3MJQA

Crystal structure of the pas domain of q24qt8_deshy protein from desulfitobacterium hafniense. northeast structural genomics consortium target dhr85c.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
KNFLETIEDMILIINREGRLLYANTAVPKKLGYTHEELMSMHILTITSAGKMAEGEKILAELFAGKKESLPLSLEKKEGTSIPAKARIWQGKWHNEPCLFAIIKDLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title Crystal structure of the PAS domain of Q24QT8_DESHY protein from Desulfitobacterium hafniense.
rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
total genus 19
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mjqA00
3BY9A 1S67L 1F9IA 2QKPA 3RH8B 1GSWA 4L9EA 4BBTA 1XFQA 1D7EA 5J4EA 3UB8A 4EW7A 1T1BA 1OJGA 3CAXA 4R3AA 4JGPA 2V1AA 2L1MA 1G28A 4GCZA 4HP4A 2I9VA 2PD7A 4WF0A 2BASA 4HH2A 5DJTA 5IS1A 4LLOB 3MFXA 2A24B 3IS2B 5HDSA 3FC7A 2ZBBA 4HOIA 3ZQ5A 3KX0X 2B02A 5DJUA 3H82A 2PR6A 4KQDA 3F1OA 3LI9A 1OTIA 4I3JA 5HDCA 4NXFA 4I39A 2VLGA 4DJ3A 4JGQA 4E04A 3PHYA 5TBMA 5HWTA 5J3WA 4KUKA 5G4YA 4HQAA 1LSWA 3K3DA 1EW0A 2K7SA 3P7NA 2KDKA 2OOLA 1TS6A 3RTYA 3PYPA 4H6JB 2Z6CA 2JHEA 3LIFA 3A0VA 3G6OA 3UB7A 3NHQA 1OT9A 2ZOIA 3GECA 3UB9A 2J80A 1KOUA 3A0RA 4HJ6A 5F5YA 1DP6A 4KUOA 5F6AA 3K3CA 3OLOA 4L9FA 4M4XA 2D02A 2L4RA 5EFWA 2WKPA 4WL9A 3VE4A 3BWLA 3E4OA 4JGOA 1ODVA 4K08A 1T19A 3D72A 5IU1A 4EQ1A 5F68A 1XJ6A 3EEHA 4WUJA 1DP8A 2CMNA 5AVFA 3LYXA 1S1YA 4LRYC 1BYWA 3ULFA 4EEUA 1JNUA 1F98A 1P97A 2OWHA 1XJ4A 5HSQA 2V0WA 1P0ZA 4H6JA 2INWA 4R6LA 4HNBA 4HY8A 3B33A 4BBUA 3H9WA 3LI8A 4F3LB 3LIAA 1S66L 1N9LA 2PYRA 2GJ3A 5J7EA 2WKRA 3HJIA 2V1BA 4L9GA 1D06A 1OTAA 4YWZA 3E4QA 1WA9A 4HHDA 4RQ9A 3NOPC 3F1NB 3BY8A 3VE3A 2PD8A 2H28A 4HJ3A 4R38A 4NXGA 2YKFA 2W27A 2OWJA 1MZUA 1N9OA 5HD3A 1X0OA 2PR5A 2WKQA 1NWZA 3MXQA 3SW1A 3VOLA 4I5SA 1GSXA 5HZHA 3NJAA 4EERA 3C2WA 1OT6A 2PDRA 5AVEA 2A24A 3FG8A 3IS2A 1N9NA 4R70A 3F1PB 2EA9A 4NXBA 3EWKA 3A0SA 4PKYG 2PYPA 4EXOA 1VB6A 3MJQA 3UMDA 2ZOHA 4WLAA 5DKKA 4F3LA 4I3AA 1S1ZA 4B9OA 3E4PA 2KX6A 3CWFA 1DRMA 5TBMB 1LL8A 3LIBA 2YKHA 3NOTC 3HJKA 2QHKA 4GS9B 5G4ZA 2VV7A 4EESA 1UWPX 3H7WB 1S4RA 3F1NA 4EEPA 5HD5A 1LT0A 4LPZA 1UGUA 3IBRA 1TS7A 2HV1A 3T50A 3MQOA 1GSVA 4HI4A 5KIZA 1V9YA 1T1CA 4XT2B 3LIDA 1OTEA 3UMEA 4LRXC 4GHIB 1V9ZA 1OTDA 3UE6A 2P7JA 1Y28A 5HWWA 2V9AA 2D01A 3C8CA 3MQQA 2V0UA 3F1PA 2QWSA 4HJ4A 5A8BA 1TS0A 1UWNX 1T18A 2L0WA 4HIAA 1T1AA 1LSXA 4HP9A 4BBVA 4HH3A 4LRZE 1OJ5A 4I38A 2PHYA 3ICYA 4JGRA 3LIEA 4MN6A 4DJ2A 1OTBA 4GS9A 2Z6DA 4GW9A 2VV6A 5F69A 3H7WA 3MR0A 2W0NA 1S4SA 1LSVA 2VEAA 4I3IA 5I5LA 4EETB 1XJ2A 2JN7A 1TS8A 1DP9A 4NXEA 3CLOA 4XT2A 2QJ5A 2QJ7A 5DKLA 2VV8A 2R78A 4PKYA 2M1CA 4GHIA 1XFNA 3H82B 3LUQA 1XJ3A 3F1OB 5HWVA 3UB6A 3GDIA 5HDDA 3LICA 4WN5A 4MN5A 3NOUC
chains in the Genus database with same CATH superfamily
1LL9A 2M7VA 3MMHA 1BUEA 4HBTA 4E3KA 3U2AA 1AWIA 3UB8A 3LR0A 1Z6FA 4JGPA 4QY6A 2VGLM 3T1RA 4S2MA 3VOYA 4HP4A 2PD7A 4WF0A 1YSQA 4RX3A 1ES5A 2VGKA 3G30A 1N4OA 2BASA 2XDMA 4EBLA 2J8YA 3OBFA 2A24B 4BL2A 4QB8A 4E3JA 2ZBBA 2HP9A 4QPRA 5E2HA 5A93A 5TGFA 2XH9A 4U0XA 3KX0X 4OPYA 2B02A 3GR2A 5CGXA 3H82A 3NECA 4KQDA 1OTIA 4NKPA 3E98A 4NXFA 1ERQA 5HARA 2VLGA 5I94A 2XGNA 1FILA 1JWZA 4KUKA 1OPXA 3T4SA 3ZYTA 4ZBEA 5G4YA 3PXPA 4BLMA 3BYDA 3K3DA 4IUKA 2EWVA 5L07A 1YM1A 2K7SA 1PYYA 4GB7A 2Y8HA 4ZDXA 2KDKA 4MBKA 3QHYA 4WBGA 1KDSA 1ZG6A 4GNUA 3BLSA 1KGGA 3S22A 1CQAA 3A0VA 4DMZA 3OPLA 2XQZA 3GECA 2WGWA 4UA6A 3GRJA 2XF3A 3ZGAB 4HJ6A 3Q82A 3W4OA 1GHIA 3K3CA 4WEKA 5M18A 2W1TB 5EVEA 4IVKA 1HZOA 1FCMA 3G4PA 5EFWA 3W8KA 4UQIS 1RCJA 3BWLA 4WZ5A 3CPTB 3IWIA 3IHBA 1BTLA 2LB5A 5DFXA 3CMZA 3PBTA 3D72A 4MLLA 4WEJA 5F68A 3B47A 1DJBA 1XJ6A 3M2KA 4OONA 2X02A 3EEHA 4LV3A 4Q8IA 2EWWA 3B3XA 4Q0IA 3LYXA 1G68A 3FPVA 1MWSA 4LRYC 3HUNA 3HREA 1BYWA 1NRFA 5GLAA 2ZMFA 1ES4A 3WS1A 1P97A 4X25A 5FL3A 2V0WA 1ESIA 5M1AA 2INWA 4HNBA 3RJUA 1GHMA 1YMXA 4QHCA 1DJAA 4PPRA 1S66L 2PYRA 2GJ3A 4QWOA 2WKRA 4MDZA 3VP3A 3NC8A 4PM5A 4OPQA 3CI6A 1MWTA 1WA9A 2ZM0A 4HHDA 4RQ9A 3MZFA 5HL6A 3FKWA 3UPNA 4DXBA 1K55C 4ETXA 4WMCA 1J9MA 4PM8A 2O99A 4NXGA 2PBYA 2YKFA 1NLYA 3OC2A 5AQBA 1L0DA 5EV0A 3LFVA 2K31A 4GN2A 2EFXA 4P6ZM 3LY3A 1X0OA 3ZVWA 2WKQA 3VOLA 2JKFA 3NY4A 1GSXA 2ZQ9A 5HZHA 3NJAA 1EWZA 4EERA 3JYIA 2IWBA 3ZHHA 1D1JA 3T4LA 2A24A 3D4FA 5FQMA 4R70A 1GCEA 2EA9A 4NXBA 1TD5A 2G2UA 1MKIA 3QP4A 2VKSA 1N9BA 3UMDA 2ZOHA 4LCLA 4F3LA 3ZNTA 3E4PA 3CWFA 4GJ4A 5HAPA 5TBMB 1LL8A 3ZDJA 4GOGA 2QHKA 5L10A 4EBPA 4GS9B 5G4ZA 5HL1A 3CJMA 3PBNA 3AGFA 4O7DA 3ITBA 5HD5A 3G32A 4LPZA 4B4ZA 1BLHA 3KSHA 3T4KA 4ZJ3A 2A49A 3UPOA 3MQOA 4MEZA 4BL3A 1IKIA 5KIZA 5JYOA 1V9YA 4XT2B 4CLCB 5HW3A 3A3DA 2P04A 3BW6A 3MZEA 3BJNA 1S0WA 1W7FA 3UE6A 2Q0OA 5HWWA 1SKFA 4EBNA 5KSHA 2HPBA 3OPRA 1K57A 3U4LP 1UWNX 4PMAA 4DN0A 4Y5FA 3PR6A 1T1AA 4HP9A 4XUZA 3ZG7B 3V5MA 3CPTA 2PHYA 3A3JA 1SKOB 4MN6A 2DCFA 5CTNA 5CERA 5KMWA 5F69A 1JTDA 1S4SA 4QD4A 1ZKJA 4JBFA 4IVIA 1KE4A 2H10A 1VHMA 4I3IA 5FAOA 4S2NC 2JN7A 3OPPA 1U60A 4NXEA 3W4PA 3T1QB 2J3WA 4K91A 2J9PA 2ZQDA 4QY5A 1FR6A 1YLWA 2WZXA 3IBJA 1CI9A 1YT4A 3BM6A 2R78A 2BG1A 3W2ZA 1XFNA 3H82B 2ZC4B 3LUQA 3NDGA 1XJ3A 1STZA 1XP4A 1SZVA 4Y3IA 4MMNA 4U3TA 2EXAA 1CF0A 4R4SA 3CUEA 1LLBA 3BY9A 1F9IA 3NIAA 5E2GA 1GSWA 2RL3A 3UN7A 1XFQA 3VP2A 3HBRA 1LI0A 4EW7A 2P74A 4Y2FA 2WK0A 1K0KA 1IOUA 3CAXA 3T4OA 4R3AA 2V1AA 3KYEA 3G34A 3TW8A 2L1MA 4GCZA 4Q0HA 2AVXA 2OSUA 5FDHA 1A0KA 1YKDA 2WGWB 5IS1A 1SDNA 1PW8A 1J3WA 3IS2B 4X1LA 1TVFA 3FV7A 2P9VA 2RCXA 2Y2JA 4X68A 4ZJ1A 3MKFA 3ZQ5A 4BWIA 4JF6A 1O7EA 4XXRA 2ZL1A 3ZG9B 3GV9A 2PR6A 3BECA 3GMWA 3LI9A 3G35A 4I3JA 5HDCA 4DJ3A 4JGQA 2FFYA 4FUWA 5TBMA 3M2JA 5HWTA 3UDXA 3WRZA 5FAQA 2V20A 4DKIA 5EOEA 1BT5A 1IYOA 4OH0A 3MF0A 5DTSA 4PM9A 5HAIA 4HQAA 1LSWA 3L9KA 2ZQ8A 4WM9A 3DAVA 4O01A 2VX8A 1BSGA 5FA7A 1LHYA 4DE1A 1ESUA 3SH9A 1ES2A 1CEFA 3P7NA 3MQ0A 4DDYA 4CLCA 1TS6A 3RTYA 5L09A 2Z6CA 4EU0A 2JHEA 4E6WA 3DTEA 4LCMA 1PIOA 2W3DA 3LIFA 2JKTI 3O3VA 4XUXA 2Y2KA 3NHQA 1YLZA 4Y15A 3M6HA 5F82A 5FATA 3SS4A 4KZ5A 1W79A 4X53A 3A0RA 1DP6A 4KUOA 3HLWA 2Y2IA 2WAFA 3A3FA 4MNRA 3PBSA 3RXWA 4Z9QA 1XGIA 4JXVA 4GD8A 4EWFA 5CECA 4BMWA 2WKPA 3HVFA 4LGWA 3E4OA 1NYYA 5CEBA 4E3IA 3OPHA 1SKOA 2XA7S 3IF6B 4EQ1A 5GLBA 3MS6A 4OQIA 1L0GA 4C3QA 4OLGA 2G7UA 4CLCD 2NUTC 1H8MA 4F94A 3FYZA 1YLPA 4BD0A 2ACGA 4WZ4A 4MCWA 5EUAA 3IX8A 1S1YA 1GHPA 2JE5A 1KGFA 1ONHA 2ZC6B 1YSPA 2OAP1 3NI9A 4H6JA 2OLVA 4DE0A 5GHYA 3MXRA 3P98A 3IH9A 4U0TA 2HDRA 4F3LB 3LIAA 2EFUA 3FZCA 1I2SA 3HJIA 4L9GA 1PFLA 1D06A 3GQZA 4N9KA 2JCHA 3N4IA 2PT7A 1SHVA 3BEBA 4NETA 2XRNA 3E4QA 2WKHA 1WE4A 3NOPC 1RGZA 3VE3A 4R0QA 2PD8A 3P01A 4IUHA 4OQGA 4HJ3A 1XPBA 1IYQA 2W27A 5CXWA 2VJWA 3ZCZA 2OWJA 3LGOA 4IBXA 2PR5A 5EE8A 2ZC3B 1H3QA 1IYPA 4FD8A 4ME4A 4OQ0A 3A3EA 1FOFA 3PBRA 3ZNYA 1FQGA 2PDRA 4P0MA 5AVEA 2I72A 3FG8A 3IS2A 1N9NA 4BENA 3IX3A 3EWKA 3A0SA 1BLSA 2PRFA 3VFHA 3VMAA 4R4RA 1NYMA 4EXOA 1VB6A 2ZMVA 4Y0OA 2HGVA 2VGJA 5DF9A 1DY6A 5DKKA 3S7OA 5FEFA 4OOYA 4B9OA 5CRFA 2HP6A 1K6SA 3NOTC 2K2NA 2W1RA 2XA7M 3VFFA 4E3OA 3LEQA 1JWPA 1S4RA 2JBFA 2Y59A 3BQ8A 4ESPA 1C3BA 4DDSA 3IBRA 4B88A 3PBQA 3JPUA 3T50A 2HP5A 1GSVA 4KZ9A 4CJNA 3G2YA 3IXGA 1W63Q 5FSRA 2XLNA 1OTEA 4IEDA 1K25A 2W3FA 1V9ZA 3HUMA 3OCLA 3EQUA 2KLIA 4P87A 1OTDA 1W63M 2OV5A 3P09A 2WYXA 2P7JA 4RYEA 3ZG5A 1MKMA 3GVBA 1NRJA 3MFDA 3C7UA 2D01A 4H8RA 4YFMA 3F1PA 3UDFA 4HJ4A 5A8BA 2GNXA 3IT9A 1T18A 3BFGA 2L0WA 2V2FF 5FQ9A 3G2ZA 2DMWA 1OMEA 1YLYA 3EGDC 3QP2A 4WELA 3UE1A 4BBVA 3IXDA 4LRZE 3G31A 3SH7A 4I38A 1BZAA 3ICYA 3LIEA 3MXSA 1TF1A 3IF6A 5CGSA 4A5RA 4BQMA 4OKPA 4K0WA 4GW9A 3MR0A 1ES3A 2W0NA 1Y54A 3TRCA 3CG5A 4DF6A 5CGWA 4KZAA 3R4KA 2Y55A 3Q7VA 3VP1A 1TS8A 3EEAA 1PI5A 3FWLA 1FCOA 4N1HA 1H8ZA 4KZ3A 2JKRM 3CLOA 3TE8A 2P9VB 2JKTM 2Z2LB 3HLEA 3KSFA 2VV8A 5TJJA 2ZL1B 4UA9A 2M1CA 3SS3A 1NY0A 3NULA 1WYBA 4HEFA 4N9LA 4WMCD 3BFCA 4MN5A 4UQIM 5FAPA 2XSSA 3KSIA 5F1FA 1E4DA 2FZ0A 3ISGA 2QKPA 2P08A 4L9EA 5F83A 2EXBA 3DWKA 3FKVA 3QP5A 5J4EA 1BLCA 1IFQA 3UB5P 4DE3A 4KG5A 2C6WB 3K2NA 4ID4A 2WZZA 1O07A 4FH4A 3SZTA 2XEPA 3KSGA 4Y0UA 5FQKA 2I9VA 2H0YA 4KQQA 4EUVA 2HDQA 2GX5A 5EVIA 5A92A 2UWXA 3IHAA 5DJTA 5GHXA 3MFXA 5L2FA 3ZFZA 5U47A 3N7WA 4HOIA 1NZOA 4S2OA 1G5UA 1M40A 4OQHA 4WZ5C 1PW1A 1SCWA 4CPKA 4Q0JA 3IX4A 5DJUA 3BFEA 2Y2PA 4QJGA 4E04A 3PHYA 5FQIA 4JF4A 1WYCA 2A3UA 5M19A 1M6KA 1CK3A 2O9CA 4UHUA 2ZC7A 3QP1A 1HVBA 3HL9A 2ZLYA 4ZJ2A 2EX9A 2WUQA 1EW0A 4C75A 5G18A 3LY4A 1E25A 1K4FA 2OOLA 4JF5A 3L7HA 3BFDA 3MZDA 4H6JB 4OPRA 5TFQA 3IH8A 3UDIA 3G6OA 1VETB 1TDLA 2WGVA 3UB9A 4OP5A 2J80A 2IWCA 2QMIA 1KOUA 1MPLA 2X01A 4JLFA 3DWZA 1BLPA 1K38A 1S6RA 2X71A 4OVDA 3OLOA 4L9FA 3O87A 4M4XA 2D02A 3AGDA 3LR4A 1EI5A 1RP5A 1AXBA 5JYPA 3V67A 2HJEA 4K08A 1T19A 3VSLA 1ERMA 1PWCA 4JXWA 3WRTA 4Y17A 4KG2A 1IKGA 1Q2QA 2XFTA 5AQ7A 5FQJA 3T1XA 3TOIA 2PU2A 1DP8A 1XKZA 4PAUA 4Z1WA 2CMNA 5AVFA 1CJFA 2Y2LA 5E2FA 3DTIA 4EEUA 2LB9A 1JNUA 1KVMA 1F98A 1MC0A 3Q7ZA 2OWHA 1XJ4A 4BD1A 4B93A 1P0ZA 4GZBA 1PNEA 2EX8A 4YINA 4LV0A 2Q9MA 4R6LA 1IEMA 3OOVA 1L0EA 3D3OA 1ZG4A 4BBUA 1I5QA 4RX2A 1VM1A 3QNCA 2WKIA 4DXCA 5HAQA 3LI8A 1N9LA 1W8QA 2V1ZA 3T4JA 5KZHA 3IWOA 4GLQA 3I7JA 3LEZA 4YWZA 1YAXA 3SS5A 3N8SA 3BY8A 1FSWA 5AQAA 2H28A 3DTKA 1PRQA 2NUPC 4R3JA 2ZJ9A 4X6TA 4R38A 1LL5A 1NLZA 2V8CA 3MSHA 3HLDA 1I2WA 4KZ6A 1MZUA 1K56A 1N9OA 5HD3A 5EECA 5EPHA 2JKRI 1NWZA 4R23A 2JKGA 2J9OA 4GDBA 3SW1A 1HLUP 4I5SA 4IBRA 4O0PA 3E0YA 3KYZA 3TG9A 1KDWA 3C2WA 1OT6A 3B42A 1K57C 2Y2OA 1CEGA 3O5YA 5IHVA 2UV0E 3F1PB 4R3BA 3V3SA 3WS0A 5KSCA 2O9BA 4PKYG 5EVLA 2PYPA 4JKTA 5AJGA 4NEED 2BLSA 4I3AA 1PZOA 1JTGA 1FSYA 5FASA 3LIBA 2WKEA 3N6IA 4N92A 2YKHA 3IF5A 2Y2MA 3ZG8B 2Y2GA 3ZG0A 4EESA 2XROA 5DF7A 1UWPX 1K56D 3HLBA 1FIKA 3F1NA 4EEPA 1UGUA 3WS4A 3SH8A 2EX6A 3Q7VB 4C6YA 5FI6A 1K54A 2Q9NA 2VK3A 5DTKA 3LO7A 1K55A 4HI4A 4LV2A 4EUZA 4GD6A 3UMEA 4LRXC 2O9AA 1L2SA 2VZWA 3CUEC 3VP4A 3UY6A 4LFUA 2HDSA 1VETA 2XD5A 1Y28A 4KENB 2V9AA 3C8CA 2R9WA 3PTEA 2B18A 3HCYA 3MKEA 2QWSA 1TS0A 5CHUA 5K5BA 2HZ5A 4B4XA 4HIAA 1LSXA 5CHMA 3C30A 4OLDA 3VSKA 1IELA 2XR0A 5A91A 4JGRA 4LV1A 1OTBA 3DW0A 4ARZA 2Z6DA 1PI4A 2VV6A 1MXOA 2E8IA 3H7WA 1K6RA 1LSVA 2ZC5B 2PAVP 2VEAA 5I5LA 5EM1A 4EETB 4S2KA 4D60A 5EVIB 1DP9A 3V39A 3ZVTA 4P6ZS 1ACFA 1ALQA 3C4PA 2WGIA 4CLCE 4ZTKA 2Y91A 1NZUA 1YPRA 5DKLA 2J7VA 4GHIA 4X56A 2XFSA 2A2LA 2OLUA 4QU3A 1QMEA 5FI2A 3UB6A 3GDIA 4S2LA 5HDDA 2W3GA 3NCKA 3FPWA 3NOUC 3W4QA 1S67L 3IQAA 3EGXC 3RH8B 4RA7A 4ZRRA 4BBTA 5HPFA 2HJ9C 2GDNA 1D7EA 2DRWA 3HUOA 4Y0TA 2WADA 1G6AA 3D9YA 4O8GA 3PAEA 2J3TD 4NG2A 1T1BA 2Y2NA 1P9RA 1OJGA 3Q1FA 4CLCC 1HTZA 5BOHA 3V50A 2E8JA 3ITAA 1FR1A 4HESA 4HBUA 2BTFP 5CX7A 1G28A 3WS5A 3PAGA 3QP8A 5F1GA 1MY8A 4HH2A 4OPZA 2DNSA 3O86A 4LLOB 3GSGA 1PZPA 5HDSA 3FC7A 4S2NA 4E3MA 1G6OA 5C5KA 1MWRA 4S2IA 3UO9A 2W3HA 2GZAA 3TSGA 3F1OA 1BULA 4I39A 1HD8A 4EV4A 1XA1A 2W3EA 3T1SA 5J3WA 4UA7A 1YQSA 3GTCA 1XX2A 1K54C 5FQQA 2M7UA 4K0XA 5DTTA 5LBRA 1E3UA 4UEYA 5E43A 4IJGA 5GLCA 3S7PA 3N8RA 1XGJA 5HPIA 1MWUA 3PYPA 2H5SA 2HDUA 1RGYA 1F5MA 4E3NA 5DF8A 4PHTA 3CZDA 4S2PA 3UB7A 1OT9A 2ZOIA 3DTMA 5AQ9A 3Q81A 3PBOA 5F5YA 2OAQ1 5F6AA 3WS2A 2MJ6A 3KO6A 3UPPA 2L4RA 3TJZC 1VEUB 4WL9A 5D3OA 3VE4A 5IT5A 2QYBA 1E3UD 1QMFA 4JGOA 1ODVA 5FDSA 2ZQ7A 2C5WB 4YOFA 3LR5A 3Q07A 5IU1A 3OCNA 4KZBA 2H0TA 1LI9A 2J3TC 1Q2PA 3MBZA 3UNWA 3T12B 2QPNA 3SOIA 4GDNA 4RVAA 4WUJA 4KQOA 4MBHA 3EOIA 4S2JA 3R7WB 1FCNA 3BFFA 3HLGA 4M3KA 2ZQAA 4II7A 5A90A 3HLFA 3ULFA 3UE0A 4KQRA 3QP6A 4N1XA 1XA7A 2HF6A 1CI8A 1PWDA 3M6BA 5HSQA 4FTXA 1Y4OA 4R1GA 2Y4AA 5J8XA 3DBAA 4HY8A 3B33A 4JXSA 4MN7A 4UAAA 4X69A 2CC1A 3NDEA 4NK3A 4Y13A 3H9WA 1ONGA 4EQIA 4E3LA 5J7EA 4LENA 2V1BA 1VQQA 1NJ4A 1Z09A 3CHWP 2EX2A 3IXBA 2IA2A 1OTAA 3JVVA 3HLCA 2Y2QA 1GA0A 2W1TA 4AFIA 1L0FA 4PM6A 3F1NB 4KZ7A 4IHQA 1H5XA 5CTMA 1H0MA 1ZC2A 5EVID 4ETZA 3VOZA 3E2KA 4FCFA 2VA0A 4DE2A 4G3WA 5HX9A 2B5RA 3V3RA 5GLDA 3BRMA 4CQHA 3MXQA 2FH5A 4YNRA 3C38A 2Y2HA 4OOMA 4X55A 1XXMA 1YLJA 5L8MA 1JVJA 4P6BA 2XD1A 4L0LA 5TR7A 4G3VA 2V8FA 4KG6A 2R9XA 3C4OA 4OOLA 3WWXA 1KE0A 1ZHHB 5MC7A 2WAEA 3RFBA 1NXYA 3MJQA 5GHZA 4WLAA 4DRTA 2B95A 3IF6C 1S1ZA 3CITA 2KX6A 1DRMA 1KVLA 1P9WA 3S7NA 3LCEA 3VP0A 3HJKA 4E6XA 3AGEA 4ARZB 1TEMA 5EM0A 3S1YA 2VV7A 2PU4A 1GA9A 3H7WB 3S7QA 1LT0A 4Y7PA 3N8LA 1TS7A 3T4TA 2HV1A 2Z2MB 2G2WA 3S4XA 2QZ6A 2O0YA 2VGLS 1ZTUA 1T1CA 2ZQCA 3LIDA 3BLMA 1W8YA 4GHIB 2ZD8A 1L3LA 2PBDP 1DJCA 3C7VA 1JWVA 3IWQA 4D2OA 4GKUA 2ZM8A 1TDGA 3MQQA 4OP8A 1YLTA 5CEDA 2V0UA 5DFYA 1W5DA 4PM7A 1IYSA 1PWGA 1YMSA 5EOOA 3NBLA 3E2LA 2XK1A 4WYYA 3T4QA 1F2KA 1VEUA 3JVUA 4HH3A 4ZAMA 1OJ5A 3BQAA 4FH2A 2FFFB 4DJ2A 5FEGA 1KE3A 4GS9A 2Y79A 1K4EA 3A3IA 3QNBA 3C5AA 3UE3A 3EQVA 5EVIC 4BJPA 4P85A 1EROA 5GL9A 4MBFA 4X1MA 2KOIA 3R7WA 1XJ2A 5FI7A 5DVAA 5CHJA 4FOFA 4JPMA 5E2EA 3LR3A 3OZHA 2ZM2A 2IWDA 3IXHA 4JXGA 4FSFA 4XT2A 2JC7A 3KYQA 2QJ5A 4G3KA 2QJ7A 1SDEA 3VV4A 4PKYA 3RXXA 2ZMAA 5HFOA 3F1OB 5HWVA 1H8YA 1KGEA 3LICA 4WN5A 4KZ8A 3O88A 4KZ4A 1MBLA
chains in the Genus database with same CATH topology
2XSSA 3KSIA 3BY9A 1S67L 1F9IA 2FZ0A 2QKPA 3EGXC 3RH8B 1GSWA 2P08A 4L9EA 2M7VA 3MMHA 4ZRRA 4BBTA 5HPFA 1XFQA 2HJ9C 1D7EA 3U2AA 5J4EA 3UB8A 1IFQA 4O8GA 4EW7A 2J3TD 1T1BA 4Y2FA 1P9RA 1OJGA 3LR0A 4CLCC 3K2NA 1IOUA 3CAXA 3T4OA 4R3AA 4JGPA 2VGLM 2V1AA 3TW8A 2L1MA 5CX7A 1G28A 3KSGA 4GCZA 4HP4A 2I9VA 2PD7A 4WF0A 4Q0HA 1YSQA 4EUVA 1YKDA 2GX5A 2BASA 4HH2A 5DJTA 5IS1A 4LLOB 3MFXA 3OBFA 2A24B 3IS2B 5HDSA 3FC7A 2ZBBA 4HOIA 4QPRA 1G6OA 3ZQ5A 5C5KA 3KX0X 4BWIA 2B02A 2W3HA 4Q0JA 5DJUA 2GZAA 3H82A 2PR6A 4KQDA 3F1OA 3LI9A 1OTIA 4NKPA 4I3JA 5HDCA 3E98A 4NXFA 4I39A 2VLGA 4DJ3A 4JGQA 2W3EA 4E04A 3PHYA 5TBMA 5HWTA 5J3WA 2O9CA 4KUKA 1OPXA 2M7UA 3T4SA 3MF0A 3ZYTA 5G4YA 3PXPA 4HQAA 1LSWA 5LBRA 4O01A 2VX8A 3K3DA 4UEYA 4IUKA 2EWVA 1EW0A 2K7SA 4IJGA 3S7PA 2Y8HA 3P7NA 2KDKA 3MQ0A 5HPIA 4CLCA 2OOLA 1TS6A 3RTYA 3PYPA 4H6JB 1F5MA 2Z6CA 4EU0A 2JHEA 4PHTA 2W3DA 3LIFA 2JKTI 3A0VA 4DMZA 3G6OA 3UB7A 3NHQA 1OT9A 2ZOIA 3GECA 3UB9A 3PBOA 2J80A 1KOUA 3A0RA 4HJ6A 5F5YA 2OAQ1 1DP6A 4KUOA 5F6AA 3K3CA 4WEKA 3OLOA 2W1TB 3PBSA 4L9FA 2MJ6A 3KO6A 4M4XA 2D02A 2L4RA 5EFWA 3LR4A 3TJZC 4BMWA 2WKPA 4WL9A 3VE4A 4UQIS 5IT5A 3BWLA 2QYBA 3E4OA 4JGOA 1ODVA 3V67A 2HJEA 4K08A 2LB5A 3PBTA 5DFXA 4YOFA 1T19A 3D72A 3LR5A 2XA7S 4WEJA 5IU1A 3OCNA 4EQ1A 5F68A 3B47A 2J3TC 1XJ6A 2G7UA 4CLCD 2NUTC 3EEHA 1H8MA 2EWWA 4WUJA 1DP8A 4PAUA 4Z1WA 2CMNA 4KQOA 5AVFA 4Q0IA 3EOIA 3LYXA 3R7WB 4MCWA 3FPVA 1S1YA 4LRYC 1BYWA 4II7A 3ULFA 2ZMFA 4EEUA 2LB9A 2HF6A 1JNUA 1F98A 1P97A 1YSPA 2OAP1 1MC0A 2OWHA 1XJ4A 5HSQA 5FL3A 2V0WA 4B93A 1P0ZA 4H6JA 2INWA 4R6LA 3DBAA 4HNBA 4HY8A 3B33A 3OOVA 4MN7A 3D3OA 4BBUA 3H9WA 3LI8A 4F3LB 3LIAA 1S66L 1N9LA 2PYRA 2GJ3A 5J7EA 2WKRA 3HJIA 3T4JA 4MDZA 2V1BA 4L9GA 1D06A 4GLQA 2IA2A 2PT7A 1OTAA 3JVVA 4YWZA 3CI6A 2XRNA 3E4QA 1YAXA 1WA9A 2W1TA 4AFIA 4HHDA 4RQ9A 5HL6A 3NOPC 3F1NB 3BY8A 3VE3A 4ETXA 2PD8A 3P01A 4IHQA 2H28A 4IUHA 2NUPC 4HJ3A 4R38A 2O99A 4NXGA 2YKFA 2W27A 4ETZA 1NLYA 1NLZA 3OC2A 2VJWA 2OWJA 3LFVA 2K31A 1MZUA 2VA0A 1N9OA 4G3WA 5HD3A 4P6ZM 1X0OA 2PR5A 4CQHA 2WKQA 1H3QA 2JKRI 1NWZA 3MXQA 2FH5A 3SW1A 4ME4A 4YNRA 3VOLA 3C38A 4I5SA 1GSXA 3PBRA 4O0PA 5HZHA 3NJAA 4OOMA 3E0YA 3KYZA 4EERA 3C2WA 1OT6A 2PDRA 3B42A 5AVEA 5L8MA 3T4LA 2A24A 3FG8A 3IS2A 3O5YA 4L0LA 1N9NA 4G3VA 4R70A 3F1PB 2EA9A 4NXBA 3EWKA 1TD5A 4OOLA 1ZHHB 2O9BA 3A0SA 4PKYG 2VKSA 5MC7A 2PYPA 3RFBA 5AJGA 4EXOA 1VB6A 2ZMVA 2HGVA 3MJQA 3UMDA 2ZOHA 4NEED 4WLAA 5DF9A 5DKKA 3S7OA 4F3LA 4I3AA 1S1ZA 4B9OA 3CITA 2KX6A 3CWFA 1DRMA 3E4PA 4GJ4A 1P9WA 5TBMB 1LL8A 3LIBA 2YKHA 3S7NA 3NOTC 3HJKA 2K2NA 2QHKA 4ARZB 4GS9B 5G4ZA 2VV7A 2W1RA 2XA7M 4EESA 2XROA 1UWPX 3PBNA 3H7WB 1S4RA 3F1NA 4EEPA 5HD5A 3S7QA 1LT0A 4LPZA 3BQ8A 1UGUA 3IBRA 1TS7A 3KSHA 3T4KA 3T4TA 2HV1A 3PBQA 3T50A 3MQOA 1GSVA 4HI4A 2O0YA 5KIZA 2VGLS 1ZTUA 1W63Q 1V9YA 1T1CA 4XT2B 4CLCB 3LIDA 1OTEA 3UMEA 2P04A 3BW6A 2W3FA 4GHIB 1V9ZA 4LRXC 3BJNA 2O9AA 2VZWA 3OCLA 3CUEC 3EQUA 2KLIA 1OTDA 1W63M 3UE6A 2P7JA 1Y28A 5HWWA 1MKMA 1NRJA 2V9AA 2D01A 3C8CA 3MQQA 5KSHA 2V0UA 5DFYA 3F1PA 2B18A 3HCYA 2QWSA 4HJ4A 2GNXA 5A8BA 1TS0A 1UWNX 5K5BA 1T18A 2L0WA 4HIAA 4Y5FA 4DN0A 2DMWA 3T4QA 3PR6A 3EGDC 3JVUA 1T1AA 4WELA 1LSXA 4HP9A 3C30A 4BBVA 4HH3A 4LRZE 1OJ5A 4I38A 2PHYA 3BQAA 3ICYA 4JGRA 3LIEA 4MN6A 4DJ2A 1TF1A 1OTBA 4ARZA 4GS9A 2Y79A 2Z6DA 4GW9A 2VV6A 5F69A 3UE3A 3EQVA 3H7WA 3MR0A 2W0NA 4BJPA 1S4SA 1LSVA 3TRCA 2VEAA 1VHMA 4I3IA 3R4KA 5I5LA 4EETB 2KOIA 3R7WA 1XJ2A 2JN7A 1TS8A 3EEAA 1DP9A 4NXEA 2J3WA 4FOFA 3LR3A 2JKRM 3CLOA 3TE8A 4P6ZS 4CLCE 3IBJA 4FSFA 4XT2A 3KYQA 2QJ5A 2JKTM 4G3KA 2QJ7A 3KSFA 5DKLA 2VV8A 3VV4A 5TJJA 2R78A 4PKYA 2M1CA 4GHIA 3W2ZA 1XFNA 3H82B 3LUQA 2A2LA 1XJ3A 1STZA 3F1OB 5HWVA 3UB6A 3GDIA 4Y3IA 5HDDA 4MMNA 2W3GA 3LICA 4WN5A 4MN5A 4UQIM 3FPWA 3CUEA 3NOUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY9 A;  1S67 L;  1F9I A;  2QKP A;  3RH8 B;  1GSW A;  4L9E A;  4BBT A;  1XFQ A;  1D7E A;  5J4E A;  3UB8 A;  4EW7 A;  1T1B A;  1OJG A;  3CAX A;  4R3A A;  4JGP A;  2V1A A;  2L1M A;  1G28 A;  4GCZ A;  4HP4 A;  2I9V A;  2PD7 A;  4WF0 A;  2BAS A;  4HH2 A;  5DJT A;  5IS1 A;  4LLO B;  3MFX A;  2A24 B;  3IS2 B;  5HDS A;  3FC7 A;  2ZBB A;  4HOI A;  3ZQ5 A;  3KX0 X;  2B02 A;  5DJU A;  3H82 A;  2PR6 A;  4KQD A;  3F1O A;  3LI9 A;  1OTI A;  4I3J A;  5HDC A;  4NXF A;  4I39 A;  2VLG A;  4DJ3 A;  4JGQ A;  4E04 A;  3PHY A;  5TBM A;  5HWT A;  5J3W A;  4KUK A;  5G4Y A;  4HQA A;  1LSW A;  3K3D A;  1EW0 A;  2K7S A;  3P7N A;  2KDK A;  2OOL A;  1TS6 A;  3RTY A;  3PYP A;  4H6J B;  2Z6C A;  2JHE A;  3LIF A;  3A0V A;  3G6O A;  3UB7 A;  3NHQ A;  1OT9 A;  2ZOI A;  3GEC A;  3UB9 A;  2J80 A;  1KOU A;  3A0R A;  4HJ6 A;  5F5Y A;  1DP6 A;  4KUO A;  5F6A A;  3K3C A;  3OLO A;  4L9F A;  4M4X A;  2D02 A;  2L4R A;  5EFW A;  2WKP A;  4WL9 A;  3VE4 A;  3BWL A;  3E4O A;  4JGO A;  1ODV A;  4K08 A;  1T19 A;  3D72 A;  5IU1 A;  4EQ1 A;  5F68 A;  1XJ6 A;  3EEH A;  4WUJ A;  1DP8 A;  2CMN A;  5AVF A;  3LYX A;  1S1Y A;  4LRY C;  1BYW A;  3ULF A;  4EEU A;  1JNU A;  1F98 A;  1P97 A;  2OWH A;  1XJ4 A;  5HSQ A;  2V0W A;  1P0Z A;  4H6J A;  2INW A;  4R6L A;  4HNB A;  4HY8 A;  3B33 A;  4BBU A;  3H9W A;  3LI8 A;  4F3L B;  3LIA A;  1S66 L;  1N9L A;  2PYR A;  2GJ3 A;  5J7E A;  2WKR A;  3HJI A;  2V1B A;  4L9G A;  1D06 A;  1OTA A;  4YWZ A;  3E4Q A;  1WA9 A;  4HHD A;  4RQ9 A;  3NOP C;  3F1N B;  3BY8 A;  3VE3 A;  2PD8 A;  2H28 A;  4HJ3 A;  4R38 A;  4NXG A;  2YKF A;  2W27 A;  2OWJ A;  1MZU A;  1N9O A;  5HD3 A;  1X0O A;  2PR5 A;  2WKQ A;  1NWZ A;  3MXQ A;  3SW1 A;  3VOL A;  4I5S A;  1GSX A;  5HZH A;  3NJA A;  4EER A;  3C2W A;  1OT6 A;  2PDR A;  5AVE A;  2A24 A;  3FG8 A;  3IS2 A;  1N9N A;  4R70 A;  3F1P B;  2EA9 A;  4NXB A;  3EWK A;  3A0S A;  4PKY G;  2PYP A;  4EXO A;  1VB6 A;  3MJQ A;  3UMD A;  2ZOH A;  4WLA A;  5DKK A;  4F3L A;  4I3A A;  1S1Z A;  4B9O A;  3E4P A;  2KX6 A;  3CWF A;  1DRM A;  5TBM B;  1LL8 A;  3LIB A;  2YKH A;  3NOT C;  3HJK A;  2QHK A;  4GS9 B;  5G4Z A;  2VV7 A;  4EES A;  1UWP X;  3H7W B;  1S4R A;  3F1N A;  4EEP A;  5HD5 A;  1LT0 A;  4LPZ A;  1UGU A;  3IBR A;  1TS7 A;  2HV1 A;  3T50 A;  3MQO A;  1GSV A;  4HI4 A;  5KIZ A;  1V9Y A;  1T1C A;  4XT2 B;  3LID A;  1OTE A;  3UME A;  4LRX C;  4GHI B;  1V9Z A;  1OTD A;  3UE6 A;  2P7J A;  1Y28 A;  5HWW A;  2V9A A;  2D01 A;  3C8C A;  3MQQ A;  2V0U A;  3F1P A;  2QWS A;  4HJ4 A;  5A8B A;  1TS0 A;  1UWN X;  1T18 A;  2L0W A;  4HIA A;  1T1A A;  1LSX A;  4HP9 A;  4BBV A;  4HH3 A;  4LRZ E;  1OJ5 A;  4I38 A;  2PHY A;  3ICY A;  4JGR A;  3LIE A;  4MN6 A;  4DJ2 A;  1OTB A;  4GS9 A;  2Z6D A;  4GW9 A;  2VV6 A;  5F69 A;  3H7W A;  3MR0 A;  2W0N A;  1S4S A;  1LSV A;  2VEA A;  4I3I A;  5I5L A;  4EET B;  1XJ2 A;  2JN7 A;  1TS8 A;  1DP9 A;  4NXE A;  3CLO A;  4XT2 A;  2QJ5 A;  2QJ7 A;  5DKL A;  2VV8 A;  2R78 A;  4PKY A;  2M1C A;  4GHI A;  1XFN A;  3H82 B;  3LUQ A;  1XJ3 A;  3F1O B;  5HWV A;  3UB6 A;  3GDI A;  5HDD A;  3LIC A;  4WN5 A;  4MN5 A;  3NOU C; 
#chains in the Genus database with same CATH topology
 1LL9 A;  2M7V A;  3MMH A;  1BUE A;  4HBT A;  4E3K A;  3U2A A;  1AWI A;  3UB8 A;  3LR0 A;  1Z6F A;  4JGP A;  4QY6 A;  2VGL M;  3T1R A;  4S2M A;  3VOY A;  4HP4 A;  2PD7 A;  4WF0 A;  1YSQ A;  4RX3 A;  1ES5 A;  2VGK A;  3G30 A;  1N4O A;  2BAS A;  2XDM A;  4EBL A;  2J8Y A;  3OBF A;  2A24 B;  4BL2 A;  4QB8 A;  4E3J A;  2ZBB A;  2HP9 A;  4QPR A;  5E2H A;  5A93 A;  5TGF A;  2XH9 A;  4U0X A;  3KX0 X;  4OPY A;  2B02 A;  3GR2 A;  5CGX A;  3H82 A;  3NEC A;  4KQD A;  1OTI A;  4NKP A;  3E98 A;  4NXF A;  1ERQ A;  5HAR A;  2VLG A;  5I94 A;  2XGN A;  1FIL A;  1JWZ A;  4KUK A;  1OPX A;  3T4S A;  3ZYT A;  4ZBE A;  5G4Y A;  3PXP A;  4BLM A;  3BYD A;  3K3D A;  4IUK A;  2EWV A;  5L07 A;  1YM1 A;  2K7S A;  1PYY A;  4GB7 A;  2Y8H A;  4ZDX A;  2KDK A;  4MBK A;  3QHY A;  4WBG A;  1KDS A;  1ZG6 A;  4GNU A;  3BLS A;  1KGG A;  3S22 A;  1CQA A;  3A0V A;  4DMZ A;  3OPL A;  2XQZ A;  3GEC A;  2WGW A;  4UA6 A;  3GRJ A;  2XF3 A;  3ZGA B;  4HJ6 A;  3Q82 A;  3W4O A;  1GHI A;  3K3C A;  4WEK A;  5M18 A;  2W1T B;  5EVE A;  4IVK A;  1HZO A;  1FCM A;  3G4P A;  5EFW A;  3W8K A;  4UQI S;  1RCJ A;  3BWL A;  4WZ5 A;  3CPT B;  3IWI A;  3IHB A;  1BTL A;  2LB5 A;  5DFX A;  3CMZ A;  3PBT A;  3D72 A;  4MLL A;  4WEJ A;  5F68 A;  3B47 A;  1DJB A;  1XJ6 A;  3M2K A;  4OON A;  2X02 A;  3EEH A;  4LV3 A;  4Q8I A;  2EWW A;  3B3X A;  4Q0I A;  3LYX A;  1G68 A;  3FPV A;  1MWS A;  4LRY C;  3HUN A;  3HRE A;  1BYW A;  1NRF A;  5GLA A;  2ZMF A;  1ES4 A;  3WS1 A;  1P97 A;  4X25 A;  5FL3 A;  2V0W A;  1ESI A;  5M1A A;  2INW A;  4HNB A;  3RJU A;  1GHM A;  1YMX A;  4QHC A;  1DJA A;  4PPR A;  1S66 L;  2PYR A;  2GJ3 A;  4QWO A;  2WKR A;  4MDZ A;  3VP3 A;  3NC8 A;  4PM5 A;  4OPQ A;  3CI6 A;  1MWT A;  1WA9 A;  2ZM0 A;  4HHD A;  4RQ9 A;  3MZF A;  5HL6 A;  3FKW A;  3UPN A;  4DXB A;  1K55 C;  4ETX A;  4WMC A;  1J9M A;  4PM8 A;  2O99 A;  4NXG A;  2PBY A;  2YKF A;  1NLY A;  3OC2 A;  5AQB A;  1L0D A;  5EV0 A;  3LFV A;  2K31 A;  4GN2 A;  2EFX A;  4P6Z M;  3LY3 A;  1X0O A;  3ZVW A;  2WKQ A;  3VOL A;  2JKF A;  3NY4 A;  1GSX A;  2ZQ9 A;  5HZH A;  3NJA A;  1EWZ A;  4EER A;  3JYI A;  2IWB A;  3ZHH A;  1D1J A;  3T4L A;  2A24 A;  3D4F A;  5FQM A;  4R70 A;  1GCE A;  2EA9 A;  4NXB A;  1TD5 A;  2G2U A;  1MKI A;  3QP4 A;  2VKS A;  1N9B A;  3UMD A;  2ZOH A;  4LCL A;  4F3L A;  3ZNT A;  3E4P A;  3CWF A;  4GJ4 A;  5HAP A;  5TBM B;  1LL8 A;  3ZDJ A;  4GOG A;  2QHK A;  5L10 A;  4EBP A;  4GS9 B;  5G4Z A;  5HL1 A;  3CJM A;  3PBN A;  3AGF A;  4O7D A;  3ITB A;  5HD5 A;  3G32 A;  4LPZ A;  4B4Z A;  1BLH A;  3KSH A;  3T4K A;  4ZJ3 A;  2A49 A;  3UPO A;  3MQO A;  4MEZ A;  4BL3 A;  1IKI A;  5KIZ A;  5JYO A;  1V9Y A;  4XT2 B;  4CLC B;  5HW3 A;  3A3D A;  2P04 A;  3BW6 A;  3MZE A;  3BJN A;  1S0W A;  1W7F A;  3UE6 A;  2Q0O A;  5HWW A;  1SKF A;  4EBN A;  5KSH A;  2HPB A;  3OPR A;  1K57 A;  3U4L P;  1UWN X;  4PMA A;  4DN0 A;  4Y5F A;  3PR6 A;  1T1A A;  4HP9 A;  4XUZ A;  3ZG7 B;  3V5M A;  3CPT A;  2PHY A;  3A3J A;  1SKO B;  4MN6 A;  2DCF A;  5CTN A;  5CER A;  5KMW A;  5F69 A;  1JTD A;  1S4S A;  4QD4 A;  1ZKJ A;  4JBF A;  4IVI A;  1KE4 A;  2H10 A;  1VHM A;  4I3I A;  5FAO A;  4S2N C;  2JN7 A;  3OPP A;  1U60 A;  4NXE A;  3W4P A;  3T1Q B;  2J3W A;  4K91 A;  2J9P A;  2ZQD A;  4QY5 A;  1FR6 A;  1YLW A;  2WZX A;  3IBJ A;  1CI9 A;  1YT4 A;  3BM6 A;  2R78 A;  2BG1 A;  3W2Z A;  1XFN A;  3H82 B;  2ZC4 B;  3LUQ A;  3NDG A;  1XJ3 A;  1STZ A;  1XP4 A;  1SZV A;  4Y3I A;  4MMN A;  4U3T A;  2EXA A;  1CF0 A;  4R4S A;  3CUE A;  1LLB A;  3BY9 A;  1F9I A;  3NIA A;  5E2G A;  1GSW A;  2RL3 A;  3UN7 A;  1XFQ A;  3VP2 A;  3HBR A;  1LI0 A;  4EW7 A;  2P74 A;  4Y2F A;  2WK0 A;  1K0K A;  1IOU A;  3CAX A;  3T4O A;  4R3A A;  2V1A A;  3KYE A;  3G34 A;  3TW8 A;  2L1M A;  4GCZ A;  4Q0H A;  2AVX A;  2OSU A;  5FDH A;  1A0K A;  1YKD A;  2WGW B;  5IS1 A;  1SDN A;  1PW8 A;  1J3W A;  3IS2 B;  4X1L A;  1TVF A;  3FV7 A;  2P9V A;  2RCX A;  2Y2J A;  4X68 A;  4ZJ1 A;  3MKF A;  3ZQ5 A;  4BWI A;  4JF6 A;  1O7E A;  4XXR A;  2ZL1 A;  3ZG9 B;  3GV9 A;  2PR6 A;  3BEC A;  3GMW A;  3LI9 A;  3G35 A;  4I3J A;  5HDC A;  4DJ3 A;  4JGQ A;  2FFY A;  4FUW A;  5TBM A;  3M2J A;  5HWT A;  3UDX A;  3WRZ A;  5FAQ A;  2V20 A;  4DKI A;  5EOE A;  1BT5 A;  1IYO A;  4OH0 A;  3MF0 A;  5DTS A;  4PM9 A;  5HAI A;  4HQA A;  1LSW A;  3L9K A;  2ZQ8 A;  4WM9 A;  3DAV A;  4O01 A;  2VX8 A;  1BSG A;  5FA7 A;  1LHY A;  4DE1 A;  1ESU A;  3SH9 A;  1ES2 A;  1CEF A;  3P7N A;  3MQ0 A;  4DDY A;  4CLC A;  1TS6 A;  3RTY A;  5L09 A;  2Z6C A;  4EU0 A;  2JHE A;  4E6W A;  3DTE A;  4LCM A;  1PIO A;  2W3D A;  3LIF A;  2JKT I;  3O3V A;  4XUX A;  2Y2K A;  3NHQ A;  1YLZ A;  4Y15 A;  3M6H A;  5F82 A;  5FAT A;  3SS4 A;  4KZ5 A;  1W79 A;  4X53 A;  3A0R A;  1DP6 A;  4KUO A;  3HLW A;  2Y2I A;  2WAF A;  3A3F A;  4MNR A;  3PBS A;  3RXW A;  4Z9Q A;  1XGI A;  4JXV A;  4GD8 A;  4EWF A;  5CEC A;  4BMW A;  2WKP A;  3HVF A;  4LGW A;  3E4O A;  1NYY A;  5CEB A;  4E3I A;  3OPH A;  1SKO A;  2XA7 S;  3IF6 B;  4EQ1 A;  5GLB A;  3MS6 A;  4OQI A;  1L0G A;  4C3Q A;  4OLG A;  2G7U A;  4CLC D;  2NUT C;  1H8M A;  4F94 A;  3FYZ A;  1YLP A;  4BD0 A;  2ACG A;  4WZ4 A;  4MCW A;  5EUA A;  3IX8 A;  1S1Y A;  1GHP A;  2JE5 A;  1KGF A;  1ONH A;  2ZC6 B;  1YSP A;  2OAP 1;  3NI9 A;  4H6J A;  2OLV A;  4DE0 A;  5GHY A;  3MXR A;  3P98 A;  3IH9 A;  4U0T A;  2HDR A;  4F3L B;  3LIA A;  2EFU A;  3FZC A;  1I2S A;  3HJI A;  4L9G A;  1PFL A;  1D06 A;  3GQZ A;  4N9K A;  2JCH A;  3N4I A;  2PT7 A;  1SHV A;  3BEB A;  4NET A;  2XRN A;  3E4Q A;  2WKH A;  1WE4 A;  3NOP C;  1RGZ A;  3VE3 A;  4R0Q A;  2PD8 A;  3P01 A;  4IUH A;  4OQG A;  4HJ3 A;  1XPB A;  1IYQ A;  2W27 A;  5CXW A;  2VJW A;  3ZCZ A;  2OWJ A;  3LGO A;  4IBX A;  2PR5 A;  5EE8 A;  2ZC3 B;  1H3Q A;  1IYP A;  4FD8 A;  4ME4 A;  4OQ0 A;  3A3E A;  1FOF A;  3PBR A;  3ZNY A;  1FQG A;  2PDR A;  4P0M A;  5AVE A;  2I72 A;  3FG8 A;  3IS2 A;  1N9N A;  4BEN A;  3IX3 A;  3EWK A;  3A0S A;  1BLS A;  2PRF A;  3VFH A;  3VMA A;  4R4R A;  1NYM A;  4EXO A;  1VB6 A;  2ZMV A;  4Y0O A;  2HGV A;  2VGJ A;  5DF9 A;  1DY6 A;  5DKK A;  3S7O A;  5FEF A;  4OOY A;  4B9O A;  5CRF A;  2HP6 A;  1K6S A;  3NOT C;  2K2N A;  2W1R A;  2XA7 M;  3VFF A;  4E3O A;  3LEQ A;  1JWP A;  1S4R A;  2JBF A;  2Y59 A;  3BQ8 A;  4ESP A;  1C3B A;  4DDS A;  3IBR A;  4B88 A;  3PBQ A;  3JPU A;  3T50 A;  2HP5 A;  1GSV A;  4KZ9 A;  4CJN A;  3G2Y A;  3IXG A;  1W63 Q;  5FSR A;  2XLN A;  1OTE A;  4IED A;  1K25 A;  2W3F A;  1V9Z A;  3HUM A;  3OCL A;  3EQU A;  2KLI A;  4P87 A;  1OTD A;  1W63 M;  2OV5 A;  3P09 A;  2WYX A;  2P7J A;  4RYE A;  3ZG5 A;  1MKM A;  3GVB A;  1NRJ A;  3MFD A;  3C7U A;  2D01 A;  4H8R A;  4YFM A;  3F1P A;  3UDF A;  4HJ4 A;  5A8B A;  2GNX A;  3IT9 A;  1T18 A;  3BFG A;  2L0W A;  2V2F F;  5FQ9 A;  3G2Z A;  2DMW A;  1OME A;  1YLY A;  3EGD C;  3QP2 A;  4WEL A;  3UE1 A;  4BBV A;  3IXD A;  4LRZ E;  3G31 A;  3SH7 A;  4I38 A;  1BZA A;  3ICY A;  3LIE A;  3MXS A;  1TF1 A;  3IF6 A;  5CGS A;  4A5R A;  4BQM A;  4OKP A;  4K0W A;  4GW9 A;  3MR0 A;  1ES3 A;  2W0N A;  1Y54 A;  3TRC A;  3CG5 A;  4DF6 A;  5CGW A;  4KZA A;  3R4K A;  2Y55 A;  3Q7V A;  3VP1 A;  1TS8 A;  3EEA A;  1PI5 A;  3FWL A;  1FCO A;  4N1H A;  1H8Z A;  4KZ3 A;  2JKR M;  3CLO A;  3TE8 A;  2P9V B;  2JKT M;  2Z2L B;  3HLE A;  3KSF A;  2VV8 A;  5TJJ A;  2ZL1 B;  4UA9 A;  2M1C A;  3SS3 A;  1NY0 A;  3NUL A;  1WYB A;  4HEF A;  4N9L A;  4WMC D;  3BFC A;  4MN5 A;  4UQI M;  5FAP A;  2XSS A;  3KSI A;  5F1F A;  1E4D A;  2FZ0 A;  3ISG A;  2QKP A;  2P08 A;  4L9E A;  5F83 A;  2EXB A;  3DWK A;  3FKV A;  3QP5 A;  5J4E A;  1BLC A;  1IFQ A;  3UB5 P;  4DE3 A;  4KG5 A;  2C6W B;  3K2N A;  4ID4 A;  2WZZ A;  1O07 A;  4FH4 A;  3SZT A;  2XEP A;  3KSG A;  4Y0U A;  5FQK A;  2I9V A;  2H0Y A;  4KQQ A;  4EUV A;  2HDQ A;  2GX5 A;  5EVI A;  5A92 A;  2UWX A;  3IHA A;  5DJT A;  5GHX A;  3MFX A;  5L2F A;  3ZFZ A;  5U47 A;  3N7W A;  4HOI A;  1NZO A;  4S2O A;  1G5U A;  1M40 A;  4OQH A;  4WZ5 C;  1PW1 A;  1SCW A;  4CPK A;  4Q0J A;  3IX4 A;  5DJU A;  3BFE A;  2Y2P A;  4QJG A;  4E04 A;  3PHY A;  5FQI A;  4JF4 A;  1WYC A;  2A3U A;  5M19 A;  1M6K A;  1CK3 A;  2O9C A;  4UHU A;  2ZC7 A;  3QP1 A;  1HVB A;  3HL9 A;  2ZLY A;  4ZJ2 A;  2EX9 A;  2WUQ A;  1EW0 A;  4C75 A;  5G18 A;  3LY4 A;  1E25 A;  1K4F A;  2OOL A;  4JF5 A;  3L7H A;  3BFD A;  3MZD A;  4H6J B;  4OPR A;  5TFQ A;  3IH8 A;  3UDI A;  3G6O A;  1VET B;  1TDL A;  2WGV A;  3UB9 A;  4OP5 A;  2J80 A;  2IWC A;  2QMI A;  1KOU A;  1MPL A;  2X01 A;  4JLF A;  3DWZ A;  1BLP A;  1K38 A;  1S6R A;  2X71 A;  4OVD A;  3OLO A;  4L9F A;  3O87 A;  4M4X A;  2D02 A;  3AGD A;  3LR4 A;  1EI5 A;  1RP5 A;  1AXB A;  5JYP A;  3V67 A;  2HJE A;  4K08 A;  1T19 A;  3VSL A;  1ERM A;  1PWC A;  4JXW A;  3WRT A;  4Y17 A;  4KG2 A;  1IKG A;  1Q2Q A;  2XFT A;  5AQ7 A;  5FQJ A;  3T1X A;  3TOI A;  2PU2 A;  1DP8 A;  1XKZ A;  4PAU A;  4Z1W A;  2CMN A;  5AVF A;  1CJF A;  2Y2L A;  5E2F A;  3DTI A;  4EEU A;  2LB9 A;  1JNU A;  1KVM A;  1F98 A;  1MC0 A;  3Q7Z A;  2OWH A;  1XJ4 A;  4BD1 A;  4B93 A;  1P0Z A;  4GZB A;  1PNE A;  2EX8 A;  4YIN A;  4LV0 A;  2Q9M A;  4R6L A;  1IEM A;  3OOV A;  1L0E A;  3D3O A;  1ZG4 A;  4BBU A;  1I5Q A;  4RX2 A;  1VM1 A;  3QNC A;  2WKI A;  4DXC A;  5HAQ A;  3LI8 A;  1N9L A;  1W8Q A;  2V1Z A;  3T4J A;  5KZH A;  3IWO A;  4GLQ A;  3I7J A;  3LEZ A;  4YWZ A;  1YAX A;  3SS5 A;  3N8S A;  3BY8 A;  1FSW A;  5AQA A;  2H28 A;  3DTK A;  1PRQ A;  2NUP C;  4R3J A;  2ZJ9 A;  4X6T A;  4R38 A;  1LL5 A;  1NLZ A;  2V8C A;  3MSH A;  3HLD A;  1I2W A;  4KZ6 A;  1MZU A;  1K56 A;  1N9O A;  5HD3 A;  5EEC A;  5EPH A;  2JKR I;  1NWZ A;  4R23 A;  2JKG A;  2J9O A;  4GDB A;  3SW1 A;  1HLU P;  4I5S A;  4IBR A;  4O0P A;  3E0Y A;  3KYZ A;  3TG9 A;  1KDW A;  3C2W A;  1OT6 A;  3B42 A;  1K57 C;  2Y2O A;  1CEG A;  3O5Y A;  5IHV A;  2UV0 E;  3F1P B;  4R3B A;  3V3S A;  3WS0 A;  5KSC A;  2O9B A;  4PKY G;  5EVL A;  2PYP A;  4JKT A;  5AJG A;  4NEE D;  2BLS A;  4I3A A;  1PZO A;  1JTG A;  1FSY A;  5FAS A;  3LIB A;  2WKE A;  3N6I A;  4N92 A;  2YKH A;  3IF5 A;  2Y2M A;  3ZG8 B;  2Y2G A;  3ZG0 A;  4EES A;  2XRO A;  5DF7 A;  1UWP X;  1K56 D;  3HLB A;  1FIK A;  3F1N A;  4EEP A;  1UGU A;  3WS4 A;  3SH8 A;  2EX6 A;  3Q7V B;  4C6Y A;  5FI6 A;  1K54 A;  2Q9N A;  2VK3 A;  5DTK A;  3LO7 A;  1K55 A;  4HI4 A;  4LV2 A;  4EUZ A;  4GD6 A;  3UME A;  4LRX C;  2O9A A;  1L2S A;  2VZW A;  3CUE C;  3VP4 A;  3UY6 A;  4LFU A;  2HDS A;  1VET A;  2XD5 A;  1Y28 A;  4KEN B;  2V9A A;  3C8C A;  2R9W A;  3PTE A;  2B18 A;  3HCY A;  3MKE A;  2QWS A;  1TS0 A;  5CHU A;  5K5B A;  2HZ5 A;  4B4X A;  4HIA A;  1LSX A;  5CHM A;  3C30 A;  4OLD A;  3VSK A;  1IEL A;  2XR0 A;  5A91 A;  4JGR A;  4LV1 A;  1OTB A;  3DW0 A;  4ARZ A;  2Z6D A;  1PI4 A;  2VV6 A;  1MXO A;  2E8I A;  3H7W A;  1K6R A;  1LSV A;  2ZC5 B;  2PAV P;  2VEA A;  5I5L A;  5EM1 A;  4EET B;  4S2K A;  4D60 A;  5EVI B;  1DP9 A;  3V39 A;  3ZVT A;  4P6Z S;  1ACF A;  1ALQ A;  3C4P A;  2WGI A;  4CLC E;  4ZTK A;  2Y91 A;  1NZU A;  1YPR A;  5DKL A;  2J7V A;  4GHI A;  4X56 A;  2XFS A;  2A2L A;  2OLU A;  4QU3 A;  1QME A;  5FI2 A;  3UB6 A;  3GDI A;  4S2L A;  5HDD A;  2W3G A;  3NCK A;  3FPW A;  3NOU C;  3W4Q A;  1S67 L;  3IQA A;  3EGX C;  3RH8 B;  4RA7 A;  4ZRR A;  4BBT A;  5HPF A;  2HJ9 C;  2GDN A;  1D7E A;  2DRW A;  3HUO A;  4Y0T A;  2WAD A;  1G6A A;  3D9Y A;  4O8G A;  3PAE A;  2J3T D;  4NG2 A;  1T1B A;  2Y2N A;  1P9R A;  1OJG A;  3Q1F A;  4CLC C;  1HTZ A;  5BOH A;  3V50 A;  2E8J A;  3ITA A;  1FR1 A;  4HES A;  4HBU A;  2BTF P;  5CX7 A;  1G28 A;  3WS5 A;  3PAG A;  3QP8 A;  5F1G A;  1MY8 A;  4HH2 A;  4OPZ A;  2DNS A;  3O86 A;  4LLO B;  3GSG A;  1PZP A;  5HDS A;  3FC7 A;  4S2N A;  4E3M A;  1G6O A;  5C5K A;  1MWR A;  4S2I A;  3UO9 A;  2W3H A;  2GZA A;  3TSG A;  3F1O A;  1BUL A;  4I39 A;  1HD8 A;  4EV4 A;  1XA1 A;  2W3E A;  3T1S A;  5J3W A;  4UA7 A;  1YQS A;  3GTC A;  1XX2 A;  1K54 C;  5FQQ A;  2M7U A;  4K0X A;  5DTT A;  5LBR A;  1E3U A;  4UEY A;  5E43 A;  4IJG A;  5GLC A;  3S7P A;  3N8R A;  1XGJ A;  5HPI A;  1MWU A;  3PYP A;  2H5S A;  2HDU A;  1RGY A;  1F5M A;  4E3N A;  5DF8 A;  4PHT A;  3CZD A;  4S2P A;  3UB7 A;  1OT9 A;  2ZOI A;  3DTM A;  5AQ9 A;  3Q81 A;  3PBO A;  5F5Y A;  2OAQ 1;  5F6A A;  3WS2 A;  2MJ6 A;  3KO6 A;  3UPP A;  2L4R A;  3TJZ C;  1VEU B;  4WL9 A;  5D3O A;  3VE4 A;  5IT5 A;  2QYB A;  1E3U D;  1QMF A;  4JGO A;  1ODV A;  5FDS A;  2ZQ7 A;  2C5W B;  4YOF A;  3LR5 A;  3Q07 A;  5IU1 A;  3OCN A;  4KZB A;  2H0T A;  1LI9 A;  2J3T C;  1Q2P A;  3MBZ A;  3UNW A;  3T12 B;  2QPN A;  3SOI A;  4GDN A;  4RVA A;  4WUJ A;  4KQO A;  4MBH A;  3EOI A;  4S2J A;  3R7W B;  1FCN A;  3BFF A;  3HLG A;  4M3K A;  2ZQA A;  4II7 A;  5A90 A;  3HLF A;  3ULF A;  3UE0 A;  4KQR A;  3QP6 A;  4N1X A;  1XA7 A;  2HF6 A;  1CI8 A;  1PWD A;  3M6B A;  5HSQ A;  4FTX A;  1Y4O A;  4R1G A;  2Y4A A;  5J8X A;  3DBA A;  4HY8 A;  3B33 A;  4JXS A;  4MN7 A;  4UAA A;  4X69 A;  2CC1 A;  3NDE A;  4NK3 A;  4Y13 A;  3H9W A;  1ONG A;  4EQI A;  4E3L A;  5J7E A;  4LEN A;  2V1B A;  1VQQ A;  1NJ4 A;  1Z09 A;  3CHW P;  2EX2 A;  3IXB A;  2IA2 A;  1OTA A;  3JVV A;  3HLC A;  2Y2Q A;  1GA0 A;  2W1T A;  4AFI A;  1L0F A;  4PM6 A;  3F1N B;  4KZ7 A;  4IHQ A;  1H5X A;  5CTM A;  1H0M A;  1ZC2 A;  5EVI D;  4ETZ A;  3VOZ A;  3E2K A;  4FCF A;  2VA0 A;  4DE2 A;  4G3W A;  5HX9 A;  2B5R A;  3V3R A;  5GLD A;  3BRM A;  4CQH A;  3MXQ A;  2FH5 A;  4YNR A;  3C38 A;  2Y2H A;  4OOM A;  4X55 A;  1XXM A;  1YLJ A;  5L8M A;  1JVJ A;  4P6B A;  2XD1 A;  4L0L A;  5TR7 A;  4G3V A;  2V8F A;  4KG6 A;  2R9X A;  3C4O A;  4OOL A;  3WWX A;  1KE0 A;  1ZHH B;  5MC7 A;  2WAE A;  3RFB A;  1NXY A;  3MJQ A;  5GHZ A;  4WLA A;  4DRT A;  2B95 A;  3IF6 C;  1S1Z A;  3CIT A;  2KX6 A;  1DRM A;  1KVL A;  1P9W A;  3S7N A;  3LCE A;  3VP0 A;  3HJK A;  4E6X A;  3AGE A;  4ARZ B;  1TEM A;  5EM0 A;  3S1Y A;  2VV7 A;  2PU4 A;  1GA9 A;  3H7W B;  3S7Q A;  1LT0 A;  4Y7P A;  3N8L A;  1TS7 A;  3T4T A;  2HV1 A;  2Z2M B;  2G2W A;  3S4X A;  2QZ6 A;  2O0Y A;  2VGL S;  1ZTU A;  1T1C A;  2ZQC A;  3LID A;  3BLM A;  1W8Y A;  4GHI B;  2ZD8 A;  1L3L A;  2PBD P;  1DJC A;  3C7V A;  1JWV A;  3IWQ A;  4D2O A;  4GKU A;  2ZM8 A;  1TDG A;  3MQQ A;  4OP8 A;  1YLT A;  5CED A;  2V0U A;  5DFY A;  1W5D A;  4PM7 A;  1IYS A;  1PWG A;  1YMS A;  5EOO A;  3NBL A;  3E2L A;  2XK1 A;  4WYY A;  3T4Q A;  1F2K A;  1VEU A;  3JVU A;  4HH3 A;  4ZAM A;  1OJ5 A;  3BQA A;  4FH2 A;  2FFF B;  4DJ2 A;  5FEG A;  1KE3 A;  4GS9 A;  2Y79 A;  1K4E A;  3A3I A;  3QNB A;  3C5A A;  3UE3 A;  3EQV A;  5EVI C;  4BJP A;  4P85 A;  1ERO A;  5GL9 A;  4MBF A;  4X1M A;  2KOI A;  3R7W A;  1XJ2 A;  5FI7 A;  5DVA A;  5CHJ A;  4FOF A;  4JPM A;  5E2E A;  3LR3 A;  3OZH A;  2ZM2 A;  2IWD A;  3IXH A;  4JXG A;  4FSF A;  4XT2 A;  2JC7 A;  3KYQ A;  2QJ5 A;  4G3K A;  2QJ7 A;  1SDE A;  3VV4 A;  4PKY A;  3RXX A;  2ZMA A;  5HFO A;  3F1O B;  5HWV A;  1H8Y A;  1KGE A;  3LIC A;  4WN5 A;  4KZ8 A;  3O88 A;  4KZ4 A;  1MBL A; 
#chains in the Genus database with same CATH homology
 2XSS A;  3KSI A;  3BY9 A;  1S67 L;  1F9I A;  2FZ0 A;  2QKP A;  3EGX C;  3RH8 B;  1GSW A;  2P08 A;  4L9E A;  2M7V A;  3MMH A;  4ZRR A;  4BBT A;  5HPF A;  1XFQ A;  2HJ9 C;  1D7E A;  3U2A A;  5J4E A;  3UB8 A;  1IFQ A;  4O8G A;  4EW7 A;  2J3T D;  1T1B A;  4Y2F A;  1P9R A;  1OJG A;  3LR0 A;  4CLC C;  3K2N A;  1IOU A;  3CAX A;  3T4O A;  4R3A A;  4JGP A;  2VGL M;  2V1A A;  3TW8 A;  2L1M A;  5CX7 A;  1G28 A;  3KSG A;  4GCZ A;  4HP4 A;  2I9V A;  2PD7 A;  4WF0 A;  4Q0H A;  1YSQ A;  4EUV A;  1YKD A;  2GX5 A;  2BAS A;  4HH2 A;  5DJT A;  5IS1 A;  4LLO B;  3MFX A;  3OBF A;  2A24 B;  3IS2 B;  5HDS A;  3FC7 A;  2ZBB A;  4HOI A;  4QPR A;  1G6O A;  3ZQ5 A;  5C5K A;  3KX0 X;  4BWI A;  2B02 A;  2W3H A;  4Q0J A;  5DJU A;  2GZA A;  3H82 A;  2PR6 A;  4KQD A;  3F1O A;  3LI9 A;  1OTI A;  4NKP A;  4I3J A;  5HDC A;  3E98 A;  4NXF A;  4I39 A;  2VLG A;  4DJ3 A;  4JGQ A;  2W3E A;  4E04 A;  3PHY A;  5TBM A;  5HWT A;  5J3W A;  2O9C A;  4KUK A;  1OPX A;  2M7U A;  3T4S A;  3MF0 A;  3ZYT A;  5G4Y A;  3PXP A;  4HQA A;  1LSW A;  5LBR A;  4O01 A;  2VX8 A;  3K3D A;  4UEY A;  4IUK A;  2EWV A;  1EW0 A;  2K7S A;  4IJG A;  3S7P A;  2Y8H A;  3P7N A;  2KDK A;  3MQ0 A;  5HPI A;  4CLC A;  2OOL A;  1TS6 A;  3RTY A;  3PYP A;  4H6J B;  1F5M A;  2Z6C A;  4EU0 A;  2JHE A;  4PHT A;  2W3D A;  3LIF A;  2JKT I;  3A0V A;  4DMZ A;  3G6O A;  3UB7 A;  3NHQ A;  1OT9 A;  2ZOI A;  3GEC A;  3UB9 A;  3PBO A;  2J80 A;  1KOU A;  3A0R A;  4HJ6 A;  5F5Y A;  2OAQ 1;  1DP6 A;  4KUO A;  5F6A A;  3K3C A;  4WEK A;  3OLO A;  2W1T B;  3PBS A;  4L9F A;  2MJ6 A;  3KO6 A;  4M4X A;  2D02 A;  2L4R A;  5EFW A;  3LR4 A;  3TJZ C;  4BMW A;  2WKP A;  4WL9 A;  3VE4 A;  4UQI S;  5IT5 A;  3BWL A;  2QYB A;  3E4O A;  4JGO A;  1ODV A;  3V67 A;  2HJE A;  4K08 A;  2LB5 A;  3PBT A;  5DFX A;  4YOF A;  1T19 A;  3D72 A;  3LR5 A;  2XA7 S;  4WEJ A;  5IU1 A;  3OCN A;  4EQ1 A;  5F68 A;  3B47 A;  2J3T C;  1XJ6 A;  2G7U A;  4CLC D;  2NUT C;  3EEH A;  1H8M A;  2EWW A;  4WUJ A;  1DP8 A;  4PAU A;  4Z1W A;  2CMN A;  4KQO A;  5AVF A;  4Q0I A;  3EOI A;  3LYX A;  3R7W B;  4MCW A;  3FPV A;  1S1Y A;  4LRY C;  1BYW A;  4II7 A;  3ULF A;  2ZMF A;  4EEU A;  2LB9 A;  2HF6 A;  1JNU A;  1F98 A;  1P97 A;  1YSP A;  2OAP 1;  1MC0 A;  2OWH A;  1XJ4 A;  5HSQ A;  5FL3 A;  2V0W A;  4B93 A;  1P0Z A;  4H6J A;  2INW A;  4R6L A;  3DBA A;  4HNB A;  4HY8 A;  3B33 A;  3OOV A;  4MN7 A;  3D3O A;  4BBU A;  3H9W A;  3LI8 A;  4F3L B;  3LIA A;  1S66 L;  1N9L A;  2PYR A;  2GJ3 A;  5J7E A;  2WKR A;  3HJI A;  3T4J A;  4MDZ A;  2V1B A;  4L9G A;  1D06 A;  4GLQ A;  2IA2 A;  2PT7 A;  1OTA A;  3JVV A;  4YWZ A;  3CI6 A;  2XRN A;  3E4Q A;  1YAX A;  1WA9 A;  2W1T A;  4AFI A;  4HHD A;  4RQ9 A;  5HL6 A;  3NOP C;  3F1N B;  3BY8 A;  3VE3 A;  4ETX A;  2PD8 A;  3P01 A;  4IHQ A;  2H28 A;  4IUH A;  2NUP C;  4HJ3 A;  4R38 A;  2O99 A;  4NXG A;  2YKF A;  2W27 A;  4ETZ A;  1NLY A;  1NLZ A;  3OC2 A;  2VJW A;  2OWJ A;  3LFV A;  2K31 A;  1MZU A;  2VA0 A;  1N9O A;  4G3W A;  5HD3 A;  4P6Z M;  1X0O A;  2PR5 A;  4CQH A;  2WKQ A;  1H3Q A;  2JKR I;  1NWZ A;  3MXQ A;  2FH5 A;  3SW1 A;  4ME4 A;  4YNR A;  3VOL A;  3C38 A;  4I5S A;  1GSX A;  3PBR A;  4O0P A;  5HZH A;  3NJA A;  4OOM A;  3E0Y A;  3KYZ A;  4EER A;  3C2W A;  1OT6 A;  2PDR A;  3B42 A;  5AVE A;  5L8M A;  3T4L A;  2A24 A;  3FG8 A;  3IS2 A;  3O5Y A;  4L0L A;  1N9N A;  4G3V A;  4R70 A;  3F1P B;  2EA9 A;  4NXB A;  3EWK A;  1TD5 A;  4OOL A;  1ZHH B;  2O9B A;  3A0S A;  4PKY G;  2VKS A;  5MC7 A;  2PYP A;  3RFB A;  5AJG A;  4EXO A;  1VB6 A;  2ZMV A;  2HGV A;  3MJQ A;  3UMD A;  2ZOH A;  4NEE D;  4WLA A;  5DF9 A;  5DKK A;  3S7O A;  4F3L A;  4I3A A;  1S1Z A;  4B9O A;  3CIT A;  2KX6 A;  3CWF A;  1DRM A;  3E4P A;  4GJ4 A;  1P9W A;  5TBM B;  1LL8 A;  3LIB A;  2YKH A;  3S7N A;  3NOT C;  3HJK A;  2K2N A;  2QHK A;  4ARZ B;  4GS9 B;  5G4Z A;  2VV7 A;  2W1R A;  2XA7 M;  4EES A;  2XRO A;  1UWP X;  3PBN A;  3H7W B;  1S4R A;  3F1N A;  4EEP A;  5HD5 A;  3S7Q A;  1LT0 A;  4LPZ A;  3BQ8 A;  1UGU A;  3IBR A;  1TS7 A;  3KSH A;  3T4K A;  3T4T A;  2HV1 A;  3PBQ A;  3T50 A;  3MQO A;  1GSV A;  4HI4 A;  2O0Y A;  5KIZ A;  2VGL S;  1ZTU A;  1W63 Q;  1V9Y A;  1T1C A;  4XT2 B;  4CLC B;  3LID A;  1OTE A;  3UME A;  2P04 A;  3BW6 A;  2W3F A;  4GHI B;  1V9Z A;  4LRX C;  3BJN A;  2O9A A;  2VZW A;  3OCL A;  3CUE C;  3EQU A;  2KLI A;  1OTD A;  1W63 M;  3UE6 A;  2P7J A;  1Y28 A;  5HWW A;  1MKM A;  1NRJ A;  2V9A A;  2D01 A;  3C8C A;  3MQQ A;  5KSH A;  2V0U A;  5DFY A;  3F1P A;  2B18 A;  3HCY A;  2QWS A;  4HJ4 A;  2GNX A;  5A8B A;  1TS0 A;  1UWN X;  5K5B A;  1T18 A;  2L0W A;  4HIA A;  4Y5F A;  4DN0 A;  2DMW A;  3T4Q A;  3PR6 A;  3EGD C;  3JVU A;  1T1A A;  4WEL A;  1LSX A;  4HP9 A;  3C30 A;  4BBV A;  4HH3 A;  4LRZ E;  1OJ5 A;  4I38 A;  2PHY A;  3BQA A;  3ICY A;  4JGR A;  3LIE A;  4MN6 A;  4DJ2 A;  1TF1 A;  1OTB A;  4ARZ A;  4GS9 A;  2Y79 A;  2Z6D A;  4GW9 A;  2VV6 A;  5F69 A;  3UE3 A;  3EQV A;  3H7W A;  3MR0 A;  2W0N A;  4BJP A;  1S4S A;  1LSV A;  3TRC A;  2VEA A;  1VHM A;  4I3I A;  3R4K A;  5I5L A;  4EET B;  2KOI A;  3R7W A;  1XJ2 A;  2JN7 A;  1TS8 A;  3EEA A;  1DP9 A;  4NXE A;  2J3W A;  4FOF A;  3LR3 A;  2JKR M;  3CLO A;  3TE8 A;  4P6Z S;  4CLC E;  3IBJ A;  4FSF A;  4XT2 A;  3KYQ A;  2QJ5 A;  2JKT M;  4G3K A;  2QJ7 A;  3KSF A;  5DKL A;  2VV8 A;  3VV4 A;  5TJJ A;  2R78 A;  4PKY A;  2M1C A;  4GHI A;  3W2Z A;  1XFN A;  3H82 B;  3LUQ A;  2A2L A;  1XJ3 A;  1STZ A;  3F1O B;  5HWV A;  3UB6 A;  3GDI A;  4Y3I A;  5HDD A;  4MMN A;  2W3G A;  3LIC A;  4WN5 A;  4MN5 A;  4UQI M;  3FPW A;  3CUE A;  3NOU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...