4HJ3A

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
175
structure length
175
Chain Sequence
DQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGYLTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords LOV protein
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 52
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hj3A00
4L9FA 2BASA 3CLOA 1XJ3A 2L1MA 3B33A 1N9OA 4I3JA 4F3LB 1F98A 4EXOA 3NJAA 3F1NB 3UMDA 3C8CA 3UB8A 4BBTA 3K3CA 3BWLA 2GJ3A 2WKQA 1DP6A 1S66L 1T1AA 3UB9A 3LIFA 3F1OB 3HJKA 2PD7A 3H9WA 4EW7A 2ZBBA 4I3AA 3LYXA 4LRYC 5F68A 4HQAA 3BY8A 5HWVA 4GCZA 4JGPA 4HP9A 3CWFA 3ULFA 2D01A 4H6JB 1N9NA 4L9GA 3H7WB 1DP9A 2WKPA 5HDSA 5J7EA 4B9OA 1JNUA 4NXGA 1XFNA 5HWTA 4PKYA 4I3IA 4JGOA 2KDKA 4EEPA 4LRXC 1T1CA 3LICA 2PHYA 4XT2A 4HOIA 1P0ZA 2QHKA 2VV7A 4R3AA 2YKFA 1P97A 2H28A 2PYRA 2V0WA 4GS9A 1F9IA 3IBRA 4JGQA 3EEHA 3FC7A 5DJUA 1X0OA 5DKKA 3KX0X 4GHIA 2PD8A 4MN6A 3C2WA 4WUJA 5F5YA 3H82A 3CAXA 3GDIA 1S4RA 5DKLA 4KUOA 4HNBA 1OTIA 3NOTC 3G6OA 4LLOB 2PDRA 3LI8A 4R38A 1XJ4A 4DJ3A 1OTAA 5TBMA 2QJ5A 2M1CA 5I5LA 3T50A 2B02A 3MXQA 4HIAA 2J80A 5AVEA 1LL8A 3K3DA 2PR5A 4PKYG 3A0SA 1BYWA 3LUQA 1OTDA 3F1PB 1S67L 4EETB 3MJQA 4RQ9A 2L4RA 1T1BA 2VV8A 2ZOIA 1NWZA 2OWHA 3IS2B 3FG8A 2V0UA 3LI9A 3LIAA 3E4QA 1GSXA 4F3LA 1GSVA 4GW9A 1DP8A 3F1NA 2QWSA 1VB6A 2PYPA 2A24B 5G4YA 2CMNA 4XT2B 1TS0A 1S4SA 1T18A 1GSWA 2R78A 3D72A 1MZUA 2VEAA 5IU1A 1LSXA 5HD3A 5J3WA 3VE4A 4WL9A 2PR6A 3F1OA 2Z6CA 4YWZA 5HD5A 3PYPA 3UE6A 1XFQA 3ZQ5A 1V9YA 1TS6A 4I5SA 4R6LA 3ICYA 5F69A 1S1YA 2KX6A 3BY9A 1OTBA 4H6JA 4EERA 4WN5A 3H7WA 4HJ3A 4K08A 2V1AA 3MR0A 4I38A 1N9LA 4EQ1A 1OTEA 1S1ZA 4KQDA 4WF0A 4NXEA 4KUKA 3LIDA 2W0NA 5G4ZA 5TBMB 2VLGA 3P7NA 5HSQA 2HV1A 4HY8A 3NHQA 5AVFA 1KOUA 2YKHA 1Y28A 1OT9A 4R70A 1LSWA 4WLAA 3RTYA 1XJ2A 2Z6DA 2INWA 2W27A 2EA9A 4NXFA 4NXBA 2K7SA 5EFWA 1T19A 4EEUA 5HDDA 3OLOA 1LSVA 3MQOA 4HJ4A 2D02A 1EW0A 4I39A 1OJGA 4BBUA 4LPZA 3UB7A 4BBVA 5HWWA 3LIEA 5IS1A 4MN5A 3VE3A 3E4OA 4L9EA 3A0VA 2OOLA 1OT6A 3A0RA 2JHEA 1V9ZA 5J4EA 2I9VA 4HI4A 2JN7A 3UB6A 2V1BA 4HH2A 1XJ6A 2V9AA 2P7JA 4GS9B 1UGUA 3F1PA 5KIZA 4E04A 3SW1A 3MQQA 3LIBA 2L0WA 3IS2A 5HZHA 1UWNX 4GHIB 3MFXA 4DJ2A 2ZOHA 3H82B 3UMEA 4HHDA 3E4PA 2QJ7A 4M4XA 5DJTA 1ODVA 2A24A 3GECA 5HDCA 1WA9A 2QKPA 1OJ5A 5A8BA 1UWPX 3EWKA 4EESA 2OWJA 3HJIA 4HJ6A 1D06A 1TS7A 1D7EA 1LT0A 2WKRA 3VOLA 1DRMA 4HH3A 1TS8A 4JGRA 3PHYA 3NOPC 4HP4A 4LRZE 5F6AA 2VV6A 1G28A 3RH8B 3NOUC
chains in the Genus database with same CATH superfamily
1IYSA 1CEGA 1Z09A 3NY4A 4WMCA 4QPRA 1E3UA 3U2AA 3CLOA 1EI5A 1TEMA 4C6YA 4I3JA 3CITA 3KSGA 1F98A 3ZDJA 1NRFA 3Q1FA 3OPPA 3UMDA 4S2NA 4X6TA 2VJWA 5EUAA 3BWLA 4KQQA 1DP6A 1S66L 3CUEA 3JYIA 4JF5A 3HBRA 3VFFA 3UPOA 5FL3A 3FYZA 3UB9A 3HJKA 3H9WA 2OSUA 5L09A 1L0GA 1C3BA 4BL2A 2OV5A 4ME4A 1KGFA 1ES2A 2EFUA 4S2LA 4OOYA 1MKMA 3LEZA 3CWFA 2ZC4B 5CTMA 4L9GA 1YQSA 3BFCA 5FA7A 2XLNA 2GZAA 5FI2A 3HLFA 5AQ7A 4PAUA 4GB7A 1TDLA 4U3TA 4B9OA 4KZ8A 3BLMA 4BQMA 3KYZA 1GA0A 1NY0A 5GLBA 3AGFA 2ZC6B 4ZTKA 1K0KA 2KLIA 2KOIA 3P09A 4LRXC 1MWUA 2W3HA 4FUWA 1KGEA 3MKFA 2MJ6A 3C4OA 4HOIA 3V50A 4E6XA 2RL3A 1K55C 4R3AA 2H28A 5FAPA 4Z9QA 2WGWB 2ZMFA 4Y2FA 5U47A 4JBFA 4MCWA 1E4DA 2PU2A 3IBRA 4ARZB 4JGQA 3Q81A 5GHYA 5DJUA 2ZM2A 2JBFA 4GOGA 3ITBA 3KX0X 2M7VA 4UA7A 2ZQAA 2QPNA 1W8QA 5F5YA 3G4PA 4M3KA 3QHYA 2R9WA 2Q9NA 4Y0OA 2HF6A 3LCEA 3G6OA 1PW1A 4LV2A 3LGOA 2W1TB 2ZC3B 4B4XA 3OBFA 4KZAA 4DJ3A 3KSFA 2WAEA 2XROA 3GQZA 3PBOA 2ZD8A 5TBMA 3OCNA 3HREA 2Y55A 5CECA 2AVXA 3WWXA 4CJNA 2GNXA 1H8YA 2PR5A 3ZHHA 3A0SA 1MWSA 3LR5A 1BYWA 3LUQA 3BYDA 3W8KA 5E2HA 2OAQ1 1S67L 4JPMA 4EETB 4RQ9A 2Q9MA 2J3WA 4X68A 2VV8A 2ZOIA 1NWZA 3E4QA 3IF6A 3KO6A 1MXOA 3Q82A 4GD6A 1M6KA 4LGWA 3MZEA 2QWSA 4N9KA 3DWKA 3UE1A 5HAIA 4XT2B 2K2NA 4MBFA 3D72A 1F2KA 4KZ5A 5IU1A 1W5DA 3WS0A 5J3WA 4R1GA 3WS4A 5E2GA 3F1OA 2Z6CA 4WBGA 4KZBA 2ZL1A 2WADA 4E3MA 5AQ9A 3ZG7B 3ZQ5A 1L3LA 4E6WA 5L07A 3KSHA 4R3BA 5CHMA 4PM7A 2PBDP 2XFSA 3NECA 2M7UA 3BECA 3ICYA 1P9RA 3BW6A 5DVAA 3H7WA 4UHUA 4X56A 4X55A 3Q7ZA 3DTEA 1ALQA 5CTNA 4KQDA 3IQAA 4N1XA 1L0DA 2XH9A 4KZ3A 4NXEA 5E2EA 2J7VA 1K4FA 3B3XA 2I72A 4GDNA 2A49A 4XUZA 2Y2NA 3Q7VB 3ZG0A 4MNRA 1ESUA 1XXMA 3LR3A 1FQGA 5AVFA 1JTDA 3NC8A 3QNCA 1FSWA 4OOMA 4FH2A 2XF3A 2BG1A 3V39A 3CMZA 5FDSA 1S6RA 2XDMA 4CLCD 4MN7A 3RJUA 1CQAA 2INWA 3GSGA 4NXFA 3VMAA 2K7SA 5EM0A 3IX3A 4HJ4A 3MFDA 4ID4A 3FWLA 2H0TA 3E2KA 3OPLA 2W1RA 4LPZA 3I7JA 4EWFA 4EV4A 2WZXA 4OQ0A 5IS1A 4MN5A 3MXSA 3VE3A 4B4ZA 3SH7A 1KE3A 1PZOA 1XPBA 5FASA 3B42A 4L9EA 3A0VA 3K2NA 3A0RA 4IVKA 2Y2PA 3CI6A 2JN7A 1BLHA 4P87A 2V1ZA 4G3KA 2V1BA 4P85A 5EVEA 1XJ6A 2V9AA 1VEUA 2GX5A 5EOEA 1Y4OA 2WKHA 1ES4A 3SW1A 3LIBA 3ZG9B 3C4PA 3GV9A 1PI5A 5HAQA 2ACGA 2L0WA 2WK0A 1FCOA 2VGJA 4MMNA 3T4LA 1K54C 1IYOA 5TGFA 3JVUA 3D4FA 3VOZA 4DJ2A 1G68A 5EV0A 3E4PA 4KQOA 4S2OA 3PXPA 4R3JA 3R4KA 4JXVA 5KSHA 5HPIA 3FV7A 4ZAMA 1WYBA 5CERA 4WEJA 4UA6A 3G35A 5A8BA 1UWPX 3PBTA 4EESA 1O7EA 4DXCA 2EX8A 3M6BA 1DJCA 4OPYA 3JPUA 4H8RA 1OMEA 3CPTB 3LR4A 3LY3A 3HJIA 1GHMA 4UEYA 4O8GA 4R0QA 5EECA 1TS7A 1KVMA 2C6WB 3ZCZA 4JGRA 1PNEA 2HZ5A 1GHIA 3VSKA 4ZJ3A 2O9CA 4L9FA 2BASA 5EPHA 1A0KA 1RGYA 2L1MA 5L10A 2WKIA 1DY6A 4F3LB 5DF8A 3IXDA 3VP2A 5IT5A 1TDGA 4EXOA 4CLCB 4EQIA 4MEZA 1PYYA 4X1MA 2OLUA 2P08A 5E2FA 3T4JA 3UB8A 4C75A 2W3DA 3K3CA 2GJ3A 4LENA 1P9WA 2Y2KA 5JYOA 1K57A 4ZRRA 2J9OA 3LIFA 1JWVA 2LB9A 2ZM8A 2ZC7A 3T1QB 4DE1A 5F68A 2FZ0A 1VETA 3BY8A 1KVLA 3UDXA 5DF7A 4IUHA 4GCZA 3G2YA 4JGPA 5EVLA 5TFQA 1N9NA 4Y0UA 2Q0OA 4LCLA 4GN2A 4R23A 4S2IA 2DCFA 1PWCA 1CF0A 1JNUA 2ZQ7A 4GD8A 1JWPA 3S7NA 4PKYA 1FILA 1ESIA 4B93A 1SDEA 1KE4A 3UO9A 5K5BA 3OZHA 3EEAA 4LFUA 4CLCC 2ZQDA 4KQRA 1YSQA 5DFXA 3U4LP 1P0ZA 4NETA 4QJGA 2QHKA 2G2WA 2RCXA 2VV7A 3NDEA 4BD0A 5CRFA 1P97A 2P9VA 5GHZA 3UPPA 3OOVA 2PYRA 3EOIA 3NCKA 2V0WA 4GS9A 5HAPA 1BT5A 3BLSA 4BMWA 3FC7A 3M6HA 3BQ8A 3BFDA 2Y59A 5DKKA 3BFEA 1XKZA 3C2WA 3H82A 1TF1A 2QYBA 4HNBA 2R9XA 1KE0A 2ZJ9A 2H10A 2A2LA 4DKIA 4LLOB 3N7WA 1U60A 3T1XA 3LI8A 3PBSA 3RXXA 1K25A 3B47A 3C30A 1XJ4A 3BJNA 1OTAA 2P04A 5G18A 4AFIA 3ZG8B 3LR0A 3MXQA 3ITAA 4HIAA 5DTSA 3IWOA 4HESA 1YLJA 5EVID 3R7WA 4S2JA 1K56A 3TSGA 3MJQA 3DTIA 2DNSA 2EWWA 2L4RA 1T1BA 3P98A 1GA9A 1SHVA 3FG8A 4YINA 3LI9A 3D3OA 4EU0A 5TR7A 1GSXA 1GSVA 2XD1A 4OQIA 1FCNA 1DP8A 1ES3A 4DN0A 1K6RA 3SOIA 1ONHA 3BRMA 3MZDA 4LV0A 2A24B 1S4SA 1T18A 1GSWA 2R78A 3E98A 4HEFA 1MZUA 2VEAA 4DRTA 1K55A 5HD3A 4OOLA 4JXSA 1BLSA 3E0YA 2JKTI 1E25A 4OQGA 3PYPA 5FQKA 1XFQA 2Y2MA 2EX2A 1V9YA 1TS6A 3W2ZA 2EX9A 1K4EA 4MBKA 1MWTA 4JKTA 2B5RA 4OPRA 1S1YA 2KX6A 3BY9A 5F1FA 4Q0HA 5F82A 3DTMA 2JKTM 3CHWP 4EERA 3CG5A 3MR0A 2XEPA 4RX3A 4Z1WA 2HJEA 1IEMA 1OTEA 1S1ZA 3RXWA 4FH4A 1YLZA 1ZKJA 4WF0A 3C38A 3BEBA 1ACFA 3QP4A 2J3TD 2W0NA 4OPQA 5TBMB 1L2SA 5HSQA 2EWVA 3ZVTA 5M1AA 1NLZA 2HV1A 4HY8A 4K0WA 2WGWA 4KZ9A 1PZPA 4OLGA 4ARZA 5C5KA 1H5XA 2V8CA 1Y28A 3PBQA 2G2UA 4R70A 2XA7M 2Y2JA 4IBXA 3VFHA 2Z6DA 3QP1A 4JLFA 5EFWA 1T19A 5I94A 4EEUA 4XUXA 2HP5A 2QMIA 4NEED 5DFYA 1LSVA 2PAVP 1JTGA 3UY6A 3QP5A 4EUZA 4I39A 1ZC2A 5EVIB 5J8XA 4N9LA 2Z2LB 1LL5A 5HWWA 2W1TA 3IH9A 4D2OA 1W79A 4FTXA 3BQAA 1FR1A 3O5YA 3E4OA 5FI6A 2ZL1B 3WS2A 2OOLA 1TVFA 4EUVA 5J4EA 4HI4A 2ZMAA 2ZQ8A 1NZOA 1JVJA 4Y15A 3HLGA 2P7JA 3VV4A 2VGLM 1UGUA 3OPRA 3O87A 4KG2A 2HDUA 4WEKA 5A92A 3FPWA 4GHIB 2EXBA 3TE8A 3PBRA 5GHXA 2QJ7A 4N1HA 2HDSA 1GHPA 1YLPA 4OPZA 5EVIC 4QWOA 4IVIA 3TG9A 1PWGA 1KGGA 3MXRA 4PMAA 1TD5A 2PRFA 3SS3A 1AWIA 1VHMA 4PHTA 5FQMA 1AXBA 3ZVWA 3LY4A 5HL1A 1D7EA 1LT0A 1BTLA 4HH3A 1EWZA 3OC2A 2ZC5B 3ZFZA 3TJZC 1CI8A 5L8MA 3NOPC 1XGJA 2HDQA 4HP4A 4LRZE 3GR2A 5F6AA 4FSFA 2ZMVA 3A3IA 3RH8B 3NOUC 3HL9A 5MC7A 1ZHHB 1N9OA 5FATA 3C7VA 3F1NB 1H0MA 3C8CA 3Q7VA 3ZG5A 4LCMA 4BBTA 3N8LA 3PAGA 3O86A 2IWDA 2WKQA 2HP6A 3QP2A 1GCEA 1T1AA 4A5RA 2FH5A 2VK3A 1VEUB 1W7FA 5FQQA 4Q8IA 4NKPA 2ZBBA 1L0EA 2ZQCA 3LYXA 2J3TC 2XA7S 5FQ9A 1YLTA 2O9BA 1K54A 2WAFA 4Y7PA 5GLCA 1LLBA 3SH9A 4HP9A 4KZ7A 4Q0JA 1SKOB 2D01A 3FZCA 4H6JB 1EROA 1NLYA 3WS1A 2J9PA 5J7EA 3SS5A 1QMFA 4NXGA 1XFNA 1WE4A 3BM6A 3S7QA 5IHVA 1PW8A 2HDRA 2KDKA 1BUEA 3RFBA 3PAEA 1XP4A 3ZNTA 2XR0A 3D9YA 3GVBA 1ES5A 3LICA 2BLSA 5EOOA 2B18A 2Y91A 1FR6A 4GLQA 1H8MA 4IBRA 5CEDA 5CHUA 2DRWA 1RGZA 1NRJA 3MQ0A 5GLDA 4WMCD 3UE3A 4RX2A 4DXBA 1E3UD 2VGLS 4GDBA 2ZQ9A 4X25A 5A91A 1RCJA 1YM1A 4CPKA 3IHBA 4KUOA 3DTKA 2Y2HA 2P74A 1OTIA 3NOTC 4O7DA 4BWIA 2WZZA 2PDRA 1K56D 1DJAA 4BD1A 1I2SA 4FCFA 4C3QA 3IX4A 1H8ZA 3CPTA 1I2WA 4BLMA 3FKWA 3T4QA 5I5LA 5AQBA 2FFFB 3T50A 3IXBA 2B02A 1NJ4A 3MF0A 1D1JA 1VETB 3HLBA 4IJGA 1LL8A 1IFQA 1Z6FA 4QHCA 3G34A 4UA9A 1STZA 3WS5A 4Q0IA 2VGKA 3TW8A 3F1PB 4R4RA 3L7HA 4BJPA 3HUOA 5M19A 4ZDXA 3AGEA 3DWZA 3SZTA 1S0WA 2WKEA 2Z2MB 4F94A 3IS2B 2V0UA 3LIAA 3IWIA 4F3LA 4DMZA 4GW9A 4CLCA 4JXWA 3ZYTA 2NUTC 5GL9A 5G4YA 2W3EA 2UV0E 1TS0A 3HVFA 4WZ5C 4KENB 2JKRI 3CJMA 1FSYA 1LSXA 1YAXA 3VE4A 3MS6A 4WL9A 4PM8A 2WYXA 4YWZA 5HD5A 4P0MA 3V5MA 3QNBA 5FSRA 4RA7A 3PR6A 5BOHA 4I5SA 2HP9A 4R6LA 5GLAA 2JKRM 1XX2A 2HJ9C 3GRJA 5CGWA 3VOYA 1ZG4A 3C7UA 1XA1A 4K08A 2DMWA 2V1AA 1G6AA 4I38A 4P6BA 1NYYA 4EQ1A 4O01A 3IF5A 2HPBA 3PBNA 1FIKA 3HCYA 1HZOA 3HUMA 1OPXA 3SH8A 4KZ4A 4X69A 5G4ZA 4OP5A 2VLGA 3P7NA 5A93A 3TRCA 2ZM0A 2Y2GA 2WGIA 2PT7A 3G31A 4MBHA 5E43A 3NHQA 3S4XA 4GNUA 5CXWA 3NBLA 4S2MA 4MLLA 1CEFA 3LEQA 1KOUA 3R7WB 2YKHA 3V67A 4S2PA 1PWDA 3TOIA 4WLAA 1XJ2A 2W27A 2EA9A 3HLDA 1KDSA 4NXBA 1LI9A 3NI9A 2JKGA 3DBAA 3MQOA 4EBLA 4HBUA 2D02A 1EW0A 2BTFP 1MC0A 5CX7A 3UB7A 4BBVA 4UAAA 3LIEA 1G5UA 2V2FF 4LV1A 3KYEA 2H0YA 4Y0TA 2X71A 4S2NC 1ONGA 2V20A 4FD8A 3EQVA 4NG2A 2JHEA 1V9ZA 2Y2LA 5HFOA 2I9VA 3FPVA 3VSLA 3CUEC 2CC1A 1IKGA 4UQIM 3UB6A 3PTEA 2JC7A 4OKPA 1LHYA 5HPFA 3VP1A 1M40A 3T4OA 5KIZA 3LO7A 4E04A 3MQQA 5EM1A 4N92A 1O07A 3W4OA 5HZHA 3QP8A 1Q2QA 1UWNX 3IXHA 3UN7A 4NK3A 1YSPA 3ZNYA 2Y2IA 1Q2PA 3BFFA 3IHAA 3S1YA 1PIOA 5DJTA 3WRTA 4GJ4A 2XK1A 3A3EA 2A24A 3L9KA 3HLCA 4KG6A 2WGVA 3MSHA 3GECA 5HDCA 4B88A 2QKPA 1OJ5A 4Y13A 2Y79A 5HARA 2XD5A 1NZUA 2OLVA 4OH0A 1SZVA 4HJ6A 3VP0A 1D06A 2WKRA 2Y2OA 1DRMA 3BFGA 1IELA 4QY6A 3PHYA 1CI9A 4EBPA 1YLYA 3KSIA 2VV6A 1SDNA 1G28A 4WYYA 4X53A 4R4SA 4PM9A 4E3KA 5CGSA 5L2FA 3EQUA 5AJGA 2Y2QA 1XJ3A 1NYMA 3B33A 3IF6B 5DF9A 2E8JA 3NJAA 2WUQA 1ERMA 1YPRA 5FAQA 4G3WA 1F5MA 2E8IA 4PM5A 4ZJ2A 1Y54A 3F1OB 4G3VA 2PD7A 3FKVA 4EW7A 4DDYA 4E3JA 4I3AA 4ESPA 4E3IA 4O0PA 4LRYC 3DAVA 4HQAA 3IWQA 5HWVA 4QY5A 5HL6A 1J3WA 1YLWA 3ULFA 3MKEA 3GTCA 1ZG6A 3O3VA 1YMXA 4JF6A 5FQJA 3H7WB 1DP9A 1W8YA 2WKPA 5HDSA 5EVIA 3A3JA 3P01A 1LI0A 4OP8A 3M2KA 4CLCE 1MWRA 5HWTA 3A3DA 3MZFA 4BL3A 4I3IA 4JGOA 3IF6C 1IYQA 4P6ZM 1VQQA 2IWCA 4JF4A 2XSSA 4EEPA 1T1CA 3ISGA 3T12B 3UE0A 3Q07A 5KSCA 1KDWA 5FAOA 2PHYA 4XT2A 2LB5A 4WELA 2O0YA 5CGXA 1HD8A 2OAP1 2YKFA 3T4KA 2G7UA 3G2ZA 4YNRA 4UQIS 4ZBEA 4L0LA 3JVVA 1F9IA 3SS4A 3S7OA 3EEHA 1WYCA 4Y5FA 1YKDA 4FOFA 1X0OA 1MKIA 5EE8A 5JYPA 4GHIA 4ETXA 2PD8A 4MN6A 4WUJA 1LL9A 3CAXA 3GDIA 1S4RA 5DKLA 3T1RA 1N9BA 4E3NA 3T4TA 3HLWA 1K38A 3IBJA 2EXAA 1MPLA 1IOUA 1PI4A 4RVAA 4R38A 3G30A 3G32A 4ETZA 2QJ5A 2O99A 2M1CA 2JE5A 2K31A 4U0TA 1BZAA 2J80A 1ZTUA 5AVEA 4S2KA 1YT4A 3K3DA 4OLDA 4PKYG 2XRNA 5AQAA 5CEBA 3GMWA 1FOFA 1OTDA 3CZDA 3T1SA 2VZWA 3N4IA 1JWZA 2OWHA 4U0XA 5D3OA 4E3LA 4Y3IA 3A3FA 3MMHA 2B95A 3F1NA 4MDZA 1VB6A 2PYPA 2CMNA 1XGIA 5F1GA 3IXGA 3N6IA 2PBYA 3IT9A 3N8RA 1I5QA 3OCLA 3NULA 2PR6A 5F83A 1PRQA 1W63Q 3VP3A 3UE6A 4HBTA 3QP6A 3ZGAB 5DTTA 3W4PA 3KYQA 4PPRA 3MBZA 5LBRA 5F69A 2UWXA 1IYPA 1SKOA 3HLEA 5TJJA 2VKSA 1OTBA 3NDGA 4H6JA 3S22A 4WN5A 4HJ3A 1DJBA 2XQZA 4DE2A 4QU3A 2H5SA 4OVDA 1N9LA 1XA7A 2Y4AA 4Y17A 5CHJA 4YOFA 3O88A 3UB5P 4KUKA 4P6ZS 3LIDA 2W3GA 3VP4A 4PM6A 4OQHA 2QZ6A 5FEFA 4OONA 3AGDA 4QD4A 4E3OA 4GKUA 3V3SA 1MBLA 4LV3A 3UDIA 4D60A 3C5AA 4BENA 4DE0A 1SCWA 2VA0A 2O9AA 1OT9A 2X01A 1BSGA 3DW0A 1BLCA 1LSWA 1W63M 3RTYA 1VM1A 5KMWA 4JXGA 4RYEA 1ERQA 3WRZA 2EFXA 5HDDA 1CK3A 4IEDA 4WZ4A 2JCHA 2Y8HA 1J9MA 1K6SA 3OLOA 4YFMA 4ZJ1A 3N8SA 1OJGA 4EBNA 3T4SA 4BBUA 4QB8A 4XXRA 2NUPC 2GDNA 3M2JA 4KG5A 1HLUP 4WZ5A 1FCMA 4DF6A 4DDSA 2W3FA 2VX8A 3LFVA 4DE3A 1OT6A 3W4QA 5M18A 2A3UA 4CQHA 2PU4A 1H3QA 2IWBA 1NXYA 1QMEA 1K57C 2P9VB 4HH2A 5A90A 1MY8A 2C5WB 4GS9B 3F1PA 2JKFA 2XFTA 4K0XA 5KZHA 3IS2A 1SKFA 3OPHA 5DTKA 5FI7A 3UDFA 3S7PA 1YMSA 1BULA 2ZLYA 3MFXA 1PFLA 2J8YA 5HW3A 2ZOHA 3H82B 3UMEA 4HHDA 2IA2A 4M4XA 4GZBA 2V8FA 1ODVA 5FEGA 3IH8A 1BLPA 4KZ6A 3E2LA 2XGNA 3EGXC 1WA9A 3UPNA 3EWKA 4IUKA 2EX6A 2FFYA 5FDHA 1CJFA 2X02A 1N4OA 3NIAA 4K91A 3V3RA 2OWJA 1IKIA 4IHQA 1G6OA 5HX9A 3HUNA 1L0FA 3VOLA 4WM9A 1RP5A 1TS8A 3UNWA 1HVBA 4II7A 2HGVA 3IX8A 1HTZA 4X1LA 5FQIA 3EGDC
chains in the Genus database with same CATH topology
2O9CA 3EQUA 4L9FA 4QPRA 5AJGA 2BASA 3U2AA 3CLOA 5MC7A 1XJ3A 2L1MA 3B33A 1ZHHB 1N9OA 4I3JA 3CITA 3KSGA 5DF9A 4F3LB 1F98A 5IT5A 4EXOA 4CLCB 3NJAA 3F1NB 3UMDA 2P08A 3C8CA 3T4JA 3UB8A 2VJWA 4BBTA 2W3DA 3K3CA 4G3WA 1F5MA 3BWLA 2GJ3A 2WKQA 1DP6A 1S66L 3CUEA 1P9WA 1T1AA 4ZRRA 2FH5A 5FL3A 3UB9A 3LIFA 3F1OB 3HJKA 2LB9A 4G3VA 2PD7A 3H9WA 4NKPA 4EW7A 2ZBBA 4ME4A 4I3AA 3LYXA 2J3TC 4O0PA 4LRYC 5F68A 2FZ0A 2XA7S 4HQAA 3BY8A 1MKMA 5HWVA 2O9BA 4IUHA 4GCZA 5HL6A 4JGPA 4HP9A 4Q0JA 3CWFA 3ULFA 2D01A 4H6JB 1N9NA 4L9GA 1NLYA 3H7WB 1DP9A 2GZAA 4PAUA 2WKPA 5HDSA 5J7EA 3P01A 4B9OA 1JNUA 4CLCE 4NXGA 1XFNA 5HWTA 3S7NA 4PKYA 3KYZA 4B93A 3S7QA 4I3IA 4JGOA 5K5BA 2KDKA 3EEAA 4P6ZM 3RFBA 4CLCC 2KLIA 2XSSA 4EEPA 2KOIA 4LRXC 1T1CA 2W3HA 3LICA 1YSQA 5DFXA 2MJ6A 2B18A 2PHYA 4XT2A 4GLQA 1H8MA 4HOIA 1P0ZA 2LB5A 4WELA 2O0YA 2QHKA 2VV7A 4R3AA 2OAP1 2YKFA 3T4KA 1P97A 2G7UA 3OOVA 2H28A 2PYRA 2ZMFA 3EOIA 4UQIS 4Y2FA 1NRJA 3MQ0A 4YNRA 3UE3A 4L0LA 3JVVA 2V0WA 4GS9A 4MCWA 1F9IA 3IBRA 4ARZB 4JGQA 3S7OA 3EEHA 4BMWA 4Y5FA 2VGLS 3FC7A 5DJUA 1YKDA 4FOFA 3BQ8A 1X0OA 5DKKA 3KX0X 2M7VA 4GHIA 4ETXA 2PD8A 4MN6A 3C2WA 4WUJA 5F5YA 3H82A 3CAXA 1TF1A 3GDIA 1S4RA 5DKLA 2HF6A 2QYBA 4KUOA 4HNBA 2A2LA 1OTIA 3NOTC 4BWIA 3G6OA 4LLOB 3T4TA 2PDRA 3IBJA 2W1TB 1IOUA 3LI8A 3PBSA 3B47A 3OBFA 3C30A 4R38A 1XJ4A 4DJ3A 3KSFA 2XROA 3BJNA 1OTAA 2P04A 4ETZA 3PBOA 5TBMA 3OCNA 4AFIA 2QJ5A 2O99A 2M1CA 5I5LA 3T4QA 3T50A 2B02A 3LR0A 2K31A 3MF0A 3MXQA 4HIAA 2J80A 1ZTUA 2GNXA 5AVEA 4IJGA 1LL8A 3K3DA 2PR5A 1IFQA 4PKYG 2XRNA 3A0SA 3R7WA 3LR5A 1BYWA 3LUQA 1STZA 1OTDA 4Q0IA 3TW8A 2OAQ1 3F1PB 1S67L 4BJPA 4EETB 2VZWA 3MJQA 4RQ9A 2EWWA 2L4RA 2J3WA 1T1BA 2VV8A 2ZOIA 1NWZA 2OWHA 3IS2B 3FG8A 2V0UA 3LI9A 3D3OA 3LIAA 4Y3IA 4EU0A 3E4QA 1GSXA 4F3LA 4DMZA 3KO6A 1GSVA 4GW9A 4CLCA 1DP8A 3ZYTA 4DN0A 3MMHA 3F1NA 4MDZA 2QWSA 1VB6A 2NUTC 2PYPA 2A24B 5G4YA 2CMNA 2W3EA 4XT2B 1TS0A 3E98A 1S4SA 1GSWA 1T18A 2K2NA 2R78A 3D72A 1MZUA 2VEAA 2JKRI 5IU1A 1LSXA 5HD3A 5J3WA 3OCLA 1YAXA 3VE4A 4OOLA 4WL9A 2PR6A 3F1OA 2Z6CA 4YWZA 3E0YA 2JKTI 1W63Q 5HD5A 3PYPA 3UE6A 1XFQA 3ZQ5A 1V9YA 1TS6A 3W2ZA 3KSHA 3PR6A 4I5SA 3KYQA 4R6LA 5LBRA 2M7UA 2JKRM 3ICYA 5F69A 2HJ9C 1S1YA 1P9RA 2KX6A 3BY9A 5TJJA 4Q0HA 2JKTM 1OTBA 2VKSA 3BW6A 4H6JA 4EERA 4WN5A 3H7WA 4HJ3A 4K08A 2DMWA 2V1AA 3MR0A 4I38A 4Z1WA 2HJEA 1N9LA 4EQ1A 1OTEA 1S1ZA 4KQDA 4O01A 3PBNA 3HCYA 4WF0A 4NXEA 3C38A 4YOFA 1OPXA 4KUKA 4P6ZS 3LIDA 2J3TD 2W0NA 2W3GA 5G4ZA 5TBMB 2VLGA 3P7NA 5HSQA 2EWVA 3TRCA 1NLZA 2HV1A 2PT7A 4HY8A 3NHQA 3LR3A 5AVFA 1KOUA 3R7WB 4ARZA 4OOMA 5C5KA 2YKHA 3V67A 2VA0A 1Y28A 3PBQA 2O9AA 1OT9A 4R70A 2XA7M 1LSWA 4WLAA 1W63M 4CLCD 4MN7A 3RTYA 1XJ2A 2Z6DA 2INWA 2W27A 2EA9A 4NXFA 4NXBA 2K7SA 5EFWA 1T19A 4EEUA 5HDDA 4NEED 5DFYA 3DBAA 2Y8HA 3OLOA 1LSVA 3MQOA 4HJ4A 2D02A 1EW0A 4I39A 1OJGA 3T4SA 4BBUA 1MC0A 2NUPC 2W1RA 4LPZA 5CX7A 3UB7A 4BBVA 5HWWA 2W1TA 3LIEA 2W3FA 5IS1A 4MN5A 3BQAA 3VE3A 2VX8A 3LFVA 3O5YA 3E4OA 3B42A 4L9EA 3A0VA 3K2NA 2OOLA 1OT6A 3A0RA 4EUVA 3EQVA 2JHEA 1V9ZA 5J4EA 3CI6A 2I9VA 3FPVA 4HI4A 2JN7A 4CQHA 1H3QA 3CUEC 4UQIM 3UB6A 4G3KA 2V1BA 4HH2A 1XJ6A 2V9AA 2GX5A 2P7JA 3VV4A 4GS9B 5HPFA 2VGLM 1UGUA 3F1PA 3T4OA 5KIZA 4E04A 3SW1A 3MQQA 4WEKA 3LIBA 2L0WA 3IS2A 5HZHA 4MMNA 3T4LA 1UWNX 3FPWA 3S7PA 3JVUA 4GHIB 1YSPA 3MFXA 3TE8A 3PBRA 4DJ2A 2ZOHA 3H82B 3UMEA 4HHDA 3E4PA 4KQOA 2IA2A 2QJ7A 4M4XA 5DJTA 1ODVA 3PXPA 3R4KA 4GJ4A 2A24A 5KSHA 5HPIA 3EGXC 3GECA 4WEJA 1WA9A 5HDCA 2QKPA 1TD5A 1OJ5A 5A8BA 1UWPX 3EWKA 3PBTA 2Y79A 4IUKA 4EESA 1VHMA 4PHTA 3LR4A 2OWJA 4IHQA 3HJIA 4UEYA 4HJ6A 1G6OA 1D06A 4O8GA 1TS7A 1D7EA 1LT0A 2WKRA 3VOLA 1DRMA 4HH3A 3OC2A 1TS8A 3TJZC 4JGRA 3PHYA 5L8MA 3NOPC 4II7A 4HP4A 2HGVA 4LRZE 5F6AA 3EGDC 3KSIA 4FSFA 2VV6A 2ZMVA 1G28A 3RH8B 3NOUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9F A;  2BAS A;  3CLO A;  1XJ3 A;  2L1M A;  3B33 A;  1N9O A;  4I3J A;  4F3L B;  1F98 A;  4EXO A;  3NJA A;  3F1N B;  3UMD A;  3C8C A;  3UB8 A;  4BBT A;  3K3C A;  3BWL A;  2GJ3 A;  2WKQ A;  1DP6 A;  1S66 L;  1T1A A;  3UB9 A;  3LIF A;  3F1O B;  3HJK A;  2PD7 A;  3H9W A;  4EW7 A;  2ZBB A;  4I3A A;  3LYX A;  4LRY C;  5F68 A;  4HQA A;  3BY8 A;  5HWV A;  4GCZ A;  4JGP A;  4HP9 A;  3CWF A;  3ULF A;  2D01 A;  4H6J B;  1N9N A;  4L9G A;  3H7W B;  1DP9 A;  2WKP A;  5HDS A;  5J7E A;  4B9O A;  1JNU A;  4NXG A;  1XFN A;  5HWT A;  4PKY A;  4I3I A;  4JGO A;  2KDK A;  4EEP A;  4LRX C;  1T1C A;  3LIC A;  2PHY A;  4XT2 A;  4HOI A;  1P0Z A;  2QHK A;  2VV7 A;  4R3A A;  2YKF A;  1P97 A;  2H28 A;  2PYR A;  2V0W A;  4GS9 A;  1F9I A;  3IBR A;  4JGQ A;  3EEH A;  3FC7 A;  5DJU A;  1X0O A;  5DKK A;  3KX0 X;  4GHI A;  2PD8 A;  4MN6 A;  3C2W A;  4WUJ A;  5F5Y A;  3H82 A;  3CAX A;  3GDI A;  1S4R A;  5DKL A;  4KUO A;  4HNB A;  1OTI A;  3NOT C;  3G6O A;  4LLO B;  2PDR A;  3LI8 A;  4R38 A;  1XJ4 A;  4DJ3 A;  1OTA A;  5TBM A;  2QJ5 A;  2M1C A;  5I5L A;  3T50 A;  2B02 A;  3MXQ A;  4HIA A;  2J80 A;  5AVE A;  1LL8 A;  3K3D A;  2PR5 A;  4PKY G;  3A0S A;  1BYW A;  3LUQ A;  1OTD A;  3F1P B;  1S67 L;  4EET B;  3MJQ A;  4RQ9 A;  2L4R A;  1T1B A;  2VV8 A;  2ZOI A;  1NWZ A;  2OWH A;  3IS2 B;  3FG8 A;  2V0U A;  3LI9 A;  3LIA A;  3E4Q A;  1GSX A;  4F3L A;  1GSV A;  4GW9 A;  1DP8 A;  3F1N A;  2QWS A;  1VB6 A;  2PYP A;  2A24 B;  5G4Y A;  2CMN A;  4XT2 B;  1TS0 A;  1S4S A;  1T18 A;  1GSW A;  2R78 A;  3D72 A;  1MZU A;  2VEA A;  5IU1 A;  1LSX A;  5HD3 A;  5J3W A;  3VE4 A;  4WL9 A;  2PR6 A;  3F1O A;  2Z6C A;  4YWZ A;  5HD5 A;  3PYP A;  3UE6 A;  1XFQ A;  3ZQ5 A;  1V9Y A;  1TS6 A;  4I5S A;  4R6L A;  3ICY A;  5F69 A;  1S1Y A;  2KX6 A;  3BY9 A;  1OTB A;  4H6J A;  4EER A;  4WN5 A;  3H7W A;  4HJ3 A;  4K08 A;  2V1A A;  3MR0 A;  4I38 A;  1N9L A;  4EQ1 A;  1OTE A;  1S1Z A;  4KQD A;  4WF0 A;  4NXE A;  4KUK A;  3LID A;  2W0N A;  5G4Z A;  5TBM B;  2VLG A;  3P7N A;  5HSQ A;  2HV1 A;  4HY8 A;  3NHQ A;  5AVF A;  1KOU A;  2YKH A;  1Y28 A;  1OT9 A;  4R70 A;  1LSW A;  4WLA A;  3RTY A;  1XJ2 A;  2Z6D A;  2INW A;  2W27 A;  2EA9 A;  4NXF A;  4NXB A;  2K7S A;  5EFW A;  1T19 A;  4EEU A;  5HDD A;  3OLO A;  1LSV A;  3MQO A;  4HJ4 A;  2D02 A;  1EW0 A;  4I39 A;  1OJG A;  4BBU A;  4LPZ A;  3UB7 A;  4BBV A;  5HWW A;  3LIE A;  5IS1 A;  4MN5 A;  3VE3 A;  3E4O A;  4L9E A;  3A0V A;  2OOL A;  1OT6 A;  3A0R A;  2JHE A;  1V9Z A;  5J4E A;  2I9V A;  4HI4 A;  2JN7 A;  3UB6 A;  2V1B A;  4HH2 A;  1XJ6 A;  2V9A A;  2P7J A;  4GS9 B;  1UGU A;  3F1P A;  5KIZ A;  4E04 A;  3SW1 A;  3MQQ A;  3LIB A;  2L0W A;  3IS2 A;  5HZH A;  1UWN X;  4GHI B;  3MFX A;  4DJ2 A;  2ZOH A;  3H82 B;  3UME A;  4HHD A;  3E4P A;  2QJ7 A;  4M4X A;  5DJT A;  1ODV A;  2A24 A;  3GEC A;  5HDC A;  1WA9 A;  2QKP A;  1OJ5 A;  5A8B A;  1UWP X;  3EWK A;  4EES A;  2OWJ A;  3HJI A;  4HJ6 A;  1D06 A;  1TS7 A;  1D7E A;  1LT0 A;  2WKR A;  3VOL A;  1DRM A;  4HH3 A;  1TS8 A;  4JGR A;  3PHY A;  3NOP C;  4HP4 A;  4LRZ E;  5F6A A;  2VV6 A;  1G28 A;  3RH8 B;  3NOU C; 
#chains in the Genus database with same CATH topology
 1IYS A;  1CEG A;  1Z09 A;  3NY4 A;  4WMC A;  4QPR A;  1E3U A;  3U2A A;  3CLO A;  1EI5 A;  1TEM A;  4C6Y A;  4I3J A;  3CIT A;  3KSG A;  1F98 A;  3ZDJ A;  1NRF A;  3Q1F A;  3OPP A;  3UMD A;  4S2N A;  4X6T A;  2VJW A;  5EUA A;  3BWL A;  4KQQ A;  1DP6 A;  1S66 L;  3CUE A;  3JYI A;  4JF5 A;  3HBR A;  3VFF A;  3UPO A;  5FL3 A;  3FYZ A;  3UB9 A;  3HJK A;  3H9W A;  2OSU A;  5L09 A;  1L0G A;  1C3B A;  4BL2 A;  2OV5 A;  4ME4 A;  1KGF A;  1ES2 A;  2EFU A;  4S2L A;  4OOY A;  1MKM A;  3LEZ A;  3CWF A;  2ZC4 B;  5CTM A;  4L9G A;  1YQS A;  3BFC A;  5FA7 A;  2XLN A;  2GZA A;  5FI2 A;  3HLF A;  5AQ7 A;  4PAU A;  4GB7 A;  1TDL A;  4U3T A;  4B9O A;  4KZ8 A;  3BLM A;  4BQM A;  3KYZ A;  1GA0 A;  1NY0 A;  5GLB A;  3AGF A;  2ZC6 B;  4ZTK A;  1K0K A;  2KLI A;  2KOI A;  3P09 A;  4LRX C;  1MWU A;  2W3H A;  4FUW A;  1KGE A;  3MKF A;  2MJ6 A;  3C4O A;  4HOI A;  3V50 A;  4E6X A;  2RL3 A;  1K55 C;  4R3A A;  2H28 A;  5FAP A;  4Z9Q A;  2WGW B;  2ZMF A;  4Y2F A;  5U47 A;  4JBF A;  4MCW A;  1E4D A;  2PU2 A;  3IBR A;  4ARZ B;  4JGQ A;  3Q81 A;  5GHY A;  5DJU A;  2ZM2 A;  2JBF A;  4GOG A;  3ITB A;  3KX0 X;  2M7V A;  4UA7 A;  2ZQA A;  2QPN A;  1W8Q A;  5F5Y A;  3G4P A;  4M3K A;  3QHY A;  2R9W A;  2Q9N A;  4Y0O A;  2HF6 A;  3LCE A;  3G6O A;  1PW1 A;  4LV2 A;  3LGO A;  2W1T B;  2ZC3 B;  4B4X A;  3OBF A;  4KZA A;  4DJ3 A;  3KSF A;  2WAE A;  2XRO A;  3GQZ A;  3PBO A;  2ZD8 A;  5TBM A;  3OCN A;  3HRE A;  2Y55 A;  5CEC A;  2AVX A;  3WWX A;  4CJN A;  2GNX A;  1H8Y A;  2PR5 A;  3ZHH A;  3A0S A;  1MWS A;  3LR5 A;  1BYW A;  3LUQ A;  3BYD A;  3W8K A;  5E2H A;  2OAQ 1;  1S67 L;  4JPM A;  4EET B;  4RQ9 A;  2Q9M A;  2J3W A;  4X68 A;  2VV8 A;  2ZOI A;  1NWZ A;  3E4Q A;  3IF6 A;  3KO6 A;  1MXO A;  3Q82 A;  4GD6 A;  1M6K A;  4LGW A;  3MZE A;  2QWS A;  4N9K A;  3DWK A;  3UE1 A;  5HAI A;  4XT2 B;  2K2N A;  4MBF A;  3D72 A;  1F2K A;  4KZ5 A;  5IU1 A;  1W5D A;  3WS0 A;  5J3W A;  4R1G A;  3WS4 A;  5E2G A;  3F1O A;  2Z6C A;  4WBG A;  4KZB A;  2ZL1 A;  2WAD A;  4E3M A;  5AQ9 A;  3ZG7 B;  3ZQ5 A;  1L3L A;  4E6W A;  5L07 A;  3KSH A;  4R3B A;  5CHM A;  4PM7 A;  2PBD P;  2XFS A;  3NEC A;  2M7U A;  3BEC A;  3ICY A;  1P9R A;  3BW6 A;  5DVA A;  3H7W A;  4UHU A;  4X56 A;  4X55 A;  3Q7Z A;  3DTE A;  1ALQ A;  5CTN A;  4KQD A;  3IQA A;  4N1X A;  1L0D A;  2XH9 A;  4KZ3 A;  4NXE A;  5E2E A;  2J7V A;  1K4F A;  3B3X A;  2I72 A;  4GDN A;  2A49 A;  4XUZ A;  2Y2N A;  3Q7V B;  3ZG0 A;  4MNR A;  1ESU A;  1XXM A;  3LR3 A;  1FQG A;  5AVF A;  1JTD A;  3NC8 A;  3QNC A;  1FSW A;  4OOM A;  4FH2 A;  2XF3 A;  2BG1 A;  3V39 A;  3CMZ A;  5FDS A;  1S6R A;  2XDM A;  4CLC D;  4MN7 A;  3RJU A;  1CQA A;  2INW A;  3GSG A;  4NXF A;  3VMA A;  2K7S A;  5EM0 A;  3IX3 A;  4HJ4 A;  3MFD A;  4ID4 A;  3FWL A;  2H0T A;  3E2K A;  3OPL A;  2W1R A;  4LPZ A;  3I7J A;  4EWF A;  4EV4 A;  2WZX A;  4OQ0 A;  5IS1 A;  4MN5 A;  3MXS A;  3VE3 A;  4B4Z A;  3SH7 A;  1KE3 A;  1PZO A;  1XPB A;  5FAS A;  3B42 A;  4L9E A;  3A0V A;  3K2N A;  3A0R A;  4IVK A;  2Y2P A;  3CI6 A;  2JN7 A;  1BLH A;  4P87 A;  2V1Z A;  4G3K A;  2V1B A;  4P85 A;  5EVE A;  1XJ6 A;  2V9A A;  1VEU A;  2GX5 A;  5EOE A;  1Y4O A;  2WKH A;  1ES4 A;  3SW1 A;  3LIB A;  3ZG9 B;  3C4P A;  3GV9 A;  1PI5 A;  5HAQ A;  2ACG A;  2L0W A;  2WK0 A;  1FCO A;  2VGJ A;  4MMN A;  3T4L A;  1K54 C;  1IYO A;  5TGF A;  3JVU A;  3D4F A;  3VOZ A;  4DJ2 A;  1G68 A;  5EV0 A;  3E4P A;  4KQO A;  4S2O A;  3PXP A;  4R3J A;  3R4K A;  4JXV A;  5KSH A;  5HPI A;  3FV7 A;  4ZAM A;  1WYB A;  5CER A;  4WEJ A;  4UA6 A;  3G35 A;  5A8B A;  1UWP X;  3PBT A;  4EES A;  1O7E A;  4DXC A;  2EX8 A;  3M6B A;  1DJC A;  4OPY A;  3JPU A;  4H8R A;  1OME A;  3CPT B;  3LR4 A;  3LY3 A;  3HJI A;  1GHM A;  4UEY A;  4O8G A;  4R0Q A;  5EEC A;  1TS7 A;  1KVM A;  2C6W B;  3ZCZ A;  4JGR A;  1PNE A;  2HZ5 A;  1GHI A;  3VSK A;  4ZJ3 A;  2O9C A;  4L9F A;  2BAS A;  5EPH A;  1A0K A;  1RGY A;  2L1M A;  5L10 A;  2WKI A;  1DY6 A;  4F3L B;  5DF8 A;  3IXD A;  3VP2 A;  5IT5 A;  1TDG A;  4EXO A;  4CLC B;  4EQI A;  4MEZ A;  1PYY A;  4X1M A;  2OLU A;  2P08 A;  5E2F A;  3T4J A;  3UB8 A;  4C75 A;  2W3D A;  3K3C A;  2GJ3 A;  4LEN A;  1P9W A;  2Y2K A;  5JYO A;  1K57 A;  4ZRR A;  2J9O A;  3LIF A;  1JWV A;  2LB9 A;  2ZM8 A;  2ZC7 A;  3T1Q B;  4DE1 A;  5F68 A;  2FZ0 A;  1VET A;  3BY8 A;  1KVL A;  3UDX A;  5DF7 A;  4IUH A;  4GCZ A;  3G2Y A;  4JGP A;  5EVL A;  5TFQ A;  1N9N A;  4Y0U A;  2Q0O A;  4LCL A;  4GN2 A;  4R23 A;  4S2I A;  2DCF A;  1PWC A;  1CF0 A;  1JNU A;  2ZQ7 A;  4GD8 A;  1JWP A;  3S7N A;  4PKY A;  1FIL A;  1ESI A;  4B93 A;  1SDE A;  1KE4 A;  3UO9 A;  5K5B A;  3OZH A;  3EEA A;  4LFU A;  4CLC C;  2ZQD A;  4KQR A;  1YSQ A;  5DFX A;  3U4L P;  1P0Z A;  4NET A;  4QJG A;  2QHK A;  2G2W A;  2RCX A;  2VV7 A;  3NDE A;  4BD0 A;  5CRF A;  1P97 A;  2P9V A;  5GHZ A;  3UPP A;  3OOV A;  2PYR A;  3EOI A;  3NCK A;  2V0W A;  4GS9 A;  5HAP A;  1BT5 A;  3BLS A;  4BMW A;  3FC7 A;  3M6H A;  3BQ8 A;  3BFD A;  2Y59 A;  5DKK A;  3BFE A;  1XKZ A;  3C2W A;  3H82 A;  1TF1 A;  2QYB A;  4HNB A;  2R9X A;  1KE0 A;  2ZJ9 A;  2H10 A;  2A2L A;  4DKI A;  4LLO B;  3N7W A;  1U60 A;  3T1X A;  3LI8 A;  3PBS A;  3RXX A;  1K25 A;  3B47 A;  3C30 A;  1XJ4 A;  3BJN A;  1OTA A;  2P04 A;  5G18 A;  4AFI A;  3ZG8 B;  3LR0 A;  3MXQ A;  3ITA A;  4HIA A;  5DTS A;  3IWO A;  4HES A;  1YLJ A;  5EVI D;  3R7W A;  4S2J A;  1K56 A;  3TSG A;  3MJQ A;  3DTI A;  2DNS A;  2EWW A;  2L4R A;  1T1B A;  3P98 A;  1GA9 A;  1SHV A;  3FG8 A;  4YIN A;  3LI9 A;  3D3O A;  4EU0 A;  5TR7 A;  1GSX A;  1GSV A;  2XD1 A;  4OQI A;  1FCN A;  1DP8 A;  1ES3 A;  4DN0 A;  1K6R A;  3SOI A;  1ONH A;  3BRM A;  3MZD A;  4LV0 A;  2A24 B;  1S4S A;  1T18 A;  1GSW A;  2R78 A;  3E98 A;  4HEF A;  1MZU A;  2VEA A;  4DRT A;  1K55 A;  5HD3 A;  4OOL A;  4JXS A;  1BLS A;  3E0Y A;  2JKT I;  1E25 A;  4OQG A;  3PYP A;  5FQK A;  1XFQ A;  2Y2M A;  2EX2 A;  1V9Y A;  1TS6 A;  3W2Z A;  2EX9 A;  1K4E A;  4MBK A;  1MWT A;  4JKT A;  2B5R A;  4OPR A;  1S1Y A;  2KX6 A;  3BY9 A;  5F1F A;  4Q0H A;  5F82 A;  3DTM A;  2JKT M;  3CHW P;  4EER A;  3CG5 A;  3MR0 A;  2XEP A;  4RX3 A;  4Z1W A;  2HJE A;  1IEM A;  1OTE A;  1S1Z A;  3RXW A;  4FH4 A;  1YLZ A;  1ZKJ A;  4WF0 A;  3C38 A;  3BEB A;  1ACF A;  3QP4 A;  2J3T D;  2W0N A;  4OPQ A;  5TBM B;  1L2S A;  5HSQ A;  2EWV A;  3ZVT A;  5M1A A;  1NLZ A;  2HV1 A;  4HY8 A;  4K0W A;  2WGW A;  4KZ9 A;  1PZP A;  4OLG A;  4ARZ A;  5C5K A;  1H5X A;  2V8C A;  1Y28 A;  3PBQ A;  2G2U A;  4R70 A;  2XA7 M;  2Y2J A;  4IBX A;  3VFH A;  2Z6D A;  3QP1 A;  4JLF A;  5EFW A;  1T19 A;  5I94 A;  4EEU A;  4XUX A;  2HP5 A;  2QMI A;  4NEE D;  5DFY A;  1LSV A;  2PAV P;  1JTG A;  3UY6 A;  3QP5 A;  4EUZ A;  4I39 A;  1ZC2 A;  5EVI B;  5J8X A;  4N9L A;  2Z2L B;  1LL5 A;  5HWW A;  2W1T A;  3IH9 A;  4D2O A;  1W79 A;  4FTX A;  3BQA A;  1FR1 A;  3O5Y A;  3E4O A;  5FI6 A;  2ZL1 B;  3WS2 A;  2OOL A;  1TVF A;  4EUV A;  5J4E A;  4HI4 A;  2ZMA A;  2ZQ8 A;  1NZO A;  1JVJ A;  4Y15 A;  3HLG A;  2P7J A;  3VV4 A;  2VGL M;  1UGU A;  3OPR A;  3O87 A;  4KG2 A;  2HDU A;  4WEK A;  5A92 A;  3FPW A;  4GHI B;  2EXB A;  3TE8 A;  3PBR A;  5GHX A;  2QJ7 A;  4N1H A;  2HDS A;  1GHP A;  1YLP A;  4OPZ A;  5EVI C;  4QWO A;  4IVI A;  3TG9 A;  1PWG A;  1KGG A;  3MXR A;  4PMA A;  1TD5 A;  2PRF A;  3SS3 A;  1AWI A;  1VHM A;  4PHT A;  5FQM A;  1AXB A;  3ZVW A;  3LY4 A;  5HL1 A;  1D7E A;  1LT0 A;  1BTL A;  4HH3 A;  1EWZ A;  3OC2 A;  2ZC5 B;  3ZFZ A;  3TJZ C;  1CI8 A;  5L8M A;  3NOP C;  1XGJ A;  2HDQ A;  4HP4 A;  4LRZ E;  3GR2 A;  5F6A A;  4FSF A;  2ZMV A;  3A3I A;  3RH8 B;  3NOU C;  3HL9 A;  5MC7 A;  1ZHH B;  1N9O A;  5FAT A;  3C7V A;  3F1N B;  1H0M A;  3C8C A;  3Q7V A;  3ZG5 A;  4LCM A;  4BBT A;  3N8L A;  3PAG A;  3O86 A;  2IWD A;  2WKQ A;  2HP6 A;  3QP2 A;  1GCE A;  1T1A A;  4A5R A;  2FH5 A;  2VK3 A;  1VEU B;  1W7F A;  5FQQ A;  4Q8I A;  4NKP A;  2ZBB A;  1L0E A;  2ZQC A;  3LYX A;  2J3T C;  2XA7 S;  5FQ9 A;  1YLT A;  2O9B A;  1K54 A;  2WAF A;  4Y7P A;  5GLC A;  1LLB A;  3SH9 A;  4HP9 A;  4KZ7 A;  4Q0J A;  1SKO B;  2D01 A;  3FZC A;  4H6J B;  1ERO A;  1NLY A;  3WS1 A;  2J9P A;  5J7E A;  3SS5 A;  1QMF A;  4NXG A;  1XFN A;  1WE4 A;  3BM6 A;  3S7Q A;  5IHV A;  1PW8 A;  2HDR A;  2KDK A;  1BUE A;  3RFB A;  3PAE A;  1XP4 A;  3ZNT A;  2XR0 A;  3D9Y A;  3GVB A;  1ES5 A;  3LIC A;  2BLS A;  5EOO A;  2B18 A;  2Y91 A;  1FR6 A;  4GLQ A;  1H8M A;  4IBR A;  5CED A;  5CHU A;  2DRW A;  1RGZ A;  1NRJ A;  3MQ0 A;  5GLD A;  4WMC D;  3UE3 A;  4RX2 A;  4DXB A;  1E3U D;  2VGL S;  4GDB A;  2ZQ9 A;  4X25 A;  5A91 A;  1RCJ A;  1YM1 A;  4CPK A;  3IHB A;  4KUO A;  3DTK A;  2Y2H A;  2P74 A;  1OTI A;  3NOT C;  4O7D A;  4BWI A;  2WZZ A;  2PDR A;  1K56 D;  1DJA A;  4BD1 A;  1I2S A;  4FCF A;  4C3Q A;  3IX4 A;  1H8Z A;  3CPT A;  1I2W A;  4BLM A;  3FKW A;  3T4Q A;  5I5L A;  5AQB A;  2FFF B;  3T50 A;  3IXB A;  2B02 A;  1NJ4 A;  3MF0 A;  1D1J A;  1VET B;  3HLB A;  4IJG A;  1LL8 A;  1IFQ A;  1Z6F A;  4QHC A;  3G34 A;  4UA9 A;  1STZ A;  3WS5 A;  4Q0I A;  2VGK A;  3TW8 A;  3F1P B;  4R4R A;  3L7H A;  4BJP A;  3HUO A;  5M19 A;  4ZDX A;  3AGE A;  3DWZ A;  3SZT A;  1S0W A;  2WKE A;  2Z2M B;  4F94 A;  3IS2 B;  2V0U A;  3LIA A;  3IWI A;  4F3L A;  4DMZ A;  4GW9 A;  4CLC A;  4JXW A;  3ZYT A;  2NUT C;  5GL9 A;  5G4Y A;  2W3E A;  2UV0 E;  1TS0 A;  3HVF A;  4WZ5 C;  4KEN B;  2JKR I;  3CJM A;  1FSY A;  1LSX A;  1YAX A;  3VE4 A;  3MS6 A;  4WL9 A;  4PM8 A;  2WYX A;  4YWZ A;  5HD5 A;  4P0M A;  3V5M A;  3QNB A;  5FSR A;  4RA7 A;  3PR6 A;  5BOH A;  4I5S A;  2HP9 A;  4R6L A;  5GLA A;  2JKR M;  1XX2 A;  2HJ9 C;  3GRJ A;  5CGW A;  3VOY A;  1ZG4 A;  3C7U A;  1XA1 A;  4K08 A;  2DMW A;  2V1A A;  1G6A A;  4I38 A;  4P6B A;  1NYY A;  4EQ1 A;  4O01 A;  3IF5 A;  2HPB A;  3PBN A;  1FIK A;  3HCY A;  1HZO A;  3HUM A;  1OPX A;  3SH8 A;  4KZ4 A;  4X69 A;  5G4Z A;  4OP5 A;  2VLG A;  3P7N A;  5A93 A;  3TRC A;  2ZM0 A;  2Y2G A;  2WGI A;  2PT7 A;  3G31 A;  4MBH A;  5E43 A;  3NHQ A;  3S4X A;  4GNU A;  5CXW A;  3NBL A;  4S2M A;  4MLL A;  1CEF A;  3LEQ A;  1KOU A;  3R7W B;  2YKH A;  3V67 A;  4S2P A;  1PWD A;  3TOI A;  4WLA A;  1XJ2 A;  2W27 A;  2EA9 A;  3HLD A;  1KDS A;  4NXB A;  1LI9 A;  3NI9 A;  2JKG A;  3DBA A;  3MQO A;  4EBL A;  4HBU A;  2D02 A;  1EW0 A;  2BTF P;  1MC0 A;  5CX7 A;  3UB7 A;  4BBV A;  4UAA A;  3LIE A;  1G5U A;  2V2F F;  4LV1 A;  3KYE A;  2H0Y A;  4Y0T A;  2X71 A;  4S2N C;  1ONG A;  2V20 A;  4FD8 A;  3EQV A;  4NG2 A;  2JHE A;  1V9Z A;  2Y2L A;  5HFO A;  2I9V A;  3FPV A;  3VSL A;  3CUE C;  2CC1 A;  1IKG A;  4UQI M;  3UB6 A;  3PTE A;  2JC7 A;  4OKP A;  1LHY A;  5HPF A;  3VP1 A;  1M40 A;  3T4O A;  5KIZ A;  3LO7 A;  4E04 A;  3MQQ A;  5EM1 A;  4N92 A;  1O07 A;  3W4O A;  5HZH A;  3QP8 A;  1Q2Q A;  1UWN X;  3IXH A;  3UN7 A;  4NK3 A;  1YSP A;  3ZNY A;  2Y2I A;  1Q2P A;  3BFF A;  3IHA A;  3S1Y A;  1PIO A;  5DJT A;  3WRT A;  4GJ4 A;  2XK1 A;  3A3E A;  2A24 A;  3L9K A;  3HLC A;  4KG6 A;  2WGV A;  3MSH A;  3GEC A;  5HDC A;  4B88 A;  2QKP A;  1OJ5 A;  4Y13 A;  2Y79 A;  5HAR A;  2XD5 A;  1NZU A;  2OLV A;  4OH0 A;  1SZV A;  4HJ6 A;  3VP0 A;  1D06 A;  2WKR A;  2Y2O A;  1DRM A;  3BFG A;  1IEL A;  4QY6 A;  3PHY A;  1CI9 A;  4EBP A;  1YLY A;  3KSI A;  2VV6 A;  1SDN A;  1G28 A;  4WYY A;  4X53 A;  4R4S A;  4PM9 A;  4E3K A;  5CGS A;  5L2F A;  3EQU A;  5AJG A;  2Y2Q A;  1XJ3 A;  1NYM A;  3B33 A;  3IF6 B;  5DF9 A;  2E8J A;  3NJA A;  2WUQ A;  1ERM A;  1YPR A;  5FAQ A;  4G3W A;  1F5M A;  2E8I A;  4PM5 A;  4ZJ2 A;  1Y54 A;  3F1O B;  4G3V A;  2PD7 A;  3FKV A;  4EW7 A;  4DDY A;  4E3J A;  4I3A A;  4ESP A;  4E3I A;  4O0P A;  4LRY C;  3DAV A;  4HQA A;  3IWQ A;  5HWV A;  4QY5 A;  5HL6 A;  1J3W A;  1YLW A;  3ULF A;  3MKE A;  3GTC A;  1ZG6 A;  3O3V A;  1YMX A;  4JF6 A;  5FQJ A;  3H7W B;  1DP9 A;  1W8Y A;  2WKP A;  5HDS A;  5EVI A;  3A3J A;  3P01 A;  1LI0 A;  4OP8 A;  3M2K A;  4CLC E;  1MWR A;  5HWT A;  3A3D A;  3MZF A;  4BL3 A;  4I3I A;  4JGO A;  3IF6 C;  1IYQ A;  4P6Z M;  1VQQ A;  2IWC A;  4JF4 A;  2XSS A;  4EEP A;  1T1C A;  3ISG A;  3T12 B;  3UE0 A;  3Q07 A;  5KSC A;  1KDW A;  5FAO A;  2PHY A;  4XT2 A;  2LB5 A;  4WEL A;  2O0Y A;  5CGX A;  1HD8 A;  2OAP 1;  2YKF A;  3T4K A;  2G7U A;  3G2Z A;  4YNR A;  4UQI S;  4ZBE A;  4L0L A;  3JVV A;  1F9I A;  3SS4 A;  3S7O A;  3EEH A;  1WYC A;  4Y5F A;  1YKD A;  4FOF A;  1X0O A;  1MKI A;  5EE8 A;  5JYP A;  4GHI A;  4ETX A;  2PD8 A;  4MN6 A;  4WUJ A;  1LL9 A;  3CAX A;  3GDI A;  1S4R A;  5DKL A;  3T1R A;  1N9B A;  4E3N A;  3T4T A;  3HLW A;  1K38 A;  3IBJ A;  2EXA A;  1MPL A;  1IOU A;  1PI4 A;  4RVA A;  4R38 A;  3G30 A;  3G32 A;  4ETZ A;  2QJ5 A;  2O99 A;  2M1C A;  2JE5 A;  2K31 A;  4U0T A;  1BZA A;  2J80 A;  1ZTU A;  5AVE A;  4S2K A;  1YT4 A;  3K3D A;  4OLD A;  4PKY G;  2XRN A;  5AQA A;  5CEB A;  3GMW A;  1FOF A;  1OTD A;  3CZD A;  3T1S A;  2VZW A;  3N4I A;  1JWZ A;  2OWH A;  4U0X A;  5D3O A;  4E3L A;  4Y3I A;  3A3F A;  3MMH A;  2B95 A;  3F1N A;  4MDZ A;  1VB6 A;  2PYP A;  2CMN A;  1XGI A;  5F1G A;  3IXG A;  3N6I A;  2PBY A;  3IT9 A;  3N8R A;  1I5Q A;  3OCL A;  3NUL A;  2PR6 A;  5F83 A;  1PRQ A;  1W63 Q;  3VP3 A;  3UE6 A;  4HBT A;  3QP6 A;  3ZGA B;  5DTT A;  3W4P A;  3KYQ A;  4PPR A;  3MBZ A;  5LBR A;  5F69 A;  2UWX A;  1IYP A;  1SKO A;  3HLE A;  5TJJ A;  2VKS A;  1OTB A;  3NDG A;  4H6J A;  3S22 A;  4WN5 A;  4HJ3 A;  1DJB A;  2XQZ A;  4DE2 A;  4QU3 A;  2H5S A;  4OVD A;  1N9L A;  1XA7 A;  2Y4A A;  4Y17 A;  5CHJ A;  4YOF A;  3O88 A;  3UB5 P;  4KUK A;  4P6Z S;  3LID A;  2W3G A;  3VP4 A;  4PM6 A;  4OQH A;  2QZ6 A;  5FEF A;  4OON A;  3AGD A;  4QD4 A;  4E3O A;  4GKU A;  3V3S A;  1MBL A;  4LV3 A;  3UDI A;  4D60 A;  3C5A A;  4BEN A;  4DE0 A;  1SCW A;  2VA0 A;  2O9A A;  1OT9 A;  2X01 A;  1BSG A;  3DW0 A;  1BLC A;  1LSW A;  1W63 M;  3RTY A;  1VM1 A;  5KMW A;  4JXG A;  4RYE A;  1ERQ A;  3WRZ A;  2EFX A;  5HDD A;  1CK3 A;  4IED A;  4WZ4 A;  2JCH A;  2Y8H A;  1J9M A;  1K6S A;  3OLO A;  4YFM A;  4ZJ1 A;  3N8S A;  1OJG A;  4EBN A;  3T4S A;  4BBU A;  4QB8 A;  4XXR A;  2NUP C;  2GDN A;  3M2J A;  4KG5 A;  1HLU P;  4WZ5 A;  1FCM A;  4DF6 A;  4DDS A;  2W3F A;  2VX8 A;  3LFV A;  4DE3 A;  1OT6 A;  3W4Q A;  5M18 A;  2A3U A;  4CQH A;  2PU4 A;  1H3Q A;  2IWB A;  1NXY A;  1QME A;  1K57 C;  2P9V B;  4HH2 A;  5A90 A;  1MY8 A;  2C5W B;  4GS9 B;  3F1P A;  2JKF A;  2XFT A;  4K0X A;  5KZH A;  3IS2 A;  1SKF A;  3OPH A;  5DTK A;  5FI7 A;  3UDF A;  3S7P A;  1YMS A;  1BUL A;  2ZLY A;  3MFX A;  1PFL A;  2J8Y A;  5HW3 A;  2ZOH A;  3H82 B;  3UME A;  4HHD A;  2IA2 A;  4M4X A;  4GZB A;  2V8F A;  1ODV A;  5FEG A;  3IH8 A;  1BLP A;  4KZ6 A;  3E2L A;  2XGN A;  3EGX C;  1WA9 A;  3UPN A;  3EWK A;  4IUK A;  2EX6 A;  2FFY A;  5FDH A;  1CJF A;  2X02 A;  1N4O A;  3NIA A;  4K91 A;  3V3R A;  2OWJ A;  1IKI A;  4IHQ A;  1G6O A;  5HX9 A;  3HUN A;  1L0F A;  3VOL A;  4WM9 A;  1RP5 A;  1TS8 A;  3UNW A;  1HVB A;  4II7 A;  2HGV A;  3IX8 A;  1HTZ A;  4X1L A;  5FQI A;  3EGD C; 
#chains in the Genus database with same CATH homology
 2O9C A;  3EQU A;  4L9F A;  4QPR A;  5AJG A;  2BAS A;  3U2A A;  3CLO A;  5MC7 A;  1XJ3 A;  2L1M A;  3B33 A;  1ZHH B;  1N9O A;  4I3J A;  3CIT A;  3KSG A;  5DF9 A;  4F3L B;  1F98 A;  5IT5 A;  4EXO A;  4CLC B;  3NJA A;  3F1N B;  3UMD A;  2P08 A;  3C8C A;  3T4J A;  3UB8 A;  2VJW A;  4BBT A;  2W3D A;  3K3C A;  4G3W A;  1F5M A;  3BWL A;  2GJ3 A;  2WKQ A;  1DP6 A;  1S66 L;  3CUE A;  1P9W A;  1T1A A;  4ZRR A;  2FH5 A;  5FL3 A;  3UB9 A;  3LIF A;  3F1O B;  3HJK A;  2LB9 A;  4G3V A;  2PD7 A;  3H9W A;  4NKP A;  4EW7 A;  2ZBB A;  4ME4 A;  4I3A A;  3LYX A;  2J3T C;  4O0P A;  4LRY C;  5F68 A;  2FZ0 A;  2XA7 S;  4HQA A;  3BY8 A;  1MKM A;  5HWV A;  2O9B A;  4IUH A;  4GCZ A;  5HL6 A;  4JGP A;  4HP9 A;  4Q0J A;  3CWF A;  3ULF A;  2D01 A;  4H6J B;  1N9N A;  4L9G A;  1NLY A;  3H7W B;  1DP9 A;  2GZA A;  4PAU A;  2WKP A;  5HDS A;  5J7E A;  3P01 A;  4B9O A;  1JNU A;  4CLC E;  4NXG A;  1XFN A;  5HWT A;  3S7N A;  4PKY A;  3KYZ A;  4B93 A;  3S7Q A;  4I3I A;  4JGO A;  5K5B A;  2KDK A;  3EEA A;  4P6Z M;  3RFB A;  4CLC C;  2KLI A;  2XSS A;  4EEP A;  2KOI A;  4LRX C;  1T1C A;  2W3H A;  3LIC A;  1YSQ A;  5DFX A;  2MJ6 A;  2B18 A;  2PHY A;  4XT2 A;  4GLQ A;  1H8M A;  4HOI A;  1P0Z A;  2LB5 A;  4WEL A;  2O0Y A;  2QHK A;  2VV7 A;  4R3A A;  2OAP 1;  2YKF A;  3T4K A;  1P97 A;  2G7U A;  3OOV A;  2H28 A;  2PYR A;  2ZMF A;  3EOI A;  4UQI S;  4Y2F A;  1NRJ A;  3MQ0 A;  4YNR A;  3UE3 A;  4L0L A;  3JVV A;  2V0W A;  4GS9 A;  4MCW A;  1F9I A;  3IBR A;  4ARZ B;  4JGQ A;  3S7O A;  3EEH A;  4BMW A;  4Y5F A;  2VGL S;  3FC7 A;  5DJU A;  1YKD A;  4FOF A;  3BQ8 A;  1X0O A;  5DKK A;  3KX0 X;  2M7V A;  4GHI A;  4ETX A;  2PD8 A;  4MN6 A;  3C2W A;  4WUJ A;  5F5Y A;  3H82 A;  3CAX A;  1TF1 A;  3GDI A;  1S4R A;  5DKL A;  2HF6 A;  2QYB A;  4KUO A;  4HNB A;  2A2L A;  1OTI A;  3NOT C;  4BWI A;  3G6O A;  4LLO B;  3T4T A;  2PDR A;  3IBJ A;  2W1T B;  1IOU A;  3LI8 A;  3PBS A;  3B47 A;  3OBF A;  3C30 A;  4R38 A;  1XJ4 A;  4DJ3 A;  3KSF A;  2XRO A;  3BJN A;  1OTA A;  2P04 A;  4ETZ A;  3PBO A;  5TBM A;  3OCN A;  4AFI A;  2QJ5 A;  2O99 A;  2M1C A;  5I5L A;  3T4Q A;  3T50 A;  2B02 A;  3LR0 A;  2K31 A;  3MF0 A;  3MXQ A;  4HIA A;  2J80 A;  1ZTU A;  2GNX A;  5AVE A;  4IJG A;  1LL8 A;  3K3D A;  2PR5 A;  1IFQ A;  4PKY G;  2XRN A;  3A0S A;  3R7W A;  3LR5 A;  1BYW A;  3LUQ A;  1STZ A;  1OTD A;  4Q0I A;  3TW8 A;  2OAQ 1;  3F1P B;  1S67 L;  4BJP A;  4EET B;  2VZW A;  3MJQ A;  4RQ9 A;  2EWW A;  2L4R A;  2J3W A;  1T1B A;  2VV8 A;  2ZOI A;  1NWZ A;  2OWH A;  3IS2 B;  3FG8 A;  2V0U A;  3LI9 A;  3D3O A;  3LIA A;  4Y3I A;  4EU0 A;  3E4Q A;  1GSX A;  4F3L A;  4DMZ A;  3KO6 A;  1GSV A;  4GW9 A;  4CLC A;  1DP8 A;  3ZYT A;  4DN0 A;  3MMH A;  3F1N A;  4MDZ A;  2QWS A;  1VB6 A;  2NUT C;  2PYP A;  2A24 B;  5G4Y A;  2CMN A;  2W3E A;  4XT2 B;  1TS0 A;  3E98 A;  1S4S A;  1GSW A;  1T18 A;  2K2N A;  2R78 A;  3D72 A;  1MZU A;  2VEA A;  2JKR I;  5IU1 A;  1LSX A;  5HD3 A;  5J3W A;  3OCL A;  1YAX A;  3VE4 A;  4OOL A;  4WL9 A;  2PR6 A;  3F1O A;  2Z6C A;  4YWZ A;  3E0Y A;  2JKT I;  1W63 Q;  5HD5 A;  3PYP A;  3UE6 A;  1XFQ A;  3ZQ5 A;  1V9Y A;  1TS6 A;  3W2Z A;  3KSH A;  3PR6 A;  4I5S A;  3KYQ A;  4R6L A;  5LBR A;  2M7U A;  2JKR M;  3ICY A;  5F69 A;  2HJ9 C;  1S1Y A;  1P9R A;  2KX6 A;  3BY9 A;  5TJJ A;  4Q0H A;  2JKT M;  1OTB A;  2VKS A;  3BW6 A;  4H6J A;  4EER A;  4WN5 A;  3H7W A;  4HJ3 A;  4K08 A;  2DMW A;  2V1A A;  3MR0 A;  4I38 A;  4Z1W A;  2HJE A;  1N9L A;  4EQ1 A;  1OTE A;  1S1Z A;  4KQD A;  4O01 A;  3PBN A;  3HCY A;  4WF0 A;  4NXE A;  3C38 A;  4YOF A;  1OPX A;  4KUK A;  4P6Z S;  3LID A;  2J3T D;  2W0N A;  2W3G A;  5G4Z A;  5TBM B;  2VLG A;  3P7N A;  5HSQ A;  2EWV A;  3TRC A;  1NLZ A;  2HV1 A;  2PT7 A;  4HY8 A;  3NHQ A;  3LR3 A;  5AVF A;  1KOU A;  3R7W B;  4ARZ A;  4OOM A;  5C5K A;  2YKH A;  3V67 A;  2VA0 A;  1Y28 A;  3PBQ A;  2O9A A;  1OT9 A;  4R70 A;  2XA7 M;  1LSW A;  4WLA A;  1W63 M;  4CLC D;  4MN7 A;  3RTY A;  1XJ2 A;  2Z6D A;  2INW A;  2W27 A;  2EA9 A;  4NXF A;  4NXB A;  2K7S A;  5EFW A;  1T19 A;  4EEU A;  5HDD A;  4NEE D;  5DFY A;  3DBA A;  2Y8H A;  3OLO A;  1LSV A;  3MQO A;  4HJ4 A;  2D02 A;  1EW0 A;  4I39 A;  1OJG A;  3T4S A;  4BBU A;  1MC0 A;  2NUP C;  2W1R A;  4LPZ A;  5CX7 A;  3UB7 A;  4BBV A;  5HWW A;  2W1T A;  3LIE A;  2W3F A;  5IS1 A;  4MN5 A;  3BQA A;  3VE3 A;  2VX8 A;  3LFV A;  3O5Y A;  3E4O A;  3B42 A;  4L9E A;  3A0V A;  3K2N A;  2OOL A;  1OT6 A;  3A0R A;  4EUV A;  3EQV A;  2JHE A;  1V9Z A;  5J4E A;  3CI6 A;  2I9V A;  3FPV A;  4HI4 A;  2JN7 A;  4CQH A;  1H3Q A;  3CUE C;  4UQI M;  3UB6 A;  4G3K A;  2V1B A;  4HH2 A;  1XJ6 A;  2V9A A;  2GX5 A;  2P7J A;  3VV4 A;  4GS9 B;  5HPF A;  2VGL M;  1UGU A;  3F1P A;  3T4O A;  5KIZ A;  4E04 A;  3SW1 A;  3MQQ A;  4WEK A;  3LIB A;  2L0W A;  3IS2 A;  5HZH A;  4MMN A;  3T4L A;  1UWN X;  3FPW A;  3S7P A;  3JVU A;  4GHI B;  1YSP A;  3MFX A;  3TE8 A;  3PBR A;  4DJ2 A;  2ZOH A;  3H82 B;  3UME A;  4HHD A;  3E4P A;  4KQO A;  2IA2 A;  2QJ7 A;  4M4X A;  5DJT A;  1ODV A;  3PXP A;  3R4K A;  4GJ4 A;  2A24 A;  5KSH A;  5HPI A;  3EGX C;  3GEC A;  4WEJ A;  1WA9 A;  5HDC A;  2QKP A;  1TD5 A;  1OJ5 A;  5A8B A;  1UWP X;  3EWK A;  3PBT A;  2Y79 A;  4IUK A;  4EES A;  1VHM A;  4PHT A;  3LR4 A;  2OWJ A;  4IHQ A;  3HJI A;  4UEY A;  4HJ6 A;  1G6O A;  1D06 A;  4O8G A;  1TS7 A;  1D7E A;  1LT0 A;  2WKR A;  3VOL A;  1DRM A;  4HH3 A;  3OC2 A;  1TS8 A;  3TJZ C;  4JGR A;  3PHY A;  5L8M A;  3NOP C;  4II7 A;  4HP4 A;  2HGV A;  4LRZ E;  5F6A A;  3EGD C;  3KSI A;  4FSF A;  2VV6 A;  2ZMV A;  1G28 A;  3RH8 B;  3NOU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...