3MJQA

Crystal structure of the pas domain of q24qt8_deshy protein from desulfitobacterium hafniense. northeast structural genomics consortium target dhr85c.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
KNFLETIEDMILIINREGRLLYANTAVPKKLGYTHEELMSMHILTITSAGKMAEGEKILAELFAGKKESLPLSLEKKEGTSIPAKARIWQGKWHNEPCLFAIIKDLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PAS domain of Q24QT8_DESHY protein from Desulfitobacterium hafniense.
rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 19
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mjqA00
1OTIA 2V1AA 4EEUA 3E4PA 2ZOHA 1UWNX 4I3IA 4R38A 2QHKA 5J4EA 4HJ4A 1DP8A 1T19A 1N9NA 3PYPA 4M4XA 1TS6A 4XT2A 1N9LA 3G6OA 4GW9A 2QJ5A 4K08A 3VE3A 1OJ5A 1GSVA 3NOTC 4EW7A 3FC7A 1DP9A 3F1PB 3OLOA 3T50A 2V0UA 3EEHA 4PKYG 2Z6DA 5TBMB 4EXOA 5HDSA 1D7EA 2KDKA 3H82A 4LPZA 5DKKA 2R78A 3CWFA 5HDCA 4HIAA 3ULFA 4JGRA 2ZOIA 1ODVA 2YKFA 1T1BA 2PR5A 4HY8A 4JGQA 4H6JA 5A8BA 3UMDA 4HHDA 1S1ZA 2V9AA 2WKRA 3F1NA 3UB7A 3C8CA 5IS1A 2VV6A 3HJIA 3RH8B 3UMEA 4LRZE 3ZQ5A 1S4RA 3E4OA 3MR0A 5HWTA 4WLAA 1Y28A 1V9YA 5HDDA 5J7EA 2L0WA 4WN5A 4PKYA 2PR6A 1NWZA 4LRXC 4MN5A 3F1OA 1TS7A 4RQ9A 2A24B 1S67L 4LLOB 1LL8A 2QWSA 4L9EA 1LT0A 4NXGA 4BBTA 4HP4A 2QKPA 3A0SA 3CAXA 3K3CA 3MQQA 5DKLA 4I3AA 2JN7A 5HWWA 2VLGA 3RTYA 3GECA 5AVFA 3ICYA 3BY8A 2BASA 2JHEA 3A0VA 3LI8A 3NHQA 5F6AA 4KUKA 4F3LB 1P97A 4HOIA 3IS2A 3LICA 3LIEA 1EW0A 4H6JB 1OTDA 1P0ZA 1TS0A 2J80A 4WUJA 2OWHA 2PD7A 1T1CA 2YKHA 3K3DA 4EERA 4R6LA 5J3WA 2OWJA 2QJ7A 4GHIB 4L9FA 3VOLA 4R70A 1XFNA 2GJ3A 3H82B 3P7NA 5HZHA 4EESA 1S1YA 2W0NA 1OT6A 5HD3A 3SW1A 3F1PA 4DJ2A 2L4RA 5DJUA 4R3AA 5AVEA 1G28A 1LSVA 2D02A 2PYPA 4I38A 1S66L 4KQDA 3LIFA 1LSWA 4I3JA 1KOUA 4LRYC 5G4ZA 1GSXA 2ZBBA 5KIZA 4HP9A 1MZUA 2V1BA 3IBRA 3LUQA 4JGPA 2Z6CA 5F68A 1V9ZA 1F9IA 5I5LA 3LIDA 5G4YA 2HV1A 3HJKA 3LI9A 4I5SA 4NXBA 1JNUA 1OTBA 4GS9A 4WL9A 1OTAA 4YWZA 3LYXA 3F1NB 1UGUA 1XJ4A 1S4SA 4EETB 2PDRA 1OJGA 4E04A 4GCZA 3IS2B 4GHIA 1GSWA 2L1MA 2INWA 2PD8A 2W27A 2VEAA 4MN6A 4BBUA 2K7SA 5F69A 4F3LA 1XJ3A 3E4QA 3UE6A 5DJTA 5HD5A 5TBMA 2OOLA 1OT9A 4EEPA 4GS9B 1LSXA 2P7JA 3BWLA 2WKPA 2M1CA 4HNBA 4NXFA 3CLOA 4WF0A 4DJ3A 4NXEA 3F1OB 3KX0X 3LIAA 3H7WB 2PHYA 3H9WA 4EQ1A 1F98A 1XJ6A 3D72A 4HJ3A 3UB9A 2A24A 4HH3A 3GDIA 4I39A 1VB6A 2PYRA 3C2WA 3MQOA 3NOPC 3VE4A 3H7WA 5HSQA 2CMNA 3MFXA 3BY9A 4JGOA 3A0RA 4KUOA 1N9OA 1UWPX 1T18A 2V0WA 5F5YA 1D06A 4HH2A 2EA9A 4BBVA 2KX6A 2WKQA 1OTEA 1X0OA 3LIBA 1T1AA 4HQAA 4L9GA 1BYWA 2B02A 1WA9A 3MJQA 3NOUC 5EFWA 3UB6A 1XFQA 1XJ2A 2D01A 3NJAA 2VV8A 3PHYA 2H28A 1DP6A 3EWKA 4B9OA 3UB8A 4HJ6A 3MXQA 3B33A 5HWVA 1DRMA 2I9VA 2VV7A 3FG8A 4HI4A 4XT2B 5IU1A 1TS8A
chains in the Genus database with same CATH superfamily
2ZQDA 3V5MA 1RP5A 3A3FA 4BD0A 4XUXA 1K4FA 4WEJA 1D7EA 4PPRA 5HDCA 1PZOA 1YLJA 2FFYA 1K25A 3JPUA 1KDWA 1S1ZA 3NULA 2JKFA 2ZMAA 4BWIA 3HLFA 4Y17A 2L0WA 3MZEA 5KSCA 2Y2KA 4OOMA 1LT0A 1CEGA 4F94A 1NZOA 5AVFA 5F6AA 3LFVA 4CJNA 1CI8A 3IS2A 4WUJA 3Q07A 1EW0A 4GD6A 2OWHA 3K3DA 5AQAA 4C75A 4JXGA 4YINA 4GKUA 2PBYA 1KVLA 3NDGA 4ZJ1A 3ZGAB 5F68A 5I5LA 1YSQA 2HV1A 3IH9A 4LFUA 2Q9NA 4NEED 4F3LA 1BLHA 3R7WA 2XH9A 3NIAA 5DJTA 2UV0E 5HD5A 3IWQA 2WKHA 5TBMA 1ZKJA 5EM1A 3CLOA 4WF0A 2X02A 3H9WA 4PMAA 4P6BA 3GDIA 2IWBA 3VE4A 4II7A 1HD8A 1T18A 3SH9A 3CZDA 3BFGA 4Q8IA 1IKGA 1LI0A 4E3JA 2ZC5B 2OSUA 2VKSA 5CERA 1WE4A 1PZPA 4KZ9A 4OOYA 2Y79A 5L8MA 5GLBA 3SOIA 1G6AA 2JKTI 3GR2A 5DKKA 1SKOA 1PWGA 1MWRA 5CGWA 4HHDA 4IHQA 1KGEA 4OPRA 5IS1A 3HJIA 1XPBA 3DAVA 2XDMA 4GZBA 4X53A 3B3XA 2QYBA 3ZVTA 5EVIA 1RGZA 1ZG6A 3MQQA 4IBRA 4PM7A 5JYPA 4IJGA 3S22A 2WAEA 4NETA 2UWXA 1CK3A 1OTDA 2YKHA 1G68A 3VOLA 2PAVP 4WELA 3NC8A 4QY5A 4UA9A 3ZYTA 1J3WA 3BFFA 1BSGA 3Q7ZA 1AXBA 5TGFA 4GHIA 3VSLA 1GCEA 3LY4A 4X69A 3MKEA 3PTEA 5HAIA 4G3VA 2FFFB 1IFQA 2XD1A 4Y5FA 3IHAA 4X1LA 2Z2LB 1SDEA 3T4SA 1DY6A 1F2KA 3BY9A 1I2WA 1UWPX 1N9OA 1RCJA 4IBXA 3KSHA 1FR1A 1X0OA 1T1AA 3UPNA 5EFWA 2ZM2A 1FSYA 3TOIA 4DE0A 4XT2B 3A3EA 3G6OA 3GV9A 4NG2A 1L2SA 5FSRA 3F1PB 4OPYA 4EUVA 4Z1WA 3MZDA 2O9CA 3FYZA 2LB5A 3SH7A 3RH8B 2HJ9C 3W2ZA 5EVID 1ZC2A 4LLOB 1EWZA 4JLFA 4O0PA 3ITAA 2W3GA 3BY8A 4N9LA 4DE1A 4L9FA 2HDSA 3ZCZA 2WGVA 5EVIB 4Q0HA 2IA2A 3RXXA 2ZBBA 2ACGA 2XR0A 3IXDA 2Y2LA 1O07A 3FV7A 2ZLYA 1OTAA 4QD4A 1TDGA 4EETB 3HREA 3MKFA 4LV2A 4QPRA 4E6XA 1TDLA 5TJJA 2H0YA 2PU4A 3BLSA 3VP1A 4GN2A 3UDXA 3KX0X 4DE3A 4XUZA 3SH8A 5J8XA 4EV4A 3T4LA 3DTMA 5FATA 2P04A 3NECA 2ZQ9A 5F83A 3UB6A 2J9OA 3T4QA 3UE1A 2VV8A 2H28A 3RXWA 4HBTA 2GNXA 2NUPC 5HWVA 2I9VA 4K0XA 3G34A 4R4RA 3HLCA 2Y91A 2C6WB 2H10A 5IT5A 5EVIC 4KG6A 1S6RA 4R3BA 1VETB 4EWFA 5TBMB 3W4PA 3T4TA 2NUTC 3NI9A 2YKFA 4JGQA 3IXHA 1FCNA 2P74A 3UE3A 3ZQ5A 1PFLA 3MR0A 3MFDA 4HESA 4S2MA 4LRXC 1S67L 4BMWA 1LL8A 4BBTA 5I94A 2EXBA 3UNWA 1K38A 3CAXA 4DN0A 1EROA 3LR3A 1GHIA 5FAQA 2JHEA 3A0VA 4OPZA 4DKIA 5FDHA 4HOIA 1NRJA 3CPTB 3OPHA 4O01A 2EXAA 3VP4A 2OAP1 2HP9A 1XFNA 1OT6A 4DMZA 3UE0A 2BG1A 2ZC7A 1CEFA 5G4ZA 3E2KA 4WZ4A 1MBLA 4OVDA 3TJZC 5G4YA 1A0KA 1NRFA 5D3OA 4LENA 5GHYA 2XK1A 1OT9A 2CC1A 3ZG7B 4DJ3A 3HUMA 1MKMA 4GDBA 2A24A 1VB6A 4ZRRA 5HSQA 3MFXA 4B4XA 4DRTA 2ZD8A 4L9GA 1BYWA 2B02A 2ZC3B 3S1YA 3MZFA 3UB8A 4G3KA 5FASA 3E4PA 4S2NC 1N9NA 3NCKA 4BLMA 3E2LA 1QMFA 1FCOA 2IWDA 3H82A 4LPZA 3OZHA 3QNBA 2QPNA 3C4OA 2K2NA 3DTIA 3OCNA 4K0WA 4OP5A 3LCEA 3SZTA 4L9EA 1XX2A 4PHTA 2LB9A 2W1TA 1ERQA 1JTDA 1LHYA 1NLZA 3L9KA 3N4IA 2J80A 3QNCA 2O99A 1WYCA 4R70A 3SW1A 1CF0A 4EUZA 1KE3A 3MXRA 1LSVA 3C5AA 3Q81A 3NBLA 3LIFA 3A3DA 3CUEA 4RX2A 4ETXA 1XKZA 1H8MA 4WL9A 3M6HA 3F1NB 4UQIS 1S4SA 2EX8A 3PR6A 3HUOA 4MN6A 1M6KA 1GHMA 3IF6C 1NYMA 3BWLA 4ZBEA 4B93A 1PW1A 3MBZA 5KMWA 1NYYA 3LGOA 1DJCA 2CMNA 4FSFA 1OPXA 2XQZA 4UEYA 3BFEA 3FPVA 1P9RA 4WZ5C 3DWZA 4K91A 1W7FA 2WZXA 2HPBA 1TS6A 3BJNA 5GLDA 1FOFA 4GLQA 3FWLA 5CHMA 3T50A 4BQMA 3EGXC 2KDKA 3C7VA 2XF3A 2PR5A 4H6JA 5CHUA 1EI5A 2WKRA 1IYSA 3ZFZA 3T12B 4E3NA 1Y28A 4WN5A 3F1OA 5C5KA 1MWTA 3K3CA 4P87A 4N9KA 3VOZA 2VLGA 4CQHA 1FILA 3BRMA 4S2LA 1K57C 4MBFA 4ZJ3A 2DCFA 5KIZA 1GSXA 2WYXA 5E2HA 4WMCD 3LYXA 4GCZA 4IVKA 2INWA 3VFHA 3UE6A 1MWSA 1K57A 3Q82A 5HL1A 3M6BA 2WGWA 1GA0A 5KSHA 2WKPA 4S2OA 5A90A 4OQ0A 3H7WB 4OLGA 1IYQA 2RCXA 2ZMFA 4X68A 3CPTA 5FAOA 4ARZB 3GMWA 2EA9A 4FH2A 4CPKA 3HVFA 3NJAA 4IVIA 2WZZA 3PBQA 2EX2A 3B47A 1SZVA 5A91A 2ZOHA 3MXSA 3D3OA 3G2YA 3PYPA 5DFXA 4JKTA 2WK0A 1K4EA 4R1GA 5HDSA 2QMIA 1L0FA 4P0MA 4LV0A 4PM9A 4OLDA 5CEBA 5CEDA 4WM9A 3UMEA 2HF6A 2QZ6A 4MN5A 4DF6A 4RQ9A 3WS4A 3S4XA 2JE5A 3BQ8A 3JVVA 5G18A 1K55A 3BM6A 3BFCA 2BASA 3V67A 4OP8A 3LICA 3MSHA 2JC7A 2E8JA 2W1TB 3E98A 3KYZA 3KO6A 3H82B 2ZQ8A 2VGKA 3LEZA 4KQDA 4I3JA 4CLCC 1F5MA 1PW8A 2JCHA 3MQ0A 5L2FA 5EVEA 1XA1A 2A49A 3HLGA 3FZCA 3Q7VA 4HEFA 5MC7A 1OJGA 4KG5A 4QB8A 1IEMA 2VA0A 3O86A 1KE4A 5F69A 3E4QA 5CXWA 1BLSA 4EEPA 5JYOA 2P7JA 3T4KA 3ZG0A 4OQHA 3MF0A 4UA6A 5CGSA 3CG5A 2ZL1B 1Q2QA 2J3WA 2V20A 4UQIM 4E3MA 4S2IA 1MXOA 4ESPA 1K6SA 1H8YA 1BUEA 2H5SA 3D9YA 4DXBA 4HI4A 1OTIA 4QJGA 2Y59A 4X25A 1OJ5A 3LEQA 5E2EA 3FC7A 3OLOA 3BFDA 1YT4A 2WAFA 5E43A 3AGEA 3JYIA 3UPPA 3DTKA 2K31A 3ZNTA 4U0XA 1VM1A 5HDDA 1L0DA 4PKYA 3LR4A 2PT7A 3WRZA 1W8QA 3OC2A 1P97A 2OWJA 3P7NA 2HDUA 4WYYA 1JWPA 1YQSA 3G30A 3O5YA 1G28A 1PI5A 5DTSA 3TG9A 4HP9A 4IEDA 5A93A 4I5SA 2BTFP 5E2GA 4E6WA 2K7SA 1VETA 3S7OA 3TW8A 4GB7A 4MBHA 4MMNA 2VGLM 2XEPA 3C7UA 3F1OB 2G2UA 4KZ8A 2GX5A 2ZQAA 3H7WA 4KUOA 3GSGA 3EEAA 4HH2A 5AQ9A 1M40A 5CHJA 3N7WA 4EBPA 5CTNA 5FL3A 5IHVA 4MEZA 3FG8A 4D2OA 3WS2A 4UA7A 1D1JA 3GQZA 2FH5A 1LL5A 4HJ4A 3JVUA 2PBDP 3VE3A 1GSVA 1DP9A 1PWDA 3N6IA 3A3JA 2Z6DA 1XGIA 3CI6A 2FZ0A 3CWFA 3TE8A 4HIAA 1PYYA 4KG2A 1FIKA 4HY8A 4KQOA 3U4LP 3OPLA 3T1SA 5L09A 3GTCA 2VV6A 2OAQ1 4GNUA 2EFXA 2V8CA 4WLAA 5AJGA 5J7EA 3O88A 5GL9A 3UY6A 1TS7A 3SS5A 3ZHHA 4IUHA 4NXGA 1I2SA 2ZQ7A 1ZHHB 2GDNA 1HLUP 1E25A 3G32A 5M1AA 3NY4A 2E8IA 3LIEA 4X1MA 4H6JB 5TFQA 4R0QA 4RA7A 5HD3A 2ZJ9A 4DJ2A 2L4RA 1CQAA 5DKLA 1JWVA 1LSWA 1JTGA 5HPIA 1MZUA 2R9WA 2XSSA 3ZG5A 3PBOA 1FSWA 4OQIA 4U0TA 1G5UA 3EQUA 4UHUA 2M7VA 4EBNA 4N92A 1ERMA 5A92A 1QMEA 2XA7M 3WS1A 1LSXA 2W3FA 4NXFA 2VZWA 4NXEA 4KZAA 4A5RA 4EQ1A 1G6OA 3VOYA 1MWUA 4FOFA 3NOPC 5DFYA 2G2WA 2Y2JA 3FKWA 4PM6A 3OPRA 3P09A 3MJQA 2A2LA 5EOOA 2HZ5A 4HJ6A 3B33A 3A3IA 4C3QA 5J4EA 2ZMVA 1IYPA 4HBUA 1FCMA 3ITBA 4KZBA 4Q0JA 1K54A 1XXMA 4PKYG 2OV5A 2Y2PA 1VQQA 4FH4A 4KZ6A 2EWWA 3VMAA 4DDSA 1K6RA 3VFFA 3PBNA 5EVLA 3B42A 3QHYA 5HX9A 4R3JA 5DF7A 3PBSA 3LR5A 3UN7A 5GLCA 4HP4A 3VP3A 1N4OA 1BLCA 3TSGA 2QKPA 2O9AA 3U2AA 2WGWB 4GJ4A 2R9XA 4LGWA 2Y2HA 3KYQA 4Z9QA 4P85A 4Q0IA 4CLCE 1S66L 4G3WA 4WEKA 1IKIA 2Z6CA 2HP5A 4NXBA 1JNUA 3V3RA 5FI7A 1LI9A 5DF9A 3ZDJA 4Y2FA 2VX8A 2IWCA 2Y8HA 2MJ6A 1ES4A 3OOVA 4IUKA 4HH3A 4MN7A 3A0RA 5F5YA 1FR6A 4R23A 3OPPA 3UPOA 5EECA 1WA9A 1ESIA 3BECA 1E3UD 1J9MA 3OBFA 5GLAA 5FEGA 1HTZA 3S7QA 4EEUA 2HJEA 3G35A 5FEFA 4S2PA 4M4XA 4GW9A 2AVXA 5TR7A 5EUAA 3R7WB 5CGXA 3HL9A 2V0UA 3CITA 4YOFA 4ARZA 3C38A 3UB7A 2J8YA 4NK3A 4OOLA 4FTXA 1V9YA 1IOUA 1NWZA 2Y2MA 1W79A 1LL9A 3KSFA 3M2KA 1H3QA 5HWWA 1YLPA 1P0ZA 1TS0A 2KOIA 1N9BA 3W4QA 4R6LA 3IXGA 4WMCA 2QJ7A 4GHIB 3BLMA 1YMSA 4PAUA 1FQGA 1W63M 1Q2PA 1YMXA 3IF6A 3V3SA 2PU2A 2O9BA 4S2NA 5HFOA 4N1HA 1HZOA 3FPWA 4UAAA 4GS9A 4YWZA 1XJ4A 3PAGA 2JKRI 2ZM8A 1ALQA 2DNSA 2W27A 3KSIA 4ZJ2A 5FI2A 4GS9B 3W4OA 5KZHA 3LR0A 4Y0TA 3VP0A 4I39A 1NJ4A 1SDNA 4JGOA 4BD1A 5L10A 1HVBA 5AQBA 5GHXA 5FI6A 3R4KA 1SKOB 3IWOA 1XJ2A 3Q7VB 4ID4A 3PHYA 3UO9A 3VP2A 4B9OA 1DRMA 2C5WB 3S7NA 4OQGA 3HBRA 4WZ5A 3UB5P 1L0EA 2XGNA 4E3LA 4K08A 4JF5A 2ZC6B 3IXBA 1PWCA 5EM0A 1VHMA 5F82A 4KZ3A 1YLWA 1Y4OA 4S2KA 3RJUA 3P01A 2Y2IA 4FUWA 1YPRA 1YSPA 2JKTM 3FKVA 2P9VB 3ISGA 2RL3A 2A24B 2G7UA 5HAQA 3WWXA 4I3AA 3LI8A 1MKIA 1CI9A 1T1CA 5GHZA 4E3KA 5J3WA 4EQIA 5FQJA 1OMEA 4EESA 2WADA 1KE0A 2H0TA 3F1PA 5AQ7A 1P9WA 2D02A 4ZAMA 1PNEA 3C4PA 2V1BA 5HL6A 1F9IA 2Y4AA 4QHCA 3IBJA 3V50A 4MLLA 1YLZA 1Z09A 1NY0A 4M3KA 2PD8A 4BBUA 1IYOA 4CLCA 4RX3A 2JKGA 3WS0A 5FQMA 1YKDA 3IF6B 2J3TD 1S0WA 2W3DA 3UB9A 1KGFA 2XD5A 1IELA 3OCLA 1MC0A 1C3BA 1TVFA 2VK3A 4BL3A 5CTMA 4KQQA 3NOUC 4LCLA 4NKPA 2Y55A 3VV4A 4DDYA 1XFQA 1XA7A 1WYBA 3HLBA 2VV7A 5HARA 3L7HA 3IWIA 1UWNX 2WGIA 3GRJA 1MY8A 4N1XA 4EW7A 4B88A 1DJAA 5DVAA 1BT5A 5F1FA 2XLNA 3EEHA 1BULA 4OH0A 2EWVA 1Y54A 3HCYA 1ODVA 4Y15A 2ZQCA 1KVMA 3DW0A 2V9AA 5DTKA 5EV0A 3C8CA 4ZTKA 3PBTA 3QP4A 3IH8A 3E4OA 1NXYA 2P08A 3SS4A 4O8GA 1K54C 5DF8A 4U3TA 2QWSA 2Z2MB 3RTYA 4RVAA 4F3LB 3NHQA 2J9PA 4KUKA 1CJFA 4BL2A 4KZ4A 4JPMA 4KQRA 1L3LA 1PI4A 1AWIA 4GD8A 3Q1FA 2EFUA 3PAEA 3DWKA 4OONA 3LIDA 4CLCD 4MBKA 3HJKA 2Y2GA 1UGUA 3IS2B 3UDIA 1XJ3A 1H0MA 5FDSA 4EU0A 4H8RA 4JXVA 4XXRA 4R4SA 3T1RA 3E0YA 3LIAA 2PHYA 1GA9A 4ETZA 2KLIA 2EX9A 2XFSA 2DRWA 3IX4A 2EX6A 5FAPA 1ONHA 2V1ZA 3IHBA 2J7VA 2B18A 2KX6A 3LIBA 4HQAA 5BOHA 5EOEA 4Y0OA 1BZAA 3EWKA 3RFBA 2BLSA 3QP1A 1U60A 3CHWP 1DP8A 1T19A 4QY6A 1L0GA 2X01A 4YFMA 5CRFA 1VEUA 3T4JA 4GOGA 4QU3A 4BJPA 1E4DA 4LRZE 1W63Q 5L07A 5EE8A 4ZDXA 1YAXA 2GZAA 2XROA 3N8LA 3I7JA 3GECA 3ICYA 3QP5A 2JKRM 2PD7A 2OLVA 5HZHA 2GJ3A 4P6ZM 2W0NA 3BYDA 5FA7A 5HAPA 4MDZA 4E3OA 2PYPA 4I38A 1PIOA 3HLDA 5DTTA 4DXCA 3IBRA 2J3TC 2HDQA 3LUQA 2JBFA 2W3HA 4CLCB 3N8RA 1W8YA 3LI9A 1OTBA 3AGFA 4X6TA 5CECA 3WRTA 4LCMA 1NZUA 2WUQA 3CUEC 4GDNA 2M7UA 2OOLA 4D60A 4YNRA 4B4ZA 3N8SA 1F98A 4MCWA 1XJ6A 3D72A 4C6YA 4OKPA 2HP6A 5HW3A 3BW6A 2V0WA 4Y0UA 2WKQA 4BENA 4JF4A 2HDRA 3PBRA 4JXWA 4E3IA 4PM8A 3G2ZA 3MXQA 4P6ZS 4QWOA 3VSKA 3O3VA 5IU1A 4JXSA 3CJMA 4I3IA 2QHKA 4XT2A 2Y2QA 2QJ5A 2PRFA 3NOTC 3C30A 1BTLA 2A3UA 2ZC4B 3DTEA 3S7PA 2XRNA 2XA7S 4EXOA 3IT9A 3EGDC 2ZOIA 1KDSA 1T1BA 2VGJA 4MNRA 5EPHA 1STZA 1S4RA 2VGLS 3V39A 5HWTA 2W1RA 3ZNYA 1K0KA 4X55A 1K56A 1YM1A 4OPQA 3A0SA 2JN7A 1K56D 1ONGA 4AFIA 5LBRA 3GVBA 2DMWA 5M18A 4X56A 4LV1A 4KZ5A 2HGVA 1TD5A 3K2NA 4EBLA 2Y2NA 4R3AA 2ZL1A 3LY3A 1ES5A 3IX3A 1H5XA 4PM5A 5F1GA 4EERA 1SKFA 4KZ7A 3D4FA 1YLTA 1YLYA 1XGJA 3EOIA 2M1CA 4HNBA 3MMHA 1ES2A 2ZM0A 1H8ZA 4HJ3A 3G4PA 3ZG9B 1TF1A 2PYRA 3MQOA 3TRCA 3NDEA 3P98A 3SS3A 3KSGA 4Y7PA 1MPLA 2I72A 4BBVA 3CMZA 5E2FA 1ACFA 2WKIA 3M2JA 4FCFA 4WBGA 1JVJA 1DP6A 4JF6A 3BEBA 4O7DA 2V1AA 4R38A 1GHPA 1BLPA 2OLUA 1N9LA 3QP2A 1ESUA 1JWZA 3AGDA 3PXPA 1SCWA 1ZG4A 5K5BA 3ZVWA 5FQKA 1ZTUA 2Q0OA 2R78A 4Y3IA 2Q9MA 3ULFA 4JGRA 1Z6FA 1PRQA 3UMDA 3F1NA 1KGGA 3W8KA 3T1QB 2B95A 3IF5A 3UDFA 1O7EA 3QP8A 3WS5A 4S2JA 2WKEA 2PR6A 3QP6A 2P9VA 2O0YA 3HLEA 3T4OA 3T1XA 3DBAA 3MS6A 1I5QA 3IX8A 4DE2A 5A8BA 1S1YA 5FQ9A 3HLWA 5DJUA 5AVEA 5FQQA 4LRYC 3HUNA 4RYEA 1KOUA 2X71A 4JGPA 5FQIA 1V9ZA 5CX7A 1RGYA 1LLBA 2PDRA 4E04A 1GSWA 2L1MA 1NLYA 2VEAA 4ME4A 1K55C 3BQAA 5M19A 1DJBA 2Y2OA 3EQVA 1TEMA 2V8FA 1ES3A 2XFTA 3IQAA 4FD8A 2VJWA 3G31A 5U47A 3C2WA 2V2FF 1E3UA 1XP4A 3KYEA 1VEUB 5HPFA 1W5DA 1D06A 4JBFA 1OTEA 4Y13A 4LV3A 4KENB 4L0LA 1SHVA 3O87A 2D01A 2W3EA 2B5RA 3LO7A 3ZG8B 1TS8A
chains in the Genus database with same CATH topology
3E4PA 1UWNX 2FH5A 4HJ4A 1N9NA 3JVUA 3VE3A 4EW7A 1GSVA 1DP9A 4WEJA 3EEHA 2Z6DA 2EWVA 1D7EA 3H82A 3CI6A 4LPZA 2FZ0A 5HDCA 3CWFA 3TE8A 4HIAA 3HCYA 1ODVA 4HY8A 4KQOA 1S1ZA 2V9AA 3C8CA 3PBTA 2VV6A 4BWIA 2OAQ1 2K2NA 3E4OA 4WLAA 5AJGA 5J7EA 3OCNA 2P08A 2L0WA 4O8GA 1TS7A 4IUHA 2QWSA 4L9EA 1LT0A 4NXGA 4OOMA 4PHTA 1ZHHB 2LB9A 2W1TA 3RTYA 5AVFA 5F6AA 3LFVA 4F3LB 3NHQA 4KUKA 1NLZA 3IS2A 4WUJA 3LIEA 1EW0A 4H6JB 2J80A 2OWHA 3K3DA 2O99A 4R70A 5HD3A 3SW1A 4DJ2A 2L4RA 1LSVA 5DKLA 3LIFA 1LSWA 5HPIA 3CUEA 1MZUA 4ETXA 5F68A 2XSSA 3PBOA 5I5LA 3LIDA 1YSQA 4CLCD 1H8MA 2HV1A 3HJKA 3EQUA 4WL9A 2M7VA 3F1NB 1UGUA 4UQIS 1S4SA 3PR6A 3IS2B 4NEED 4MN6A 4F3LA 1XJ3A 3R7WA 5DJTA 5HD5A 5TBMA 4EU0A 2XA7M 1LSXA 3BWLA 4B93A 2W3FA 4NXFA 3CLOA 4WF0A 2VZWA 3E0YA 4NXEA 3LIAA 2PHYA 3H9WA 4EQ1A 4ETZA 2KLIA 1G6OA 3GDIA 4FOFA 3NOPC 3VE4A 5DFYA 4II7A 2CMNA 4FSFA 1T18A 2B18A 1OPXA 2KX6A 3LIBA 4HQAA 4UEYA 3MJQA 2A2LA 3FPVA 3EWKA 1P9RA 4HJ6A 3RFBA 3B33A 2VKSA 5J4EA 2ZMVA 1DP8A 1T19A 2Y79A 1TS6A 5L8MA 3BJNA 4GLQA 2JKTI 4Q0JA 3T50A 4PKYG 3EGXC 5DKKA 2KDKA 2EWWA 2PR5A 4H6JA 4HHDA 4IHQA 3T4JA 2WKRA 3PBNA 4BJPA 5IS1A 3HJIA 4LRZE 3B42A 1Y28A 1W63Q 2QYBA 3PBSA 4WN5A 3LR5A 3F1OA 1YAXA 2GZAA 5C5KA 4HP4A 2QKPA 2XROA 3K3CA 3MQQA 2O9AA 4IJGA 3U2AA 2VLGA 4CQHA 3GECA 3ICYA 2JKRM 1OTDA 4GJ4A 2PD7A 2YKHA 3KYQA 3VOLA 5HZHA 4WELA 2GJ3A 4P6ZM 4Q0IA 2W0NA 4MDZA 4CLCE 2PYPA 3ZYTA 4I38A 1S66L 4G3WA 5KIZA 1GSXA 3IBRA 2J3TC 3LUQA 4WEKA 2Z6CA 2W3HA 4CLCB 3LI9A 4NXBA 1JNUA 1OTBA 3LYXA 5DF9A 4GCZA 4GHIA 2INWA 3UE6A 3CUEC 2M7UA 2OOLA 4Y2FA 5KSHA 2WKPA 2VX8A 4YNRA 2Y8HA 4G3VA 2MJ6A 1IFQA 3H7WB 4Y5FA 1F98A 3OOVA 4MCWA 1XJ6A 3D72A 4IUKA 4HH3A 3T4SA 3BY9A 4MN7A 3A0RA 2ZMFA 3BW6A 1N9OA 1UWPX 2V0WA 5F5YA 4ARZB 3KSHA 2EA9A 2WKQA 1X0OA 1T1AA 1WA9A 5EFWA 3PBRA 3NJAA 3PBQA 3OBFA 3MXQA 4P6ZS 3B47A 4XT2B 5IU1A 3S7QA 4EEUA 2ZOHA 4I3IA 2HJEA 2QHKA 3D3OA 3PYPA 4M4XA 4XT2A 5DFXA 3G6OA 4GW9A 2QJ5A 3NOTC 3C30A 3R7WB 3F1PB 3S7PA 2V0UA 2XRNA 3CITA 2XA7S 4EXOA 5HDSA 4EUVA 3EGDC 4YOFA 2ZOIA 4Z1WA 1T1BA 2O9CA 4ARZA 3C38A 2LB5A 3UB7A 3RH8B 1STZA 3UMEA 4OOLA 1S4RA 2HF6A 2VGLS 2HJ9C 2W1RA 5HWTA 1V9YA 3W2ZA 1IOUA 4MN5A 1NWZA 4RQ9A 4LLOB 3JVVA 3BQ8A 3KSFA 4O0PA 2W3GA 3A0SA 1H3QA 5HWWA 2JN7A 3BY8A 2BASA 4AFIA 5LBRA 3V67A 3LICA 1P0ZA 1TS0A 2DMWA 2KOIA 2W1TB 4R6LA 2HGVA 2QJ7A 3E98A 3KYZA 4GHIB 3KO6A 4L9FA 3H82B 1TD5A 3K2NA 4PAUA 1W63M 4R3AA 4Q0HA 2IA2A 4KQDA 4I3JA 2ZBBA 4CLCC 2O9BA 1F5MA 3MQ0A 4EERA 3FPWA 4GS9A 1OTAA 4YWZA 1XJ4A 5MC7A 4EETB 2JKRI 1OJGA 2VA0A 2W27A 3KSIA 5F69A 3E4QA 4QPRA 4EEPA 4GS9B 5TJJA 2P7JA 3EOIA 3LR0A 2M1CA 4HNBA 3MMHA 3T4KA 3KX0X 3MF0A 4HJ3A 4I39A 1TF1A 2J3WA 2PYRA 3MQOA 3TRCA 3T4LA 4JGOA 3KSGA 4UQIM 4BBVA 2P04A 3R4KA 3UB6A 3T4QA 1XJ2A 2VV8A 3PHYA 2H28A 1DP6A 4B9OA 2GNXA 2NUPC 5HWVA 1DRMA 2I9VA 4HI4A 3S7NA 1OTIA 2V1AA 4R38A 5IT5A 1N9LA 4K08A 1OJ5A 3FC7A 3PXPA 3OLOA 1VHMA 5TBMB 5K5BA 1ZTUA 2R78A 3T4TA 4Y3IA 2NUTC 3ULFA 4JGRA 2YKFA 4JGQA 2K31A 3P01A 3UMDA 3F1NA 3UE3A 1YSPA 3ZQ5A 2JKTM 3MR0A 5HDDA 4PKYA 2PR6A 4LRXC 2A24B 1S67L 2G7UA 4BMWA 1LL8A 4BBTA 3LR4A 2PT7A 2O0YA 3CAXA 4I3AA 3T4OA 4DN0A 3LR3A 3DBAA 3OC2A 2JHEA 3A0VA 3LI8A 1P97A 4HOIA 1NRJA 1T1CA 4O01A 5J3WA 2OWJA 2OAP1 5A8BA 1XFNA 3P7NA 4EESA 1S1YA 1OT6A 3F1PA 5DJUA 4DMZA 3O5YA 1P9WA 5AVEA 1G28A 2D02A 4LRYC 5G4ZA 1KOUA 4HP9A 2V1BA 4JGPA 5HL6A 1V9ZA 1F9IA 5CX7A 3TJZC 5G4YA 4I5SA 3IBJA 2PDRA 4E04A 1GSWA 2L1MA 2PD8A 1NLYA 2VEAA 4BBUA 4ME4A 2K7SA 3S7OA 3BQAA 3TW8A 4CLCA 1OT9A 4MMNA 2VGLM 3EQVA 1YKDA 4DJ3A 3F1OB 1MKMA 2J3TD 2W3DA 3UB9A 2A24A 2VJWA 1VB6A 4ZRRA 3C2WA 2GX5A 3H7WA 5HSQA 3MFXA 3OCLA 1MC0A 4KUOA 3EEAA 5HPFA 1D06A 4HH2A 1OTEA 4L9GA 1BYWA 2B02A 3NOUC 4NKPA 4L0LA 3VV4A 1XFQA 2D01A 2W3EA 5FL3A 3UB8A 4G3KA 2VV7A 3FG8A 1TS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTI A;  2V1A A;  4EEU A;  3E4P A;  2ZOH A;  1UWN X;  4I3I A;  4R38 A;  2QHK A;  5J4E A;  4HJ4 A;  1DP8 A;  1T19 A;  1N9N A;  3PYP A;  4M4X A;  1TS6 A;  4XT2 A;  1N9L A;  3G6O A;  4GW9 A;  2QJ5 A;  4K08 A;  3VE3 A;  1OJ5 A;  1GSV A;  3NOT C;  4EW7 A;  3FC7 A;  1DP9 A;  3F1P B;  3OLO A;  3T50 A;  2V0U A;  3EEH A;  4PKY G;  2Z6D A;  5TBM B;  4EXO A;  5HDS A;  1D7E A;  2KDK A;  3H82 A;  4LPZ A;  5DKK A;  2R78 A;  3CWF A;  5HDC A;  4HIA A;  3ULF A;  4JGR A;  2ZOI A;  1ODV A;  2YKF A;  1T1B A;  2PR5 A;  4HY8 A;  4JGQ A;  4H6J A;  5A8B A;  3UMD A;  4HHD A;  1S1Z A;  2V9A A;  2WKR A;  3F1N A;  3UB7 A;  3C8C A;  5IS1 A;  2VV6 A;  3HJI A;  3RH8 B;  3UME A;  4LRZ E;  3ZQ5 A;  1S4R A;  3E4O A;  3MR0 A;  5HWT A;  4WLA A;  1Y28 A;  1V9Y A;  5HDD A;  5J7E A;  2L0W A;  4WN5 A;  4PKY A;  2PR6 A;  1NWZ A;  4LRX C;  4MN5 A;  3F1O A;  1TS7 A;  4RQ9 A;  2A24 B;  1S67 L;  4LLO B;  1LL8 A;  2QWS A;  4L9E A;  1LT0 A;  4NXG A;  4BBT A;  4HP4 A;  2QKP A;  3A0S A;  3CAX A;  3K3C A;  3MQQ A;  5DKL A;  4I3A A;  2JN7 A;  5HWW A;  2VLG A;  3RTY A;  3GEC A;  5AVF A;  3ICY A;  3BY8 A;  2BAS A;  2JHE A;  3A0V A;  3LI8 A;  3NHQ A;  5F6A A;  4KUK A;  4F3L B;  1P97 A;  4HOI A;  3IS2 A;  3LIC A;  3LIE A;  1EW0 A;  4H6J B;  1OTD A;  1P0Z A;  1TS0 A;  2J80 A;  4WUJ A;  2OWH A;  2PD7 A;  1T1C A;  2YKH A;  3K3D A;  4EER A;  4R6L A;  5J3W A;  2OWJ A;  2QJ7 A;  4GHI B;  4L9F A;  3VOL A;  4R70 A;  1XFN A;  2GJ3 A;  3H82 B;  3P7N A;  5HZH A;  4EES A;  1S1Y A;  2W0N A;  1OT6 A;  5HD3 A;  3SW1 A;  3F1P A;  4DJ2 A;  2L4R A;  5DJU A;  4R3A A;  5AVE A;  1G28 A;  1LSV A;  2D02 A;  2PYP A;  4I38 A;  1S66 L;  4KQD A;  3LIF A;  1LSW A;  4I3J A;  1KOU A;  4LRY C;  5G4Z A;  1GSX A;  2ZBB A;  5KIZ A;  4HP9 A;  1MZU A;  2V1B A;  3IBR A;  3LUQ A;  4JGP A;  2Z6C A;  5F68 A;  1V9Z A;  1F9I A;  5I5L A;  3LID A;  5G4Y A;  2HV1 A;  3HJK A;  3LI9 A;  4I5S A;  4NXB A;  1JNU A;  1OTB A;  4GS9 A;  4WL9 A;  1OTA A;  4YWZ A;  3LYX A;  3F1N B;  1UGU A;  1XJ4 A;  1S4S A;  4EET B;  2PDR A;  1OJG A;  4E04 A;  4GCZ A;  3IS2 B;  4GHI A;  1GSW A;  2L1M A;  2INW A;  2PD8 A;  2W27 A;  2VEA A;  4MN6 A;  4BBU A;  2K7S A;  5F69 A;  4F3L A;  1XJ3 A;  3E4Q A;  3UE6 A;  5DJT A;  5HD5 A;  5TBM A;  2OOL A;  1OT9 A;  4EEP A;  4GS9 B;  1LSX A;  2P7J A;  3BWL A;  2WKP A;  2M1C A;  4HNB A;  4NXF A;  3CLO A;  4WF0 A;  4DJ3 A;  4NXE A;  3F1O B;  3KX0 X;  3LIA A;  3H7W B;  2PHY A;  3H9W A;  4EQ1 A;  1F98 A;  1XJ6 A;  3D72 A;  4HJ3 A;  3UB9 A;  2A24 A;  4HH3 A;  3GDI A;  4I39 A;  1VB6 A;  2PYR A;  3C2W A;  3MQO A;  3NOP C;  3VE4 A;  3H7W A;  5HSQ A;  2CMN A;  3MFX A;  3BY9 A;  4JGO A;  3A0R A;  4KUO A;  1N9O A;  1UWP X;  1T18 A;  2V0W A;  5F5Y A;  1D06 A;  4HH2 A;  2EA9 A;  4BBV A;  2KX6 A;  2WKQ A;  1OTE A;  1X0O A;  3LIB A;  1T1A A;  4HQA A;  4L9G A;  1BYW A;  2B02 A;  1WA9 A;  3MJQ A;  3NOU C;  5EFW A;  3UB6 A;  1XFQ A;  1XJ2 A;  2D01 A;  3NJA A;  2VV8 A;  3PHY A;  2H28 A;  1DP6 A;  3EWK A;  4B9O A;  3UB8 A;  4HJ6 A;  3MXQ A;  3B33 A;  5HWV A;  1DRM A;  2I9V A;  2VV7 A;  3FG8 A;  4HI4 A;  4XT2 B;  5IU1 A;  1TS8 A; 
#chains in the Genus database with same CATH topology
 2ZQD A;  3V5M A;  1RP5 A;  3A3F A;  4BD0 A;  4XUX A;  1K4F A;  4WEJ A;  1D7E A;  4PPR A;  5HDC A;  1PZO A;  1YLJ A;  2FFY A;  1K25 A;  3JPU A;  1KDW A;  1S1Z A;  3NUL A;  2JKF A;  2ZMA A;  4BWI A;  3HLF A;  4Y17 A;  2L0W A;  3MZE A;  5KSC A;  2Y2K A;  4OOM A;  1LT0 A;  1CEG A;  4F94 A;  1NZO A;  5AVF A;  5F6A A;  3LFV A;  4CJN A;  1CI8 A;  3IS2 A;  4WUJ A;  3Q07 A;  1EW0 A;  4GD6 A;  2OWH A;  3K3D A;  5AQA A;  4C75 A;  4JXG A;  4YIN A;  4GKU A;  2PBY A;  1KVL A;  3NDG A;  4ZJ1 A;  3ZGA B;  5F68 A;  5I5L A;  1YSQ A;  2HV1 A;  3IH9 A;  4LFU A;  2Q9N A;  4NEE D;  4F3L A;  1BLH A;  3R7W A;  2XH9 A;  3NIA A;  5DJT A;  2UV0 E;  5HD5 A;  3IWQ A;  2WKH A;  5TBM A;  1ZKJ A;  5EM1 A;  3CLO A;  4WF0 A;  2X02 A;  3H9W A;  4PMA A;  4P6B A;  3GDI A;  2IWB A;  3VE4 A;  4II7 A;  1HD8 A;  1T18 A;  3SH9 A;  3CZD A;  3BFG A;  4Q8I A;  1IKG A;  1LI0 A;  4E3J A;  2ZC5 B;  2OSU A;  2VKS A;  5CER A;  1WE4 A;  1PZP A;  4KZ9 A;  4OOY A;  2Y79 A;  5L8M A;  5GLB A;  3SOI A;  1G6A A;  2JKT I;  3GR2 A;  5DKK A;  1SKO A;  1PWG A;  1MWR A;  5CGW A;  4HHD A;  4IHQ A;  1KGE A;  4OPR A;  5IS1 A;  3HJI A;  1XPB A;  3DAV A;  2XDM A;  4GZB A;  4X53 A;  3B3X A;  2QYB A;  3ZVT A;  5EVI A;  1RGZ A;  1ZG6 A;  3MQQ A;  4IBR A;  4PM7 A;  5JYP A;  4IJG A;  3S22 A;  2WAE A;  4NET A;  2UWX A;  1CK3 A;  1OTD A;  2YKH A;  1G68 A;  3VOL A;  2PAV P;  4WEL A;  3NC8 A;  4QY5 A;  4UA9 A;  3ZYT A;  1J3W A;  3BFF A;  1BSG A;  3Q7Z A;  1AXB A;  5TGF A;  4GHI A;  3VSL A;  1GCE A;  3LY4 A;  4X69 A;  3MKE A;  3PTE A;  5HAI A;  4G3V A;  2FFF B;  1IFQ A;  2XD1 A;  4Y5F A;  3IHA A;  4X1L A;  2Z2L B;  1SDE A;  3T4S A;  1DY6 A;  1F2K A;  3BY9 A;  1I2W A;  1UWP X;  1N9O A;  1RCJ A;  4IBX A;  3KSH A;  1FR1 A;  1X0O A;  1T1A A;  3UPN A;  5EFW A;  2ZM2 A;  1FSY A;  3TOI A;  4DE0 A;  4XT2 B;  3A3E A;  3G6O A;  3GV9 A;  4NG2 A;  1L2S A;  5FSR A;  3F1P B;  4OPY A;  4EUV A;  4Z1W A;  3MZD A;  2O9C A;  3FYZ A;  2LB5 A;  3SH7 A;  3RH8 B;  2HJ9 C;  3W2Z A;  5EVI D;  1ZC2 A;  4LLO B;  1EWZ A;  4JLF A;  4O0P A;  3ITA A;  2W3G A;  3BY8 A;  4N9L A;  4DE1 A;  4L9F A;  2HDS A;  3ZCZ A;  2WGV A;  5EVI B;  4Q0H A;  2IA2 A;  3RXX A;  2ZBB A;  2ACG A;  2XR0 A;  3IXD A;  2Y2L A;  1O07 A;  3FV7 A;  2ZLY A;  1OTA A;  4QD4 A;  1TDG A;  4EET B;  3HRE A;  3MKF A;  4LV2 A;  4QPR A;  4E6X A;  1TDL A;  5TJJ A;  2H0Y A;  2PU4 A;  3BLS A;  3VP1 A;  4GN2 A;  3UDX A;  3KX0 X;  4DE3 A;  4XUZ A;  3SH8 A;  5J8X A;  4EV4 A;  3T4L A;  3DTM A;  5FAT A;  2P04 A;  3NEC A;  2ZQ9 A;  5F83 A;  3UB6 A;  2J9O A;  3T4Q A;  3UE1 A;  2VV8 A;  2H28 A;  3RXW A;  4HBT A;  2GNX A;  2NUP C;  5HWV A;  2I9V A;  4K0X A;  3G34 A;  4R4R A;  3HLC A;  2Y91 A;  2C6W B;  2H10 A;  5IT5 A;  5EVI C;  4KG6 A;  1S6R A;  4R3B A;  1VET B;  4EWF A;  5TBM B;  3W4P A;  3T4T A;  2NUT C;  3NI9 A;  2YKF A;  4JGQ A;  3IXH A;  1FCN A;  2P74 A;  3UE3 A;  3ZQ5 A;  1PFL A;  3MR0 A;  3MFD A;  4HES A;  4S2M A;  4LRX C;  1S67 L;  4BMW A;  1LL8 A;  4BBT A;  5I94 A;  2EXB A;  3UNW A;  1K38 A;  3CAX A;  4DN0 A;  1ERO A;  3LR3 A;  1GHI A;  5FAQ A;  2JHE A;  3A0V A;  4OPZ A;  4DKI A;  5FDH A;  4HOI A;  1NRJ A;  3CPT B;  3OPH A;  4O01 A;  2EXA A;  3VP4 A;  2OAP 1;  2HP9 A;  1XFN A;  1OT6 A;  4DMZ A;  3UE0 A;  2BG1 A;  2ZC7 A;  1CEF A;  5G4Z A;  3E2K A;  4WZ4 A;  1MBL A;  4OVD A;  3TJZ C;  5G4Y A;  1A0K A;  1NRF A;  5D3O A;  4LEN A;  5GHY A;  2XK1 A;  1OT9 A;  2CC1 A;  3ZG7 B;  4DJ3 A;  3HUM A;  1MKM A;  4GDB A;  2A24 A;  1VB6 A;  4ZRR A;  5HSQ A;  3MFX A;  4B4X A;  4DRT A;  2ZD8 A;  4L9G A;  1BYW A;  2B02 A;  2ZC3 B;  3S1Y A;  3MZF A;  3UB8 A;  4G3K A;  5FAS A;  3E4P A;  4S2N C;  1N9N A;  3NCK A;  4BLM A;  3E2L A;  1QMF A;  1FCO A;  2IWD A;  3H82 A;  4LPZ A;  3OZH A;  3QNB A;  2QPN A;  3C4O A;  2K2N A;  3DTI A;  3OCN A;  4K0W A;  4OP5 A;  3LCE A;  3SZT A;  4L9E A;  1XX2 A;  4PHT A;  2LB9 A;  2W1T A;  1ERQ A;  1JTD A;  1LHY A;  1NLZ A;  3L9K A;  3N4I A;  2J80 A;  3QNC A;  2O99 A;  1WYC A;  4R70 A;  3SW1 A;  1CF0 A;  4EUZ A;  1KE3 A;  3MXR A;  1LSV A;  3C5A A;  3Q81 A;  3NBL A;  3LIF A;  3A3D A;  3CUE A;  4RX2 A;  4ETX A;  1XKZ A;  1H8M A;  4WL9 A;  3M6H A;  3F1N B;  4UQI S;  1S4S A;  2EX8 A;  3PR6 A;  3HUO A;  4MN6 A;  1M6K A;  1GHM A;  3IF6 C;  1NYM A;  3BWL A;  4ZBE A;  4B93 A;  1PW1 A;  3MBZ A;  5KMW A;  1NYY A;  3LGO A;  1DJC A;  2CMN A;  4FSF A;  1OPX A;  2XQZ A;  4UEY A;  3BFE A;  3FPV A;  1P9R A;  4WZ5 C;  3DWZ A;  4K91 A;  1W7F A;  2WZX A;  2HPB A;  1TS6 A;  3BJN A;  5GLD A;  1FOF A;  4GLQ A;  3FWL A;  5CHM A;  3T50 A;  4BQM A;  3EGX C;  2KDK A;  3C7V A;  2XF3 A;  2PR5 A;  4H6J A;  5CHU A;  1EI5 A;  2WKR A;  1IYS A;  3ZFZ A;  3T12 B;  4E3N A;  1Y28 A;  4WN5 A;  3F1O A;  5C5K A;  1MWT A;  3K3C A;  4P87 A;  4N9K A;  3VOZ A;  2VLG A;  4CQH A;  1FIL A;  3BRM A;  4S2L A;  1K57 C;  4MBF A;  4ZJ3 A;  2DCF A;  5KIZ A;  1GSX A;  2WYX A;  5E2H A;  4WMC D;  3LYX A;  4GCZ A;  4IVK A;  2INW A;  3VFH A;  3UE6 A;  1MWS A;  1K57 A;  3Q82 A;  5HL1 A;  3M6B A;  2WGW A;  1GA0 A;  5KSH A;  2WKP A;  4S2O A;  5A90 A;  4OQ0 A;  3H7W B;  4OLG A;  1IYQ A;  2RCX A;  2ZMF A;  4X68 A;  3CPT A;  5FAO A;  4ARZ B;  3GMW A;  2EA9 A;  4FH2 A;  4CPK A;  3HVF A;  3NJA A;  4IVI A;  2WZZ A;  3PBQ A;  2EX2 A;  3B47 A;  1SZV A;  5A91 A;  2ZOH A;  3MXS A;  3D3O A;  3G2Y A;  3PYP A;  5DFX A;  4JKT A;  2WK0 A;  1K4E A;  4R1G A;  5HDS A;  2QMI A;  1L0F A;  4P0M A;  4LV0 A;  4PM9 A;  4OLD A;  5CEB A;  5CED A;  4WM9 A;  3UME A;  2HF6 A;  2QZ6 A;  4MN5 A;  4DF6 A;  4RQ9 A;  3WS4 A;  3S4X A;  2JE5 A;  3BQ8 A;  3JVV A;  5G18 A;  1K55 A;  3BM6 A;  3BFC A;  2BAS A;  3V67 A;  4OP8 A;  3LIC A;  3MSH A;  2JC7 A;  2E8J A;  2W1T B;  3E98 A;  3KYZ A;  3KO6 A;  3H82 B;  2ZQ8 A;  2VGK A;  3LEZ A;  4KQD A;  4I3J A;  4CLC C;  1F5M A;  1PW8 A;  2JCH A;  3MQ0 A;  5L2F A;  5EVE A;  1XA1 A;  2A49 A;  3HLG A;  3FZC A;  3Q7V A;  4HEF A;  5MC7 A;  1OJG A;  4KG5 A;  4QB8 A;  1IEM A;  2VA0 A;  3O86 A;  1KE4 A;  5F69 A;  3E4Q A;  5CXW A;  1BLS A;  4EEP A;  5JYO A;  2P7J A;  3T4K A;  3ZG0 A;  4OQH A;  3MF0 A;  4UA6 A;  5CGS A;  3CG5 A;  2ZL1 B;  1Q2Q A;  2J3W A;  2V20 A;  4UQI M;  4E3M A;  4S2I A;  1MXO A;  4ESP A;  1K6S A;  1H8Y A;  1BUE A;  2H5S A;  3D9Y A;  4DXB A;  4HI4 A;  1OTI A;  4QJG A;  2Y59 A;  4X25 A;  1OJ5 A;  3LEQ A;  5E2E A;  3FC7 A;  3OLO A;  3BFD A;  1YT4 A;  2WAF A;  5E43 A;  3AGE A;  3JYI A;  3UPP A;  3DTK A;  2K31 A;  3ZNT A;  4U0X A;  1VM1 A;  5HDD A;  1L0D A;  4PKY A;  3LR4 A;  2PT7 A;  3WRZ A;  1W8Q A;  3OC2 A;  1P97 A;  2OWJ A;  3P7N A;  2HDU A;  4WYY A;  1JWP A;  1YQS A;  3G30 A;  3O5Y A;  1G28 A;  1PI5 A;  5DTS A;  3TG9 A;  4HP9 A;  4IED A;  5A93 A;  4I5S A;  2BTF P;  5E2G A;  4E6W A;  2K7S A;  1VET A;  3S7O A;  3TW8 A;  4GB7 A;  4MBH A;  4MMN A;  2VGL M;  2XEP A;  3C7U A;  3F1O B;  2G2U A;  4KZ8 A;  2GX5 A;  2ZQA A;  3H7W A;  4KUO A;  3GSG A;  3EEA A;  4HH2 A;  5AQ9 A;  1M40 A;  5CHJ A;  3N7W A;  4EBP A;  5CTN A;  5FL3 A;  5IHV A;  4MEZ A;  3FG8 A;  4D2O A;  3WS2 A;  4UA7 A;  1D1J A;  3GQZ A;  2FH5 A;  1LL5 A;  4HJ4 A;  3JVU A;  2PBD P;  3VE3 A;  1GSV A;  1DP9 A;  1PWD A;  3N6I A;  3A3J A;  2Z6D A;  1XGI A;  3CI6 A;  2FZ0 A;  3CWF A;  3TE8 A;  4HIA A;  1PYY A;  4KG2 A;  1FIK A;  4HY8 A;  4KQO A;  3U4L P;  3OPL A;  3T1S A;  5L09 A;  3GTC A;  2VV6 A;  2OAQ 1;  4GNU A;  2EFX A;  2V8C A;  4WLA A;  5AJG A;  5J7E A;  3O88 A;  5GL9 A;  3UY6 A;  1TS7 A;  3SS5 A;  3ZHH A;  4IUH A;  4NXG A;  1I2S A;  2ZQ7 A;  1ZHH B;  2GDN A;  1HLU P;  1E25 A;  3G32 A;  5M1A A;  3NY4 A;  2E8I A;  3LIE A;  4X1M A;  4H6J B;  5TFQ A;  4R0Q A;  4RA7 A;  5HD3 A;  2ZJ9 A;  4DJ2 A;  2L4R A;  1CQA A;  5DKL A;  1JWV A;  1LSW A;  1JTG A;  5HPI A;  1MZU A;  2R9W A;  2XSS A;  3ZG5 A;  3PBO A;  1FSW A;  4OQI A;  4U0T A;  1G5U A;  3EQU A;  4UHU A;  2M7V A;  4EBN A;  4N92 A;  1ERM A;  5A92 A;  1QME A;  2XA7 M;  3WS1 A;  1LSX A;  2W3F A;  4NXF A;  2VZW A;  4NXE A;  4KZA A;  4A5R A;  4EQ1 A;  1G6O A;  3VOY A;  1MWU A;  4FOF A;  3NOP C;  5DFY A;  2G2W A;  2Y2J A;  3FKW A;  4PM6 A;  3OPR A;  3P09 A;  3MJQ A;  2A2L A;  5EOO A;  2HZ5 A;  4HJ6 A;  3B33 A;  3A3I A;  4C3Q A;  5J4E A;  2ZMV A;  1IYP A;  4HBU A;  1FCM A;  3ITB A;  4KZB A;  4Q0J A;  1K54 A;  1XXM A;  4PKY G;  2OV5 A;  2Y2P A;  1VQQ A;  4FH4 A;  4KZ6 A;  2EWW A;  3VMA A;  4DDS A;  1K6R A;  3VFF A;  3PBN A;  5EVL A;  3B42 A;  3QHY A;  5HX9 A;  4R3J A;  5DF7 A;  3PBS A;  3LR5 A;  3UN7 A;  5GLC A;  4HP4 A;  3VP3 A;  1N4O A;  1BLC A;  3TSG A;  2QKP A;  2O9A A;  3U2A A;  2WGW B;  4GJ4 A;  2R9X A;  4LGW A;  2Y2H A;  3KYQ A;  4Z9Q A;  4P85 A;  4Q0I A;  4CLC E;  1S66 L;  4G3W A;  4WEK A;  1IKI A;  2Z6C A;  2HP5 A;  4NXB A;  1JNU A;  3V3R A;  5FI7 A;  1LI9 A;  5DF9 A;  3ZDJ A;  4Y2F A;  2VX8 A;  2IWC A;  2Y8H A;  2MJ6 A;  1ES4 A;  3OOV A;  4IUK A;  4HH3 A;  4MN7 A;  3A0R A;  5F5Y A;  1FR6 A;  4R23 A;  3OPP A;  3UPO A;  5EEC A;  1WA9 A;  1ESI A;  3BEC A;  1E3U D;  1J9M A;  3OBF A;  5GLA A;  5FEG A;  1HTZ A;  3S7Q A;  4EEU A;  2HJE A;  3G35 A;  5FEF A;  4S2P A;  4M4X A;  4GW9 A;  2AVX A;  5TR7 A;  5EUA A;  3R7W B;  5CGX A;  3HL9 A;  2V0U A;  3CIT A;  4YOF A;  4ARZ A;  3C38 A;  3UB7 A;  2J8Y A;  4NK3 A;  4OOL A;  4FTX A;  1V9Y A;  1IOU A;  1NWZ A;  2Y2M A;  1W79 A;  1LL9 A;  3KSF A;  3M2K A;  1H3Q A;  5HWW A;  1YLP A;  1P0Z A;  1TS0 A;  2KOI A;  1N9B A;  3W4Q A;  4R6L A;  3IXG A;  4WMC A;  2QJ7 A;  4GHI B;  3BLM A;  1YMS A;  4PAU A;  1FQG A;  1W63 M;  1Q2P A;  1YMX A;  3IF6 A;  3V3S A;  2PU2 A;  2O9B A;  4S2N A;  5HFO A;  4N1H A;  1HZO A;  3FPW A;  4UAA A;  4GS9 A;  4YWZ A;  1XJ4 A;  3PAG A;  2JKR I;  2ZM8 A;  1ALQ A;  2DNS A;  2W27 A;  3KSI A;  4ZJ2 A;  5FI2 A;  4GS9 B;  3W4O A;  5KZH A;  3LR0 A;  4Y0T A;  3VP0 A;  4I39 A;  1NJ4 A;  1SDN A;  4JGO A;  4BD1 A;  5L10 A;  1HVB A;  5AQB A;  5GHX A;  5FI6 A;  3R4K A;  1SKO B;  3IWO A;  1XJ2 A;  3Q7V B;  4ID4 A;  3PHY A;  3UO9 A;  3VP2 A;  4B9O A;  1DRM A;  2C5W B;  3S7N A;  4OQG A;  3HBR A;  4WZ5 A;  3UB5 P;  1L0E A;  2XGN A;  4E3L A;  4K08 A;  4JF5 A;  2ZC6 B;  3IXB A;  1PWC A;  5EM0 A;  1VHM A;  5F82 A;  4KZ3 A;  1YLW A;  1Y4O A;  4S2K A;  3RJU A;  3P01 A;  2Y2I A;  4FUW A;  1YPR A;  1YSP A;  2JKT M;  3FKV A;  2P9V B;  3ISG A;  2RL3 A;  2A24 B;  2G7U A;  5HAQ A;  3WWX A;  4I3A A;  3LI8 A;  1MKI A;  1CI9 A;  1T1C A;  5GHZ A;  4E3K A;  5J3W A;  4EQI A;  5FQJ A;  1OME A;  4EES A;  2WAD A;  1KE0 A;  2H0T A;  3F1P A;  5AQ7 A;  1P9W A;  2D02 A;  4ZAM A;  1PNE A;  3C4P A;  2V1B A;  5HL6 A;  1F9I A;  2Y4A A;  4QHC A;  3IBJ A;  3V50 A;  4MLL A;  1YLZ A;  1Z09 A;  1NY0 A;  4M3K A;  2PD8 A;  4BBU A;  1IYO A;  4CLC A;  4RX3 A;  2JKG A;  3WS0 A;  5FQM A;  1YKD A;  3IF6 B;  2J3T D;  1S0W A;  2W3D A;  3UB9 A;  1KGF A;  2XD5 A;  1IEL A;  3OCL A;  1MC0 A;  1C3B A;  1TVF A;  2VK3 A;  4BL3 A;  5CTM A;  4KQQ A;  3NOU C;  4LCL A;  4NKP A;  2Y55 A;  3VV4 A;  4DDY A;  1XFQ A;  1XA7 A;  1WYB A;  3HLB A;  2VV7 A;  5HAR A;  3L7H A;  3IWI A;  1UWN X;  2WGI A;  3GRJ A;  1MY8 A;  4N1X A;  4EW7 A;  4B88 A;  1DJA A;  5DVA A;  1BT5 A;  5F1F A;  2XLN A;  3EEH A;  1BUL A;  4OH0 A;  2EWV A;  1Y54 A;  3HCY A;  1ODV A;  4Y15 A;  2ZQC A;  1KVM A;  3DW0 A;  2V9A A;  5DTK A;  5EV0 A;  3C8C A;  4ZTK A;  3PBT A;  3QP4 A;  3IH8 A;  3E4O A;  1NXY A;  2P08 A;  3SS4 A;  4O8G A;  1K54 C;  5DF8 A;  4U3T A;  2QWS A;  2Z2M B;  3RTY A;  4RVA A;  4F3L B;  3NHQ A;  2J9P A;  4KUK A;  1CJF A;  4BL2 A;  4KZ4 A;  4JPM A;  4KQR A;  1L3L A;  1PI4 A;  1AWI A;  4GD8 A;  3Q1F A;  2EFU A;  3PAE A;  3DWK A;  4OON A;  3LID A;  4CLC D;  4MBK A;  3HJK A;  2Y2G A;  1UGU A;  3IS2 B;  3UDI A;  1XJ3 A;  1H0M A;  5FDS A;  4EU0 A;  4H8R A;  4JXV A;  4XXR A;  4R4S A;  3T1R A;  3E0Y A;  3LIA A;  2PHY A;  1GA9 A;  4ETZ A;  2KLI A;  2EX9 A;  2XFS A;  2DRW A;  3IX4 A;  2EX6 A;  5FAP A;  1ONH A;  2V1Z A;  3IHB A;  2J7V A;  2B18 A;  2KX6 A;  3LIB A;  4HQA A;  5BOH A;  5EOE A;  4Y0O A;  1BZA A;  3EWK A;  3RFB A;  2BLS A;  3QP1 A;  1U60 A;  3CHW P;  1DP8 A;  1T19 A;  4QY6 A;  1L0G A;  2X01 A;  4YFM A;  5CRF A;  1VEU A;  3T4J A;  4GOG A;  4QU3 A;  4BJP A;  1E4D A;  4LRZ E;  1W63 Q;  5L07 A;  5EE8 A;  4ZDX A;  1YAX A;  2GZA A;  2XRO A;  3N8L A;  3I7J A;  3GEC A;  3ICY A;  3QP5 A;  2JKR M;  2PD7 A;  2OLV A;  5HZH A;  2GJ3 A;  4P6Z M;  2W0N A;  3BYD A;  5FA7 A;  5HAP A;  4MDZ A;  4E3O A;  2PYP A;  4I38 A;  1PIO A;  3HLD A;  5DTT A;  4DXC A;  3IBR A;  2J3T C;  2HDQ A;  3LUQ A;  2JBF A;  2W3H A;  4CLC B;  3N8R A;  1W8Y A;  3LI9 A;  1OTB A;  3AGF A;  4X6T A;  5CEC A;  3WRT A;  4LCM A;  1NZU A;  2WUQ A;  3CUE C;  4GDN A;  2M7U A;  2OOL A;  4D60 A;  4YNR A;  4B4Z A;  3N8S A;  1F98 A;  4MCW A;  1XJ6 A;  3D72 A;  4C6Y A;  4OKP A;  2HP6 A;  5HW3 A;  3BW6 A;  2V0W A;  4Y0U A;  2WKQ A;  4BEN A;  4JF4 A;  2HDR A;  3PBR A;  4JXW A;  4E3I A;  4PM8 A;  3G2Z A;  3MXQ A;  4P6Z S;  4QWO A;  3VSK A;  3O3V A;  5IU1 A;  4JXS A;  3CJM A;  4I3I A;  2QHK A;  4XT2 A;  2Y2Q A;  2QJ5 A;  2PRF A;  3NOT C;  3C30 A;  1BTL A;  2A3U A;  2ZC4 B;  3DTE A;  3S7P A;  2XRN A;  2XA7 S;  4EXO A;  3IT9 A;  3EGD C;  2ZOI A;  1KDS A;  1T1B A;  2VGJ A;  4MNR A;  5EPH A;  1STZ A;  1S4R A;  2VGL S;  3V39 A;  5HWT A;  2W1R A;  3ZNY A;  1K0K A;  4X55 A;  1K56 A;  1YM1 A;  4OPQ A;  3A0S A;  2JN7 A;  1K56 D;  1ONG A;  4AFI A;  5LBR A;  3GVB A;  2DMW A;  5M18 A;  4X56 A;  4LV1 A;  4KZ5 A;  2HGV A;  1TD5 A;  3K2N A;  4EBL A;  2Y2N A;  4R3A A;  2ZL1 A;  3LY3 A;  1ES5 A;  3IX3 A;  1H5X A;  4PM5 A;  5F1G A;  4EER A;  1SKF A;  4KZ7 A;  3D4F A;  1YLT A;  1YLY A;  1XGJ A;  3EOI A;  2M1C A;  4HNB A;  3MMH A;  1ES2 A;  2ZM0 A;  1H8Z A;  4HJ3 A;  3G4P A;  3ZG9 B;  1TF1 A;  2PYR A;  3MQO A;  3TRC A;  3NDE A;  3P98 A;  3SS3 A;  3KSG A;  4Y7P A;  1MPL A;  2I72 A;  4BBV A;  3CMZ A;  5E2F A;  1ACF A;  2WKI A;  3M2J A;  4FCF A;  4WBG A;  1JVJ A;  1DP6 A;  4JF6 A;  3BEB A;  4O7D A;  2V1A A;  4R38 A;  1GHP A;  1BLP A;  2OLU A;  1N9L A;  3QP2 A;  1ESU A;  1JWZ A;  3AGD A;  3PXP A;  1SCW A;  1ZG4 A;  5K5B A;  3ZVW A;  5FQK A;  1ZTU A;  2Q0O A;  2R78 A;  4Y3I A;  2Q9M A;  3ULF A;  4JGR A;  1Z6F A;  1PRQ A;  3UMD A;  3F1N A;  1KGG A;  3W8K A;  3T1Q B;  2B95 A;  3IF5 A;  3UDF A;  1O7E A;  3QP8 A;  3WS5 A;  4S2J A;  2WKE A;  2PR6 A;  3QP6 A;  2P9V A;  2O0Y A;  3HLE A;  3T4O A;  3T1X A;  3DBA A;  3MS6 A;  1I5Q A;  3IX8 A;  4DE2 A;  5A8B A;  1S1Y A;  5FQ9 A;  3HLW A;  5DJU A;  5AVE A;  5FQQ A;  4LRY C;  3HUN A;  4RYE A;  1KOU A;  2X71 A;  4JGP A;  5FQI A;  1V9Z A;  5CX7 A;  1RGY A;  1LLB A;  2PDR A;  4E04 A;  1GSW A;  2L1M A;  1NLY A;  2VEA A;  4ME4 A;  1K55 C;  3BQA A;  5M19 A;  1DJB A;  2Y2O A;  3EQV A;  1TEM A;  2V8F A;  1ES3 A;  2XFT A;  3IQA A;  4FD8 A;  2VJW A;  3G31 A;  5U47 A;  3C2W A;  2V2F F;  1E3U A;  1XP4 A;  3KYE A;  1VEU B;  5HPF A;  1W5D A;  1D06 A;  4JBF A;  1OTE A;  4Y13 A;  4LV3 A;  4KEN B;  4L0L A;  1SHV A;  3O87 A;  2D01 A;  2W3E A;  2B5R A;  3LO7 A;  3ZG8 B;  1TS8 A; 
#chains in the Genus database with same CATH homology
 3E4P A;  1UWN X;  2FH5 A;  4HJ4 A;  1N9N A;  3JVU A;  3VE3 A;  4EW7 A;  1GSV A;  1DP9 A;  4WEJ A;  3EEH A;  2Z6D A;  2EWV A;  1D7E A;  3H82 A;  3CI6 A;  4LPZ A;  2FZ0 A;  5HDC A;  3CWF A;  3TE8 A;  4HIA A;  3HCY A;  1ODV A;  4HY8 A;  4KQO A;  1S1Z A;  2V9A A;  3C8C A;  3PBT A;  2VV6 A;  4BWI A;  2OAQ 1;  2K2N A;  3E4O A;  4WLA A;  5AJG A;  5J7E A;  3OCN A;  2P08 A;  2L0W A;  4O8G A;  1TS7 A;  4IUH A;  2QWS A;  4L9E A;  1LT0 A;  4NXG A;  4OOM A;  4PHT A;  1ZHH B;  2LB9 A;  2W1T A;  3RTY A;  5AVF A;  5F6A A;  3LFV A;  4F3L B;  3NHQ A;  4KUK A;  1NLZ A;  3IS2 A;  4WUJ A;  3LIE A;  1EW0 A;  4H6J B;  2J80 A;  2OWH A;  3K3D A;  2O99 A;  4R70 A;  5HD3 A;  3SW1 A;  4DJ2 A;  2L4R A;  1LSV A;  5DKL A;  3LIF A;  1LSW A;  5HPI A;  3CUE A;  1MZU A;  4ETX A;  5F68 A;  2XSS A;  3PBO A;  5I5L A;  3LID A;  1YSQ A;  4CLC D;  1H8M A;  2HV1 A;  3HJK A;  3EQU A;  4WL9 A;  2M7V A;  3F1N B;  1UGU A;  4UQI S;  1S4S A;  3PR6 A;  3IS2 B;  4NEE D;  4MN6 A;  4F3L A;  1XJ3 A;  3R7W A;  5DJT A;  5HD5 A;  5TBM A;  4EU0 A;  2XA7 M;  1LSX A;  3BWL A;  4B93 A;  2W3F A;  4NXF A;  3CLO A;  4WF0 A;  2VZW A;  3E0Y A;  4NXE A;  3LIA A;  2PHY A;  3H9W A;  4EQ1 A;  4ETZ A;  2KLI A;  1G6O A;  3GDI A;  4FOF A;  3NOP C;  3VE4 A;  5DFY A;  4II7 A;  2CMN A;  4FSF A;  1T18 A;  2B18 A;  1OPX A;  2KX6 A;  3LIB A;  4HQA A;  4UEY A;  3MJQ A;  2A2L A;  3FPV A;  3EWK A;  1P9R A;  4HJ6 A;  3RFB A;  3B33 A;  2VKS A;  5J4E A;  2ZMV A;  1DP8 A;  1T19 A;  2Y79 A;  1TS6 A;  5L8M A;  3BJN A;  4GLQ A;  2JKT I;  4Q0J A;  3T50 A;  4PKY G;  3EGX C;  5DKK A;  2KDK A;  2EWW A;  2PR5 A;  4H6J A;  4HHD A;  4IHQ A;  3T4J A;  2WKR A;  3PBN A;  4BJP A;  5IS1 A;  3HJI A;  4LRZ E;  3B42 A;  1Y28 A;  1W63 Q;  2QYB A;  3PBS A;  4WN5 A;  3LR5 A;  3F1O A;  1YAX A;  2GZA A;  5C5K A;  4HP4 A;  2QKP A;  2XRO A;  3K3C A;  3MQQ A;  2O9A A;  4IJG A;  3U2A A;  2VLG A;  4CQH A;  3GEC A;  3ICY A;  2JKR M;  1OTD A;  4GJ4 A;  2PD7 A;  2YKH A;  3KYQ A;  3VOL A;  5HZH A;  4WEL A;  2GJ3 A;  4P6Z M;  4Q0I A;  2W0N A;  4MDZ A;  4CLC E;  2PYP A;  3ZYT A;  4I38 A;  1S66 L;  4G3W A;  5KIZ A;  1GSX A;  3IBR A;  2J3T C;  3LUQ A;  4WEK A;  2Z6C A;  2W3H A;  4CLC B;  3LI9 A;  4NXB A;  1JNU A;  1OTB A;  3LYX A;  5DF9 A;  4GCZ A;  4GHI A;  2INW A;  3UE6 A;  3CUE C;  2M7U A;  2OOL A;  4Y2F A;  5KSH A;  2WKP A;  2VX8 A;  4YNR A;  2Y8H A;  4G3V A;  2MJ6 A;  1IFQ A;  3H7W B;  4Y5F A;  1F98 A;  3OOV A;  4MCW A;  1XJ6 A;  3D72 A;  4IUK A;  4HH3 A;  3T4S A;  3BY9 A;  4MN7 A;  3A0R A;  2ZMF A;  3BW6 A;  1N9O A;  1UWP X;  2V0W A;  5F5Y A;  4ARZ B;  3KSH A;  2EA9 A;  2WKQ A;  1X0O A;  1T1A A;  1WA9 A;  5EFW A;  3PBR A;  3NJA A;  3PBQ A;  3OBF A;  3MXQ A;  4P6Z S;  3B47 A;  4XT2 B;  5IU1 A;  3S7Q A;  4EEU A;  2ZOH A;  4I3I A;  2HJE A;  2QHK A;  3D3O A;  3PYP A;  4M4X A;  4XT2 A;  5DFX A;  3G6O A;  4GW9 A;  2QJ5 A;  3NOT C;  3C30 A;  3R7W B;  3F1P B;  3S7P A;  2V0U A;  2XRN A;  3CIT A;  2XA7 S;  4EXO A;  5HDS A;  4EUV A;  3EGD C;  4YOF A;  2ZOI A;  4Z1W A;  1T1B A;  2O9C A;  4ARZ A;  3C38 A;  2LB5 A;  3UB7 A;  3RH8 B;  1STZ A;  3UME A;  4OOL A;  1S4R A;  2HF6 A;  2VGL S;  2HJ9 C;  2W1R A;  5HWT A;  1V9Y A;  3W2Z A;  1IOU A;  4MN5 A;  1NWZ A;  4RQ9 A;  4LLO B;  3JVV A;  3BQ8 A;  3KSF A;  4O0P A;  2W3G A;  3A0S A;  1H3Q A;  5HWW A;  2JN7 A;  3BY8 A;  2BAS A;  4AFI A;  5LBR A;  3V67 A;  3LIC A;  1P0Z A;  1TS0 A;  2DMW A;  2KOI A;  2W1T B;  4R6L A;  2HGV A;  2QJ7 A;  3E98 A;  3KYZ A;  4GHI B;  3KO6 A;  4L9F A;  3H82 B;  1TD5 A;  3K2N A;  4PAU A;  1W63 M;  4R3A A;  4Q0H A;  2IA2 A;  4KQD A;  4I3J A;  2ZBB A;  4CLC C;  2O9B A;  1F5M A;  3MQ0 A;  4EER A;  3FPW A;  4GS9 A;  1OTA A;  4YWZ A;  1XJ4 A;  5MC7 A;  4EET B;  2JKR I;  1OJG A;  2VA0 A;  2W27 A;  3KSI A;  5F69 A;  3E4Q A;  4QPR A;  4EEP A;  4GS9 B;  5TJJ A;  2P7J A;  3EOI A;  3LR0 A;  2M1C A;  4HNB A;  3MMH A;  3T4K A;  3KX0 X;  3MF0 A;  4HJ3 A;  4I39 A;  1TF1 A;  2J3W A;  2PYR A;  3MQO A;  3TRC A;  3T4L A;  4JGO A;  3KSG A;  4UQI M;  4BBV A;  2P04 A;  3R4K A;  3UB6 A;  3T4Q A;  1XJ2 A;  2VV8 A;  3PHY A;  2H28 A;  1DP6 A;  4B9O A;  2GNX A;  2NUP C;  5HWV A;  1DRM A;  2I9V A;  4HI4 A;  3S7N A;  1OTI A;  2V1A A;  4R38 A;  5IT5 A;  1N9L A;  4K08 A;  1OJ5 A;  3FC7 A;  3PXP A;  3OLO A;  1VHM A;  5TBM B;  5K5B A;  1ZTU A;  2R78 A;  3T4T A;  4Y3I A;  2NUT C;  3ULF A;  4JGR A;  2YKF A;  4JGQ A;  2K31 A;  3P01 A;  3UMD A;  3F1N A;  3UE3 A;  1YSP A;  3ZQ5 A;  2JKT M;  3MR0 A;  5HDD A;  4PKY A;  2PR6 A;  4LRX C;  2A24 B;  1S67 L;  2G7U A;  4BMW A;  1LL8 A;  4BBT A;  3LR4 A;  2PT7 A;  2O0Y A;  3CAX A;  4I3A A;  3T4O A;  4DN0 A;  3LR3 A;  3DBA A;  3OC2 A;  2JHE A;  3A0V A;  3LI8 A;  1P97 A;  4HOI A;  1NRJ A;  1T1C A;  4O01 A;  5J3W A;  2OWJ A;  2OAP 1;  5A8B A;  1XFN A;  3P7N A;  4EES A;  1S1Y A;  1OT6 A;  3F1P A;  5DJU A;  4DMZ A;  3O5Y A;  1P9W A;  5AVE A;  1G28 A;  2D02 A;  4LRY C;  5G4Z A;  1KOU A;  4HP9 A;  2V1B A;  4JGP A;  5HL6 A;  1V9Z A;  1F9I A;  5CX7 A;  3TJZ C;  5G4Y A;  4I5S A;  3IBJ A;  2PDR A;  4E04 A;  1GSW A;  2L1M A;  2PD8 A;  1NLY A;  2VEA A;  4BBU A;  4ME4 A;  2K7S A;  3S7O A;  3BQA A;  3TW8 A;  4CLC A;  1OT9 A;  4MMN A;  2VGL M;  3EQV A;  1YKD A;  4DJ3 A;  3F1O B;  1MKM A;  2J3T D;  2W3D A;  3UB9 A;  2A24 A;  2VJW A;  1VB6 A;  4ZRR A;  3C2W A;  2GX5 A;  3H7W A;  5HSQ A;  3MFX A;  3OCL A;  1MC0 A;  4KUO A;  3EEA A;  5HPF A;  1D06 A;  4HH2 A;  1OTE A;  4L9G A;  1BYW A;  2B02 A;  3NOU C;  4NKP A;  4L0L A;  3VV4 A;  1XFQ A;  2D01 A;  2W3E A;  5FL3 A;  3UB8 A;  4G3K A;  2VV7 A;  3FG8 A;  1TS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...