A;  1OME A;  1WYC A;  2IWD A;  3WS4 A;  5TFQ A;  2ZMA A;  5CGW A;  3PAE A;  5LBR A;  1WA9 A;  4JGP A;  4O8G A;  3UB7 A;  4HI4 A;  4P87 A;  2P9V A;  5E43 A;  5BOH A;  4PPR A;  3LR4 A;  2D02 A;  1PRQ A;  2HDU A;  3LI9 A;  4MDZ A;  4R0Q A;  4WF0 A;  4ZBE A;  4ESP A;  2MJ6 A;  4DDY A;  2VGL M;  5EVI B;  2PBY A;  1ZHH B;  2PD8 A;  3C7U A;  1VQQ A;  4S2O A;  5DJT A;  2B02 A;  1IYQ A;  1KE0 A;  2XDM A;  4N9K A;  3LIF A;  5FI7 A;  4DRT A;  5FDS A;  4DDS A;  3OOV A;  3V39 A;  4E3O A;  1J9M A;  3KO6 A;  1S4S A;  1K56 D;  3LIA A;  1P0Z A;  1ZG6 A;  3G32 A;  1YLP A;  3HJK A;  1OTA A;  3IS2 B;  5F82 A;  3RFB A;  3BFG A;  1XGI A;  2OV5 A;  1HZO A;  3FZC A;  2H0Y A;  4E3J A;  4PAU A;  2Z2L B;  4IUH A;  1IYO A;  1SKO B;  3HUM A;  2E8J A;  1IEL A;  4KZ4 A;  1S6R A;  4JKT A;  3IWI A;  1ODV A;  1KE4 A;  5HAI A;  4UQI S;  1LI0 A;  4NET A;  2Y91 A;  5FQM A;  1LSX A;  2V0U A;  2XSS A;  3A3F A;  2UV0 E;  5F1G A;  1D7E A;  1YLW A;  1EWZ A;  2Y2G A;  4WEK A;  5KMW A;  5L10 A;  3OBF A;  2KDK A;  3T1S A;  4Z1W A;  5EM1 A;  3C2W A;  3UE0 A;  1N9L A;  4G3W A;  4JLF A;  4NXB A;  3NOU C;  3ITA A;  5FQJ A;  2WKP A;  3E4P A;  3MXS A;  1TDL A;  4I38 A;  4YNR A;  3AGE A;  3KYZ A;  4L9F A;  4A5R A;  3CWF A;  1KOU A;  2G2W A;  4QWO A;  4HP9 A;  4NXG A;  3F1P A;  4K91 A;  1K25 A;  4OOL A;  4R6L A;  2R9W A;  3IF6 A;  4OP5 A;  5FQ9 A;  1P9W A;  1IOU A;  3U2A A;  3MFD A;  3S22 A;  4FH2 A;  2WKE A;  1ZKJ A;  1XX2 A;  2RCX A;  3PTE A;  3M2J A;  1W79 A;  4JPM A;  4C6Y A;  1ONH A;  5EEC A;  3WRZ A;  1GHP A;  5IS1 A;  2WAF A;  3K2N A;  4S2K A;  3G2Y A;  4JGR A;  5AVE A;  1XJ6 A;  4LEN A;  4MN6 A;  2P74 A;  5EV0 A;  3MMH A;  3GMW A;  3CPT A;  3GQZ A;  2E8I A;  3KSH A;  4IHQ A;  2GZA A;  4OQ0 A;  2WKI A;  1BLC A;  3E0Y A;  3UB6 A;  1FR6 A;  3PXP A;  4II7 A;  3P98 A;  3MFX A;  1STZ A;  2XFT A;  3QNB A;  1G6A A;  3ZHH A;  2RL3 A;  4P6Z S;  4X1M A;  4R23 A;  2VV8 A;  4KQD A;  3MKF A;  1H8M A;  3M2K A;  5HDD A;  1V9Y A;  4M4X A;  2G2U A;  2XRN A;  4OKP A;  4GN2 A;  5TR7 A;  1K38 A;  3FYZ A;  4O0P A;  3VOL A;  5DKL A;  4UQI M;  3LY4 A;  3UNW A;  2PR6 A;  2OWH A;  4FSF A;  4C75 A;  3TG9 A;  3D3O A;  1GA9 A;  1LL8 A;  4KZ3 A;  4DKI A;  3L7H A;  1CEF A;  4IUK A;  2P08 A;  2GNX A;  3OCL A;  1VEU A;  1BLP A;  1G5U A;  1FSW A;  5HPI A;  2ZOH A;  2JKT M;  3EWK A;  3T4T A;  3G2Z A;  4ETX A;  2ZQ9 A;  3HUN A;  1IKI A;  4QHC A;  3DTI A;  3VP1 A;  3C4P A;  4GCZ A;  2PYR A;  1BUE A;  3UMD A;  3NBL A;  4P0M A;  4RX3 A;  4HNB A;  3T1Q B;  1NZO A;  4UEY A;  4WMC D;  1FCM A;  4LFU A;  3MS6 A;  5L2F A;  4QJG A;  3LID A;  3W4Q A;  1RP5 A;  5TBM B;  5A93 A;  1RGZ A;  3LYX A;  4LCM A;  3N6I A;  4L0L A;  1MBL A;  5CRF A;  2J9P A;  4JXS A;  2W1T A;  4IVI A;  1L0F A;  3Q1F A;  1LSV A;  1BUL A;  2KLI A;  3S7N A;  1UGU A;  2H0T A;  2B95 A;  3W8K A;  1ALQ A;  3BJN A;  5GL9 A;  4QD4 A;  4KZ5 A;  1S1Z A;  3DBA A;  1WE4 A;  3IX4 A;  2ZC5 B;  1A0K A;  3DWK A;  1ESI A;  1X0O A;  3WS1 A;  4EBN A;  5GHY A;  4EXO A;  5FDH A;  4BWI A;  2QWS A;  3BWL A;  4OOY A;  4HEF A;  4H8R A;  4KQO A;  4S2M A;  5EVI A;  1CQA A;  4UHU A;  2BTF P;  5F1F A;  3T50 A;  2Y4A A;  3MXQ A;  1JNU A;  4S2N A;  3ZG5 A;  1KGF A;  2VZW A;  3ITB A;  4D60 A;  4PM9 A;  3MQO A;  4U0T A;  3VFH A;  2WK0 A;  3NEC A;  3BW6 A;  1PFL A;  2Q9N A;  3FV7 A;  4WN5 A;  3K3D A;  4FUW A;  1JTD A;  1FIK A;  4UA7 A;  1CEG A;  3KYE A;  5CX7 A;  3UPN A;  1NRF A;  4CLC B;  4NXE A;  5HD3 A;  3GEC A;  2WZX A;  3SOI A;  3ISG A;  3VP3 A;  2HF6 A;  4OLG A;  3IS2 A;  4K08 A;  3S4X A;  1AWI A;  3A0R A;  1NZU A;  3C7V A;  1YKD A;  4EET B;  1SKO A;  4HJ6 A;  3NOP C;  2GX5 A;  2W3H A;  4GOG A;  1SZV A;  4RVA A;  3S7P A;  3KSF A;  5F69 A;  1E25 A;  1YLJ A;  3S7Q A;  1GHM A;  1LI9 A;  3A3D A;  3BEB A;  2Y2N A;  1FSY A;  3BLS A;  5DTT A;  2Y2M A;  4PM8 A;  2P7J A;  2VGL S;  1OT9 A;  5CHJ A;  1FOF A;  1K54 A;  5CXW A;  3UME A;  3T4L A;  4PKY A;  4G3V A;  1N9O A;  3F1O B;  4GS9 B;  3MBZ A;  3V3S A;  5J7E A;  2IWB A;  3UDX A;  2VGJ A;  1ES4 A;  1FIL A;  2ZL1 B;  3PHY A;  2X71 A;  3IF6 C;  3NIA A;  3HJI A;  3BY8 A;  1C3B A;  4U3T A;  1NYY A;  3RJU A;  1OJ5 A;  1LHY A;  1YMS A;  4R70 A;  5FA7 A;  2XLN A;  3FC7 A;  5EOE A;  3S1Y A;  1AXB A;  1XFN A;  3H9W A;  3UDF A;  5J8X A;  1Y54 A;  1TDG A;  4WEJ A;  1RGY A;  4EV4 A;  3EEA A;  2VJW A;  5J4E A;  2ZJ9 A;  2EFU A;  5KIZ A;  2EFX A;  2VLG A;  1H8Y A;  4HH2 A;  5L8M A;  4HQA A;  2J7V A;  4IBR A;  4HJ3 A;  1VM1 A;  2FH5 A;  4YIN A;  3BFE A;  5HAP A;  3HUO A;  3A0V A;  1TF1 A;  3VSL A;  2J80 A;  5E2F A;  1VET B;  1D1J A;  4FD8 A;  1JTG A;  1NRJ A;  5GLA A;  3QP6 A;  1S1Y A;  2IA2 A;  3NCK A;  4R4S A;  3FG8 A;  4EQI A;  4WZ5 C;  4F3L B;  1CI9 A;  3LGO A;  2HP6 A;  3M6B A;  3ZG0 A;  1PWC A;  1GHI A;  3ZG9 B;  3FKW A;  4ZTK A;  3CUE A;  3MXR A;  4BBU A;  2OOL A;  4GNU A;  3QP1 A;  1XA7 A;  1XJ3 A;  3JVV A;  1E3U D;  2QHK A;  2Z6D A;  1ESU A;  4KZ7 A;  5HFO A;  3N8S A;  1S4R A;  4MBK A;  5HWW A;  3OC2 A;  4ETZ A;  1XKZ A;  4FTX A;  2PR5 A;  1Y4O A;  2WGI A;  3IF5 A;  5AQ9 A;  1KGG A;  1S66 L;  1YPR A;  1KDW A;  2HP5 A;  5E2E A;  5G4Y A;  2ZQC A;  1ZTU A;  1YM1 A;  1S67 L;  1OTI A;  3IX8 A;  5JYP A;  2DCF A;  1PWD A;  1K55 A;  3FWL A;  2DMW A;  2BG1 A;  3HLE A;  4DMZ A;  1G6O A;  1PYY A;  2V1Z A;  4R4R A;  2JKG A;  4YFM A;  1ES5 A;  4DE2 A;  3VSK A;  4ZRR A;  2W3D A;  4WUJ A;  3UB8 A;  1K56 A;  4E3L A;  3Q7V A;  3IHB A;  3TSG A;  2JKR I;  4Q0H A;  4NK3 A;  5TBM A;  4BL2 A;  4MNR A;  2ZQ8 A;  2G7U A;  3UB9 A;  4KZ6 A;  1OJG A;  2YKH A;  2FFF B;  3OCN A;  4RX2 A;  1T1A A;  1F5M A;  4GW9 A;  1MWR A;  3UN7 A;  3VMA A;  2GDN A;  3HLD A;  4GJ4 A;  1EW0 A;  3A3J A;  1F9I A;  1FQG A;  4RA7 A;  1NYM A;  5EVI C;  3OPL A;  4YWZ A;  3QP4 A;  3T4S A;  2PRF A;  1TS7 A;  5FQK A;  1K57 A;  4PHT A;  4S2N C;  5FQI A;  1MKI A;  2A2L A;  3VP2 A;  2Y2P A;  3TW8 A;  4GHI B;  4EEU A;  1MWU A;  3U4L P;  3BM6 A;  3SS5 A;  1NLY A;  3CI6 A;  3E4O A;  2M1C A;  3B33 A;  5HL1 A;  4HP4 A;  3E98 A;  3MF0 A;  4WL9 A;  3VOY A;  3A3I A;  3AGF A;  4OPQ A;  3RTY A;  1YLT A;  4CLC A;  2VEA A;  4ID4 A;  5CER A;  4NKP A;  3P01 A;  4LCL A;  2QPN A;  4KEN B;  2VGK A;  2ZBB A;  3T12 B;  4E3N A;  2PYP A;  1JVJ A;  1DP8 A;  3LCE A;  5FAQ A;  2XF3 A;  1FR1 A;  1OTB A;  4OQG A;  3OPH A;  4KZ9 A;  2PU4 A;  3PR6 A;  3A3E A;  2XH9 A;  1PIO A;  2Y2J A;  1GCE A;  1D06 A;  1IFQ A;  4H6J B;  2JE5 A;  3VP0 A;  3IXH A;  1YMX A;  5FL3 A;  1T1C A;  3EQU A;  3LFV A;  1V9Z A;  3BYD A;  1K54 C;  5DKK A;  2VK3 A;  3KX0 X;  4R3J A;  4JGO A;  2V1B A;  1YSQ A;  5AJG A;  1ZC2 A;  1J3W A;  1TS8 A;  4GZB A;  3WRT A;  4Y3I A;  1NLZ A;  2J3T C;  5TGF A;  2WKR A;  2B18 A;  3F1O A;  3H7W B;  3QP5 A;  4X53 A;  4GS9 A;  4I3A A;  1TD5 A;  2O9A A;  4K0X A;  1HLU P;  3KSI A;  4EWF A;  2ZOI A;  4ZAM A;  2ZL1 A;  5FI6 A;  1DY6 A;  3BFD A;  4DJ3 A;  4WM9 A;  2EXA A;  5FAT A;  2JKF A;  4KUK A;  3JYI A;  4S2J A;  1MY8 A;  4L9E A;  1G68 A;  3PAG A;  3T4O A;  5HAR A;  1GA0 A;  3FPW A;  3EEH A;  3V50 A;  1H3Q A;  5CHM A;  3HL9 A;  4WBG A;  1YAX A;  5J3W A;  3ZDJ A;  3MQ0 A;  4HOI A;  1L0G A;  2Q9M A;  3MJQ A;  4EU0 A;  3ZVW A;  4EES A;  1T19 A;  5IU1 A;  1VET A;  4QY5 A;  3NY4 A;  4LGW A;  5HDS A;  1GSW A;  2WAD A;  2XD5 A;  4Y0U A;  3BY9 A;  3WS0 A;  3PBO A;  3W4O A;  3O86 A;  3Q7V B;  4DJ2 A;  3SW1 A;  1O07 A;  3F1N B;  4F3L A;  4Q8I A;  3P09 A;  4FH4 A;  3CUE C;  5E2G A;  4B4X A;  2H5S A;  3GVB A;  1BTL A;  2OAQ 1;  4MLL A;  4WLA A;  2HDQ A;  4PMA A;  3BRM A;  3Q81 A;  4JBF A;  1O7E A;  1RCJ A;  3Q7Z A;  1IYP A;  3R7W B;  1P9R A;  1PWG A;  3LEQ A;  4EER A;  3G34 A;  2R78 A;  4R38 A;  4OPZ A;  3C5A A;  3MZF A;  1W63 M;  2ZQA A;  2M7U A;  2OLV A;  3GRJ A;  3T1R A;  2WKQ A;  2CMN A;  1K55 C;  5EVE A;  1Y28 A;  3CMZ A;  5AQA A;  3BQ8 A;  1YLY A;  3HLG A;  5FEG A;  3NOT C;  1OT6 A;  5M18 A;  4PM6 A;  2PT7 A;  2ZC4 B;  5EM0 A;  4JGQ A;  5AVF A;  3O3V A;  4HES A;  4WYY A;  5GLD A;  5HX9 A;  2W3F A;  1BLS A;  2W3E A;  1MXO A;  5DFX A;  4BMW A;  1ERM A;  3G30 A;  4XXR A;  1K6S A;  3WS5 A;  1K0K A;  2JCH A;  4BD1 A;  1XJ4 A;  4N1H A;  5I94 A;  2V8C A;  1JWV A;  3VP4 A;  1DJB A;  3G6O A;  3JPU A;  3CHW P;  2WYX A;  2OLU A;  3HLC A;  4EEP A;  1I2W A;  3OZH A;  3EGD C;  3BFF A;  2CC1 A;  4XT2 B;  2ZD8 A;  2J8Y A;  1L0D A;  1PZO A;  4IVK A;  4N92 A;  1L3L A;  3VOZ A;  1K57 C;  3TOI A;  2R9X A;  1L0E A;  3D4F A;  1E4D A;  2QMI A;  1BZA A;  1LSW A;  1XP4 A;  3HLB A;  1PNE A;  4R1G A;  1QME A;  4FCF A;  4B4Z A;  4E3K A;  3Q07 A;  1NXY A;  4FOF A;  5F5Y A;  4Y0O A;  1YSP A;  4GDB A;  4KG2 A;  1MKM A;  4GHI A;  2WGW B;  3UDI A;  1BSG A;  2PBD P;  2V1A A;  2HDR A;  3W4P A;  2DRW A;  3H82 B;  3EQV A;  4CLC C;  4Y15 A;  3MZE A;  3IXD A;  2H10 A;  4QY6 A;  4X68 A;  1G28 A;  4NXF A;  4OQI A;  2JKT I;  3SS4 A;  3OPR A;  4Q0I A;  2J3T D;  3DTM A;  4R3A A;  1XJ2 A;  2PDR A;  3C30 A;  4BBT A;  4X69 A;  5CGS A;  1JWZ A;  2JBF A;  1ACF A;  4S2P A;  1H8Z A;  4IJG A;  1XA1 A;  4D2O A;  3LR5 A;  3PBQ A;  1W8Y A;  2QYB A;  1YQS A;  4GLQ A;  3CIT A;  3IXB A;  4GDN A;  2OWJ A;  1K4F A;  4QB8 A;  4S2I A;  5KZH A;  3MR0 A;  4HBU A;  3TJZ C;  3FPV A;  5FEF A;  2A24 B;  4H6J A;  4EQ1 A;  1DJA A;  1TS0 A;  1ZG4 A;  5JYO A;  2INW A;  2ZC6 B;  1TEM A;  4Y17 A;  2A49 A;  2LB9 A; 
#chains in the Genus database with same CATH homology
 4UQI M;  1F9I A;  2O99 A;  2OWH A;  2PR6 A;  4YWZ A;  4FSF A;  3T4S A;  1TS7 A;  3D3O A;  3F1P B;  1LL8 A;  3C8C A;  4PHT A;  2GJ3 A;  3OLO A;  3ICY A;  4BJP A;  2A2L A;  4YOF A;  4MMN A;  3H7W A;  3TW8 A;  4GHI B;  2K7S A;  4IUK A;  4EEU A;  5C5K A;  2P08 A;  2GNX A;  3OCL A;  2VKS A;  1NLY A;  1N9N A;  4I39 A;  4Y2F A;  2XA7 M;  5HPI A;  2ZOH A;  2EWW A;  2JKT M;  3EWK A;  3T4T A;  5HZH A;  3V67 A;  4G3K A;  4ARZ A;  4ETX A;  4HH3 A;  3CI6 A;  3E4O A;  2M1C A;  5A8B A;  3B33 A;  4MCW A;  4HP4 A;  4GCZ A;  2JKR M;  2PYR A;  5IT5 A;  3O5Y A;  3UMD A;  3E98 A;  3MF0 A;  4WL9 A;  4HNB A;  4PKY G;  4LLO B;  3RTY A;  2Y8H A;  4MN5 A;  4CLC A;  2VEA A;  3ZYT A;  4UEY A;  5HD5 A;  3LIC A;  4WEL A;  1T18 A;  2VX8 A;  4NKP A;  3P01 A;  2YKF A;  2EWV A;  2ZBB A;  3LID A;  3LIE A;  5TBM B;  4OOM A;  3BQA A;  2PYP A;  1DP8 A;  4LPZ A;  3LYX A;  2O9B A;  1XFQ A;  4L0L A;  1OTD A;  1T1B A;  2W1R A;  3VE3 A;  1OTB A;  5EFW A;  3UE3 A;  2QKP A;  2W1T A;  4LRZ E;  1LSV A;  3PR6 A;  2KLI A;  3S7N A;  1D06 A;  1UGU A;  4HJ4 A;  2K31 A;  1IFQ A;  4H6J B;  3BJN A;  5HPF A;  5FL3 A;  1T1C A;  3EQU A;  3LFV A;  3PBT A;  1V9Z A;  5DKK A;  3F1N A;  3KX0 X;  4JGO A;  5G4Z A;  2V1B A;  1S1Z A;  4O01 A;  1YSQ A;  3K3C A;  5AJG A;  2HJE A;  4ME4 A;  3DBA A;  1TS8 A;  1X0O A;  4L9G A;  4Y3I A;  3UE6 A;  3TE8 A;  2PHY A;  3KYQ A;  4I5S A;  3R4K A;  4EXO A;  4BBV A;  4BWI A;  2QWS A;  3BWL A;  4AFI A;  3P7N A;  1NLZ A;  2J3T C;  2WKR A;  3ULF A;  2B18 A;  2Z6C A;  4NEE D;  3F1O A;  3H7W B;  4KQO A;  2OAP 1;  3VE4 A;  2K2N A;  4GS9 A;  4I3A A;  1TD5 A;  3VV4 A;  2VA0 A;  5DFY A;  2O9A A;  2L1M A;  3CLO A;  3T50 A;  3T4Q A;  3TRC A;  1BYW A;  3MXQ A;  1JNU A;  3KSI A;  4LRY C;  2ZOI A;  4HY8 A;  3R7W A;  2I9V A;  2VZW A;  5TJJ A;  4ARZ B;  1OTE A;  1DP6 A;  3IBR A;  3MQO A;  4DJ3 A;  3PBS A;  1F98 A;  3NJA A;  4KUO A;  4KUK A;  3BW6 A;  2ZMF A;  2L0W A;  3HCY A;  2W3G A;  4WN5 A;  4L9E A;  3LUQ A;  3K3D A;  3EOI A;  4I3J A;  5CX7 A;  3T4O A;  4CLC B;  5DF9 A;  4NXE A;  5HD3 A;  2NUT C;  3FPW A;  3GEC A;  3EEH A;  1H3Q A;  3JVU A;  5F68 A;  2HF6 A;  3IS2 A;  2HGV A;  4K08 A;  1GSX A;  3ZQ5 A;  3NHQ A;  1YAX A;  5J3W A;  4CQH A;  5HSQ A;  3A0R A;  1NWZ A;  5F6A A;  3RH8 B;  3W2Z A;  1YKD A;  3MQ0 A;  4HOI A;  3MJQ A;  4MN7 A;  4QPR A;  2H28 A;  4EET B;  4EU0 A;  4I3I A;  3LR3 A;  4HJ6 A;  2W1T B;  3NOP C;  1LT0 A;  3MQQ A;  2GX5 A;  2W3H A;  4EES A;  1T19 A;  5IU1 A;  5HDS A;  3S7P A;  3KSF A;  3D72 A;  1OPX A;  1GSW A;  2EA9 A;  5F69 A;  3BY9 A;  5LBR A;  5I5L A;  1WA9 A;  4JGP A;  4EW7 A;  2L4R A;  3PBO A;  4CLC E;  2KOI A;  4DJ2 A;  3SW1 A;  2BAS A;  4O8G A;  3UB7 A;  3F1N B;  4HI4 A;  3S7Q A;  4F3L A;  1EW0 A;  3CUE C;  5K5B A;  1DP9 A;  4Q0J A;  1MC0 A;  3IBJ A;  2OAQ 1;  3LR4 A;  4CLC D;  2D02 A;  2P7J A;  2VGL S;  1OT9 A;  3LI9 A;  4MDZ A;  4WLA A;  3S7O A;  2JHE A;  4WF0 A;  2V0W A;  3UME A;  3T4L A;  4PKY A;  4G3V A;  1N9O A;  3EGX C;  2MJ6 A;  3F1O B;  2VGL M;  4GS9 B;  1ZHH B;  2PD8 A;  4B93 A;  5J7E A;  4XT2 A;  3R7W B;  3PHY A;  1P9R A;  5KSH A;  5DJT A;  2B02 A;  3HJI A;  3BY8 A;  4EER A;  4R38 A;  2R78 A;  3LIF A;  1OJ5 A;  2QJ5 A;  4R70 A;  4Y5F A;  3A0S A;  1W63 M;  2PD7 A;  2ZMV A;  3OOV A;  2M7U A;  2J3W A;  3KO6 A;  3FC7 A;  2JN7 A;  2WKQ A;  1S4S A;  2CMN A;  1GSV A;  3H9W A;  1XFN A;  2VV7 A;  1P0Z A;  3LIA A;  4WEJ A;  3EEA A;  3KSG A;  1Y28 A;  3CAX A;  2VJW A;  3HJK A;  3PBN A;  5J4E A;  5KIZ A;  4EUV A;  2XRO A;  1OTA A;  3IS2 B;  2VLG A;  1P97 A;  3RFB A;  3BQ8 A;  4HH2 A;  2KX6 A;  5L8M A;  4HQA A;  3H82 A;  3NOT C;  1OT6 A;  4HJ3 A;  5HDC A;  1MZU A;  4PAU A;  2PT7 A;  2FH5 A;  4IUH A;  4JGQ A;  5AVF A;  3A0V A;  1TF1 A;  2W0N A;  2HJ9 C;  2J80 A;  1ODV A;  4LRX C;  2W3F A;  4UQI S;  2W3E A;  5DFX A;  2V9A A;  3GDI A;  1NRJ A;  4BMW A;  1LSX A;  2V0U A;  2XSS A;  1S1Y A;  1D7E A;  2IA2 A;  3T4J A;  3PBR A;  3FG8 A;  4F3L B;  3E4Q A;  3T4K A;  4WEK A;  1XJ4 A;  3LR0 A;  2KDK A;  3OBF A;  3LIB A;  4Z1W A;  3G6O A;  2FZ0 A;  3C2W A;  1UWP X;  5HWV A;  1N9L A;  4G3W A;  2XA7 S;  4NXB A;  3NOU C;  4EEP A;  2WKP A;  3CUE A;  3EGD C;  3E4P A;  4BBU A;  3LI8 A;  2OOL A;  1DRM A;  2A24 A;  4XT2 B;  4RQ9 A;  4I38 A;  4YNR A;  3JVV A;  1XJ3 A;  2QHK A;  2Z6D A;  3KYZ A;  2M7V A;  4L9F A;  2Y79 A;  3PYP A;  1S4R A;  5MC7 A;  1W63 Q;  3CWF A;  5HWW A;  3OC2 A;  4ETZ A;  1LSW A;  1KOU A;  2PR5 A;  4HP9 A;  2P04 A;  1VHM A;  4NXG A;  3F1P A;  1S66 L;  4OOL A;  4R6L A;  3C38 A;  1P9W A;  4FOF A;  5F5Y A;  1IOU A;  3U2A A;  1YSP A;  5G4Y A;  2O9C A;  1ZTU A;  3B47 A;  1MKM A;  4GHI A;  2LB5 A;  1S67 L;  1OTI A;  2V1A A;  2NUP C;  1TS6 A;  2DMW A;  3H82 B;  4B9O A;  3EQV A;  4CLC C;  4DN0 A;  4DMZ A;  1G6O A;  5DJU A;  1G28 A;  4NXF A;  5IS1 A;  3K2N A;  2JKT I;  4JGR A;  5AVE A;  1XJ6 A;  4MN6 A;  4ZRR A;  2W3D A;  3MMH A;  4Q0I A;  2J3T D;  4WUJ A;  3UB8 A;  4R3A A;  1XJ2 A;  2PDR A;  3C30 A;  2HV1 A;  4BBT A;  2JKR I;  4Q0H A;  4HHD A;  3KSH A;  4IJG A;  4IHQ A;  2GZA A;  4HIA A;  5TBM A;  3E0Y A;  3UB6 A;  3PXP A;  4II7 A;  3LR5 A;  3MFX A;  1STZ A;  2D01 A;  3PBQ A;  1VB6 A;  2VV6 A;  2G7U A;  2QYB A;  2O0Y A;  3UB9 A;  1OJG A;  4GLQ A;  3CIT A;  4E04 A;  4P6Z S;  2OWJ A;  2YKH A;  3B42 A;  3OCN A;  5HWT A;  2VV8 A;  4KQD A;  1T1A A;  1F5M A;  3MR0 A;  4GW9 A;  1H8M A;  5HDD A;  4P6Z M;  1V9Y A;  3TJZ C;  3FPV A;  4M4X A;  2A24 B;  4H6J A;  4EQ1 A;  2XRN A;  1TS0 A;  2INW A;  2W27 A;  4GJ4 A;  2QJ7 A;  1UWN X;  4O0P A;  5HL6 A;  3VOL A;  5DKL A;  2LB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...