5L2FA

High resolution structure of acinetobacter baumannii beta-lactamase oxa-51 i129l/k83d bound to doripenem
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
239
structure length
239
Chain Sequence
b'EKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFDMLNALIGLEHHKATTTEVFKWDGQKRLFPEWEKDMTLGDAMKASALPVYQDLARRIGLELMSKEVKRVGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKIYAKSGWGWDVDPQVGWLTGWVVQPQGNIVAFSLNLEMKKGIPSSVRKEITYKSLEQLGIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title The structure of a doripenem-bound OXA-51 class D beta-lactamase variant with enhanced carbapenemase activity.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase/antibiotic
total genus 80
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5l2fA00
3BFFA 4BJPA 2XLNA 1ERMA 1W7FA 2FFYA 4R0QA 3UE1A 4RYEA 2ZQAA 2J7VA 2H5SA 3UDIA 2ZQDA 2BLSA 3BLMA 4N1XA 2CC1A 4JF5A 1DJAA 3M2JA 3N8LA 5EVIC 4IBRA 4O7DA 4IBXA 3MZDA 4F94A 1BULA 3SS3A 3PAEA 2V20A 2WAFA 4LV2A 4QU3A 3VFHA 4S2NA 2OV5A 1K54C 4N9KA 3WS2A 2JCHA 4OPQA 1MWTA 1XX2A 4OQGA 2V2FF 3WS5A 1IYPA 3M6HA 4OPYA 1K55C 2EXBA 3FV7A 1ESUA 1GA9A 2WZZA 2XDMA 3GQZA 4DRTA 5HAQA 5KMWA 1TEMA 4IVIA 4JF6A 3UO9A 2PU2A 5EOEA 5CGXA 1K4FA 2HPBA 3G35A 1EWZA 3BFEA 5EECA 1GHPA 2H0TA 5DVAA 4Y0UA 1EROA 3MBZA 3Q82A 2QPNA 5EOOA 3A3EA 3RXWA 2RCXA 4LV0A 4WELA 4Q8IA 1ZG6A 3IXGA 2Y2NA 1AXBA 1ZKJA 3OPRA 4KG5A 4E3NA 4RVAA 2WKIA 1FSWA 3WS0A 2HDRA 2A49A 3WWXA 3UNWA 3G32A 4R1GA 1L2SA 2JE5A 5EVIA 2VGJA 1HVBA 4KZ4A 1N4OA 3IXDA 2I72A 1I2WA 3B3XA 1Y54A 4P0MA 4S2LA 3MKEA 4XUZA 4ZJ2A 4RX3A 4BL2A 2G2UA 3BRMA 3FKWA 3HLWA 5DF7A 4XXRA 1FSYA 2Y91A 4GD8A 4QHCA 3I7JA 4L0LA 3W4PA 1K55A 3NDEA 3AGFA 1K4EA 4JXGA 5A90A 3GRJA 1U60A 2WGIA 2Q9NA 2HDSA 4YINA 3PBTA 5FQIA 2R9WA 5DTSA 4CPKA 3ZVWA 4RA7A 4Y7PA 3UY6A 1M6KA 2HP5A 3PTEA 3SH9A 4KG6A 4OQ0A 1CEGA 1G6AA 2C6WB 5GHYA 3D4FA 3HVFA 4PM7A 3O88A 2DNSA 3BFCA 1GA0A 4N1HA 1IKGA 3VP1A 4LV3A 4WBGA 3UDXA 4A5RA 4MBKA 1E3UD 1HD8A 1FOFA 3GSGA 4Y0TA 1PI5A 1XP4A 4JBFA 4GZBA 4EBLA 1PIOA 3VFFA 1XGIA 2JC7A 5FSRA 2X71A 4GNUA 4Z9QA 1Q2QA 5CXWA 4S2NC 1IKIA 4WM9A 4PM8A 4R23A 5HARA 3UE3A 5GHXA 5HW3A 1PZOA 2WZXA 5M18A 4E6WA 5JYOA 3N8RA 1I2SA 1K6SA 3Q81A 1HTZA 1L0FA 4OQHA 4KENB 4X56A 3M6BA 2OSUA 1BLCA 1L0EA 4JPMA 5D3OA 3DTMA 3TSGA 2J8YA 3IHAA 2ZLYA 3HUOA 3PBRA 4JKTA 1GHIA 4KZ7A 4WMCA 3UE0A 3VP2A 4BLMA 4JXWA 2ZQCA 4OPRA 3OC2A 4JXSA 4UAAA 3G4PA 3VP3A 1K6RA 5GLBA 3SH8A 3NY4A 2HP6A 2ZC4B 5KSHA 5E2HA 3ZVTA 2DCFA 1LHYA 1BSGA 1Q2PA 1GHMA 4IVKA 3ZG7B 2OLVA 3UPNA 1W8QA 3QNBA 4R4SA 3RJUA 4WEKA 4QD4A 5HL1A 5DTKA 1CI9A 1LLBA 3IH9A 5GLDA 3ZDJA 2VGKA 4X55A 3V3SA 4E3KA 4DDYA 4OKPA 4S2PA 3LCEA 3ZG0A 1IEMA 1MKIA 1FQGA 3IF6B 4WMCD 4MBFA 1TDLA 4KZ5A 4EUZA 5CGSA 1ES5A 4R4RA 1XPBA 4DKIA 3HLEA 3G2YA 3W4OA 4JLFA 5FQJA 4DE2A 4KZ3A 4P87A 3VOYA 3IF6C 2X01A 4NK3A 1WYBA 5E2GA 2XGNA 4FD8A 3ZFZA 2PBYA 3C7VA 2ZC6B 1MY8A 4MEZA 1RGYA 4BD0A 4BD1A 3WS1A 1VQQA 2IWCA 5HAPA 2BG1A 5EUAA 4GN2A 1J9MA 4KQOA 3UN7A 5M19A 1IYOA 1H5XA 2R9XA 3OPPA 4K0WA 5F82A 4KZAA 4MNRA 4X53A 5FQMA 1XGJA 4PMAA 1YMSA 3Q7ZA 4U0TA 2XQZA 3O3VA 1YLTA 1JWPA 2X02A 4EQIA 4OQIA 2H10A 4X68A 4GOGA 2QZ6A 1L0DA 4FH2A 4HESA 4B88A 4EBNA 1IELA 3W4QA 3PAGA 3DWKA 3OCLA 1RP5A 3ZG9B 5FQKA 4WEJA 4HBUA 4QY5A 3OZHA 1KDSA 1FR6A 3IWOA 1SDNA 4KQQA 4ZJ1A 3V50A 1E3UA 1SCWA 1YQSA 1KGGA 4QJGA 2ZMAA 1ZG4A 4U0XA 5HAIA 5F1FA 1G68A 3OCNA 5AQBA 3P98A 3GV9A 4KZBA 4ZAMA 5TFQA 5FASA 1BLSA 3IF5A 3IF6A 5DF9A 5FATA 1RCJA 4KZ9A 1W79A 1GCEA 5G18A 4C75A 3NCKA 4MLLA 3JYIA 3NDGA 1ONGA 3FZCA 1L0GA 1NYYA 3MXRA 5FI7A 1SDEA 5CEDA 2C5WB 3BECA 1PW1A 3IT9A 3SS4A 3FWLA 3N4IA 3LY3A 5F1GA 2Q9MA 3A3DA 4EBPA 4EV4A 5L2FA 1NXYA 2A3UA 3P09A 4R3BA 4YFMA 1JWVA 4Y0OA 4GD6A 3AGEA 1TVFA 4UHUA 5CHJA 3ZGAB 1E25A 1MWRA 2ZM8A 3ZG8B 3G30A 2Y2GA 4WZ4A 2IWBA 2P74A 4LCLA 3RXXA 4HBTA 1M40A 4KQRA 1PI4A 4S2OA 1K56D 3M2KA 2J9PA 3IWIA 3MKFA 4FCFA 5FAOA 3TOIA 4RX2A 2OLUA 4OP8A 2XD1A 4DDSA 4DF6A 1MWUA 2WKEA 5FI2A 2Z2MB 2JBFA 5CEBA 2HDUA 1CI8A 3IXBA 2E8IA 2Y2OA 1YLYA 2WGVA 4ZDXA 2QMIA 3NI9A 3BLSA 1KE3A 3CJMA 4OONA 3FKVA 4N9LA 1XXMA 1JTGA 2Y2MA 3LEZA 3NBLA 1ERQA 1YLZA 4HEFA 2XD5A 1NJ4A 3MZFA 3HLGA 3GR2A 3OPHA 3O86A 2IWDA 1SHVA 3S4XA 3SOIA 1N9BA 3ZG5A 3CMZA 5A91A 1YLJA 3ITAA 4PM9A 5GLAA 4X6TA 2ZM0A 3HLFA 1K57A 4MBHA 5IHVA 3VP0A 1PW8A 4OOMA 5TGFA 3HBRA 3CG5A 1KE0A 1NYMA 1MBLA 1FR1A 1PZPA 2P9VB 1VM1A 2XK1A 2WK0A 3A3JA 2Y4AA 1LI9A 4P6BA 2WAEA 4PPRA 3VSLA 4FH4A 1YT4A 3GTCA 3G31A 4GDNA 1YMXA 1FCMA 1MXOA 3S1YA 2Y2QA 3HUNA 3LO7A 2Y55A 2ZQ8A 1DJBA 1Z6FA 3C5AA 2Y59A 4R3JA 3ZHHA 1H8YA 3PBQA 5EPHA 1BZAA 3W8KA 3BM6A 4BQMA 2XFTA 2FFFB 2WGWB 3ZNTA 2WKHA 2WYXA 3C4OA 3WS4A 3E2LA 4D2OA 3SH7A 2ZC5B 5KZHA 1PYYA 4OPZA 3V5MA 3LY4A 2EX6A 1BTLA 1KVMA 1BLHA 2Y2LA 2ZC7A 4OP5A 4E3OA 4LV1A 3MXSA 2EX2A 2GDNA 4WZ5A 3BEBA 3MZEA 4KZ8A 3V3RA 5I94A 3NC8A 2UWXA 5JYPA 3PBOA 2XH9A 3VP4A 5E2FA 4K0XA 3PBNA 2Y2KA 4BENA 4M3KA 3E2KA 4DE3A 4IEDA 3S22A 5FAPA 3UPOA 5AQAA 1FCNA 1DJCA 1YLWA 1DY6A 3IWQA 4JF4A 4B4XA 3A3FA 2EFXA 4E3JA 4E3LA 3UDFA 2DRWA 5CECA 3IQAA 1H8ZA 3ISGA 5FI6A 2EX9A 1JTDA 2WADA 4CJNA 1ES4A 1NZUA 1ZC2A 3C4PA 4S2JA 2XR0A 5DF8A 3Q1FA 1C3BA 1XA1A 3IXHA 3NIAA 3VMAA 3DWZA 3HLCA 1QMEA 4ZBEA 3V39A 1ES3A 2P9VA 3G2ZA 4DXBA 3OPLA 2PU4A 3HLBA 1LI0A 2HP9A 4S2MA 2XF3A 4ZTKA 5HFOA 1IYSA 4C6YA 3CZDA 5FDHA 1ALQA 4PM6A 1KGEA 1CEFA 1NY0A 1WYCA 4ZJ3A 4XUXA 2Y2HA 1I5QA 3FYZA 3Q7VB 3ZCZA 4BL3A 1YM1A 4PM5A 5BOHA 4UA6A 5GL9A 4QB8A 4GB7A 1K56A 3UPPA 4C3QA 3WRTA 1O07A 2WGWA 2Y2JA 5CERA 1IYQA 3HUMA 2EXAA 4JXVA 1OMEA 3C7UA 2HDQA 5E2EA 5TR7A 5CHMA 5EE8A 1WE4A 2Z2LB 3A3IA 5FA7A 5A93A 2XEPA 4ID4A 1EI5A 1K54A 5CTMA 1TDGA 1K57C 5CGWA 3ZNYA 4DE0A 4E3IA 1W5DA 4X69A 3MFDA 4P85A 4GDBA 4B4ZA 3Q07A 1PWDA 2G2WA 4FSFA 2WUQA 1ESIA 4KG2A 1K38A 3N7WA 4DE1A 5EVIB 5A92A 4OLDA 2H0YA 5CTNA 5FAQA 2Y2PA 4OH0A 2RL3A 3N8SA 1O7EA 5KSCA 3G34A 2ZQ9A 3QHYA 1KGFA 3VSKA 5DTTA 3SS5A 3BYDA 3BFGA 5EVID 1RGZA 4E3MA 1NRFA 1S6RA 3HL9A 4OOYA 4WYYA 1QMFA 4K91A 3HREA 1BLPA 4UA9A 1BT5A 5U47A 1CK3A 1KDWA 3EQVA 4N92A 5AQ7A 1XA7A 1NZOA 4S2KA 2ZQ7A 4OLGA 2ZC3B 3EQUA 4KZ6A 4LENA 5GLCA 4NETA 2ZM2A 5FQ9A 1ES2A 4U3TA 1KVLA 5CHUA 4EWFA 1SKFA 2Y2IA 1S0WA 2EFUA 2B5RA 4WZ5C 4GKUA 1YLPA 3VOZA 3BFDA 1MWSA 5EVLA 2XFSA 1XKZA 2V1ZA 3AGDA 4S2IA 5HX9A 1ONHA 3Q7VA 1LL5A 1FCOA 1W8YA 2ZD8A 2ZJ9A 5E43A 1HZOA 3GVBA 1KE4A 4OOLA 1E4DA 1JVJA 3HLDA 4E6XA 4DXCA 3DW0A 3WRZA 5M1AA 4UA7A 2J9OA 1BUEA 4H8RA 4QY6A 1LL9A 5CRFA 5F83A 3N6IA 2EX8A 5J8XA 3GMWA 3IHBA 3ITBA 1PWGA 1PWCA 3TG9A 5GHZA 1K25A 1JWZA 5AQ9A 3O87A 3IH8A 3PBSA 3QNCA 4OVDA 4LCMA 5FQQA 1MPLA
chains in the Genus database with same CATH superfamily
4BJPA 2XLNA 3T12B 1W7FA 2FFYA 5CX7A 4NKPA 5MC7A 1DRMA 2J7VA 2VV6A 2OWJA 4JF5A 1DJAA 3N8LA 4O7DA 2NUTC 1BULA 3PAEA 4PKYA 1SZVA 4S2NA 4X1MA 1K54C 2W3DA 3EWKA 3FPWA 3OLOA 4HH3A 4ESPA 2XSSA 4QPRA 3ZQ5A 4OQGA 3LR5A 3WS5A 1IYPA 2XA7S 2EXBA 1GA9A 2WZZA 1W63M 1TEMA 4IVIA 1X0OA 2QYBA 3G35A 2B02A 5F68A 1EROA 4X1LA 2ZL1B 3A3EA 5EOOA 3RXWA 4LV0A 4Q8IA 4WELA 1FIKA 2Y2NA 1AXBA 3QP2A 3P01A 4RVAA 3G32A 4R1GA 1VETB 3LIEA 2VGJA 2JKFA 5DFYA 3IXDA 4XUZA 4YOFA 2G2UA 3HJIA 5DF7A 3V67A 3MF0A 1K55A 1YPRA 2JN7A 3AGFA 3QP5A 3GRJA 2Y79A 4YINA 2R9WA 5DTSA 4Y7PA 3UY6A 1M6KA 3PTEA 3SH9A 5F6AA 3BW6A 3D4FA 3T1RA 2M7VA 3VP1A 4WBGA 5HWVA 1PI5A 4EBLA 4GNUA 3CITA 4R23A 5HARA 3P7NA 4E6WA 1I2SA 4IUKA 1BLCA 4JPMA 2VLGA 3LGOA 2ZQCA 3JVUA 5GLBA 3SH8A 4CLCC 2JKRM 2ZC4B 5E2HA 1BSGA 3UPNA 4R4SA 3F1NA 2O9CA 2W0NA 4S2PA 3ZG0A 3E4QA 1IEMA 1MKIA 1FQGA 3IF6B 4EUZA 1ES5A 3MQOA 4KZ3A 3VOYA 2X01A 4NK3A 3PYPA 2INWA 2IWCA 2L1MA 4XT2A 1J9MA 2NUPC 2PHYA 3UN7A 1H5XA 2OAQ1 4MNRA 2PT7A 1YMSA 2XQZA 4EESA 2GX5A 4NXBA 4OQIA 2H10A 3JPUA 5TBMA 1L0DA 4B88A 3VE3A 1KDSA 1FR6A 4KQQA 1YQSA 2V0WA 1ZG4A 1K0KA 2VX8A 5TFQA 4KZ9A 3JYIA 2G7UA 1ONGA 1L0GA 1SDEA 3SS4A 3IT9A 3LIDA 3LY3A 3C30A 4EBPA 5IS1A 3U2AA 5L2FA 3T4JA 2JHEA 2PBDP 3AGEA 5CHJA 2ZM8A 3G30A 2Y2GA 4WZ4A 4LCLA 4Y17A 4KQRA 1K56D 3M2KA 3LEQA 4FCFA 3UB6A 4RX2A 4DF6A 1MWUA 2WKEA 2OAP1 3DBAA 1DP8A 5CEBA 1CI8A 2WGVA 2QMIA 3CJMA 1JTGA 2IWDA 1LT0A 1SHVA 3ITAA 1AWIA 4X6TA 3U4LP 2HGVA 5IHVA 3HBRA 1NYMA 1FR1A 3QP4A 2WAEA 4GDNA 3MFXA 3S1YA 1OTEA 3LO7A 5EPHA 2H28A 3MR0A 2XA7M 1D1JA 1L3LA 4L9FA 2PAVP 4HY8A 4LLOB 2WGWB 4R3AA 3WS4A 3E2LA 3SH7A 3V5MA 1BTLA 4OP5A 1ODVA 3MZEA 5I94A 3IX4A 2Y2KA 2PDRA 3E2KA 4GLQA 4EXOA 1FCNA 1DJCA 1OTAA 3A3FA 4E3LA 2KLIA 3IQAA 4EU0A 4CJNA 1NZUA 2XR0A 1XA1A 1QMEA 3V39A 1ES3A 2P9VA 4BMWA 3E4PA 1OT9A 3OPLA 3R4KA 2WKRA 4S2MA 2XF3A 4ZTKA 1IYSA 3C8CA 3QP1A 5FDHA 1WYCA 4ZJ3A 3ZCZA 4Y13A 4QB8A 1K56A 3LFVA 3CWFA 2PRFA 1O07A 3RH8B 1IYQA 3HUMA 4JXVA 1OMEA 3B42A 3A3IA 5CTMA 1EI5A 4DE0A 3IS2B 4KG2A 5DFXA 3N7WA 1P97A 5A92A 5CTNA 5FAQA 4OH0A 3G34A 3SS5A 3BYDA 5DKKA 1NRFA 1S6RA 1KDWA 4N92A 4JGOA 2ZC3B 3UB8A 4LENA 4NETA 5CHUA 4EWFA 5FEGA 4GKUA 3BFDA 2XFSA 1XKZA 3AGDA 5J4EA 3Q7VA 1DP9A 3TRCA 3DTEA 2WKQA 4HJ6A 3HLDA 4LRXC 5M1AA 4UA7A 4UQIS 2J9OA 1MC0A 2P7JA 4AFIA 4YNRA 3IHBA 3ITBA 1PWCA 5FDSA 4ME4A 5GHZA 4IHQA 4P6ZS 4MN5A 3QNCA 2O9AA 3H9WA 4OVDA 5FQQA 1MPLA 3CPTA 4ETZA 3LUQA 2GZAA 1ZHHB 2KOIA 2ZQDA 3BLMA 3M2JA 1T18A 4H6JA 2OOLA 3SS3A 4LV2A 2OV5A 4GS9B 1P9RA 4N9KA 3LIAA 3UB7A 1XX2A 1LSXA 3M6HA 1K55C 4Y5FA 3GQZA 4JF6A 3UO9A 3OOVA 1K4FA 2HPBA 4F3LA 2VK3A 4ETXA 1EWZA 4I3JA 1GHPA 2H0TA 3MXQA 4Y0UA 3Q82A 2FZ0A 2PD8A 2VEAA 2D02A 2RCXA 1ZG6A 3T50A 3OPRA 4K08A 4E3NA 5EM0A 1VHMA 3WS0A 2GNXA 3F1PB 1L2SA 1D7EA 4KZ4A 3T4SA 1Y54A 3MKEA 5DJUA 3FKWA 4XXRA 1FSYA 2Y91A 2ZMVA 3I7JA 3W4PA 3IBRA 2WGIA 2Q9NA 3DAVA 4CPKA 3UE6A 1DP6A 1ACFA 4KG6A 1CEGA 2C6WB 5G4ZA 3ZYTA 4PM7A 2DNSA 3BFCA 2D01A 3S7QA 3GDIA 1IKGA 4LV3A 5EM1A 2VV7A 2QKPA 5FSRA 4Z9QA 1Q2QA 5F69A 1F5MA 4WF0A 1XJ6A 3UE3A 1F2KA 5L07A 3MQ0A 1GSWA 3NHQA 1K6SA 3Q81A 1L0FA 4X56A 3H7WA 2OSUA 4GHIB 3DTMA 3TSGA 4HQAA 2J8YA 3IHAA 3UE0A 1EW0A 1GHIA 4JXWA 2JKRI 3RFBA 3BY8A 4CLCE 2VKSA 4IVKA 1GHMA 3ZG7B 1W8QA 3RJUA 5HL1A 2IA2A 1CI9A 1LLBA 5GLDA 3ZDJA 3V3SA 3KO6A 4NXFA 4OKPA 3T1SA 3F1OA 4MBFA 4KZ5A 4R4RA 4DKIA 3HLEA 3G2YA 2LB9A 4I39A 4JLFA 4RQ9A 5FQJA 2P08A 1LSWA 4DE2A 4G3WA 3K2NA 1MY8A 3L9KA 1RGYA 3WS1A 3SZTA 3K3DA 5F82A 4LPZA 2EA9A 1XGJA 4PMAA 3LI8A 3Q7ZA 4U0TA 3O3VA 4Y15A 2O9BA 4EQIA 3TJZC 1SKOB 1T19A 2QZ6A 4FH2A 1F98A 1IELA 3DWKA 3OCLA 3KSGA 4QY5A 1XJ4A 3H82A 1SDNA 4X25A 1KGGA 3BWLA 2XRNA 1G68A 3OCNA 5AJGA 3P98A 3GV9A 3PHYA 3LYXA 1BLSA 1FILA 3IF5A 3S7OA 2VV8A 4L9GA 5DF9A 5FATA 1RCJA 5G18A 2E8JA 3FZCA 3B47A 3MXRA 5FI7A 4QWOA 3IX3A 5CEDA 1PW1A 4DMZA 3FWLA 2Q0OA 3A3DA 4ARZB 3P09A 2QWSA 4R3BA 3BQAA 1JWVA 1TVFA 4UHUA 3ZGAB 1E25A 3ZG8B 3EEAA 3RTYA 4WLAA 4WUJA 2IWBA 3RXXA 4LRZE 4S2OA 2J9PA 3MKFA 1IOUA 4G3VA 4UQIM 4BWIA 2V1BA 2KX6A 3IXBA 2JKTM 1YLYA 4ZDXA 5L8MA 1UWPX 1S67L 3BLSA 1MZUA 4N9LA 1XXMA 3VE4A 4P6ZM 4HNBA 3GR2A 3KYQA 1UGUA 1G6OA 3HLFA 4LGWA 1VEUA 3VP0A 2JKGA 2XK1A 5F5YA 1LI9A 1H0MA 4FH4A 3G31A 1MXOA 3R7WB 2Y55A 2ZQ8A 1Z6FA 2W1RA 1T1BA 4BQMA 2XFTA 2FFFB 2K7SA 2HJ9C 3C4OA 4D2OA 5KZHA 4M4XA 2EX6A 4HP4A 1BLHA 2Y2LA 3D72A 4E3OA 3MXSA 4WZ5A 1PNEA 4BBVA 3KX0X 2XH9A 3VP4A 2LB5A 4BENA 4I38A 3UPOA 2CMNA 3IWQA 1DY6A 4E3JA 2DRWA 3ISGA 1H8ZA 3EGDC 5K5BA 2W1TB 4Q0HA 3IXHA 3DWZA 3CUEC 3IBJA 3CZDA 1KGEA 1CEFA 4XUXA 1I5QA 4BL3A 1YM1A 4PM5A 2VZWA 5GL9A 3FC7A 3UPPA 2HF6A 3SW1A 2PR6A 3C7UA 5CHMA 4ID4A 1K54A 1K57C 5CGWA 4EEPA 4E3IA 1W5DA 3MFDA 4P85A 1PWDA 2G2WA 2WUQA 4OLDA 3T4KA 3N8SA 2W3FA 2ZQ9A 5EVID 5AVFA 2EWVA 4UA9A 1BT5A 5U47A 1NZOA 4OLGA 1OPXA 3JVVA 3CHWP 2A24A 5FQ9A 1KVLA 1XJ3A 1SKFA 2Y2IA 3MS6A 2EFUA 2B5RA 2QJ5A 1YLPA 3VOZA 5EVLA 1MWSA 2V1ZA 4KQDA 5HX9A 2ZJ9A 2ZD8A 3MQQA 2Z6CA 4HI4A 4OOLA 3KSHA 4DXCA 4LFUA 4H8RA 5F83A 5J8XA 3GMWA 1JWZA 3VV4A 1JNUA 3O87A 3PBSA 4LCMA 4OPYA 4MMNA 4NXEA 4R0QA 4RYEA 2ZQAA 2H5SA 3UDIA 2BLSA 1XFQA 4N1XA 2CC1A 3D9YA 4CQHA 4IBRA 4IBXA 4F94A 2V20A 2WAFA 2MJ6A 4QU3A 3VFHA 2QHKA 1MWTA 3FV7A 1H3QA 1ESUA 4NG2A 4Z1WA 5HAQA 5KMWA 4I3IA 4PAUA 2PU2A 2VGLS 5EOEA 3BFEA 5EECA 5HSQA 1V9ZA 3NOUC 1V9YA 1T1AA 4CLCA 2WKIA 1FSWA 1OJGA 2HDRA 3WWXA 2JE5A 5EVIA 1N4OA 4EERA 2I72A 1VB6A 4DN0A 1XJ2A 3C2WA 3LIFA 4RX3A 1XFNA 3BRMA 3HLWA 5A8BA 4GD8A 4QHCA 3T4OA 4L0LA 1P9WA 3NDEA 1K4EA 4JXGA 5A90A 1OTBA 2HDSA 5HL6A 4EUVA 4RA7A 1G6AA 3HVFA 3O88A 3F1NB 1GA0A 3TW8A 4N1HA 3UDXA 1E3UD 1FOFA 3GSGA 4Y0TA 3EOIA 1XP4A 1Z09A 3K3CA 3CI6A 1PIOA 3VFFA 1XGIA 1LL8A 2JC7A 5CXWA 2ZOIA 1TF1A 4S2NC 1IKIA 1VETA 4KUKA 4WM9A 5GHXA 5HW3A 1PZOA 2WZXA 1YSPA 1TS7A 3N8RA 5JYOA 4G3KA 5IU1A 2L0WA 1L0EA 4XT2B 3G6OA 3KSFA 4KZ7A 3HUOA 4JKTA 4WMCA 3VP2A 4OPRA 1N9OA 3OC2A 4JXSA 4UAAA 3UB9A 3G4PA 3VP3A 1K6RA 2HP6A 5TBMB 2FH5A 1Q2PA 3QNBA 3ICYA 4QD4A 5HWTA 5DTKA 4Y3IA 3IH9A 2VGKA 3BQ8A 3E0YA 5I5LA 4E3KA 2DMWA 2W3HA 4DJ2A 1TDLA 5CGSA 1XPBA 5EV0A 1WYBA 2XGNA 4FD8A 2PBYA 2ZC6B 1OT6A 4BD0A 1VQQA 5M19A 5HDCA 3OPPA 4K0WA 4KZAA 1CF0A 4B93A 1YAXA 1JWPA 1UWNX 4GOGA 2GJ3A 4EBNA 3W4QA 3LI9A 5FQKA 4WEJA 4ZJ1A 2M1CA 2OWHA 3V50A 1N9LA 1E3UA 1SCWA 4KUOA 2ZMAA 5F1FA 4ZAMA 3IF6A 1GCEA 4JGQA 4MLLA 3CLOA 3NDGA 3BECA 5F1GA 2Q9MA 4EV4A 1NXYA 1G5UA 4Y0OA 2ACGA 1TD5A 2I9VA 4MCWA 1GSVA 3LIBA 4OP8A 1S4RA 2XD1A 4DDSA 2JKTI 2Z2MB 2JBFA 4E04A 2HDUA 4EEUA 2E8IA 2VJWA 2Y2OA 4OONA 3FKVA 2K2NA 3LEZA 1NJ4A 4GW9A 2PR5A 3O86A 3S4XA 1N9BA 1S1YA 3CAXA 5A91A 2ZM0A 2W3EA 4MBHA 4PKYG 1PW8A 4OOMA 4HIAA 3CG5A 1MBLA 2P9VB 3A3JA 5FL3A 1VM1A 2WK0A 4P6BA 2K31A 1YMXA 1FCMA 1NLZA 3HUNA 3ZHHA 3C5AA 4R3JA 2Y8HA 3PBQA 1TS8A 1BZAA 2V8CA 3BM6A 2WKPA 2VGLM 2WKHA 1P0ZA 2ZC5B 3HCYA 3EGXC 1T1CA 4LV1A 2GDNA 3V3RA 3NC8A 2PD7A 2UWXA 3PBOA 4K0XA 3PBNA 4M3KA 4DE3A 1STZA 2EFXA 3UDFA 1KOUA 2ZBBA 1JTDA 3C4PA 1GSXA 4S2JA 5DF8A 2V8FA 1C3BA 3Q1FA 1Y4OA 3VMAA 1S66L 4ZBEA 5L09A 3IX8A 3G2ZA 4DXBA 3UMDA 4NEED 3L7HA 1CQAA 1Y28A 4C6YA 4PM6A 2Y2HA 3Q7VB 4UA6A 4WL9A 2O99A 2J3TD 1BYWA 3NULA 4C3QA 4LRYC 2WGWA 5CERA 4UEYA 2EXAA 2AVXA 5E2EA 5FA7A 1WE4A 2Z2LB 3ZNYA 4X69A 5EFWA 4B4ZA 5DJTA 4FSFA 4IJGA 1ESIA 5HPIA 1K38A 4DE1A 2J80A 3QP6A 2Y2PA 3CPTB 3QHYA 5DTTA 4JGRA 1RGZA 3KSIA 4E3MA 3HREA 1BLPA 1CK3A 3EQVA 4H6JB 5AQ7A 1XA7A 2ZQ7A 4KZ6A 3E98A 5GLCA 2ZM2A 1OTIA 2V9AA 1NLYA 3A0VA 5HDSA 4S2IA 1FCOA 1W8YA 3PR6A 2Z6DA 5E43A 4F3LB 5HD3A 4E6XA 3DW0A 4Q0IA 3WRZA 4QY6A 1LL9A 4I5SA 3O5YA 1PWGA 3IS2A 4GJ4A 3TG9A 1S1ZA 1K25A 5AQ9A 2ZMFA 3IH8A 1IFQA 2PYPA 5FEFA 3S7NA 3BFFA 1OJ5A 2YKFA 1ERMA 3UE1A 4HH2A 2YKHA 4FTXA 4I3AA 5EVIC 2EWWA 3EEHA 3MZDA 3WS2A 3BY9A 3D3OA 2JCHA 4II7A 4OPQA 3MMHA 5DKLA 2V2FF 4MN7A 3LICA 3T4LA 2BTFP 1LSVA 2XDMA 4DRTA 5J7EA 4O0PA 5CGXA 5DVAA 3MBZA 2QPNA 2W3GA 3IXGA 1ZKJA 4KG5A 1D06A 5C5KA 3FG8A 2A49A 3UNWA 1HVBA 1I2WA 3B3XA 4P0MA 4S2LA 3A0RA 4ZJ2A 4BL2A 3H7WB 5J3WA 1H8MA 1U60A 3T4QA 3PBTA 5FQIA 5AVEA 4CLCD 2UV0E 4GS9A 3ZVWA 4R6LA 2HP5A 4OQ0A 5GHYA 1TS6A 1G28A 1NWZA 3W2ZA 2V1AA 3KYZA 3UMEA 3HJKA 4A5RA 4MBKA 1HD8A 3F1OB 4JBFA 4GZBA 2X71A 3FPVA 3F1PA 3C38A 4PM8A 5HDDA 4R38A 5M18A 1HTZA 5EVEA 4OQHA 4KENB 3M6BA 5D3OA 3T1QB 2XROA 3PBRA 2ZLYA 4HJ4A 4WN5A 4BLMA 4O01A 4DJ3A 2R78A 3NY4A 5KSHA 3ZVTA 2DCFA 1LHYA 3QP8A 2OLVA 3S7PA 3H82B 4WEKA 4L9EA 1F9IA 4X55A 3ULFA 2BASA 4DDYA 3LCEA 4EQ1A 5HPFA 4HP9A 4WMCD 4B9OA 1W63Q 2B95A 4IUHA 4BBTA 3W4OA 4Q0JA 4P87A 3IF6C 5E2GA 3ZFZA 3C7VA 2W27A 1YSQA 4PHTA 4MEZA 4BD1A 5HAPA 2BG1A 5EUAA 4GN2A 4KQOA 4GHIA 1IYOA 2R9XA 4EW7A 4X53A 5FQMA 1YLTA 5HD5A 2X02A 4X68A 4HESA 3PAGA 1RP5A 3ZG9B 4HBUA 3OZHA 2HZ5A 3IWOA 1YKDA 3T1XA 3A0SA 4QJGA 5HAIA 4U0XA 5AQBA 4KZBA 1VEUB 3LR3A 3OBFA 5FASA 1PFLA 3T4TA 1W79A 4C75A 3NCKA 4FUWA 2L4RA 1NYYA 1S4SA 2C5WB 4BBUA 3N4IA 2A3UA 4YFMA 4HJ3A 4GD6A 1MWRA 1ZTUA 2A2LA 3NECA 1TS0A 2ZL1A 2P74A 4HBTA 1M40A 1PI4A 3TOIA 3VOLA 3IWIA 5FAOA 2OLUA 3CUEA 5FI2A 3NI9A 1KE3A 4HHDA 2Y2MA 1SKOA 3NBLA 1ERQA 1YLZA 4HEFA 2XD5A 3MZFA 3HLGA 3OPHA 4O8GA 3SOIA 1NRJA 5KIZA 3ZG5A 3CMZA 1YLJA 4PM9A 3NJAA 5GLAA 1K57A 2J3WA 5IT5A 5TGFA 1KE0A 1J3WA 1PZPA 2KDKA 2Y4AA 4PPRA 3VSLA 1YT4A 3GTCA 3B33A 2Y2QA 3MSHA 1DJBA 2Y59A 1H8YA 4ARZA 3BJNA 3LR4A 3W8KA 3ZNTA 2WYXA 1PYYA 4OPZA 5L10A 3LY4A 4R70A 1WA9A 3DTIA 1KVMA 2ZC7A 2EX2A 2O0YA 3BEBA 4KZ8A 4D60A 5JYPA 4EETB 5E2FA 4GCZA 2B18A 4IEDA 3S22A 1MKMA 5FAPA 5AQAA 1YLWA 4B4XA 4JF4A 2ZOHA 5CECA 5FI6A 2EX9A 2WADA 1ES4A 1ZC2A 3NIAA 3HLCA 3PXPA 2QJ7A 2A24B 2PU4A 3MJQA 3HLBA 1LI0A 2HP9A 5HFOA 3R7WA 1ALQA 1NY0A 5BOHA 3FYZA 4GB7A 3WRTA 4YWZA 3KYEA 2Y2JA 2HDQA 5TR7A 5EE8A 5A93A 5HWWA 4HOIA 2VA0A 2XEPA 2HV1A 1TDGA 3TE8A 4GDBA 3Q07A 4ZRRA 4JGPA 3DTKA 3NOTC 2H0YA 2RL3A 5HZHA 1O7EA 5KSCA 1KGFA 3VSKA 3BFGA 3HL9A 3LR0A 4OOYA 4WYYA 1QMFA 4K91A 2W1TA 4MN6A 3NOPC 4S2KA 1PRQA 3EQUA 1HLUP 3UB5P 1ES2A 4U3TA 1S0WA 4NXGA 5LBRA 4WZ5C 2P04A 4FOFA 4Y2FA 1ONHA 1LL5A 3E4OA 1HZOA 5TJJA 1CJFA 3GVBA 1N9NA 1KE4A 2V0UA 1E4DA 1JVJA 2HJEA 2J3TC 1BUEA 5CRFA 2M7UA 5G4YA 3N6IA 2EX8A 1OTDA 4CLCB 1A0KA 3GECA 2PYRA 4MDZA 5EVIB
chains in the Genus database with same CATH topology
3BFFA 4BJPA 2XLNA 1ERMA 1W7FA 2FFYA 4R0QA 3UE1A 4RYEA 2ZQAA 2J7VA 2H5SA 3UDIA 2ZQDA 2BLSA 3BLMA 4N1XA 2CC1A 4JF5A 1DJAA 3M2JA 3N8LA 5EVIC 4IBRA 4O7DA 4IBXA 3MZDA 4F94A 1BULA 3SS3A 3PAEA 2V20A 2WAFA 4LV2A 4QU3A 3VFHA 4S2NA 2OV5A 1K54C 4N9KA 3WS2A 2JCHA 4OPQA 1MWTA 1XX2A 4OQGA 2V2FF 3WS5A 1IYPA 3M6HA 4OPYA 1K55C 2EXBA 3FV7A 1ESUA 1GA9A 2WZZA 2XDMA 3GQZA 4DRTA 5HAQA 5KMWA 1TEMA 4IVIA 4JF6A 3UO9A 2PU2A 5EOEA 5CGXA 1K4FA 2HPBA 3G35A 1EWZA 3BFEA 5EECA 1GHPA 2H0TA 5DVAA 4Y0UA 1EROA 3MBZA 3Q82A 2QPNA 5EOOA 3A3EA 3RXWA 2RCXA 4LV0A 4WELA 4Q8IA 1ZG6A 3IXGA 2Y2NA 1AXBA 1ZKJA 3OPRA 4KG5A 4E3NA 4RVAA 2WKIA 1FSWA 3WS0A 2HDRA 2A49A 3WWXA 3UNWA 3G32A 4R1GA 1L2SA 2JE5A 5EVIA 2VGJA 1HVBA 4KZ4A 1N4OA 3IXDA 2I72A 1I2WA 3B3XA 1Y54A 4P0MA 4S2LA 3MKEA 4XUZA 4ZJ2A 4RX3A 4BL2A 2G2UA 3BRMA 3FKWA 3HLWA 5DF7A 4XXRA 1FSYA 2Y91A 4GD8A 4QHCA 3I7JA 4L0LA 3W4PA 1K55A 3NDEA 3AGFA 1K4EA 4JXGA 5A90A 3GRJA 1U60A 2WGIA 2Q9NA 2HDSA 4YINA 3PBTA 5FQIA 2R9WA 5DTSA 4CPKA 3ZVWA 4RA7A 4Y7PA 3UY6A 1M6KA 2HP5A 3PTEA 3SH9A 4KG6A 4OQ0A 1CEGA 1G6AA 2C6WB 5GHYA 3D4FA 3HVFA 4PM7A 3O88A 2DNSA 3BFCA 1GA0A 4N1HA 1IKGA 3VP1A 4LV3A 4WBGA 3UDXA 4A5RA 4MBKA 1E3UD 1HD8A 1FOFA 3GSGA 4Y0TA 1PI5A 1XP4A 4JBFA 4GZBA 4EBLA 1PIOA 3VFFA 1XGIA 2JC7A 5FSRA 2X71A 4GNUA 4Z9QA 1Q2QA 5CXWA 4S2NC 1IKIA 4WM9A 4PM8A 4R23A 5HARA 3UE3A 5GHXA 5HW3A 1PZOA 2WZXA 5M18A 4E6WA 5JYOA 3N8RA 1I2SA 1K6SA 3Q81A 1HTZA 1L0FA 4OQHA 4KENB 4X56A 3M6BA 2OSUA 1BLCA 1L0EA 4JPMA 5D3OA 3DTMA 3TSGA 2J8YA 3IHAA 2ZLYA 3HUOA 3PBRA 4JKTA 1GHIA 4KZ7A 4WMCA 3UE0A 3VP2A 4BLMA 4JXWA 2ZQCA 4OPRA 3OC2A 4JXSA 4UAAA 3G4PA 3VP3A 1K6RA 5GLBA 3SH8A 3NY4A 2HP6A 2ZC4B 5KSHA 5E2HA 3ZVTA 2DCFA 1LHYA 1BSGA 1Q2PA 1GHMA 4IVKA 3ZG7B 2OLVA 3UPNA 1W8QA 3QNBA 4R4SA 3RJUA 4WEKA 4QD4A 5HL1A 5DTKA 1CI9A 1LLBA 3IH9A 5GLDA 3ZDJA 2VGKA 4X55A 3V3SA 4E3KA 4DDYA 4OKPA 4S2PA 3LCEA 3ZG0A 1IEMA 1MKIA 1FQGA 3IF6B 4WMCD 4MBFA 1TDLA 4KZ5A 4EUZA 5CGSA 1ES5A 4R4RA 1XPBA 4DKIA 3HLEA 3G2YA 3W4OA 4JLFA 5FQJA 4DE2A 4KZ3A 4P87A 3VOYA 3IF6C 2X01A 4NK3A 1WYBA 5E2GA 2XGNA 4FD8A 3ZFZA 2PBYA 3C7VA 2ZC6B 1MY8A 4MEZA 1RGYA 4BD0A 4BD1A 3WS1A 1VQQA 2IWCA 5HAPA 2BG1A 5EUAA 4GN2A 1J9MA 4KQOA 3UN7A 5M19A 1IYOA 1H5XA 2R9XA 3OPPA 4K0WA 5F82A 4KZAA 4MNRA 4X53A 5FQMA 1XGJA 4PMAA 1YMSA 3Q7ZA 4U0TA 2XQZA 3O3VA 1YLTA 1JWPA 2X02A 4EQIA 4OQIA 2H10A 4X68A 4GOGA 2QZ6A 1L0DA 4FH2A 4HESA 4B88A 4EBNA 1IELA 3W4QA 3PAGA 3DWKA 3OCLA 1RP5A 3ZG9B 5FQKA 4WEJA 4HBUA 4QY5A 3OZHA 1KDSA 1FR6A 3IWOA 1SDNA 4KQQA 4ZJ1A 3V50A 1E3UA 1SCWA 1YQSA 1KGGA 4QJGA 2ZMAA 1ZG4A 4U0XA 5HAIA 5F1FA 1G68A 3OCNA 5AQBA 3P98A 3GV9A 4KZBA 4ZAMA 5TFQA 5FASA 1BLSA 3IF5A 3IF6A 5DF9A 5FATA 1RCJA 4KZ9A 1W79A 1GCEA 5G18A 4C75A 3NCKA 4MLLA 3JYIA 3NDGA 1ONGA 3FZCA 1L0GA 1NYYA 3MXRA 5FI7A 1SDEA 5CEDA 2C5WB 3BECA 1PW1A 3IT9A 3SS4A 3FWLA 3N4IA 3LY3A 5F1GA 2Q9MA 3A3DA 4EBPA 4EV4A 5L2FA 1NXYA 2A3UA 3P09A 4R3BA 4YFMA 1JWVA 4Y0OA 4GD6A 3AGEA 1TVFA 4UHUA 5CHJA 3ZGAB 1E25A 1MWRA 2ZM8A 3ZG8B 3G30A 2Y2GA 4WZ4A 2IWBA 2P74A 4LCLA 3RXXA 4HBTA 1M40A 4KQRA 1PI4A 4S2OA 1K56D 3M2KA 2J9PA 3IWIA 3MKFA 4FCFA 5FAOA 3TOIA 4RX2A 2OLUA 4OP8A 2XD1A 4DDSA 4DF6A 1MWUA 2WKEA 5FI2A 2Z2MB 2JBFA 5CEBA 2HDUA 1CI8A 3IXBA 2E8IA 2Y2OA 1YLYA 2WGVA 4ZDXA 2QMIA 3NI9A 3BLSA 1KE3A 3CJMA 4OONA 3FKVA 4N9LA 1XXMA 1JTGA 2Y2MA 3LEZA 3NBLA 1ERQA 1YLZA 4HEFA 2XD5A 1NJ4A 3MZFA 3HLGA 3GR2A 3OPHA 3O86A 2IWDA 1SHVA 3S4XA 3SOIA 1N9BA 3ZG5A 3CMZA 5A91A 1YLJA 3ITAA 4PM9A 5GLAA 4X6TA 2ZM0A 3HLFA 1K57A 4MBHA 5IHVA 3VP0A 1PW8A 4OOMA 5TGFA 3HBRA 3CG5A 1KE0A 1NYMA 1MBLA 1FR1A 1PZPA 2P9VB 1VM1A 2XK1A 2WK0A 3A3JA 2Y4AA 1LI9A 4P6BA 2WAEA 4PPRA 3VSLA 4FH4A 1YT4A 3GTCA 3G31A 4GDNA 1YMXA 1FCMA 1MXOA 3S1YA 2Y2QA 3HUNA 3LO7A 2Y55A 2ZQ8A 1DJBA 1Z6FA 3C5AA 2Y59A 4R3JA 3ZHHA 1H8YA 3PBQA 5EPHA 1BZAA 3W8KA 3BM6A 4BQMA 2XFTA 2FFFB 2WGWB 3ZNTA 2WKHA 2WYXA 3C4OA 3WS4A 3E2LA 4D2OA 3SH7A 2ZC5B 5KZHA 1PYYA 4OPZA 3V5MA 3LY4A 2EX6A 1BTLA 1KVMA 1BLHA 2Y2LA 2ZC7A 4OP5A 4E3OA 4LV1A 3MXSA 2EX2A 2GDNA 4WZ5A 3BEBA 3MZEA 4KZ8A 3V3RA 5I94A 3NC8A 2UWXA 5JYPA 3PBOA 2XH9A 3VP4A 5E2FA 4K0XA 3PBNA 2Y2KA 4BENA 4M3KA 3E2KA 4DE3A 4IEDA 3S22A 5FAPA 3UPOA 5AQAA 1FCNA 1DJCA 1YLWA 1DY6A 3IWQA 4JF4A 4B4XA 3A3FA 2EFXA 4E3JA 4E3LA 3UDFA 2DRWA 5CECA 3IQAA 1H8ZA 3ISGA 5FI6A 2EX9A 1JTDA 2WADA 4CJNA 1ES4A 1NZUA 1ZC2A 3C4PA 4S2JA 2XR0A 5DF8A 3Q1FA 1C3BA 1XA1A 3IXHA 3NIAA 3VMAA 3DWZA 3HLCA 1QMEA 4ZBEA 3V39A 1ES3A 2P9VA 3G2ZA 4DXBA 3OPLA 2PU4A 3HLBA 1LI0A 2HP9A 4S2MA 2XF3A 4ZTKA 5HFOA 1IYSA 4C6YA 3CZDA 5FDHA 1ALQA 4PM6A 1KGEA 1CEFA 1NY0A 1WYCA 4ZJ3A 4XUXA 2Y2HA 1I5QA 3FYZA 3Q7VB 3ZCZA 4BL3A 1YM1A 4PM5A 5BOHA 4UA6A 5GL9A 4QB8A 4GB7A 1K56A 3UPPA 4C3QA 3WRTA 1O07A 2WGWA 2Y2JA 5CERA 1IYQA 3HUMA 2EXAA 4JXVA 1OMEA 3C7UA 2HDQA 5E2EA 5TR7A 5CHMA 5EE8A 1WE4A 2Z2LB 3A3IA 5FA7A 5A93A 2XEPA 4ID4A 1EI5A 1K54A 5CTMA 1TDGA 1K57C 5CGWA 3ZNYA 4DE0A 4E3IA 1W5DA 4X69A 3MFDA 4P85A 4GDBA 4B4ZA 3Q07A 1PWDA 2G2WA 4FSFA 2WUQA 1ESIA 4KG2A 1K38A 3N7WA 4DE1A 5EVIB 5A92A 4OLDA 2H0YA 5CTNA 5FAQA 2Y2PA 4OH0A 2RL3A 3N8SA 1O7EA 5KSCA 3G34A 2ZQ9A 3QHYA 1KGFA 3VSKA 5DTTA 3SS5A 3BYDA 3BFGA 5EVID 1RGZA 4E3MA 1NRFA 1S6RA 3HL9A 4OOYA 4WYYA 1QMFA 4K91A 3HREA 1BLPA 4UA9A 1BT5A 5U47A 1CK3A 1KDWA 3EQVA 4N92A 5AQ7A 1XA7A 1NZOA 4S2KA 2ZQ7A 4OLGA 2ZC3B 3EQUA 4KZ6A 4LENA 5GLCA 4NETA 2ZM2A 5FQ9A 1ES2A 4U3TA 1KVLA 5CHUA 4EWFA 1SKFA 2Y2IA 1S0WA 2EFUA 2B5RA 4WZ5C 4GKUA 1YLPA 3VOZA 3BFDA 1MWSA 5EVLA 2XFSA 1XKZA 2V1ZA 3AGDA 4S2IA 5HX9A 1ONHA 3Q7VA 1LL5A 1FCOA 1W8YA 2ZD8A 2ZJ9A 5E43A 1HZOA 3GVBA 1KE4A 4OOLA 1E4DA 1JVJA 3HLDA 4E6XA 4DXCA 3DW0A 3WRZA 5M1AA 4UA7A 2J9OA 1BUEA 4H8RA 4QY6A 1LL9A 5CRFA 5F83A 3N6IA 2EX8A 5J8XA 3GMWA 3IHBA 3ITBA 1PWGA 1PWCA 3TG9A 5GHZA 1K25A 1JWZA 5AQ9A 3O87A 3IH8A 3PBSA 3QNCA 4OVDA 4LCMA 5FQQA 1MPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFF A;  4BJP A;  2XLN A;  1ERM A;  1W7F A;  2FFY A;  4R0Q A;  3UE1 A;  4RYE A;  2ZQA A;  2J7V A;  2H5S A;  3UDI A;  2ZQD A;  2BLS A;  3BLM A;  4N1X A;  2CC1 A;  4JF5 A;  1DJA A;  3M2J A;  3N8L A;  5EVI C;  4IBR A;  4O7D A;  4IBX A;  3MZD A;  4F94 A;  1BUL A;  3SS3 A;  3PAE A;  2V20 A;  2WAF A;  4LV2 A;  4QU3 A;  3VFH A;  4S2N A;  2OV5 A;  1K54 C;  4N9K A;  3WS2 A;  2JCH A;  4OPQ A;  1MWT A;  1XX2 A;  4OQG A;  2V2F F;  3WS5 A;  1IYP A;  3M6H A;  4OPY A;  1K55 C;  2EXB A;  3FV7 A;  1ESU A;  1GA9 A;  2WZZ A;  2XDM A;  3GQZ A;  4DRT A;  5HAQ A;  5KMW A;  1TEM A;  4IVI A;  4JF6 A;  3UO9 A;  2PU2 A;  5EOE A;  5CGX A;  1K4F A;  2HPB A;  3G35 A;  1EWZ A;  3BFE A;  5EEC A;  1GHP A;  2H0T A;  5DVA A;  4Y0U A;  1ERO A;  3MBZ A;  3Q82 A;  2QPN A;  5EOO A;  3A3E A;  3RXW A;  2RCX A;  4LV0 A;  4WEL A;  4Q8I A;  1ZG6 A;  3IXG A;  2Y2N A;  1AXB A;  1ZKJ A;  3OPR A;  4KG5 A;  4E3N A;  4RVA A;  2WKI A;  1FSW A;  3WS0 A;  2HDR A;  2A49 A;  3WWX A;  3UNW A;  3G32 A;  4R1G A;  1L2S A;  2JE5 A;  5EVI A;  2VGJ A;  1HVB A;  4KZ4 A;  1N4O A;  3IXD A;  2I72 A;  1I2W A;  3B3X A;  1Y54 A;  4P0M A;  4S2L A;  3MKE A;  4XUZ A;  4ZJ2 A;  4RX3 A;  4BL2 A;  2G2U A;  3BRM A;  3FKW A;  3HLW A;  5DF7 A;  4XXR A;  1FSY A;  2Y91 A;  4GD8 A;  4QHC A;  3I7J A;  4L0L A;  3W4P A;  1K55 A;  3NDE A;  3AGF A;  1K4E A;  4JXG A;  5A90 A;  3GRJ A;  1U60 A;  2WGI A;  2Q9N A;  2HDS A;  4YIN A;  3PBT A;  5FQI A;  2R9W A;  5DTS A;  4CPK A;  3ZVW A;  4RA7 A;  4Y7P A;  3UY6 A;  1M6K A;  2HP5 A;  3PTE A;  3SH9 A;  4KG6 A;  4OQ0 A;  1CEG A;  1G6A A;  2C6W B;  5GHY A;  3D4F A;  3HVF A;  4PM7 A;  3O88 A;  2DNS A;  3BFC A;  1GA0 A;  4N1H A;  1IKG A;  3VP1 A;  4LV3 A;  4WBG A;  3UDX A;  4A5R A;  4MBK A;  1E3U D;  1HD8 A;  1FOF A;  3GSG A;  4Y0T A;  1PI5 A;  1XP4 A;  4JBF A;  4GZB A;  4EBL A;  1PIO A;  3VFF A;  1XGI A;  2JC7 A;  5FSR A;  2X71 A;  4GNU A;  4Z9Q A;  1Q2Q A;  5CXW A;  4S2N C;  1IKI A;  4WM9 A;  4PM8 A;  4R23 A;  5HAR A;  3UE3 A;  5GHX A;  5HW3 A;  1PZO A;  2WZX A;  5M18 A;  4E6W A;  5JYO A;  3N8R A;  1I2S A;  1K6S A;  3Q81 A;  1HTZ A;  1L0F A;  4OQH A;  4KEN B;  4X56 A;  3M6B A;  2OSU A;  1BLC A;  1L0E A;  4JPM A;  5D3O A;  3DTM A;  3TSG A;  2J8Y A;  3IHA A;  2ZLY A;  3HUO A;  3PBR A;  4JKT A;  1GHI A;  4KZ7 A;  4WMC A;  3UE0 A;  3VP2 A;  4BLM A;  4JXW A;  2ZQC A;  4OPR A;  3OC2 A;  4JXS A;  4UAA A;  3G4P A;  3VP3 A;  1K6R A;  5GLB A;  3SH8 A;  3NY4 A;  2HP6 A;  2ZC4 B;  5KSH A;  5E2H A;  3ZVT A;  2DCF A;  1LHY A;  1BSG A;  1Q2P A;  1GHM A;  4IVK A;  3ZG7 B;  2OLV A;  3UPN A;  1W8Q A;  3QNB A;  4R4S A;  3RJU A;  4WEK A;  4QD4 A;  5HL1 A;  5DTK A;  1CI9 A;  1LLB A;  3IH9 A;  5GLD A;  3ZDJ A;  2VGK A;  4X55 A;  3V3S A;  4E3K A;  4DDY A;  4OKP A;  4S2P A;  3LCE A;  3ZG0 A;  1IEM A;  1MKI A;  1FQG A;  3IF6 B;  4WMC D;  4MBF A;  1TDL A;  4KZ5 A;  4EUZ A;  5CGS A;  1ES5 A;  4R4R A;  1XPB A;  4DKI A;  3HLE A;  3G2Y A;  3W4O A;  4JLF A;  5FQJ A;  4DE2 A;  4KZ3 A;  4P87 A;  3VOY A;  3IF6 C;  2X01 A;  4NK3 A;  1WYB A;  5E2G A;  2XGN A;  4FD8 A;  3ZFZ A;  2PBY A;  3C7V A;  2ZC6 B;  1MY8 A;  4MEZ A;  1RGY A;  4BD0 A;  4BD1 A;  3WS1 A;  1VQQ A;  2IWC A;  5HAP A;  2BG1 A;  5EUA A;  4GN2 A;  1J9M A;  4KQO A;  3UN7 A;  5M19 A;  1IYO A;  1H5X A;  2R9X A;  3OPP A;  4K0W A;  5F82 A;  4KZA A;  4MNR A;  4X53 A;  5FQM A;  1XGJ A;  4PMA A;  1YMS A;  3Q7Z A;  4U0T A;  2XQZ A;  3O3V A;  1YLT A;  1JWP A;  2X02 A;  4EQI A;  4OQI A;  2H10 A;  4X68 A;  4GOG A;  2QZ6 A;  1L0D A;  4FH2 A;  4HES A;  4B88 A;  4EBN A;  1IEL A;  3W4Q A;  3PAG A;  3DWK A;  3OCL A;  1RP5 A;  3ZG9 B;  5FQK A;  4WEJ A;  4HBU A;  4QY5 A;  3OZH A;  1KDS A;  1FR6 A;  3IWO A;  1SDN A;  4KQQ A;  4ZJ1 A;  3V50 A;  1E3U A;  1SCW A;  1YQS A;  1KGG A;  4QJG A;  2ZMA A;  1ZG4 A;  4U0X A;  5HAI A;  5F1F A;  1G68 A;  3OCN A;  5AQB A;  3P98 A;  3GV9 A;  4KZB A;  4ZAM A;  5TFQ A;  5FAS A;  1BLS A;  3IF5 A;  3IF6 A;  5DF9 A;  5FAT A;  1RCJ A;  4KZ9 A;  1W79 A;  1GCE A;  5G18 A;  4C75 A;  3NCK A;  4MLL A;  3JYI A;  3NDG A;  1ONG A;  3FZC A;  1L0G A;  1NYY A;  3MXR A;  5FI7 A;  1SDE A;  5CED A;  2C5W B;  3BEC A;  1PW1 A;  3IT9 A;  3SS4 A;  3FWL A;  3N4I A;  3LY3 A;  5F1G A;  2Q9M A;  3A3D A;  4EBP A;  4EV4 A;  5L2F A;  1NXY A;  2A3U A;  3P09 A;  4R3B A;  4YFM A;  1JWV A;  4Y0O A;  4GD6 A;  3AGE A;  1TVF A;  4UHU A;  5CHJ A;  3ZGA B;  1E25 A;  1MWR A;  2ZM8 A;  3ZG8 B;  3G30 A;  2Y2G A;  4WZ4 A;  2IWB A;  2P74 A;  4LCL A;  3RXX A;  4HBT A;  1M40 A;  4KQR A;  1PI4 A;  4S2O A;  1K56 D;  3M2K A;  2J9P A;  3IWI A;  3MKF A;  4FCF A;  5FAO A;  3TOI A;  4RX2 A;  2OLU A;  4OP8 A;  2XD1 A;  4DDS A;  4DF6 A;  1MWU A;  2WKE A;  5FI2 A;  2Z2M B;  2JBF A;  5CEB A;  2HDU A;  1CI8 A;  3IXB A;  2E8I A;  2Y2O A;  1YLY A;  2WGV A;  4ZDX A;  2QMI A;  3NI9 A;  3BLS A;  1KE3 A;  3CJM A;  4OON A;  3FKV A;  4N9L A;  1XXM A;  1JTG A;  2Y2M A;  3LEZ A;  3NBL A;  1ERQ A;  1YLZ A;  4HEF A;  2XD5 A;  1NJ4 A;  3MZF A;  3HLG A;  3GR2 A;  3OPH A;  3O86 A;  2IWD A;  1SHV A;  3S4X A;  3SOI A;  1N9B A;  3ZG5 A;  3CMZ A;  5A91 A;  1YLJ A;  3ITA A;  4PM9 A;  5GLA A;  4X6T A;  2ZM0 A;  3HLF A;  1K57 A;  4MBH A;  5IHV A;  3VP0 A;  1PW8 A;  4OOM A;  5TGF A;  3HBR A;  3CG5 A;  1KE0 A;  1NYM A;  1MBL A;  1FR1 A;  1PZP A;  2P9V B;  1VM1 A;  2XK1 A;  2WK0 A;  3A3J A;  2Y4A A;  1LI9 A;  4P6B A;  2WAE A;  4PPR A;  3VSL A;  4FH4 A;  1YT4 A;  3GTC A;  3G31 A;  4GDN A;  1YMX A;  1FCM A;  1MXO A;  3S1Y A;  2Y2Q A;  3HUN A;  3LO7 A;  2Y55 A;  2ZQ8 A;  1DJB A;  1Z6F A;  3C5A A;  2Y59 A;  4R3J A;  3ZHH A;  1H8Y A;  3PBQ A;  5EPH A;  1BZA A;  3W8K A;  3BM6 A;  4BQM A;  2XFT A;  2FFF B;  2WGW B;  3ZNT A;  2WKH A;  2WYX A;  3C4O A;  3WS4 A;  3E2L A;  4D2O A;  3SH7 A;  2ZC5 B;  5KZH A;  1PYY A;  4OPZ A;  3V5M A;  3LY4 A;  2EX6 A;  1BTL A;  1KVM A;  1BLH A;  2Y2L A;  2ZC7 A;  4OP5 A;  4E3O A;  4LV1 A;  3MXS A;  2EX2 A;  2GDN A;  4WZ5 A;  3BEB A;  3MZE A;  4KZ8 A;  3V3R A;  5I94 A;  3NC8 A;  2UWX A;  5JYP A;  3PBO A;  2XH9 A;  3VP4 A;  5E2F A;  4K0X A;  3PBN A;  2Y2K A;  4BEN A;  4M3K A;  3E2K A;  4DE3 A;  4IED A;  3S22 A;  5FAP A;  3UPO A;  5AQA A;  1FCN A;  1DJC A;  1YLW A;  1DY6 A;  3IWQ A;  4JF4 A;  4B4X A;  3A3F A;  2EFX A;  4E3J A;  4E3L A;  3UDF A;  2DRW A;  5CEC A;  3IQA A;  1H8Z A;  3ISG A;  5FI6 A;  2EX9 A;  1JTD A;  2WAD A;  4CJN A;  1ES4 A;  1NZU A;  1ZC2 A;  3C4P A;  4S2J A;  2XR0 A;  5DF8 A;  3Q1F A;  1C3B A;  1XA1 A;  3IXH A;  3NIA A;  3VMA A;  3DWZ A;  3HLC A;  1QME A;  4ZBE A;  3V39 A;  1ES3 A;  2P9V A;  3G2Z A;  4DXB A;  3OPL A;  2PU4 A;  3HLB A;  1LI0 A;  2HP9 A;  4S2M A;  2XF3 A;  4ZTK A;  5HFO A;  1IYS A;  4C6Y A;  3CZD A;  5FDH A;  1ALQ A;  4PM6 A;  1KGE A;  1CEF A;  1NY0 A;  1WYC A;  4ZJ3 A;  4XUX A;  2Y2H A;  1I5Q A;  3FYZ A;  3Q7V B;  3ZCZ A;  4BL3 A;  1YM1 A;  4PM5 A;  5BOH A;  4UA6 A;  5GL9 A;  4QB8 A;  4GB7 A;  1K56 A;  3UPP A;  4C3Q A;  3WRT A;  1O07 A;  2WGW A;  2Y2J A;  5CER A;  1IYQ A;  3HUM A;  2EXA A;  4JXV A;  1OME A;  3C7U A;  2HDQ A;  5E2E A;  5TR7 A;  5CHM A;  5EE8 A;  1WE4 A;  2Z2L B;  3A3I A;  5FA7 A;  5A93 A;  2XEP A;  4ID4 A;  1EI5 A;  1K54 A;  5CTM A;  1TDG A;  1K57 C;  5CGW A;  3ZNY A;  4DE0 A;  4E3I A;  1W5D A;  4X69 A;  3MFD A;  4P85 A;  4GDB A;  4B4Z A;  3Q07 A;  1PWD A;  2G2W A;  4FSF A;  2WUQ A;  1ESI A;  4KG2 A;  1K38 A;  3N7W A;  4DE1 A;  5EVI B;  5A92 A;  4OLD A;  2H0Y A;  5CTN A;  5FAQ A;  2Y2P A;  4OH0 A;  2RL3 A;  3N8S A;  1O7E A;  5KSC A;  3G34 A;  2ZQ9 A;  3QHY A;  1KGF A;  3VSK A;  5DTT A;  3SS5 A;  3BYD A;  3BFG A;  5EVI D;  1RGZ A;  4E3M A;  1NRF A;  1S6R A;  3HL9 A;  4OOY A;  4WYY A;  1QMF A;  4K91 A;  3HRE A;  1BLP A;  4UA9 A;  1BT5 A;  5U47 A;  1CK3 A;  1KDW A;  3EQV A;  4N92 A;  5AQ7 A;  1XA7 A;  1NZO A;  4S2K A;  2ZQ7 A;  4OLG A;  2ZC3 B;  3EQU A;  4KZ6 A;  4LEN A;  5GLC A;  4NET A;  2ZM2 A;  5FQ9 A;  1ES2 A;  4U3T A;  1KVL A;  5CHU A;  4EWF A;  1SKF A;  2Y2I A;  1S0W A;  2EFU A;  2B5R A;  4WZ5 C;  4GKU A;  1YLP A;  3VOZ A;  3BFD A;  1MWS A;  5EVL A;  2XFS A;  1XKZ A;  2V1Z A;  3AGD A;  4S2I A;  5HX9 A;  1ONH A;  3Q7V A;  1LL5 A;  1FCO A;  1W8Y A;  2ZD8 A;  2ZJ9 A;  5E43 A;  1HZO A;  3GVB A;  1KE4 A;  4OOL A;  1E4D A;  1JVJ A;  3HLD A;  4E6X A;  4DXC A;  3DW0 A;  3WRZ A;  5M1A A;  4UA7 A;  2J9O A;  1BUE A;  4H8R A;  4QY6 A;  1LL9 A;  5CRF A;  5F83 A;  3N6I A;  2EX8 A;  5J8X A;  3GMW A;  3IHB A;  3ITB A;  1PWG A;  1PWC A;  3TG9 A;  5GHZ A;  1K25 A;  1JWZ A;  5AQ9 A;  3O87 A;  3IH8 A;  3PBS A;  3QNC A;  4OVD A;  4LCM A;  5FQQ A;  1MPL A; 
#chains in the Genus database with same CATH topology
 4BJP A;  2XLN A;  3T12 B;  1W7F A;  2FFY A;  5CX7 A;  4NKP A;  5MC7 A;  1DRM A;  2J7V A;  2VV6 A;  2OWJ A;  4JF5 A;  1DJA A;  3N8L A;  4O7D A;  2NUT C;  1BUL A;  3PAE A;  4PKY A;  1SZV A;  4S2N A;  4X1M A;  1K54 C;  2W3D A;  3EWK A;  3FPW A;  3OLO A;  4HH3 A;  4ESP A;  2XSS A;  4QPR A;  3ZQ5 A;  4OQG A;  3LR5 A;  3WS5 A;  1IYP A;  2XA7 S;  2EXB A;  1GA9 A;  2WZZ A;  1W63 M;  1TEM A;  4IVI A;  1X0O A;  2QYB A;  3G35 A;  2B02 A;  5F68 A;  1ERO A;  4X1L A;  2ZL1 B;  3A3E A;  5EOO A;  3RXW A;  4LV0 A;  4Q8I A;  4WEL A;  1FIK A;  2Y2N A;  1AXB A;  3QP2 A;  3P01 A;  4RVA A;  3G32 A;  4R1G A;  1VET B;  3LIE A;  2VGJ A;  2JKF A;  5DFY A;  3IXD A;  4XUZ A;  4YOF A;  2G2U A;  3HJI A;  5DF7 A;  3V67 A;  3MF0 A;  1K55 A;  1YPR A;  2JN7 A;  3AGF A;  3QP5 A;  3GRJ A;  2Y79 A;  4YIN A;  2R9W A;  5DTS A;  4Y7P A;  3UY6 A;  1M6K A;  3PTE A;  3SH9 A;  5F6A A;  3BW6 A;  3D4F A;  3T1R A;  2M7V A;  3VP1 A;  4WBG A;  5HWV A;  1PI5 A;  4EBL A;  4GNU A;  3CIT A;  4R23 A;  5HAR A;  3P7N A;  4E6W A;  1I2S A;  4IUK A;  1BLC A;  4JPM A;  2VLG A;  3LGO A;  2ZQC A;  3JVU A;  5GLB A;  3SH8 A;  4CLC C;  2JKR M;  2ZC4 B;  5E2H A;  1BSG A;  3UPN A;  4R4S A;  3F1N A;  2O9C A;  2W0N A;  4S2P A;  3ZG0 A;  3E4Q A;  1IEM A;  1MKI A;  1FQG A;  3IF6 B;  4EUZ A;  1ES5 A;  3MQO A;  4KZ3 A;  3VOY A;  2X01 A;  4NK3 A;  3PYP A;  2INW A;  2IWC A;  2L1M A;  4XT2 A;  1J9M A;  2NUP C;  2PHY A;  3UN7 A;  1H5X A;  2OAQ 1;  4MNR A;  2PT7 A;  1YMS A;  2XQZ A;  4EES A;  2GX5 A;  4NXB A;  4OQI A;  2H10 A;  3JPU A;  5TBM A;  1L0D A;  4B88 A;  3VE3 A;  1KDS A;  1FR6 A;  4KQQ A;  1YQS A;  2V0W A;  1ZG4 A;  1K0K A;  2VX8 A;  5TFQ A;  4KZ9 A;  3JYI A;  2G7U A;  1ONG A;  1L0G A;  1SDE A;  3SS4 A;  3IT9 A;  3LID A;  3LY3 A;  3C30 A;  4EBP A;  5IS1 A;  3U2A A;  5L2F A;  3T4J A;  2JHE A;  2PBD P;  3AGE A;  5CHJ A;  2ZM8 A;  3G30 A;  2Y2G A;  4WZ4 A;  4LCL A;  4Y17 A;  4KQR A;  1K56 D;  3M2K A;  3LEQ A;  4FCF A;  3UB6 A;  4RX2 A;  4DF6 A;  1MWU A;  2WKE A;  2OAP 1;  3DBA A;  1DP8 A;  5CEB A;  1CI8 A;  2WGV A;  2QMI A;  3CJM A;  1JTG A;  2IWD A;  1LT0 A;  1SHV A;  3ITA A;  1AWI A;  4X6T A;  3U4L P;  2HGV A;  5IHV A;  3HBR A;  1NYM A;  1FR1 A;  3QP4 A;  2WAE A;  4GDN A;  3MFX A;  3S1Y A;  1OTE A;  3LO7 A;  5EPH A;  2H28 A;  3MR0 A;  2XA7 M;  1D1J A;  1L3L A;  4L9F A;  2PAV P;  4HY8 A;  4LLO B;  2WGW B;  4R3A A;  3WS4 A;  3E2L A;  3SH7 A;  3V5M A;  1BTL A;  4OP5 A;  1ODV A;  3MZE A;  5I94 A;  3IX4 A;  2Y2K A;  2PDR A;  3E2K A;  4GLQ A;  4EXO A;  1FCN A;  1DJC A;  1OTA A;  3A3F A;  4E3L A;  2KLI A;  3IQA A;  4EU0 A;  4CJN A;  1NZU A;  2XR0 A;  1XA1 A;  1QME A;  3V39 A;  1ES3 A;  2P9V A;  4BMW A;  3E4P A;  1OT9 A;  3OPL A;  3R4K A;  2WKR A;  4S2M A;  2XF3 A;  4ZTK A;  1IYS A;  3C8C A;  3QP1 A;  5FDH A;  1WYC A;  4ZJ3 A;  3ZCZ A;  4Y13 A;  4QB8 A;  1K56 A;  3LFV A;  3CWF A;  2PRF A;  1O07 A;  3RH8 B;  1IYQ A;  3HUM A;  4JXV A;  1OME A;  3B42 A;  3A3I A;  5CTM A;  1EI5 A;  4DE0 A;  3IS2 B;  4KG2 A;  5DFX A;  3N7W A;  1P97 A;  5A92 A;  5CTN A;  5FAQ A;  4OH0 A;  3G34 A;  3SS5 A;  3BYD A;  5DKK A;  1NRF A;  1S6R A;  1KDW A;  4N92 A;  4JGO A;  2ZC3 B;  3UB8 A;  4LEN A;  4NET A;  5CHU A;  4EWF A;  5FEG A;  4GKU A;  3BFD A;  2XFS A;  1XKZ A;  3AGD A;  5J4E A;  3Q7V A;  1DP9 A;  3TRC A;  3DTE A;  2WKQ A;  4HJ6 A;  3HLD A;  4LRX C;  5M1A A;  4UA7 A;  4UQI S;  2J9O A;  1MC0 A;  2P7J A;  4AFI A;  4YNR A;  3IHB A;  3ITB A;  1PWC A;  5FDS A;  4ME4 A;  5GHZ A;  4IHQ A;  4P6Z S;  4MN5 A;  3QNC A;  2O9A A;  3H9W A;  4OVD A;  5FQQ A;  1MPL A;  3CPT A;  4ETZ A;  3LUQ A;  2GZA A;  1ZHH B;  2KOI A;  2ZQD A;  3BLM A;  3M2J A;  1T18 A;  4H6J A;  2OOL A;  3SS3 A;  4LV2 A;  2OV5 A;  4GS9 B;  1P9R A;  4N9K A;  3LIA A;  3UB7 A;  1XX2 A;  1LSX A;  3M6H A;  1K55 C;  4Y5F A;  3GQZ A;  4JF6 A;  3UO9 A;  3OOV A;  1K4F A;  2HPB A;  4F3L A;  2VK3 A;  4ETX A;  1EWZ A;  4I3J A;  1GHP A;  2H0T A;  3MXQ A;  4Y0U A;  3Q82 A;  2FZ0 A;  2PD8 A;  2VEA A;  2D02 A;  2RCX A;  1ZG6 A;  3T50 A;  3OPR A;  4K08 A;  4E3N A;  5EM0 A;  1VHM A;  3WS0 A;  2GNX A;  3F1P B;  1L2S A;  1D7E A;  4KZ4 A;  3T4S A;  1Y54 A;  3MKE A;  5DJU A;  3FKW A;  4XXR A;  1FSY A;  2Y91 A;  2ZMV A;  3I7J A;  3W4P A;  3IBR A;  2WGI A;  2Q9N A;  3DAV A;  4CPK A;  3UE6 A;  1DP6 A;  1ACF A;  4KG6 A;  1CEG A;  2C6W B;  5G4Z A;  3ZYT A;  4PM7 A;  2DNS A;  3BFC A;  2D01 A;  3S7Q A;  3GDI A;  1IKG A;  4LV3 A;  5EM1 A;  2VV7 A;  2QKP A;  5FSR A;  4Z9Q A;  1Q2Q A;  5F69 A;  1F5M A;  4WF0 A;  1XJ6 A;  3UE3 A;  1F2K A;  5L07 A;  3MQ0 A;  1GSW A;  3NHQ A;  1K6S A;  3Q81 A;  1L0F A;  4X56 A;  3H7W A;  2OSU A;  4GHI B;  3DTM A;  3TSG A;  4HQA A;  2J8Y A;  3IHA A;  3UE0 A;  1EW0 A;  1GHI A;  4JXW A;  2JKR I;  3RFB A;  3BY8 A;  4CLC E;  2VKS A;  4IVK A;  1GHM A;  3ZG7 B;  1W8Q A;  3RJU A;  5HL1 A;  2IA2 A;  1CI9 A;  1LLB A;  5GLD A;  3ZDJ A;  3V3S A;  3KO6 A;  4NXF A;  4OKP A;  3T1S A;  3F1O A;  4MBF A;  4KZ5 A;  4R4R A;  4DKI A;  3HLE A;  3G2Y A;  2LB9 A;  4I39 A;  4JLF A;  4RQ9 A;  5FQJ A;  2P08 A;  1LSW A;  4DE2 A;  4G3W A;  3K2N A;  1MY8 A;  3L9K A;  1RGY A;  3WS1 A;  3SZT A;  3K3D A;  5F82 A;  4LPZ A;  2EA9 A;  1XGJ A;  4PMA A;  3LI8 A;  3Q7Z A;  4U0T A;  3O3V A;  4Y15 A;  2O9B A;  4EQI A;  3TJZ C;  1SKO B;  1T19 A;  2QZ6 A;  4FH2 A;  1F98 A;  1IEL A;  3DWK A;  3OCL A;  3KSG A;  4QY5 A;  1XJ4 A;  3H82 A;  1SDN A;  4X25 A;  1KGG A;  3BWL A;  2XRN A;  1G68 A;  3OCN A;  5AJG A;  3P98 A;  3GV9 A;  3PHY A;  3LYX A;  1BLS A;  1FIL A;  3IF5 A;  3S7O A;  2VV8 A;  4L9G A;  5DF9 A;  5FAT A;  1RCJ A;  5G18 A;  2E8J A;  3FZC A;  3B47 A;  3MXR A;  5FI7 A;  4QWO A;  3IX3 A;  5CED A;  1PW1 A;  4DMZ A;  3FWL A;  2Q0O A;  3A3D A;  4ARZ B;  3P09 A;  2QWS A;  4R3B A;  3BQA A;  1JWV A;  1TVF A;  4UHU A;  3ZGA B;  1E25 A;  3ZG8 B;  3EEA A;  3RTY A;  4WLA A;  4WUJ A;  2IWB A;  3RXX A;  4LRZ E;  4S2O A;  2J9P A;  3MKF A;  1IOU A;  4G3V A;  4UQI M;  4BWI A;  2V1B A;  2KX6 A;  3IXB A;  2JKT M;  1YLY A;  4ZDX A;  5L8M A;  1UWP X;  1S67 L;  3BLS A;  1MZU A;  4N9L A;  1XXM A;  3VE4 A;  4P6Z M;  4HNB A;  3GR2 A;  3KYQ A;  1UGU A;  1G6O A;  3HLF A;  4LGW A;  1VEU A;  3VP0 A;  2JKG A;  2XK1 A;  5F5Y A;  1LI9 A;  1H0M A;  4FH4 A;  3G31 A;  1MXO A;  3R7W B;  2Y55 A;  2ZQ8 A;  1Z6F A;  2W1R A;  1T1B A;  4BQM A;  2XFT A;  2FFF B;  2K7S A;  2HJ9 C;  3C4O A;  4D2O A;  5KZH A;  4M4X A;  2EX6 A;  4HP4 A;  1BLH A;  2Y2L A;  3D72 A;  4E3O A;  3MXS A;  4WZ5 A;  1PNE A;  4BBV A;  3KX0 X;  2XH9 A;  3VP4 A;  2LB5 A;  4BEN A;  4I38 A;  3UPO A;  2CMN A;  3IWQ A;  1DY6 A;  4E3J A;  2DRW A;  3ISG A;  1H8Z A;  3EGD C;  5K5B A;  2W1T B;  4Q0H A;  3IXH A;  3DWZ A;  3CUE C;  3IBJ A;  3CZD A;  1KGE A;  1CEF A;  4XUX A;  1I5Q A;  4BL3 A;  1YM1 A;  4PM5 A;  2VZW A;  5GL9 A;  3FC7 A;  3UPP A;  2HF6 A;  3SW1 A;  2PR6 A;  3C7U A;  5CHM A;  4ID4 A;  1K54 A;  1K57 C;  5CGW A;  4EEP A;  4E3I A;  1W5D A;  3MFD A;  4P85 A;  1PWD A;  2G2W A;  2WUQ A;  4OLD A;  3T4K A;  3N8S A;  2W3F A;  2ZQ9 A;  5EVI D;  5AVF A;  2EWV A;  4UA9 A;  1BT5 A;  5U47 A;  1NZO A;  4OLG A;  1OPX A;  3JVV A;  3CHW P;  2A24 A;  5FQ9 A;  1KVL A;  1XJ3 A;  1SKF A;  2Y2I A;  3MS6 A;  2EFU A;  2B5R A;  2QJ5 A;  1YLP A;  3VOZ A;  5EVL A;  1MWS A;  2V1Z A;  4KQD A;  5HX9 A;  2ZJ9 A;  2ZD8 A;  3MQQ A;  2Z6C A;  4HI4 A;  4OOL A;  3KSH A;  4DXC A;  4LFU A;  4H8R A;  5F83 A;  5J8X A;  3GMW A;  1JWZ A;  3VV4 A;  1JNU A;  3O87 A;  3PBS A;  4LCM A;  4OPY A;  4MMN A;  4NXE A;  4R0Q A;  4RYE A;  2ZQA A;  2H5S A;  3UDI A;  2BLS A;  1XFQ A;  4N1X A;  2CC1 A;  3D9Y A;  4CQH A;  4IBR A;  4IBX A;  4F94 A;  2V20 A;  2WAF A;  2MJ6 A;  4QU3 A;  3VFH A;  2QHK A;  1MWT A;  3FV7 A;  1H3Q A;  1ESU A;  4NG2 A;  4Z1W A;  5HAQ A;  5KMW A;  4I3I A;  4PAU A;  2PU2 A;  2VGL S;  5EOE A;  3BFE A;  5EEC A;  5HSQ A;  1V9Z A;  3NOU C;  1V9Y A;  1T1A A;  4CLC A;  2WKI A;  1FSW A;  1OJG A;  2HDR A;  3WWX A;  2JE5 A;  5EVI A;  1N4O A;  4EER A;  2I72 A;  1VB6 A;  4DN0 A;  1XJ2 A;  3C2W A;  3LIF A;  4RX3 A;  1XFN A;  3BRM A;  3HLW A;  5A8B A;  4GD8 A;  4QHC A;  3T4O A;  4L0L A;  1P9W A;  3NDE A;  1K4E A;  4JXG A;  5A90 A;  1OTB A;  2HDS A;  5HL6 A;  4EUV A;  4RA7 A;  1G6A A;  3HVF A;  3O88 A;  3F1N B;  1GA0 A;  3TW8 A;  4N1H A;  3UDX A;  1E3U D;  1FOF A;  3GSG A;  4Y0T A;  3EOI A;  1XP4 A;  1Z09 A;  3K3C A;  3CI6 A;  1PIO A;  3VFF A;  1XGI A;  1LL8 A;  2JC7 A;  5CXW A;  2ZOI A;  1TF1 A;  4S2N C;  1IKI A;  1VET A;  4KUK A;  4WM9 A;  5GHX A;  5HW3 A;  1PZO A;  2WZX A;  1YSP A;  1TS7 A;  3N8R A;  5JYO A;  4G3K A;  5IU1 A;  2L0W A;  1L0E A;  4XT2 B;  3G6O A;  3KSF A;  4KZ7 A;  3HUO A;  4JKT A;  4WMC A;  3VP2 A;  4OPR A;  1N9O A;  3OC2 A;  4JXS A;  4UAA A;  3UB9 A;  3G4P A;  3VP3 A;  1K6R A;  2HP6 A;  5TBM B;  2FH5 A;  1Q2P A;  3QNB A;  3ICY A;  4QD4 A;  5HWT A;  5DTK A;  4Y3I A;  3IH9 A;  2VGK A;  3BQ8 A;  3E0Y A;  5I5L A;  4E3K A;  2DMW A;  2W3H A;  4DJ2 A;  1TDL A;  5CGS A;  1XPB A;  5EV0 A;  1WYB A;  2XGN A;  4FD8 A;  2PBY A;  2ZC6 B;  1OT6 A;  4BD0 A;  1VQQ A;  5M19 A;  5HDC A;  3OPP A;  4K0W A;  4KZA A;  1CF0 A;  4B93 A;  1YAX A;  1JWP A;  1UWN X;  4GOG A;  2GJ3 A;  4EBN A;  3W4Q A;  3LI9 A;  5FQK A;  4WEJ A;  4ZJ1 A;  2M1C A;  2OWH A;  3V50 A;  1N9L A;  1E3U A;  1SCW A;  4KUO A;  2ZMA A;  5F1F A;  4ZAM A;  3IF6 A;  1GCE A;  4JGQ A;  4MLL A;  3CLO A;  3NDG A;  3BEC A;  5F1G A;  2Q9M A;  4EV4 A;  1NXY A;  1G5U A;  4Y0O A;  2ACG A;  1TD5 A;  2I9V A;  4MCW A;  1GSV A;  3LIB A;  4OP8 A;  1S4R A;  2XD1 A;  4DDS A;  2JKT I;  2Z2M B;  2JBF A;  4E04 A;  2HDU A;  4EEU A;  2E8I A;  2VJW A;  2Y2O A;  4OON A;  3FKV A;  2K2N A;  3LEZ A;  1NJ4 A;  4GW9 A;  2PR5 A;  3O86 A;  3S4X A;  1N9B A;  1S1Y A;  3CAX A;  5A91 A;  2ZM0 A;  2W3E A;  4MBH A;  4PKY G;  1PW8 A;  4OOM A;  4HIA A;  3CG5 A;  1MBL A;  2P9V B;  3A3J A;  5FL3 A;  1VM1 A;  2WK0 A;  4P6B A;  2K31 A;  1YMX A;  1FCM A;  1NLZ A;  3HUN A;  3ZHH A;  3C5A A;  4R3J A;  2Y8H A;  3PBQ A;  1TS8 A;  1BZA A;  2V8C A;  3BM6 A;  2WKP A;  2VGL M;  2WKH A;  1P0Z A;  2ZC5 B;  3HCY A;  3EGX C;  1T1C A;  4LV1 A;  2GDN A;  3V3R A;  3NC8 A;  2PD7 A;  2UWX A;  3PBO A;  4K0X A;  3PBN A;  4M3K A;  4DE3 A;  1STZ A;  2EFX A;  3UDF A;  1KOU A;  2ZBB A;  1JTD A;  3C4P A;  1GSX A;  4S2J A;  5DF8 A;  2V8F A;  1C3B A;  3Q1F A;  1Y4O A;  3VMA A;  1S66 L;  4ZBE A;  5L09 A;  3IX8 A;  3G2Z A;  4DXB A;  3UMD A;  4NEE D;  3L7H A;  1CQA A;  1Y28 A;  4C6Y A;  4PM6 A;  2Y2H A;  3Q7V B;  4UA6 A;  4WL9 A;  2O99 A;  2J3T D;  1BYW A;  3NUL A;  4C3Q A;  4LRY C;  2WGW A;  5CER A;  4UEY A;  2EXA A;  2AVX A;  5E2E A;  5FA7 A;  1WE4 A;  2Z2L B;  3ZNY A;  4X69 A;  5EFW A;  4B4Z A;  5DJT A;  4FSF A;  4IJG A;  1ESI A;  5HPI A;  1K38 A;  4DE1 A;  2J80 A;  3QP6 A;  2Y2P A;  3CPT B;  3QHY A;  5DTT A;  4JGR A;  1RGZ A;  3KSI A;  4E3M A;  3HRE A;  1BLP A;  1CK3 A;  3EQV A;  4H6J B;  5AQ7 A;  1XA7 A;  2ZQ7 A;  4KZ6 A;  3E98 A;  5GLC A;  2ZM2 A;  1OTI A;  2V9A A;  1NLY A;  3A0V A;  5HDS A;  4S2I A;  1FCO A;  1W8Y A;  3PR6 A;  2Z6D A;  5E43 A;  4F3L B;  5HD3 A;  4E6X A;  3DW0 A;  4Q0I A;  3WRZ A;  4QY6 A;  1LL9 A;  4I5S A;  3O5Y A;  1PWG A;  3IS2 A;  4GJ4 A;  3TG9 A;  1S1Z A;  1K25 A;  5AQ9 A;  2ZMF A;  3IH8 A;  1IFQ A;  2PYP A;  5FEF A;  3S7N A;  3BFF A;  1OJ5 A;  2YKF A;  1ERM A;  3UE1 A;  4HH2 A;  2YKH A;  4FTX A;  4I3A A;  5EVI C;  2EWW A;  3EEH A;  3MZD A;  3WS2 A;  3BY9 A;  3D3O A;  2JCH A;  4II7 A;  4OPQ A;  3MMH A;  5DKL A;  2V2F F;  4MN7 A;  3LIC A;  3T4L A;  2BTF P;  1LSV A;  2XDM A;  4DRT A;  5J7E A;  4O0P A;  5CGX A;  5DVA A;  3MBZ A;  2QPN A;  2W3G A;  3IXG A;  1ZKJ A;  4KG5 A;  1D06 A;  5C5K A;  3FG8 A;  2A49 A;  3UNW A;  1HVB A;  1I2W A;  3B3X A;  4P0M A;  4S2L A;  3A0R A;  4ZJ2 A;  4BL2 A;  3H7W B;  5J3W A;  1H8M A;  1U60 A;  3T4Q A;  3PBT A;  5FQI A;  5AVE A;  4CLC D;  2UV0 E;  4GS9 A;  3ZVW A;  4R6L A;  2HP5 A;  4OQ0 A;  5GHY A;  1TS6 A;  1G28 A;  1NWZ A;  3W2Z A;  2V1A A;  3KYZ A;  3UME A;  3HJK A;  4A5R A;  4MBK A;  1HD8 A;  3F1O B;  4JBF A;  4GZB A;  2X71 A;  3FPV A;  3F1P A;  3C38 A;  4PM8 A;  5HDD A;  4R38 A;  5M18 A;  1HTZ A;  5EVE A;  4OQH A;  4KEN B;  3M6B A;  5D3O A;  3T1Q B;  2XRO A;  3PBR A;  2ZLY A;  4HJ4 A;  4WN5 A;  4BLM A;  4O01 A;  4DJ3 A;  2R78 A;  3NY4 A;  5KSH A;  3ZVT A;  2DCF A;  1LHY A;  3QP8 A;  2OLV A;  3S7P A;  3H82 B;  4WEK A;  4L9E A;  1F9I A;  4X55 A;  3ULF A;  2BAS A;  4DDY A;  3LCE A;  4EQ1 A;  5HPF A;  4HP9 A;  4WMC D;  4B9O A;  1W63 Q;  2B95 A;  4IUH A;  4BBT A;  3W4O A;  4Q0J A;  4P87 A;  3IF6 C;  5E2G A;  3ZFZ A;  3C7V A;  2W27 A;  1YSQ A;  4PHT A;  4MEZ A;  4BD1 A;  5HAP A;  2BG1 A;  5EUA A;  4GN2 A;  4KQO A;  4GHI A;  1IYO A;  2R9X A;  4EW7 A;  4X53 A;  5FQM A;  1YLT A;  5HD5 A;  2X02 A;  4X68 A;  4HES A;  3PAG A;  1RP5 A;  3ZG9 B;  4HBU A;  3OZH A;  2HZ5 A;  3IWO A;  1YKD A;  3T1X A;  3A0S A;  4QJG A;  5HAI A;  4U0X A;  5AQB A;  4KZB A;  1VEU B;  3LR3 A;  3OBF A;  5FAS A;  1PFL A;  3T4T A;  1W79 A;  4C75 A;  3NCK A;  4FUW A;  2L4R A;  1NYY A;  1S4S A;  2C5W B;  4BBU A;  3N4I A;  2A3U A;  4YFM A;  4HJ3 A;  4GD6 A;  1MWR A;  1ZTU A;  2A2L A;  3NEC A;  1TS0 A;  2ZL1 A;  2P74 A;  4HBT A;  1M40 A;  1PI4 A;  3TOI A;  3VOL A;  3IWI A;  5FAO A;  2OLU A;  3CUE A;  5FI2 A;  3NI9 A;  1KE3 A;  4HHD A;  2Y2M A;  1SKO A;  3NBL A;  1ERQ A;  1YLZ A;  4HEF A;  2XD5 A;  3MZF A;  3HLG A;  3OPH A;  4O8G A;  3SOI A;  1NRJ A;  5KIZ A;  3ZG5 A;  3CMZ A;  1YLJ A;  4PM9 A;  3NJA A;  5GLA A;  1K57 A;  2J3W A;  5IT5 A;  5TGF A;  1KE0 A;  1J3W A;  1PZP A;  2KDK A;  2Y4A A;  4PPR A;  3VSL A;  1YT4 A;  3GTC A;  3B33 A;  2Y2Q A;  3MSH A;  1DJB A;  2Y59 A;  1H8Y A;  4ARZ A;  3BJN A;  3LR4 A;  3W8K A;  3ZNT A;  2WYX A;  1PYY A;  4OPZ A;  5L10 A;  3LY4 A;  4R70 A;  1WA9 A;  3DTI A;  1KVM A;  2ZC7 A;  2EX2 A;  2O0Y A;  3BEB A;  4KZ8 A;  4D60 A;  5JYP A;  4EET B;  5E2F A;  4GCZ A;  2B18 A;  4IED A;  3S22 A;  1MKM A;  5FAP A;  5AQA A;  1YLW A;  4B4X A;  4JF4 A;  2ZOH A;  5CEC A;  5FI6 A;  2EX9 A;  2WAD A;  1ES4 A;  1ZC2 A;  3NIA A;  3HLC A;  3PXP A;  2QJ7 A;  2A24 B;  2PU4 A;  3MJQ A;  3HLB A;  1LI0 A;  2HP9 A;  5HFO A;  3R7W A;  1ALQ A;  1NY0 A;  5BOH A;  3FYZ A;  4GB7 A;  3WRT A;  4YWZ A;  3KYE A;  2Y2J A;  2HDQ A;  5TR7 A;  5EE8 A;  5A93 A;  5HWW A;  4HOI A;  2VA0 A;  2XEP A;  2HV1 A;  1TDG A;  3TE8 A;  4GDB A;  3Q07 A;  4ZRR A;  4JGP A;  3DTK A;  3NOT C;  2H0Y A;  2RL3 A;  5HZH A;  1O7E A;  5KSC A;  1KGF A;  3VSK A;  3BFG A;  3HL9 A;  3LR0 A;  4OOY A;  4WYY A;  1QMF A;  4K91 A;  2W1T A;  4MN6 A;  3NOP C;  4S2K A;  1PRQ A;  3EQU A;  1HLU P;  3UB5 P;  1ES2 A;  4U3T A;  1S0W A;  4NXG A;  5LBR A;  4WZ5 C;  2P04 A;  4FOF A;  4Y2F A;  1ONH A;  1LL5 A;  3E4O A;  1HZO A;  5TJJ A;  1CJF A;  3GVB A;  1N9N A;  1KE4 A;  2V0U A;  1E4D A;  1JVJ A;  2HJE A;  2J3T C;  1BUE A;  5CRF A;  2M7U A;  5G4Y A;  3N6I A;  2EX8 A;  1OTD A;  4CLC B;  1A0K A;  3GEC A;  2PYR A;  4MDZ A;  5EVI B; 
#chains in the Genus database with same CATH homology
 3BFF A;  4BJP A;  2XLN A;  1ERM A;  1W7F A;  2FFY A;  4R0Q A;  3UE1 A;  4RYE A;  2ZQA A;  2J7V A;  2H5S A;  3UDI A;  2ZQD A;  2BLS A;  3BLM A;  4N1X A;  2CC1 A;  4JF5 A;  1DJA A;  3M2J A;  3N8L A;  5EVI C;  4IBR A;  4O7D A;  4IBX A;  3MZD A;  4F94 A;  1BUL A;  3SS3 A;  3PAE A;  2V20 A;  2WAF A;  4LV2 A;  4QU3 A;  3VFH A;  4S2N A;  2OV5 A;  1K54 C;  4N9K A;  3WS2 A;  2JCH A;  4OPQ A;  1MWT A;  1XX2 A;  4OQG A;  2V2F F;  3WS5 A;  1IYP A;  3M6H A;  4OPY A;  1K55 C;  2EXB A;  3FV7 A;  1ESU A;  1GA9 A;  2WZZ A;  2XDM A;  3GQZ A;  4DRT A;  5HAQ A;  5KMW A;  1TEM A;  4IVI A;  4JF6 A;  3UO9 A;  2PU2 A;  5EOE A;  5CGX A;  1K4F A;  2HPB A;  3G35 A;  1EWZ A;  3BFE A;  5EEC A;  1GHP A;  2H0T A;  5DVA A;  4Y0U A;  1ERO A;  3MBZ A;  3Q82 A;  2QPN A;  5EOO A;  3A3E A;  3RXW A;  2RCX A;  4LV0 A;  4WEL A;  4Q8I A;  1ZG6 A;  3IXG A;  2Y2N A;  1AXB A;  1ZKJ A;  3OPR A;  4KG5 A;  4E3N A;  4RVA A;  2WKI A;  1FSW A;  3WS0 A;  2HDR A;  2A49 A;  3WWX A;  3UNW A;  3G32 A;  4R1G A;  1L2S A;  2JE5 A;  5EVI A;  2VGJ A;  1HVB A;  4KZ4 A;  1N4O A;  3IXD A;  2I72 A;  1I2W A;  3B3X A;  1Y54 A;  4P0M A;  4S2L A;  3MKE A;  4XUZ A;  4ZJ2 A;  4RX3 A;  4BL2 A;  2G2U A;  3BRM A;  3FKW A;  3HLW A;  5DF7 A;  4XXR A;  1FSY A;  2Y91 A;  4GD8 A;  4QHC A;  3I7J A;  4L0L A;  3W4P A;  1K55 A;  3NDE A;  3AGF A;  1K4E A;  4JXG A;  5A90 A;  3GRJ A;  1U60 A;  2WGI A;  2Q9N A;  2HDS A;  4YIN A;  3PBT A;  5FQI A;  2R9W A;  5DTS A;  4CPK A;  3ZVW A;  4RA7 A;  4Y7P A;  3UY6 A;  1M6K A;  2HP5 A;  3PTE A;  3SH9 A;  4KG6 A;  4OQ0 A;  1CEG A;  1G6A A;  2C6W B;  5GHY A;  3D4F A;  3HVF A;  4PM7 A;  3O88 A;  2DNS A;  3BFC A;  1GA0 A;  4N1H A;  1IKG A;  3VP1 A;  4LV3 A;  4WBG A;  3UDX A;  4A5R A;  4MBK A;  1E3U D;  1HD8 A;  1FOF A;  3GSG A;  4Y0T A;  1PI5 A;  1XP4 A;  4JBF A;  4GZB A;  4EBL A;  1PIO A;  3VFF A;  1XGI A;  2JC7 A;  5FSR A;  2X71 A;  4GNU A;  4Z9Q A;  1Q2Q A;  5CXW A;  4S2N C;  1IKI A;  4WM9 A;  4PM8 A;  4R23 A;  5HAR A;  3UE3 A;  5GHX A;  5HW3 A;  1PZO A;  2WZX A;  5M18 A;  4E6W A;  5JYO A;  3N8R A;  1I2S A;  1K6S A;  3Q81 A;  1HTZ A;  1L0F A;  4OQH A;  4KEN B;  4X56 A;  3M6B A;  2OSU A;  1BLC A;  1L0E A;  4JPM A;  5D3O A;  3DTM A;  3TSG A;  2J8Y A;  3IHA A;  2ZLY A;  3HUO A;  3PBR A;  4JKT A;  1GHI A;  4KZ7 A;  4WMC A;  3UE0 A;  3VP2 A;  4BLM A;  4JXW A;  2ZQC A;  4OPR A;  3OC2 A;  4JXS A;  4UAA A;  3G4P A;  3VP3 A;  1K6R A;  5GLB A;  3SH8 A;  3NY4 A;  2HP6 A;  2ZC4 B;  5KSH A;  5E2H A;  3ZVT A;  2DCF A;  1LHY A;  1BSG A;  1Q2P A;  1GHM A;  4IVK A;  3ZG7 B;  2OLV A;  3UPN A;  1W8Q A;  3QNB A;  4R4S A;  3RJU A;  4WEK A;  4QD4 A;  5HL1 A;  5DTK A;  1CI9 A;  1LLB A;  3IH9 A;  5GLD A;  3ZDJ A;  2VGK A;  4X55 A;  3V3S A;  4E3K A;  4DDY A;  4OKP A;  4S2P A;  3LCE A;  3ZG0 A;  1IEM A;  1MKI A;  1FQG A;  3IF6 B;  4WMC D;  4MBF A;  1TDL A;  4KZ5 A;  4EUZ A;  5CGS A;  1ES5 A;  4R4R A;  1XPB A;  4DKI A;  3HLE A;  3G2Y A;  3W4O A;  4JLF A;  5FQJ A;  4DE2 A;  4KZ3 A;  4P87 A;  3VOY A;  3IF6 C;  2X01 A;  4NK3 A;  1WYB A;  5E2G A;  2XGN A;  4FD8 A;  3ZFZ A;  2PBY A;  3C7V A;  2ZC6 B;  1MY8 A;  4MEZ A;  1RGY A;  4BD0 A;  4BD1 A;  3WS1 A;  1VQQ A;  2IWC A;  5HAP A;  2BG1 A;  5EUA A;  4GN2 A;  1J9M A;  4KQO A;  3UN7 A;  5M19 A;  1IYO A;  1H5X A;  2R9X A;  3OPP A;  4K0W A;  5F82 A;  4KZA A;  4MNR A;  4X53 A;  5FQM A;  1XGJ A;  4PMA A;  1YMS A;  3Q7Z A;  4U0T A;  2XQZ A;  3O3V A;  1YLT A;  1JWP A;  2X02 A;  4EQI A;  4OQI A;  2H10 A;  4X68 A;  4GOG A;  2QZ6 A;  1L0D A;  4FH2 A;  4HES A;  4B88 A;  4EBN A;  1IEL A;  3W4Q A;  3PAG A;  3DWK A;  3OCL A;  1RP5 A;  3ZG9 B;  5FQK A;  4WEJ A;  4HBU A;  4QY5 A;  3OZH A;  1KDS A;  1FR6 A;  3IWO A;  1SDN A;  4KQQ A;  4ZJ1 A;  3V50 A;  1E3U A;  1SCW A;  1YQS A;  1KGG A;  4QJG A;  2ZMA A;  1ZG4 A;  4U0X A;  5HAI A;  5F1F A;  1G68 A;  3OCN A;  5AQB A;  3P98 A;  3GV9 A;  4KZB A;  4ZAM A;  5TFQ A;  5FAS A;  1BLS A;  3IF5 A;  3IF6 A;  5DF9 A;  5FAT A;  1RCJ A;  4KZ9 A;  1W79 A;  1GCE A;  5G18 A;  4C75 A;  3NCK A;  4MLL A;  3JYI A;  3NDG A;  1ONG A;  3FZC A;  1L0G A;  1NYY A;  3MXR A;  5FI7 A;  1SDE A;  5CED A;  2C5W B;  3BEC A;  1PW1 A;  3IT9 A;  3SS4 A;  3FWL A;  3N4I A;  3LY3 A;  5F1G A;  2Q9M A;  3A3D A;  4EBP A;  4EV4 A;  5L2F A;  1NXY A;  2A3U A;  3P09 A;  4R3B A;  4YFM A;  1JWV A;  4Y0O A;  4GD6 A;  3AGE A;  1TVF A;  4UHU A;  5CHJ A;  3ZGA B;  1E25 A;  1MWR A;  2ZM8 A;  3ZG8 B;  3G30 A;  2Y2G A;  4WZ4 A;  2IWB A;  2P74 A;  4LCL A;  3RXX A;  4HBT A;  1M40 A;  4KQR A;  1PI4 A;  4S2O A;  1K56 D;  3M2K A;  2J9P A;  3IWI A;  3MKF A;  4FCF A;  5FAO A;  3TOI A;  4RX2 A;  2OLU A;  4OP8 A;  2XD1 A;  4DDS A;  4DF6 A;  1MWU A;  2WKE A;  5FI2 A;  2Z2M B;  2JBF A;  5CEB A;  2HDU A;  1CI8 A;  3IXB A;  2E8I A;  2Y2O A;  1YLY A;  2WGV A;  4ZDX A;  2QMI A;  3NI9 A;  3BLS A;  1KE3 A;  3CJM A;  4OON A;  3FKV A;  4N9L A;  1XXM A;  1JTG A;  2Y2M A;  3LEZ A;  3NBL A;  1ERQ A;  1YLZ A;  4HEF A;  2XD5 A;  1NJ4 A;  3MZF A;  3HLG A;  3GR2 A;  3OPH A;  3O86 A;  2IWD A;  1SHV A;  3S4X A;  3SOI A;  1N9B A;  3ZG5 A;  3CMZ A;  5A91 A;  1YLJ A;  3ITA A;  4PM9 A;  5GLA A;  4X6T A;  2ZM0 A;  3HLF A;  1K57 A;  4MBH A;  5IHV A;  3VP0 A;  1PW8 A;  4OOM A;  5TGF A;  3HBR A;  3CG5 A;  1KE0 A;  1NYM A;  1MBL A;  1FR1 A;  1PZP A;  2P9V B;  1VM1 A;  2XK1 A;  2WK0 A;  3A3J A;  2Y4A A;  1LI9 A;  4P6B A;  2WAE A;  4PPR A;  3VSL A;  4FH4 A;  1YT4 A;  3GTC A;  3G31 A;  4GDN A;  1YMX A;  1FCM A;  1MXO A;  3S1Y A;  2Y2Q A;  3HUN A;  3LO7 A;  2Y55 A;  2ZQ8 A;  1DJB A;  1Z6F A;  3C5A A;  2Y59 A;  4R3J A;  3ZHH A;  1H8Y A;  3PBQ A;  5EPH A;  1BZA A;  3W8K A;  3BM6 A;  4BQM A;  2XFT A;  2FFF B;  2WGW B;  3ZNT A;  2WKH A;  2WYX A;  3C4O A;  3WS4 A;  3E2L A;  4D2O A;  3SH7 A;  2ZC5 B;  5KZH A;  1PYY A;  4OPZ A;  3V5M A;  3LY4 A;  2EX6 A;  1BTL A;  1KVM A;  1BLH A;  2Y2L A;  2ZC7 A;  4OP5 A;  4E3O A;  4LV1 A;  3MXS A;  2EX2 A;  2GDN A;  4WZ5 A;  3BEB A;  3MZE A;  4KZ8 A;  3V3R A;  5I94 A;  3NC8 A;  2UWX A;  5JYP A;  3PBO A;  2XH9 A;  3VP4 A;  5E2F A;  4K0X A;  3PBN A;  2Y2K A;  4BEN A;  4M3K A;  3E2K A;  4DE3 A;  4IED A;  3S22 A;  5FAP A;  3UPO A;  5AQA A;  1FCN A;  1DJC A;  1YLW A;  1DY6 A;  3IWQ A;  4JF4 A;  4B4X A;  3A3F A;  2EFX A;  4E3J A;  4E3L A;  3UDF A;  2DRW A;  5CEC A;  3IQA A;  1H8Z A;  3ISG A;  5FI6 A;  2EX9 A;  1JTD A;  2WAD A;  4CJN A;  1ES4 A;  1NZU A;  1ZC2 A;  3C4P A;  4S2J A;  2XR0 A;  5DF8 A;  3Q1F A;  1C3B A;  1XA1 A;  3IXH A;  3NIA A;  3VMA A;  3DWZ A;  3HLC A;  1QME A;  4ZBE A;  3V39 A;  1ES3 A;  2P9V A;  3G2Z A;  4DXB A;  3OPL A;  2PU4 A;  3HLB A;  1LI0 A;  2HP9 A;  4S2M A;  2XF3 A;  4ZTK A;  5HFO A;  1IYS A;  4C6Y A;  3CZD A;  5FDH A;  1ALQ A;  4PM6 A;  1KGE A;  1CEF A;  1NY0 A;  1WYC A;  4ZJ3 A;  4XUX A;  2Y2H A;  1I5Q A;  3FYZ A;  3Q7V B;  3ZCZ A;  4BL3 A;  1YM1 A;  4PM5 A;  5BOH A;  4UA6 A;  5GL9 A;  4QB8 A;  4GB7 A;  1K56 A;  3UPP A;  4C3Q A;  3WRT A;  1O07 A;  2WGW A;  2Y2J A;  5CER A;  1IYQ A;  3HUM A;  2EXA A;  4JXV A;  1OME A;  3C7U A;  2HDQ A;  5E2E A;  5TR7 A;  5CHM A;  5EE8 A;  1WE4 A;  2Z2L B;  3A3I A;  5FA7 A;  5A93 A;  2XEP A;  4ID4 A;  1EI5 A;  1K54 A;  5CTM A;  1TDG A;  1K57 C;  5CGW A;  3ZNY A;  4DE0 A;  4E3I A;  1W5D A;  4X69 A;  3MFD A;  4P85 A;  4GDB A;  4B4Z A;  3Q07 A;  1PWD A;  2G2W A;  4FSF A;  2WUQ A;  1ESI A;  4KG2 A;  1K38 A;  3N7W A;  4DE1 A;  5EVI B;  5A92 A;  4OLD A;  2H0Y A;  5CTN A;  5FAQ A;  2Y2P A;  4OH0 A;  2RL3 A;  3N8S A;  1O7E A;  5KSC A;  3G34 A;  2ZQ9 A;  3QHY A;  1KGF A;  3VSK A;  5DTT A;  3SS5 A;  3BYD A;  3BFG A;  5EVI D;  1RGZ A;  4E3M A;  1NRF A;  1S6R A;  3HL9 A;  4OOY A;  4WYY A;  1QMF A;  4K91 A;  3HRE A;  1BLP A;  4UA9 A;  1BT5 A;  5U47 A;  1CK3 A;  1KDW A;  3EQV A;  4N92 A;  5AQ7 A;  1XA7 A;  1NZO A;  4S2K A;  2ZQ7 A;  4OLG A;  2ZC3 B;  3EQU A;  4KZ6 A;  4LEN A;  5GLC A;  4NET A;  2ZM2 A;  5FQ9 A;  1ES2 A;  4U3T A;  1KVL A;  5CHU A;  4EWF A;  1SKF A;  2Y2I A;  1S0W A;  2EFU A;  2B5R A;  4WZ5 C;  4GKU A;  1YLP A;  3VOZ A;  3BFD A;  1MWS A;  5EVL A;  2XFS A;  1XKZ A;  2V1Z A;  3AGD A;  4S2I A;  5HX9 A;  1ONH A;  3Q7V A;  1LL5 A;  1FCO A;  1W8Y A;  2ZD8 A;  2ZJ9 A;  5E43 A;  1HZO A;  3GVB A;  1KE4 A;  4OOL A;  1E4D A;  1JVJ A;  3HLD A;  4E6X A;  4DXC A;  3DW0 A;  3WRZ A;  5M1A A;  4UA7 A;  2J9O A;  1BUE A;  4H8R A;  4QY6 A;  1LL9 A;  5CRF A;  5F83 A;  3N6I A;  2EX8 A;  5J8X A;  3GMW A;  3IHB A;  3ITB A;  1PWG A;  1PWC A;  3TG9 A;  5GHZ A;  1K25 A;  1JWZ A;  5AQ9 A;  3O87 A;  3IH8 A;  3PBS A;  3QNC A;  4OVD A;  4LCM A;  5FQQ A;  1MPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...