5L2FA

High resolution structure of acinetobacter baumannii beta-lactamase oxa-51 i129l/k83d bound to doripenem
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
239
structure length
239
Chain Sequence
EKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFDMLNALIGLEHHKATTTEVFKWDGQKRLFPEWEKDMTLGDAMKASALPVYQDLARRIGLELMSKEVKRVGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKIYAKSGWGWDVDPQVGWLTGWVVQPQGNIVAFSLNLEMKKGIPSSVRKEITYKSLEQLGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title The structure of a doripenem-bound OXA-51 class D beta-lactamase variant with enhanced carbapenemase activity.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase/antibiotic
total genus 80
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5l2fA00
3VP0A 4EQIA 1O07A 2WZXA 1QMFA 2ZMAA 1XX2A 2Y2OA 1BLHA 1GCEA 4MEZA 2V2FF 3ZNTA 5GLBA 3M2JA 1L0FA 5EECA 3Q7VA 1BLSA 5DF8A 4E3IA 3S22A 4BJPA 1NYMA 2VGKA 3BFCA 3A3JA 3FV7A 2HDRA 3G31A 3N4IA 4OP8A 4HBTA 4GD8A 4KQOA 4GB7A 1IYSA 4X56A 3VSLA 4K91A 5EVIB 2VGJA 1AXBA 4OOLA 3NI9A 2EX2A 3AGEA 4QY5A 1BSGA 1W7FA 4PM6A 1NYYA 4UA7A 1XPBA 1KDWA 3HREA 2Y2HA 2P9VB 1NZOA 2G2WA 3HUMA 3IH8A 4KZ7A 5GLAA 5FAPA 5CGSA 1QMEA 5FI2A 2ZQ7A 2WYXA 2XR0A 2ZC4B 3PBTA 4S2KA 5M1AA 2HDUA 1K56A 1L0DA 5DF7A 5EVIA 1K4EA 4KQQA 2CC1A 3N8SA 4OPQA 3M2KA 2ZQDA 3EQVA 5FAOA 5CGWA 2R9XA 4C75A 1NJ4A 2XF3A 1I2SA 5HAIA 4FH2A 1KVLA 1MBLA 5FQMA 3D4FA 3ZG7B 4NK3A 2J9PA 3FYZA 3ZNYA 1GA0A 3LY3A 3GV9A 4B4XA 4B4ZA 1XA7A 5EOOA 3B3XA 1K55C 1RGZA 1LHYA 3ZVTA 4LENA 1ZC2A 3LEZA 2QPNA 2Y2KA 4IVIA 1J9MA 3OC2A 2XEPA 1IKGA 5KSHA 2PU4A 3HLWA 4H8RA 4U0XA 1G68A 5KMWA 3SH9A 3LCEA 4E3JA 3IXGA 4U3TA 4GZBA 3S1YA 5DTKA 4E6WA 2RCXA 4HESA 4CPKA 2XLNA 4S2LA 4U0TA 5A90A 1EROA 4LCMA 3ZCZA 1H8ZA 3MZDA 3EQUA 3MKFA 2IWCA 3ZGAB 1GHIA 1ONHA 1FCOA 4QU3A 2X01A 5AQAA 3HLGA 4X69A 4IBXA 3ZG5A 1K4FA 5GLDA 3VP2A 5FSRA 3AGDA 4R23A 1YLZA 1TEMA 3TG9A 1K56D 3GTCA 4DDSA 1YLWA 3SS3A 5CTNA 5KSCA 4OP5A 3IF6C 3V50A 4PM5A 1FQGA 2DRWA 1CEGA 4DKIA 1OMEA 2EFXA 1JWZA 5CGXA 3VP1A 2Y91A 1SKFA 4WZ5C 1PZOA 3FKVA 5EVLA 5A91A 1HZOA 3P09A 4S2PA 2XH9A 1KGFA 1NZUA 3JYIA 4OONA 3SS4A 4PM7A 4WBGA 4S2JA 1BZAA 4UAAA 4EUZA 1GHMA 3VP4A 1Q2QA 1XA1A 4WEJA 5AQ9A 3V3RA 5E2GA 4QB8A 5JYPA 4E6XA 3E2LA 2XFSA 2HP9A 5DTSA 1KDSA 2WGWA 5FA7A 5FI7A 2XK1A 3BRMA 1MWRA 1JWPA 4QHCA 5F1GA 5DTTA 3O86A 4N1XA 1MKIA 2QMIA 2IWDA 1BT5A 1ES3A 4X53A 3P98A 4MBFA 3W4OA 1MY8A 3G35A 5JYOA 4PPRA 3VFFA 1G6AA 1IELA 3ZG8B 1BULA 5L2FA 1LLBA 4MBHA 1YM1A 1BUEA 1PW1A 4RX3A 3WS2A 1DJCA 3IXBA 3NCKA 3HBRA 4OPRA 2ZQ9A 5GHYA 5EOEA 2WKEA 3UPOA 1FR1A 4WELA 1IEMA 2XD5A 4K0WA 2H10A 4DE0A 3A3FA 4E3NA 3WRTA 1K57A 3C4PA 4ZJ1A 2Y2QA 3Q7VB 2ZQ8A 3BECA 4JXVA 5EVIC 3NDGA 1DY6A 1K54C 4ZJ2A 2E8IA 3ITAA 4QD4A 3IWOA 4JBFA 5CHUA 4ZJ3A 2XQZA 3IH9A 1FR6A 2ZM2A 3IHAA 4MLLA 5HX9A 4C6YA 4X55A 1K6RA 1MXOA 4KZAA 3PAGA 5E2HA 2ZC6B 4KZBA 4WYYA 2I72A 4JF4A 3V5MA 3I7JA 3HLFA 4OQGA 1TVFA 2Y2NA 3GSGA 2Y2IA 4LV2A 2XD1A 3RJUA 4DE2A 3HLEA 3C5AA 4LV1A 2Y2GA 5A93A 4PMAA 2JCHA 2WUQA 4HEFA 3GVBA 4LV0A 5G18A 5GLCA 3C7UA 4S2NA 3OCNA 3LO7A 2Z2MB 5EUAA 3SS5A 2FFFB 2WGVA 4R0QA 2ZC5B 3E2KA 1XKZA 3N8RA 3WS4A 1K38A 3W4QA 3HLBA 1FSWA 4UHUA 1FOFA 4MBKA 3C4OA 4JF5A 3MXSA 3GMWA 2Y2LA 1W8QA 1PW8A 5D3OA 5CERA 1ERMA 5AQ7A 2DNSA 2ZQAA 5F1FA 5DF9A 5E43A 5M19A 4GDBA 4GN2A 1IYOA 4FSFA 4KQRA 1TDGA 2R9WA 3MKEA 3UPNA 2A49A 4KENB 1S0WA 4KG2A 1I5QA 4P87A 4OQHA 4UA6A 3BFGA 1KE3A 4BD0A 1I2WA 3BLMA 2BG1A 4LCLA 4R4RA 5GL9A 3OPHA 2P74A 3A3EA 4FD8A 1KVMA 3QNCA 1N9BA 2EX6A 4DRTA 3VOYA 2PBYA 4N9KA 4R3BA 3DTMA 3HVFA 1E25A 3BEBA 1H8YA 5TFQA 4GDNA 1JVJA 1BLCA 2J8YA 3V39A 2Y2MA 2XGNA 3G2YA 2BLSA 3HL9A 3NY4A 3Q1FA 3ZFZA 3QNBA 5A92A 1WYBA 3LY4A 3PAEA 3GRJA 4M3KA 2EXBA 3QHYA 4WZ4A 1LL5A 2HDSA 2UWXA 3Q82A 4P6BA 3UE0A 3WS1A 2OSUA 3UDXA 3UNWA 2EX8A 4YFMA 4ZAMA 1CK3A 1K57C 3MFDA 1W5DA 4OH0A 2WKHA 2ZQCA 4R1GA 4Z9QA 3IHBA 2OLVA 3TSGA 2WGWB 1MWUA 5FAQA 3NIAA 4Y0OA 4B88A 4KG6A 1CEFA 4P0MA 5AQBA 1ES2A 1KGGA 4DE3A 4N1HA 5CEBA 3SH8A 1Q2PA 3VMAA 2JC7A 1FCNA 2HPBA 2Q9MA 2PU2A 1K6SA 1WYCA 3HLCA 4S2MA 1VM1A 4Q8IA 1M40A 2OV5A 1NRFA 5F83A 2C5WB 3M6BA 4NETA 1EI5A 3HUOA 4RX2A 1WE4A 1ZKJA 3PTEA 4JXWA 1HTZA 1ZG6A 3ZG0A 2V20A 5FQ9A 1LI0A 5J8XA 3G2ZA 1K25A 4RVAA 3CZDA 4MNRA 3ZHHA 4L0LA 3UDFA 3UPPA 4KG5A 1ESUA 4OPYA 1EWZA 3WS5A 4BL3A 3GR2A 3UN7A 3FWLA 1YMSA 4JKTA 5FQQA 2Y2JA 1YT4A 5GHXA 3NDEA 5I94A 1XGJA 4DDYA 4GD6A 1H5XA 2WADA 3BLSA 4GKUA 3IT9A 3PBQA 1NY0A 1YLYA 2ZC3B 4ID4A 4F94A 1Z6FA 2Y59A 4WM9A 4DXCA 4X68A 5GHZA 4OLDA 1YLTA 3G32A 1SDEA 4DXBA 4E3OA 3SH7A 1MWTA 4IEDA 2XDMA 1LL9A 4DE1A 1ONGA 1PZPA 3IWQA 3A3IA 5E2EA 1L2SA 3GQZA 2H0TA 4KZ8A 2A3UA 5U47A 4EV4A 1SDNA 2V1ZA 1BTLA 4WMCD 3IXHA 1HVBA 3BYDA 1FSYA 3UY6A 3UE1A 5CEDA 4K0XA 3O88A 1XP4A 2X71A 1W8YA 5CRFA 4E3KA 4Y0UA 5HFOA 3G34A 1E4DA 2HP6A 1CI9A 1JTDA 4R4SA 2GDNA 5FQKA 5TR7A 1L0GA 4D2OA 3Q7ZA 1PWDA 3HLDA 2WZZA 3UDIA 1XXMA 3IXDA 2ZD8A 5CTMA 2WAEA 3IF5A 1ALQA 4OQIA 2RL3A 3ZG9B 1GA9A 1ESIA 3CMZA 4JXGA 1E3UA 4JLFA 4N9LA 4WEKA 3TOIA 1GHPA 4R3JA 3S4XA 3PBRA 3BFDA 3OPPA 3O87A 4KZ6A 4YINA 5DVAA 4UA9A 1PI4A 3A3DA 3ZDJA 1U60A 3WRZA 5TGFA 2X02A 3BFEA 4KZ9A 4BL2A 4ZDXA 4EBNA 3ZVWA 2QZ6A 2WKIA 3G30A 4Y0TA 3N6IA 3Q81A 3ITBA 4XXRA 4A5RA 1N4OA 1K54A 4RYEA 1TDLA 3M6HA 3UO9A 1PWGA 1ZG4A 5M18A 2Y55A 2C6WB 1IKIA 4XUXA 1NXYA 4S2IA 5CHMA 4Y7PA 4JF6A 4KZ5A 4FH4A 2P9VA 1BLPA 4HBUA 1FCMA 3PBNA 1IYPA 3C7VA 2XFTA 5FATA 5FI6A 1DJBA 2J7VA 5CHJA 4OLGA 3WWXA 3MXRA 2JE5A 4EBLA 1RP5A 3MZEA 3N8LA 5HAPA 4O7DA 1C3BA 2Q9NA 3NC8A 1S6RA 4KZ4A 5FQJA 1SCWA 1LI9A 2Y2PA 3SOIA 4JXSA 1M6KA 5IHVA 3NBLA 3BFFA 1YMXA 3BM6A 3WS0A 5BOHA 4IBRA 5FASA 4EWFA 2OLUA 5CECA 1VQQA 4X6TA 2H0YA 3DWKA 3OZHA 3RXXA 1E3UD 4XUZA 3VOZA 4EBPA 2EFUA 2FFYA 4BLMA 4OOYA 1SHVA 3O3VA 4BD1A 1JTGA 2IWBA 4DF6A 3ISGA 2HP5A 2ZM8A 4ZTKA 4QJGA 3FKWA 2WK0A 4CJNA 2ZC7A 3IQAA 3PBOA 4OOMA 5FDHA 5FQIA 5EVID 1DJAA 1PWCA 2Y4AA 1YLJA 5HARA 2EXAA 4BENA 1ES4A 4OVDA 3IWIA 4C3QA 1YLPA 1RGYA 3VP3A 2JBFA 4P85A 1ERQA 4WMCA 2HDQA 1W79A 1IYQA 3AGFA 1O7EA 4RA7A 4QY6A 5HL1A 1K55A 1HD8A 3CJMA 4S2NC 4E3LA 1KE4A 3DWZA 3VSKA 2Z2LB 4GOGA 1YQSA 3VFHA 2WGIA 5HW3A 3W8KA 3W4PA 5KZHA 4BQMA 4GNUA 1KE0A 5HAQA 4IVKA 3OPRA 5E2FA 3FZCA 3HUNA 1RCJA 2G2UA 1XGIA 4E3MA 2H5SA 1ES5A 3IF6B 2EX9A 4OQ0A 3UE3A 4ZBEA 5F82A 1Y54A 3MZFA 2ZJ9A 4LV3A 3OPLA 5CXWA 3Q07A 5EPHA 2DCFA 4S2OA 3PBSA 4N92A 4KZ3A 2B5RA 1MPLA 1MWSA 4OPZA 5EE8A 2ZLYA 2ZM0A 3V3SA 4PM8A 1L0EA 3CG5A 4JPMA 1PYYA 3G4PA 3IF6A 4OKPA 1CI8A 1PI5A 3OCLA 3N7WA 4PM9A 3RXWA 1JWVA 2J9OA 2WAFA 3MBZA 1KGEA 1PIOA 4FCFA 3DW0A 4WZ5A
chains in the Genus database with same CATH superfamily
4X1MA 2WZXA 2ZMAA 4MEZA 2VK3A 2W1TB 4Y2FA 5HD5A 3Q7VA 1BLSA 2V8CA 2OAQ1 4E3IA 3S22A 4BJPA 1ZTUA 3ZYTA 2WKQA 2VLGA 2VJWA 1NYMA 2VGKA 3G31A 4HBTA 1IYSA 5EVIB 4OOLA 3AGEA 4QY5A 1P9WA 4PM6A 3NJAA 2XA7M 5GLAA 5FAPA 3IX3A 2ZQ7A 4KQQA 5HD3A 2ZQDA 5FAOA 1I2SA 5HAIA 4FH2A 1KVLA 4P6ZM 5FQMA 4PKYA 3ZNYA 3T1XA 1FIKA 3B3XA 1RGZA 3CUEC 2O9CA 3LEZA 2QPNA 2Y2KA 3OC2A 2XEPA 5DJTA 4U0XA 1G68A 5TBMA 2XLNA 4U0TA 1EROA 1H8ZA 3NOTC 4QU3A 5AQAA 3HLGA 4IBXA 1K4FA 3UB5P 4R23A 4CLCC 4DDSA 2ZOIA 4JGPA 4OP5A 2DRWA 4DKIA 4PM7A 4WBGA 1BZAA 1Q2QA 1XA1A 1Y4OA 4MN6A 3KSHA 5DTSA 2O99A 1KDSA 3IS2A 4EETB 1OJ5A 2WGWA 2XK1A 4R6LA 3BRMA 5F1GA 5DTTA 3ICYA 3W4OA 3MXQA 5HDDA 5L2FA 4MBHA 1BUEA 3MQOA 4RX3A 4Q0JA 1PNEA 3NCKA 3HBRA 3QP2A 2XROA 4GHIB 4LGWA 2XD5A 3WRTA 2Y2QA 2ZQ8A 5EVIC 3NDGA 1DY6A 4ZJ2A 5HSQA 3IWOA 4JBFA 1OT6A 3IH9A 1FR6A 2ZM2A 4O0PA 4C6YA 2VZWA 5E2HA 1T1BA 3GSGA 2Y2IA 1PRQA 3T12B 2KDKA 2JCHA 2WUQA 5GLCA 2V0WA 3MQ0A 1D7EA 5TJJA 3HLBA 1FSWA 4LPZA 4MBKA 3GMWA 1ERMA 2DNSA 2ZQAA 5F1FA 5M19A 4GDBA 5DFYA 4KQRA 4QWOA 3DAVA 3C30A 3MKEA 4KG2A 1I5QA 3TJZC 1KE3A 5J3WA 1I2WA 2BG1A 5F6AA 4FD8A 3W2ZA 3V67A 1S4RA 2YKHA 1H8YA 2L1MA 1BLCA 2Y2MA 2GJ3A 3CHWP 3G2YA 4D60A 3GECA 3QNBA 5A92A 3LIDA 3LY4A 2V8FA 3PAEA 3GRJA 2EXBA 1LL5A 3UE0A 4YFMA 3MFDA 2WKHA 2ZQCA 2OLVA 3TSGA 2W27A 5FAQA 3NIAA 5AQBA 4JGQA 5EM0A 1WYCA 4S2MA 1VM1A 1M40A 3M6BA 1EI5A 3MFXA 3HUOA 3P01A 4RX2A 4JXWA 3ZG0A 5FQ9A 1ESUA 2QYBA 3WS5A 4NKPA 3FWLA 1YMSA 4JKTA 3T4OA 5GHXA 3T1QB 1ZHHB 5L8MA 5I5LA 1XGJA 2M7VA 1H5XA 4WM9A 2D02A 5GHZA 4OLDA 4E3OA 4IEDA 3T4KA 1ONGA 3R7WA 3F1OB 5U47A 2VV7A 1T18A 1HVBA 1W63Q 3BYDA 4HJ4A 2A24B 2Q0OA 5K5BA 3O88A 1XP4A 2VA0A 5HFOA 2PT7A 3CPTB 1E4DA 2VEAA 3BY8A 1PWDA 3BW6A 2PHYA 3BWLA 1XXMA 3IXDA 2PYPA 3ZG9B 5DKLA 1E3UA 4WEKA 3DBAA 5KIZA 3OPPA 3O87A 4UA9A 3A3DA 3ZDJA 4CLCD 3UB9A 2HZ5A 4HP9A 4BL2A 4EBNA 3ZVWA 3ITBA 1K54A 4RYEA 3M6HA 2C6WB 4XUXA 2ACGA 1BLPA 1FCMA 3PBNA 1IYPA 3C7VA 1DJBA 2J7VA 3FG8A 3WWXA 1IFQA 1TS0A 1V9YA 1CQAA 1Z09A 3UB6A 3LYXA 1YMXA 5BOHA 5F5YA 3S7PA 4WLAA 4BLMA 4BMWA 4ZTKA 4KUOA 3IQAA 5FDHA 5FQIA 5EVID 5HARA 2EXAA 4OVDA 5DKKA 4X1LA 3RFBA 3AGFA 1PFLA 5HL1A 3CJMA 4S2NC 4E3LA 3DWZA 5DJUA 4GOGA 1YQSA 5HW3A 1KE0A 4IVKA 3HUNA 2H5SA 1WA9A 3QP8A 4OQ0A 3UE3A 2JKTM 3OPLA 2VV6A 2DCFA 4S2OA 4KZ3A 2W3GA 2ZM0A 3IBJA 4JPMA 3G4PA 3IF6A 5IU1A 2JHEA 1JWVA 2J9OA 2WAFA 4FCFA 4WZ5A 2P7JA 5AJGA 1XX2A 1BLHA 1GCEA 2V2FF 4ETXA 1GSVA 1OTIA 5EECA 1H0MA 5DF8A 4H6JA 3VV4A 4GS9A 3MSHA 3FV7A 3N4IA 2HDRA 3OOVA 2EA9A 4OP8A 4GD8A 4GB7A 5EVEA 1AXBA 1BSGA 1NYYA 1XPBA 1KDWA 2P9VB 1NZOA 3IH8A 1GSWA 1F2KA 1QMEA 2WYXA 5M1AA 3PBTA 1SZVA 5EFWA 3PYPA 1K4EA 4EUVA 1NJ4A 2FZ0A 1NLZA 1Y28A 3D4FA 1XFQA 4NK3A 2J9PA 3FYZA 4EESA 4B4XA 3E98A 5EOOA 1K55C 4PHTA 4IVIA 1UGUA 5HWWA 2PU4A 3HLWA 2PR5A 5KMWA 3NOUC 3SH9A 5L09A 4E6WA 2RCXA 4HESA 1YAXA 4S2LA 5A90A 2JKRM 4LCMA 3MZDA 3MKFA 1GHIA 1FCOA 4I38A 5CX7A 4X69A 3D3OA 4HH2A 5GLDA 3T1SA 1TEMA 1K56D 3GTCA 2H28A 3CWFA 3B47A 3K3CA 5CTNA 4CLCE 5KSCA 2PDRA 1FQGA 3LI9A 1OMEA 5CGXA 3VP1A 3IS2B 3FKVA 5EVLA 1HZOA 3LR3A 3P09A 4FOFA 4S2PA 4Y13A 2L0WA 2V1BA 4NXEA 4DN0A 4S2JA 4WF0A 1GHMA 1N9OA 5E2GA 3E2LA 1CJFA 4I3IA 4UQIM 3E0YA 3ZQ5A 2QMIA 2IWDA 3B42A 4MBFA 1MY8A 2B95A 1BULA 3NULA 1TF1A 5EV0A 3WS2A 1DJCA 2NUTC 3UPOA 1FR1A 4WELA 2H10A 5FEGA 3BECA 4JXVA 5FEFA 5F69A 1A0KA 2E8IA 3LR4A 3IHAA 4X55A 1MXOA 1TS8A 3PAGA 2ZC6B 3V5MA 3I7JA 4LLOB 1TVFA 3RJUA 4FUWA 4PMAA 4LV0A 3S7QA 1OTBA 2AVXA 4R0QA 3LIAA 4DJ3A 3E2KA 3W4QA 4NXGA 3MXSA 5AQ7A 4B9OA 5DF9A 2V1AA 4FSFA 2A49A 1SKOA 3LIBA 1XJ6A 4P87A 5LBRA 4OQHA 4BD0A 4LRYC 2W1RA 4LCLA 2HV1A 2P74A 4G3VA 4EERA 4DRTA 2PR6A 4N9KA 4R3BA 4Y5FA 3H82B 5TFQA 2BTFP 1JVJA 3V39A 1AWIA 1VHMA 3NY4A 3Q1FA 3ZFZA 1WYBA 3LI8A 4M3KA 3QHYA 4WZ4A 1TS7A 3Q82A 3UDXA 4K08A 3UNWA 1CK3A 1W5DA 4OH0A 2V0UA 4BBTA 3SZTA 3T50A 1YSQA 3EOIA 4G3KA 1MWUA 4Y0OA 4KG6A 1CEFA 4EU0A 5CEBA 3VMAA 2JC7A 1FCNA 2Q9MA 4ARZA 1NRFA 2C5WB 1P9RA 1DP6A 1WE4A 1ZKJA 3PTEA 1HTZA 3CUEA 4MNRA 3UDFA 1EWZA 4BL3A 3GR2A 1YT4A 5I94A 2NUPC 4DDYA 3BLSA 4GKUA 3IT9A 3PBQA 1YLYA 2E8JA 4M4XA 4WUJA 1YLTA 4EEUA 1SDEA 4DXBA 2XRNA 3O5YA 1MWTA 4ZRRA 4HNBA 4CLCA 2PD7A 3UMEA 5E2EA 1L2SA 2BASA 3T4QA 3GQZA 2H0TA 2A3UA 1G5UA 4EV4A 1SDNA 3T4JA 1L3LA 1FSYA 3UE1A 1V9ZA 2X71A 1W8YA 4E3KA 1CI9A 2KOIA 1LSVA 2HJ9C 1L0GA 5A8BA 3Q7ZA 3HLDA 1YKDA 2WAEA 3IF5A 2RL3A 2W1TA 4JGRA 1GA9A 1ESIA 3L7HA 3FC7A 4JXGA 3S7NA 4N9LA 3TOIA 4Y17A 3S4XA 2PAVP 2K31A 3BFDA 3L9KA 4KZ6A 4YINA 1PI4A 5TGFA 4ZDXA 2O9AA 2QZ6A 1G6OA 5M18A 2DMWA 1PWGA 4KUKA 2Y55A 1IKIA 1NXYA 3H7WB 4JF6A 2HJEA 5CHJA 1KOUA 3MXRA 4EBLA 1RP5A 1D1JA 3LGOA 5FQJA 4HY8A 4YNRA 3NBLA 3BFFA 3BM6A 3LIFA 5G4ZA 4EWFA 1VQQA 3RXXA 2H0YA 3DWKA 5HWVA 4BD1A 3ISGA 2P04A 3FKWA 3F1PB 1IOUA 2Y4AA 1YLJA 1ES4A 1K0KA 2VGLM 3HCYA 4WMCA 2XA7S 2J3WA 1HD8A 3NECA 4RQ9A 3G6OA 2M1CA 3SW1A 3W8KA 3W4PA 3C8CA 4Y3IA 4X25A 3C38A 3OPRA 2EWVA 3NOPC 2G2UA 4P6ZS 3IF6B 5DFXA 5F82A 2ZJ9A 3F1NB 1OPXA 2B5RA 1MWSA 4OPZA 2ZLYA 4PM8A 1L0EA 4QPRA 3CG5A 3N7WA 2EWWA 1KGEA 2INWA 3UE6A 3VP0A 4EQIA 3T4TA 1O07A 4NXFA 4GHIA 3RTYA 1L0FA 1S1ZA 2KLIA 4JGOA 2W0NA 3MQQA 3BFCA 3A3JA 4X56A 2LB5A 3S7OA 2EX2A 3HREA 3HUMA 2G2WA 4DJ2A 1OJGA 5CGSA 5FI2A 2XR0A 2ZC4B 1VETB 4S2KA 2HDUA 2ZL1B 4EEPA 1K56A 5DF7A 2CC1A 3N8SA 2D01A 4OPQA 3M2KA 1TD5A 5CGWA 4G3WA 4EQ1A 4BWIA 1MBLA 3ZG7B 1GA0A 3GV9A 1XA7A 4XT2B 1YSPA 1LHYA 4KQDA 3ZVTA 1J9MA 1IKGA 3JVVA 4CQHA 3LCEA 3IXGA 4U3TA 5DTKA 4CPKA 4IUKA 5IS1A 3NHQA 3ZCZA 3EQUA 3ZGAB 4MN7A 2GZAA 4AFIA 3TG9A 3KSGA 3DTEA 3SS3A 1XJ4A 1VEUB 3IF6C 4PM5A 4R3AA 2Y91A 4WZ5C 1PZOA 3E4QA 2XH9A 1KGFA 4L9GA 1NZUA 3JYIA 4L9EA 3SS4A 4DMZA 4EUZA 4UAAA 3VP4A 4WEJA 1DP8A 3MF0A 4QB8A 2HP9A 5FA7A 4QHCA 1JWPA 1FILA 3O86A 1MKIA 4X53A 5HDSA 3G35A 3CI6A 3VFFA 1IELA 3ZG8B 5J7EA 1PW1A 4O8GA 4OPRA 1NRJA 5GHYA 3FPVA 1CF0A 5EOEA 4DE0A 4K0WA 4E3NA 3A3FA 1JNUA 1K57A 4ZJ1A 3KSIA 3Q7VB 4QD4A 3H9WA 5CHUA 3UB7A 4HJ6A 3GDIA 5FDSA 3U2AA 2Y2NA 4DE2A 3C5AA 4ETZA 4BBUA 2YKFA 5A93A 3C7UA 1OTDA 4S2NA 5EUAA 3SS5A 1LT0A 2ZC5B 4HOIA 1XKZA 1SKOB 1FOFA 3C4OA 2I9VA 2VGLS 1MZUA 2Y2LA 1PW8A 5CERA 2A24A 3CPTA 3EGDC 5TBMB 3UPNA 4KENB 3BFGA 2HGVA 3BLMA 3UB8A 4L9FA 4R4RA 2QKPA 3QNCA 1N9BA 2EX6A 3A0RA 2PBYA 3DTMA 3HVFA 4GDNA 2J8YA 3EEAA 4GCZA 4ME4A 1T1CA 2XGNA 2BLSA 3QP1A 4YWZA 3IX4A 4P6BA 2WKPA 5HPIA 2OSUA 2EX8A 4Z9QA 3IHBA 2WGWB 1ES2A 2QHKA 1J3WA 4DE3A 1D06A 2HPBA 3LEQA 2PU2A 1K6SA 3HLCA 5HZHA 2OV5A 2OAP1 3K3DA 1ZG6A 4WN5A 2V20A 1LI0A 3G2ZA 1K25A 3CZDA 4L0LA 3UPPA 3BQAA 1G28A 2Z6DA 3MMHA 3NDEA 2FH5A 3PHYA 3CITA 2WADA 4ID4A 1Z6FA 2Y59A 3C2WA 3G32A 3ULFA 5C5KA 2WKRA 4MN5A 1MC0A 2R78A 2XDMA 3T1RA 1PZPA 3IWQA 3A3IA 1N9NA 4KZ8A 1BYWA 1BTLA 3TRCA 3UY6A 5CEDA 1LSWA 5CRFA 1JTDA 4R4SA 3EGXC 4D2OA 5AVEA 3QP6A 1DP9A 2WZZA 4R38A 3UDIA 2ZD8A 5CTMA 5AVFA 4EW7A 3CMZA 4JLFA 1GHPA 3K2NA 3PBRA 3QP4A 3A0VA 3WRZA 3R4KA 3BFEA 1T19A 2WKIA 5EM1A 4Y0TA 3N6IA 4XXRA 1N4OA 2ZMVA 4ESPA 3KSFA 4S2IA 4Y7PA 2P9VA 4HBUA 2XFTA 4OLGA 3PR6A 2L4RA 3MZEA 2Z6CA 1S1YA 1S6RA 3SOIA 3B33A 4WL9A 3WS0A 4IBRA 5FASA 2OLUA 5CECA 4Q8IA 2PD8A 3P7NA 3OZHA 4X6TA 2Y79A 2EFUA 2FFYA 4OOYA 3O3VA 2IWBA 2ZMFA 4QJGA 4CJNA 3KX0X 3PBOA 3U4LP 1DJAA 1PWCA 4BENA 2JBFA 1UWPX 1ERQA 4YOFA 2HDQA 1GSXA 1IYQA 1O7EA 4QY6A 1KE4A 1P0ZA 1X0OA 4HP4A 3VFHA 2WGIA 3CAXA 5KZHA 3D9YA 4GNUA 3FZCA 3R7WB 3KYQA 1ES5A 2EX9A 5HL6A 4LFUA 4ZBEA 4F3LA 5EPHA 2A2LA 3LICA 3PBSA 3T4LA 3EWKA 2W3DA 1UWNX 3V3SA 4Z1WA 5G4YA 1PI5A 3BJNA 2JKTI 3RXWA 2JKFA 3LFVA 3DW0A 4LRXC 1QMFA 2Y2OA 3OLOA 5MC7A 3ZNTA 5GLBA 3M2JA 3EEHA 3TE8A 1NWZA 4KQOA 3VSLA 1YPRA 2O0YA 3IX8A 1S66L 4K91A 2VGJA 4MDZA 3NI9A 1W7FA 2W3EA 4UA7A 4NEED 2Y2HA 4KZ7A 1LL8A 1L0DA 5EVIA 2K7SA 4UQIS 3EQVA 2R9XA 4C75A 3VE3A 2XF3A 3BY9A 4E04A 3LY3A 2J3TC 4B4ZA 4Q0IA 4LENA 1ZC2A 2QWSA 5KSHA 2V9AA 4H8RA 4E3JA 4GZBA 3S1YA 3LR5A 3DTKA 3MJQA 2J80A 2IWCA 1ONHA 2X01A 2GX5A 3ZG5A 1OTEA 3VP2A 5FSRA 3AGDA 3MR0A 1YLZA 2JKRI 1NLYA 2Y8HA 3H82A 1OT9A 1YLWA 1T1AA 3V50A 2CMNA 1CEGA 2EFXA 1JWZA 4HHDA 4R70A 1SKFA 5A91A 4NXBA 4OONA 1XJ3A 3A0SA 5AQ9A 3HJKA 3V3RA 5JYPA 1MKMA 4E6XA 2XFSA 5FI7A 4GLQA 1MWRA 4N1XA 1BT5A 1ES3A 2VX8A 3P98A 5JYOA 4PPRA 1G6AA 1LLBA 4EXOA 1YM1A 4I5SA 3DTIA 3IXBA 3TW8A 1VB6A 2ZQ9A 3CLOA 2WKEA 1IEMA 3C4PA 1ODVA 4H6JB 1ACFA 1K54C 3ITAA 4ZJ3A 2XQZA 4GS9B 4MLLA 5HX9A 1K6RA 4KZAA 4KZBA 4WYYA 2I72A 4JF4A 3HLFA 4OQGA 3D72A 2LB9A 4LV2A 2XD1A 1XFNA 3HLEA 4LV1A 1F98A 2Y2GA 4HEFA 3GVBA 5G18A 5HWTA 3OCNA 3LO7A 2Z2MB 2W3FA 2FFFB 2WGVA 3PXPA 3N8RA 3WS4A 1S4SA 1K38A 4GJ4A 4UHUA 4LRZE 4JF5A 1W8QA 5D3OA 5E43A 4II7A 4GN2A 4I39A 1IYOA 1OTAA 1TDGA 2R9WA 1S0WA 4UA6A 1S67L 5GL9A 2QJ7A 3OPHA 1N9LA 3A3EA 1KVMA 3VOLA 4UEYA 2OWHA 3VOYA 3IBRA 1E25A 3BEBA 4GW9A 2MJ6A 3HL9A 5HPFA 3H7WA 1W63M 2HDSA 2UWXA 3WS1A 3HJIA 4Q0HA 4ZAMA 1EW0A 1K57C 4R1GA 1TS6A 2W3HA 2P08A 4I3AA 2PRFA 4B88A 4P0MA 1KGGA 4N1HA 3SH8A 1Q2PA 3E4PA 4HH3A 1XJ2A 2QJ5A 4I3JA 4B93A 5F83A 4NETA 3F1PA 2JKGA 4FTXA 5IT5A 4IJGA 5J8XA 1STZA 2VKSA 4RVAA 3ZHHA 3KYZA 3QP5A 4KG5A 4OPYA 3UN7A 5FQQA 2Y2JA 2K2NA 3OBFA 2G7UA 4GD6A 2O9BA 1NY0A 2ZC3B 1LSXA 4F94A 4DXCA 1F5MA 4X68A 3SH7A 1P97A 3JVUA 4DE1A 1LL9A 4HQAA 3RH8B 3F1NA 2V1ZA 4WMCD 5J4EA 2J3TD 3IXHA 4K0XA 2OWJA 4Y0UA 3G34A 3F1OA 2HP6A 2PYRA 2GDNA 4O01A 2VV8A 5FQKA 5TR7A 3E4OA 1ALQA 4OQIA 2ZOHA 2JN7A 4R3JA 5DVAA 1U60A 2XSSA 2X02A 4KZ9A 3LR0A 2HF6A 4PAUA 3G30A 3Q81A 4A5RA 3UO9A 1TDLA 1ZG4A 5CHMA 3UMDA 4MMNA 4KZ5A 2ZBBA 5L10A 2IA2A 4FH4A 5FATA 5FI6A 2UV0E 3MS6A 1VETA 1HLUP 2ZL1A 2JE5A 5HDCA 5HAPA 3N8LA 4IUHA 4O7DA 5L07A 1C3BA 2Q9NA 3NC8A 4KZ4A 1SCWA 4NG2A 3VE4A 1LI9A 2Y2PA 4JXSA 1M6KA 5IHVA 2B18A 4XT2A 4ARZB 4EBPA 1E3UD 4XUZA 3VOZA 4MCWA 1SHVA 1JTGA 4DF6A 2HP5A 2ZM8A 2WK0A 2ZC7A 4Y15A 2PBDP 4OOMA 2B02A 3FPWA 3IWIA 3KO6A 4C3QA 1YLPA 1RGYA 3JPUA 4PKYG 2OOLA 3VP3A 4P85A 1W79A 1DRMA 4RA7A 1K55A 3LUQA 2M7UA 3VSKA 2GNXA 4BBVA 2Z2LB 1VEUA 5F68A 4F3LB 4BQMA 5HAQA 5E2FA 3T4SA 4CLCB 4HJ3A 1F9IA 1H3QA 1RCJA 1XGIA 4E3MA 3LIEA 1Y54A 3MZFA 1H8MA 4LV3A 5CXWA 3Q07A 5FL3A 4N92A 2KX6A 5EE8A 1MPLA 3BQ8A 4IHQA 1PYYA 4OKPA 4HIAA 1CI8A 3KYEA 3OCLA 4PM9A 3MBZA 1PIOA 4HI4A
chains in the Genus database with same CATH topology
3VP0A 4EQIA 1O07A 2WZXA 1QMFA 2ZMAA 1XX2A 2Y2OA 1BLHA 1GCEA 4MEZA 2V2FF 3ZNTA 5GLBA 3M2JA 1L0FA 5EECA 3Q7VA 1BLSA 5DF8A 4E3IA 3S22A 4BJPA 1NYMA 2VGKA 3BFCA 3A3JA 3FV7A 2HDRA 3G31A 3N4IA 4OP8A 4HBTA 4GD8A 4KQOA 4GB7A 1IYSA 4X56A 3VSLA 4K91A 5EVIB 2VGJA 1AXBA 4OOLA 3NI9A 2EX2A 3AGEA 4QY5A 1BSGA 1W7FA 4PM6A 1NYYA 4UA7A 1XPBA 1KDWA 3HREA 2Y2HA 2P9VB 1NZOA 2G2WA 3HUMA 3IH8A 4KZ7A 5GLAA 5FAPA 5CGSA 1QMEA 5FI2A 2ZQ7A 2WYXA 2XR0A 2ZC4B 3PBTA 4S2KA 5M1AA 2HDUA 1K56A 1L0DA 5DF7A 5EVIA 1K4EA 4KQQA 2CC1A 3N8SA 4OPQA 3M2KA 2ZQDA 3EQVA 5FAOA 5CGWA 2R9XA 4C75A 1NJ4A 2XF3A 1I2SA 5HAIA 4FH2A 1KVLA 1MBLA 5FQMA 3D4FA 3ZG7B 4NK3A 2J9PA 3FYZA 3ZNYA 1GA0A 3LY3A 3GV9A 4B4XA 4B4ZA 1XA7A 5EOOA 3B3XA 1K55C 1RGZA 1LHYA 3ZVTA 4LENA 1ZC2A 3LEZA 2QPNA 2Y2KA 4IVIA 1J9MA 3OC2A 2XEPA 1IKGA 5KSHA 2PU4A 3HLWA 4H8RA 4U0XA 1G68A 5KMWA 3SH9A 3LCEA 4E3JA 3IXGA 4U3TA 4GZBA 3S1YA 5DTKA 4E6WA 2RCXA 4HESA 4CPKA 2XLNA 4S2LA 4U0TA 5A90A 1EROA 4LCMA 3ZCZA 1H8ZA 3MZDA 3EQUA 3MKFA 2IWCA 3ZGAB 1GHIA 1ONHA 1FCOA 4QU3A 2X01A 5AQAA 3HLGA 4X69A 4IBXA 3ZG5A 1K4FA 5GLDA 3VP2A 5FSRA 3AGDA 4R23A 1YLZA 1TEMA 3TG9A 1K56D 3GTCA 4DDSA 1YLWA 3SS3A 5CTNA 5KSCA 4OP5A 3IF6C 3V50A 4PM5A 1FQGA 2DRWA 1CEGA 4DKIA 1OMEA 2EFXA 1JWZA 5CGXA 3VP1A 2Y91A 1SKFA 4WZ5C 1PZOA 3FKVA 5EVLA 5A91A 1HZOA 3P09A 4S2PA 2XH9A 1KGFA 1NZUA 3JYIA 4OONA 3SS4A 4PM7A 4WBGA 4S2JA 1BZAA 4UAAA 4EUZA 1GHMA 3VP4A 1Q2QA 1XA1A 4WEJA 5AQ9A 3V3RA 5E2GA 4QB8A 5JYPA 4E6XA 3E2LA 2XFSA 2HP9A 5DTSA 1KDSA 2WGWA 5FA7A 5FI7A 2XK1A 3BRMA 1MWRA 1JWPA 4QHCA 5F1GA 5DTTA 3O86A 4N1XA 1MKIA 2QMIA 2IWDA 1BT5A 1ES3A 4X53A 3P98A 4MBFA 3W4OA 1MY8A 3G35A 5JYOA 4PPRA 3VFFA 1G6AA 1IELA 3ZG8B 1BULA 5L2FA 1LLBA 4MBHA 1YM1A 1BUEA 1PW1A 4RX3A 3WS2A 1DJCA 3IXBA 3NCKA 3HBRA 4OPRA 2ZQ9A 5GHYA 5EOEA 2WKEA 3UPOA 1FR1A 4WELA 1IEMA 2XD5A 4K0WA 2H10A 4DE0A 3A3FA 4E3NA 3WRTA 1K57A 3C4PA 4ZJ1A 2Y2QA 3Q7VB 2ZQ8A 3BECA 4JXVA 5EVIC 3NDGA 1DY6A 1K54C 4ZJ2A 2E8IA 3ITAA 4QD4A 3IWOA 4JBFA 5CHUA 4ZJ3A 2XQZA 3IH9A 1FR6A 2ZM2A 3IHAA 4MLLA 5HX9A 4C6YA 4X55A 1K6RA 1MXOA 4KZAA 3PAGA 5E2HA 2ZC6B 4KZBA 4WYYA 2I72A 4JF4A 3V5MA 3I7JA 3HLFA 4OQGA 1TVFA 2Y2NA 3GSGA 2Y2IA 4LV2A 2XD1A 3RJUA 4DE2A 3HLEA 3C5AA 4LV1A 2Y2GA 5A93A 4PMAA 2JCHA 2WUQA 4HEFA 3GVBA 4LV0A 5G18A 5GLCA 3C7UA 4S2NA 3OCNA 3LO7A 2Z2MB 5EUAA 3SS5A 2FFFB 2WGVA 4R0QA 2ZC5B 3E2KA 1XKZA 3N8RA 3WS4A 1K38A 3W4QA 3HLBA 1FSWA 4UHUA 1FOFA 4MBKA 3C4OA 4JF5A 3MXSA 3GMWA 2Y2LA 1W8QA 1PW8A 5D3OA 5CERA 1ERMA 5AQ7A 2DNSA 2ZQAA 5F1FA 5DF9A 5E43A 5M19A 4GDBA 4GN2A 1IYOA 4FSFA 4KQRA 1TDGA 2R9WA 3MKEA 3UPNA 2A49A 4KENB 1S0WA 4KG2A 1I5QA 4P87A 4OQHA 4UA6A 3BFGA 1KE3A 4BD0A 1I2WA 3BLMA 2BG1A 4LCLA 4R4RA 5GL9A 3OPHA 2P74A 3A3EA 4FD8A 1KVMA 3QNCA 1N9BA 2EX6A 4DRTA 3VOYA 2PBYA 4N9KA 4R3BA 3DTMA 3HVFA 1E25A 3BEBA 1H8YA 5TFQA 4GDNA 1JVJA 1BLCA 2J8YA 3V39A 2Y2MA 2XGNA 3G2YA 2BLSA 3HL9A 3NY4A 3Q1FA 3ZFZA 3QNBA 5A92A 1WYBA 3LY4A 3PAEA 3GRJA 4M3KA 2EXBA 3QHYA 4WZ4A 1LL5A 2HDSA 2UWXA 3Q82A 4P6BA 3UE0A 3WS1A 2OSUA 3UDXA 3UNWA 2EX8A 4YFMA 4ZAMA 1CK3A 1K57C 3MFDA 1W5DA 4OH0A 2WKHA 2ZQCA 4R1GA 4Z9QA 3IHBA 2OLVA 3TSGA 2WGWB 1MWUA 5FAQA 3NIAA 4Y0OA 4B88A 4KG6A 1CEFA 4P0MA 5AQBA 1ES2A 1KGGA 4DE3A 4N1HA 5CEBA 3SH8A 1Q2PA 3VMAA 2JC7A 1FCNA 2HPBA 2Q9MA 2PU2A 1K6SA 1WYCA 3HLCA 4S2MA 1VM1A 4Q8IA 1M40A 2OV5A 1NRFA 5F83A 2C5WB 3M6BA 4NETA 1EI5A 3HUOA 4RX2A 1WE4A 1ZKJA 3PTEA 4JXWA 1HTZA 1ZG6A 3ZG0A 2V20A 5FQ9A 1LI0A 5J8XA 3G2ZA 1K25A 4RVAA 3CZDA 4MNRA 3ZHHA 4L0LA 3UDFA 3UPPA 4KG5A 1ESUA 4OPYA 1EWZA 3WS5A 4BL3A 3GR2A 3UN7A 3FWLA 1YMSA 4JKTA 5FQQA 2Y2JA 1YT4A 5GHXA 3NDEA 5I94A 1XGJA 4DDYA 4GD6A 1H5XA 2WADA 3BLSA 4GKUA 3IT9A 3PBQA 1NY0A 1YLYA 2ZC3B 4ID4A 4F94A 1Z6FA 2Y59A 4WM9A 4DXCA 4X68A 5GHZA 4OLDA 1YLTA 3G32A 1SDEA 4DXBA 4E3OA 3SH7A 1MWTA 4IEDA 2XDMA 1LL9A 4DE1A 1ONGA 1PZPA 3IWQA 3A3IA 5E2EA 1L2SA 3GQZA 2H0TA 4KZ8A 2A3UA 5U47A 4EV4A 1SDNA 2V1ZA 1BTLA 4WMCD 3IXHA 1HVBA 3BYDA 1FSYA 3UY6A 3UE1A 5CEDA 4K0XA 3O88A 1XP4A 2X71A 1W8YA 5CRFA 4E3KA 4Y0UA 5HFOA 3G34A 1E4DA 2HP6A 1CI9A 1JTDA 4R4SA 2GDNA 5FQKA 5TR7A 1L0GA 4D2OA 3Q7ZA 1PWDA 3HLDA 2WZZA 3UDIA 1XXMA 3IXDA 2ZD8A 5CTMA 2WAEA 3IF5A 1ALQA 4OQIA 2RL3A 3ZG9B 1GA9A 1ESIA 3CMZA 4JXGA 1E3UA 4JLFA 4N9LA 4WEKA 3TOIA 1GHPA 4R3JA 3S4XA 3PBRA 3BFDA 3OPPA 3O87A 4KZ6A 4YINA 5DVAA 4UA9A 1PI4A 3A3DA 3ZDJA 1U60A 3WRZA 5TGFA 2X02A 3BFEA 4KZ9A 4BL2A 4ZDXA 4EBNA 3ZVWA 2QZ6A 2WKIA 3G30A 4Y0TA 3N6IA 3Q81A 3ITBA 4XXRA 4A5RA 1N4OA 1K54A 4RYEA 1TDLA 3M6HA 3UO9A 1PWGA 1ZG4A 5M18A 2Y55A 2C6WB 1IKIA 4XUXA 1NXYA 4S2IA 5CHMA 4Y7PA 4JF6A 4KZ5A 4FH4A 2P9VA 1BLPA 4HBUA 1FCMA 3PBNA 1IYPA 3C7VA 2XFTA 5FATA 5FI6A 1DJBA 2J7VA 5CHJA 4OLGA 3WWXA 3MXRA 2JE5A 4EBLA 1RP5A 3MZEA 3N8LA 5HAPA 4O7DA 1C3BA 2Q9NA 3NC8A 1S6RA 4KZ4A 5FQJA 1SCWA 1LI9A 2Y2PA 3SOIA 4JXSA 1M6KA 5IHVA 3NBLA 3BFFA 1YMXA 3BM6A 3WS0A 5BOHA 4IBRA 5FASA 4EWFA 2OLUA 5CECA 1VQQA 4X6TA 2H0YA 3DWKA 3OZHA 3RXXA 1E3UD 4XUZA 3VOZA 4EBPA 2EFUA 2FFYA 4BLMA 4OOYA 1SHVA 3O3VA 4BD1A 1JTGA 2IWBA 4DF6A 3ISGA 2HP5A 2ZM8A 4ZTKA 4QJGA 3FKWA 2WK0A 4CJNA 2ZC7A 3IQAA 3PBOA 4OOMA 5FDHA 5FQIA 5EVID 1DJAA 1PWCA 2Y4AA 1YLJA 5HARA 2EXAA 4BENA 1ES4A 4OVDA 3IWIA 4C3QA 1YLPA 1RGYA 3VP3A 2JBFA 4P85A 1ERQA 4WMCA 2HDQA 1W79A 1IYQA 3AGFA 1O7EA 4RA7A 4QY6A 5HL1A 1K55A 1HD8A 3CJMA 4S2NC 4E3LA 1KE4A 3DWZA 3VSKA 2Z2LB 4GOGA 1YQSA 3VFHA 2WGIA 5HW3A 3W8KA 3W4PA 5KZHA 4BQMA 4GNUA 1KE0A 5HAQA 4IVKA 3OPRA 5E2FA 3FZCA 3HUNA 1RCJA 2G2UA 1XGIA 4E3MA 2H5SA 1ES5A 3IF6B 2EX9A 4OQ0A 3UE3A 4ZBEA 5F82A 1Y54A 3MZFA 2ZJ9A 4LV3A 3OPLA 5CXWA 3Q07A 5EPHA 2DCFA 4S2OA 3PBSA 4N92A 4KZ3A 2B5RA 1MPLA 1MWSA 4OPZA 5EE8A 2ZLYA 2ZM0A 3V3SA 4PM8A 1L0EA 3CG5A 4JPMA 1PYYA 3G4PA 3IF6A 4OKPA 1CI8A 1PI5A 3OCLA 3N7WA 4PM9A 3RXWA 1JWVA 2J9OA 2WAFA 3MBZA 1KGEA 1PIOA 4FCFA 3DW0A 4WZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VP0 A;  4EQI A;  1O07 A;  2WZX A;  1QMF A;  2ZMA A;  1XX2 A;  2Y2O A;  1BLH A;  1GCE A;  4MEZ A;  2V2F F;  3ZNT A;  5GLB A;  3M2J A;  1L0F A;  5EEC A;  3Q7V A;  1BLS A;  5DF8 A;  4E3I A;  3S22 A;  4BJP A;  1NYM A;  2VGK A;  3BFC A;  3A3J A;  3FV7 A;  2HDR A;  3G31 A;  3N4I A;  4OP8 A;  4HBT A;  4GD8 A;  4KQO A;  4GB7 A;  1IYS A;  4X56 A;  3VSL A;  4K91 A;  5EVI B;  2VGJ A;  1AXB A;  4OOL A;  3NI9 A;  2EX2 A;  3AGE A;  4QY5 A;  1BSG A;  1W7F A;  4PM6 A;  1NYY A;  4UA7 A;  1XPB A;  1KDW A;  3HRE A;  2Y2H A;  2P9V B;  1NZO A;  2G2W A;  3HUM A;  3IH8 A;  4KZ7 A;  5GLA A;  5FAP A;  5CGS A;  1QME A;  5FI2 A;  2ZQ7 A;  2WYX A;  2XR0 A;  2ZC4 B;  3PBT A;  4S2K A;  5M1A A;  2HDU A;  1K56 A;  1L0D A;  5DF7 A;  5EVI A;  1K4E A;  4KQQ A;  2CC1 A;  3N8S A;  4OPQ A;  3M2K A;  2ZQD A;  3EQV A;  5FAO A;  5CGW A;  2R9X A;  4C75 A;  1NJ4 A;  2XF3 A;  1I2S A;  5HAI A;  4FH2 A;  1KVL A;  1MBL A;  5FQM A;  3D4F A;  3ZG7 B;  4NK3 A;  2J9P A;  3FYZ A;  3ZNY A;  1GA0 A;  3LY3 A;  3GV9 A;  4B4X A;  4B4Z A;  1XA7 A;  5EOO A;  3B3X A;  1K55 C;  1RGZ A;  1LHY A;  3ZVT A;  4LEN A;  1ZC2 A;  3LEZ A;  2QPN A;  2Y2K A;  4IVI A;  1J9M A;  3OC2 A;  2XEP A;  1IKG A;  5KSH A;  2PU4 A;  3HLW A;  4H8R A;  4U0X A;  1G68 A;  5KMW A;  3SH9 A;  3LCE A;  4E3J A;  3IXG A;  4U3T A;  4GZB A;  3S1Y A;  5DTK A;  4E6W A;  2RCX A;  4HES A;  4CPK A;  2XLN A;  4S2L A;  4U0T A;  5A90 A;  1ERO A;  4LCM A;  3ZCZ A;  1H8Z A;  3MZD A;  3EQU A;  3MKF A;  2IWC A;  3ZGA B;  1GHI A;  1ONH A;  1FCO A;  4QU3 A;  2X01 A;  5AQA A;  3HLG A;  4X69 A;  4IBX A;  3ZG5 A;  1K4F A;  5GLD A;  3VP2 A;  5FSR A;  3AGD A;  4R23 A;  1YLZ A;  1TEM A;  3TG9 A;  1K56 D;  3GTC A;  4DDS A;  1YLW A;  3SS3 A;  5CTN A;  5KSC A;  4OP5 A;  3IF6 C;  3V50 A;  4PM5 A;  1FQG A;  2DRW A;  1CEG A;  4DKI A;  1OME A;  2EFX A;  1JWZ A;  5CGX A;  3VP1 A;  2Y91 A;  1SKF A;  4WZ5 C;  1PZO A;  3FKV A;  5EVL A;  5A91 A;  1HZO A;  3P09 A;  4S2P A;  2XH9 A;  1KGF A;  1NZU A;  3JYI A;  4OON A;  3SS4 A;  4PM7 A;  4WBG A;  4S2J A;  1BZA A;  4UAA A;  4EUZ A;  1GHM A;  3VP4 A;  1Q2Q A;  1XA1 A;  4WEJ A;  5AQ9 A;  3V3R A;  5E2G A;  4QB8 A;  5JYP A;  4E6X A;  3E2L A;  2XFS A;  2HP9 A;  5DTS A;  1KDS A;  2WGW A;  5FA7 A;  5FI7 A;  2XK1 A;  3BRM A;  1MWR A;  1JWP A;  4QHC A;  5F1G A;  5DTT A;  3O86 A;  4N1X A;  1MKI A;  2QMI A;  2IWD A;  1BT5 A;  1ES3 A;  4X53 A;  3P98 A;  4MBF A;  3W4O A;  1MY8 A;  3G35 A;  5JYO A;  4PPR A;  3VFF A;  1G6A A;  1IEL A;  3ZG8 B;  1BUL A;  5L2F A;  1LLB A;  4MBH A;  1YM1 A;  1BUE A;  1PW1 A;  4RX3 A;  3WS2 A;  1DJC A;  3IXB A;  3NCK A;  3HBR A;  4OPR A;  2ZQ9 A;  5GHY A;  5EOE A;  2WKE A;  3UPO A;  1FR1 A;  4WEL A;  1IEM A;  2XD5 A;  4K0W A;  2H10 A;  4DE0 A;  3A3F A;  4E3N A;  3WRT A;  1K57 A;  3C4P A;  4ZJ1 A;  2Y2Q A;  3Q7V B;  2ZQ8 A;  3BEC A;  4JXV A;  5EVI C;  3NDG A;  1DY6 A;  1K54 C;  4ZJ2 A;  2E8I A;  3ITA A;  4QD4 A;  3IWO A;  4JBF A;  5CHU A;  4ZJ3 A;  2XQZ A;  3IH9 A;  1FR6 A;  2ZM2 A;  3IHA A;  4MLL A;  5HX9 A;  4C6Y A;  4X55 A;  1K6R A;  1MXO A;  4KZA A;  3PAG A;  5E2H A;  2ZC6 B;  4KZB A;  4WYY A;  2I72 A;  4JF4 A;  3V5M A;  3I7J A;  3HLF A;  4OQG A;  1TVF A;  2Y2N A;  3GSG A;  2Y2I A;  4LV2 A;  2XD1 A;  3RJU A;  4DE2 A;  3HLE A;  3C5A A;  4LV1 A;  2Y2G A;  5A93 A;  4PMA A;  2JCH A;  2WUQ A;  4HEF A;  3GVB A;  4LV0 A;  5G18 A;  5GLC A;  3C7U A;  4S2N A;  3OCN A;  3LO7 A;  2Z2M B;  5EUA A;  3SS5 A;  2FFF B;  2WGV A;  4R0Q A;  2ZC5 B;  3E2K A;  1XKZ A;  3N8R A;  3WS4 A;  1K38 A;  3W4Q A;  3HLB A;  1FSW A;  4UHU A;  1FOF A;  4MBK A;  3C4O A;  4JF5 A;  3MXS A;  3GMW A;  2Y2L A;  1W8Q A;  1PW8 A;  5D3O A;  5CER A;  1ERM A;  5AQ7 A;  2DNS A;  2ZQA A;  5F1F A;  5DF9 A;  5E43 A;  5M19 A;  4GDB A;  4GN2 A;  1IYO A;  4FSF A;  4KQR A;  1TDG A;  2R9W A;  3MKE A;  3UPN A;  2A49 A;  4KEN B;  1S0W A;  4KG2 A;  1I5Q A;  4P87 A;  4OQH A;  4UA6 A;  3BFG A;  1KE3 A;  4BD0 A;  1I2W A;  3BLM A;  2BG1 A;  4LCL A;  4R4R A;  5GL9 A;  3OPH A;  2P74 A;  3A3E A;  4FD8 A;  1KVM A;  3QNC A;  1N9B A;  2EX6 A;  4DRT A;  3VOY A;  2PBY A;  4N9K A;  4R3B A;  3DTM A;  3HVF A;  1E25 A;  3BEB A;  1H8Y A;  5TFQ A;  4GDN A;  1JVJ A;  1BLC A;  2J8Y A;  3V39 A;  2Y2M A;  2XGN A;  3G2Y A;  2BLS A;  3HL9 A;  3NY4 A;  3Q1F A;  3ZFZ A;  3QNB A;  5A92 A;  1WYB A;  3LY4 A;  3PAE A;  3GRJ A;  4M3K A;  2EXB A;  3QHY A;  4WZ4 A;  1LL5 A;  2HDS A;  2UWX A;  3Q82 A;  4P6B A;  3UE0 A;  3WS1 A;  2OSU A;  3UDX A;  3UNW A;  2EX8 A;  4YFM A;  4ZAM A;  1CK3 A;  1K57 C;  3MFD A;  1W5D A;  4OH0 A;  2WKH A;  2ZQC A;  4R1G A;  4Z9Q A;  3IHB A;  2OLV A;  3TSG A;  2WGW B;  1MWU A;  5FAQ A;  3NIA A;  4Y0O A;  4B88 A;  4KG6 A;  1CEF A;  4P0M A;  5AQB A;  1ES2 A;  1KGG A;  4DE3 A;  4N1H A;  5CEB A;  3SH8 A;  1Q2P A;  3VMA A;  2JC7 A;  1FCN A;  2HPB A;  2Q9M A;  2PU2 A;  1K6S A;  1WYC A;  3HLC A;  4S2M A;  1VM1 A;  4Q8I A;  1M40 A;  2OV5 A;  1NRF A;  5F83 A;  2C5W B;  3M6B A;  4NET A;  1EI5 A;  3HUO A;  4RX2 A;  1WE4 A;  1ZKJ A;  3PTE A;  4JXW A;  1HTZ A;  1ZG6 A;  3ZG0 A;  2V20 A;  5FQ9 A;  1LI0 A;  5J8X A;  3G2Z A;  1K25 A;  4RVA A;  3CZD A;  4MNR A;  3ZHH A;  4L0L A;  3UDF A;  3UPP A;  4KG5 A;  1ESU A;  4OPY A;  1EWZ A;  3WS5 A;  4BL3 A;  3GR2 A;  3UN7 A;  3FWL A;  1YMS A;  4JKT A;  5FQQ A;  2Y2J A;  1YT4 A;  5GHX A;  3NDE A;  5I94 A;  1XGJ A;  4DDY A;  4GD6 A;  1H5X A;  2WAD A;  3BLS A;  4GKU A;  3IT9 A;  3PBQ A;  1NY0 A;  1YLY A;  2ZC3 B;  4ID4 A;  4F94 A;  1Z6F A;  2Y59 A;  4WM9 A;  4DXC A;  4X68 A;  5GHZ A;  4OLD A;  1YLT A;  3G32 A;  1SDE A;  4DXB A;  4E3O A;  3SH7 A;  1MWT A;  4IED A;  2XDM A;  1LL9 A;  4DE1 A;  1ONG A;  1PZP A;  3IWQ A;  3A3I A;  5E2E A;  1L2S A;  3GQZ A;  2H0T A;  4KZ8 A;  2A3U A;  5U47 A;  4EV4 A;  1SDN A;  2V1Z A;  1BTL A;  4WMC D;  3IXH A;  1HVB A;  3BYD A;  1FSY A;  3UY6 A;  3UE1 A;  5CED A;  4K0X A;  3O88 A;  1XP4 A;  2X71 A;  1W8Y A;  5CRF A;  4E3K A;  4Y0U A;  5HFO A;  3G34 A;  1E4D A;  2HP6 A;  1CI9 A;  1JTD A;  4R4S A;  2GDN A;  5FQK A;  5TR7 A;  1L0G A;  4D2O A;  3Q7Z A;  1PWD A;  3HLD A;  2WZZ A;  3UDI A;  1XXM A;  3IXD A;  2ZD8 A;  5CTM A;  2WAE A;  3IF5 A;  1ALQ A;  4OQI A;  2RL3 A;  3ZG9 B;  1GA9 A;  1ESI A;  3CMZ A;  4JXG A;  1E3U A;  4JLF A;  4N9L A;  4WEK A;  3TOI A;  1GHP A;  4R3J A;  3S4X A;  3PBR A;  3BFD A;  3OPP A;  3O87 A;  4KZ6 A;  4YIN A;  5DVA A;  4UA9 A;  1PI4 A;  3A3D A;  3ZDJ A;  1U60 A;  3WRZ A;  5TGF A;  2X02 A;  3BFE A;  4KZ9 A;  4BL2 A;  4ZDX A;  4EBN A;  3ZVW A;  2QZ6 A;  2WKI A;  3G30 A;  4Y0T A;  3N6I A;  3Q81 A;  3ITB A;  4XXR A;  4A5R A;  1N4O A;  1K54 A;  4RYE A;  1TDL A;  3M6H A;  3UO9 A;  1PWG A;  1ZG4 A;  5M18 A;  2Y55 A;  2C6W B;  1IKI A;  4XUX A;  1NXY A;  4S2I A;  5CHM A;  4Y7P A;  4JF6 A;  4KZ5 A;  4FH4 A;  2P9V A;  1BLP A;  4HBU A;  1FCM A;  3PBN A;  1IYP A;  3C7V A;  2XFT A;  5FAT A;  5FI6 A;  1DJB A;  2J7V A;  5CHJ A;  4OLG A;  3WWX A;  3MXR A;  2JE5 A;  4EBL A;  1RP5 A;  3MZE A;  3N8L A;  5HAP A;  4O7D A;  1C3B A;  2Q9N A;  3NC8 A;  1S6R A;  4KZ4 A;  5FQJ A;  1SCW A;  1LI9 A;  2Y2P A;  3SOI A;  4JXS A;  1M6K A;  5IHV A;  3NBL A;  3BFF A;  1YMX A;  3BM6 A;  3WS0 A;  5BOH A;  4IBR A;  5FAS A;  4EWF A;  2OLU A;  5CEC A;  1VQQ A;  4X6T A;  2H0Y A;  3DWK A;  3OZH A;  3RXX A;  1E3U D;  4XUZ A;  3VOZ A;  4EBP A;  2EFU A;  2FFY A;  4BLM A;  4OOY A;  1SHV A;  3O3V A;  4BD1 A;  1JTG A;  2IWB A;  4DF6 A;  3ISG A;  2HP5 A;  2ZM8 A;  4ZTK A;  4QJG A;  3FKW A;  2WK0 A;  4CJN A;  2ZC7 A;  3IQA A;  3PBO A;  4OOM A;  5FDH A;  5FQI A;  5EVI D;  1DJA A;  1PWC A;  2Y4A A;  1YLJ A;  5HAR A;  2EXA A;  4BEN A;  1ES4 A;  4OVD A;  3IWI A;  4C3Q A;  1YLP A;  1RGY A;  3VP3 A;  2JBF A;  4P85 A;  1ERQ A;  4WMC A;  2HDQ A;  1W79 A;  1IYQ A;  3AGF A;  1O7E A;  4RA7 A;  4QY6 A;  5HL1 A;  1K55 A;  1HD8 A;  3CJM A;  4S2N C;  4E3L A;  1KE4 A;  3DWZ A;  3VSK A;  2Z2L B;  4GOG A;  1YQS A;  3VFH A;  2WGI A;  5HW3 A;  3W8K A;  3W4P A;  5KZH A;  4BQM A;  4GNU A;  1KE0 A;  5HAQ A;  4IVK A;  3OPR A;  5E2F A;  3FZC A;  3HUN A;  1RCJ A;  2G2U A;  1XGI A;  4E3M A;  2H5S A;  1ES5 A;  3IF6 B;  2EX9 A;  4OQ0 A;  3UE3 A;  4ZBE A;  5F82 A;  1Y54 A;  3MZF A;  2ZJ9 A;  4LV3 A;  3OPL A;  5CXW A;  3Q07 A;  5EPH A;  2DCF A;  4S2O A;  3PBS A;  4N92 A;  4KZ3 A;  2B5R A;  1MPL A;  1MWS A;  4OPZ A;  5EE8 A;  2ZLY A;  2ZM0 A;  3V3S A;  4PM8 A;  1L0E A;  3CG5 A;  4JPM A;  1PYY A;  3G4P A;  3IF6 A;  4OKP A;  1CI8 A;  1PI5 A;  3OCL A;  3N7W A;  4PM9 A;  3RXW A;  1JWV A;  2J9O A;  2WAF A;  3MBZ A;  1KGE A;  1PIO A;  4FCF A;  3DW0 A;  4WZ5 A; 
#chains in the Genus database with same CATH topology
 4X1M A;  2WZX A;  2ZMA A;  4MEZ A;  2VK3 A;  2W1T B;  4Y2F A;  5HD5 A;  3Q7V A;  1BLS A;  2V8C A;  2OAQ 1;  4E3I A;  3S22 A;  4BJP A;  1ZTU A;  3ZYT A;  2WKQ A;  2VLG A;  2VJW A;  1NYM A;  2VGK A;  3G31 A;  4HBT A;  1IYS A;  5EVI B;  4OOL A;  3AGE A;  4QY5 A;  1P9W A;  4PM6 A;  3NJA A;  2XA7 M;  5GLA A;  5FAP A;  3IX3 A;  2ZQ7 A;  4KQQ A;  5HD3 A;  2ZQD A;  5FAO A;  1I2S A;  5HAI A;  4FH2 A;  1KVL A;  4P6Z M;  5FQM A;  4PKY A;  3ZNY A;  3T1X A;  1FIK A;  3B3X A;  1RGZ A;  3CUE C;  2O9C A;  3LEZ A;  2QPN A;  2Y2K A;  3OC2 A;  2XEP A;  5DJT A;  4U0X A;  1G68 A;  5TBM A;  2XLN A;  4U0T A;  1ERO A;  1H8Z A;  3NOT C;  4QU3 A;  5AQA A;  3HLG A;  4IBX A;  1K4F A;  3UB5 P;  4R23 A;  4CLC C;  4DDS A;  2ZOI A;  4JGP A;  4OP5 A;  2DRW A;  4DKI A;  4PM7 A;  4WBG A;  1BZA A;  1Q2Q A;  1XA1 A;  1Y4O A;  4MN6 A;  3KSH A;  5DTS A;  2O99 A;  1KDS A;  3IS2 A;  4EET B;  1OJ5 A;  2WGW A;  2XK1 A;  4R6L A;  3BRM A;  5F1G A;  5DTT A;  3ICY A;  3W4O A;  3MXQ A;  5HDD A;  5L2F A;  4MBH A;  1BUE A;  3MQO A;  4RX3 A;  4Q0J A;  1PNE A;  3NCK A;  3HBR A;  3QP2 A;  2XRO A;  4GHI B;  4LGW A;  2XD5 A;  3WRT A;  2Y2Q A;  2ZQ8 A;  5EVI C;  3NDG A;  1DY6 A;  4ZJ2 A;  5HSQ A;  3IWO A;  4JBF A;  1OT6 A;  3IH9 A;  1FR6 A;  2ZM2 A;  4O0P A;  4C6Y A;  2VZW A;  5E2H A;  1T1B A;  3GSG A;  2Y2I A;  1PRQ A;  3T12 B;  2KDK A;  2JCH A;  2WUQ A;  5GLC A;  2V0W A;  3MQ0 A;  1D7E A;  5TJJ A;  3HLB A;  1FSW A;  4LPZ A;  4MBK A;  3GMW A;  1ERM A;  2DNS A;  2ZQA A;  5F1F A;  5M19 A;  4GDB A;  5DFY A;  4KQR A;  4QWO A;  3DAV A;  3C30 A;  3MKE A;  4KG2 A;  1I5Q A;  3TJZ C;  1KE3 A;  5J3W A;  1I2W A;  2BG1 A;  5F6A A;  4FD8 A;  3W2Z A;  3V67 A;  1S4R A;  2YKH A;  1H8Y A;  2L1M A;  1BLC A;  2Y2M A;  2GJ3 A;  3CHW P;  3G2Y A;  4D60 A;  3GEC A;  3QNB A;  5A92 A;  3LID A;  3LY4 A;  2V8F A;  3PAE A;  3GRJ A;  2EXB A;  1LL5 A;  3UE0 A;  4YFM A;  3MFD A;  2WKH A;  2ZQC A;  2OLV A;  3TSG A;  2W27 A;  5FAQ A;  3NIA A;  5AQB A;  4JGQ A;  5EM0 A;  1WYC A;  4S2M A;  1VM1 A;  1M40 A;  3M6B A;  1EI5 A;  3MFX A;  3HUO A;  3P01 A;  4RX2 A;  4JXW A;  3ZG0 A;  5FQ9 A;  1ESU A;  2QYB A;  3WS5 A;  4NKP A;  3FWL A;  1YMS A;  4JKT A;  3T4O A;  5GHX A;  3T1Q B;  1ZHH B;  5L8M A;  5I5L A;  1XGJ A;  2M7V A;  1H5X A;  4WM9 A;  2D02 A;  5GHZ A;  4OLD A;  4E3O A;  4IED A;  3T4K A;  1ONG A;  3R7W A;  3F1O B;  5U47 A;  2VV7 A;  1T18 A;  1HVB A;  1W63 Q;  3BYD A;  4HJ4 A;  2A24 B;  2Q0O A;  5K5B A;  3O88 A;  1XP4 A;  2VA0 A;  5HFO A;  2PT7 A;  3CPT B;  1E4D A;  2VEA A;  3BY8 A;  1PWD A;  3BW6 A;  2PHY A;  3BWL A;  1XXM A;  3IXD A;  2PYP A;  3ZG9 B;  5DKL A;  1E3U A;  4WEK A;  3DBA A;  5KIZ A;  3OPP A;  3O87 A;  4UA9 A;  3A3D A;  3ZDJ A;  4CLC D;  3UB9 A;  2HZ5 A;  4HP9 A;  4BL2 A;  4EBN A;  3ZVW A;  3ITB A;  1K54 A;  4RYE A;  3M6H A;  2C6W B;  4XUX A;  2ACG A;  1BLP A;  1FCM A;  3PBN A;  1IYP A;  3C7V A;  1DJB A;  2J7V A;  3FG8 A;  3WWX A;  1IFQ A;  1TS0 A;  1V9Y A;  1CQA A;  1Z09 A;  3UB6 A;  3LYX A;  1YMX A;  5BOH A;  5F5Y A;  3S7P A;  4WLA A;  4BLM A;  4BMW A;  4ZTK A;  4KUO A;  3IQA A;  5FDH A;  5FQI A;  5EVI D;  5HAR A;  2EXA A;  4OVD A;  5DKK A;  4X1L A;  3RFB A;  3AGF A;  1PFL A;  5HL1 A;  3CJM A;  4S2N C;  4E3L A;  3DWZ A;  5DJU A;  4GOG A;  1YQS A;  5HW3 A;  1KE0 A;  4IVK A;  3HUN A;  2H5S A;  1WA9 A;  3QP8 A;  4OQ0 A;  3UE3 A;  2JKT M;  3OPL A;  2VV6 A;  2DCF A;  4S2O A;  4KZ3 A;  2W3G A;  2ZM0 A;  3IBJ A;  4JPM A;  3G4P A;  3IF6 A;  5IU1 A;  2JHE A;  1JWV A;  2J9O A;  2WAF A;  4FCF A;  4WZ5 A;  2P7J A;  5AJG A;  1XX2 A;  1BLH A;  1GCE A;  2V2F F;  4ETX A;  1GSV A;  1OTI A;  5EEC A;  1H0M A;  5DF8 A;  4H6J A;  3VV4 A;  4GS9 A;  3MSH A;  3FV7 A;  3N4I A;  2HDR A;  3OOV A;  2EA9 A;  4OP8 A;  4GD8 A;  4GB7 A;  5EVE A;  1AXB A;  1BSG A;  1NYY A;  1XPB A;  1KDW A;  2P9V B;  1NZO A;  3IH8 A;  1GSW A;  1F2K A;  1QME A;  2WYX A;  5M1A A;  3PBT A;  1SZV A;  5EFW A;  3PYP A;  1K4E A;  4EUV A;  1NJ4 A;  2FZ0 A;  1NLZ A;  1Y28 A;  3D4F A;  1XFQ A;  4NK3 A;  2J9P A;  3FYZ A;  4EES A;  4B4X A;  3E98 A;  5EOO A;  1K55 C;  4PHT A;  4IVI A;  1UGU A;  5HWW A;  2PU4 A;  3HLW A;  2PR5 A;  5KMW A;  3NOU C;  3SH9 A;  5L09 A;  4E6W A;  2RCX A;  4HES A;  1YAX A;  4S2L A;  5A90 A;  2JKR M;  4LCM A;  3MZD A;  3MKF A;  1GHI A;  1FCO A;  4I38 A;  5CX7 A;  4X69 A;  3D3O A;  4HH2 A;  5GLD A;  3T1S A;  1TEM A;  1K56 D;  3GTC A;  2H28 A;  3CWF A;  3B47 A;  3K3C A;  5CTN A;  4CLC E;  5KSC A;  2PDR A;  1FQG A;  3LI9 A;  1OME A;  5CGX A;  3VP1 A;  3IS2 B;  3FKV A;  5EVL A;  1HZO A;  3LR3 A;  3P09 A;  4FOF A;  4S2P A;  4Y13 A;  2L0W A;  2V1B A;  4NXE A;  4DN0 A;  4S2J A;  4WF0 A;  1GHM A;  1N9O A;  5E2G A;  3E2L A;  1CJF A;  4I3I A;  4UQI M;  3E0Y A;  3ZQ5 A;  2QMI A;  2IWD A;  3B42 A;  4MBF A;  1MY8 A;  2B95 A;  1BUL A;  3NUL A;  1TF1 A;  5EV0 A;  3WS2 A;  1DJC A;  2NUT C;  3UPO A;  1FR1 A;  4WEL A;  2H10 A;  5FEG A;  3BEC A;  4JXV A;  5FEF A;  5F69 A;  1A0K A;  2E8I A;  3LR4 A;  3IHA A;  4X55 A;  1MXO A;  1TS8 A;  3PAG A;  2ZC6 B;  3V5M A;  3I7J A;  4LLO B;  1TVF A;  3RJU A;  4FUW A;  4PMA A;  4LV0 A;  3S7Q A;  1OTB A;  2AVX A;  4R0Q A;  3LIA A;  4DJ3 A;  3E2K A;  3W4Q A;  4NXG A;  3MXS A;  5AQ7 A;  4B9O A;  5DF9 A;  2V1A A;  4FSF A;  2A49 A;  1SKO A;  3LIB A;  1XJ6 A;  4P87 A;  5LBR A;  4OQH A;  4BD0 A;  4LRY C;  2W1R A;  4LCL A;  2HV1 A;  2P74 A;  4G3V A;  4EER A;  4DRT A;  2PR6 A;  4N9K A;  4R3B A;  4Y5F A;  3H82 B;  5TFQ A;  2BTF P;  1JVJ A;  3V39 A;  1AWI A;  1VHM A;  3NY4 A;  3Q1F A;  3ZFZ A;  1WYB A;  3LI8 A;  4M3K A;  3QHY A;  4WZ4 A;  1TS7 A;  3Q82 A;  3UDX A;  4K08 A;  3UNW A;  1CK3 A;  1W5D A;  4OH0 A;  2V0U A;  4BBT A;  3SZT A;  3T50 A;  1YSQ A;  3EOI A;  4G3K A;  1MWU A;  4Y0O A;  4KG6 A;  1CEF A;  4EU0 A;  5CEB A;  3VMA A;  2JC7 A;  1FCN A;  2Q9M A;  4ARZ A;  1NRF A;  2C5W B;  1P9R A;  1DP6 A;  1WE4 A;  1ZKJ A;  3PTE A;  1HTZ A;  3CUE A;  4MNR A;  3UDF A;  1EWZ A;  4BL3 A;  3GR2 A;  1YT4 A;  5I94 A;  2NUP C;  4DDY A;  3BLS A;  4GKU A;  3IT9 A;  3PBQ A;  1YLY A;  2E8J A;  4M4X A;  4WUJ A;  1YLT A;  4EEU A;  1SDE A;  4DXB A;  2XRN A;  3O5Y A;  1MWT A;  4ZRR A;  4HNB A;  4CLC A;  2PD7 A;  3UME A;  5E2E A;  1L2S A;  2BAS A;  3T4Q A;  3GQZ A;  2H0T A;  2A3U A;  1G5U A;  4EV4 A;  1SDN A;  3T4J A;  1L3L A;  1FSY A;  3UE1 A;  1V9Z A;  2X71 A;  1W8Y A;  4E3K A;  1CI9 A;  2KOI A;  1LSV A;  2HJ9 C;  1L0G A;  5A8B A;  3Q7Z A;  3HLD A;  1YKD A;  2WAE A;  3IF5 A;  2RL3 A;  2W1T A;  4JGR A;  1GA9 A;  1ESI A;  3L7H A;  3FC7 A;  4JXG A;  3S7N A;  4N9L A;  3TOI A;  4Y17 A;  3S4X A;  2PAV P;  2K31 A;  3BFD A;  3L9K A;  4KZ6 A;  4YIN A;  1PI4 A;  5TGF A;  4ZDX A;  2O9A A;  2QZ6 A;  1G6O A;  5M18 A;  2DMW A;  1PWG A;  4KUK A;  2Y55 A;  1IKI A;  1NXY A;  3H7W B;  4JF6 A;  2HJE A;  5CHJ A;  1KOU A;  3MXR A;  4EBL A;  1RP5 A;  1D1J A;  3LGO A;  5FQJ A;  4HY8 A;  4YNR A;  3NBL A;  3BFF A;  3BM6 A;  3LIF A;  5G4Z A;  4EWF A;  1VQQ A;  3RXX A;  2H0Y A;  3DWK A;  5HWV A;  4BD1 A;  3ISG A;  2P04 A;  3FKW A;  3F1P B;  1IOU A;  2Y4A A;  1YLJ A;  1ES4 A;  1K0K A;  2VGL M;  3HCY A;  4WMC A;  2XA7 S;  2J3W A;  1HD8 A;  3NEC A;  4RQ9 A;  3G6O A;  2M1C A;  3SW1 A;  3W8K A;  3W4P A;  3C8C A;  4Y3I A;  4X25 A;  3C38 A;  3OPR A;  2EWV A;  3NOP C;  2G2U A;  4P6Z S;  3IF6 B;  5DFX A;  5F82 A;  2ZJ9 A;  3F1N B;  1OPX A;  2B5R A;  1MWS A;  4OPZ A;  2ZLY A;  4PM8 A;  1L0E A;  4QPR A;  3CG5 A;  3N7W A;  2EWW A;  1KGE A;  2INW A;  3UE6 A;  3VP0 A;  4EQI A;  3T4T A;  1O07 A;  4NXF A;  4GHI A;  3RTY A;  1L0F A;  1S1Z A;  2KLI A;  4JGO A;  2W0N A;  3MQQ A;  3BFC A;  3A3J A;  4X56 A;  2LB5 A;  3S7O A;  2EX2 A;  3HRE A;  3HUM A;  2G2W A;  4DJ2 A;  1OJG A;  5CGS A;  5FI2 A;  2XR0 A;  2ZC4 B;  1VET B;  4S2K A;  2HDU A;  2ZL1 B;  4EEP A;  1K56 A;  5DF7 A;  2CC1 A;  3N8S A;  2D01 A;  4OPQ A;  3M2K A;  1TD5 A;  5CGW A;  4G3W A;  4EQ1 A;  4BWI A;  1MBL A;  3ZG7 B;  1GA0 A;  3GV9 A;  1XA7 A;  4XT2 B;  1YSP A;  1LHY A;  4KQD A;  3ZVT A;  1J9M A;  1IKG A;  3JVV A;  4CQH A;  3LCE A;  3IXG A;  4U3T A;  5DTK A;  4CPK A;  4IUK A;  5IS1 A;  3NHQ A;  3ZCZ A;  3EQU A;  3ZGA B;  4MN7 A;  2GZA A;  4AFI A;  3TG9 A;  3KSG A;  3DTE A;  3SS3 A;  1XJ4 A;  1VEU B;  3IF6 C;  4PM5 A;  4R3A A;  2Y91 A;  4WZ5 C;  1PZO A;  3E4Q A;  2XH9 A;  1KGF A;  4L9G A;  1NZU A;  3JYI A;  4L9E A;  3SS4 A;  4DMZ A;  4EUZ A;  4UAA A;  3VP4 A;  4WEJ A;  1DP8 A;  3MF0 A;  4QB8 A;  2HP9 A;  5FA7 A;  4QHC A;  1JWP A;  1FIL A;  3O86 A;  1MKI A;  4X53 A;  5HDS A;  3G35 A;  3CI6 A;  3VFF A;  1IEL A;  3ZG8 B;  5J7E A;  1PW1 A;  4O8G A;  4OPR A;  1NRJ A;  5GHY A;  3FPV A;  1CF0 A;  5EOE A;  4DE0 A;  4K0W A;  4E3N A;  3A3F A;  1JNU A;  1K57 A;  4ZJ1 A;  3KSI A;  3Q7V B;  4QD4 A;  3H9W A;  5CHU A;  3UB7 A;  4HJ6 A;  3GDI A;  5FDS A;  3U2A A;  2Y2N A;  4DE2 A;  3C5A A;  4ETZ A;  4BBU A;  2YKF A;  5A93 A;  3C7U A;  1OTD A;  4S2N A;  5EUA A;  3SS5 A;  1LT0 A;  2ZC5 B;  4HOI A;  1XKZ A;  1SKO B;  1FOF A;  3C4O A;  2I9V A;  2VGL S;  1MZU A;  2Y2L A;  1PW8 A;  5CER A;  2A24 A;  3CPT A;  3EGD C;  5TBM B;  3UPN A;  4KEN B;  3BFG A;  2HGV A;  3BLM A;  3UB8 A;  4L9F A;  4R4R A;  2QKP A;  3QNC A;  1N9B A;  2EX6 A;  3A0R A;  2PBY A;  3DTM A;  3HVF A;  4GDN A;  2J8Y A;  3EEA A;  4GCZ A;  4ME4 A;  1T1C A;  2XGN A;  2BLS A;  3QP1 A;  4YWZ A;  3IX4 A;  4P6B A;  2WKP A;  5HPI A;  2OSU A;  2EX8 A;  4Z9Q A;  3IHB A;  2WGW B;  1ES2 A;  2QHK A;  1J3W A;  4DE3 A;  1D06 A;  2HPB A;  3LEQ A;  2PU2 A;  1K6S A;  3HLC A;  5HZH A;  2OV5 A;  2OAP 1;  3K3D A;  1ZG6 A;  4WN5 A;  2V20 A;  1LI0 A;  3G2Z A;  1K25 A;  3CZD A;  4L0L A;  3UPP A;  3BQA A;  1G28 A;  2Z6D A;  3MMH A;  3NDE A;  2FH5 A;  3PHY A;  3CIT A;  2WAD A;  4ID4 A;  1Z6F A;  2Y59 A;  3C2W A;  3G32 A;  3ULF A;  5C5K A;  2WKR A;  4MN5 A;  1MC0 A;  2R78 A;  2XDM A;  3T1R A;  1PZP A;  3IWQ A;  3A3I A;  1N9N A;  4KZ8 A;  1BYW A;  1BTL A;  3TRC A;  3UY6 A;  5CED A;  1LSW A;  5CRF A;  1JTD A;  4R4S A;  3EGX C;  4D2O A;  5AVE A;  3QP6 A;  1DP9 A;  2WZZ A;  4R38 A;  3UDI A;  2ZD8 A;  5CTM A;  5AVF A;  4EW7 A;  3CMZ A;  4JLF A;  1GHP A;  3K2N A;  3PBR A;  3QP4 A;  3A0V A;  3WRZ A;  3R4K A;  3BFE A;  1T19 A;  2WKI A;  5EM1 A;  4Y0T A;  3N6I A;  4XXR A;  1N4O A;  2ZMV A;  4ESP A;  3KSF A;  4S2I A;  4Y7P A;  2P9V A;  4HBU A;  2XFT A;  4OLG A;  3PR6 A;  2L4R A;  3MZE A;  2Z6C A;  1S1Y A;  1S6R A;  3SOI A;  3B33 A;  4WL9 A;  3WS0 A;  4IBR A;  5FAS A;  2OLU A;  5CEC A;  4Q8I A;  2PD8 A;  3P7N A;  3OZH A;  4X6T A;  2Y79 A;  2EFU A;  2FFY A;  4OOY A;  3O3V A;  2IWB A;  2ZMF A;  4QJG A;  4CJN A;  3KX0 X;  3PBO A;  3U4L P;  1DJA A;  1PWC A;  4BEN A;  2JBF A;  1UWP X;  1ERQ A;  4YOF A;  2HDQ A;  1GSX A;  1IYQ A;  1O7E A;  4QY6 A;  1KE4 A;  1P0Z A;  1X0O A;  4HP4 A;  3VFH A;  2WGI A;  3CAX A;  5KZH A;  3D9Y A;  4GNU A;  3FZC A;  3R7W B;  3KYQ A;  1ES5 A;  2EX9 A;  5HL6 A;  4LFU A;  4ZBE A;  4F3L A;  5EPH A;  2A2L A;  3LIC A;  3PBS A;  3T4L A;  3EWK A;  2W3D A;  1UWN X;  3V3S A;  4Z1W A;  5G4Y A;  1PI5 A;  3BJN A;  2JKT I;  3RXW A;  2JKF A;  3LFV A;  3DW0 A;  4LRX C;  1QMF A;  2Y2O A;  3OLO A;  5MC7 A;  3ZNT A;  5GLB A;  3M2J A;  3EEH A;  3TE8 A;  1NWZ A;  4KQO A;  3VSL A;  1YPR A;  2O0Y A;  3IX8 A;  1S66 L;  4K91 A;  2VGJ A;  4MDZ A;  3NI9 A;  1W7F A;  2W3E A;  4UA7 A;  4NEE D;  2Y2H A;  4KZ7 A;  1LL8 A;  1L0D A;  5EVI A;  2K7S A;  4UQI S;  3EQV A;  2R9X A;  4C75 A;  3VE3 A;  2XF3 A;  3BY9 A;  4E04 A;  3LY3 A;  2J3T C;  4B4Z A;  4Q0I A;  4LEN A;  1ZC2 A;  2QWS A;  5KSH A;  2V9A A;  4H8R A;  4E3J A;  4GZB A;  3S1Y A;  3LR5 A;  3DTK A;  3MJQ A;  2J80 A;  2IWC A;  1ONH A;  2X01 A;  2GX5 A;  3ZG5 A;  1OTE A;  3VP2 A;  5FSR A;  3AGD A;  3MR0 A;  1YLZ A;  2JKR I;  1NLY A;  2Y8H A;  3H82 A;  1OT9 A;  1YLW A;  1T1A A;  3V50 A;  2CMN A;  1CEG A;  2EFX A;  1JWZ A;  4HHD A;  4R70 A;  1SKF A;  5A91 A;  4NXB A;  4OON A;  1XJ3 A;  3A0S A;  5AQ9 A;  3HJK A;  3V3R A;  5JYP A;  1MKM A;  4E6X A;  2XFS A;  5FI7 A;  4GLQ A;  1MWR A;  4N1X A;  1BT5 A;  1ES3 A;  2VX8 A;  3P98 A;  5JYO A;  4PPR A;  1G6A A;  1LLB A;  4EXO A;  1YM1 A;  4I5S A;  3DTI A;  3IXB A;  3TW8 A;  1VB6 A;  2ZQ9 A;  3CLO A;  2WKE A;  1IEM A;  3C4P A;  1ODV A;  4H6J B;  1ACF A;  1K54 C;  3ITA A;  4ZJ3 A;  2XQZ A;  4GS9 B;  4MLL A;  5HX9 A;  1K6R A;  4KZA A;  4KZB A;  4WYY A;  2I72 A;  4JF4 A;  3HLF A;  4OQG A;  3D72 A;  2LB9 A;  4LV2 A;  2XD1 A;  1XFN A;  3HLE A;  4LV1 A;  1F98 A;  2Y2G A;  4HEF A;  3GVB A;  5G18 A;  5HWT A;  3OCN A;  3LO7 A;  2Z2M B;  2W3F A;  2FFF B;  2WGV A;  3PXP A;  3N8R A;  3WS4 A;  1S4S A;  1K38 A;  4GJ4 A;  4UHU A;  4LRZ E;  4JF5 A;  1W8Q A;  5D3O A;  5E43 A;  4II7 A;  4GN2 A;  4I39 A;  1IYO A;  1OTA A;  1TDG A;  2R9W A;  1S0W A;  4UA6 A;  1S67 L;  5GL9 A;  2QJ7 A;  3OPH A;  1N9L A;  3A3E A;  1KVM A;  3VOL A;  4UEY A;  2OWH A;  3VOY A;  3IBR A;  1E25 A;  3BEB A;  4GW9 A;  2MJ6 A;  3HL9 A;  5HPF A;  3H7W A;  1W63 M;  2HDS A;  2UWX A;  3WS1 A;  3HJI A;  4Q0H A;  4ZAM A;  1EW0 A;  1K57 C;  4R1G A;  1TS6 A;  2W3H A;  2P08 A;  4I3A A;  2PRF A;  4B88 A;  4P0M A;  1KGG A;  4N1H A;  3SH8 A;  1Q2P A;  3E4P A;  4HH3 A;  1XJ2 A;  2QJ5 A;  4I3J A;  4B93 A;  5F83 A;  4NET A;  3F1P A;  2JKG A;  4FTX A;  5IT5 A;  4IJG A;  5J8X A;  1STZ A;  2VKS A;  4RVA A;  3ZHH A;  3KYZ A;  3QP5 A;  4KG5 A;  4OPY A;  3UN7 A;  5FQQ A;  2Y2J A;  2K2N A;  3OBF A;  2G7U A;  4GD6 A;  2O9B A;  1NY0 A;  2ZC3 B;  1LSX A;  4F94 A;  4DXC A;  1F5M A;  4X68 A;  3SH7 A;  1P97 A;  3JVU A;  4DE1 A;  1LL9 A;  4HQA A;  3RH8 B;  3F1N A;  2V1Z A;  4WMC D;  5J4E A;  2J3T D;  3IXH A;  4K0X A;  2OWJ A;  4Y0U A;  3G34 A;  3F1O A;  2HP6 A;  2PYR A;  2GDN A;  4O01 A;  2VV8 A;  5FQK A;  5TR7 A;  3E4O A;  1ALQ A;  4OQI A;  2ZOH A;  2JN7 A;  4R3J A;  5DVA A;  1U60 A;  2XSS A;  2X02 A;  4KZ9 A;  3LR0 A;  2HF6 A;  4PAU A;  3G30 A;  3Q81 A;  4A5R A;  3UO9 A;  1TDL A;  1ZG4 A;  5CHM A;  3UMD A;  4MMN A;  4KZ5 A;  2ZBB A;  5L10 A;  2IA2 A;  4FH4 A;  5FAT A;  5FI6 A;  2UV0 E;  3MS6 A;  1VET A;  1HLU P;  2ZL1 A;  2JE5 A;  5HDC A;  5HAP A;  3N8L A;  4IUH A;  4O7D A;  5L07 A;  1C3B A;  2Q9N A;  3NC8 A;  4KZ4 A;  1SCW A;  4NG2 A;  3VE4 A;  1LI9 A;  2Y2P A;  4JXS A;  1M6K A;  5IHV A;  2B18 A;  4XT2 A;  4ARZ B;  4EBP A;  1E3U D;  4XUZ A;  3VOZ A;  4MCW A;  1SHV A;  1JTG A;  4DF6 A;  2HP5 A;  2ZM8 A;  2WK0 A;  2ZC7 A;  4Y15 A;  2PBD P;  4OOM A;  2B02 A;  3FPW A;  3IWI A;  3KO6 A;  4C3Q A;  1YLP A;  1RGY A;  3JPU A;  4PKY G;  2OOL A;  3VP3 A;  4P85 A;  1W79 A;  1DRM A;  4RA7 A;  1K55 A;  3LUQ A;  2M7U A;  3VSK A;  2GNX A;  4BBV A;  2Z2L B;  1VEU A;  5F68 A;  4F3L B;  4BQM A;  5HAQ A;  5E2F A;  3T4S A;  4CLC B;  4HJ3 A;  1F9I A;  1H3Q A;  1RCJ A;  1XGI A;  4E3M A;  3LIE A;  1Y54 A;  3MZF A;  1H8M A;  4LV3 A;  5CXW A;  3Q07 A;  5FL3 A;  4N92 A;  2KX6 A;  5EE8 A;  1MPL A;  3BQ8 A;  4IHQ A;  1PYY A;  4OKP A;  4HIA A;  1CI8 A;  3KYE A;  3OCL A;  4PM9 A;  3MBZ A;  1PIO A;  4HI4 A; 
#chains in the Genus database with same CATH homology
 3VP0 A;  4EQI A;  1O07 A;  2WZX A;  1QMF A;  2ZMA A;  1XX2 A;  2Y2O A;  1BLH A;  1GCE A;  4MEZ A;  2V2F F;  3ZNT A;  5GLB A;  3M2J A;  1L0F A;  5EEC A;  3Q7V A;  1BLS A;  5DF8 A;  4E3I A;  3S22 A;  4BJP A;  1NYM A;  2VGK A;  3BFC A;  3A3J A;  3FV7 A;  2HDR A;  3G31 A;  3N4I A;  4OP8 A;  4HBT A;  4GD8 A;  4KQO A;  4GB7 A;  1IYS A;  4X56 A;  3VSL A;  4K91 A;  5EVI B;  2VGJ A;  1AXB A;  4OOL A;  3NI9 A;  2EX2 A;  3AGE A;  4QY5 A;  1BSG A;  1W7F A;  4PM6 A;  1NYY A;  4UA7 A;  1XPB A;  1KDW A;  3HRE A;  2Y2H A;  2P9V B;  1NZO A;  2G2W A;  3HUM A;  3IH8 A;  4KZ7 A;  5GLA A;  5FAP A;  5CGS A;  1QME A;  5FI2 A;  2ZQ7 A;  2WYX A;  2XR0 A;  2ZC4 B;  3PBT A;  4S2K A;  5M1A A;  2HDU A;  1K56 A;  1L0D A;  5DF7 A;  5EVI A;  1K4E A;  4KQQ A;  2CC1 A;  3N8S A;  4OPQ A;  3M2K A;  2ZQD A;  3EQV A;  5FAO A;  5CGW A;  2R9X A;  4C75 A;  1NJ4 A;  2XF3 A;  1I2S A;  5HAI A;  4FH2 A;  1KVL A;  1MBL A;  5FQM A;  3D4F A;  3ZG7 B;  4NK3 A;  2J9P A;  3FYZ A;  3ZNY A;  1GA0 A;  3LY3 A;  3GV9 A;  4B4X A;  4B4Z A;  1XA7 A;  5EOO A;  3B3X A;  1K55 C;  1RGZ A;  1LHY A;  3ZVT A;  4LEN A;  1ZC2 A;  3LEZ A;  2QPN A;  2Y2K A;  4IVI A;  1J9M A;  3OC2 A;  2XEP A;  1IKG A;  5KSH A;  2PU4 A;  3HLW A;  4H8R A;  4U0X A;  1G68 A;  5KMW A;  3SH9 A;  3LCE A;  4E3J A;  3IXG A;  4U3T A;  4GZB A;  3S1Y A;  5DTK A;  4E6W A;  2RCX A;  4HES A;  4CPK A;  2XLN A;  4S2L A;  4U0T A;  5A90 A;  1ERO A;  4LCM A;  3ZCZ A;  1H8Z A;  3MZD A;  3EQU A;  3MKF A;  2IWC A;  3ZGA B;  1GHI A;  1ONH A;  1FCO A;  4QU3 A;  2X01 A;  5AQA A;  3HLG A;  4X69 A;  4IBX A;  3ZG5 A;  1K4F A;  5GLD A;  3VP2 A;  5FSR A;  3AGD A;  4R23 A;  1YLZ A;  1TEM A;  3TG9 A;  1K56 D;  3GTC A;  4DDS A;  1YLW A;  3SS3 A;  5CTN A;  5KSC A;  4OP5 A;  3IF6 C;  3V50 A;  4PM5 A;  1FQG A;  2DRW A;  1CEG A;  4DKI A;  1OME A;  2EFX A;  1JWZ A;  5CGX A;  3VP1 A;  2Y91 A;  1SKF A;  4WZ5 C;  1PZO A;  3FKV A;  5EVL A;  5A91 A;  1HZO A;  3P09 A;  4S2P A;  2XH9 A;  1KGF A;  1NZU A;  3JYI A;  4OON A;  3SS4 A;  4PM7 A;  4WBG A;  4S2J A;  1BZA A;  4UAA A;  4EUZ A;  1GHM A;  3VP4 A;  1Q2Q A;  1XA1 A;  4WEJ A;  5AQ9 A;  3V3R A;  5E2G A;  4QB8 A;  5JYP A;  4E6X A;  3E2L A;  2XFS A;  2HP9 A;  5DTS A;  1KDS A;  2WGW A;  5FA7 A;  5FI7 A;  2XK1 A;  3BRM A;  1MWR A;  1JWP A;  4QHC A;  5F1G A;  5DTT A;  3O86 A;  4N1X A;  1MKI A;  2QMI A;  2IWD A;  1BT5 A;  1ES3 A;  4X53 A;  3P98 A;  4MBF A;  3W4O A;  1MY8 A;  3G35 A;  5JYO A;  4PPR A;  3VFF A;  1G6A A;  1IEL A;  3ZG8 B;  1BUL A;  5L2F A;  1LLB A;  4MBH A;  1YM1 A;  1BUE A;  1PW1 A;  4RX3 A;  3WS2 A;  1DJC A;  3IXB A;  3NCK A;  3HBR A;  4OPR A;  2ZQ9 A;  5GHY A;  5EOE A;  2WKE A;  3UPO A;  1FR1 A;  4WEL A;  1IEM A;  2XD5 A;  4K0W A;  2H10 A;  4DE0 A;  3A3F A;  4E3N A;  3WRT A;  1K57 A;  3C4P A;  4ZJ1 A;  2Y2Q A;  3Q7V B;  2ZQ8 A;  3BEC A;  4JXV A;  5EVI C;  3NDG A;  1DY6 A;  1K54 C;  4ZJ2 A;  2E8I A;  3ITA A;  4QD4 A;  3IWO A;  4JBF A;  5CHU A;  4ZJ3 A;  2XQZ A;  3IH9 A;  1FR6 A;  2ZM2 A;  3IHA A;  4MLL A;  5HX9 A;  4C6Y A;  4X55 A;  1K6R A;  1MXO A;  4KZA A;  3PAG A;  5E2H A;  2ZC6 B;  4KZB A;  4WYY A;  2I72 A;  4JF4 A;  3V5M A;  3I7J A;  3HLF A;  4OQG A;  1TVF A;  2Y2N A;  3GSG A;  2Y2I A;  4LV2 A;  2XD1 A;  3RJU A;  4DE2 A;  3HLE A;  3C5A A;  4LV1 A;  2Y2G A;  5A93 A;  4PMA A;  2JCH A;  2WUQ A;  4HEF A;  3GVB A;  4LV0 A;  5G18 A;  5GLC A;  3C7U A;  4S2N A;  3OCN A;  3LO7 A;  2Z2M B;  5EUA A;  3SS5 A;  2FFF B;  2WGV A;  4R0Q A;  2ZC5 B;  3E2K A;  1XKZ A;  3N8R A;  3WS4 A;  1K38 A;  3W4Q A;  3HLB A;  1FSW A;  4UHU A;  1FOF A;  4MBK A;  3C4O A;  4JF5 A;  3MXS A;  3GMW A;  2Y2L A;  1W8Q A;  1PW8 A;  5D3O A;  5CER A;  1ERM A;  5AQ7 A;  2DNS A;  2ZQA A;  5F1F A;  5DF9 A;  5E43 A;  5M19 A;  4GDB A;  4GN2 A;  1IYO A;  4FSF A;  4KQR A;  1TDG A;  2R9W A;  3MKE A;  3UPN A;  2A49 A;  4KEN B;  1S0W A;  4KG2 A;  1I5Q A;  4P87 A;  4OQH A;  4UA6 A;  3BFG A;  1KE3 A;  4BD0 A;  1I2W A;  3BLM A;  2BG1 A;  4LCL A;  4R4R A;  5GL9 A;  3OPH A;  2P74 A;  3A3E A;  4FD8 A;  1KVM A;  3QNC A;  1N9B A;  2EX6 A;  4DRT A;  3VOY A;  2PBY A;  4N9K A;  4R3B A;  3DTM A;  3HVF A;  1E25 A;  3BEB A;  1H8Y A;  5TFQ A;  4GDN A;  1JVJ A;  1BLC A;  2J8Y A;  3V39 A;  2Y2M A;  2XGN A;  3G2Y A;  2BLS A;  3HL9 A;  3NY4 A;  3Q1F A;  3ZFZ A;  3QNB A;  5A92 A;  1WYB A;  3LY4 A;  3PAE A;  3GRJ A;  4M3K A;  2EXB A;  3QHY A;  4WZ4 A;  1LL5 A;  2HDS A;  2UWX A;  3Q82 A;  4P6B A;  3UE0 A;  3WS1 A;  2OSU A;  3UDX A;  3UNW A;  2EX8 A;  4YFM A;  4ZAM A;  1CK3 A;  1K57 C;  3MFD A;  1W5D A;  4OH0 A;  2WKH A;  2ZQC A;  4R1G A;  4Z9Q A;  3IHB A;  2OLV A;  3TSG A;  2WGW B;  1MWU A;  5FAQ A;  3NIA A;  4Y0O A;  4B88 A;  4KG6 A;  1CEF A;  4P0M A;  5AQB A;  1ES2 A;  1KGG A;  4DE3 A;  4N1H A;  5CEB A;  3SH8 A;  1Q2P A;  3VMA A;  2JC7 A;  1FCN A;  2HPB A;  2Q9M A;  2PU2 A;  1K6S A;  1WYC A;  3HLC A;  4S2M A;  1VM1 A;  4Q8I A;  1M40 A;  2OV5 A;  1NRF A;  5F83 A;  2C5W B;  3M6B A;  4NET A;  1EI5 A;  3HUO A;  4RX2 A;  1WE4 A;  1ZKJ A;  3PTE A;  4JXW A;  1HTZ A;  1ZG6 A;  3ZG0 A;  2V20 A;  5FQ9 A;  1LI0 A;  5J8X A;  3G2Z A;  1K25 A;  4RVA A;  3CZD A;  4MNR A;  3ZHH A;  4L0L A;  3UDF A;  3UPP A;  4KG5 A;  1ESU A;  4OPY A;  1EWZ A;  3WS5 A;  4BL3 A;  3GR2 A;  3UN7 A;  3FWL A;  1YMS A;  4JKT A;  5FQQ A;  2Y2J A;  1YT4 A;  5GHX A;  3NDE A;  5I94 A;  1XGJ A;  4DDY A;  4GD6 A;  1H5X A;  2WAD A;  3BLS A;  4GKU A;  3IT9 A;  3PBQ A;  1NY0 A;  1YLY A;  2ZC3 B;  4ID4 A;  4F94 A;  1Z6F A;  2Y59 A;  4WM9 A;  4DXC A;  4X68 A;  5GHZ A;  4OLD A;  1YLT A;  3G32 A;  1SDE A;  4DXB A;  4E3O A;  3SH7 A;  1MWT A;  4IED A;  2XDM A;  1LL9 A;  4DE1 A;  1ONG A;  1PZP A;  3IWQ A;  3A3I A;  5E2E A;  1L2S A;  3GQZ A;  2H0T A;  4KZ8 A;  2A3U A;  5U47 A;  4EV4 A;  1SDN A;  2V1Z A;  1BTL A;  4WMC D;  3IXH A;  1HVB A;  3BYD A;  1FSY A;  3UY6 A;  3UE1 A;  5CED A;  4K0X A;  3O88 A;  1XP4 A;  2X71 A;  1W8Y A;  5CRF A;  4E3K A;  4Y0U A;  5HFO A;  3G34 A;  1E4D A;  2HP6 A;  1CI9 A;  1JTD A;  4R4S A;  2GDN A;  5FQK A;  5TR7 A;  1L0G A;  4D2O A;  3Q7Z A;  1PWD A;  3HLD A;  2WZZ A;  3UDI A;  1XXM A;  3IXD A;  2ZD8 A;  5CTM A;  2WAE A;  3IF5 A;  1ALQ A;  4OQI A;  2RL3 A;  3ZG9 B;  1GA9 A;  1ESI A;  3CMZ A;  4JXG A;  1E3U A;  4JLF A;  4N9L A;  4WEK A;  3TOI A;  1GHP A;  4R3J A;  3S4X A;  3PBR A;  3BFD A;  3OPP A;  3O87 A;  4KZ6 A;  4YIN A;  5DVA A;  4UA9 A;  1PI4 A;  3A3D A;  3ZDJ A;  1U60 A;  3WRZ A;  5TGF A;  2X02 A;  3BFE A;  4KZ9 A;  4BL2 A;  4ZDX A;  4EBN A;  3ZVW A;  2QZ6 A;  2WKI A;  3G30 A;  4Y0T A;  3N6I A;  3Q81 A;  3ITB A;  4XXR A;  4A5R A;  1N4O A;  1K54 A;  4RYE A;  1TDL A;  3M6H A;  3UO9 A;  1PWG A;  1ZG4 A;  5M18 A;  2Y55 A;  2C6W B;  1IKI A;  4XUX A;  1NXY A;  4S2I A;  5CHM A;  4Y7P A;  4JF6 A;  4KZ5 A;  4FH4 A;  2P9V A;  1BLP A;  4HBU A;  1FCM A;  3PBN A;  1IYP A;  3C7V A;  2XFT A;  5FAT A;  5FI6 A;  1DJB A;  2J7V A;  5CHJ A;  4OLG A;  3WWX A;  3MXR A;  2JE5 A;  4EBL A;  1RP5 A;  3MZE A;  3N8L A;  5HAP A;  4O7D A;  1C3B A;  2Q9N A;  3NC8 A;  1S6R A;  4KZ4 A;  5FQJ A;  1SCW A;  1LI9 A;  2Y2P A;  3SOI A;  4JXS A;  1M6K A;  5IHV A;  3NBL A;  3BFF A;  1YMX A;  3BM6 A;  3WS0 A;  5BOH A;  4IBR A;  5FAS A;  4EWF A;  2OLU A;  5CEC A;  1VQQ A;  4X6T A;  2H0Y A;  3DWK A;  3OZH A;  3RXX A;  1E3U D;  4XUZ A;  3VOZ A;  4EBP A;  2EFU A;  2FFY A;  4BLM A;  4OOY A;  1SHV A;  3O3V A;  4BD1 A;  1JTG A;  2IWB A;  4DF6 A;  3ISG A;  2HP5 A;  2ZM8 A;  4ZTK A;  4QJG A;  3FKW A;  2WK0 A;  4CJN A;  2ZC7 A;  3IQA A;  3PBO A;  4OOM A;  5FDH A;  5FQI A;  5EVI D;  1DJA A;  1PWC A;  2Y4A A;  1YLJ A;  5HAR A;  2EXA A;  4BEN A;  1ES4 A;  4OVD A;  3IWI A;  4C3Q A;  1YLP A;  1RGY A;  3VP3 A;  2JBF A;  4P85 A;  1ERQ A;  4WMC A;  2HDQ A;  1W79 A;  1IYQ A;  3AGF A;  1O7E A;  4RA7 A;  4QY6 A;  5HL1 A;  1K55 A;  1HD8 A;  3CJM A;  4S2N C;  4E3L A;  1KE4 A;  3DWZ A;  3VSK A;  2Z2L B;  4GOG A;  1YQS A;  3VFH A;  2WGI A;  5HW3 A;  3W8K A;  3W4P A;  5KZH A;  4BQM A;  4GNU A;  1KE0 A;  5HAQ A;  4IVK A;  3OPR A;  5E2F A;  3FZC A;  3HUN A;  1RCJ A;  2G2U A;  1XGI A;  4E3M A;  2H5S A;  1ES5 A;  3IF6 B;  2EX9 A;  4OQ0 A;  3UE3 A;  4ZBE A;  5F82 A;  1Y54 A;  3MZF A;  2ZJ9 A;  4LV3 A;  3OPL A;  5CXW A;  3Q07 A;  5EPH A;  2DCF A;  4S2O A;  3PBS A;  4N92 A;  4KZ3 A;  2B5R A;  1MPL A;  1MWS A;  4OPZ A;  5EE8 A;  2ZLY A;  2ZM0 A;  3V3S A;  4PM8 A;  1L0E A;  3CG5 A;  4JPM A;  1PYY A;  3G4P A;  3IF6 A;  4OKP A;  1CI8 A;  1PI5 A;  3OCL A;  3N7W A;  4PM9 A;  3RXW A;  1JWV A;  2J9O A;  2WAF A;  3MBZ A;  1KGE A;  1PIO A;  4FCF A;  3DW0 A;  4WZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...