3MJQA

Crystal structure of the pas domain of q24qt8_deshy protein from desulfitobacterium hafniense. northeast structural genomics consortium target dhr85c.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
KNFLETIEDMILIINREGRLLYANTAVPKKLGYTHEELMSMHILTITSAGKMAEGEKILAELFAGKKESLPLSLEKKEGTSIPAKARIWQGKWHNEPCLFAIIKDLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PAS domain of Q24QT8_DESHY protein from Desulfitobacterium hafniense.
rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 19
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mjqA00
3C2WA 2PD7A 4R38A 3LIDA 3LIBA 1F9IA 3HJIA 5HWWA 1LSXA 2L4RA 4HNBA 1X0OA 2INWA 4NXFA 1OJ5A 3UB9A 4BBTA 1BYWA 3H7WB 3E4QA 3VE4A 5HSQA 4HQAA 1OTDA 1P0ZA 1UWNX 1N9OA 1OJGA 1S1ZA 4MN6A 4EXOA 1LSVA 2A24B 2YKFA 1DP6A 2W27A 2D01A 1T18A 2QWSA 3A0RA 5F5YA 1XJ4A 4DJ2A 4HHDA 2QKPA 5HDSA 2P7JA 3E4OA 5G4ZA 2V1AA 1S66L 2WKPA 4F3LB 4GHIA 1XFNA 4EQ1A 3F1NB 3MFXA 4PKYG 4WF0A 5F6AA 5DJUA 3D72A 3F1PB 3F1PA 3B33A 1MZUA 3ICYA 3MJQA 3T50A 2QJ7A 2GJ3A 1OT9A 2PR5A 3CWFA 5HZHA 2OOLA 3P7NA 1S4SA 3ULFA 3KX0X 1D7EA 3A0SA 3GECA 3F1NA 3LI8A 3LIFA 1T1AA 3FC7A 4KUKA 3SW1A 2PYRA 1S1YA 1UWPX 1N9LA 3E4PA 4LRYC 3UMEA 3LIEA 4R6LA 4LLOB 1OTAA 4JGPA 1DP9A 2I9VA 1WA9A 1D06A 5DJTA 2JN7A 2J80A 4EW7A 5AVEA 1VB6A 4MN5A 2A24A 4GS9B 4NXEA 2VV6A 4EEUA 4NXGA 4B9OA 3G6OA 3UMDA 2VV8A 4M4XA 1JNUA 2PDRA 3BWLA 5KIZA 4HJ4A 4GCZA 4JGOA 3RTYA 3NHQA 1GSVA 2M1CA 3LYXA 1TS7A 1TS8A 1TS6A 3EEHA 3F1OA 4H6JB 1GSXA 1XJ6A 4R70A 1G28A 2KX6A 3K3CA 3UB6A 3IS2B 5HWTA 5DKKA 1Y28A 5HD5A 1DP8A 1GSWA 2Z6DA 4EESA 3H9WA 2BASA 2WKRA 1T1BA 2WKQA 5A8BA 5DKLA 1P97A 3NOUC 4HY8A 1XJ3A 5HWVA 1LSWA 2QHKA 3LIAA 4WL9A 4I38A 1OT6A 1KOUA 3OLOA 4NXBA 1XJ2A 3NOTC 5HDCA 3UB8A 4GS9A 2D02A 2VLGA 1OTIA 5G4YA 4RQ9A 3UE6A 4EERA 1T1CA 1T19A 2OWJA 2PYPA 3PHYA 4I3JA 4L9EA 2KDKA 4JGRA 4KQDA 4HIAA 5I5LA 1S67L 2EA9A 2CMNA 4LRXC 4DJ3A 2V0WA 4WN5A 1F98A 2L1MA 4HJ3A 4L9FA 1TS0A 4HH2A 4E04A 2VV7A 2YKHA 1ODVA 2ZBBA 3MR0A 4H6JA 4LRZE 4WLAA 1OTBA 3LICA 4XT2A 2W0NA 4GW9A 1LT0A 3CLOA 4HJ6A 2V1BA 3C8CA 3PYPA 2R78A 1S4RA 3BY9A 3MQOA 5J4EA 1V9ZA 4F3LA 3BY8A 3NOPC 1LL8A 4HP4A 5F68A 4JGQA 4XT2B 1XFQA 4HOIA 2L0WA 3A0VA 1NWZA 4KUOA 5HD3A 5IU1A 3VOLA 3MXQA 3FG8A 3ZQ5A 3F1OB 3H7WA 2PHYA 3K3DA 5TBMB 4I3AA 4R3AA 3IS2A 4I39A 1V9YA 4BBVA 2PR6A 4WUJA 3H82B 2HV1A 2ZOHA 3NJAA 5F69A 5AVFA 4YWZA 2VEAA 4HI4A 1DRMA 4HH3A 4I5SA 2QJ5A 4L9GA 4PKYA 1OTEA 5EFWA 3CAXA 2JHEA 5IS1A 3LI9A 3RH8B 4GHIB 2OWHA 1N9NA 2V9AA 3IBRA 2K7SA 5J3WA 3UB7A 5TBMA 1EW0A 3MQQA 3VE3A 4EEPA 4HP9A 3EWKA 2H28A 2V0UA 3H82A 4I3IA 5HDDA 4EETB 2B02A 3LUQA 4K08A 2Z6CA 2PD8A 2ZOIA 3GDIA 3HJKA 4BBUA 4LPZA 5J7EA 1UGUA
chains in the Genus database with same CATH superfamily
5FI7A 2P9VB 2M7VA 1VETB 3P98A 2J3WA 2HP6A 4IUHA 3W4PA 2W27A 3HLFA 3T4LA 2VJWA 4HHDA 3E4OA 4IVKA 3CITA 3RJUA 1BLHA 3F1PA 1NRJA 4MMNA 3QP6A 3HUNA 4ZBEA 4U0TA 4KUKA 1IFQA 3SW1A 1N9LA 4EBPA 4LRYC 4LLOB 2K2NA 1OTAA 4MBKA 2XD1A 3V3SA 4MN5A 2KLIA 4CPKA 3BFGA 4GLQA 3MXRA 4UA6A 5EE8A 4KZBA 1TS7A 1FILA 3F1OA 1W8YA 5HWTA 2BASA 4PM9A 5A90A 4L0LA 4FH2A 4NG2A 4QHCA 5G4YA 4L9EA 4LV0A 2GZAA 4EWFA 3T4QA 1K55C 4Y0TA 4KG6A 4LRZE 2HDUA 3HL9A 2IA2A 5M19A 4ZJ1A 1YLJA 3UPPA 1ES2A 2P08A 1PNEA 1K56A 1SDNA 2L0WA 4Y3IA 5FASA 3OOVA 5TBMB 4DF6A 4R3AA 2NUPC 4BWIA 1E3UD 1KVLA 1HZOA 3T1RA 3U2AA 3EEAA 3QP8A 3WS1A 3KO6A 3HJKA 4JF5A 1JTDA 1AXBA 2INWA 2W3HA 4MN6A 3S7OA 1ES3A 1T18A 3NCKA 1I2SA 4WF0A 3BRMA 4GNUA 2QJ7A 3RXWA 5FDSA 3A3DA 3F1NA 3MFDA 2JBFA 2O99A 5U47A 4CLCD 2Y2QA 1GHPA 3TRCA 3U4LP 2WGIA 4P85A 2OAQ1 2XQZA 2W1RA 2HZ5A 3N7WA 4NXGA 4OH0A 5EM1A 3VP0A 4MBHA 4PM5A 1FOFA 3SOIA 4HJ4A 3ZYTA 3BLSA 1ONHA 3D3OA 5CXWA 3UDIA 1A0KA 2Y79A 1XJ6A 2QZ6A 1NY0A 1JVJA 3S22A 3H9WA 1XGIA 3NIAA 2FFYA 3LIAA 3W4QA 3HLGA 3BFEA 3NOTC 4RQ9A 2EX2A 2QPNA 3CHWP 4DJ3A 2XK1A 4OPZA 4OLGA 4HJ6A 5L07A 3E2KA 2HJEA 2FH5A 5EOOA 2QMIA 3ZCZA 4OQIA 1NWZA 4KZ8A 3CPTA 3CUEC 3ZQ5A 4IUKA 4MBFA 5F69A 1ZTUA 3NECA 3FWLA 1PRQA 2JHEA 4HP9A 5K5BA 3PAGA 3SS3A 5CHJA 4P6BA 4WZ4A 1GHMA 4A5RA 3HJIA 5HWWA 1O7EA 4R4RA 4X1LA 1BYWA 2IWCA 3EQVA 2J9OA 3A0RA 3UO9A 5DTKA 2LB9A 2XROA 5KSCA 2EWWA 4EU0A 2XF3A 3ZG7B 1XA7A 1Y54A 2VKSA 3T4SA 5AQAA 4U0XA 3BFFA 3PBSA 3UMEA 3G35A 1D06A 3LR4A 3RXXA 1VB6A 3G6OA 2GX5A 2XFSA 4O01A 4R70A 3KSHA 4OLDA 2KX6A 1JTGA 3RFBA 5HD5A 1F5MA 3WS2A 2LB5A 3MS6A 5GL9A 4WMCA 3FKVA 4CLCE 3ITAA 2ZL1B 3SH9A 4ZTKA 4G3WA 3VSKA 3UPNA 1XPBA 3G2YA 4KQOA 3EQUA 4L9FA 3SS5A 3MR0A 1SKOB 2JKTI 3ZG8B 3B47A 4KUOA 3K2NA 3VP4A 3H7WA 1YKDA 3O3VA 1P9WA 2M7UA 4HH3A 2ZC4B 4PHTA 3T4KA 4BMWA 3IBRA 4U3TA 2W3EA 5HDDA 3VOYA 3GSGA 3IXGA 3LIDA 1E3UA 1RP5A 4HNBA 2ZM8A 1IYOA 1I5QA 5AQ7A 4JLFA 1Q2QA 1MKIA 4KZ7A 3GTCA 3C38A 3NBLA 4DJ2A 1PFLA 1IYPA 1FSYA 4R3BA 4WZ5C 1J9MA 5J8XA 3O5YA 4S2JA 3NDEA 5HZHA 3KX0X 3LI8A 3QNBA 2JE5A 2PBDP 3MBZA 3IXBA 3HREA 4X56A 3OBFA 2VGKA 3T12B 4IBXA 3UDFA 3S1YA 4B9OA 1W8QA 3OPLA 4Y5FA 5HPFA 1LL9A 4K0XA 1YM1A 3M6BA 3T1SA 3SH8A 1LSWA 1CF0A 2HP5A 5JYPA 3TOIA 2ZBBA 2XDMA 2ZLYA 4XT2A 4GW9A 3CLOA 3ITBA 5HX9A 3NOPC 5HD3A 1VEUA 2MJ6A 2H0YA 4R4SA 4Y15A 4I39A 2PR6A 1PIOA 3N8LA 4N1XA 2VEAA 5KMWA 5DF9A 3WRZA 2ZMVA 5TBMA 3MZFA 3QHYA 4I3IA 3PAEA 4E3KA 1TD5A 4IBRA 3N8RA 1BULA 3HLEA 4E3JA 1XA1A 3VP2A 2YKFA 1DP6A 4E3IA 4Y0OA 2G2WA 3W4OA 2W3FA 2WKPA 4QB8A 1WYBA 3WS4A 4DE2A 5BOHA 1NZOA 1PI5A 3P7NA 1YQSA 3LIFA 3V5MA 4LV1A 4KG2A 5FATA 4CLCC 3E0YA 3IF6C 3LIEA 4QJGA 4K91A 3OC2A 2XEPA 1RGZA 1EI5A 1ERQA 2OAP1 3BYDA 4BL2A 3CG5A 2XA7M 1YSPA 3RTYA 1LLBA 1NZUA 4OPYA 1XP4A 3BFDA 3IHBA 4S2NC 3NOUC 4DKIA 2DRWA 2AVXA 2Y2JA 1ZG4A 1VQQA 3G32A 2Y55A 1OTIA 1FR6A 1NJ4A 2Y2HA 2WGVA 2WAFA 1TS0A 1D1JA 2JKTM 2VGJA 3W8KA 4EUVA 3ZNYA 4XT2B 1XFQA 3VOLA 5IU1A 4DMZA 3MXQA 4CQHA 4MN7A 4BBVA 3C7UA 1ERMA 4DXCA 1FIKA 2XGNA 3PBNA 5FI2A 4RVAA 3BEBA 4BBUA 3HCYA 1EROA 4F3LB 3DWZA 1L0FA 2EX6A 3LR5A 4JXVA 3IXDA 1KVMA 5IT5A 1PYYA 4YFMA 3E98A 3LEZA 1K6RA 1K57C 5CGSA 3MFXA 4Y2FA 5DJUA 3D72A 2Y4AA 3WS0A 3VOZA 3R7WB 3ULFA 3UPOA 3LEQA 1H8ZA 3JPUA 2ZQ9A 4OVDA 4DDYA 4R23A 3UB5P 2VGLM 1W63Q 4EW7A 2A24A 3PR6A 1DY6A 1ESUA 1K56D 1NYMA 3C4PA 1L2SA 4H6JB 1CK3A 1HLUP 3MXSA 2WKQA 2ACGA 2P74A 4B93A 4XUXA 2DCFA 1I2WA 2XR0A 4ME4A 1DJAA 2D02A 3EOIA 3PHYA 4UQIM 5GHYA 1HD8A 4KQDA 1MWTA 2EA9A 4Q0HA 4GOGA 1BZAA 1H8YA 2J7VA 4II7A 3F1OB 4I3AA 1QMEA 5IS1A 1MWUA 3FYZA 4LENA 2V9AA 2O9AA 1NRFA 2J3TD 3MQQA 1MWRA 3G2ZA 5EVIA 3QP4A 4LPZA 5FQKA 5J7EA 3NI9A 4ETXA 3BFCA 3PBTA 1EWZA 2J8YA 4BBTA 3UDXA 3G31A 4PAUA 1N9OA 4DE1A 1STZA 1L3LA 3E2LA 5FI6A 1K55A 3F1NB 4PKYG 4ZJ3A 5FL3A 1VETA 5HFOA 2Y2LA 3KYEA 4X53A 1SKOA 3LGOA 2WK0A 1MXOA 5TR7A 1E25A 4YNRA 1IOUA 5DJTA 1YMXA 3ISGA 4GZBA 5AVEA 4GKUA 2VV6A 3QP2A 5CEBA 2W3DA 2VGLS 2VV8A 5KIZA 3IH9A 2V8CA 4Q0JA 3VMAA 1IYSA 2J9PA 4DXBA 5L8MA 1DP8A 4MEZA 2WKRA 3BW6A 1XJ3A 3DTKA 1JWZA 2HPBA 4NETA 3LR0A 2Y91A 3UB8A 1K4FA 2VLGA 3UE6A 1T1CA 4I3JA 3UE3A 2PBYA 5E43A 1CJFA 3C4OA 2W1TA 4N92A 5CTNA 1HVBA 4B4ZA 4E04A 4H6JA 4WLAA 5FAPA 2ZQDA 3P01A 2A49A 4KZ9A 3M2KA 3BY8A 2J3TC 4HP4A 3VFFA 4ETZA 2ZM2A 5CHMA 4S2KA 2XRNA 5GLAA 3OCLA 4B88A 5A92A 4PKYA 2Q9NA 1N9NA 1JWVA 2VK3A 5CHUA 1FQGA 5EOEA 3C2WA 3N8SA 3LIBA 4S2OA 1F9IA 2G7UA 1OJ5A 3E4QA 2ZMAA 3TSGA 2E8IA 4IVIA 4BD0A 1S66L 4GDBA 3DTEA 4LCMA 2BG1A 2IWBA 3IXHA 3VV4A 1DJBA 2Y8HA 1MY8A 1OT9A 2EX9A 3DTIA 3ZG0A 3GECA 3FC7A 2XA7S 4GD6A 4R6LA 4PPRA 1YPRA 1DP9A 2WKEA 2J80A 2ZQCA 1Z6FA 2WGWB 3V3RA 5HAIA 1H0MA 2PDRA 5I94A 2EWVA 3IF6A 2PU4A 4OQHA 1G6AA 3HLDA 3GV9A 4QU3A 3UB6A 5DKKA 1S0WA 2ZC7A 4EESA 3VP3A 1TDLA 3S4XA 3V67A 4HY8A 1ALQA 1OT6A 1BUEA 2EXBA 4EBNA 1XJ2A 4HBTA 2OWJA 4G3VA 1ZG6A 3ZNTA 1TVFA 2JKRM 1S67L 4HJ3A 2L1MA 1SDEA 3LICA 4MCWA 4R0QA 3MQOA 1IKIA 1KDSA 1YMSA 5F68A 5L09A 1GHIA 4S2MA 4LCLA 1K6SA 1OMEA 1V9YA 4YWZA 3HVFA 5JYOA 2OWHA 2V20A 5J3WA 4EV4A 1EW0A 1MBLA 2V0UA 4ZDXA 5GLDA 3LFVA 5LBRA 2B02A 4UA9A 5CRFA 2Y2OA 4IJGA 4JXWA 2PD7A 5HPIA 2H5SA 4NXFA 1G5UA 2PU2A 1LSVA 2WGWA 2Q0OA 3OCNA 5DFYA 2FZ0A 2V8FA 3SS4A 4EQ1A 5TJJA 4S2IA 4X6TA 3F1PB 5HL1A 3ICYA 3GVBA 3HLCA 1CI9A 4D60A 1K0KA 1DJCA 1S4SA 1CI8A 3ZG5A 5DVAA 3Q7VB 4BENA 2WKIA 2IWDA 3E4PA 4KQRA 5E2EA 4KZ5A 2JN7A 2PAVP 4DDSA 1N4OA 3L9KA 4WM9A 3LYXA 3EEHA 3IS2B 5DTTA 2Z6DA 4ZAMA 5A93A 1K4EA 5A8BA 2OV5A 1PW1A 2XLNA 2Y2KA 3GR2A 1SCWA 4S2LA 5G18A 4YOFA 4D2OA 3KSFA 1T19A 2WAEA 3OPHA 3IF6B 3MKEA 4R3JA 5J4EA 1C3BA 2H10A 2W1TB 3B42A 3PBOA 1KGGA 3PTEA 3IX3A 2PHYA 4Q0IA 3JVVA 3HUMA 1IKGA 5EFWA 4QY5A 2OSUA 2P9VA 3CZDA 4EEPA 4FSFA 4EETB 5DF8A 1ONGA 3FV7A 2EXAA 1ESIA 1OTDA 3IX8A 1S1ZA 4LGWA 4X25A 3C7VA 4JKTA 1XXMA 4R1GA 1MKMA 2CC1A 4GHIA 2Y2MA 1BLSA 3B33A 5CECA 2V1ZA 4P87A 3BQAA 1PZOA 4KZ4A 3L7HA 5FQQA 4IHQA 2ZM0A 1L0EA 3NDGA 4B4XA 2V2FF 3MF0A 2XFTA 3S7PA 1IEMA 1W63M 4X69A 3TG9A 3UMDA 2Q9MA 1MPLA 3EGXC 4BD1A 1GSXA 2JCHA 1BLPA 1YLZA 1VM1A 2ZQAA 3KYQA 4JXSA 5E2GA 2C6WB 4Z1WA 1KDWA 2QHKA 3TJZC 1KOUA 3I7JA 5HL6A 5TFQA 4C6YA 4P0MA 2JKRI 4JGRA 3AGDA 1F2KA 5EECA 1K57A 3QP1A 1ODVA 1XGJA 5CGWA 4Z9QA 3T4TA 1KE4A 1YAXA 1NXYA 5CGXA 4LV2A 3GQZA 1RCJA 2HDRA 2HDSA 4HOIA 1GA9A 1VEUB 4GD8A 2WYXA 3IS2A 1E4DA 1YT4A 3NJAA 4HI4A 2QJ5A 3LI9A 4GHIB 3CMZA 3H82A 5FDHA 1NLYA 4QD4A 5DTSA 4KG5A 3MKFA 2ZQ7A 2Y2NA 4KZAA 2L4RA 5FQIA 3R4KA 3H7WB 2WZZA 4EQIA 2A24B 3BM6A 4WELA 5GLCA 5EUAA 2OLUA 5HAPA 2ZMFA 3C30A 4KZ3A 2ZC3B 3HBRA 4ZJ2A 3CPTB 3ZDJA 1M6KA 2O9BA 3OZHA 4WBGA 3DBAA 1RGYA 3UNWA 2C5WB 4FH4A 3NHQA 5C5KA 1PWCA 5FEFA 1P97A 2XH9A 3IQAA 3O87A 2VZWA 2PT7A 1QMFA 4Y0UA 4KENB 5HDCA 4GS9A 1G6OA 2RCXA 5EVID 5FEGA 2Y59A 5EM0A 1F98A 4NKPA 4FTXA 2HP9A 3A3IA 5GHZA 2FFFB 3MQ0A 2X01A 4YINA 1SZVA 4HEFA 4G3KA 3FG8A 1KE0A 4WUJA 5AVFA 2Z2MB 2ZOHA 1DRMA 1OTEA 3CAXA 5CTMA 3WS5A 3EWKA 4C3QA 2H28A 3DWKA 5AQBA 4K08A 3DAVA 3KSIA 5AJGA 1YSQA 4EBLA 4R38A 3QNCA 1PZPA 1Y4OA 3UB9A 3BLMA 3N6IA 4JF6A 1TEMA 1WE4A 2ZC6B 1P0ZA 5KSHA 5TGFA 1NYYA 1OJGA 4EXOA 2WZXA 2E8JA 1PWDA 4CJNA 3BECA 1MWSA 3T1QB 1Q2PA 5F6AA 4E3OA 1MZUA 2A2LA 3HLBA 1LI0A 2ZJ9A 5L2FA 3P09A 2OLVA 2OOLA 4OONA 3QP5A 1H8MA 2EX8A 2HF6A 3KYZA 3IF5A 4GS9B 4QWOA 2ZL1A 3LR3A 3R7WA 4E3LA 5CERA 2B95A 3KSGA 5HARA 2M1CA 4FOFA 3V39A 4ESPA 3SH7A 3G30A 1T1BA 3LO7A 1XX2A 1BTLA 3Q7VA 4WL9A 4IEDA 5EPHA 1TF1A 3W2ZA 2JC7A 5A91A 2YKHA 2K31A 3C8CA 1FCMA 3BY9A 1V9ZA 4RYEA 1LI9A 4CLCB 3ZFZA 4NEED 3UE1A 2A3UA 1K25A 3IX4A 1L0GA 1W5DA 4X1MA 4Y7PA 2WKHA 1YLPA 3A3JA 5DF7A 4OPQA 1CEGA 3UY6A 3V50A 2ZQ8A 4DN0A 1MC0A 3BQ8A 3VE4A 3MMHA 4Y17A 1S6RA 2DMWA 2B18A 1XJ4A 3T4JA 5HDSA 1K54C 2P7JA 3IWOA 3MSHA 4DE0A 3FKWA 1ZHHB 4JPMA 3PBQA 3ZG9B 3MJQA 5IHVA 4PMAA 3AGEA 3G34A 4OOMA 2X02A 4OQGA 1T1AA 4MNRA 1UWPX 2JKFA 1ZC2A 1GCEA 1SKFA 3Q1FA 5CEDA 5F1FA 1JNUA 3WRTA 1GSVA 1ES4A 1N9BA 3BJNA 2VX8A 1KGFA 5DKLA 5FQMA 3WWXA 1K38A 2Z2LB 1KE3A 2QYBA 3OLOA 4P6ZS 2PYPA 3PXPA 2HJ9C 5I5LA 2CMNA 3NULA 1ZKJA 1YLWA 2VV7A 5HW3A 1O07A 4RX3A 4PM8A 2V1BA 4XXRA 5AQ9A 2R78A 1S4RA 4X55A 2HGVA 1LL8A 4JXGA 1LL5A 2NUTC 3H82B 2HV1A 4QPRA 3IWIA 4I5SA 4E6WA 2RL3A 4L9GA 2WUQA 2K7SA 3GMWA 1LHYA 4UAAA 3FPVA 5F1GA 5FQJA 4Y13A 3TW8A 1K54A 1LSXA 1X0OA 4E3MA 3VSLA 3UE0A 3M2JA 4BL3A 2G2UA 1G68A 2QWSA 2QKPA 2UV0E 3HUOA 4O7DA 4QY6A 3CI6A 1IYQA 4C75A 1BLCA 1TDGA 5G4ZA 3JVUA 2GNXA 3ZVWA 4AFIA 5M1AA 1CQAA 2I9VA 5F82A 4KQQA 4NXEA 3IBJA 4EEUA 1P9RA 2XSSA 2VA0A 2PRFA 3IH8A 1JWPA 4GCZA 4LFUA 3B3XA 3PBRA 1AWIA 3K3CA 4O0PA 3IT9A 3S7NA 1W7FA 1H5XA 1FCNA 3IWQA 4K0WA 1W79A 4NXBA 4XUZA 3Q07A 3O86A 4EERA 4S2NA 4OPRA 4OKPA 3OPPA 3NY4A 3LCEA 4LRXC 2V0WA 3ZGAB 2EFXA 1YLYA 5F83A 3A3FA 3D9YA 4N1HA 2W0NA 5EVEA 3PYPA 1OPXA 4ARZB 5CX7A 2XD5A 3T4OA 1FCOA 4M3KA 4RX2A 3DW0A 5FAOA 4GDNA 3K3DA 5EVIB 4PM6A 3SZTA 3D4FA 3RH8B 1H3QA 1IELA 3UB7A 4WMCD 4MDZA 5L10A 1PWGA 5M18A 5E2HA 4UEYA 3DTMA 2ZOIA 3A3EA 5EV0A 4OOYA 2KOIA 4N9KA 2H0TA 5HSQA 2O9CA 1PI4A 4UQIS 1UWNX 2D01A 3C5AA 3NC8A 5FA7A 2Y2IA 2O0YA 1XFNA 1PW8A 3N4IA 3T50A 3AGFA 5FSRA 4LV3A 1M40A 3UN7A 1D7EA 2R9XA 1S1YA 4OQ0A 3O88A 4HBUA 1WA9A 1BSGA 1L0DA 3FZCA 3BWLA 5HAQA 3M6HA 2WADA 2BTFP 1TS6A 1G28A 1SHVA 1GSWA 2JKGA 4DRTA 2Y2PA 2ZC5B 4UHUA 4I38A 5GLBA 3VFHA 1NLZA 4S2PA 4GN2A 4DE3A 4Q8IA 2KDKA 4HIAA 5GHXA 4WZ5A 3MZEA 4FCFA 3LY4A 4MLLA 4JBFA 1OTBA 3CUEA 2BLSA 4X68A 1LT0A 2X71A 5MC7A 1KGEA 5D3OA 3Q81A 4HESA 1HTZA 4ID4A 1VHMA 5KZHA 4N9LA 3VE3A 4GB7A 4O8GA 2R9WA 2B5RA 2DNSA 2UWXA 2GDNA 1J3WA 4WYYA 3EGDC 1YLTA 3IHAA 4HQAA 4WEKA 5EVIC 3LY3A 1XKZA 4P6ZM 4BQMA 5F5YA 1WYCA 4FD8A 3MZDA 2V1AA 4CLCA 4ZRRA 1Z09A 5DFXA 1U60A 3T1XA 5EVLA 2GJ3A 2PR5A 3CWFA 4H8RA 3A0SA 2PYRA 1ACFA 4NK3A 3OPRA 4OP8A 4JGPA 5FAQA 2I72A 2ZD8A 4M4XA 2EFUA 4JGOA 1TS8A 4FUWA 2P04A 3S7QA 2HDQA 2W3GA 5E2FA 4F94A 1Y28A 4E3NA 1FR1A 3FPWA 3Q7ZA 5HWVA 2Y2GA 1ES5A 4UA7A 3G4PA 4RA7A 3ZHHA 1GA0A 5FQ9A 4WN5A 4HH2A 4PM7A 4BJPA 3HLWA 4OOLA 4F3LA 4GJ4A 4JGQA 3GRJA 3A0VA 4E6XA 3JYIA 4WEJA 3VP1A 1CEFA 4EUZA 4ARZA 3ZVTA 3TE8A 3CJMA 4BLMA 4KZ6A 1BT5A 4OP5A 3Q82A 3LUQA 2Z6CA 2PD8A 1FSWA 3GDIA 4JF4A 1UGUA
chains in the Genus database with same CATH topology
2M7VA 2PD7A 5HPIA 4DN0A 1MC0A 3BQ8A 4NXFA 3VE4A 2J3WA 3MMHA 1LSVA 2YKFA 4IUHA 1DP6A 2W27A 2DMWA 2B18A 1XJ4A 3T4JA 2VJWA 4HHDA 3OCNA 5DFYA 2FZ0A 2P7JA 3E4OA 5HDSA 3T4LA 2W3FA 2WKPA 3CITA 4EQ1A 5TJJA 1ZHHB 3PBQA 3F1PB 3F1PA 3ICYA 3MJQA 1NRJA 4MMNA 3P7NA 1S4SA 3LIFA 4KUKA 1IFQA 4OOMA 3SW1A 1T1AA 1UWPX 1N9LA 4CLCC 3E4PA 3E0YA 4LRYC 3LIEA 4LLOB 2K2NA 1OTAA 2JN7A 4MN5A 3OC2A 2KLIA 2OAP1 1JNUA 2XA7M 4GLQA 1YSPA 3RTYA 1GSVA 3LYXA 1TS7A 3EEHA 3F1OA 3BJNA 3IS2B 5HWTA 2Z6DA 2VX8A 2BASA 5A8BA 5DKLA 4L0LA 3NOUC 3OLOA 2QYBA 4P6ZS 4YOFA 5G4YA 1OTIA 2PYPA 1T19A 3KSFA 3PXPA 4L9EA 2GZAA 2HJ9C 5I5LA 3T4QA 2CMNA 1TS0A 2VV7A 4LRZE 2JKTM 2IA2A 2V1BA 2R78A 1S4RA 5J4EA 4EUVA 2P08A 2HGVA 1LL8A 2W1TB 4XT2B 1XFQA 3VOLA 2L0WA 5IU1A 3B42A 3PBOA 4Y3IA 4DMZA 3MXQA 4CQHA 4MN7A 3OOVA 2NUTC 2PHYA 5TBMB 4R3AA 4BBVA 2NUPC 4Q0IA 3H82B 2HV1A 3JVVA 4QPRA 4I5SA 4BWIA 4L9GA 5EFWA 3PBNA 2K7SA 3U2AA 4EEPA 3EEAA 4FSFA 3KO6A 3FPVA 4EETB 3TW8A 3HJKA 4BBUA 3HCYA 4F3LB 1LSXA 1X0OA 2INWA 2W3HA 3LR5A 1OTDA 1S1ZA 4MN6A 3S7OA 5IT5A 1T18A 2QWSA 2QKPA 3E98A 1MKMA 4GHIA 3MFXA 4WF0A 4Y2FA 5DJUA 3D72A 3CI6A 3B33A 2QJ7A 3BQAA 3R7WB 3ULFA 5G4ZA 3JVUA 3F1NA 4IHQA 2GNXA 4AFIA 2O99A 3MF0A 4CLCD 2VGLM 3TRCA 1W63Q 2I9VA 4EW7A 3S7PA 2A24A 2OAQ1 3IBJA 4NXEA 2W1RA 1W63M 4EEUA 3PR6A 4NXGA 3UMDA 1P9RA 2XSSA 2VA0A 4HJ4A 4GCZA 3ZYTA 3D3OA 3EGXC 2Y79A 4H6JB 1GSXA 1XJ6A 3PBRA 3K3CA 4O0PA 3S7NA 3H9WA 2WKQA 3KYQA 4Z1WA 2QHKA 3LIAA 3TJZC 1KOUA 4NXBA 4B93A 5HL6A 3NOTC 4ME4A 2D02A 3EOIA 4RQ9A 4EERA 3PHYA 2JKRI 4UQIM 4JGRA 4KQDA 2EA9A 4LRXC 4DJ3A 4Q0HA 2V0WA 1ODVA 3T4TA 2W0NA 4HJ6A 1YAXA 3PYPA 1OPXA 2HJEA 5CX7A 2FH5A 4ARZB 3T4OA 4HOIA 4II7A 1NWZA 3ZQ5A 3CUEC 3F1OB 3K3DA 4I3AA 4IUKA 3IS2A 5IS1A 5F69A 1ZTUA 3NJAA 4HI4A 2QJ5A 2JHEA 3LI9A 3RH8B 1H3QA 4GHIB 2V9AA 2O9AA 3UB7A 2J3TD 4MDZA 3MQQA 4HP9A 3H82A 5K5BA 1NLYA 4UEYA 2ZOIA 4LPZA 5J7EA 4ETXA 2KOIA 3HJIA 3PBTA 5HWWA 2L4RA 5HSQA 3R4KA 4BBTA 1BYWA 2O9CA 3H7WB 4PAUA 4UQIS 1UWNX 3EQVA 1N9OA 2A24B 4WELA 1STZA 2D01A 3A0RA 2LB9A 2XROA 2O0YA 1XFNA 3F1NB 4PKYG 2EWWA 4EU0A 5FL3A 3T50A 2ZMFA 3C30A 4IJGA 1D7EA 2VKSA 3T4SA 1S1YA 3PBSA 4YNRA 3UMEA 1IOUA 1D06A 1WA9A 2O9BA 3LR4A 5DJTA 5AVEA 1VB6A 3DBAA 2VV6A 2W3DA 2VGLS 2VV8A 3G6OA 3BWLA 5KIZA 3NHQA 2GX5A 4O01A 4Q0JA 1TS6A 4R70A 3KSHA 1G28A 2KX6A 5C5KA 5L8MA 3RFBA 5HD5A 1DP8A 1GSWA 2WKRA 1F5MA 3BW6A 1P97A 1XJ3A 2VZWA 2PT7A 4I38A 2LB5A 3LR0A 1NLZA 4CLCE 5HDCA 3UB8A 4GS9A 2VLGA 1G6OA 3UE6A 1T1CA 4I3JA 3UE3A 2KDKA 4G3WA 4HIAA 4KQOA 1F98A 2W1TA 4NKPA 3EQUA 4L9FA 4E04A 3MR0A 4H6JA 4WLAA 1OTBA 3CUEA 1LT0A 2JKTI 5MC7A 3P01A 3MQ0A 3BY8A 2J3TC 4HP4A 3B47A 4ETZA 4KUOA 3K2NA 4G3KA 3FG8A 3H7WA 1YKDA 2XRNA 1VHMA 4WUJA 5AVFA 1P9WA 2ZOHA 3OCLA 2M7UA 1DRMA 4HH3A 4PHTA 4PKYA 1OTEA 3CAXA 3T4KA 4BMWA 1N9NA 3IBRA 3VE3A 4O8GA 2W3EA 3EWKA 2H28A 5HDDA 4K08A 3KSIA 5AJGA 1YSQA 3C2WA 4R38A 3LIDA 3LIBA 3EGDC 1F9IA 2G7UA 4HNBA 3UB9A 1OJ5A 3E4QA 4HQAA 1P0ZA 5KSHA 4WEKA 1OJGA 4EXOA 4P6ZM 5F5YA 3C38A 4DJ2A 2V1AA 1S66L 4CLCA 4ZRRA 5F6AA 5DFXA 3VV4A 1MZUA 2A2LA 2Y8HA 3O5YA 2GJ3A 1OT9A 2PR5A 3CWFA 5HZHA 2OOLA 3KX0X 3A0SA 3GECA 3LI8A 3FC7A 2PYRA 2XA7S 4R6LA 1H8MA 4JGPA 1DP9A 2HF6A 3KYZA 3OBFA 2J80A 4GS9B 3LR3A 4B9OA 3R7WA 4M4XA 2PDRA 3KSGA 4JGOA 4Y5FA 2EWVA 2M1CA 1TS8A 4FOFA 5HPFA 2P04A 3S7QA 3UB6A 2W3GA 5DKKA 1Y28A 4EESA 1T1BA 3FPWA 3V67A 4HY8A 5HWVA 1LSWA 4WL9A 1OT6A 1XJ2A 1TF1A 3W2ZA 2OWJA 4G3VA 2JKRM 1S67L 4WN5A 4HJ3A 2L1MA 4HH2A 2YKHA 2ZBBA 2K31A 3LICA 4MCWA 4XT2A 4BJPA 4GW9A 3CLOA 3C8CA 3BY9A 3MQOA 1V9ZA 4OOLA 4F3LA 3NOPC 4GJ4A 5F68A 4CLCB 4JGQA 3A0VA 5HD3A 4NEED 2MJ6A 4I39A 1V9YA 4WEJA 2PR6A 4YWZA 2VEAA 4ARZA 5DF9A 3TE8A 2OWHA 5J3WA 2ZMVA 5TBMA 1EW0A 4I3IA 2V0UA 5LBRA 3LFVA 2B02A 3LUQA 2Z6CA 2PD8A 3GDIA 1TD5A 1UGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2W A;  2PD7 A;  4R38 A;  3LID A;  3LIB A;  1F9I A;  3HJI A;  5HWW A;  1LSX A;  2L4R A;  4HNB A;  1X0O A;  2INW A;  4NXF A;  1OJ5 A;  3UB9 A;  4BBT A;  1BYW A;  3H7W B;  3E4Q A;  3VE4 A;  5HSQ A;  4HQA A;  1OTD A;  1P0Z A;  1UWN X;  1N9O A;  1OJG A;  1S1Z A;  4MN6 A;  4EXO A;  1LSV A;  2A24 B;  2YKF A;  1DP6 A;  2W27 A;  2D01 A;  1T18 A;  2QWS A;  3A0R A;  5F5Y A;  1XJ4 A;  4DJ2 A;  4HHD A;  2QKP A;  5HDS A;  2P7J A;  3E4O A;  5G4Z A;  2V1A A;  1S66 L;  2WKP A;  4F3L B;  4GHI A;  1XFN A;  4EQ1 A;  3F1N B;  3MFX A;  4PKY G;  4WF0 A;  5F6A A;  5DJU A;  3D72 A;  3F1P B;  3F1P A;  3B33 A;  1MZU A;  3ICY A;  3MJQ A;  3T50 A;  2QJ7 A;  2GJ3 A;  1OT9 A;  2PR5 A;  3CWF A;  5HZH A;  2OOL A;  3P7N A;  1S4S A;  3ULF A;  3KX0 X;  1D7E A;  3A0S A;  3GEC A;  3F1N A;  3LI8 A;  3LIF A;  1T1A A;  3FC7 A;  4KUK A;  3SW1 A;  2PYR A;  1S1Y A;  1UWP X;  1N9L A;  3E4P A;  4LRY C;  3UME A;  3LIE A;  4R6L A;  4LLO B;  1OTA A;  4JGP A;  1DP9 A;  2I9V A;  1WA9 A;  1D06 A;  5DJT A;  2JN7 A;  2J80 A;  4EW7 A;  5AVE A;  1VB6 A;  4MN5 A;  2A24 A;  4GS9 B;  4NXE A;  2VV6 A;  4EEU A;  4NXG A;  4B9O A;  3G6O A;  3UMD A;  2VV8 A;  4M4X A;  1JNU A;  2PDR A;  3BWL A;  5KIZ A;  4HJ4 A;  4GCZ A;  4JGO A;  3RTY A;  3NHQ A;  1GSV A;  2M1C A;  3LYX A;  1TS7 A;  1TS8 A;  1TS6 A;  3EEH A;  3F1O A;  4H6J B;  1GSX A;  1XJ6 A;  4R70 A;  1G28 A;  2KX6 A;  3K3C A;  3UB6 A;  3IS2 B;  5HWT A;  5DKK A;  1Y28 A;  5HD5 A;  1DP8 A;  1GSW A;  2Z6D A;  4EES A;  3H9W A;  2BAS A;  2WKR A;  1T1B A;  2WKQ A;  5A8B A;  5DKL A;  1P97 A;  3NOU C;  4HY8 A;  1XJ3 A;  5HWV A;  1LSW A;  2QHK A;  3LIA A;  4WL9 A;  4I38 A;  1OT6 A;  1KOU A;  3OLO A;  4NXB A;  1XJ2 A;  3NOT C;  5HDC A;  3UB8 A;  4GS9 A;  2D02 A;  2VLG A;  1OTI A;  5G4Y A;  4RQ9 A;  3UE6 A;  4EER A;  1T1C A;  1T19 A;  2OWJ A;  2PYP A;  3PHY A;  4I3J A;  4L9E A;  2KDK A;  4JGR A;  4KQD A;  4HIA A;  5I5L A;  1S67 L;  2EA9 A;  2CMN A;  4LRX C;  4DJ3 A;  2V0W A;  4WN5 A;  1F98 A;  2L1M A;  4HJ3 A;  4L9F A;  1TS0 A;  4HH2 A;  4E04 A;  2VV7 A;  2YKH A;  1ODV A;  2ZBB A;  3MR0 A;  4H6J A;  4LRZ E;  4WLA A;  1OTB A;  3LIC A;  4XT2 A;  2W0N A;  4GW9 A;  1LT0 A;  3CLO A;  4HJ6 A;  2V1B A;  3C8C A;  3PYP A;  2R78 A;  1S4R A;  3BY9 A;  3MQO A;  5J4E A;  1V9Z A;  4F3L A;  3BY8 A;  3NOP C;  1LL8 A;  4HP4 A;  5F68 A;  4JGQ A;  4XT2 B;  1XFQ A;  4HOI A;  2L0W A;  3A0V A;  1NWZ A;  4KUO A;  5HD3 A;  5IU1 A;  3VOL A;  3MXQ A;  3FG8 A;  3ZQ5 A;  3F1O B;  3H7W A;  2PHY A;  3K3D A;  5TBM B;  4I3A A;  4R3A A;  3IS2 A;  4I39 A;  1V9Y A;  4BBV A;  2PR6 A;  4WUJ A;  3H82 B;  2HV1 A;  2ZOH A;  3NJA A;  5F69 A;  5AVF A;  4YWZ A;  2VEA A;  4HI4 A;  1DRM A;  4HH3 A;  4I5S A;  2QJ5 A;  4L9G A;  4PKY A;  1OTE A;  5EFW A;  3CAX A;  2JHE A;  5IS1 A;  3LI9 A;  3RH8 B;  4GHI B;  2OWH A;  1N9N A;  2V9A A;  3IBR A;  2K7S A;  5J3W A;  3UB7 A;  5TBM A;  1EW0 A;  3MQQ A;  3VE3 A;  4EEP A;  4HP9 A;  3EWK A;  2H28 A;  2V0U A;  3H82 A;  4I3I A;  5HDD A;  4EET B;  2B02 A;  3LUQ A;  4K08 A;  2Z6C A;  2PD8 A;  2ZOI A;  3GDI A;  3HJK A;  4BBU A;  4LPZ A;  5J7E A;  1UGU A; 
#chains in the Genus database with same CATH topology
 5FI7 A;  2P9V B;  2M7V A;  1VET B;  3P98 A;  2J3W A;  2HP6 A;  4IUH A;  3W4P A;  2W27 A;  3HLF A;  3T4L A;  2VJW A;  4HHD A;  3E4O A;  4IVK A;  3CIT A;  3RJU A;  1BLH A;  3F1P A;  1NRJ A;  4MMN A;  3QP6 A;  3HUN A;  4ZBE A;  4U0T A;  4KUK A;  1IFQ A;  3SW1 A;  1N9L A;  4EBP A;  4LRY C;  4LLO B;  2K2N A;  1OTA A;  4MBK A;  2XD1 A;  3V3S A;  4MN5 A;  2KLI A;  4CPK A;  3BFG A;  4GLQ A;  3MXR A;  4UA6 A;  5EE8 A;  4KZB A;  1TS7 A;  1FIL A;  3F1O A;  1W8Y A;  5HWT A;  2BAS A;  4PM9 A;  5A90 A;  4L0L A;  4FH2 A;  4NG2 A;  4QHC A;  5G4Y A;  4L9E A;  4LV0 A;  2GZA A;  4EWF A;  3T4Q A;  1K55 C;  4Y0T A;  4KG6 A;  4LRZ E;  2HDU A;  3HL9 A;  2IA2 A;  5M19 A;  4ZJ1 A;  1YLJ A;  3UPP A;  1ES2 A;  2P08 A;  1PNE A;  1K56 A;  1SDN A;  2L0W A;  4Y3I A;  5FAS A;  3OOV A;  5TBM B;  4DF6 A;  4R3A A;  2NUP C;  4BWI A;  1E3U D;  1KVL A;  1HZO A;  3T1R A;  3U2A A;  3EEA A;  3QP8 A;  3WS1 A;  3KO6 A;  3HJK A;  4JF5 A;  1JTD A;  1AXB A;  2INW A;  2W3H A;  4MN6 A;  3S7O A;  1ES3 A;  1T18 A;  3NCK A;  1I2S A;  4WF0 A;  3BRM A;  4GNU A;  2QJ7 A;  3RXW A;  5FDS A;  3A3D A;  3F1N A;  3MFD A;  2JBF A;  2O99 A;  5U47 A;  4CLC D;  2Y2Q A;  1GHP A;  3TRC A;  3U4L P;  2WGI A;  4P85 A;  2OAQ 1;  2XQZ A;  2W1R A;  2HZ5 A;  3N7W A;  4NXG A;  4OH0 A;  5EM1 A;  3VP0 A;  4MBH A;  4PM5 A;  1FOF A;  3SOI A;  4HJ4 A;  3ZYT A;  3BLS A;  1ONH A;  3D3O A;  5CXW A;  3UDI A;  1A0K A;  2Y79 A;  1XJ6 A;  2QZ6 A;  1NY0 A;  1JVJ A;  3S22 A;  3H9W A;  1XGI A;  3NIA A;  2FFY A;  3LIA A;  3W4Q A;  3HLG A;  3BFE A;  3NOT C;  4RQ9 A;  2EX2 A;  2QPN A;  3CHW P;  4DJ3 A;  2XK1 A;  4OPZ A;  4OLG A;  4HJ6 A;  5L07 A;  3E2K A;  2HJE A;  2FH5 A;  5EOO A;  2QMI A;  3ZCZ A;  4OQI A;  1NWZ A;  4KZ8 A;  3CPT A;  3CUE C;  3ZQ5 A;  4IUK A;  4MBF A;  5F69 A;  1ZTU A;  3NEC A;  3FWL A;  1PRQ A;  2JHE A;  4HP9 A;  5K5B A;  3PAG A;  3SS3 A;  5CHJ A;  4P6B A;  4WZ4 A;  1GHM A;  4A5R A;  3HJI A;  5HWW A;  1O7E A;  4R4R A;  4X1L A;  1BYW A;  2IWC A;  3EQV A;  2J9O A;  3A0R A;  3UO9 A;  5DTK A;  2LB9 A;  2XRO A;  5KSC A;  2EWW A;  4EU0 A;  2XF3 A;  3ZG7 B;  1XA7 A;  1Y54 A;  2VKS A;  3T4S A;  5AQA A;  4U0X A;  3BFF A;  3PBS A;  3UME A;  3G35 A;  1D06 A;  3LR4 A;  3RXX A;  1VB6 A;  3G6O A;  2GX5 A;  2XFS A;  4O01 A;  4R70 A;  3KSH A;  4OLD A;  2KX6 A;  1JTG A;  3RFB A;  5HD5 A;  1F5M A;  3WS2 A;  2LB5 A;  3MS6 A;  5GL9 A;  4WMC A;  3FKV A;  4CLC E;  3ITA A;  2ZL1 B;  3SH9 A;  4ZTK A;  4G3W A;  3VSK A;  3UPN A;  1XPB A;  3G2Y A;  4KQO A;  3EQU A;  4L9F A;  3SS5 A;  3MR0 A;  1SKO B;  2JKT I;  3ZG8 B;  3B47 A;  4KUO A;  3K2N A;  3VP4 A;  3H7W A;  1YKD A;  3O3V A;  1P9W A;  2M7U A;  4HH3 A;  2ZC4 B;  4PHT A;  3T4K A;  4BMW A;  3IBR A;  4U3T A;  2W3E A;  5HDD A;  3VOY A;  3GSG A;  3IXG A;  3LID A;  1E3U A;  1RP5 A;  4HNB A;  2ZM8 A;  1IYO A;  1I5Q A;  5AQ7 A;  4JLF A;  1Q2Q A;  1MKI A;  4KZ7 A;  3GTC A;  3C38 A;  3NBL A;  4DJ2 A;  1PFL A;  1IYP A;  1FSY A;  4R3B A;  4WZ5 C;  1J9M A;  5J8X A;  3O5Y A;  4S2J A;  3NDE A;  5HZH A;  3KX0 X;  3LI8 A;  3QNB A;  2JE5 A;  2PBD P;  3MBZ A;  3IXB A;  3HRE A;  4X56 A;  3OBF A;  2VGK A;  3T12 B;  4IBX A;  3UDF A;  3S1Y A;  4B9O A;  1W8Q A;  3OPL A;  4Y5F A;  5HPF A;  1LL9 A;  4K0X A;  1YM1 A;  3M6B A;  3T1S A;  3SH8 A;  1LSW A;  1CF0 A;  2HP5 A;  5JYP A;  3TOI A;  2ZBB A;  2XDM A;  2ZLY A;  4XT2 A;  4GW9 A;  3CLO A;  3ITB A;  5HX9 A;  3NOP C;  5HD3 A;  1VEU A;  2MJ6 A;  2H0Y A;  4R4S A;  4Y15 A;  4I39 A;  2PR6 A;  1PIO A;  3N8L A;  4N1X A;  2VEA A;  5KMW A;  5DF9 A;  3WRZ A;  2ZMV A;  5TBM A;  3MZF A;  3QHY A;  4I3I A;  3PAE A;  4E3K A;  1TD5 A;  4IBR A;  3N8R A;  1BUL A;  3HLE A;  4E3J A;  1XA1 A;  3VP2 A;  2YKF A;  1DP6 A;  4E3I A;  4Y0O A;  2G2W A;  3W4O A;  2W3F A;  2WKP A;  4QB8 A;  1WYB A;  3WS4 A;  4DE2 A;  5BOH A;  1NZO A;  1PI5 A;  3P7N A;  1YQS A;  3LIF A;  3V5M A;  4LV1 A;  4KG2 A;  5FAT A;  4CLC C;  3E0Y A;  3IF6 C;  3LIE A;  4QJG A;  4K91 A;  3OC2 A;  2XEP A;  1RGZ A;  1EI5 A;  1ERQ A;  2OAP 1;  3BYD A;  4BL2 A;  3CG5 A;  2XA7 M;  1YSP A;  3RTY A;  1LLB A;  1NZU A;  4OPY A;  1XP4 A;  3BFD A;  3IHB A;  4S2N C;  3NOU C;  4DKI A;  2DRW A;  2AVX A;  2Y2J A;  1ZG4 A;  1VQQ A;  3G32 A;  2Y55 A;  1OTI A;  1FR6 A;  1NJ4 A;  2Y2H A;  2WGV A;  2WAF A;  1TS0 A;  1D1J A;  2JKT M;  2VGJ A;  3W8K A;  4EUV A;  3ZNY A;  4XT2 B;  1XFQ A;  3VOL A;  5IU1 A;  4DMZ A;  3MXQ A;  4CQH A;  4MN7 A;  4BBV A;  3C7U A;  1ERM A;  4DXC A;  1FIK A;  2XGN A;  3PBN A;  5FI2 A;  4RVA A;  3BEB A;  4BBU A;  3HCY A;  1ERO A;  4F3L B;  3DWZ A;  1L0F A;  2EX6 A;  3LR5 A;  4JXV A;  3IXD A;  1KVM A;  5IT5 A;  1PYY A;  4YFM A;  3E98 A;  3LEZ A;  1K6R A;  1K57 C;  5CGS A;  3MFX A;  4Y2F A;  5DJU A;  3D72 A;  2Y4A A;  3WS0 A;  3VOZ A;  3R7W B;  3ULF A;  3UPO A;  3LEQ A;  1H8Z A;  3JPU A;  2ZQ9 A;  4OVD A;  4DDY A;  4R23 A;  3UB5 P;  2VGL M;  1W63 Q;  4EW7 A;  2A24 A;  3PR6 A;  1DY6 A;  1ESU A;  1K56 D;  1NYM A;  3C4P A;  1L2S A;  4H6J B;  1CK3 A;  1HLU P;  3MXS A;  2WKQ A;  2ACG A;  2P74 A;  4B93 A;  4XUX A;  2DCF A;  1I2W A;  2XR0 A;  4ME4 A;  1DJA A;  2D02 A;  3EOI A;  3PHY A;  4UQI M;  5GHY A;  1HD8 A;  4KQD A;  1MWT A;  2EA9 A;  4Q0H A;  4GOG A;  1BZA A;  1H8Y A;  2J7V A;  4II7 A;  3F1O B;  4I3A A;  1QME A;  5IS1 A;  1MWU A;  3FYZ A;  4LEN A;  2V9A A;  2O9A A;  1NRF A;  2J3T D;  3MQQ A;  1MWR A;  3G2Z A;  5EVI A;  3QP4 A;  4LPZ A;  5FQK A;  5J7E A;  3NI9 A;  4ETX A;  3BFC A;  3PBT A;  1EWZ A;  2J8Y A;  4BBT A;  3UDX A;  3G31 A;  4PAU A;  1N9O A;  4DE1 A;  1STZ A;  1L3L A;  3E2L A;  5FI6 A;  1K55 A;  3F1N B;  4PKY G;  4ZJ3 A;  5FL3 A;  1VET A;  5HFO A;  2Y2L A;  3KYE A;  4X53 A;  1SKO A;  3LGO A;  2WK0 A;  1MXO A;  5TR7 A;  1E25 A;  4YNR A;  1IOU A;  5DJT A;  1YMX A;  3ISG A;  4GZB A;  5AVE A;  4GKU A;  2VV6 A;  3QP2 A;  5CEB A;  2W3D A;  2VGL S;  2VV8 A;  5KIZ A;  3IH9 A;  2V8C A;  4Q0J A;  3VMA A;  1IYS A;  2J9P A;  4DXB A;  5L8M A;  1DP8 A;  4MEZ A;  2WKR A;  3BW6 A;  1XJ3 A;  3DTK A;  1JWZ A;  2HPB A;  4NET A;  3LR0 A;  2Y91 A;  3UB8 A;  1K4F A;  2VLG A;  3UE6 A;  1T1C A;  4I3J A;  3UE3 A;  2PBY A;  5E43 A;  1CJF A;  3C4O A;  2W1T A;  4N92 A;  5CTN A;  1HVB A;  4B4Z A;  4E04 A;  4H6J A;  4WLA A;  5FAP A;  2ZQD A;  3P01 A;  2A49 A;  4KZ9 A;  3M2K A;  3BY8 A;  2J3T C;  4HP4 A;  3VFF A;  4ETZ A;  2ZM2 A;  5CHM A;  4S2K A;  2XRN A;  5GLA A;  3OCL A;  4B88 A;  5A92 A;  4PKY A;  2Q9N A;  1N9N A;  1JWV A;  2VK3 A;  5CHU A;  1FQG A;  5EOE A;  3C2W A;  3N8S A;  3LIB A;  4S2O A;  1F9I A;  2G7U A;  1OJ5 A;  3E4Q A;  2ZMA A;  3TSG A;  2E8I A;  4IVI A;  4BD0 A;  1S66 L;  4GDB A;  3DTE A;  4LCM A;  2BG1 A;  2IWB A;  3IXH A;  3VV4 A;  1DJB A;  2Y8H A;  1MY8 A;  1OT9 A;  2EX9 A;  3DTI A;  3ZG0 A;  3GEC A;  3FC7 A;  2XA7 S;  4GD6 A;  4R6L A;  4PPR A;  1YPR A;  1DP9 A;  2WKE A;  2J80 A;  2ZQC A;  1Z6F A;  2WGW B;  3V3R A;  5HAI A;  1H0M A;  2PDR A;  5I94 A;  2EWV A;  3IF6 A;  2PU4 A;  4OQH A;  1G6A A;  3HLD A;  3GV9 A;  4QU3 A;  3UB6 A;  5DKK A;  1S0W A;  2ZC7 A;  4EES A;  3VP3 A;  1TDL A;  3S4X A;  3V67 A;  4HY8 A;  1ALQ A;  1OT6 A;  1BUE A;  2EXB A;  4EBN A;  1XJ2 A;  4HBT A;  2OWJ A;  4G3V A;  1ZG6 A;  3ZNT A;  1TVF A;  2JKR M;  1S67 L;  4HJ3 A;  2L1M A;  1SDE A;  3LIC A;  4MCW A;  4R0Q A;  3MQO A;  1IKI A;  1KDS A;  1YMS A;  5F68 A;  5L09 A;  1GHI A;  4S2M A;  4LCL A;  1K6S A;  1OME A;  1V9Y A;  4YWZ A;  3HVF A;  5JYO A;  2OWH A;  2V20 A;  5J3W A;  4EV4 A;  1EW0 A;  1MBL A;  2V0U A;  4ZDX A;  5GLD A;  3LFV A;  5LBR A;  2B02 A;  4UA9 A;  5CRF A;  2Y2O A;  4IJG A;  4JXW A;  2PD7 A;  5HPI A;  2H5S A;  4NXF A;  1G5U A;  2PU2 A;  1LSV A;  2WGW A;  2Q0O A;  3OCN A;  5DFY A;  2FZ0 A;  2V8F A;  3SS4 A;  4EQ1 A;  5TJJ A;  4S2I A;  4X6T A;  3F1P B;  5HL1 A;  3ICY A;  3GVB A;  3HLC A;  1CI9 A;  4D60 A;  1K0K A;  1DJC A;  1S4S A;  1CI8 A;  3ZG5 A;  5DVA A;  3Q7V B;  4BEN A;  2WKI A;  2IWD A;  3E4P A;  4KQR A;  5E2E A;  4KZ5 A;  2JN7 A;  2PAV P;  4DDS A;  1N4O A;  3L9K A;  4WM9 A;  3LYX A;  3EEH A;  3IS2 B;  5DTT A;  2Z6D A;  4ZAM A;  5A93 A;  1K4E A;  5A8B A;  2OV5 A;  1PW1 A;  2XLN A;  2Y2K A;  3GR2 A;  1SCW A;  4S2L A;  5G18 A;  4YOF A;  4D2O A;  3KSF A;  1T19 A;  2WAE A;  3OPH A;  3IF6 B;  3MKE A;  4R3J A;  5J4E A;  1C3B A;  2H10 A;  2W1T B;  3B42 A;  3PBO A;  1KGG A;  3PTE A;  3IX3 A;  2PHY A;  4Q0I A;  3JVV A;  3HUM A;  1IKG A;  5EFW A;  4QY5 A;  2OSU A;  2P9V A;  3CZD A;  4EEP A;  4FSF A;  4EET B;  5DF8 A;  1ONG A;  3FV7 A;  2EXA A;  1ESI A;  1OTD A;  3IX8 A;  1S1Z A;  4LGW A;  4X25 A;  3C7V A;  4JKT A;  1XXM A;  4R1G A;  1MKM A;  2CC1 A;  4GHI A;  2Y2M A;  1BLS A;  3B33 A;  5CEC A;  2V1Z A;  4P87 A;  3BQA A;  1PZO A;  4KZ4 A;  3L7H A;  5FQQ A;  4IHQ A;  2ZM0 A;  1L0E A;  3NDG A;  4B4X A;  2V2F F;  3MF0 A;  2XFT A;  3S7P A;  1IEM A;  1W63 M;  4X69 A;  3TG9 A;  3UMD A;  2Q9M A;  1MPL A;  3EGX C;  4BD1 A;  1GSX A;  2JCH A;  1BLP A;  1YLZ A;  1VM1 A;  2ZQA A;  3KYQ A;  4JXS A;  5E2G A;  2C6W B;  4Z1W A;  1KDW A;  2QHK A;  3TJZ C;  1KOU A;  3I7J A;  5HL6 A;  5TFQ A;  4C6Y A;  4P0M A;  2JKR I;  4JGR A;  3AGD A;  1F2K A;  5EEC A;  1K57 A;  3QP1 A;  1ODV A;  1XGJ A;  5CGW A;  4Z9Q A;  3T4T A;  1KE4 A;  1YAX A;  1NXY A;  5CGX A;  4LV2 A;  3GQZ A;  1RCJ A;  2HDR A;  2HDS A;  4HOI A;  1GA9 A;  1VEU B;  4GD8 A;  2WYX A;  3IS2 A;  1E4D A;  1YT4 A;  3NJA A;  4HI4 A;  2QJ5 A;  3LI9 A;  4GHI B;  3CMZ A;  3H82 A;  5FDH A;  1NLY A;  4QD4 A;  5DTS A;  4KG5 A;  3MKF A;  2ZQ7 A;  2Y2N A;  4KZA A;  2L4R A;  5FQI A;  3R4K A;  3H7W B;  2WZZ A;  4EQI A;  2A24 B;  3BM6 A;  4WEL A;  5GLC A;  5EUA A;  2OLU A;  5HAP A;  2ZMF A;  3C30 A;  4KZ3 A;  2ZC3 B;  3HBR A;  4ZJ2 A;  3CPT B;  3ZDJ A;  1M6K A;  2O9B A;  3OZH A;  4WBG A;  3DBA A;  1RGY A;  3UNW A;  2C5W B;  4FH4 A;  3NHQ A;  5C5K A;  1PWC A;  5FEF A;  1P97 A;  2XH9 A;  3IQA A;  3O87 A;  2VZW A;  2PT7 A;  1QMF A;  4Y0U A;  4KEN B;  5HDC A;  4GS9 A;  1G6O A;  2RCX A;  5EVI D;  5FEG A;  2Y59 A;  5EM0 A;  1F98 A;  4NKP A;  4FTX A;  2HP9 A;  3A3I A;  5GHZ A;  2FFF B;  3MQ0 A;  2X01 A;  4YIN A;  1SZV A;  4HEF A;  4G3K A;  3FG8 A;  1KE0 A;  4WUJ A;  5AVF A;  2Z2M B;  2ZOH A;  1DRM A;  1OTE A;  3CAX A;  5CTM A;  3WS5 A;  3EWK A;  4C3Q A;  2H28 A;  3DWK A;  5AQB A;  4K08 A;  3DAV A;  3KSI A;  5AJG A;  1YSQ A;  4EBL A;  4R38 A;  3QNC A;  1PZP A;  1Y4O A;  3UB9 A;  3BLM A;  3N6I A;  4JF6 A;  1TEM A;  1WE4 A;  2ZC6 B;  1P0Z A;  5KSH A;  5TGF A;  1NYY A;  1OJG A;  4EXO A;  2WZX A;  2E8J A;  1PWD A;  4CJN A;  3BEC A;  1MWS A;  3T1Q B;  1Q2P A;  5F6A A;  4E3O A;  1MZU A;  2A2L A;  3HLB A;  1LI0 A;  2ZJ9 A;  5L2F A;  3P09 A;  2OLV A;  2OOL A;  4OON A;  3QP5 A;  1H8M A;  2EX8 A;  2HF6 A;  3KYZ A;  3IF5 A;  4GS9 B;  4QWO A;  2ZL1 A;  3LR3 A;  3R7W A;  4E3L A;  5CER A;  2B95 A;  3KSG A;  5HAR A;  2M1C A;  4FOF A;  3V39 A;  4ESP A;  3SH7 A;  3G30 A;  1T1B A;  3LO7 A;  1XX2 A;  1BTL A;  3Q7V A;  4WL9 A;  4IED A;  5EPH A;  1TF1 A;  3W2Z A;  2JC7 A;  5A91 A;  2YKH A;  2K31 A;  3C8C A;  1FCM A;  3BY9 A;  1V9Z A;  4RYE A;  1LI9 A;  4CLC B;  3ZFZ A;  4NEE D;  3UE1 A;  2A3U A;  1K25 A;  3IX4 A;  1L0G A;  1W5D A;  4X1M A;  4Y7P A;  2WKH A;  1YLP A;  3A3J A;  5DF7 A;  4OPQ A;  1CEG A;  3UY6 A;  3V50 A;  2ZQ8 A;  4DN0 A;  1MC0 A;  3BQ8 A;  3VE4 A;  3MMH A;  4Y17 A;  1S6R A;  2DMW A;  2B18 A;  1XJ4 A;  3T4J A;  5HDS A;  1K54 C;  2P7J A;  3IWO A;  3MSH A;  4DE0 A;  3FKW A;  1ZHH B;  4JPM A;  3PBQ A;  3ZG9 B;  3MJQ A;  5IHV A;  4PMA A;  3AGE A;  3G34 A;  4OOM A;  2X02 A;  4OQG A;  1T1A A;  4MNR A;  1UWP X;  2JKF A;  1ZC2 A;  1GCE A;  1SKF A;  3Q1F A;  5CED A;  5F1F A;  1JNU A;  3WRT A;  1GSV A;  1ES4 A;  1N9B A;  3BJN A;  2VX8 A;  1KGF A;  5DKL A;  5FQM A;  3WWX A;  1K38 A;  2Z2L B;  1KE3 A;  2QYB A;  3OLO A;  4P6Z S;  2PYP A;  3PXP A;  2HJ9 C;  5I5L A;  2CMN A;  3NUL A;  1ZKJ A;  1YLW A;  2VV7 A;  5HW3 A;  1O07 A;  4RX3 A;  4PM8 A;  2V1B A;  4XXR A;  5AQ9 A;  2R78 A;  1S4R A;  4X55 A;  2HGV A;  1LL8 A;  4JXG A;  1LL5 A;  2NUT C;  3H82 B;  2HV1 A;  4QPR A;  3IWI A;  4I5S A;  4E6W A;  2RL3 A;  4L9G A;  2WUQ A;  2K7S A;  3GMW A;  1LHY A;  4UAA A;  3FPV A;  5F1G A;  5FQJ A;  4Y13 A;  3TW8 A;  1K54 A;  1LSX A;  1X0O A;  4E3M A;  3VSL A;  3UE0 A;  3M2J A;  4BL3 A;  2G2U A;  1G68 A;  2QWS A;  2QKP A;  2UV0 E;  3HUO A;  4O7D A;  4QY6 A;  3CI6 A;  1IYQ A;  4C75 A;  1BLC A;  1TDG A;  5G4Z A;  3JVU A;  2GNX A;  3ZVW A;  4AFI A;  5M1A A;  1CQA A;  2I9V A;  5F82 A;  4KQQ A;  4NXE A;  3IBJ A;  4EEU A;  1P9R A;  2XSS A;  2VA0 A;  2PRF A;  3IH8 A;  1JWP A;  4GCZ A;  4LFU A;  3B3X A;  3PBR A;  1AWI A;  3K3C A;  4O0P A;  3IT9 A;  3S7N A;  1W7F A;  1H5X A;  1FCN A;  3IWQ A;  4K0W A;  1W79 A;  4NXB A;  4XUZ A;  3Q07 A;  3O86 A;  4EER A;  4S2N A;  4OPR A;  4OKP A;  3OPP A;  3NY4 A;  3LCE A;  4LRX C;  2V0W A;  3ZGA B;  2EFX A;  1YLY A;  5F83 A;  3A3F A;  3D9Y A;  4N1H A;  2W0N A;  5EVE A;  3PYP A;  1OPX A;  4ARZ B;  5CX7 A;  2XD5 A;  3T4O A;  1FCO A;  4M3K A;  4RX2 A;  3DW0 A;  5FAO A;  4GDN A;  3K3D A;  5EVI B;  4PM6 A;  3SZT A;  3D4F A;  3RH8 B;  1H3Q A;  1IEL A;  3UB7 A;  4WMC D;  4MDZ A;  5L10 A;  1PWG A;  5M18 A;  5E2H A;  4UEY A;  3DTM A;  2ZOI A;  3A3E A;  5EV0 A;  4OOY A;  2KOI A;  4N9K A;  2H0T A;  5HSQ A;  2O9C A;  1PI4 A;  4UQI S;  1UWN X;  2D01 A;  3C5A A;  3NC8 A;  5FA7 A;  2Y2I A;  2O0Y A;  1XFN A;  1PW8 A;  3N4I A;  3T50 A;  3AGF A;  5FSR A;  4LV3 A;  1M40 A;  3UN7 A;  1D7E A;  2R9X A;  1S1Y A;  4OQ0 A;  3O88 A;  4HBU A;  1WA9 A;  1BSG A;  1L0D A;  3FZC A;  3BWL A;  5HAQ A;  3M6H A;  2WAD A;  2BTF P;  1TS6 A;  1G28 A;  1SHV A;  1GSW A;  2JKG A;  4DRT A;  2Y2P A;  2ZC5 B;  4UHU A;  4I38 A;  5GLB A;  3VFH A;  1NLZ A;  4S2P A;  4GN2 A;  4DE3 A;  4Q8I A;  2KDK A;  4HIA A;  5GHX A;  4WZ5 A;  3MZE A;  4FCF A;  3LY4 A;  4MLL A;  4JBF A;  1OTB A;  3CUE A;  2BLS A;  4X68 A;  1LT0 A;  2X71 A;  5MC7 A;  1KGE A;  5D3O A;  3Q81 A;  4HES A;  1HTZ A;  4ID4 A;  1VHM A;  5KZH A;  4N9L A;  3VE3 A;  4GB7 A;  4O8G A;  2R9W A;  2B5R A;  2DNS A;  2UWX A;  2GDN A;  1J3W A;  4WYY A;  3EGD C;  1YLT A;  3IHA A;  4HQA A;  4WEK A;  5EVI C;  3LY3 A;  1XKZ A;  4P6Z M;  4BQM A;  5F5Y A;  1WYC A;  4FD8 A;  3MZD A;  2V1A A;  4CLC A;  4ZRR A;  1Z09 A;  5DFX A;  1U60 A;  3T1X A;  5EVL A;  2GJ3 A;  2PR5 A;  3CWF A;  4H8R A;  3A0S A;  2PYR A;  1ACF A;  4NK3 A;  3OPR A;  4OP8 A;  4JGP A;  5FAQ A;  2I72 A;  2ZD8 A;  4M4X A;  2EFU A;  4JGO A;  1TS8 A;  4FUW A;  2P04 A;  3S7Q A;  2HDQ A;  2W3G A;  5E2F A;  4F94 A;  1Y28 A;  4E3N A;  1FR1 A;  3FPW A;  3Q7Z A;  5HWV A;  2Y2G A;  1ES5 A;  4UA7 A;  3G4P A;  4RA7 A;  3ZHH A;  1GA0 A;  5FQ9 A;  4WN5 A;  4HH2 A;  4PM7 A;  4BJP A;  3HLW A;  4OOL A;  4F3L A;  4GJ4 A;  4JGQ A;  3GRJ A;  3A0V A;  4E6X A;  3JYI A;  4WEJ A;  3VP1 A;  1CEF A;  4EUZ A;  4ARZ A;  3ZVT A;  3TE8 A;  3CJM A;  4BLM A;  4KZ6 A;  1BT5 A;  4OP5 A;  3Q82 A;  3LUQ A;  2Z6C A;  2PD8 A;  1FSW A;  3GDI A;  4JF4 A;  1UGU A; 
#chains in the Genus database with same CATH homology
 2M7V A;  2PD7 A;  5HPI A;  4DN0 A;  1MC0 A;  3BQ8 A;  4NXF A;  3VE4 A;  2J3W A;  3MMH A;  1LSV A;  2YKF A;  4IUH A;  1DP6 A;  2W27 A;  2DMW A;  2B18 A;  1XJ4 A;  3T4J A;  2VJW A;  4HHD A;  3OCN A;  5DFY A;  2FZ0 A;  2P7J A;  3E4O A;  5HDS A;  3T4L A;  2W3F A;  2WKP A;  3CIT A;  4EQ1 A;  5TJJ A;  1ZHH B;  3PBQ A;  3F1P B;  3F1P A;  3ICY A;  3MJQ A;  1NRJ A;  4MMN A;  3P7N A;  1S4S A;  3LIF A;  4KUK A;  1IFQ A;  4OOM A;  3SW1 A;  1T1A A;  1UWP X;  1N9L A;  4CLC C;  3E4P A;  3E0Y A;  4LRY C;  3LIE A;  4LLO B;  2K2N A;  1OTA A;  2JN7 A;  4MN5 A;  3OC2 A;  2KLI A;  2OAP 1;  1JNU A;  2XA7 M;  4GLQ A;  1YSP A;  3RTY A;  1GSV A;  3LYX A;  1TS7 A;  3EEH A;  3F1O A;  3BJN A;  3IS2 B;  5HWT A;  2Z6D A;  2VX8 A;  2BAS A;  5A8B A;  5DKL A;  4L0L A;  3NOU C;  3OLO A;  2QYB A;  4P6Z S;  4YOF A;  5G4Y A;  1OTI A;  2PYP A;  1T19 A;  3KSF A;  3PXP A;  4L9E A;  2GZA A;  2HJ9 C;  5I5L A;  3T4Q A;  2CMN A;  1TS0 A;  2VV7 A;  4LRZ E;  2JKT M;  2IA2 A;  2V1B A;  2R78 A;  1S4R A;  5J4E A;  4EUV A;  2P08 A;  2HGV A;  1LL8 A;  2W1T B;  4XT2 B;  1XFQ A;  3VOL A;  2L0W A;  5IU1 A;  3B42 A;  3PBO A;  4Y3I A;  4DMZ A;  3MXQ A;  4CQH A;  4MN7 A;  3OOV A;  2NUT C;  2PHY A;  5TBM B;  4R3A A;  4BBV A;  2NUP C;  4Q0I A;  3H82 B;  2HV1 A;  3JVV A;  4QPR A;  4I5S A;  4BWI A;  4L9G A;  5EFW A;  3PBN A;  2K7S A;  3U2A A;  4EEP A;  3EEA A;  4FSF A;  3KO6 A;  3FPV A;  4EET B;  3TW8 A;  3HJK A;  4BBU A;  3HCY A;  4F3L B;  1LSX A;  1X0O A;  2INW A;  2W3H A;  3LR5 A;  1OTD A;  1S1Z A;  4MN6 A;  3S7O A;  5IT5 A;  1T18 A;  2QWS A;  2QKP A;  3E98 A;  1MKM A;  4GHI A;  3MFX A;  4WF0 A;  4Y2F A;  5DJU A;  3D72 A;  3CI6 A;  3B33 A;  2QJ7 A;  3BQA A;  3R7W B;  3ULF A;  5G4Z A;  3JVU A;  3F1N A;  4IHQ A;  2GNX A;  4AFI A;  2O99 A;  3MF0 A;  4CLC D;  2VGL M;  3TRC A;  1W63 Q;  2I9V A;  4EW7 A;  3S7P A;  2A24 A;  2OAQ 1;  3IBJ A;  4NXE A;  2W1R A;  1W63 M;  4EEU A;  3PR6 A;  4NXG A;  3UMD A;  1P9R A;  2XSS A;  2VA0 A;  4HJ4 A;  4GCZ A;  3ZYT A;  3D3O A;  3EGX C;  2Y79 A;  4H6J B;  1GSX A;  1XJ6 A;  3PBR A;  3K3C A;  4O0P A;  3S7N A;  3H9W A;  2WKQ A;  3KYQ A;  4Z1W A;  2QHK A;  3LIA A;  3TJZ C;  1KOU A;  4NXB A;  4B93 A;  5HL6 A;  3NOT C;  4ME4 A;  2D02 A;  3EOI A;  4RQ9 A;  4EER A;  3PHY A;  2JKR I;  4UQI M;  4JGR A;  4KQD A;  2EA9 A;  4LRX C;  4DJ3 A;  4Q0H A;  2V0W A;  1ODV A;  3T4T A;  2W0N A;  4HJ6 A;  1YAX A;  3PYP A;  1OPX A;  2HJE A;  5CX7 A;  2FH5 A;  4ARZ B;  3T4O A;  4HOI A;  4II7 A;  1NWZ A;  3ZQ5 A;  3CUE C;  3F1O B;  3K3D A;  4I3A A;  4IUK A;  3IS2 A;  5IS1 A;  5F69 A;  1ZTU A;  3NJA A;  4HI4 A;  2QJ5 A;  2JHE A;  3LI9 A;  3RH8 B;  1H3Q A;  4GHI B;  2V9A A;  2O9A A;  3UB7 A;  2J3T D;  4MDZ A;  3MQQ A;  4HP9 A;  3H82 A;  5K5B A;  1NLY A;  4UEY A;  2ZOI A;  4LPZ A;  5J7E A;  4ETX A;  2KOI A;  3HJI A;  3PBT A;  5HWW A;  2L4R A;  5HSQ A;  3R4K A;  4BBT A;  1BYW A;  2O9C A;  3H7W B;  4PAU A;  4UQI S;  1UWN X;  3EQV A;  1N9O A;  2A24 B;  4WEL A;  1STZ A;  2D01 A;  3A0R A;  2LB9 A;  2XRO A;  2O0Y A;  1XFN A;  3F1N B;  4PKY G;  2EWW A;  4EU0 A;  5FL3 A;  3T50 A;  2ZMF A;  3C30 A;  4IJG A;  1D7E A;  2VKS A;  3T4S A;  1S1Y A;  3PBS A;  4YNR A;  3UME A;  1IOU A;  1D06 A;  1WA9 A;  2O9B A;  3LR4 A;  5DJT A;  5AVE A;  1VB6 A;  3DBA A;  2VV6 A;  2W3D A;  2VGL S;  2VV8 A;  3G6O A;  3BWL A;  5KIZ A;  3NHQ A;  2GX5 A;  4O01 A;  4Q0J A;  1TS6 A;  4R70 A;  3KSH A;  1G28 A;  2KX6 A;  5C5K A;  5L8M A;  3RFB A;  5HD5 A;  1DP8 A;  1GSW A;  2WKR A;  1F5M A;  3BW6 A;  1P97 A;  1XJ3 A;  2VZW A;  2PT7 A;  4I38 A;  2LB5 A;  3LR0 A;  1NLZ A;  4CLC E;  5HDC A;  3UB8 A;  4GS9 A;  2VLG A;  1G6O A;  3UE6 A;  1T1C A;  4I3J A;  3UE3 A;  2KDK A;  4G3W A;  4HIA A;  4KQO A;  1F98 A;  2W1T A;  4NKP A;  3EQU A;  4L9F A;  4E04 A;  3MR0 A;  4H6J A;  4WLA A;  1OTB A;  3CUE A;  1LT0 A;  2JKT I;  5MC7 A;  3P01 A;  3MQ0 A;  3BY8 A;  2J3T C;  4HP4 A;  3B47 A;  4ETZ A;  4KUO A;  3K2N A;  4G3K A;  3FG8 A;  3H7W A;  1YKD A;  2XRN A;  1VHM A;  4WUJ A;  5AVF A;  1P9W A;  2ZOH A;  3OCL A;  2M7U A;  1DRM A;  4HH3 A;  4PHT A;  4PKY A;  1OTE A;  3CAX A;  3T4K A;  4BMW A;  1N9N A;  3IBR A;  3VE3 A;  4O8G A;  2W3E A;  3EWK A;  2H28 A;  5HDD A;  4K08 A;  3KSI A;  5AJG A;  1YSQ A;  3C2W A;  4R38 A;  3LID A;  3LIB A;  3EGD C;  1F9I A;  2G7U A;  4HNB A;  3UB9 A;  1OJ5 A;  3E4Q A;  4HQA A;  1P0Z A;  5KSH A;  4WEK A;  1OJG A;  4EXO A;  4P6Z M;  5F5Y A;  3C38 A;  4DJ2 A;  2V1A A;  1S66 L;  4CLC A;  4ZRR A;  5F6A A;  5DFX A;  3VV4 A;  1MZU A;  2A2L A;  2Y8H A;  3O5Y A;  2GJ3 A;  1OT9 A;  2PR5 A;  3CWF A;  5HZH A;  2OOL A;  3KX0 X;  3A0S A;  3GEC A;  3LI8 A;  3FC7 A;  2PYR A;  2XA7 S;  4R6L A;  1H8M A;  4JGP A;  1DP9 A;  2HF6 A;  3KYZ A;  3OBF A;  2J80 A;  4GS9 B;  3LR3 A;  4B9O A;  3R7W A;  4M4X A;  2PDR A;  3KSG A;  4JGO A;  4Y5F A;  2EWV A;  2M1C A;  1TS8 A;  4FOF A;  5HPF A;  2P04 A;  3S7Q A;  3UB6 A;  2W3G A;  5DKK A;  1Y28 A;  4EES A;  1T1B A;  3FPW A;  3V67 A;  4HY8 A;  5HWV A;  1LSW A;  4WL9 A;  1OT6 A;  1XJ2 A;  1TF1 A;  3W2Z A;  2OWJ A;  4G3V A;  2JKR M;  1S67 L;  4WN5 A;  4HJ3 A;  2L1M A;  4HH2 A;  2YKH A;  2ZBB A;  2K31 A;  3LIC A;  4MCW A;  4XT2 A;  4BJP A;  4GW9 A;  3CLO A;  3C8C A;  3BY9 A;  3MQO A;  1V9Z A;  4OOL A;  4F3L A;  3NOP C;  4GJ4 A;  5F68 A;  4CLC B;  4JGQ A;  3A0V A;  5HD3 A;  4NEE D;  2MJ6 A;  4I39 A;  1V9Y A;  4WEJ A;  2PR6 A;  4YWZ A;  2VEA A;  4ARZ A;  5DF9 A;  3TE8 A;  2OWH A;  5J3W A;  2ZMV A;  5TBM A;  1EW0 A;  4I3I A;  2V0U A;  5LBR A;  3LFV A;  2B02 A;  3LUQ A;  2Z6C A;  2PD8 A;  3GDI A;  1TD5 A;  1UGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...