3MJQA

Crystal structure of the pas domain of q24qt8_deshy protein from desulfitobacterium hafniense. northeast structural genomics consortium target dhr85c.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
KNFLETIEDMILIINREGRLLYANTAVPKKLGYTHEELMSMHILTITSAGKMAEGEKILAELFAGKKESLPLSLEKKEGTSIPAKARIWQGKWHNEPCLFAIIKDLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title Crystal structure of the PAS domain of Q24QT8_DESHY protein from Desulfitobacterium hafniense.
rcsb
source organism Desulfitobacterium hafniense
total genus 19
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mjqA00
3NHQA 4EQ1A 3EEHA 1DP6A 4BBVA 3OLOA 4I3JA 2CMNA 3VE3A 1LSVA 4GS9B 4I38A 4L9FA 2HV1A 1P0ZA 3H9WA 1NWZA 3K3CA 5TBMB 1DP8A 2QJ7A 1N9NA 1OTEA 4KUOA 4HH3A 3VE4A 4NXBA 4MN6A 2Z6CA 4XT2B 2OWHA 2QHKA 3ICYA 2EA9A 2YKHA 3MR0A 5DKKA 3A0VA 2VLGA 4RQ9A 4BBTA 2JHEA 4NXFA 2PHYA 1D7EA 2BASA 3LUQA 5HWVA 1WA9A 4R6LA 2L0WA 4EEUA 4L9EA 4JGPA 1BYWA 1TS8A 1OTDA 5HWTA 2P7JA 2V9AA 4R3AA 2WKQA 1VB6A 5HDSA 4LLOB 4EESA 1XFQA 3H7WA 5HDCA 3C2WA 4HY8A 1T19A 3LICA 1OT6A 4WLAA 4I3AA 2PDRA 3E4OA 1MZUA 5HD3A 3VOLA 5F6AA 3K3DA 3MFXA 4H6JA 3E4QA 5AVEA 1XJ2A 2D02A 3ULFA 4GHIA 3G6OA 1OTBA 4LRYC 3A0SA 4HNBA 1OJ5A 4DJ2A 4I5SA 5HSQA 4HJ4A 4HH2A 3GECA 1LT0A 3PHYA 4EERA 3H7WB 4B9OA 5J4EA 3LI9A 3LYXA 4EW7A 3H82A 1XJ3A 3KX0X 3LIBA 1N9OA 3GDIA 2OWJA 1GSXA 2VV8A 1UWPX 5I5LA 2M1CA 4H6JB 5F5YA 5G4YA 2Z6DA 4GHIB 2L1MA 1P97A 5F69A 4MN5A 3UE6A 1JNUA 5G4ZA 3NOPC 3NOTC 2A24A 5HWWA 1V9ZA 3PYPA 2VV7A 4HOIA 4K08A 4KUKA 2KDKA 1OT9A 3RH8B 2QJ5A 3CLOA 1F9IA 2PYRA 4PKYA 3H82B 4HJ6A 3ZQ5A 4LPZA 3IBRA 1T1AA 2W27A 1GSWA 1T1CA 1TS6A 4R38A 4HIAA 3P7NA 2V1AA 3CWFA 4JGRA 1N9LA 2ZBBA 3UB7A 2A24B 1OTAA 4M4XA 2JN7A 3LI8A 1TS0A 2PD8A 2VV6A 3IS2A 1LSWA 1V9YA 2YKFA 4HHDA 2ZOIA 3BY8A 5IS1A 1T1BA 5DKLA 4EXOA 2OOLA 3EWKA 2H28A 1TS7A 2PD7A 1T18A 4HP4A 3FC7A 2PR6A 3HJIA 3BWLA 1LL8A 5EFWA 2D01A 2ZOHA 3F1NA 2V0WA 1F98A 2INWA 1D06A 4HP9A 4WUJA 4NXEA 3RTYA 1ODVA 1S67L 3LIDA 3MQOA 3B33A 5F68A 1KOUA 4PKYG 5J3WA 2PR5A 3UMDA 4R70A 5HD5A 3UB9A 1S4SA 5A8BA 3F1NB 3T50A 3UMEA 4WN5A 1Y28A 1LSXA 3F1PA 2K7SA 3LIAA 1GSVA 1S1ZA 4WF0A 4I39A 2WKRA 4EEPA 4DJ3A 1XFNA 3SW1A 1XJ4A 3NOUC 1X0OA 4HJ3A 1S66L 4BBUA 2L4RA 4YWZA 3FG8A 4JGQA 1DP9A 3LIEA 5DJTA 5HZHA 3C8CA 3BY9A 3A0RA 2V1BA 2QKPA 3F1PB 4HI4A 4GCZA 5J7EA 5IU1A 3MQQA 4F3LA 1DRMA 1UWNX 1UGUA 1XJ6A 2GJ3A 5AVFA 4E04A 3D72A 1EW0A 2R78A 3E4PA 2V0UA 4L9GA 5KIZA 3LIFA 4EETB 3F1OA 3HJKA 2WKPA 4GW9A 3MXQA 4HQAA 2VEAA 2B02A 2PYPA 4GS9A 4NXGA 3IS2B 1S4RA 3MJQA 3NJAA 1OTIA 1OJGA 4LRXC 4I3IA 2J80A 4F3LB 2W0NA 5DJUA 5TBMA 4WL9A 3UB6A 5HDDA 2KX6A 1G28A 1S1YA 3F1OB 4XT2A 3UB8A 4KQDA 4JGOA 3CAXA 4LRZE 2I9VA 2QWSA
chains in the Genus database with same CATH superfamily
4EQ1A 3EGXC 1DP6A 3BM6A 4BBVA 3RXWA 4GS9B 2RL3A 5JYOA 4U0TA 2HV1A 4MN7A 3GRJA 4WZ5A 5TJJA 4KZ3A 1FR6A 3TRCA 4FH2A 2EX8A 1W8QA 1I5QA 3PAEA 1DP8A 2Y2QA 4OQIA 4WEKA 5EVIB 2ZQ7A 1N9NA 4HH3A 2X02A 2EFXA 4MN6A 5EE8A 2Z6CA 1H3QA 1KGFA 3HCYA 3T1QB 1ERQA 1KVMA 2WGVA 2QHKA 2YKHA 4GDBA 2ZC7A 3UPNA 4AFIA 3MR0A 2ZL1A 4LFUA 3AGEA 3A0VA 1XPBA 3W8KA 2VLGA 4BBTA 4KG5A 2BASA 2BG1A 3VFHA 4A5RA 5EV0A 2FFYA 5HWTA 2V9AA 1VB6A 4E3IA 3IX4A 1LI9A 2XDMA 4EESA 3UPOA 4KQRA 1XFQA 5FQKA 2O9BA 2PT7A 1T19A 1OT6A 5GLDA 5EUAA 3V67A 5HD3A 3GR2A 5DTKA 1VHMA 3MFXA 2C5WB 3UPPA 2ZMAA 4PHTA 1S6RA 1MKIA 1XJ2A 3CI6A 2D02A 2W3GA 3VFFA 1K55C 3DBAA 1OTBA 2J9OA 4BENA 4GN2A 3A0SA 1CEGA 4HNBA 5FSRA 4LV2A 3NECA 4DJ2A 2O9AA 3UDXA 3DTMA 1NXYA 1N4OA 1K57C 2VJWA 2ZM2A 3EEAA 5M1AA 5BOHA 4IVIA 3H7WB 4B93A 4B9OA 4R4RA 1DJBA 3CITA 3LI9A 5J4EA 1XJ3A 3LIBA 2Y4AA 1MWUA 2Y2LA 3QP1A 4GD8A 4KG6A 5DFXA 1ZTUA 2M1CA 5DF7A 4UQIS 3QNCA 4H6JB 5F5YA 3BFFA 2Z6DA 4GHIB 1Q2QA 4E6XA 4DE2A 4MN5A 3UE6A 2V20A 3NOPC 3VOYA 4G3VA 4JKTA 3L7HA 5HWWA 2VV7A 4K08A 3DTIA 4KUKA 3ZVTA 3CLOA 3ZG0A 1FCMA 1F9IA 4PKYA 3H82B 3BLMA 3ZQ5A 3IBRA 1T1AA 5EPHA 4E6WA 2V8FA 2XROA 2W27A 1SDNA 1T1CA 2MJ6A 2G2UA 2V2FF 4OOYA 4WM9A 3RXXA 4C6YA 3DWKA 1XA7A 1K38A 3C5AA 2P08A 1QMEA 4GKUA 3G2YA 5CTNA 4JF6A 4XUZA 2LB5A 3LI8A 3MMHA 1E4DA 1TS0A 5L10A 1BUEA 3EQUA 3G2ZA 3IS2A 3NDEA 5TGFA 3VP0A 1VETA 2GDNA 4X69A 1H5XA 5GL9A 1V9YA 2YKFA 3G31A 5U47A 3HLGA 3BY8A 5IS1A 4E3MA 5DKLA 4OKPA 1ONGA 4HEFA 2WZZA 1IYPA 3HL9A 3EOIA 1GHIA 1YMSA 2EFUA 3P01A 4HP4A 3W4OA 3VSLA 1BLPA 5HL1A 1WE4A 2GX5A 3BWLA 1SKOA 3V3SA 2ZM0A 2Y2JA 5FEGA 3O3VA 1MWRA 2VGLS 2INWA 1PZPA 2XQZA 3G32A 2R9XA 5GHYA 3CG5A 3KSFA 3NIAA 3RTYA 1S67L 5FASA 3LIDA 3B47A 1STZA 4E3NA 1PZOA 1NJ4A 1KOUA 5A93A 1GHPA 1HTZA 1L0DA 4PKYG 5J3WA 1IFQA 3IWIA 4GNUA 1MY8A 1E3UA 2PR5A 2BTFP 2WKHA 4R70A 2XH9A 4LENA 3CMZA 5CERA 2V1ZA 1S4SA 4ZAMA 3IF6A 4X6TA 2ZQCA 2JBFA 5EOOA 5AJGA 2HF6A 5FEFA 1WYCA 1ES5A 1XA1A 1ZHHB 3F1PA 2K7SA 3IQAA 3UDIA 2EX2A 4JLFA 3IT9A 3IF5A 2ZQAA 4KZ9A 3SW1A 3NOUC 2WKEA 3TW8A 3SS3A 1S66L 3OPPA 3ZVWA 5HPFA 2ZD8A 1L3LA 3T4JA 4O01A 3QP2A 2HDUA 4II7A 4Y7PA 2OLUA 3M6BA 3GVBA 5CHMA 4DE1A 4B4XA 5L8MA 1Y4OA 1M6KA 4PM9A 1MWSA 1EWZA 2JE5A 4P6ZS 4HI4A 4PMAA 4R4SA 2QMIA 1UWNX 5AVFA 1G6OA 4KQQA 4CLCC 3D72A 4R23A 3FZCA 4X1MA 2V0UA 4S2KA 2B95A 1PI4A 3F1OA 2P04A 3MZEA 2HJEA 3SH9A 2XFTA 3MXQA 4JXVA 2HPBA 3LGOA 1G68A 1YT4A 5HX9A 4WEJA 1OPXA 5HAPA 4FH4A 1SCWA 2EX9A 4CLCB 2XRNA 2Z2LB 1OJGA 4LRXC 3G35A 2GZAA 2E8IA 4K91A 4F3LB 2W0NA 5FQJA 2EX6A 1NLZA 4WL9A 2E8JA 3OPRA 2Y8HA 3UB6A 1K54A 5FDHA 2KX6A 2P9VA 3VP3A 1WYBA 5FATA 3HVFA 2EWWA 2IA2A 1RCJA 4OQHA 4NK3A 4UA9A 3VP2A 4WZ4A 2XR0A 5HWVA 3QP4A 4UA6A 1LLBA 3OLOA 4G3WA 4HESA 4I3JA 2CMNA 3VE3A 4B4ZA 1FCOA 1LSVA 4I38A 3LR5A 4EBNA 3OPLA 5FAOA 2JKTI 3FPWA 1TF1A 3K3CA 3BQAA 3R7WB 5TBMB 3HLEA 2QJ7A 5M18A 4WZ5C 4KZ7A 2Y55A 1OTEA 4CJNA 1Z09A 4S2NA 3VE4A 4NXBA 1VEUA 4HBUA 4JBFA 1YLZA 5E2EA 4XT2B 3KSGA 5CEBA 4QY5A 2XEPA 3EGDC 4DDYA 4N92A 2P74A 3HUNA 2EA9A 5F1FA 2KLIA 2OLVA 3VSKA 3HBRA 4H8RA 5DKKA 4BJPA 4RQ9A 1NZUA 4LV1A 2RCXA 2J8YA 3PR6A 2PHYA 2EXBA 1D7EA 5EVLA 4NETA 2W3EA 4BLMA 3OPHA 5HDSA 3LO7A 2G7UA 1FSYA 3IWQA 1YM1A 5HDCA 3E98A 4ZDXA 4HY8A 3FKVA 4R3BA 2M7VA 4RVAA 4WLAA 4QWOA 3E4OA 4QPRA 1E3UD 5F6AA 2XGNA 4P85A 5FI7A 2ZL1B 4OOLA 3LCEA 1YKDA 3ULFA 4ZJ3A 1YLPA 2Q9MA 4Z1WA 1KE0A 3T1SA 4LRYC 3LR0A 2Y2PA 5FQMA 4Y2FA 1S0WA 4QJGA 3N6IA 4Y0OA 3ZGAB 3GTCA 4DE3A 3NI9A 5A90A 1H8ZA 4HJ4A 5TFQA 3VMAA 2VA0A 1A0KA 4KZAA 3GECA 3T1XA 2VGKA 1BLHA 4E3OA 1CK3A 4WMCA 3IXDA 3LYXA 4DRTA 2OWJA 2EXAA 3PBOA 2ZC3B 3CUEA 3U4LP 4E3LA 3KO6A 1PYYA 5HFOA 2WAEA 2L1MA 5F69A 4WYYA 1JNUA 1IYSA 2A24A 1HVBA 4PAUA 3RJUA 1KE3A 4ZBEA 1V9ZA 3PYPA 1CEFA 4HOIA 4EQIA 3NC8A 5FAPA 1SHVA 2J3TC 1VQQA 4S2LA 2VZWA 4HJ6A 4XUXA 4LPZA 4EBLA 2NUTC 3S7PA 5LBRA 5JYPA 3QP5A 1IYQA 3N7WA 4HIAA 2OV5A 3P7NA 3PBQA 5CGXA 4JGRA 5IT5A 1N9LA 2ZBBA 3KYQA 2Y2KA 1YLWA 4IEDA 4IBXA 3T4LA 2VK3A 2JKTM 5FA7A 3S22A 4GB7A 3O86A 3ZDJA 2JN7A 3O5YA 1CI8A 1TDLA 1Z6FA 3GQZA 3CPTA 4OPYA 1TVFA 2PU2A 2PBDP 2WYXA 1G5UA 2W3FA 2Z2MB 3A3FA 2Y2MA 4M3KA 3TG9A 4X68A 5AQ7A 2OOLA 1O7EA 1EI5A 5EM0A 4P87A 3OBFA 2PD7A 1T18A 2ACGA 3C4OA 4R0QA 4U3TA 2ZM8A 3NULA 4D2OA 3JVVA 2PAVP 5DTSA 4FCFA 2D01A 2ZOHA 2V8CA 1DJAA 4FUWA 4EV4A 1F98A 1BLCA 1VETB 4OPQA 4WUJA 3PTEA 1ODVA 4OQGA 5F68A 3JYIA 4DN0A 2XF3A 1TEMA 3CHWP 2XA7S 4S2JA 3Q1FA 1KDWA 5CGSA 3MXSA 1SKOB 3MFDA 5A8BA 4Y13A 2ZC6B 4RA7A 1IYOA 4O0PA 1Y28A 2WGWA 4E3JA 2WZXA 4R3JA 2NUPC 3SZTA 3LIAA 4MEZA 1SKFA 1F2KA 4WF0A 2K31A 3FV7A 4ME4A 1VM1A 4N9LA 3BFEA 4C75A 1XJ4A 1IKIA 4RYEA 3S7QA 2Q9NA 2HP5A 4LV3A 3TOIA 2L4RA 4Q0HA 3LR3A 4OLGA 1LI0A 1QMFA 4LGWA 3FG8A 4JGQA 1DP9A 3DTKA 1K25A 3IF6B 4MDZA 3W4PA 3ZFZA 3UY6A 2QKPA 3F1PB 2JKRI 1FILA 5A91A 1K4EA 3HUOA 3NCKA 5FQ9A 1UGUA 1XJ6A 2XFSA 4WMCD 3E4PA 1EW0A 2WGIA 2A49A 2B18A 2O99A 1NLYA 5KIZA 1J9MA 5GLBA 3LIFA 4NG2A 2G2WA 3HJKA 1XKZA 4R1GA 3IBJA 4GW9A 3S7OA 1K55A 3Q7VB 1YSPA 5G18A 3LEZA 2VEAA 5AQ9A 4OPZA 3ZG5A 2B02A 3ITAA 1S4RA 1NY0A 3MJQA 3IXBA 2ZJ9A 1K57A 3A3JA 1D1JA 2J80A 5CECA 3C7VA 4BL2A 5F1GA 2JKFA 1Y54A 4K0XA 2O9CA 5D3OA 3BQ8A 2DNSA 1G28A 1S1YA 4BQMA 3F1OB 3E2KA 3P09A 3UB8A 1CJFA 1JWPA 3P98A 4JGOA 4KQDA 2WK0A 1K54C 2QWSA 3NHQA 1W5DA 2X71A 1HLUP 2QZ6A 3VP4A 1XX2A 4XXRA 1IOUA 4L9FA 3W2ZA 3H9WA 5KSHA 1K6RA 5HL6A 3N8SA 1BLSA 1YSQA 2QPNA 5K5BA 2W1TA 2ZC4B 4KUOA 1YAXA 4OP8A 2J7VA 1KE4A 2EWVA 3HLWA 1L0FA 4X56A 4S2NC 2FFFB 2XK1A 4ETZA 3GV9A 1XXMA 2BLSA 3JPUA 3D3OA 4LCMA 1ZG6A 3LUQA 4ARZA 4R6LA 4BD0A 2L0WA 4JGPA 2ZMVA 2AVXA 2I72A 2Y2OA 1U60A 3DW0A 2Y2IA 4R3AA 2WKQA 1L2SA 3ZCZA 2O0YA 4LLOB 4KZBA 3PBNA 4EWFA 1VEUB 3C2WA 3MZFA 5EVID 1GA0A 3G34A 4DF6A 4I3AA 1MZUA 1G6AA 5IHVA 3K3DA 1YLJA 4PM7A 4MBHA 5AVEA 4QY6A 2JCHA 4IUKA 3G6OA 1KVLA 2HZ5A 1PFLA 1NYYA 1OJ5A 3ZYTA 3WRTA 5HPIA 4Q0JA 4I5SA 1TD5A 3RFBA 4MCWA 1IKGA 3PHYA 3OC2A 4EERA 1MC0A 3MKEA 4EW7A 1LHYA 1GSXA 4YNRA 3ZG9B 1C3BA 5I5LA 3ZG8B 4Y0TA 5DF8A 2KOIA 5HARA 1PWGA 1XGIA 2HGVA 5DF9A 1PRQA 4DKIA 2FH5A 1FSWA 3IHBA 5DFYA 2Y91A 4IHQA 3WWXA 3RH8B 1OT9A 1ZG4A 4MBFA 4Y3IA 1RGZA 4PM6A 3BECA 2PYRA 2CC1A 1ES2A 2J9PA 1YMXA 4UQIM 4LV0A 4R38A 2WUQA 3C38A 4Y0UA 1DY6A 2ZQ9A 2IWDA 3UB7A 5EVEA 2FZ0A 4GD6A 1RP5A 4D60A 3HLFA 3FYZA 3SOIA 2A24B 4ZTKA 1OTAA 4M4XA 3M6HA 2HDRA 1GA9A 2OAQ1 3QHYA 3M2JA 5J8XA 1PWDA 5AQBA 1PIOA 4CLCA 4CPKA 1W7FA 4L0LA 2UWXA 1T1BA 4MBKA 4EXOA 4O8GA 1N9BA 1BSGA 1FQGA 3PBRA 4ETXA 2C6WB 3EWKA 2Y2NA 2DCFA 2H28A 3EQVA 3PXPA 3FC7A 2IWCA 4Y15A 3E2LA 4OP5A 1YLYA 3F1NA 4S2IA 2V0WA 4FOFA 1O07A 4S2OA 1PNEA 5FI6A 3ZNYA 3CPTB 4Y5FA 2HDSA 4YINA 3HUMA 3V5MA 2HP6A 3MQOA 3Q7ZA 3FWLA 3G4PA 4DXBA 3TE8A 3UMDA 5HD5A 3WS1A 3UB9A 4IJGA 4GLQA 2W3HA 4F94A 3WS0A 3IX8A 2VGLM 4QB8A 4EBPA 1ZKJA 3BEBA 1LSXA 5DTTA 3OOVA 3HLCA 4MLLA 1GSVA 3IXGA 3A3DA 4Q8IA 1W63M 4EEPA 4N1XA 3B3XA 1PWCA 3MXRA 4GOGA 4HJ3A 4RX2A 3GSGA 3LY3A 5FDSA 3M2KA 3IXHA 5M19A 3DWZA 3V3RA 3LIEA 3D9YA 3BJNA 1H8YA 3N8LA 5HZHA 3C8CA 3O88A 3BLSA 2V1BA 2WGWB 2Y2GA 2JKGA 5J7EA 3C7UA 5FQIA 1FCNA 1DRMA 1JTDA 2GJ3A 2DMWA 2R78A 1MKMA 1FIKA 3DAVA 4KQOA 3T1RA 2M7UA 3UE3A 3ZHHA 4EETB 3S4XA 5A92A 2WKPA 1BT5A 5E2FA 4OONA 3T4QA 1HZOA 1SDEA 3IWOA 4FD8A 1NZOA 4JXWA 3ITBA 2HP9A 4GS9A 2XLNA 4P6ZM 3IS2B 3NJAA 3MSHA 3G30A 1KGEA 3MZDA 3SH7A 1K6SA 1XP4A 5DJUA 4JXGA 3MF0A 3T4TA 1ESUA 2PU4A 2WADA 4PM5A 5EVIA 5CGWA 5E43A 3V50A 5HDDA 3WRZA 2Y2HA 4WBGA 3BFDA 1YLTA 5GHZA 1MXOA 3OCNA 5L07A 4LCLA 2I9VA 2VKSA 3UDFA 1K0KA 2ZMFA 3EEHA 5CXWA 3U2AA 3OZHA 1CF0A 3UO9A 4EU0A 4ID4A 1P0ZA 3FKWA 3IF6C 3PBTA 3TJZC 1NWZA 1NRJA 5FQQA 3ZNTA 4CLCD 1K56A 5FI2A 2ZQ8A 4YFMA 3JVUA 3UE1A 3LFVA 4B88A 3B42A 2ZC5B 3MKFA 2OSUA 4RX3A 1MPLA 5CRFA 1PW1A 3TSGA 2VGJA 3QNBA 3T4KA 2OWHA 4OPRA 3ICYA 2ZQDA 1OMEA 2W1RA 5L2FA 2XSSA 3VP1A 2JHEA 4NXFA 4FTXA 1WA9A 1ONHA 4OLDA 4EEUA 4CQHA 4L9EA 1M40A 3BW6A 1BYWA 1W63Q 1TS8A 1OTDA 1P9WA 2P7JA 1F5MA 1ALQA 2W1TB 1DJCA 4ZJ2A 1BTLA 3I7JA 4S2PA 3H7WA 4ESPA 4PM8A 3LICA 3HREA 5GLAA 2XD1A 4EUZA 4FSFA 4GZBA 3BFCA 4UAAA 2PDRA 4Q0IA 1I2WA 3KSIA 3VOLA 3ZG7B 5E2HA 4E3KA 5F83A 4H6JA 3E4QA 4Z9QA 3NY4A 3S7NA 4GHIA 3NDGA 4ARZB 4P0MA 5EOEA 1JWZA 5HSQA 5FAQA 3IX3A 4QU3A 4HH2A 3PBSA 3UNWA 1LT0A 1J3WA 1FOFA 5L09A 3H82A 3KX0X 1N9OA 3GDIA 5CHJA 1FR1A 2VV8A 3Q82A 1I2SA 1UWPX 4OVDA 1BULA 3DTEA 4KZ4A 1W8YA 5KZHA 4JF4A 1PW8A 3LEQA 3D4FA 2UV0E 5G4YA 3FPVA 3WS4A 1P97A 4BD1A 2W3DA 5G4ZA 4BL3A 3NOTC 4OH0A 3NBLA 3WS2A 1ESIA 2Y59A 1ES3A 3QP8A 2KDKA 3AGDA 2QJ5A 4QD4A 3N8RA 2P9VB 2HDQA 1IELA 3O87A 1L0EA 3KYEA 5FL3A 4OQ0A 1AXBA 5MC7A 3C4PA 5CTMA 3W4QA 3E0YA 4KZ6A 2H5SA 1GSWA 3Q81A 1TS6A 3AGFA 2H10A 3BFGA 1K4FA 2V1AA 3CWFA 4IUHA 4ZJ1A 1NRFA 4X25A 3QP6A 1AWIA 2WAFA 1PI5A 3T12B 1MWTA 3T4SA 1GHMA 5KMWA 3Q7VA 3OCLA 3R4KA 1BZAA 5C5KA 2PD8A 2PBYA 2VV6A 1KGGA 1LSWA 3PAGA 4HHDA 3MS6A 4KG2A 2ZOIA 3T4OA 2VX8A 4JF5A 4YOFA 4N9KA 3HLDA 2R9WA 4DDSA 3UN7A 1JTGA 1TDGA 1TS7A 4MNRA 1EROA 4IVKA 2PR6A 3SS4A 1L0GA 2JKRM 5I94A 3HJIA 2OAP1 3SH8A 4NKPA 1LL8A 5EFWA 2HJ9C 5AQAA 1RGYA 4K0WA 4JPMA 2J3TD 3MQ0A 5EECA 4EUVA 1K56D 4UA7A 1D06A 4HP9A 4NXEA 5EM1A 3BYDA 1NYMA 4O7DA 4QHCA 4GJ4A 5TR7A 2IWBA 3B33A 1JVJA 1ZC2A 1YPRA 2QYBA 3BRMA 3K2NA 1E25A 2H0YA 3MBZA 1XGJA 1ACFA 3IH9A 5CHUA 3L9KA 4KZ8A 4JXSA 5GHXA 3CUEC 4DE0A 2X01A 2XD5A 4UEYA 3CZDA 1KDSA 4GDNA 3LR4A 3KYZA 3HLBA 3F1NB 4DXCA 4Y17A 3T50A 3UMEA 4WN5A 4X1LA 1MBLA 2H0TA 1H8MA 4DMZA 4WELA 4UHUA 4KZ5A 5DVAA 4X53A 1YQSA 1S1ZA 2A3UA 4KENB 4I39A 2WKRA 3SS5A 3S1YA 3GMWA 4DJ3A 1XFNA 4S2MA 2JC7A 5CEDA 1LL5A 2LB9A 1X0OA 2B5RA 3ISGA 2XA7M 4BBUA 5E2GA 1H0MA 5CX7A 4YWZA 2J3WA 4MMNA 1CI9A 2A2LA 3C30A 1JWVA 4NEED 4OOMA 1HD8A 5DJTA 3WS5A 1W79A 3CJMA 2ZLYA 4P6BA 2PRFA 2K2NA 3BY9A 3VV4A 3A0RA 5KSCA 4N1HA 3N4IA 4GCZA 5HW3A 5IU1A 3MQQA 1ES4A 3LY4A 4F3LA 4E04A 4CLCE 4L9GA 1SZVA 5HAQA 5F82A 3UE0A 1P9RA 3V39A 1Q2PA 2Q0OA 4HQAA 3VOZA 3A3IA 2PYPA 2GNXA 4HBTA 2Y79A 4NXGA 4G3KA 3Q07A 1OTIA 2DRWA 4I3IA 1GCEA 3UB5P 3R7WA 5TBMA 4X55A 1ERMA 5HAIA 1IEMA 1CQAA 4PPRA 3A3EA 5GLCA 2WKIA 4IBRA 4BMWA 4C3QA 4XT2A 3KSHA 4U0XA 3CAXA 3IH8A 4LRZE 4BWIA 5EVIC 4ZRRA 1LL9A 3IHAA
chains in the Genus database with same CATH topology
3NHQA 4EQ1A 3EGXC 2ZMFA 3EEHA 1DP6A 3U2AA 4BBVA 3OLOA 4G3WA 4I3JA 2CMNA 3VE3A 1LSVA 4GS9B 4EU0A 4I38A 3LR5A 1IOUA 4L9FA 2HV1A 1P0ZA 3W2ZA 4MN7A 2JKTI 5TJJA 3H9WA 3FPWA 3PBTA 3TRCA 3TJZC 5KSHA 1TF1A 1NWZA 3K3CA 3BQAA 1NRJA 5HL6A 3R7WB 5TBMB 4CLCD 1DP8A 2QJ7A 1YSQA 4WEKA 3JVUA 5K5BA 2W1TA 1N9NA 3LFVA 1OTEA 4KUOA 1YAXA 3B42A 4HH3A 3VE4A 4NXBA 4MN6A 2Z6CA 4XT2B 3KSGA 1H3QA 3HCYA 2EWVA 3EGDC 3T4KA 2OWHA 2QHKA 3ICYA 2EA9A 2YKHA 2KLIA 4AFIA 4ETZA 3MR0A 2W1RA 2XSSA 5DKKA 3A0VA 4BJPA 2VLGA 4RQ9A 3D3OA 4BBTA 3PR6A 2JHEA 4NXFA 2PHYA 1D7EA 2BASA 3LUQA 4ARZA 5HWVA 1WA9A 4R6LA 2L0WA 4EEUA 4CQHA 4L9EA 4JGPA 3BW6A 2ZMVA 2W3EA 1BYWA 1TS8A 1OTDA 1W63Q 5HWTA 1P9WA 2P7JA 2V9AA 1F5MA 2WKQA 1VB6A 4R3AA 5HDSA 2O0YA 2G7UA 2W1TB 4LLOB 4EESA 3PBNA 1XFQA 3H7WA 5HDCA 3C2WA 3E98A 2O9BA 2PT7A 4HY8A 1T19A 3LICA 1OT6A 2M7VA 4WLAA 4FSFA 4I3AA 2PDRA 3E4OA 4Q0IA 1MZUA 5HD3A 3V67A 3KSIA 4QPRA 3VOLA 5F6AA 3K3DA 1VHMA 3MFXA 4OOLA 4H6JA 4PHTA 3E4QA 5AVEA 4IUKA 1XJ2A 3CI6A 2D02A 3S7NA 1YKDA 3ULFA 2W3GA 4GHIA 3G6OA 4Z1WA 3DBAA 1OTBA 4LRYC 3A0SA 3LR0A 4ARZB 4HNBA 4Y2FA 1OJ5A 3ZYTA 4DJ2A 5HPIA 2O9AA 4Q0JA 4I5SA 5HSQA 1TD5A 3RFBA 2VJWA 4HJ4A 2VA0A 4HH2A 3PBSA 4MCWA 3GECA 1LT0A 3PHYA 3EEAA 3OC2A 4EERA 3H7WB 4B93A 4B9OA 1MC0A 3CITA 3LI9A 5J4EA 3LYXA 4EW7A 3H82A 1XJ3A 3KX0X 3LIBA 1N9OA 3GDIA 2OWJA 1GSXA 2VV8A 4YNRA 3PBOA 1UWPX 5DFXA 3CUEA 5I5LA 1ZTUA 2M1CA 3KO6A 4UQIS 4H6JB 2VKSA 5F5YA 5G4YA 2KOIA 3FPVA 2Z6DA 4GHIB 2L1MA 1P97A 5F69A 4MN5A 2W3DA 2HGVA 5DF9A 3UE6A 1JNUA 5G4ZA 3NOPC 3NOTC 2A24A 2FH5A 4G3VA 4PAUA 5DFYA 5HWWA 1V9ZA 3PYPA 2VV7A 4HOIA 4K08A 4KUKA 4IHQA 2KDKA 1OT9A 3RH8B 2QJ5A 3CLOA 2J3TC 4Y3IA 1F9IA 2PYRA 5FL3A 4PKYA 2VZWA 3H82B 5MC7A 4HJ6A 4LPZA 3ZQ5A 3E0YA 3IBRA 1T1AA 2NUTC 2XROA 4UQIM 3S7PA 2W27A 5LBRA 1GSWA 1T1CA 1TS6A 2MJ6A 4R38A 4HIAA 3P7NA 3PBQA 2V1AA 3C38A 3CWFA 4IUHA 4JGRA 5IT5A 1N9LA 2ZBBA 3UB7A 3KYQA 2FZ0A 3T4LA 2P08A 2A24B 2JKTM 1OTAA 3T4SA 4M4XA 2OAQ1 2JN7A 3O5YA 3OCLA 3R4KA 2LB5A 3LI8A 5C5KA 3MMHA 1TS0A 2PD8A 3EQUA 2VV6A 3IS2A 1LSWA 4CLCA 1V9YA 2YKFA 2W3FA 4HHDA 2ZOIA 3T4OA 4L0LA 3BY8A 5IS1A 2VX8A 1T1BA 5DKLA 4EXOA 4O8GA 3PBRA 2OOLA 4ETXA 4YOFA 3EOIA 3EWKA 3EQVA 2H28A 3OBFA 1TS7A 3PXPA 2PD7A 3P01A 1T18A 4HP4A 3FC7A 2PR6A 2JKRM 3JVVA 3HJIA 2GX5A 2OAP1 3BWLA 4NKPA 1LL8A 5EFWA 2HJ9C 2D01A 2ZOHA 3F1NA 2V0WA 4FOFA 2J3TD 1F98A 3MQ0A 2VGLS 2INWA 4EUVA 1D06A 4HP9A 4Y5FA 4WUJA 4NXEA 3KSFA 3RTYA 4GJ4A 1ODVA 1S67L 3LIDA 3B47A 1STZA 3B33A 3MQOA 5F68A 1KOUA 2QYBA 3K2NA 4DN0A 4PKYG 5J3WA 1IFQA 2PR5A 3TE8A 3UMDA 3CUEC 4R70A 2XA7S 5HD5A 3UB9A 4IJGA 4GLQA 2W3HA 4UEYA 1S4SA 3LR4A 3KYZA 5A8BA 3F1NB 2VGLM 5AJGA 2HF6A 3T50A 3UMEA 4WN5A 4O0PA 1H8MA 1Y28A 4DMZA 1LSXA 1ZHHB 3F1PA 3OOVA 4WELA 2K7SA 2NUPC 3LIAA 1GSVA 1S1ZA 4WF0A 2K31A 4I39A 4ME4A 2WKRA 1W63M 4EEPA 4DJ3A 1XFNA 3SW1A 1XJ4A 3NOUC 3S7QA 2LB9A 3TW8A 1X0OA 2XA7M 1S66L 4HJ3A 4BBUA 2L4RA 4Q0HA 3LR3A 5HPFA 5CX7A 4YWZA 3FG8A 2J3WA 4MMNA 4JGQA 3T4JA 4O01A 4II7A 1DP9A 2A2LA 3C30A 3LIEA 4NEED 4OOMA 3BJNA 5DJTA 5HZHA 3C8CA 5L8MA 2K2NA 3BY9A 3VV4A 3A0RA 4MDZA 2V1BA 4P6ZS 2QKPA 3F1PB 4HI4A 2JKRI 4GCZA 5J7EA 5IU1A 3MQQA 4F3LA 1DRMA 1UWNX 1UGUA 1XJ6A 2GJ3A 5AVFA 1G6OA 2DMWA 4CLCC 4CLCE 4E04A 3D72A 1EW0A 1MKMA 2R78A 3E4PA 2V0UA 2B18A 2O99A 4L9GA 1NLYA 4KQOA 5KIZA 2M7UA 3LIFA 3UE3A 4EETB 3F1OA 3HJKA 2P04A 2WKPA 1P9RA 2HJEA 3IBJA 3T4QA 4GW9A 3MXQA 3S7OA 1YSPA 4HQAA 2VEAA 2B02A 2PYPA 4WEJA 1OPXA 2GNXA 4GS9A 2Y79A 4NXGA 4P6ZM 4G3KA 3IS2B 1S4RA 3MJQA 3NJAA 1OTIA 4CLCB 2XRNA 1OJGA 4LRXC 4I3IA 2GZAA 2J80A 4F3LB 2W0NA 5DJUA 3R7WA 5TBMA 3MF0A 1NLZA 3T4TA 2O9CA 4WL9A 3BQ8A 3UB6A 2Y8HA 5HDDA 2KX6A 1G28A 1S1YA 4BMWA 3F1OB 4XT2A 3OCNA 3KSHA 3UB8A 4KQDA 4JGOA 3CAXA 4LRZE 4BWIA 2EWWA 2IA2A 4ZRRA 2I9VA 2QWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHQ A;  4EQ1 A;  3EEH A;  1DP6 A;  4BBV A;  3OLO A;  4I3J A;  2CMN A;  3VE3 A;  1LSV A;  4GS9 B;  4I38 A;  4L9F A;  2HV1 A;  1P0Z A;  3H9W A;  1NWZ A;  3K3C A;  5TBM B;  1DP8 A;  2QJ7 A;  1N9N A;  1OTE A;  4KUO A;  4HH3 A;  3VE4 A;  4NXB A;  4MN6 A;  2Z6C A;  4XT2 B;  2OWH A;  2QHK A;  3ICY A;  2EA9 A;  2YKH A;  3MR0 A;  5DKK A;  3A0V A;  2VLG A;  4RQ9 A;  4BBT A;  2JHE A;  4NXF A;  2PHY A;  1D7E A;  2BAS A;  3LUQ A;  5HWV A;  1WA9 A;  4R6L A;  2L0W A;  4EEU A;  4L9E A;  4JGP A;  1BYW A;  1TS8 A;  1OTD A;  5HWT A;  2P7J A;  2V9A A;  4R3A A;  2WKQ A;  1VB6 A;  5HDS A;  4LLO B;  4EES A;  1XFQ A;  3H7W A;  5HDC A;  3C2W A;  4HY8 A;  1T19 A;  3LIC A;  1OT6 A;  4WLA A;  4I3A A;  2PDR A;  3E4O A;  1MZU A;  5HD3 A;  3VOL A;  5F6A A;  3K3D A;  3MFX A;  4H6J A;  3E4Q A;  5AVE A;  1XJ2 A;  2D02 A;  3ULF A;  4GHI A;  3G6O A;  1OTB A;  4LRY C;  3A0S A;  4HNB A;  1OJ5 A;  4DJ2 A;  4I5S A;  5HSQ A;  4HJ4 A;  4HH2 A;  3GEC A;  1LT0 A;  3PHY A;  4EER A;  3H7W B;  4B9O A;  5J4E A;  3LI9 A;  3LYX A;  4EW7 A;  3H82 A;  1XJ3 A;  3KX0 X;  3LIB A;  1N9O A;  3GDI A;  2OWJ A;  1GSX A;  2VV8 A;  1UWP X;  5I5L A;  2M1C A;  4H6J B;  5F5Y A;  5G4Y A;  2Z6D A;  4GHI B;  2L1M A;  1P97 A;  5F69 A;  4MN5 A;  3UE6 A;  1JNU A;  5G4Z A;  3NOP C;  3NOT C;  2A24 A;  5HWW A;  1V9Z A;  3PYP A;  2VV7 A;  4HOI A;  4K08 A;  4KUK A;  2KDK A;  1OT9 A;  3RH8 B;  2QJ5 A;  3CLO A;  1F9I A;  2PYR A;  4PKY A;  3H82 B;  4HJ6 A;  3ZQ5 A;  4LPZ A;  3IBR A;  1T1A A;  2W27 A;  1GSW A;  1T1C A;  1TS6 A;  4R38 A;  4HIA A;  3P7N A;  2V1A A;  3CWF A;  4JGR A;  1N9L A;  2ZBB A;  3UB7 A;  2A24 B;  1OTA A;  4M4X A;  2JN7 A;  3LI8 A;  1TS0 A;  2PD8 A;  2VV6 A;  3IS2 A;  1LSW A;  1V9Y A;  2YKF A;  4HHD A;  2ZOI A;  3BY8 A;  5IS1 A;  1T1B A;  5DKL A;  4EXO A;  2OOL A;  3EWK A;  2H28 A;  1TS7 A;  2PD7 A;  1T18 A;  4HP4 A;  3FC7 A;  2PR6 A;  3HJI A;  3BWL A;  1LL8 A;  5EFW A;  2D01 A;  2ZOH A;  3F1N A;  2V0W A;  1F98 A;  2INW A;  1D06 A;  4HP9 A;  4WUJ A;  4NXE A;  3RTY A;  1ODV A;  1S67 L;  3LID A;  3MQO A;  3B33 A;  5F68 A;  1KOU A;  4PKY G;  5J3W A;  2PR5 A;  3UMD A;  4R70 A;  5HD5 A;  3UB9 A;  1S4S A;  5A8B A;  3F1N B;  3T50 A;  3UME A;  4WN5 A;  1Y28 A;  1LSX A;  3F1P A;  2K7S A;  3LIA A;  1GSV A;  1S1Z A;  4WF0 A;  4I39 A;  2WKR A;  4EEP A;  4DJ3 A;  1XFN A;  3SW1 A;  1XJ4 A;  3NOU C;  1X0O A;  4HJ3 A;  1S66 L;  4BBU A;  2L4R A;  4YWZ A;  3FG8 A;  4JGQ A;  1DP9 A;  3LIE A;  5DJT A;  5HZH A;  3C8C A;  3BY9 A;  3A0R A;  2V1B A;  2QKP A;  3F1P B;  4HI4 A;  4GCZ A;  5J7E A;  5IU1 A;  3MQQ A;  4F3L A;  1DRM A;  1UWN X;  1UGU A;  1XJ6 A;  2GJ3 A;  5AVF A;  4E04 A;  3D72 A;  1EW0 A;  2R78 A;  3E4P A;  2V0U A;  4L9G A;  5KIZ A;  3LIF A;  4EET B;  3F1O A;  3HJK A;  2WKP A;  4GW9 A;  3MXQ A;  4HQA A;  2VEA A;  2B02 A;  2PYP A;  4GS9 A;  4NXG A;  3IS2 B;  1S4R A;  3MJQ A;  3NJA A;  1OTI A;  1OJG A;  4LRX C;  4I3I A;  2J80 A;  4F3L B;  2W0N A;  5DJU A;  5TBM A;  4WL9 A;  3UB6 A;  5HDD A;  2KX6 A;  1G28 A;  1S1Y A;  3F1O B;  4XT2 A;  3UB8 A;  4KQD A;  4JGO A;  3CAX A;  4LRZ E;  2I9V A;  2QWS A; 
#chains in the Genus database with same CATH topology
 4EQ1 A;  3EGX C;  1DP6 A;  3BM6 A;  4BBV A;  3RXW A;  4GS9 B;  2RL3 A;  5JYO A;  4U0T A;  2HV1 A;  4MN7 A;  3GRJ A;  4WZ5 A;  5TJJ A;  4KZ3 A;  1FR6 A;  3TRC A;  4FH2 A;  2EX8 A;  1W8Q A;  1I5Q A;  3PAE A;  1DP8 A;  2Y2Q A;  4OQI A;  4WEK A;  5EVI B;  2ZQ7 A;  1N9N A;  4HH3 A;  2X02 A;  2EFX A;  4MN6 A;  5EE8 A;  2Z6C A;  1H3Q A;  1KGF A;  3HCY A;  3T1Q B;  1ERQ A;  1KVM A;  2WGV A;  2QHK A;  2YKH A;  4GDB A;  2ZC7 A;  3UPN A;  4AFI A;  3MR0 A;  2ZL1 A;  4LFU A;  3AGE A;  3A0V A;  1XPB A;  3W8K A;  2VLG A;  4BBT A;  4KG5 A;  2BAS A;  2BG1 A;  3VFH A;  4A5R A;  5EV0 A;  2FFY A;  5HWT A;  2V9A A;  1VB6 A;  4E3I A;  3IX4 A;  1LI9 A;  2XDM A;  4EES A;  3UPO A;  4KQR A;  1XFQ A;  5FQK A;  2O9B A;  2PT7 A;  1T19 A;  1OT6 A;  5GLD A;  5EUA A;  3V67 A;  5HD3 A;  3GR2 A;  5DTK A;  1VHM A;  3MFX A;  2C5W B;  3UPP A;  2ZMA A;  4PHT A;  1S6R A;  1MKI A;  1XJ2 A;  3CI6 A;  2D02 A;  2W3G A;  3VFF A;  1K55 C;  3DBA A;  1OTB A;  2J9O A;  4BEN A;  4GN2 A;  3A0S A;  1CEG A;  4HNB A;  5FSR A;  4LV2 A;  3NEC A;  4DJ2 A;  2O9A A;  3UDX A;  3DTM A;  1NXY A;  1N4O A;  1K57 C;  2VJW A;  2ZM2 A;  3EEA A;  5M1A A;  5BOH A;  4IVI A;  3H7W B;  4B93 A;  4B9O A;  4R4R A;  1DJB A;  3CIT A;  3LI9 A;  5J4E A;  1XJ3 A;  3LIB A;  2Y4A A;  1MWU A;  2Y2L A;  3QP1 A;  4GD8 A;  4KG6 A;  5DFX A;  1ZTU A;  2M1C A;  5DF7 A;  4UQI S;  3QNC A;  4H6J B;  5F5Y A;  3BFF A;  2Z6D A;  4GHI B;  1Q2Q A;  4E6X A;  4DE2 A;  4MN5 A;  3UE6 A;  2V20 A;  3NOP C;  3VOY A;  4G3V A;  4JKT A;  3L7H A;  5HWW A;  2VV7 A;  4K08 A;  3DTI A;  4KUK A;  3ZVT A;  3CLO A;  3ZG0 A;  1FCM A;  1F9I A;  4PKY A;  3H82 B;  3BLM A;  3ZQ5 A;  3IBR A;  1T1A A;  5EPH A;  4E6W A;  2V8F A;  2XRO A;  2W27 A;  1SDN A;  1T1C A;  2MJ6 A;  2G2U A;  2V2F F;  4OOY A;  4WM9 A;  3RXX A;  4C6Y A;  3DWK A;  1XA7 A;  1K38 A;  3C5A A;  2P08 A;  1QME A;  4GKU A;  3G2Y A;  5CTN A;  4JF6 A;  4XUZ A;  2LB5 A;  3LI8 A;  3MMH A;  1E4D A;  1TS0 A;  5L10 A;  1BUE A;  3EQU A;  3G2Z A;  3IS2 A;  3NDE A;  5TGF A;  3VP0 A;  1VET A;  2GDN A;  4X69 A;  1H5X A;  5GL9 A;  1V9Y A;  2YKF A;  3G31 A;  5U47 A;  3HLG A;  3BY8 A;  5IS1 A;  4E3M A;  5DKL A;  4OKP A;  1ONG A;  4HEF A;  2WZZ A;  1IYP A;  3HL9 A;  3EOI A;  1GHI A;  1YMS A;  2EFU A;  3P01 A;  4HP4 A;  3W4O A;  3VSL A;  1BLP A;  5HL1 A;  1WE4 A;  2GX5 A;  3BWL A;  1SKO A;  3V3S A;  2ZM0 A;  2Y2J A;  5FEG A;  3O3V A;  1MWR A;  2VGL S;  2INW A;  1PZP A;  2XQZ A;  3G32 A;  2R9X A;  5GHY A;  3CG5 A;  3KSF A;  3NIA A;  3RTY A;  1S67 L;  5FAS A;  3LID A;  3B47 A;  1STZ A;  4E3N A;  1PZO A;  1NJ4 A;  1KOU A;  5A93 A;  1GHP A;  1HTZ A;  1L0D A;  4PKY G;  5J3W A;  1IFQ A;  3IWI A;  4GNU A;  1MY8 A;  1E3U A;  2PR5 A;  2BTF P;  2WKH A;  4R70 A;  2XH9 A;  4LEN A;  3CMZ A;  5CER A;  2V1Z A;  1S4S A;  4ZAM A;  3IF6 A;  4X6T A;  2ZQC A;  2JBF A;  5EOO A;  5AJG A;  2HF6 A;  5FEF A;  1WYC A;  1ES5 A;  1XA1 A;  1ZHH B;  3F1P A;  2K7S A;  3IQA A;  3UDI A;  2EX2 A;  4JLF A;  3IT9 A;  3IF5 A;  2ZQA A;  4KZ9 A;  3SW1 A;  3NOU C;  2WKE A;  3TW8 A;  3SS3 A;  1S66 L;  3OPP A;  3ZVW A;  5HPF A;  2ZD8 A;  1L3L A;  3T4J A;  4O01 A;  3QP2 A;  2HDU A;  4II7 A;  4Y7P A;  2OLU A;  3M6B A;  3GVB A;  5CHM A;  4DE1 A;  4B4X A;  5L8M A;  1Y4O A;  1M6K A;  4PM9 A;  1MWS A;  1EWZ A;  2JE5 A;  4P6Z S;  4HI4 A;  4PMA A;  4R4S A;  2QMI A;  1UWN X;  5AVF A;  1G6O A;  4KQQ A;  4CLC C;  3D72 A;  4R23 A;  3FZC A;  4X1M A;  2V0U A;  4S2K A;  2B95 A;  1PI4 A;  3F1O A;  2P04 A;  3MZE A;  2HJE A;  3SH9 A;  2XFT A;  3MXQ A;  4JXV A;  2HPB A;  3LGO A;  1G68 A;  1YT4 A;  5HX9 A;  4WEJ A;  1OPX A;  5HAP A;  4FH4 A;  1SCW A;  2EX9 A;  4CLC B;  2XRN A;  2Z2L B;  1OJG A;  4LRX C;  3G35 A;  2GZA A;  2E8I A;  4K91 A;  4F3L B;  2W0N A;  5FQJ A;  2EX6 A;  1NLZ A;  4WL9 A;  2E8J A;  3OPR A;  2Y8H A;  3UB6 A;  1K54 A;  5FDH A;  2KX6 A;  2P9V A;  3VP3 A;  1WYB A;  5FAT A;  3HVF A;  2EWW A;  2IA2 A;  1RCJ A;  4OQH A;  4NK3 A;  4UA9 A;  3VP2 A;  4WZ4 A;  2XR0 A;  5HWV A;  3QP4 A;  4UA6 A;  1LLB A;  3OLO A;  4G3W A;  4HES A;  4I3J A;  2CMN A;  3VE3 A;  4B4Z A;  1FCO A;  1LSV A;  4I38 A;  3LR5 A;  4EBN A;  3OPL A;  5FAO A;  2JKT I;  3FPW A;  1TF1 A;  3K3C A;  3BQA A;  3R7W B;  5TBM B;  3HLE A;  2QJ7 A;  5M18 A;  4WZ5 C;  4KZ7 A;  2Y55 A;  1OTE A;  4CJN A;  1Z09 A;  4S2N A;  3VE4 A;  4NXB A;  1VEU A;  4HBU A;  4JBF A;  1YLZ A;  5E2E A;  4XT2 B;  3KSG A;  5CEB A;  4QY5 A;  2XEP A;  3EGD C;  4DDY A;  4N92 A;  2P74 A;  3HUN A;  2EA9 A;  5F1F A;  2KLI A;  2OLV A;  3VSK A;  3HBR A;  4H8R A;  5DKK A;  4BJP A;  4RQ9 A;  1NZU A;  4LV1 A;  2RCX A;  2J8Y A;  3PR6 A;  2PHY A;  2EXB A;  1D7E A;  5EVL A;  4NET A;  2W3E A;  4BLM A;  3OPH A;  5HDS A;  3LO7 A;  2G7U A;  1FSY A;  3IWQ A;  1YM1 A;  5HDC A;  3E98 A;  4ZDX A;  4HY8 A;  3FKV A;  4R3B A;  2M7V A;  4RVA A;  4WLA A;  4QWO A;  3E4O A;  4QPR A;  1E3U D;  5F6A A;  2XGN A;  4P85 A;  5FI7 A;  2ZL1 B;  4OOL A;  3LCE A;  1YKD A;  3ULF A;  4ZJ3 A;  1YLP A;  2Q9M A;  4Z1W A;  1KE0 A;  3T1S A;  4LRY C;  3LR0 A;  2Y2P A;  5FQM A;  4Y2F A;  1S0W A;  4QJG A;  3N6I A;  4Y0O A;  3ZGA B;  3GTC A;  4DE3 A;  3NI9 A;  5A90 A;  1H8Z A;  4HJ4 A;  5TFQ A;  3VMA A;  2VA0 A;  1A0K A;  4KZA A;  3GEC A;  3T1X A;  2VGK A;  1BLH A;  4E3O A;  1CK3 A;  4WMC A;  3IXD A;  3LYX A;  4DRT A;  2OWJ A;  2EXA A;  3PBO A;  2ZC3 B;  3CUE A;  3U4L P;  4E3L A;  3KO6 A;  1PYY A;  5HFO A;  2WAE A;  2L1M A;  5F69 A;  4WYY A;  1JNU A;  1IYS A;  2A24 A;  1HVB A;  4PAU A;  3RJU A;  1KE3 A;  4ZBE A;  1V9Z A;  3PYP A;  1CEF A;  4HOI A;  4EQI A;  3NC8 A;  5FAP A;  1SHV A;  2J3T C;  1VQQ A;  4S2L A;  2VZW A;  4HJ6 A;  4XUX A;  4LPZ A;  4EBL A;  2NUT C;  3S7P A;  5LBR A;  5JYP A;  3QP5 A;  1IYQ A;  3N7W A;  4HIA A;  2OV5 A;  3P7N A;  3PBQ A;  5CGX A;  4JGR A;  5IT5 A;  1N9L A;  2ZBB A;  3KYQ A;  2Y2K A;  1YLW A;  4IED A;  4IBX A;  3T4L A;  2VK3 A;  2JKT M;  5FA7 A;  3S22 A;  4GB7 A;  3O86 A;  3ZDJ A;  2JN7 A;  3O5Y A;  1CI8 A;  1TDL A;  1Z6F A;  3GQZ A;  3CPT A;  4OPY A;  1TVF A;  2PU2 A;  2PBD P;  2WYX A;  1G5U A;  2W3F A;  2Z2M B;  3A3F A;  2Y2M A;  4M3K A;  3TG9 A;  4X68 A;  5AQ7 A;  2OOL A;  1O7E A;  1EI5 A;  5EM0 A;  4P87 A;  3OBF A;  2PD7 A;  1T18 A;  2ACG A;  3C4O A;  4R0Q A;  4U3T A;  2ZM8 A;  3NUL A;  4D2O A;  3JVV A;  2PAV P;  5DTS A;  4FCF A;  2D01 A;  2ZOH A;  2V8C A;  1DJA A;  4FUW A;  4EV4 A;  1F98 A;  1BLC A;  1VET B;  4OPQ A;  4WUJ A;  3PTE A;  1ODV A;  4OQG A;  5F68 A;  3JYI A;  4DN0 A;  2XF3 A;  1TEM A;  3CHW P;  2XA7 S;  4S2J A;  3Q1F A;  1KDW A;  5CGS A;  3MXS A;  1SKO B;  3MFD A;  5A8B A;  4Y13 A;  2ZC6 B;  4RA7 A;  1IYO A;  4O0P A;  1Y28 A;  2WGW A;  4E3J A;  2WZX A;  4R3J A;  2NUP C;  3SZT A;  3LIA A;  4MEZ A;  1SKF A;  1F2K A;  4WF0 A;  2K31 A;  3FV7 A;  4ME4 A;  1VM1 A;  4N9L A;  3BFE A;  4C75 A;  1XJ4 A;  1IKI A;  4RYE A;  3S7Q A;  2Q9N A;  2HP5 A;  4LV3 A;  3TOI A;  2L4R A;  4Q0H A;  3LR3 A;  4OLG A;  1LI0 A;  1QMF A;  4LGW A;  3FG8 A;  4JGQ A;  1DP9 A;  3DTK A;  1K25 A;  3IF6 B;  4MDZ A;  3W4P A;  3ZFZ A;  3UY6 A;  2QKP A;  3F1P B;  2JKR I;  1FIL A;  5A91 A;  1K4E A;  3HUO A;  3NCK A;  5FQ9 A;  1UGU A;  1XJ6 A;  2XFS A;  4WMC D;  3E4P A;  1EW0 A;  2WGI A;  2A49 A;  2B18 A;  2O99 A;  1NLY A;  5KIZ A;  1J9M A;  5GLB A;  3LIF A;  4NG2 A;  2G2W A;  3HJK A;  1XKZ A;  4R1G A;  3IBJ A;  4GW9 A;  3S7O A;  1K55 A;  3Q7V B;  1YSP A;  5G18 A;  3LEZ A;  2VEA A;  5AQ9 A;  4OPZ A;  3ZG5 A;  2B02 A;  3ITA A;  1S4R A;  1NY0 A;  3MJQ A;  3IXB A;  2ZJ9 A;  1K57 A;  3A3J A;  1D1J A;  2J80 A;  5CEC A;  3C7V A;  4BL2 A;  5F1G A;  2JKF A;  1Y54 A;  4K0X A;  2O9C A;  5D3O A;  3BQ8 A;  2DNS A;  1G28 A;  1S1Y A;  4BQM A;  3F1O B;  3E2K A;  3P09 A;  3UB8 A;  1CJF A;  1JWP A;  3P98 A;  4JGO A;  4KQD A;  2WK0 A;  1K54 C;  2QWS A;  3NHQ A;  1W5D A;  2X71 A;  1HLU P;  2QZ6 A;  3VP4 A;  1XX2 A;  4XXR A;  1IOU A;  4L9F A;  3W2Z A;  3H9W A;  5KSH A;  1K6R A;  5HL6 A;  3N8S A;  1BLS A;  1YSQ A;  2QPN A;  5K5B A;  2W1T A;  2ZC4 B;  4KUO A;  1YAX A;  4OP8 A;  2J7V A;  1KE4 A;  2EWV A;  3HLW A;  1L0F A;  4X56 A;  4S2N C;  2FFF B;  2XK1 A;  4ETZ A;  3GV9 A;  1XXM A;  2BLS A;  3JPU A;  3D3O A;  4LCM A;  1ZG6 A;  3LUQ A;  4ARZ A;  4R6L A;  4BD0 A;  2L0W A;  4JGP A;  2ZMV A;  2AVX A;  2I72 A;  2Y2O A;  1U60 A;  3DW0 A;  2Y2I A;  4R3A A;  2WKQ A;  1L2S A;  3ZCZ A;  2O0Y A;  4LLO B;  4KZB A;  3PBN A;  4EWF A;  1VEU B;  3C2W A;  3MZF A;  5EVI D;  1GA0 A;  3G34 A;  4DF6 A;  4I3A A;  1MZU A;  1G6A A;  5IHV A;  3K3D A;  1YLJ A;  4PM7 A;  4MBH A;  5AVE A;  4QY6 A;  2JCH A;  4IUK A;  3G6O A;  1KVL A;  2HZ5 A;  1PFL A;  1NYY A;  1OJ5 A;  3ZYT A;  3WRT A;  5HPI A;  4Q0J A;  4I5S A;  1TD5 A;  3RFB A;  4MCW A;  1IKG A;  3PHY A;  3OC2 A;  4EER A;  1MC0 A;  3MKE A;  4EW7 A;  1LHY A;  1GSX A;  4YNR A;  3ZG9 B;  1C3B A;  5I5L A;  3ZG8 B;  4Y0T A;  5DF8 A;  2KOI A;  5HAR A;  1PWG A;  1XGI A;  2HGV A;  5DF9 A;  1PRQ A;  4DKI A;  2FH5 A;  1FSW A;  3IHB A;  5DFY A;  2Y91 A;  4IHQ A;  3WWX A;  3RH8 B;  1OT9 A;  1ZG4 A;  4MBF A;  4Y3I A;  1RGZ A;  4PM6 A;  3BEC A;  2PYR A;  2CC1 A;  1ES2 A;  2J9P A;  1YMX A;  4UQI M;  4LV0 A;  4R38 A;  2WUQ A;  3C38 A;  4Y0U A;  1DY6 A;  2ZQ9 A;  2IWD A;  3UB7 A;  5EVE A;  2FZ0 A;  4GD6 A;  1RP5 A;  4D60 A;  3HLF A;  3FYZ A;  3SOI A;  2A24 B;  4ZTK A;  1OTA A;  4M4X A;  3M6H A;  2HDR A;  1GA9 A;  2OAQ 1;  3QHY A;  3M2J A;  5J8X A;  1PWD A;  5AQB A;  1PIO A;  4CLC A;  4CPK A;  1W7F A;  4L0L A;  2UWX A;  1T1B A;  4MBK A;  4EXO A;  4O8G A;  1N9B A;  1BSG A;  1FQG A;  3PBR A;  4ETX A;  2C6W B;  3EWK A;  2Y2N A;  2DCF A;  2H28 A;  3EQV A;  3PXP A;  3FC7 A;  2IWC A;  4Y15 A;  3E2L A;  4OP5 A;  1YLY A;  3F1N A;  4S2I A;  2V0W A;  4FOF A;  1O07 A;  4S2O A;  1PNE A;  5FI6 A;  3ZNY A;  3CPT B;  4Y5F A;  2HDS A;  4YIN A;  3HUM A;  3V5M A;  2HP6 A;  3MQO A;  3Q7Z A;  3FWL A;  3G4P A;  4DXB A;  3TE8 A;  3UMD A;  5HD5 A;  3WS1 A;  3UB9 A;  4IJG A;  4GLQ A;  2W3H A;  4F94 A;  3WS0 A;  3IX8 A;  2VGL M;  4QB8 A;  4EBP A;  1ZKJ A;  3BEB A;  1LSX A;  5DTT A;  3OOV A;  3HLC A;  4MLL A;  1GSV A;  3IXG A;  3A3D A;  4Q8I A;  1W63 M;  4EEP A;  4N1X A;  3B3X A;  1PWC A;  3MXR A;  4GOG A;  4HJ3 A;  4RX2 A;  3GSG A;  3LY3 A;  5FDS A;  3M2K A;  3IXH A;  5M19 A;  3DWZ A;  3V3R A;  3LIE A;  3D9Y A;  3BJN A;  1H8Y A;  3N8L A;  5HZH A;  3C8C A;  3O88 A;  3BLS A;  2V1B A;  2WGW B;  2Y2G A;  2JKG A;  5J7E A;  3C7U A;  5FQI A;  1FCN A;  1DRM A;  1JTD A;  2GJ3 A;  2DMW A;  2R78 A;  1MKM A;  1FIK A;  3DAV A;  4KQO A;  3T1R A;  2M7U A;  3UE3 A;  3ZHH A;  4EET B;  3S4X A;  5A92 A;  2WKP A;  1BT5 A;  5E2F A;  4OON A;  3T4Q A;  1HZO A;  1SDE A;  3IWO A;  4FD8 A;  1NZO A;  4JXW A;  3ITB A;  2HP9 A;  4GS9 A;  2XLN A;  4P6Z M;  3IS2 B;  3NJA A;  3MSH A;  3G30 A;  1KGE A;  3MZD A;  3SH7 A;  1K6S A;  1XP4 A;  5DJU A;  4JXG A;  3MF0 A;  3T4T A;  1ESU A;  2PU4 A;  2WAD A;  4PM5 A;  5EVI A;  5CGW A;  5E43 A;  3V50 A;  5HDD A;  3WRZ A;  2Y2H A;  4WBG A;  3BFD A;  1YLT A;  5GHZ A;  1MXO A;  3OCN A;  5L07 A;  4LCL A;  2I9V A;  2VKS A;  3UDF A;  1K0K A;  2ZMF A;  3EEH A;  5CXW A;  3U2A A;  3OZH A;  1CF0 A;  3UO9 A;  4EU0 A;  4ID4 A;  1P0Z A;  3FKW A;  3IF6 C;  3PBT A;  3TJZ C;  1NWZ A;  1NRJ A;  5FQQ A;  3ZNT A;  4CLC D;  1K56 A;  5FI2 A;  2ZQ8 A;  4YFM A;  3JVU A;  3UE1 A;  3LFV A;  4B88 A;  3B42 A;  2ZC5 B;  3MKF A;  2OSU A;  4RX3 A;  1MPL A;  5CRF A;  1PW1 A;  3TSG A;  2VGJ A;  3QNB A;  3T4K A;  2OWH A;  4OPR A;  3ICY A;  2ZQD A;  1OME A;  2W1R A;  5L2F A;  2XSS A;  3VP1 A;  2JHE A;  4NXF A;  4FTX A;  1WA9 A;  1ONH A;  4OLD A;  4EEU A;  4CQH A;  4L9E A;  1M40 A;  3BW6 A;  1BYW A;  1W63 Q;  1TS8 A;  1OTD A;  1P9W A;  2P7J A;  1F5M A;  1ALQ A;  2W1T B;  1DJC A;  4ZJ2 A;  1BTL A;  3I7J A;  4S2P A;  3H7W A;  4ESP A;  4PM8 A;  3LIC A;  3HRE A;  5GLA A;  2XD1 A;  4EUZ A;  4FSF A;  4GZB A;  3BFC A;  4UAA A;  2PDR A;  4Q0I A;  1I2W A;  3KSI A;  3VOL A;  3ZG7 B;  5E2H A;  4E3K A;  5F83 A;  4H6J A;  3E4Q A;  4Z9Q A;  3NY4 A;  3S7N A;  4GHI A;  3NDG A;  4ARZ B;  4P0M A;  5EOE A;  1JWZ A;  5HSQ A;  5FAQ A;  3IX3 A;  4QU3 A;  4HH2 A;  3PBS A;  3UNW A;  1LT0 A;  1J3W A;  1FOF A;  5L09 A;  3H82 A;  3KX0 X;  1N9O A;  3GDI A;  5CHJ A;  1FR1 A;  2VV8 A;  3Q82 A;  1I2S A;  1UWP X;  4OVD A;  1BUL A;  3DTE A;  4KZ4 A;  1W8Y A;  5KZH A;  4JF4 A;  1PW8 A;  3LEQ A;  3D4F A;  2UV0 E;  5G4Y A;  3FPV A;  3WS4 A;  1P97 A;  4BD1 A;  2W3D A;  5G4Z A;  4BL3 A;  3NOT C;  4OH0 A;  3NBL A;  3WS2 A;  1ESI A;  2Y59 A;  1ES3 A;  3QP8 A;  2KDK A;  3AGD A;  2QJ5 A;  4QD4 A;  3N8R A;  2P9V B;  2HDQ A;  1IEL A;  3O87 A;  1L0E A;  3KYE A;  5FL3 A;  4OQ0 A;  1AXB A;  5MC7 A;  3C4P A;  5CTM A;  3W4Q A;  3E0Y A;  4KZ6 A;  2H5S A;  1GSW A;  3Q81 A;  1TS6 A;  3AGF A;  2H10 A;  3BFG A;  1K4F A;  2V1A A;  3CWF A;  4IUH A;  4ZJ1 A;  1NRF A;  4X25 A;  3QP6 A;  1AWI A;  2WAF A;  1PI5 A;  3T12 B;  1MWT A;  3T4S A;  1GHM A;  5KMW A;  3Q7V A;  3OCL A;  3R4K A;  1BZA A;  5C5K A;  2PD8 A;  2PBY A;  2VV6 A;  1KGG A;  1LSW A;  3PAG A;  4HHD A;  3MS6 A;  4KG2 A;  2ZOI A;  3T4O A;  2VX8 A;  4JF5 A;  4YOF A;  4N9K A;  3HLD A;  2R9W A;  4DDS A;  3UN7 A;  1JTG A;  1TDG A;  1TS7 A;  4MNR A;  1ERO A;  4IVK A;  2PR6 A;  3SS4 A;  1L0G A;  2JKR M;  5I94 A;  3HJI A;  2OAP 1;  3SH8 A;  4NKP A;  1LL8 A;  5EFW A;  2HJ9 C;  5AQA A;  1RGY A;  4K0W A;  4JPM A;  2J3T D;  3MQ0 A;  5EEC A;  4EUV A;  1K56 D;  4UA7 A;  1D06 A;  4HP9 A;  4NXE A;  5EM1 A;  3BYD A;  1NYM A;  4O7D A;  4QHC A;  4GJ4 A;  5TR7 A;  2IWB A;  3B33 A;  1JVJ A;  1ZC2 A;  1YPR A;  2QYB A;  3BRM A;  3K2N A;  1E25 A;  2H0Y A;  3MBZ A;  1XGJ A;  1ACF A;  3IH9 A;  5CHU A;  3L9K A;  4KZ8 A;  4JXS A;  5GHX A;  3CUE C;  4DE0 A;  2X01 A;  2XD5 A;  4UEY A;  3CZD A;  1KDS A;  4GDN A;  3LR4 A;  3KYZ A;  3HLB A;  3F1N B;  4DXC A;  4Y17 A;  3T50 A;  3UME A;  4WN5 A;  4X1L A;  1MBL A;  2H0T A;  1H8M A;  4DMZ A;  4WEL A;  4UHU A;  4KZ5 A;  5DVA A;  4X53 A;  1YQS A;  1S1Z A;  2A3U A;  4KEN B;  4I39 A;  2WKR A;  3SS5 A;  3S1Y A;  3GMW A;  4DJ3 A;  1XFN A;  4S2M A;  2JC7 A;  5CED A;  1LL5 A;  2LB9 A;  1X0O A;  2B5R A;  3ISG A;  2XA7 M;  4BBU A;  5E2G A;  1H0M A;  5CX7 A;  4YWZ A;  2J3W A;  4MMN A;  1CI9 A;  2A2L A;  3C30 A;  1JWV A;  4NEE D;  4OOM A;  1HD8 A;  5DJT A;  3WS5 A;  1W79 A;  3CJM A;  2ZLY A;  4P6B A;  2PRF A;  2K2N A;  3BY9 A;  3VV4 A;  3A0R A;  5KSC A;  4N1H A;  3N4I A;  4GCZ A;  5HW3 A;  5IU1 A;  3MQQ A;  1ES4 A;  3LY4 A;  4F3L A;  4E04 A;  4CLC E;  4L9G A;  1SZV A;  5HAQ A;  5F82 A;  3UE0 A;  1P9R A;  3V39 A;  1Q2P A;  2Q0O A;  4HQA A;  3VOZ A;  3A3I A;  2PYP A;  2GNX A;  4HBT A;  2Y79 A;  4NXG A;  4G3K A;  3Q07 A;  1OTI A;  2DRW A;  4I3I A;  1GCE A;  3UB5 P;  3R7W A;  5TBM A;  4X55 A;  1ERM A;  5HAI A;  1IEM A;  1CQA A;  4PPR A;  3A3E A;  5GLC A;  2WKI A;  4IBR A;  4BMW A;  4C3Q A;  4XT2 A;  3KSH A;  4U0X A;  3CAX A;  3IH8 A;  4LRZ E;  4BWI A;  5EVI C;  4ZRR A;  1LL9 A;  3IHA A; 
#chains in the Genus database with same CATH homology
 3NHQ A;  4EQ1 A;  3EGX C;  2ZMF A;  3EEH A;  1DP6 A;  3U2A A;  4BBV A;  3OLO A;  4G3W A;  4I3J A;  2CMN A;  3VE3 A;  1LSV A;  4GS9 B;  4EU0 A;  4I38 A;  3LR5 A;  1IOU A;  4L9F A;  2HV1 A;  1P0Z A;  3W2Z A;  4MN7 A;  2JKT I;  5TJJ A;  3H9W A;  3FPW A;  3PBT A;  3TRC A;  3TJZ C;  5KSH A;  1TF1 A;  1NWZ A;  3K3C A;  3BQA A;  1NRJ A;  5HL6 A;  3R7W B;  5TBM B;  4CLC D;  1DP8 A;  2QJ7 A;  1YSQ A;  4WEK A;  3JVU A;  5K5B A;  2W1T A;  1N9N A;  3LFV A;  1OTE A;  4KUO A;  1YAX A;  3B42 A;  4HH3 A;  3VE4 A;  4NXB A;  4MN6 A;  2Z6C A;  4XT2 B;  3KSG A;  1H3Q A;  3HCY A;  2EWV A;  3EGD C;  3T4K A;  2OWH A;  2QHK A;  3ICY A;  2EA9 A;  2YKH A;  2KLI A;  4AFI A;  4ETZ A;  3MR0 A;  2W1R A;  2XSS A;  5DKK A;  3A0V A;  4BJP A;  2VLG A;  4RQ9 A;  3D3O A;  4BBT A;  3PR6 A;  2JHE A;  4NXF A;  2PHY A;  1D7E A;  2BAS A;  3LUQ A;  4ARZ A;  5HWV A;  1WA9 A;  4R6L A;  2L0W A;  4EEU A;  4CQH A;  4L9E A;  4JGP A;  3BW6 A;  2ZMV A;  2W3E A;  1BYW A;  1TS8 A;  1OTD A;  1W63 Q;  5HWT A;  1P9W A;  2P7J A;  2V9A A;  1F5M A;  2WKQ A;  1VB6 A;  4R3A A;  5HDS A;  2O0Y A;  2G7U A;  2W1T B;  4LLO B;  4EES A;  3PBN A;  1XFQ A;  3H7W A;  5HDC A;  3C2W A;  3E98 A;  2O9B A;  2PT7 A;  4HY8 A;  1T19 A;  3LIC A;  1OT6 A;  2M7V A;  4WLA A;  4FSF A;  4I3A A;  2PDR A;  3E4O A;  4Q0I A;  1MZU A;  5HD3 A;  3V67 A;  3KSI A;  4QPR A;  3VOL A;  5F6A A;  3K3D A;  1VHM A;  3MFX A;  4OOL A;  4H6J A;  4PHT A;  3E4Q A;  5AVE A;  4IUK A;  1XJ2 A;  3CI6 A;  2D02 A;  3S7N A;  1YKD A;  3ULF A;  2W3G A;  4GHI A;  3G6O A;  4Z1W A;  3DBA A;  1OTB A;  4LRY C;  3A0S A;  3LR0 A;  4ARZ B;  4HNB A;  4Y2F A;  1OJ5 A;  3ZYT A;  4DJ2 A;  5HPI A;  2O9A A;  4Q0J A;  4I5S A;  5HSQ A;  1TD5 A;  3RFB A;  2VJW A;  4HJ4 A;  2VA0 A;  4HH2 A;  3PBS A;  4MCW A;  3GEC A;  1LT0 A;  3PHY A;  3EEA A;  3OC2 A;  4EER A;  3H7W B;  4B93 A;  4B9O A;  1MC0 A;  3CIT A;  3LI9 A;  5J4E A;  3LYX A;  4EW7 A;  3H82 A;  1XJ3 A;  3KX0 X;  3LIB A;  1N9O A;  3GDI A;  2OWJ A;  1GSX A;  2VV8 A;  4YNR A;  3PBO A;  1UWP X;  5DFX A;  3CUE A;  5I5L A;  1ZTU A;  2M1C A;  3KO6 A;  4UQI S;  4H6J B;  2VKS A;  5F5Y A;  5G4Y A;  2KOI A;  3FPV A;  2Z6D A;  4GHI B;  2L1M A;  1P97 A;  5F69 A;  4MN5 A;  2W3D A;  2HGV A;  5DF9 A;  3UE6 A;  1JNU A;  5G4Z A;  3NOP C;  3NOT C;  2A24 A;  2FH5 A;  4G3V A;  4PAU A;  5DFY A;  5HWW A;  1V9Z A;  3PYP A;  2VV7 A;  4HOI A;  4K08 A;  4KUK A;  4IHQ A;  2KDK A;  1OT9 A;  3RH8 B;  2QJ5 A;  3CLO A;  2J3T C;  4Y3I A;  1F9I A;  2PYR A;  5FL3 A;  4PKY A;  2VZW A;  3H82 B;  5MC7 A;  4HJ6 A;  4LPZ A;  3ZQ5 A;  3E0Y A;  3IBR A;  1T1A A;  2NUT C;  2XRO A;  4UQI M;  3S7P A;  2W27 A;  5LBR A;  1GSW A;  1T1C A;  1TS6 A;  2MJ6 A;  4R38 A;  4HIA A;  3P7N A;  3PBQ A;  2V1A A;  3C38 A;  3CWF A;  4IUH A;  4JGR A;  5IT5 A;  1N9L A;  2ZBB A;  3UB7 A;  3KYQ A;  2FZ0 A;  3T4L A;  2P08 A;  2A24 B;  2JKT M;  1OTA A;  3T4S A;  4M4X A;  2OAQ 1;  2JN7 A;  3O5Y A;  3OCL A;  3R4K A;  2LB5 A;  3LI8 A;  5C5K A;  3MMH A;  1TS0 A;  2PD8 A;  3EQU A;  2VV6 A;  3IS2 A;  1LSW A;  4CLC A;  1V9Y A;  2YKF A;  2W3F A;  4HHD A;  2ZOI A;  3T4O A;  4L0L A;  3BY8 A;  5IS1 A;  2VX8 A;  1T1B A;  5DKL A;  4EXO A;  4O8G A;  3PBR A;  2OOL A;  4ETX A;  4YOF A;  3EOI A;  3EWK A;  3EQV A;  2H28 A;  3OBF A;  1TS7 A;  3PXP A;  2PD7 A;  3P01 A;  1T18 A;  4HP4 A;  3FC7 A;  2PR6 A;  2JKR M;  3JVV A;  3HJI A;  2GX5 A;  2OAP 1;  3BWL A;  4NKP A;  1LL8 A;  5EFW A;  2HJ9 C;  2D01 A;  2ZOH A;  3F1N A;  2V0W A;  4FOF A;  2J3T D;  1F98 A;  3MQ0 A;  2VGL S;  2INW A;  4EUV A;  1D06 A;  4HP9 A;  4Y5F A;  4WUJ A;  4NXE A;  3KSF A;  3RTY A;  4GJ4 A;  1ODV A;  1S67 L;  3LID A;  3B47 A;  1STZ A;  3B33 A;  3MQO A;  5F68 A;  1KOU A;  2QYB A;  3K2N A;  4DN0 A;  4PKY G;  5J3W A;  1IFQ A;  2PR5 A;  3TE8 A;  3UMD A;  3CUE C;  4R70 A;  2XA7 S;  5HD5 A;  3UB9 A;  4IJG A;  4GLQ A;  2W3H A;  4UEY A;  1S4S A;  3LR4 A;  3KYZ A;  5A8B A;  3F1N B;  2VGL M;  5AJG A;  2HF6 A;  3T50 A;  3UME A;  4WN5 A;  4O0P A;  1H8M A;  1Y28 A;  4DMZ A;  1LSX A;  1ZHH B;  3F1P A;  3OOV A;  4WEL A;  2K7S A;  2NUP C;  3LIA A;  1GSV A;  1S1Z A;  4WF0 A;  2K31 A;  4I39 A;  4ME4 A;  2WKR A;  1W63 M;  4EEP A;  4DJ3 A;  1XFN A;  3SW1 A;  1XJ4 A;  3NOU C;  3S7Q A;  2LB9 A;  3TW8 A;  1X0O A;  2XA7 M;  1S66 L;  4HJ3 A;  4BBU A;  2L4R A;  4Q0H A;  3LR3 A;  5HPF A;  5CX7 A;  4YWZ A;  3FG8 A;  2J3W A;  4MMN A;  4JGQ A;  3T4J A;  4O01 A;  4II7 A;  1DP9 A;  2A2L A;  3C30 A;  3LIE A;  4NEE D;  4OOM A;  3BJN A;  5DJT A;  5HZH A;  3C8C A;  5L8M A;  2K2N A;  3BY9 A;  3VV4 A;  3A0R A;  4MDZ A;  2V1B A;  4P6Z S;  2QKP A;  3F1P B;  4HI4 A;  2JKR I;  4GCZ A;  5J7E A;  5IU1 A;  3MQQ A;  4F3L A;  1DRM A;  1UWN X;  1UGU A;  1XJ6 A;  2GJ3 A;  5AVF A;  1G6O A;  2DMW A;  4CLC C;  4CLC E;  4E04 A;  3D72 A;  1EW0 A;  1MKM A;  2R78 A;  3E4P A;  2V0U A;  2B18 A;  2O99 A;  4L9G A;  1NLY A;  4KQO A;  5KIZ A;  2M7U A;  3LIF A;  3UE3 A;  4EET B;  3F1O A;  3HJK A;  2P04 A;  2WKP A;  1P9R A;  2HJE A;  3IBJ A;  3T4Q A;  4GW9 A;  3MXQ A;  3S7O A;  1YSP A;  4HQA A;  2VEA A;  2B02 A;  2PYP A;  4WEJ A;  1OPX A;  2GNX A;  4GS9 A;  2Y79 A;  4NXG A;  4P6Z M;  4G3K A;  3IS2 B;  1S4R A;  3MJQ A;  3NJA A;  1OTI A;  4CLC B;  2XRN A;  1OJG A;  4LRX C;  4I3I A;  2GZA A;  2J80 A;  4F3L B;  2W0N A;  5DJU A;  3R7W A;  5TBM A;  3MF0 A;  1NLZ A;  3T4T A;  2O9C A;  4WL9 A;  3BQ8 A;  3UB6 A;  2Y8H A;  5HDD A;  2KX6 A;  1G28 A;  1S1Y A;  4BMW A;  3F1O B;  4XT2 A;  3OCN A;  3KSH A;  3UB8 A;  4KQD A;  4JGO A;  3CAX A;  4LRZ E;  4BWI A;  2EWW A;  2IA2 A;  4ZRR A;  2I9V A;  2QWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...