4H6JA

Identification of cys 255 in hif-1 as a novel site for development of covalent inhibitors of hif-1 /arnt pasb domain protein-protein interaction.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
b'DSKTFLSEHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYPOXIA INDUCIBLE FACTOR 1-ALPHA
publication title Identification of Cys255 in HIF-1 alpha as a novel site for development of covalent inhibitors of HIF-1 alpha /ARNT PasB domain protein-protein interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 25
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4h6jA00
4B9OA 4HP4A 5HD5A 3MXQA 2PR6A 1Y28A 2OWJA 5HWWA 1OJGA 5J4EA 1GSVA 4GHIA 5HWVA 3H82A 1BYWA 1LSXA 1S4RA 4WUJA 2ZBBA 3F1PB 1GSWA 1F9IA 3BY9A 4BBTA 3ULFA 5A8BA 2CMNA 4GS9A 1EW0A 1VB6A 3A0RA 4JGOA 4HP9A 2V9AA 3LIFA 3EEHA 2L4RA 2WKQA 3MQQA 3H9WA 2WKPA 3NOPC 1LL8A 1OTIA 1P97A 3UB9A 3MQOA 5EFWA 3E4OA 1S1YA 1UGUA 3LUQA 4EQ1A 1TS7A 4HQAA 1KOUA 3VE3A 3PHYA 3NOTC 4EETB 1S66L 1XJ4A 2W0NA 4R6LA 5F6AA 4HIAA 3G6OA 3GECA 4LRXC 2PDRA 5I5LA 3A0SA 2KX6A 3LI8A 1XFNA 3LIEA 5KIZA 3LICA 1DP8A 1P0ZA 4I3AA 1XJ3A 3NOUC 4XT2B 4YWZA 3BWLA 3HJIA 3MR0A 2L1MA 2HV1A 2V1AA 1D7EA 2PR5A 3IS2B 5DJUA 4WF0A 2KDKA 3P7NA 1UWNX 4HH3A 2V1BA 4EXOA 5HDCA 4F3LA 2EA9A 1T1BA 2ZOHA 5G4YA 4LPZA 3CWFA 3PYPA 2QJ7A 3K3CA 5J7EA 2JN7A 4HY8A 4LRZE 3HJKA 1TS6A 2D01A 4H6JB 4EW7A 1DP9A 1S1ZA 1S4SA 3ICYA 4R3AA 2K7SA 4HNBA 1ODVA 3VOLA 1F98A 1TS0A 2YKHA 2BASA 1MZUA 3F1OB 4R38A 3C8CA 1OT9A 1WA9A 1V9YA 1XJ6A 2D02A 4GW9A 5HDDA 4R70A 3F1NB 1OJ5A 2H28A 3CLOA 5J3WA 4EEPA 4JGPA 1G28A 4EERA 5F5YA 2PHYA 3BY8A 3H7WA 3MJQA 4NXFA 1T1CA 5DKKA 2VV8A 1OTEA 2QJ5A 3IBRA 5TBMA 1T18A 3FG8A 2V0WA 3MFXA 4MN5A 1N9OA 4H6JA 3ZQ5A 4GHIB 4PKYG 4JGRA 3F1PA 1LT0A 2VEAA 3LIAA 3LIBA 2A24B 3VE4A 2YKFA 2GJ3A 3F1OA 4L9GA 3UMDA 2WKRA 5AVFA 3CAXA 4WL9A 1D06A 2I9VA 3UMEA 5DKLA 1S67L 2QKPA 2QHKA 2VV6A 1UWPX 3C2WA 4EESA 5IS1A 3UB8A 2R78A 1LSVA 4NXEA 5HD3A 3A0VA 5IU1A 4EEUA 1OTBA 4PKYA 3B33A 4L9FA 4DJ2A 2OOLA 5DJTA 4MN6A 3KX0X 2J80A 3RH8B 2Z6DA 3LIDA 3GDIA 1V9ZA 1NWZA 1DRMA 4XT2A 4NXBA 4WN5A 3LI9A 1TS8A 4HI4A 1GSXA 2A24A 1LSWA 4JGQA 3UB6A 5F69A 4LLOB 2VV7A 2QWSA 3IS2A 2Z6CA 4RQ9A 4K08A 4HJ6A 4L9EA 4HH2A 2V0UA 2P7JA 2ZOIA 5HWTA 4F3LB 2M1CA 4NXGA 3E4PA 4KQDA 5HSQA 1T1AA 4KUKA 1XFQA 4KUOA 4DJ3A 3D72A 4I3IA 5F68A 3EWKA 4HJ4A 1OTAA 2PYPA 1N9LA 2L0WA 2PD8A 3NHQA 4WLAA 3H82B 5G4ZA 4GCZA 3SW1A 4HOIA 4M4XA 5AVEA 2PD7A 3NJAA 3LYXA 4GS9B 4LRYC 2INWA 4I3JA 5HZHA 3FC7A 1DP6A 4BBVA 1T19A 1X0OA 3RTYA 1JNUA 5HDSA 4I38A 2W27A 3F1NA 1N9NA 2OWHA 4BBUA 1XJ2A 4HJ3A 2PYRA 3UE6A 3K3DA 1OTDA 2B02A 4I39A 3T50A 1OT6A 3H7WB 2VLGA 3E4QA 3OLOA 4E04A 4I5SA 2JHEA 4HHDA 3UB7A 5TBMB
chains in the Genus database with same CATH superfamily
1EROA 5IT5A 3MZDA 1HVBA 2OWJA 1W63M 2V8FA 5J4EA 3VP3A 5DF9A 1PWCA 5M19A 3CPTB 2HJ9C 2P04A 2K31A 3I7JA 3F1PB 2XLNA 2OSUA 2MJ6A 4K91A 2M7UA 1XXMA 4HP9A 1CI9A 1XGIA 4WM9A 5AQ9A 2QMIA 4B4XA 5MC7A 1ES3A 2JE5A 1OTIA 3UB9A 1YM1A 4DDSA 1KDWA 4ZAMA 1UGUA 3LR3A 3UE1A 2P9VA 4MLLA 4NETA 1JWVA 1XA7A 4CLCB 1YLJA 3DTMA 3SZTA 1NRFA 1EWZA 1SCWA 1KOUA 5CHMA 5BOHA 3PHYA 2G7UA 3NOTC 1S66L 4P0MA 4X55A 5TJJA 5HPIA 4R6LA 1IELA 2X01A 2DRWA 4RYEA 4R3BA 4AFIA 4DRTA 4BMWA 4WEJA 3VFFA 1O07A 3IX3A 4CJNA 1IYPA 4P6ZS 5FQIA 3A0SA 2Y2JA 1PW1A 1Q2QA 4Y7PA 4K0WA 4I3AA 3FPWA 2WZZA 3T1SA 2DMWA 4B93A 3BWLA 5FATA 3NCKA 5FQMA 2Q9MA 2HV1A 1KDSA 1XPBA 4GZBA 5AJGA 4BENA 2V1AA 2WGWB 3IS2B 3QP6A 2EFXA 2Y2NA 1JTGA 3ZNTA 1W8YA 4OLGA 1IFQA 3OOVA 5EVIB 3TJZC 1XGJA 1CEGA 3RXXA 3ZCZA 3PYPA 1E3UD 2PT7A 2KLIA 4KZAA 5EM1A 2JN7A 3MXRA 1GA0A 1TS6A 3IWIA 5U47A 4KZ3A 1AWIA 3R4KA 5M1AA 4S2JA 4IUHA 3PBSA 1K54C 4HNBA 3LFVA 2IWCA 3QP2A 4UEYA 1NZOA 1VEUA 4QY5A 3PTEA 2EX9A 2P74A 2BASA 2VGJA 1NYMA 1PIOA 5FEGA 1WA9A 3JYIA 4OQ0A 4WZ4A 4C3QA 2D02A 2JKRM 3C4PA 4UQIS 2OLVA 3LY3A 2PU2A 2BG1A 4OQHA 4KZBA 3E2KA 2ACGA 1YLZA 1FCNA 3ZFZA 3A3DA 1KVMA 2UV0E 4ZDXA 5DKKA 3TG9A 3V3RA 2QJ5A 3W2ZA 3C5AA 1ZKJA 2W3EA 4KQOA 3QP5A 3MF0A 2GNXA 4MN7A 5GHYA 3SH9A 3W4QA 4KZ8A 3ZQ5A 4JXGA 4MBFA 4JGRA 4Y15A 3CPTA 3HUOA 3F1PA 3NDGA 3GR2A 3MMHA 5EECA 5CHUA 1KGEA 3LIBA 2YKFA 5F83A 5E2HA 3OPRA 2GJ3A 1L3LA 1SKOA 2ZQCA 4ZJ2A 3B42A 1P9WA 3ZG5A 4WL9A 1D06A 2VKSA 5L10A 4BL2A 3M2JA 4CLCD 3GV9A 1S67L 3TSGA 4DN0A 3B47A 4MNRA 4CLCA 3C2WA 3Q07A 4X53A 3L7HA 5IS1A 4K0XA 4FD8A 4LCMA 4NXEA 4BJPA 5F1FA 5HPFA 4FH4A 1YPRA 4L9FA 1HD8A 2DNSA 3QP8A 2H10A 4Q0JA 1MWTA 2LB9A 2OAQ1 4BLMA 4WN5A 3BECA 2J3WA 1I5QA 4GNUA 4HI4A 1GSXA 1G5UA 3BJNA 1M6KA 5FAPA 3HREA 3NDEA 3RFBA 1K38A 4EV4A 5DTTA 2QWSA 3IS2A 4OH0A 1W8QA 4X1LA 3ZG0A 1TF1A 2ZOIA 5HWTA 3HLFA 4F3LB 5EVIA 4NXGA 4WMCA 1K4FA 2H5SA 3A3EA 4KQDA 5HSQA 1W7FA 3GRJA 1Q2PA 1T1AA 3BYDA 1YMXA 2Q9NA 4DE1A 4WYYA 5F68A 3SS4A 4HJ4A 1OTAA 4E3NA 3U2AA 3QP1A 3G30A 2EXBA 4GCZA 1ZTUA 3SW1A 1H0MA 4GD6A 4G3WA 4O8GA 4EBPA 3U4LP 3ZVTA 4YFMA 3AGDA 3WS2A 2Z2LB 1KGFA 3G34A 2EWVA 4UA6A 3FC7A 4BBVA 3EOIA 1JWPA 4Y0TA 1YLPA 1T19A 3V3SA 3FKVA 4X68A 3HLEA 1VETB 3S22A 1JNUA 2FFFB 2VJWA 3IT9A 1XJ2A 4MEZA 4HJ3A 3LEZA 2BTFP 3UE6A 1K57A 2ZM8A 3G4PA 4MMNA 4EBLA 4DE0A 1OTDA 2P9VB 3PBTA 4O7DA 2Y2MA 4I39A 4R0QA 1IKGA 3H7WB 1PW8A 3IF6C 2O9CA 3OLOA 4E04A 4P85A 1H8ZA 5EVEA 5L8MA 4CPKA 4G3VA 2X02A 3BRMA 3LGOA 4QPRA 1FCMA 4HP4A 5HD5A 3A3IA 3O86A 1GSVA 4QHCA 3H82A 1BYWA 4Z9QA 3GVBA 3C38A 4GJ4A 1XKZA 3ZG9B 2XGNA 5FQ9A 5EM0A 2CMNA 4B88A 4U3TA 1EW0A 3KSFA 4OOLA 4YOFA 3IXGA 3A0RA 1G68A 4QWOA 3G35A 1FIKA 1FR1A 3EEHA 4N9LA 4LV1A 2L4RA 2Y91A 2WKQA 4WELA 1FCOA 5EFWA 3EGDC 4XXRA 1YKDA 1M40A 4EQ1A 5JYOA 4KQRA 3BQ8A 3IHBA 4HQAA 3VE3A 3PAGA 1EI5A 2QZ6A 3Q1FA 4ZRRA 2W0NA 4HIAA 3G6OA 1PRQA 4LRXC 2VK3A 2XEPA 4BWIA 3G31A 4QB8A 2KX6A 3IWOA 5FAQA 3M2KA 1FQGA 1BLPA 2XA7S 4YNRA 5FQQA 3E2LA 3LR5A 4EBNA 5DTSA 2OLUA 4E6WA 3OPHA 3MR0A 3SS5A 5E43A 3Q7ZA 1L0FA 4WF0A 2KDKA 3HUMA 3P7NA 3DTIA 5K5BA 1YSQA 2V1BA 2Y8HA 3TW8A 4F3LA 5A93A 5EV0A 1T1BA 2PU4A 3LO7A 3A3FA 3CWFA 2ZD8A 4P6BA 2QJ7A 3K3CA 3M6BA 4Y0OA 4LRZE 4S2NA 3S7NA 3HJKA 3N6IA 3PBNA 4EW7A 5F1GA 1LI0A 2PBYA 5TFQA 3DWZA 2ZQAA 4R23A 4N92A 4L0LA 4E3KA 1ODVA 1F98A 4PM5A 1TS0A 2YKHA 1MZUA 4R38A 1SKOB 1OT9A 1YLWA 1PFLA 5CGSA 2W1TA 2ZC3B 1DJAA 1VETA 2J3TC 3S7OA 4S2NC 3BFCA 5HDDA 1DJBA 4UA9A 4X6TA 3F1NB 1OJ5A 1W63Q 4OONA 4BL3A 2H28A 3EEAA 4JGPA 2GZAA 3OCLA 2O9AA 1MWSA 2B18A 2IWDA 1ALQA 1YT4A 2FFYA 1TDLA 2JKTM 1CEFA 2PHYA 1IYQA 1PI5A 3H7WA 1AXBA 2VV8A 1TD5A 2XDMA 1BZAA 2UWXA 1T18A 3MFDA 1CI8A 3BM6A 3CHWP 2V0WA 5FDHA 1IEMA 4R1GA 2HZ5A 3IQAA 4WZ5C 5CERA 2HPBA 4IBRA 4XUZA 2VGKA 3WS0A 3CITA 3W4OA 3OBFA 2C6WB 3OPLA 3VE4A 3TRCA 1O7EA 1K54A 3F1OA 4G3KA 4DDYA 2Z2MB 5GL9A 1H5XA 3KO6A 1K25A 4MDZA 4OOYA 4E3OA 2FH5A 3ISGA 5DKLA 3UE0A 3LCEA 3VOZA 3P09A 2QKPA 4HBUA 1ES2A 1SKFA 2O0YA 5E2EA 1KVLA 2WGIA 4N9KA 1NLYA 2PAVP 1MXOA 1LSVA 5HD3A 3B3XA 3A0VA 2A2LA 1MKMA 4F94A 4EEUA 1ZG4A 4FOFA 3MKFA 3B33A 3IF6B 4DJ2A 4OQIA 5DVAA 2Z6DA 4Q0IA 3LIDA 1KE3A 4PMAA 2BLSA 1DRMA 3ZG7B 3GSGA 3LI9A 3ZGAB 3CJMA 1KE4A 2A24A 2XFSA 4D2OA 1NLZA 2P08A 5F69A 1SZVA 5HAQA 4LLOB 5FSRA 2IWBA 1VHMA 2Z6CA 4X56A 3IH8A 2WZXA 4L9EA 3LY4A 2P7JA 2EWWA 1DJCA 4UAAA 4NKPA 2Y2PA 3CG5A 4C6YA 5EOEA 1MC0A 1YMSA 5EVLA 3Q7VA 4LENA 3UB5P 3DAVA 1N4OA 4H8RA 4OVDA 4QJGA 3K2NA 5FDSA 4IVKA 2L0WA 3S1YA 2VGLS 1F5MA 3H82B 5G4ZA 3BFEA 4GD8A 3UPPA 3V67A 4CQHA 4M4XA 1SHVA 3LYXA 3NECA 1BLSA 3FZCA 5HAIA 4OPYA 3QHYA 2JBFA 2INWA 2ZQDA 4PM6A 2VA0A 2J8YA 4IEDA 1YAXA 4I38A 3F1NA 3KYEA 1N9NA 3PBOA 4EU0A 4DF6A 1U60A 4B4ZA 3NI9A 3UE3A 3K3DA 4XUXA 1I2WA 4IJGA 4U0TA 3ZNYA 2IA2A 1STZA 1GHPA 5A90A 2ZC4B 3C4OA 1OT6A 4ZTKA 2E8IA 4P6ZM 3BLSA 4I5SA 1D1JA 3G32A 4HHDA 2VX8A 3NY4A 3UB7A 5TBMB 4B9OA 4PPRA 4Y2FA 1S6RA 4E3IA 4D60A 5GHXA 3UN7A 3PR6A 1PI4A 2WADA 2Y59A 5HWVA 3E98A 3M6HA 1WE4A 1S4RA 4E3JA 1YSPA 1F9IA 3BY9A 4BBTA 1ERMA 1ACFA 4WBGA 2HDSA 1VB6A 2I72A 2WAEA 5DF7A 4JGOA 1FOFA 3LIFA 5EVID 1BTLA 3NC8A 4WMCD 1K56A 1VM1A 3MQQA 3DW0A 4RX3A 4E3MA 4KG5A 1N9BA 1LL8A 5EPHA 2WYXA 1TEMA 2Y2LA 3Q82A 1S1YA 2W3HA 3AGFA 5DFXA 1F2KA 3ZYTA 3LUQA 2JKFA 4PM7A 1TS7A 2GX5A 2RCXA 4KG2A 4EETB 5E2FA 1XJ4A 5F6AA 3GECA 3SH8A 1RP5A 1YLTA 4KZ6A 2PDRA 5M18A 4MBHA 3IF6A 2HF6A 2XFTA 3LI8A 2EX6A 4UQIM 1XFNA 4EQIA 4S2MA 3LIEA 5KIZA 1E25A 1HTZA 2W1TB 1DP8A 1L0EA 1P0ZA 3SH7A 3NOUC 5CHJA 4YWZA 3HJIA 1CJFA 1GA9A 3UDIA 4O0PA 4CLCE 3LR4A 3HLBA 1ESIA 4GDNA 1CQAA 1D7EA 1J9MA 2PR5A 2H0YA 3OZHA 1ZC2A 5KSHA 3HLDA 5HDCA 1OPXA 2JCHA 3HCYA 5CGXA 2ZOHA 3PBQA 4LPZA 3D9YA 3O88A 3WS4A 3S4XA 5J7EA 4JXSA 2ZMVA 5LBRA 2XD1A 1BULA 2XR0A 4KZ9A 5DFYA 5A92A 4Y3IA 1K0KA 3IF5A 2FZ0A 4BD0A 1ES4A 1S4SA 3ICYA 4FCFA 2K7SA 4FTXA 4IVIA 4BD1A 2A49A 3VOYA 4O01A 5HL1A 1E4DA 5CTMA 4EWFA 3VSKA 2AVXA 1S0WA 1LL5A 3BLMA 5KSCA 1NYYA 3WRTA 3F1OB 3C8CA 3DTEA 5L07A 2Y2QA 1RGYA 4N1XA 1IKIA 1SDNA 2WGVA 4OPQA 4GW9A 4KZ7A 3G2ZA 1GHIA 1ZHHB 1FR6A 1Y54A 3BW6A 3W4PA 5J3WA 3V5MA 3FWLA 5GHZA 3HL9A 1ERQA 5F5YA 3RJUA 3S7QA 2R9XA 4PM9A 5HAPA 1IYOA 3BY8A 3MZEA 4KG6A 3MJQA 1P9RA 4NXFA 5CEDA 2ZQ9A 3MZFA 1BLHA 1OTEA 5GLAA 2HP5A 5HX9A 3T1RA 4OP5A 1MWUA 3IBRA 5TBMA 3VP2A 3FG8A 4BQMA 3MFXA 2WUQA 5E2GA 2OAP1 5KZHA 5CGWA 1N9OA 4H6JA 4R4SA 4ZBEA 5JYPA 2ZM2A 1H3QA 4GHIB 3BEBA 4OLDA 3KSHA 1H8MA 4JF4A 1KGGA 3BFFA 3LIAA 4FUWA 2A24B 3C7UA 4ZJ1A 1K4EA 4UA7A 2WKIA 3JVVA 2HDQA 3HLGA 3UMDA 2WKRA 5FI6A 2J3TD 3UMEA 1TDGA 3E0YA 1WYCA 3KYZA 3ZHHA 2ZMAA 3LEQA 3Q7VB 1G6AA 3LR0A 3UDXA 2J9OA 4PAUA 2JKRI 3R7WB 3VV4A 2R78A 3DTKA 5FEFA 3P01A 5CRFA 2EXAA 5G18A 2RL3A 1H8YA 5IU1A 5HARA 1OTBA 2OOLA 4JXVA 4MN6A 3T12B 3KX0X 2J80A 4QU3A 1A0KA 4ARZB 3GDIA 2X71A 4S2PA 4NXBA 1Y4OA 1JWZA 2VZWA 4WZ5A 3WWXA 4Y17A 4DE3A 2GDNA 4GN2A 4EUZA 5IHVA 2WKHA 1QMEA 4HESA 3ZDJA 3DWKA 5EE8A 1JVJA 4ETXA 2VV7A 5FAOA 5CEBA 3GTCA 4WEKA 1CF0A 4RQ9A 1L0GA 3W8KA 1PZOA 4IUKA 2QYBA 3O5YA 1BLCA 3MS6A 2V20A 3EQVA 3PAEA 3E4PA 3C30A 3CMZA 3N8LA 1NXYA 3T4SA 3VP0A 1LHYA 4GLQA 4KUKA 3IX8A 5KMWA 4KUOA 2G2WA 3A3JA 2B5RA 3D72A 2KOIA 1ONHA 3EWKA 3D3OA 1PNEA 1N9LA 2PD8A 4RVAA 1MWRA 2ZM0A 5GLDA 5TR7A 5HW3A 2Q0OA 3T1XA 4RA7A 2PD7A 3N8RA 3DBAA 1K6SA 5EOOA 2HDUA 2PRFA 5EUAA 1PYYA 5DF8A 3GMWA 3WS1A 3JPUA 2Y2HA 3RTYA 5HDSA 3UNWA 3PBRA 4DXCA 2W27A 1C3BA 4LCLA 5C5KA 2OV5A 4JBFA 5DTKA 3IXBA 3P98A 3T50A 1G6OA 3FYZA 3OPPA 3E4QA 1BT5A 3CUEA 2D01A 3HVFA 4LFUA 3BFDA 2XRNA 2W3GA 4GKUA 2XA7M 3FV7A 3MXQA 2PR6A 3V39A 1E3UA 2NUTC 1W79A 1Y28A 4LV3A 5HWWA 1OJGA 5L09A 4GHIA 2W1RA 1ESUA 2XF3A 4GOGA 3VP4A 1LSXA 3SS3A 3CI6A 4WUJA 2ZBBA 4QY6A 3D4FA 3UPNA 3QNBA 1GSWA 3ULFA 5A8BA 2W3FA 5CECA 4GS9A 5FL3A 1NZUA 3BFGA 1XA1A 3HLCA 3T4TA 2V9AA 2EX8A 3CUEC 1PWDA 1MBLA 3H9WA 2WKPA 3NOPC 4FSFA 2A3UA 1P97A 3MQOA 3E4OA 2Y2KA 1LI9A 4DMZA 1LL9A 2J9PA 4X25A 2Y2GA 3HLWA 1FILA 3S7PA 3T4QA 1HZOA 3R7WA 1GHMA 3HUNA 1DY6A 5GLCA 4JKTA 2E8JA 2O99A 4Y13A 3IH9A 5A91A 3T4KA 3UPOA 5I5LA 5AQAA 4U0XA 3T4JA 1L0DA 2JC7A 2V2FF 3NIAA 4ARZA 1RCJA 4OKPA 4ETZA 2V1ZA 3LICA 1YLYA 1TVFA 1XJ3A 4MBKA 4S2IA 4XT2B 4R4RA 2M7VA 1HLUP 1K55A 1NRJA 2L1MA 3N4IA 4P87A 2ZMFA 3T1QB 4X1MA 2R9WA 4NG2A 3OC2A 2HJEA 4DKIA 2J7VA 5I94A 2XROA 1KE0A 1PWGA 3BQAA 3FKWA 5DJUA 4E3LA 1UWNX 3N8SA 4HH3A 4EXOA 4LV0A 4JPMA 2EA9A 3UDFA 5G4YA 2DCFA 5FI2A 3TE8A 4HY8A 1J3WA 3IXDA 3MBZA 3KYQA 4H6JB 5J8XA 1XP4A 1DP9A 1K55C 1S1ZA 1I2SA 2PBDP 2QPNA 4KZ4A 4R3AA 5F82A 2XK1A 3ZVWA 1OMEA 4X69A 1FSYA 5CXWA 4ME4A 3VOLA 4E6XA 2ZL1B 3TOIA 1Z6FA 3QP4A 4C75A 1XX2A 1K56D 2ZC7A 1V9YA 3IHAA 3WS5A 4UHUA 3VMAA 3Q81A 1XJ6A 2XSSA 3VFHA 4OQGA 4R70A 4CLCC 3NULA 2Y79A 2G2UA 4Y0UA 2ZC6B 3UY6A 5FQKA 3CLOA 4S2KA 4EEPA 2WGWA 1G28A 2B95A 4EERA 3NBLA 3O3VA 1SDEA 3C7VA 4GDBA 4KZ5A 4NEED 4Y5FA 1QMFA 2Y2OA 1T1CA 1NY0A 2ZC5B 4M3KA 2Y4AA 3ZG8B 4Q0HA 4RX2A 4HBTA 4MN5A 1IOUA 4FH2A 1WYBA 4LGWA 5CX7A 2O9BA 4HEFA 4EUVA 2H0TA 4PKYG 3MQ0A 1LT0A 2VEAA 3FPVA 5FASA 1MY8A 3O87A 4R3JA 4NK3A 4N1HA 4Z1WA 5FA7A 4PM8A 3KSIA 5EVIC 2XH9A 3ITAA 4L9GA 2ZQ8A 5AVFA 3CAXA 4IBXA 3GQZA 1FSWA 1K6RA 2I9VA 3IXHA 4LV2A 1ONGA 2Y55A 3SOIA 2QHKA 4S2OA 2VV6A 1UWPX 2VGLM 3VP1A 3V50A 2XQZA 4EESA 2HDRA 1PZPA 2EX2A 5HFOA 3UB8A 2HGVA 3QNCA 5GLBA 3T4LA 3JVUA 2WKEA 5CTNA 3MSHA 3HBRA 1MPLA 5HL6A 2CC1A 1CK3A 4QD4A 4OP8A 2ZLYA 4II7A 4JLFA 4PKYA 4OOMA 5DJTA 2JKTI 2C5WB 4S2LA 4GB7A 3RH8B 3EGXC 2WK0A 3MXSA 1V9ZA 1NWZA 1K57C 4KENB 2HP9A 4XT2A 3ITBA 1MKIA 1TS8A 2Y2IA 3MKEA 5TGFA 1BUEA 5AQ7A 3IBJA 1LSWA 2ZJ9A 4JGQA 3UB6A 4DE2A 4Q8IA 1BSGA 1RGZA 3L9KA 3OCNA 4K08A 4HJ6A 4ESPA 3G2YA 4HH2A 3PXPA 2V0UA 4IHQA 4JF5A 1Z09A 3AGEA 2M1CA 3WRZA 4ID4A 2K2NA 4A5RA 2W3DA 1ZG6A 4ZJ3A 1IYSA 3RXWA 1XFQA 3IWQA 4DJ3A 4I3IA 5AQBA 2PYPA 5FQJA 3NHQA 4WLAA 1W5DA 3KSGA 4HOIA 4OPZA 5AVEA 2NUPC 1LLBA 3NJAA 1VEUB 3CZDA 2HP6A 2ZL1A 4GS9B 4LRYC 4OPRA 5L2FA 3N7WA 5FI7A 4I3JA 5HZHA 1DP6A 4KQQA 5D3OA 3VSLA 1JTDA 2LB5A 1X0OA 1NJ4A 4DXBA 2JKGA 2ZQ7A 3EQUA 3IX4A 4PHTA 4JF6A 2OWHA 4MCWA 4BBUA 2EFUA 2PYRA 2XD5A 1YQSA 2B02A 1L2SA 2WAFA 2V8CA 1VQQA 4JXWA 3T4OA 1GCEA 2VLGA 2JHEA 3UO9A 1ES5A 4YINA
chains in the Genus database with same CATH topology
4B9OA 4QPRA 2XRNA 2W3GA 4HP4A 5HD5A 2XA7M 3MXQA 2PR6A 4Y2FA 2NUTC 5IT5A 3PR6A 1Y28A 2OWJA 1W63M 5HWWA 1OJGA 5J4EA 1GSVA 4GHIA 2W1RA 3E98A 5HWVA 5DF9A 3H82A 1BYWA 1LSXA 3CI6A 3C38A 2HJ9C 2P04A 1S4RA 2K31A 4WUJA 2ZBBA 3F1PB 4GJ4A 1YSPA 1GSWA 1F9IA 3BY9A 2MJ6A 4BBTA 3ULFA 5A8BA 2W3FA 2CMNA 4GS9A 1EW0A 3KSFA 4OOLA 5FL3A 2M7UA 1VB6A 4YOFA 3A0RA 4JGOA 3T4TA 4HP9A 2V9AA 3LIFA 3EEHA 3CUEC 2L4RA 2WKQA 3MQQA 5MC7A 3H9WA 4WELA 2WKPA 3NOPC 4FSFA 1LL8A 1OTIA 1P97A 3UB9A 3MQOA 5EFWA 3EGDC 3E4OA 1S1YA 2W3HA 4DMZA 1YKDA 5DFXA 1UGUA 3LR3A 3ZYTA 3LUQA 4EQ1A 4CLCB 3BQ8A 3S7PA 3T4QA 1TS7A 2GX5A 4HQAA 1KOUA 3VE3A 3R7WA 3PHYA 2G7UA 3NOTC 4EETB 1S66L 5TJJA 5HPIA 4ZRRA 1XJ4A 2W0NA 4R6LA 5F6AA 4HIAA 3G6OA 3GECA 2O99A 4LRXC 4AFIA 2PDRA 4BMWA 4WEJA 3T4KA 4BWIA 5I5LA 4P6ZS 2HF6A 3A0SA 3T4JA 2KX6A 3LI8A 4UQIM 1XFNA 4ARZA 4ETZA 3LIEA 5KIZA 2XA7S 2W1TB 4YNRA 3LICA 1DP8A 1P0ZA 3FPWA 4I3AA 3LR5A 2DMWA 1XJ3A 3NOUC 4XT2B 4B93A 4YWZA 3BWLA 2M7VA 3HJIA 3MR0A 4O0PA 1NRJA 2L1MA 4CLCE 2ZMFA 2HV1A 3LR4A 3OC2A 2HJEA 5AJGA 2V1AA 2XROA 1D7EA 2PR5A 3BQAA 3IS2B 4WF0A 5DJUA 2KDKA 3P7NA 1UWNX 4HH3A 5K5BA 5KSHA 1YSQA 2V1BA 4EXOA 5HDCA 2Y8HA 3TW8A 4F3LA 1OPXA 1IFQA 3OOVA 2EA9A 3HCYA 3TJZC 3UB7A 1T1BA 2ZOHA 5G4YA 3PBQA 4LPZA 3CWFA 3PYPA 2PT7A 2KLIA 2QJ7A 3K3CA 3TE8A 5J7EA 2JN7A 4HY8A 4LRZE 5LBRA 2ZMVA 3S7NA 3HJKA 1TS6A 3PBNA 3KYQA 4H6JB 5DFYA 4EW7A 3R4KA 1DP9A 4Y3IA 4IUHA 1S1ZA 2FZ0A 1S4SA 3ICYA 4R3AA 2K7SA 3PBSA 4HNBA 3LFVA 4L0LA 4UEYA 4O01A 1ODVA 4ME4A 3VOLA 1F98A 1TS0A 2YKHA 2BASA 1MZUA 3F1OB 4R38A 3C8CA 1OT9A 1WA9A 1V9YA 2W1TA 1XJ6A 2D02A 4GW9A 2XSSA 2JKRM 2J3TC 3S7OA 4UQIS 5HDDA 1ZHHB 4R70A 4CLCC 3F1NB 1OJ5A 2Y79A 1W63Q 3BW6A 2H28A 3CLOA 5J3WA 3EEAA 4EEPA 4JGPA 1G28A 2GZAA 4EERA 3OCLA 2O9AA 5F5YA 2B18A 3S7QA 2JKTM 2PHYA 3BY8A 4NEED 4Y5FA 3H7WA 3MJQA 1P9RA 4NXFA 1T1CA 5DKKA 2VV8A 1TD5A 1OTEA 2QJ5A 3W2ZA 3IBRA 5TBMA 1T18A 2W3EA 3FG8A 4Q0HA 4KQOA 2V0WA 3MF0A 3MFXA 4MN5A 2OAP1 1IOUA 1N9OA 4H6JA 2GNXA 4MN7A 5CX7A 2O9BA 1H3QA 3ZQ5A 4EUVA 4GHIB 4PKYG 4JGRA 3KSHA 3MQ0A 1H8MA 3F1PA 1LT0A 2VEAA 3MMHA 3CITA 3FPVA 3OBFA 3LIAA 3LIBA 2A24B 3VE4A 2YKFA 4Z1WA 3TRCA 2GJ3A 3F1OA 3JVVA 3KSIA 4G3KA 3B42A 4L9GA 3UMDA 1P9WA 3KO6A 2WKRA 4MDZA 5AVFA 3CAXA 4WL9A 1D06A 2I9VA 2FH5A 2J3TD 2VKSA 3UMEA 3E0YA 5DKLA 4CLCD 3KYZA 1S67L 2QKPA 2QHKA 2VV6A 1UWPX 2VGLM 4DN0A 3B47A 4CLCA 3LR0A 2O0YA 4PAUA 3C2WA 4EESA 2JKRI 5IS1A 3R7WB 3UB8A 2R78A 1NLYA 3VV4A 2HGVA 3T4LA 3JVUA 3P01A 1LSVA 4NXEA 5HD3A 4BJPA 3A0VA 2A2LA 5HL6A 5HPFA 5IU1A 1MKMA 4EEUA 1OTBA 4FOFA 4II7A 4PKYA 3B33A 4L9FA 4OOMA 4DJ2A 2OOLA 5DJTA 2JKTI 4MN6A 3KX0X 2J80A 4Q0JA 3RH8B 2LB9A 2Z6DA 4Q0IA 4ARZB 3LIDA 3EGXC 3GDIA 2OAQ1 1V9ZA 1NWZA 1DRMA 4XT2A 4NXBA 4WN5A 3LI9A 1TS8A 2VZWA 2J3WA 3IBJA 4HI4A 3BJNA 2A24A 1GSXA 1LSWA 1NLZA 4JGQA 2P08A 3RFBA 3UB6A 5F69A 4LLOB 1VHMA 3OCNA 4ETXA 2VV7A 2QWSA 3IS2A 2Z6CA 4WEKA 4RQ9A 4K08A 4HJ6A 4IUKA 4HH2A 2QYBA 4L9EA 3PXPA 2V0UA 1TF1A 2P7JA 2ZOIA 3O5YA 4IHQA 5HWTA 3EQVA 2EWWA 4HHDA 4F3LB 2M1CA 4NKPA 2K2NA 4NXGA 3E4PA 3C30A 2W3DA 4KQDA 5HSQA 3T4SA 1MC0A 1T1AA 4GLQA 4KUKA 1XFQA 4KUOA 4DJ3A 3D72A 2KOIA 4I3IA 5F68A 3EWKA 3K2NA 3D3OA 1OTAA 4HJ4A 2PYPA 3U2AA 1N9LA 2L0WA 2PD8A 3NHQA 4WLAA 2VGLS 1F5MA 3H82B 3KSGA 5G4ZA 4GCZA 1ZTUA 3SW1A 4HOIA 3V67A 4CQHA 4G3WA 4M4XA 4O8GA 5AVEA 2NUPC 2PD7A 3NJAA 3LYXA 3DBAA 4GS9B 4LRYC 2EWVA 2INWA 4I3JA 5HZHA 3FC7A 1DP6A 3EOIA 4BBVA 1T19A 2LB5A 1X0OA 2VA0A 3RTYA 1JNUA 5HDSA 3EQUA 1YAXA 3PBRA 4I38A 2W27A 3F1NA 1N9NA 3PBOA 2VJWA 4EU0A 4PHTA 5C5KA 2OWHA 4MCWA 4BBUA 1XJ2A 4HJ3A 2PYRA 3UE3A 3UE6A 3K3DA 4MMNA 4IJGA 1OTDA 2B02A 3PBTA 2IA2A 4I39A 1STZA 3T50A 1G6OA 1OT6A 3H7WB 3T4OA 2VLGA 4P6ZM 3E4QA 2O9CA 3OLOA 4E04A 4I5SA 2JHEA 5L8MA 3CUEA 2VX8A 2D01A 4G3VA 5TBMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9O A;  4HP4 A;  5HD5 A;  3MXQ A;  2PR6 A;  1Y28 A;  2OWJ A;  5HWW A;  1OJG A;  5J4E A;  1GSV A;  4GHI A;  5HWV A;  3H82 A;  1BYW A;  1LSX A;  1S4R A;  4WUJ A;  2ZBB A;  3F1P B;  1GSW A;  1F9I A;  3BY9 A;  4BBT A;  3ULF A;  5A8B A;  2CMN A;  4GS9 A;  1EW0 A;  1VB6 A;  3A0R A;  4JGO A;  4HP9 A;  2V9A A;  3LIF A;  3EEH A;  2L4R A;  2WKQ A;  3MQQ A;  3H9W A;  2WKP A;  3NOP C;  1LL8 A;  1OTI A;  1P97 A;  3UB9 A;  3MQO A;  5EFW A;  3E4O A;  1S1Y A;  1UGU A;  3LUQ A;  4EQ1 A;  1TS7 A;  4HQA A;  1KOU A;  3VE3 A;  3PHY A;  3NOT C;  4EET B;  1S66 L;  1XJ4 A;  2W0N A;  4R6L A;  5F6A A;  4HIA A;  3G6O A;  3GEC A;  4LRX C;  2PDR A;  5I5L A;  3A0S A;  2KX6 A;  3LI8 A;  1XFN A;  3LIE A;  5KIZ A;  3LIC A;  1DP8 A;  1P0Z A;  4I3A A;  1XJ3 A;  3NOU C;  4XT2 B;  4YWZ A;  3BWL A;  3HJI A;  3MR0 A;  2L1M A;  2HV1 A;  2V1A A;  1D7E A;  2PR5 A;  3IS2 B;  5DJU A;  4WF0 A;  2KDK A;  3P7N A;  1UWN X;  4HH3 A;  2V1B A;  4EXO A;  5HDC A;  4F3L A;  2EA9 A;  1T1B A;  2ZOH A;  5G4Y A;  4LPZ A;  3CWF A;  3PYP A;  2QJ7 A;  3K3C A;  5J7E A;  2JN7 A;  4HY8 A;  4LRZ E;  3HJK A;  1TS6 A;  2D01 A;  4H6J B;  4EW7 A;  1DP9 A;  1S1Z A;  1S4S A;  3ICY A;  4R3A A;  2K7S A;  4HNB A;  1ODV A;  3VOL A;  1F98 A;  1TS0 A;  2YKH A;  2BAS A;  1MZU A;  3F1O B;  4R38 A;  3C8C A;  1OT9 A;  1WA9 A;  1V9Y A;  1XJ6 A;  2D02 A;  4GW9 A;  5HDD A;  4R70 A;  3F1N B;  1OJ5 A;  2H28 A;  3CLO A;  5J3W A;  4EEP A;  4JGP A;  1G28 A;  4EER A;  5F5Y A;  2PHY A;  3BY8 A;  3H7W A;  3MJQ A;  4NXF A;  1T1C A;  5DKK A;  2VV8 A;  1OTE A;  2QJ5 A;  3IBR A;  5TBM A;  1T18 A;  3FG8 A;  2V0W A;  3MFX A;  4MN5 A;  1N9O A;  4H6J A;  3ZQ5 A;  4GHI B;  4PKY G;  4JGR A;  3F1P A;  1LT0 A;  2VEA A;  3LIA A;  3LIB A;  2A24 B;  3VE4 A;  2YKF A;  2GJ3 A;  3F1O A;  4L9G A;  3UMD A;  2WKR A;  5AVF A;  3CAX A;  4WL9 A;  1D06 A;  2I9V A;  3UME A;  5DKL A;  1S67 L;  2QKP A;  2QHK A;  2VV6 A;  1UWP X;  3C2W A;  4EES A;  5IS1 A;  3UB8 A;  2R78 A;  1LSV A;  4NXE A;  5HD3 A;  3A0V A;  5IU1 A;  4EEU A;  1OTB A;  4PKY A;  3B33 A;  4L9F A;  4DJ2 A;  2OOL A;  5DJT A;  4MN6 A;  3KX0 X;  2J80 A;  3RH8 B;  2Z6D A;  3LID A;  3GDI A;  1V9Z A;  1NWZ A;  1DRM A;  4XT2 A;  4NXB A;  4WN5 A;  3LI9 A;  1TS8 A;  4HI4 A;  1GSX A;  2A24 A;  1LSW A;  4JGQ A;  3UB6 A;  5F69 A;  4LLO B;  2VV7 A;  2QWS A;  3IS2 A;  2Z6C A;  4RQ9 A;  4K08 A;  4HJ6 A;  4L9E A;  4HH2 A;  2V0U A;  2P7J A;  2ZOI A;  5HWT A;  4F3L B;  2M1C A;  4NXG A;  3E4P A;  4KQD A;  5HSQ A;  1T1A A;  4KUK A;  1XFQ A;  4KUO A;  4DJ3 A;  3D72 A;  4I3I A;  5F68 A;  3EWK A;  4HJ4 A;  1OTA A;  2PYP A;  1N9L A;  2L0W A;  2PD8 A;  3NHQ A;  4WLA A;  3H82 B;  5G4Z A;  4GCZ A;  3SW1 A;  4HOI A;  4M4X A;  5AVE A;  2PD7 A;  3NJA A;  3LYX A;  4GS9 B;  4LRY C;  2INW A;  4I3J A;  5HZH A;  3FC7 A;  1DP6 A;  4BBV A;  1T19 A;  1X0O A;  3RTY A;  1JNU A;  5HDS A;  4I38 A;  2W27 A;  3F1N A;  1N9N A;  2OWH A;  4BBU A;  1XJ2 A;  4HJ3 A;  2PYR A;  3UE6 A;  3K3D A;  1OTD A;  2B02 A;  4I39 A;  3T50 A;  1OT6 A;  3H7W B;  2VLG A;  3E4Q A;  3OLO A;  4E04 A;  4I5S A;  2JHE A;  4HHD A;  3UB7 A;  5TBM B; 
#chains in the Genus database with same CATH topology
 1ERO A;  5IT5 A;  3MZD A;  1HVB A;  2OWJ A;  1W63 M;  2V8F A;  5J4E A;  3VP3 A;  5DF9 A;  1PWC A;  5M19 A;  3CPT B;  2HJ9 C;  2P04 A;  2K31 A;  3I7J A;  3F1P B;  2XLN A;  2OSU A;  2MJ6 A;  4K91 A;  2M7U A;  1XXM A;  4HP9 A;  1CI9 A;  1XGI A;  4WM9 A;  5AQ9 A;  2QMI A;  4B4X A;  5MC7 A;  1ES3 A;  2JE5 A;  1OTI A;  3UB9 A;  1YM1 A;  4DDS A;  1KDW A;  4ZAM A;  1UGU A;  3LR3 A;  3UE1 A;  2P9V A;  4MLL A;  4NET A;  1JWV A;  1XA7 A;  4CLC B;  1YLJ A;  3DTM A;  3SZT A;  1NRF A;  1EWZ A;  1SCW A;  1KOU A;  5CHM A;  5BOH A;  3PHY A;  2G7U A;  3NOT C;  1S66 L;  4P0M A;  4X55 A;  5TJJ A;  5HPI A;  4R6L A;  1IEL A;  2X01 A;  2DRW A;  4RYE A;  4R3B A;  4AFI A;  4DRT A;  4BMW A;  4WEJ A;  3VFF A;  1O07 A;  3IX3 A;  4CJN A;  1IYP A;  4P6Z S;  5FQI A;  3A0S A;  2Y2J A;  1PW1 A;  1Q2Q A;  4Y7P A;  4K0W A;  4I3A A;  3FPW A;  2WZZ A;  3T1S A;  2DMW A;  4B93 A;  3BWL A;  5FAT A;  3NCK A;  5FQM A;  2Q9M A;  2HV1 A;  1KDS A;  1XPB A;  4GZB A;  5AJG A;  4BEN A;  2V1A A;  2WGW B;  3IS2 B;  3QP6 A;  2EFX A;  2Y2N A;  1JTG A;  3ZNT A;  1W8Y A;  4OLG A;  1IFQ A;  3OOV A;  5EVI B;  3TJZ C;  1XGJ A;  1CEG A;  3RXX A;  3ZCZ A;  3PYP A;  1E3U D;  2PT7 A;  2KLI A;  4KZA A;  5EM1 A;  2JN7 A;  3MXR A;  1GA0 A;  1TS6 A;  3IWI A;  5U47 A;  4KZ3 A;  1AWI A;  3R4K A;  5M1A A;  4S2J A;  4IUH A;  3PBS A;  1K54 C;  4HNB A;  3LFV A;  2IWC A;  3QP2 A;  4UEY A;  1NZO A;  1VEU A;  4QY5 A;  3PTE A;  2EX9 A;  2P74 A;  2BAS A;  2VGJ A;  1NYM A;  1PIO A;  5FEG A;  1WA9 A;  3JYI A;  4OQ0 A;  4WZ4 A;  4C3Q A;  2D02 A;  2JKR M;  3C4P A;  4UQI S;  2OLV A;  3LY3 A;  2PU2 A;  2BG1 A;  4OQH A;  4KZB A;  3E2K A;  2ACG A;  1YLZ A;  1FCN A;  3ZFZ A;  3A3D A;  1KVM A;  2UV0 E;  4ZDX A;  5DKK A;  3TG9 A;  3V3R A;  2QJ5 A;  3W2Z A;  3C5A A;  1ZKJ A;  2W3E A;  4KQO A;  3QP5 A;  3MF0 A;  2GNX A;  4MN7 A;  5GHY A;  3SH9 A;  3W4Q A;  4KZ8 A;  3ZQ5 A;  4JXG A;  4MBF A;  4JGR A;  4Y15 A;  3CPT A;  3HUO A;  3F1P A;  3NDG A;  3GR2 A;  3MMH A;  5EEC A;  5CHU A;  1KGE A;  3LIB A;  2YKF A;  5F83 A;  5E2H A;  3OPR A;  2GJ3 A;  1L3L A;  1SKO A;  2ZQC A;  4ZJ2 A;  3B42 A;  1P9W A;  3ZG5 A;  4WL9 A;  1D06 A;  2VKS A;  5L10 A;  4BL2 A;  3M2J A;  4CLC D;  3GV9 A;  1S67 L;  3TSG A;  4DN0 A;  3B47 A;  4MNR A;  4CLC A;  3C2W A;  3Q07 A;  4X53 A;  3L7H A;  5IS1 A;  4K0X A;  4FD8 A;  4LCM A;  4NXE A;  4BJP A;  5F1F A;  5HPF A;  4FH4 A;  1YPR A;  4L9F A;  1HD8 A;  2DNS A;  3QP8 A;  2H10 A;  4Q0J A;  1MWT A;  2LB9 A;  2OAQ 1;  4BLM A;  4WN5 A;  3BEC A;  2J3W A;  1I5Q A;  4GNU A;  4HI4 A;  1GSX A;  1G5U A;  3BJN A;  1M6K A;  5FAP A;  3HRE A;  3NDE A;  3RFB A;  1K38 A;  4EV4 A;  5DTT A;  2QWS A;  3IS2 A;  4OH0 A;  1W8Q A;  4X1L A;  3ZG0 A;  1TF1 A;  2ZOI A;  5HWT A;  3HLF A;  4F3L B;  5EVI A;  4NXG A;  4WMC A;  1K4F A;  2H5S A;  3A3E A;  4KQD A;  5HSQ A;  1W7F A;  3GRJ A;  1Q2P A;  1T1A A;  3BYD A;  1YMX A;  2Q9N A;  4DE1 A;  4WYY A;  5F68 A;  3SS4 A;  4HJ4 A;  1OTA A;  4E3N A;  3U2A A;  3QP1 A;  3G30 A;  2EXB A;  4GCZ A;  1ZTU A;  3SW1 A;  1H0M A;  4GD6 A;  4G3W A;  4O8G A;  4EBP A;  3U4L P;  3ZVT A;  4YFM A;  3AGD A;  3WS2 A;  2Z2L B;  1KGF A;  3G34 A;  2EWV A;  4UA6 A;  3FC7 A;  4BBV A;  3EOI A;  1JWP A;  4Y0T A;  1YLP A;  1T19 A;  3V3S A;  3FKV A;  4X68 A;  3HLE A;  1VET B;  3S22 A;  1JNU A;  2FFF B;  2VJW A;  3IT9 A;  1XJ2 A;  4MEZ A;  4HJ3 A;  3LEZ A;  2BTF P;  3UE6 A;  1K57 A;  2ZM8 A;  3G4P A;  4MMN A;  4EBL A;  4DE0 A;  1OTD A;  2P9V B;  3PBT A;  4O7D A;  2Y2M A;  4I39 A;  4R0Q A;  1IKG A;  3H7W B;  1PW8 A;  3IF6 C;  2O9C A;  3OLO A;  4E04 A;  4P85 A;  1H8Z A;  5EVE A;  5L8M A;  4CPK A;  4G3V A;  2X02 A;  3BRM A;  3LGO A;  4QPR A;  1FCM A;  4HP4 A;  5HD5 A;  3A3I A;  3O86 A;  1GSV A;  4QHC A;  3H82 A;  1BYW A;  4Z9Q A;  3GVB A;  3C38 A;  4GJ4 A;  1XKZ A;  3ZG9 B;  2XGN A;  5FQ9 A;  5EM0 A;  2CMN A;  4B88 A;  4U3T A;  1EW0 A;  3KSF A;  4OOL A;  4YOF A;  3IXG A;  3A0R A;  1G68 A;  4QWO A;  3G35 A;  1FIK A;  1FR1 A;  3EEH A;  4N9L A;  4LV1 A;  2L4R A;  2Y91 A;  2WKQ A;  4WEL A;  1FCO A;  5EFW A;  3EGD C;  4XXR A;  1YKD A;  1M40 A;  4EQ1 A;  5JYO A;  4KQR A;  3BQ8 A;  3IHB A;  4HQA A;  3VE3 A;  3PAG A;  1EI5 A;  2QZ6 A;  3Q1F A;  4ZRR A;  2W0N A;  4HIA A;  3G6O A;  1PRQ A;  4LRX C;  2VK3 A;  2XEP A;  4BWI A;  3G31 A;  4QB8 A;  2KX6 A;  3IWO A;  5FAQ A;  3M2K A;  1FQG A;  1BLP A;  2XA7 S;  4YNR A;  5FQQ A;  3E2L A;  3LR5 A;  4EBN A;  5DTS A;  2OLU A;  4E6W A;  3OPH A;  3MR0 A;  3SS5 A;  5E43 A;  3Q7Z A;  1L0F A;  4WF0 A;  2KDK A;  3HUM A;  3P7N A;  3DTI A;  5K5B A;  1YSQ A;  2V1B A;  2Y8H A;  3TW8 A;  4F3L A;  5A93 A;  5EV0 A;  1T1B A;  2PU4 A;  3LO7 A;  3A3F A;  3CWF A;  2ZD8 A;  4P6B A;  2QJ7 A;  3K3C A;  3M6B A;  4Y0O A;  4LRZ E;  4S2N A;  3S7N A;  3HJK A;  3N6I A;  3PBN A;  4EW7 A;  5F1G A;  1LI0 A;  2PBY A;  5TFQ A;  3DWZ A;  2ZQA A;  4R23 A;  4N92 A;  4L0L A;  4E3K A;  1ODV A;  1F98 A;  4PM5 A;  1TS0 A;  2YKH A;  1MZU A;  4R38 A;  1SKO B;  1OT9 A;  1YLW A;  1PFL A;  5CGS A;  2W1T A;  2ZC3 B;  1DJA A;  1VET A;  2J3T C;  3S7O A;  4S2N C;  3BFC A;  5HDD A;  1DJB A;  4UA9 A;  4X6T A;  3F1N B;  1OJ5 A;  1W63 Q;  4OON A;  4BL3 A;  2H28 A;  3EEA A;  4JGP A;  2GZA A;  3OCL A;  2O9A A;  1MWS A;  2B18 A;  2IWD A;  1ALQ A;  1YT4 A;  2FFY A;  1TDL A;  2JKT M;  1CEF A;  2PHY A;  1IYQ A;  1PI5 A;  3H7W A;  1AXB A;  2VV8 A;  1TD5 A;  2XDM A;  1BZA A;  2UWX A;  1T18 A;  3MFD A;  1CI8 A;  3BM6 A;  3CHW P;  2V0W A;  5FDH A;  1IEM A;  4R1G A;  2HZ5 A;  3IQA A;  4WZ5 C;  5CER A;  2HPB A;  4IBR A;  4XUZ A;  2VGK A;  3WS0 A;  3CIT A;  3W4O A;  3OBF A;  2C6W B;  3OPL A;  3VE4 A;  3TRC A;  1O7E A;  1K54 A;  3F1O A;  4G3K A;  4DDY A;  2Z2M B;  5GL9 A;  1H5X A;  3KO6 A;  1K25 A;  4MDZ A;  4OOY A;  4E3O A;  2FH5 A;  3ISG A;  5DKL A;  3UE0 A;  3LCE A;  3VOZ A;  3P09 A;  2QKP A;  4HBU A;  1ES2 A;  1SKF A;  2O0Y A;  5E2E A;  1KVL A;  2WGI A;  4N9K A;  1NLY A;  2PAV P;  1MXO A;  1LSV A;  5HD3 A;  3B3X A;  3A0V A;  2A2L A;  1MKM A;  4F94 A;  4EEU A;  1ZG4 A;  4FOF A;  3MKF A;  3B33 A;  3IF6 B;  4DJ2 A;  4OQI A;  5DVA A;  2Z6D A;  4Q0I A;  3LID A;  1KE3 A;  4PMA A;  2BLS A;  1DRM A;  3ZG7 B;  3GSG A;  3LI9 A;  3ZGA B;  3CJM A;  1KE4 A;  2A24 A;  2XFS A;  4D2O A;  1NLZ A;  2P08 A;  5F69 A;  1SZV A;  5HAQ A;  4LLO B;  5FSR A;  2IWB A;  1VHM A;  2Z6C A;  4X56 A;  3IH8 A;  2WZX A;  4L9E A;  3LY4 A;  2P7J A;  2EWW A;  1DJC A;  4UAA A;  4NKP A;  2Y2P A;  3CG5 A;  4C6Y A;  5EOE A;  1MC0 A;  1YMS A;  5EVL A;  3Q7V A;  4LEN A;  3UB5 P;  3DAV A;  1N4O A;  4H8R A;  4OVD A;  4QJG A;  3K2N A;  5FDS A;  4IVK A;  2L0W A;  3S1Y A;  2VGL S;  1F5M A;  3H82 B;  5G4Z A;  3BFE A;  4GD8 A;  3UPP A;  3V67 A;  4CQH A;  4M4X A;  1SHV A;  3LYX A;  3NEC A;  1BLS A;  3FZC A;  5HAI A;  4OPY A;  3QHY A;  2JBF A;  2INW A;  2ZQD A;  4PM6 A;  2VA0 A;  2J8Y A;  4IED A;  1YAX A;  4I38 A;  3F1N A;  3KYE A;  1N9N A;  3PBO A;  4EU0 A;  4DF6 A;  1U60 A;  4B4Z A;  3NI9 A;  3UE3 A;  3K3D A;  4XUX A;  1I2W A;  4IJG A;  4U0T A;  3ZNY A;  2IA2 A;  1STZ A;  1GHP A;  5A90 A;  2ZC4 B;  3C4O A;  1OT6 A;  4ZTK A;  2E8I A;  4P6Z M;  3BLS A;  4I5S A;  1D1J A;  3G32 A;  4HHD A;  2VX8 A;  3NY4 A;  3UB7 A;  5TBM B;  4B9O A;  4PPR A;  4Y2F A;  1S6R A;  4E3I A;  4D60 A;  5GHX A;  3UN7 A;  3PR6 A;  1PI4 A;  2WAD A;  2Y59 A;  5HWV A;  3E98 A;  3M6H A;  1WE4 A;  1S4R A;  4E3J A;  1YSP A;  1F9I A;  3BY9 A;  4BBT A;  1ERM A;  1ACF A;  4WBG A;  2HDS A;  1VB6 A;  2I72 A;  2WAE A;  5DF7 A;  4JGO A;  1FOF A;  3LIF A;  5EVI D;  1BTL A;  3NC8 A;  4WMC D;  1K56 A;  1VM1 A;  3MQQ A;  3DW0 A;  4RX3 A;  4E3M A;  4KG5 A;  1N9B A;  1LL8 A;  5EPH A;  2WYX A;  1TEM A;  2Y2L A;  3Q82 A;  1S1Y A;  2W3H A;  3AGF A;  5DFX A;  1F2K A;  3ZYT A;  3LUQ A;  2JKF A;  4PM7 A;  1TS7 A;  2GX5 A;  2RCX A;  4KG2 A;  4EET B;  5E2F A;  1XJ4 A;  5F6A A;  3GEC A;  3SH8 A;  1RP5 A;  1YLT A;  4KZ6 A;  2PDR A;  5M18 A;  4MBH A;  3IF6 A;  2HF6 A;  2XFT A;  3LI8 A;  2EX6 A;  4UQI M;  1XFN A;  4EQI A;  4S2M A;  3LIE A;  5KIZ A;  1E25 A;  1HTZ A;  2W1T B;  1DP8 A;  1L0E A;  1P0Z A;  3SH7 A;  3NOU C;  5CHJ A;  4YWZ A;  3HJI A;  1CJF A;  1GA9 A;  3UDI A;  4O0P A;  4CLC E;  3LR4 A;  3HLB A;  1ESI A;  4GDN A;  1CQA A;  1D7E A;  1J9M A;  2PR5 A;  2H0Y A;  3OZH A;  1ZC2 A;  5KSH A;  3HLD A;  5HDC A;  1OPX A;  2JCH A;  3HCY A;  5CGX A;  2ZOH A;  3PBQ A;  4LPZ A;  3D9Y A;  3O88 A;  3WS4 A;  3S4X A;  5J7E A;  4JXS A;  2ZMV A;  5LBR A;  2XD1 A;  1BUL A;  2XR0 A;  4KZ9 A;  5DFY A;  5A92 A;  4Y3I A;  1K0K A;  3IF5 A;  2FZ0 A;  4BD0 A;  1ES4 A;  1S4S A;  3ICY A;  4FCF A;  2K7S A;  4FTX A;  4IVI A;  4BD1 A;  2A49 A;  3VOY A;  4O01 A;  5HL1 A;  1E4D A;  5CTM A;  4EWF A;  3VSK A;  2AVX A;  1S0W A;  1LL5 A;  3BLM A;  5KSC A;  1NYY A;  3WRT A;  3F1O B;  3C8C A;  3DTE A;  5L07 A;  2Y2Q A;  1RGY A;  4N1X A;  1IKI A;  1SDN A;  2WGV A;  4OPQ A;  4GW9 A;  4KZ7 A;  3G2Z A;  1GHI A;  1ZHH B;  1FR6 A;  1Y54 A;  3BW6 A;  3W4P A;  5J3W A;  3V5M A;  3FWL A;  5GHZ A;  3HL9 A;  1ERQ A;  5F5Y A;  3RJU A;  3S7Q A;  2R9X A;  4PM9 A;  5HAP A;  1IYO A;  3BY8 A;  3MZE A;  4KG6 A;  3MJQ A;  1P9R A;  4NXF A;  5CED A;  2ZQ9 A;  3MZF A;  1BLH A;  1OTE A;  5GLA A;  2HP5 A;  5HX9 A;  3T1R A;  4OP5 A;  1MWU A;  3IBR A;  5TBM A;  3VP2 A;  3FG8 A;  4BQM A;  3MFX A;  2WUQ A;  5E2G A;  2OAP 1;  5KZH A;  5CGW A;  1N9O A;  4H6J A;  4R4S A;  4ZBE A;  5JYP A;  2ZM2 A;  1H3Q A;  4GHI B;  3BEB A;  4OLD A;  3KSH A;  1H8M A;  4JF4 A;  1KGG A;  3BFF A;  3LIA A;  4FUW A;  2A24 B;  3C7U A;  4ZJ1 A;  1K4E A;  4UA7 A;  2WKI A;  3JVV A;  2HDQ A;  3HLG A;  3UMD A;  2WKR A;  5FI6 A;  2J3T D;  3UME A;  1TDG A;  3E0Y A;  1WYC A;  3KYZ A;  3ZHH A;  2ZMA A;  3LEQ A;  3Q7V B;  1G6A A;  3LR0 A;  3UDX A;  2J9O A;  4PAU A;  2JKR I;  3R7W B;  3VV4 A;  2R78 A;  3DTK A;  5FEF A;  3P01 A;  5CRF A;  2EXA A;  5G18 A;  2RL3 A;  1H8Y A;  5IU1 A;  5HAR A;  1OTB A;  2OOL A;  4JXV A;  4MN6 A;  3T12 B;  3KX0 X;  2J80 A;  4QU3 A;  1A0K A;  4ARZ B;  3GDI A;  2X71 A;  4S2P A;  4NXB A;  1Y4O A;  1JWZ A;  2VZW A;  4WZ5 A;  3WWX A;  4Y17 A;  4DE3 A;  2GDN A;  4GN2 A;  4EUZ A;  5IHV A;  2WKH A;  1QME A;  4HES A;  3ZDJ A;  3DWK A;  5EE8 A;  1JVJ A;  4ETX A;  2VV7 A;  5FAO A;  5CEB A;  3GTC A;  4WEK A;  1CF0 A;  4RQ9 A;  1L0G A;  3W8K A;  1PZO A;  4IUK A;  2QYB A;  3O5Y A;  1BLC A;  3MS6 A;  2V20 A;  3EQV A;  3PAE A;  3E4P A;  3C30 A;  3CMZ A;  3N8L A;  1NXY A;  3T4S A;  3VP0 A;  1LHY A;  4GLQ A;  4KUK A;  3IX8 A;  5KMW A;  4KUO A;  2G2W A;  3A3J A;  2B5R A;  3D72 A;  2KOI A;  1ONH A;  3EWK A;  3D3O A;  1PNE A;  1N9L A;  2PD8 A;  4RVA A;  1MWR A;  2ZM0 A;  5GLD A;  5TR7 A;  5HW3 A;  2Q0O A;  3T1X A;  4RA7 A;  2PD7 A;  3N8R A;  3DBA A;  1K6S A;  5EOO A;  2HDU A;  2PRF A;  5EUA A;  1PYY A;  5DF8 A;  3GMW A;  3WS1 A;  3JPU A;  2Y2H A;  3RTY A;  5HDS A;  3UNW A;  3PBR A;  4DXC A;  2W27 A;  1C3B A;  4LCL A;  5C5K A;  2OV5 A;  4JBF A;  5DTK A;  3IXB A;  3P98 A;  3T50 A;  1G6O A;  3FYZ A;  3OPP A;  3E4Q A;  1BT5 A;  3CUE A;  2D01 A;  3HVF A;  4LFU A;  3BFD A;  2XRN A;  2W3G A;  4GKU A;  2XA7 M;  3FV7 A;  3MXQ A;  2PR6 A;  3V39 A;  1E3U A;  2NUT C;  1W79 A;  1Y28 A;  4LV3 A;  5HWW A;  1OJG A;  5L09 A;  4GHI A;  2W1R A;  1ESU A;  2XF3 A;  4GOG A;  3VP4 A;  1LSX A;  3SS3 A;  3CI6 A;  4WUJ A;  2ZBB A;  4QY6 A;  3D4F A;  3UPN A;  3QNB A;  1GSW A;  3ULF A;  5A8B A;  2W3F A;  5CEC A;  4GS9 A;  5FL3 A;  1NZU A;  3BFG A;  1XA1 A;  3HLC A;  3T4T A;  2V9A A;  2EX8 A;  3CUE C;  1PWD A;  1MBL A;  3H9W A;  2WKP A;  3NOP C;  4FSF A;  2A3U A;  1P97 A;  3MQO A;  3E4O A;  2Y2K A;  1LI9 A;  4DMZ A;  1LL9 A;  2J9P A;  4X25 A;  2Y2G A;  3HLW A;  1FIL A;  3S7P A;  3T4Q A;  1HZO A;  3R7W A;  1GHM A;  3HUN A;  1DY6 A;  5GLC A;  4JKT A;  2E8J A;  2O99 A;  4Y13 A;  3IH9 A;  5A91 A;  3T4K A;  3UPO A;  5I5L A;  5AQA A;  4U0X A;  3T4J A;  1L0D A;  2JC7 A;  2V2F F;  3NIA A;  4ARZ A;  1RCJ A;  4OKP A;  4ETZ A;  2V1Z A;  3LIC A;  1YLY A;  1TVF A;  1XJ3 A;  4MBK A;  4S2I A;  4XT2 B;  4R4R A;  2M7V A;  1HLU P;  1K55 A;  1NRJ A;  2L1M A;  3N4I A;  4P87 A;  2ZMF A;  3T1Q B;  4X1M A;  2R9W A;  4NG2 A;  3OC2 A;  2HJE A;  4DKI A;  2J7V A;  5I94 A;  2XRO A;  1KE0 A;  1PWG A;  3BQA A;  3FKW A;  5DJU A;  4E3L A;  1UWN X;  3N8S A;  4HH3 A;  4EXO A;  4LV0 A;  4JPM A;  2EA9 A;  3UDF A;  5G4Y A;  2DCF A;  5FI2 A;  3TE8 A;  4HY8 A;  1J3W A;  3IXD A;  3MBZ A;  3KYQ A;  4H6J B;  5J8X A;  1XP4 A;  1DP9 A;  1K55 C;  1S1Z A;  1I2S A;  2PBD P;  2QPN A;  4KZ4 A;  4R3A A;  5F82 A;  2XK1 A;  3ZVW A;  1OME A;  4X69 A;  1FSY A;  5CXW A;  4ME4 A;  3VOL A;  4E6X A;  2ZL1 B;  3TOI A;  1Z6F A;  3QP4 A;  4C75 A;  1XX2 A;  1K56 D;  2ZC7 A;  1V9Y A;  3IHA A;  3WS5 A;  4UHU A;  3VMA A;  3Q81 A;  1XJ6 A;  2XSS A;  3VFH A;  4OQG A;  4R70 A;  4CLC C;  3NUL A;  2Y79 A;  2G2U A;  4Y0U A;  2ZC6 B;  3UY6 A;  5FQK A;  3CLO A;  4S2K A;  4EEP A;  2WGW A;  1G28 A;  2B95 A;  4EER A;  3NBL A;  3O3V A;  1SDE A;  3C7V A;  4GDB A;  4KZ5 A;  4NEE D;  4Y5F A;  1QMF A;  2Y2O A;  1T1C A;  1NY0 A;  2ZC5 B;  4M3K A;  2Y4A A;  3ZG8 B;  4Q0H A;  4RX2 A;  4HBT A;  4MN5 A;  1IOU A;  4FH2 A;  1WYB A;  4LGW A;  5CX7 A;  2O9B A;  4HEF A;  4EUV A;  2H0T A;  4PKY G;  3MQ0 A;  1LT0 A;  2VEA A;  3FPV A;  5FAS A;  1MY8 A;  3O87 A;  4R3J A;  4NK3 A;  4N1H A;  4Z1W A;  5FA7 A;  4PM8 A;  3KSI A;  5EVI C;  2XH9 A;  3ITA A;  4L9G A;  2ZQ8 A;  5AVF A;  3CAX A;  4IBX A;  3GQZ A;  1FSW A;  1K6R A;  2I9V A;  3IXH A;  4LV2 A;  1ONG A;  2Y55 A;  3SOI A;  2QHK A;  4S2O A;  2VV6 A;  1UWP X;  2VGL M;  3VP1 A;  3V50 A;  2XQZ A;  4EES A;  2HDR A;  1PZP A;  2EX2 A;  5HFO A;  3UB8 A;  2HGV A;  3QNC A;  5GLB A;  3T4L A;  3JVU A;  2WKE A;  5CTN A;  3MSH A;  3HBR A;  1MPL A;  5HL6 A;  2CC1 A;  1CK3 A;  4QD4 A;  4OP8 A;  2ZLY A;  4II7 A;  4JLF A;  4PKY A;  4OOM A;  5DJT A;  2JKT I;  2C5W B;  4S2L A;  4GB7 A;  3RH8 B;  3EGX C;  2WK0 A;  3MXS A;  1V9Z A;  1NWZ A;  1K57 C;  4KEN B;  2HP9 A;  4XT2 A;  3ITB A;  1MKI A;  1TS8 A;  2Y2I A;  3MKE A;  5TGF A;  1BUE A;  5AQ7 A;  3IBJ A;  1LSW A;  2ZJ9 A;  4JGQ A;  3UB6 A;  4DE2 A;  4Q8I A;  1BSG A;  1RGZ A;  3L9K A;  3OCN A;  4K08 A;  4HJ6 A;  4ESP A;  3G2Y A;  4HH2 A;  3PXP A;  2V0U A;  4IHQ A;  4JF5 A;  1Z09 A;  3AGE A;  2M1C A;  3WRZ A;  4ID4 A;  2K2N A;  4A5R A;  2W3D A;  1ZG6 A;  4ZJ3 A;  1IYS A;  3RXW A;  1XFQ A;  3IWQ A;  4DJ3 A;  4I3I A;  5AQB A;  2PYP A;  5FQJ A;  3NHQ A;  4WLA A;  1W5D A;  3KSG A;  4HOI A;  4OPZ A;  5AVE A;  2NUP C;  1LLB A;  3NJA A;  1VEU B;  3CZD A;  2HP6 A;  2ZL1 A;  4GS9 B;  4LRY C;  4OPR A;  5L2F A;  3N7W A;  5FI7 A;  4I3J A;  5HZH A;  1DP6 A;  4KQQ A;  5D3O A;  3VSL A;  1JTD A;  2LB5 A;  1X0O A;  1NJ4 A;  4DXB A;  2JKG A;  2ZQ7 A;  3EQU A;  3IX4 A;  4PHT A;  4JF6 A;  2OWH A;  4MCW A;  4BBU A;  2EFU A;  2PYR A;  2XD5 A;  1YQS A;  2B02 A;  1L2S A;  2WAF A;  2V8C A;  1VQQ A;  4JXW A;  3T4O A;  1GCE A;  2VLG A;  2JHE A;  3UO9 A;  1ES5 A;  4YIN A; 
#chains in the Genus database with same CATH homology
 4B9O A;  4QPR A;  2XRN A;  2W3G A;  4HP4 A;  5HD5 A;  2XA7 M;  3MXQ A;  2PR6 A;  4Y2F A;  2NUT C;  5IT5 A;  3PR6 A;  1Y28 A;  2OWJ A;  1W63 M;  5HWW A;  1OJG A;  5J4E A;  1GSV A;  4GHI A;  2W1R A;  3E98 A;  5HWV A;  5DF9 A;  3H82 A;  1BYW A;  1LSX A;  3CI6 A;  3C38 A;  2HJ9 C;  2P04 A;  1S4R A;  2K31 A;  4WUJ A;  2ZBB A;  3F1P B;  4GJ4 A;  1YSP A;  1GSW A;  1F9I A;  3BY9 A;  2MJ6 A;  4BBT A;  3ULF A;  5A8B A;  2W3F A;  2CMN A;  4GS9 A;  1EW0 A;  3KSF A;  4OOL A;  5FL3 A;  2M7U A;  1VB6 A;  4YOF A;  3A0R A;  4JGO A;  3T4T A;  4HP9 A;  2V9A A;  3LIF A;  3EEH A;  3CUE C;  2L4R A;  2WKQ A;  3MQQ A;  5MC7 A;  3H9W A;  4WEL A;  2WKP A;  3NOP C;  4FSF A;  1LL8 A;  1OTI A;  1P97 A;  3UB9 A;  3MQO A;  5EFW A;  3EGD C;  3E4O A;  1S1Y A;  2W3H A;  4DMZ A;  1YKD A;  5DFX A;  1UGU A;  3LR3 A;  3ZYT A;  3LUQ A;  4EQ1 A;  4CLC B;  3BQ8 A;  3S7P A;  3T4Q A;  1TS7 A;  2GX5 A;  4HQA A;  1KOU A;  3VE3 A;  3R7W A;  3PHY A;  2G7U A;  3NOT C;  4EET B;  1S66 L;  5TJJ A;  5HPI A;  4ZRR A;  1XJ4 A;  2W0N A;  4R6L A;  5F6A A;  4HIA A;  3G6O A;  3GEC A;  2O99 A;  4LRX C;  4AFI A;  2PDR A;  4BMW A;  4WEJ A;  3T4K A;  4BWI A;  5I5L A;  4P6Z S;  2HF6 A;  3A0S A;  3T4J A;  2KX6 A;  3LI8 A;  4UQI M;  1XFN A;  4ARZ A;  4ETZ A;  3LIE A;  5KIZ A;  2XA7 S;  2W1T B;  4YNR A;  3LIC A;  1DP8 A;  1P0Z A;  3FPW A;  4I3A A;  3LR5 A;  2DMW A;  1XJ3 A;  3NOU C;  4XT2 B;  4B93 A;  4YWZ A;  3BWL A;  2M7V A;  3HJI A;  3MR0 A;  4O0P A;  1NRJ A;  2L1M A;  4CLC E;  2ZMF A;  2HV1 A;  3LR4 A;  3OC2 A;  2HJE A;  5AJG A;  2V1A A;  2XRO A;  1D7E A;  2PR5 A;  3BQA A;  3IS2 B;  4WF0 A;  5DJU A;  2KDK A;  3P7N A;  1UWN X;  4HH3 A;  5K5B A;  5KSH A;  1YSQ A;  2V1B A;  4EXO A;  5HDC A;  2Y8H A;  3TW8 A;  4F3L A;  1OPX A;  1IFQ A;  3OOV A;  2EA9 A;  3HCY A;  3TJZ C;  3UB7 A;  1T1B A;  2ZOH A;  5G4Y A;  3PBQ A;  4LPZ A;  3CWF A;  3PYP A;  2PT7 A;  2KLI A;  2QJ7 A;  3K3C A;  3TE8 A;  5J7E A;  2JN7 A;  4HY8 A;  4LRZ E;  5LBR A;  2ZMV A;  3S7N A;  3HJK A;  1TS6 A;  3PBN A;  3KYQ A;  4H6J B;  5DFY A;  4EW7 A;  3R4K A;  1DP9 A;  4Y3I A;  4IUH A;  1S1Z A;  2FZ0 A;  1S4S A;  3ICY A;  4R3A A;  2K7S A;  3PBS A;  4HNB A;  3LFV A;  4L0L A;  4UEY A;  4O01 A;  1ODV A;  4ME4 A;  3VOL A;  1F98 A;  1TS0 A;  2YKH A;  2BAS A;  1MZU A;  3F1O B;  4R38 A;  3C8C A;  1OT9 A;  1WA9 A;  1V9Y A;  2W1T A;  1XJ6 A;  2D02 A;  4GW9 A;  2XSS A;  2JKR M;  2J3T C;  3S7O A;  4UQI S;  5HDD A;  1ZHH B;  4R70 A;  4CLC C;  3F1N B;  1OJ5 A;  2Y79 A;  1W63 Q;  3BW6 A;  2H28 A;  3CLO A;  5J3W A;  3EEA A;  4EEP A;  4JGP A;  1G28 A;  2GZA A;  4EER A;  3OCL A;  2O9A A;  5F5Y A;  2B18 A;  3S7Q A;  2JKT M;  2PHY A;  3BY8 A;  4NEE D;  4Y5F A;  3H7W A;  3MJQ A;  1P9R A;  4NXF A;  1T1C A;  5DKK A;  2VV8 A;  1TD5 A;  1OTE A;  2QJ5 A;  3W2Z A;  3IBR A;  5TBM A;  1T18 A;  2W3E A;  3FG8 A;  4Q0H A;  4KQO A;  2V0W A;  3MF0 A;  3MFX A;  4MN5 A;  2OAP 1;  1IOU A;  1N9O A;  4H6J A;  2GNX A;  4MN7 A;  5CX7 A;  2O9B A;  1H3Q A;  3ZQ5 A;  4EUV A;  4GHI B;  4PKY G;  4JGR A;  3KSH A;  3MQ0 A;  1H8M A;  3F1P A;  1LT0 A;  2VEA A;  3MMH A;  3CIT A;  3FPV A;  3OBF A;  3LIA A;  3LIB A;  2A24 B;  3VE4 A;  2YKF A;  4Z1W A;  3TRC A;  2GJ3 A;  3F1O A;  3JVV A;  3KSI A;  4G3K A;  3B42 A;  4L9G A;  3UMD A;  1P9W A;  3KO6 A;  2WKR A;  4MDZ A;  5AVF A;  3CAX A;  4WL9 A;  1D06 A;  2I9V A;  2FH5 A;  2J3T D;  2VKS A;  3UME A;  3E0Y A;  5DKL A;  4CLC D;  3KYZ A;  1S67 L;  2QKP A;  2QHK A;  2VV6 A;  1UWP X;  2VGL M;  4DN0 A;  3B47 A;  4CLC A;  3LR0 A;  2O0Y A;  4PAU A;  3C2W A;  4EES A;  2JKR I;  5IS1 A;  3R7W B;  3UB8 A;  2R78 A;  1NLY A;  3VV4 A;  2HGV A;  3T4L A;  3JVU A;  3P01 A;  1LSV A;  4NXE A;  5HD3 A;  4BJP A;  3A0V A;  2A2L A;  5HL6 A;  5HPF A;  5IU1 A;  1MKM A;  4EEU A;  1OTB A;  4FOF A;  4II7 A;  4PKY A;  3B33 A;  4L9F A;  4OOM A;  4DJ2 A;  2OOL A;  5DJT A;  2JKT I;  4MN6 A;  3KX0 X;  2J80 A;  4Q0J A;  3RH8 B;  2LB9 A;  2Z6D A;  4Q0I A;  4ARZ B;  3LID A;  3EGX C;  3GDI A;  2OAQ 1;  1V9Z A;  1NWZ A;  1DRM A;  4XT2 A;  4NXB A;  4WN5 A;  3LI9 A;  1TS8 A;  2VZW A;  2J3W A;  3IBJ A;  4HI4 A;  3BJN A;  2A24 A;  1GSX A;  1LSW A;  1NLZ A;  4JGQ A;  2P08 A;  3RFB A;  3UB6 A;  5F69 A;  4LLO B;  1VHM A;  3OCN A;  4ETX A;  2VV7 A;  2QWS A;  3IS2 A;  2Z6C A;  4WEK A;  4RQ9 A;  4K08 A;  4HJ6 A;  4IUK A;  4HH2 A;  2QYB A;  4L9E A;  3PXP A;  2V0U A;  1TF1 A;  2P7J A;  2ZOI A;  3O5Y A;  4IHQ A;  5HWT A;  3EQV A;  2EWW A;  4HHD A;  4F3L B;  2M1C A;  4NKP A;  2K2N A;  4NXG A;  3E4P A;  3C30 A;  2W3D A;  4KQD A;  5HSQ A;  3T4S A;  1MC0 A;  1T1A A;  4GLQ A;  4KUK A;  1XFQ A;  4KUO A;  4DJ3 A;  3D72 A;  2KOI A;  4I3I A;  5F68 A;  3EWK A;  3K2N A;  3D3O A;  1OTA A;  4HJ4 A;  2PYP A;  3U2A A;  1N9L A;  2L0W A;  2PD8 A;  3NHQ A;  4WLA A;  2VGL S;  1F5M A;  3H82 B;  3KSG A;  5G4Z A;  4GCZ A;  1ZTU A;  3SW1 A;  4HOI A;  3V67 A;  4CQH A;  4G3W A;  4M4X A;  4O8G A;  5AVE A;  2NUP C;  2PD7 A;  3NJA A;  3LYX A;  3DBA A;  4GS9 B;  4LRY C;  2EWV A;  2INW A;  4I3J A;  5HZH A;  3FC7 A;  1DP6 A;  3EOI A;  4BBV A;  1T19 A;  2LB5 A;  1X0O A;  2VA0 A;  3RTY A;  1JNU A;  5HDS A;  3EQU A;  1YAX A;  3PBR A;  4I38 A;  2W27 A;  3F1N A;  1N9N A;  3PBO A;  2VJW A;  4EU0 A;  4PHT A;  5C5K A;  2OWH A;  4MCW A;  4BBU A;  1XJ2 A;  4HJ3 A;  2PYR A;  3UE3 A;  3UE6 A;  3K3D A;  4MMN A;  4IJG A;  1OTD A;  2B02 A;  3PBT A;  2IA2 A;  4I39 A;  1STZ A;  3T50 A;  1G6O A;  1OT6 A;  3H7W B;  3T4O A;  2VLG A;  4P6Z M;  3E4Q A;  2O9C A;  3OLO A;  4E04 A;  4I5S A;  2JHE A;  5L8M A;  3CUE A;  2VX8 A;  2D01 A;  4G3V A;  5TBM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...