3BFDA

Crystal structure of the class a beta-lactamase sed-g238c mutant from citrobacter sedlakii
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
DVQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGACDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
molecule tags Hydrolase
molecule keywords Class A beta-lactamase Sed1
total genus 97
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bfdA00
3A3JA 3D4FA 3IXBA 2ZQDA 3ITAA 4OH0A 5DTSA 5HX9A 4EV4A 4E3LA 4CPKA 4RX2A 5FQMA 4U3TA 2OLUA 4N1HA 1CK3A 5AQBA 3NI9A 1U60A 5M18A 1K55A 1JWZA 3PBQA 4WEJA 4ZTKA 1RP5A 1ZKJA 4EBNA 2XFTA 1KE4A 1K6RA 1KGGA 1LL5A 1NJ4A 3HLWA 4MLLA 4PM9A 3GR2A 4LCMA 4PMAA 1ONGA 1XP4A 3V50A 2V2FF 3V3SA 3VMAA 5FASA 4BJPA 1K56D 3C7UA 4S2PA 2PU2A 4DKIA 4KG2A 4X69A 4OPRA 3UY6A 3RJUA 4FH2A 3VP1A 4C75A 1MBLA 4GOGA 4OOLA 4QU3A 4E6XA 4S2NA 3JYIA 3VP3A 1BT5A 4KQRA 1E25A 3IH8A 2ZM8A 1VQQA 3BEBA 2ZQ9A 5FQ9A 5TGFA 3ZNYA 4Z9QA 5DTTA 2OSUA 3IF6C 4UA6A 3WRTA 2ZLYA 3FV7A 2C5WB 2ZMAA 2ZC3B 1FR6A 2VGKA 3CJMA 1NXYA 4RVAA 2WGWA 3M6HA 3S22A 1MKIA 4BQMA 1PZOA 1CEFA 1RGZA 3UNWA 3ZVTA 1ZG4A 4KZ3A 3Q07A 4MNRA 4GKUA 2Y4AA 4RYEA 2Y91A 2J9OA 1FOFA 2H0YA 2ZQCA 3P09A 3SH8A 3HVFA 5E2GA 5EVIC 3ZG7B 3O88A 5IHVA 3HL9A 3PBOA 1WYBA 1GCEA 2XR0A 3IH9A 3LEZA 4R4SA 1OMEA 1K56A 4HEFA 1BLSA 2J7VA 2J8YA 4S2KA 4OONA 1XA1A 4B88A 4KZ6A 1EWZA 4S2OA 2FFFB 5F82A 3DW0A 1YLYA 3BYDA 1MWSA 2WZZA 4BD1A 3VP0A 1KDWA 2XQZA 4KQOA 5CTMA 2OLVA 1XPBA 5TFQA 4S2JA 3PBNA 3QHYA 4QY6A 2R9XA 3ZNTA 3VP4A 4E3KA 4JXWA 3N8SA 1O07A 4GNUA 4OOMA 3IT9A 3HLBA 1XKZA 4EBPA 5HAPA 3BFEA 1YLTA 4OKPA 1K57C 5HW3A 3UE0A 3ZG0A 2ZC5B 1YLWA 2ZQAA 1K54C 5EOEA 2XEPA 3O3VA 5DTKA 3S4XA 3V39A 5HAQA 3UO9A 3MKFA 4K0WA 1IEMA 4GDNA 2HDUA 1M6KA 4OOYA 5FAPA 1XA7A 4F94A 1NYYA 2QZ6A 3G31A 3GVBA 3UE1A 1BLCA 1FSYA 1L2SA 4DF6A 3TSGA 5M1AA 1PI5A 1HZOA 2Y2IA 5FSRA 5CEBA 1JVJA 3HUMA 3EQVA 3OCNA 4BD0A 3SH7A 2WGIA 4D2OA 1YQSA 2EX6A 4ID4A 4X53A 1W5DA 2HDRA 1LLBA 2PU4A 4O7DA 3ZG8B 3BFGA 4X68A 1GA9A 1MWTA 1S0WA 3MXRA 1YMSA 3ZFZA 1DJAA 1JTGA 1JWPA 4QHCA 3Q7ZA 1RGYA 2J9PA 5L2FA 2Y2PA 5FAQA 1G6AA 3BECA 4BL2A 2WGVA 3IQAA 3W4OA 2HP6A 4JF5A 1HVBA 2JE5A 4DE1A 3HREA 4QJGA 4HBTA 5I94A 2JCHA 2WADA 1ALQA 1XXMA 2EX8A 4MEZA 4OLGA 2QPNA 4YFMA 3M6BA 2A3UA 3ZCZA 3GRJA 2WGWB 3BFCA 4Q8IA 2GDNA 3DWZA 1J9MA 2XD5A 3HLEA 4EWFA 5JYPA 4OPYA 4FH4A 4RA7A 5CXWA 5A92A 4JBFA 1W7FA 1EI5A 3MXSA 2ZQ8A 2ZD8A 4GD8A 1FCOA 4LCLA 3FWLA 3BFFA 3LY3A 1QMEA 3VSKA 2QMIA 5DF9A 2EX2A 2V1ZA 3G2YA 1TVFA 5EE8A 3A3EA 1ESIA 3NCKA 1KDSA 3IF6B 3IXDA 5FQKA 4N9LA 4R3BA 5FI6A 4ZJ3A 3VOZA 2XD1A 4OP5A 3I7JA 1PWGA 3ZVWA 4DE2A 5GL9A 5A91A 2RL3A 4WMCA 3S1YA 4GD6A 1BULA 1BUEA 1PW1A 4KZ9A 1I2WA 3HLGA 4R0QA 4Y0OA 4OQGA 2EFXA 3W4PA 2Y2KA 4MBFA 1BZAA 2XH9A 3AGFA 3Q7VA 4LV2A 3LY4A 5HFOA 4OPQA 3GV9A 5CTNA 3MZEA 1XGJA 5EPHA 1YLZA 4LV1A 2P9VA 5FAOA 3UPPA 1GHMA 1CI9A 3UPNA 2WAFA 3DTMA 5HAIA 2Y2GA 5M19A 4E3IA 3FKVA 1XX2A 3ZG5A 3CZDA 2Y2HA 4P87A 1N9BA 1YT4A 4E3NA 3E2KA 4R23A 5CGSA 5CEDA 3OPLA 4PM7A 3G30A 4ZBEA 2OV5A 3SH9A 1YM1A 1K25A 3PBRA 3GTCA 1LL9A 3BM6A 3G32A 5FQQA 4N9KA 4MBHA 3IWQA 3WS2A 4QD4A 1NY0A 3QNBA 4XUZA 1IYPA 1K4EA 3Q7VB 1C3BA 1JWVA 4WMCD 2ZM2A 3VOYA 1IYOA 1WE4A 1ES5A 4KZBA 3PAGA 4X6TA 1TEMA 4R3JA 3NC8A 3WS5A 1W8QA 3V3RA 2ZC6B 3GMWA 3OZHA 1PWCA 2HP5A 1HTZA 1Z6FA 4H8RA 4OQHA 2XDMA 2HP9A 4OP8A 3Q1FA 1K6SA 1E3UD 3MZFA 5G18A 3ZHHA 5TR7A 2CC1A 1L0DA 2H0TA 4IBRA 2Y55A 3SS4A 5KSCA 2Y2MA 4JLFA 3GQZA 3PBTA 5FQIA 2EXAA 4KZ8A 2ZQ7A 2I72A 4KQQA 4X55A 4BLMA 5JYOA 5CHUA 3QNCA 3UPOA 4S2MA 4JXGA 3IWIA 3HUNA 2DRWA 4S2LA 5CGWA 3LCEA 2PBYA 2WZXA 2XGNA 2Z2LB 3PTEA 5HARA 2WAEA 3ZGAB 1K55C 2WUQA 5CGXA 4DRTA 5A90A 1ES2A 3FKWA 1PWDA 3DWKA 1I5QA 3HLDA 1LHYA 1ZG6A 1W79A 4JXVA 5E2HA 2VGJA 4E6WA 5FQJA 4OVDA 4R1GA 1TDLA 2RCXA 4WBGA 3VFHA 4R4RA 3MZDA 4XXRA 1ESUA 4DXCA 1JTDA 2FFYA 3MKEA 5GLBA 5KSHA 1SDNA 3NBLA 2G2UA 4XUXA 4YINA 3VFFA 5GHZA 1G68A 4E3JA 3UDFA 5EECA 2C6WB 3SOIA 3IF5A 1K4FA 5U47A 3OCLA 2Y2NA 3WWXA 5EUAA 4BL3A 1W8YA 4NK3A 4P85A 5AQAA 3MBZA 1I2SA 5E2EA 2IWCA 5F1FA 1KE0A 4WYYA 5EOOA 4DE0A 1SDEA 3CMZA 3UDXA 4QY5A 1SKFA 4ZJ1A 1K57A 3OPHA 1NRFA 4FD8A 3IF6A 5CHMA 1L0FA 2X02A 1VM1A 3NDEA 1HD8A 4JKTA 4JPMA 4KZAA 2Q9NA 3BLMA 4M3KA 5GHXA 3W4QA 3W8KA 4Y0UA 4PM8A 3NY4A 4S2IA 4WEKA 4IVKA 4OLDA 1S6RA 1E4DA 2IWBA 1ERMA 1K38A 3IHAA 4HBUA 5GLCA 4CJNA 1LI0A 4GN2A 2BLSA 3HBRA 4OPZA 5AQ7A 5FA7A 3N7WA 2WKIA 4IBXA 4PM6A 2X01A 1KGFA 4QB8A 4DDYA 4DE3A 3HUOA 4KENB 4UA9A 5F83A 2X71A 1GHPA 1QMFA 2Q9MA 2ZM0A 4P6BA 4IEDA 1MXOA 4Y7PA 5E43A 3HLFA 4K0XA 1EROA 2P74A 1CEGA 1H5XA 3E2LA 3IXGA 1MPLA 1SCWA 1IELA 3LO7A 2UWXA 1YLPA 4DXBA 3A3FA 1H8ZA 1Y54A 1MWRA 2WKEA 1GA0A 4UHUA 4ZAMA 1RCJA 3ITBA 4HESA 2WYXA 3O87A 2H10A 1NZOA 1FR1A 3VSLA 1TDGA 4GDBA 4GZBA 3WS4A 3BLSA 1ES3A 4RX3A 4KZ5A 4UAAA 5EVID 4ZJ2A 1H8YA 4LV0A 1FCNA 4ZDXA 4FCFA 4P0MA 5E2FA 3IHBA 3TG9A 1L0GA 2XF3A 5GHYA 4BENA 4DDSA 4S2NC 1PZPA 5KZHA 3B3XA 5KMWA 4KZ4A 1ERQA 2XLNA 5HL1A 5EVIB 5GLDA 1IYSA 1PYYA 1GHIA 1IKIA 2DCFA 3G35A 1PW8A 4A5RA 3VP2A 1FCMA 5CHJA 2HPBA 3AGEA 3O86A 1E3UA 4JXSA 4U0TA 2Y59A 4IVIA 1KE3A 4B4ZA 3ZDJA 2R9WA 3UN7A 5F1GA 3C4OA 3PAEA 4GB7A 4WZ5C 1XGIA 2XK1A 3ZG9B 2HDQA 4X56A 4N92A 4OQIA 2WK0A 2Y2JA 4E3MA 3IWOA 3WS1A 5DVAA 5FI2A 1AXBA 3C5AA 1BLPA 1IYQA 1DJCA 5CRFA 1Q2PA 2EXBA 1FQGA 4U0XA 1WYCA 3N8LA 3V5MA 3A3IA 4B4XA 3A3DA 3C4PA 1SHVA 3G2ZA 3Q82A 5D3OA 4FSFA 1DJBA 1ES4A 1M40A 3NIAA 3SS5A 4EQIA 5EVIA 4KZ7A 3EQUA 3N8RA 4C6YA 2ZC7A 2A49A 1BLHA 2JBFA 4JF4A 4K91A 3N6IA 4EUZA 2EFUA 1ZC2A 4PPRA 2B5RA 1CI8A 3OC2A 3MFDA 3RXWA 3BRMA 3G34A 4KG6A 3FZCA 5J8XA 2Y2LA 1K54A 2ZC4B 2E8IA 2DNSA 2Y2OA 3BFDA 4WZ5A 4NETA 2WKHA 1NZUA 1FSWA 3CG5A 3OPRA 2EX9A 1KVLA 3Q81A 1KGEA 4LENA 3FYZA 1DY6A 3P98A 1MY8A 4WM9A 4L0LA 5DF8A 5DF7A 3M2JA 4UA7A 1BTLA 2IWDA 1PI4A 1IKGA 2ZJ9A 3HLCA 5EVLA 1N4OA 3G4PA 3ISGA 4JF6A 4E3OA 3NDGA 5FATA 3PBSA 2Z2MB 3AGDA 2HDSA 1O7EA 4LV3A 5CECA 5FI7A 5FDHA 5A93A 1BSGA 5CERA 3TOIA 2JC7A 3UE3A 3C7VA 4PM5A 2P9VB 2BG1A 4OQ0A 3WRZA 3RXXA 3GSGA 1LI9A 1MWUA 1L0EA 2XFSA 3SS3A 3WS0A 1PIOA 5GLAA 4KG5A 1YMXA 5AQ9A 1Q2QA 4C3QA 3UDIA 3IXHA 4N1XA 2G2WA 1ONHA 3M2KA 1NYMA 3OPPA 4EBLA 4WZ4A 1YLJA 3N4IA 2H5SA 4MBKA 2V20A 5BOHA 2Y2QA 4Y0TA 4WELA 1KVMA
chains in the Genus database with same CATH superfamily
3A3JA 1CJFA 3ITAA 4OH0A 2PYRA 3D72A 1K55A 4WEJA 2J3WA 4I5SA 1K6RA 1KGGA 1LL5A 2KLIA 3DBAA 4PM9A 4PMAA 4LCMA 3V50A 1ONGA 2V0WA 3F1OB 4NXBA 3KYZA 4C75A 1MBLA 5DJUA 4S2NA 3MXQA 4KQRA 5FQ9A 5TGFA 4UA6A 3WRTA 3CJMA 3M6HA 2ZBBA 2HJ9C 1RGZA 3UNWA 4Y3IA 2A24A 3DTEA 3Q07A 4MNRA 2J9OA 2ZQCA 2H0YA 3ZG7B 3HL9A 1L3LA 1WYBA 4R4SA 3EWKA 2V1BA 4S2KA 4Q0IA 2BTFP 3GECA 2FFFB 1YLYA 3DTKA 5HDCA 1KDWA 2XQZA 4NKPA 5TFQA 3T4TA 4PKYA 2R9XA 3L7HA 3F1PA 4P6ZM 3IT9A 3BFEA 4GS9B 5DKLA 3ZG0A 3IX4A 3QP6A 5DFXA 3UO9A 4K0WA 2M7VA 1IEMA 4GDNA 4OOYA 1XA7A 4F94A 1FSYA 2BASA 3HUMA 4BD0A 4O8GA 3ZG8B 3BFGA 1OT9A 1MWTA 3KSHA 3MXRA 3HCYA 3ZFZA 3LIBA 4QHCA 2J9PA 4Z1WA 1G6AA 4BL2A 2INWA 2HP6A 2JE5A 3HREA 5DKKA 5I94A 2WADA 1XXMA 4UEYA 3GRJA 2WGWB 1NLZA 3DWZA 5L07A 4FH4A 2ZQ8A 2Q0OA 4YNRA 1FCOA 3FWLA 3LY3A 2QMIA 2WKPA 2OAP1 5DF9A 2EX2A 3BQ8A 3A3EA 2UV0E 1KDSA 2B02A 4ARZA 2DMWA 4N9LA 2W1TB 1G28A 5K5BA 2NUPC 4ZJ3A 4OP5A 3I7JA 3ZVWA 4PHTA 3T1QB 1P9RA 4HIAA 3CI6A 3F1NB 1BUEA 1I2WA 3W4PA 5HFOA 1XGJA 5FAOA 2PT7A 2VA0A 4E3IA 5F69A 4E3NA 5CEDA 5CGSA 3OPLA 3G30A 2OV5A 1K25A 4NXFA 3WS2A 4QD4A 3D9YA 3VOYA 1IYOA 4ESPA 1MC0A 3EGDC 3WS5A 3GMWA 3LR3A 3UB6A 4OQHA 3MS6A 1K6SA 5G18A 3ZHHA 3PBTA 1Y28A 4KZ8A 3VOLA 4BLMA 4LRZE 4I38A 5JYOA 3UMDA 4HP4A 4S2MA 3HUNA 5CGWA 4S2LA 2B95A 1JNUA 4DRTA 1G6OA 3H82A 4NXGA 5A90A 3T4SA 3FKWA 3DWKA 1ZG6A 3UMEA 4Y17A 4OVDA 1TDLA 4WBGA 2ACGA 1JTDA 1SDNA 5GHZA 1XFNA 1W8YA 1DP8A 4WYYA 4QWOA 5HD3A 1K57A 1NRFA 3S7QA 1L0FA 4M3KA 3BLMA 1STZA 3QP8A 3W8KA 3NY4A 4FUWA 2IWBA 3IHAA 1K38A 5GLCA 4HBUA 1LI0A 4GN2A 1OTIA 3HBRA 4IBXA 2QJ5A 1KGFA 4DE3A 4I3AA 2Q9MA 3LEQA 3H82B 2EWVA 3CUEC 5G4YA 5E43A 3VE4A 4K0XA 3T4LA 3IXGA 3E2LA 4DXBA 4NEED 3NJAA 4HESA 2WYXA 3O87A 3WS4A 4RX3A 5EVID 4KZ5A 1H8YA 4HH2A 1FCNA 4HNBA 4LV0A 4FCFA 3CWFA 5EM1A 5IT5A 2XF3A 4DDSA 5KZHA 3BY9A 5KMWA 1ERQA 2XLNA 1GHIA 1IKIA 3G35A 4KQDA 1OTAA 1VEUA 5CHJA 2HPBA 4U0TA 4IVIA 3ZDJA 1LSVA 5J4EA 2VGLM 2JKRI 4WZ5C 5F5YA 1XGIA 2VZWA 3ZG9B 4OQIA 2WK0A 1DP6A 2CMNA 5DVAA 3NULA 1OT6A 1LL8A 2AVXA 1FQGA 1LSWA 4U0XA 3V5MA 4B4XA 3A3IA 3CPTA 2JKGA 2PHYA 4HQAA 1BLHA 4JF4A 3MF0A 4K91A 3N6IA 4MN7A 5F68A 2QWSA 3JPUA 3OC2A 5J8XA 2V1AA 5IS1A 2E8IA 2Y2OA 3BFDA 3CLOA 3OPRA 2EX9A 1KVLA 4LENA 1DY6A 1MY8A 5DF7A 3M2JA 4JGRA 4UA7A 4WLAA 5EVLA 2IWDA 1IKGA 1IFQA 3KSGA 2VEAA 5FDHA 1XJ3A 1S4SA 1ACFA 3LIDA 3WRZA 4LLOB 3RXXA 1L0EA 1PIOA 4KG5A 1Q2QA 4N1XA 2G2WA 3OPPA 1NYMA 2JKFA 5G4ZA 1OJGA 1YLJA 2H5SA 3NOUC 5BOHA 1KVMA 5KIZA 3D4FA 4CPKA 3KO6A 3EEAA 1JWZA 4ZTKA 2VV8A 3GR2A 1XP4A 3TE8A 4BJPA 1K56D 4JGPA 4X69A 3SW1A 4E6XA 4OOLA 3B33A 2ZM8A 1OTDA 4GLQA 1W63Q 2ZMAA 2ZC3B 2VGKA 4RVAA 1MKIA 4UQIS 1CEFA 2WKRA 4IHQA 1ZG4A 4KZ3A 5HSQA 4GKUA 5E2GA 3LEZA 4HEFA 2J8YA 4KZ6A 1EWZA 4S2OA 3DW0A 2V9AA 5HWTA 2ZOHA 3B42A 2OLVA 2KOIA 1OJ5A 4O0PA 3N8SA 4GNUA 3HLBA 3L9KA 2VK3A 4KUKA 5HAPA 1YLTA 4OKPA 1K57C 3UE0A 3LFVA 3H9WA 3CPTB 4Q0HA 5EOEA 2XSSA 5DTKA 3R7WA 2XA7M 2XA7S 3S4XA 3V39A 3MKFA 3E4QA 1NYYA 3GVBA 3UE1A 1BLCA 4DF6A 5M1AA 1LT0A 5CEBA 2NUTC 1JVJA 3EQVA 3SH7A 2WGIA 2EX6A 3U2AA 4X68A 1S0WA 1YMSA 1DJAA 4L9EA 4QPRA 5FAQA 3IQAA 4DE1A 2EX8A 3BQAA 5FL3A 2HZ5A 3BFCA 4DN0A 1J9MA 3HLEA 5JYPA 2L0WA 5A92A 2J80A 2ZD8A 1MZUA 3BFFA 2OWJA 3VSKA 3G2YA 1TVFA 5L8MA 1EW0A 3NOTC 3RH8B 4GCZA 3KYEA 4NG2A 2XD1A 1PWGA 4DE2A 1T1AA 5GL9A 5A91A 2K31A 2W0NA 3S1YA 4ARZB 1BULA 5AVEA 1PW1A 3PR6A 4OQGA 4MBFA 1BZAA 5J3WA 1W63M 2XH9A 3LY4A 2O0YA 2QHKA 5EPHA 1YLZA 3UPNA 3TW8A 3DTMA 1OPXA 2Y2GA 3ZG5A 4G3KA 3CZDA 3K2NA 4P87A 3LR4A 3IS2A 4ZBEA 3UB7A 1YM1A 3PBRA 4HI4A 4N9KA 3IWQA 1NY0A 3QNBA 1K4EA 1JWVA 1C3BA 2ZM2A 4LRXC 1X0OA 1WE4A 3PAGA 4CQHA 1TEMA 3NC8A 1YKDA 3S7OA 3BWLA 2HP5A 1HTZA 1F98A 2HP9A 2XDMA 3LICA 1P9WA 5TR7A 3P7NA 5FQIA 1PNEA 2I72A 4L9FA 3QNCA 3UPOA 3T1XA 2XGNA 3PTEA 3ZGAB 2WAEA 2WUQA 2JKTM 1ES2A 3D3OA 2W3EA 3HLDA 4JXVA 5E2HA 4WN5A 2VGJA 3H7WB 3EGXC 3VFHA 4R4RA 4DXCA 2FFYA 5GLBA 5KSHA 4XUXA 1CF0A 2VKSA 4E3JA 5EECA 3IF5A 4FOFA 3FG8A 4M4XA 5U47A 3T4OA 3E98A 4NK3A 4P85A 5E2EA 2L4RA 4MN5A 1S1ZA 1KE0A 5EOOA 4DE0A 1VETA 1TS6A 1SDEA 3UDXA 4Y2FA 1SKFA 3OPHA 2PYPA 1GSWA 4JKTA 3IX8A 3W4QA 3E4PA 4HY8A 2V8CA 4EEUA 1N9OA 3KSIA 3OLOA 4PM8A 4G3WA 4IVKA 4Q0JA 1ERMA 2WKIA 4QB8A 1N9NA 5MC7A 4UA9A 5F83A 1GHPA 1QMFA 2ZM0A 1UGUA 4ETZA 4HJ3A 3T4KA 1SCWA 3A3FA 3MFXA 1MWRA 2WKEA 1GA0A 1YPRA 2PBDP 1V9ZA 3VSLA 3CAXA 2G7UA 3BLSA 1ES3A 4UAAA 5E2FA 2ZOIA 3TG9A 4XT2B 2E8JA 4S2NC 4H6JB 4ME4A 5HL1A 1IYSA 3LR5A 4A5RA 3VP2A 2GNXA 3O86A 1E3UA 4R3AA 2LB9A 4GB7A 2XK1A 2HDQA 4X56A 2Y2JA 5HPIA 3WS1A 1AXBA 3C5AA 1BLPA 3FPWA 5CRFA 3DAVA 4X1LA 2EXBA 1WYCA 3A3DA 1SHVA 5D3OA 1M40A 3NIAA 3SS5A 4EQIA 3OBFA 3C2WA 4KZ7A 4I3JA 2ZC7A 4GS9A 4EUZA 4BWIA 2B5RA 3DTIA 3A0SA 4CLCA 1CQAA 3TJZC 3Q81A 1GSXA 1BTLA 2ZJ9A 3MSHA 1NLYA 4E3OA 5FATA 2JHEA 3AGDA 3OOVA 2Y79A 4LV3A 4F3LA 5CECA 3LYXA 4R70A 2FH5A 2JC7A 4HHDA 3GSGA 2XFSA 2PD7A 3IXHA 4WZ4A 3N4IA 4Y0TA 3UB8A 5DTSA 4EV4A 2LB5A 5HX9A 4E3LA 3NI9A 5M18A 3PBQA 4PKYG 1RP5A 4EBNA 3VV4A 2XFTA 3P01A 4MLLA 3VMAA 3V3SA 2V2FF 5FASA 3IX3A 3C7UA 4S2PA 2PU2A 2ZMFA 4OPRA 2ZMVA 3VP1A 1P0ZA 4FH2A 3RJUA 4GOGA 4QU3A 3JYIA 1E25A 1Z09A 1VQQA 3ZNYA 2ZQ9A 4Z9QA 2C5WB 4DJ3A 1NXYA 2VGLS 1UWPX 3KYQA 4H6JA 3ZVTA 1PFLA 2Y4AA 2Z6DA 5EVIC 3T50A 3EEHA 5IHVA 3PBOA 3IH9A 3UB5P 1BLSA 4OONA 1XA1A 4B88A 5F82A 1T1BA 2M1CA 1MWSA 3U4LP 3VP0A 1AWIA 4KQOA 3IBRA 3PBNA 3QHYA 1ZHHB 4QY6A 4JGOA 3MQQA 2YKHA 2P04A 4E3KA 3VP4A 4JXWA 4OOMA 1F2KA 1XKZA 3NHQA 2KX6A 4Y5FA 2ZQAA 4GHIB 1K54C 1TS0A 4DMZA 2I9VA 3O3VA 4F3LB 5HAQA 1P97A 2PDRA 5FAPA 1M6KA 2QZ6A 3G31A 1H0MA 3TSGA 1HZOA 2Y2IA 3LR0A 3LIEA 2HV1A 4B93A 5FDSA 4ID4A 1T1CA 4X53A 1W5DA 2XRNA 2PU4A 4O7DA 1GA9A 1D7EA 3CITA 3MQOA 2IA2A 3G6OA 3H7WA 1JTGA 3Q7ZA 2JN7A 3W4OA 4JF5A 4HBTA 2Y8HA 4MEZA 1ALQA 4YFMA 4HJ6A 2W1RA 3O5YA 4YOFA 2V8FA 2XD5A 4EWFA 2VJWA 4CLCC 4RA7A 1W7FA 3MXSA 1S66L 2EWWA 4HOIA 4GD8A 3PYPA 1QMEA 2XROA 5EE8A 4XT2A 1ESIA 2PRFA 3IF6B 5FI6A 1NRJA 2RL3A 4BMWA 4GD6A 4JGQA 2A2LA 4BBUA 4R0QA 4Y0OA 4CLCE 3A0VA 2Y2KA 3AGFA 4LV2A 2W3FA 4LRYC 3MZEA 3VE3A 4LV1A 3UPPA 1CI9A 4EQ1A 2HJEA 1N9BA 1YT4A 4R23A 3SH9A 3BM6A 4MBHA 4Y15A 2KDKA 1SKOB 3T4QA 1ZTUA 4XUZA 5J7EA 3Q7VB 1ES5A 4KZBA 5FEFA 4X6TA 4R3JA 3V3RA 2ZC6B 3LIFA 3OZHA 1PWCA 4IUKA 1Z6FA 4H8RA 3MZFA 4D60A 2L1MA 3MMHA 4YWZA 4IBRA 2Y55A 2W3GA 2OWHA 3HJIA 5KSCA 1SKOA 4RQ9A 1LSXA 2JKTI 1T19A 4KQQA 4X55A 5CHUA 4JXGA 3IWIA 5HZHA 2PBYA 3ZYTA 1S4RA 2Z2LB 5HARA 1K55C 5CGXA 1PWDA 1W79A 4E6WA 1VEUB 2QKPA 1Y4OA 3W2ZA 2PR5A 1VB6A 1H8MA 4AFIA 3MZDA 4XXRA 3MKEA 3NBLA 1G68A 3SOIA 3WWXA 3F1OA 4BL3A 3MBZA 1I2SA 4ZRRA 4MDZA 4IJGA 4Y13A 2IWCA 3LI8A 4QY5A 4ZJ1A 4HP9A 2HGVA 4FD8A 2X02A 1VM1A 4JPMA 1HD8A 4KZAA 4ETXA 3QP1A 4GW9A 5FEGA 4S2IA 1E4DA 1GSVA 2J3TD 2A24B 3LUQA 2FZ0A 5FA7A 4GHIA 3JVVA 1EROA 1MKMA 2P74A 4P6ZS 1H5XA 1MPLA 4B9OA 3LO7A 2UWXA 2HF6A 3A0RA 2QYBA 1YSPA 1RCJA 3ITBA 3RFBA 1NZOA 1FR1A 4GDBA 5EFWA 4GZBA 5CX7A 3FPVA 1DP9A 3IHBA 3R4KA 3BW6A 5GHYA 4EW7A 1PZPA 3B3XA 1PYYA 2DCFA 4KUOA 3AGEA 2Y59A 3T4JA 4B4ZA 2R9WA 2V0UA 3MJQA 5IU1A 3BJNA 2ZL1B 4E3MA 1IYQA 4LFUA 2QJ7A 4FSFA 1DJBA 1ES4A 4EERA 5EVIA 4CLCB 3EQUA 4C6YA 2A49A 3RTYA 2EFUA 3RXWA 3MFDA 3BRMA 3G34A 4KG6A 1XJ6A 4NXEA 1K54A 2ZC4B 2W1TA 4WZ5A 3PXPA 4NETA 2W3DA 5I5LA 4GJ4A 3EOIA 3GDIA 3ZQ5A 3FYZA 2OOLA 4WM9A 3HLCA 3G4PA 3ISGA 4JF6A 3T1RA 5F6AA 3NDGA 2MJ6A 3PBSA 5HD5A 5A93A 5C5KA 4MN6A 3UE3A 3C7VA 4IUHA 2BG1A 4OQ0A 1LI9A 1MWUA 3SS3A 3WS0A 5GLAA 1YMXA 5AQ9A 1D06A 4C3QA 5HDDA 1VETB 3M2KA 5AVFA 4EBLA 2PD8A 3K3CA 4MBKA 2V20A 4WELA 3IXBA 1F5MA 2ZQDA 4RX2A 3JVUA 4U3TA 5FQMA 2OLUA 4N1HA 1CK3A 5AQBA 1U60A 1ZKJA 1KE4A 3HLWA 1NJ4A 3F1PB 5HPFA 4DKIA 2D02A 1VHMA 4KG2A 3UY6A 3TRCA 3VP3A 1BT5A 3IH8A 3BEBA 3MQ0A 5DTTA 2OSUA 3IF6C 3ICYA 2ZLYA 1N9LA 3FV7A 1YSQA 1FR6A 1HLUP 4EESA 2WGWA 3S22A 3R7WB 4I3IA 4BQMA 1PZOA 3PHYA 4RYEA 1V9YA 2Y91A 1FOFA 3SH8A 3P09A 3HVFA 1BYWA 3O88A 2XR0A 1GCEA 2J3TC 1OMEA 1K56A 2J7VA 3BYDA 4LGWA 2WZZA 4BD1A 5LBRA 5CTMA 1XPBA 4S2JA 3BY8A 3ZNTA 1O07A 4EBPA 4G3VA 5HW3A 3C30A 2ZC5B 1YLWA 4MCWA 4WF0A 2XEPA 3ULFA 5HDSA 4WUJA 2ZL1A 4E04A 2HDUA 3IS2B 1L2SA 1PI5A 5FSRA 5TJJA 3OCNA 5TBMA 4D2OA 1YQSA 2P08A 5EM0A 3NOPC 2HDRA 1LLBA 1PRQA 1F9IA 2O9BA 1JWPA 1RGYA 5L2FA 4R6LA 4EXOA 2Y2PA 2Z6CA 3BECA 2WGVA 3CHWP 1HVBA 4X25A 4QJGA 1A0KA 2JKRM 2JCHA 2K7SA 4OLGA 2QPNA 3M6BA 2A3UA 3IBJA 3ZCZA 4Q8IA 3MR0A 2GDNA 1DRMA 1TD5A 2P7JA 4OPYA 5CXWA 5L10A 3T1SA 4JBFA 1EI5A 3SZTA 1K0KA 1H3QA 4LCLA 1G5UA 4HJ4A 4O01A 2V1ZA 3NCKA 2EA9A 2GZAA 3IXDA 5FQKA 2O9CA 4R3BA 3VOZA 3LIAA 4WMCA 1FILA 5HWWA 4KZ9A 3HLGA 5TBMB 2O99A 1J3WA 2EFXA 1OTEA 2OAQ1 3Q7VA 2H28A 4OPQA 3GV9A 5CTNA 3QP4A 2P9VA 1GHMA 2WAFA 4L9GA 5HAIA 2VX8A 5M19A 3FKVA 1XX2A 2Y2HA 3E2KA 1D1JA 4PM7A 3GTCA 1LL9A 3G32A 5FQQA 5L09A 5DJTA 2D01A 1IYPA 2B18A 3QP5A 4WMCD 1XJ2A 1KOUA 5AJGA 4II7A 1W8QA 3S7PA 4OP8A 3Q1FA 4HH3A 1E3UD 4BBVA 4K08A 3C8CA 2CC1A 1L0DA 2H0TA 3SS4A 2Y2MA 3B47A 4JLFA 3GQZA 2EXAA 2ZQ7A 1SZVA 1ODVA 3KX0X 3UB9A 2DRWA 3LCEA 2WZXA 2K2NA 1I5QA 3S7NA 1LHYA 5FQJA 4R1GA 5DFYA 4MMNA 2RCXA 4X1MA 3E4OA 1ESUA 2G2UA 4YINA 3VFFA 3F1NA 3UDFA 2C6WB 1K4FA 2GX5A 3OCLA 2Y2NA 3E0YA 4UQIM 5EUAA 4EUVA 5AQAA 5F1FA 5A8BA 1IOUA 2YKFA 3CMZA 2W3HA 3IF6A 5CHMA 4BBTA 3NDEA 5GHXA 2Q9NA 3HJKA 2W27A 4Y0UA 4WEKA 4OLDA 1S6RA 2PR6A 4CJNA 1S67L 2BLSA 4FTXA 4OPZA 5AQ7A 5EV0A 4EEPA 3N7WA 4PM6A 2X01A 4DDYA 3HUOA 4KENB 4WL9A 4EETB 2X71A 4P6BA 4IEDA 1MXOA 4Y7PA 3HLFA 1CEGA 1S1YA 1IELA 2M7UA 1YLPA 1H8ZA 1Y54A 3CUEA 5HWVA 2VV6A 4UHUA 4ZAMA 4I39A 2H10A 3LI9A 1TDGA 2GJ3A 2WKQA 4ZJ2A 4DJ2A 1OTBA 4ZDXA 4P0MA 1L0GA 4BENA 2O9AA 4EU0A 4KZ4A 5EVIB 5GLDA 1PW8A 1FCMA 4JXSA 1XFQA 1KE3A 3UN7A 5F1GA 3C4OA 3PAEA 1T18A 5HL6A 3LGOA 4N92A 2VLGA 3IWOA 5FI2A 1XJ4A 1DJCA 1Q2PA 3V67A 3N8LA 3C4PA 3QP2A 3G2ZA 3Q82A 3N8RA 2JBFA 3K3DA 4PPRA 1ZC2A 3FC7A 1CI8A 4LPZA 3FZCA 2Y2LA 2DNSA 2R78A 2WKHA 1NZUA 1FSWA 3CG5A 3C38A 3KSFA 1KGEA 1FIKA 3P98A 1WA9A 1TS8A 4L0LA 5DF8A 4R38A 2PAVP 1YAXA 1PI4A 1NWZA 1N4OA 3NECA 2Z2MB 2HDSA 1TF1A 1O7EA 5FI7A 2VV7A 5EVEA 1BSGA 1UWNX 5CERA 3TOIA 4PM5A 2P9VB 1TS7A 3UE6A 3T12B 3UDIA 1ONHA 4PAUA 4CLCD 2Y2QA
chains in the Genus database with same CATH topology
3A3JA 3D4FA 3IXBA 2ZQDA 3ITAA 4OH0A 5DTSA 5HX9A 4EV4A 4E3LA 4CPKA 4RX2A 5FQMA 4U3TA 2OLUA 4N1HA 1CK3A 5AQBA 3NI9A 1U60A 5M18A 1K55A 1JWZA 3PBQA 4WEJA 4ZTKA 1RP5A 1ZKJA 4EBNA 2XFTA 1KE4A 1K6RA 1KGGA 1LL5A 1NJ4A 3HLWA 4MLLA 4PM9A 3GR2A 4LCMA 4PMAA 1ONGA 1XP4A 3V50A 2V2FF 3V3SA 3VMAA 5FASA 4BJPA 1K56D 3C7UA 4S2PA 2PU2A 4DKIA 4KG2A 4X69A 4OPRA 3UY6A 3RJUA 4FH2A 3VP1A 4C75A 1MBLA 4GOGA 4OOLA 4QU3A 4E6XA 4S2NA 3JYIA 3VP3A 1BT5A 4KQRA 1E25A 3IH8A 2ZM8A 1VQQA 3BEBA 2ZQ9A 5FQ9A 5TGFA 3ZNYA 4Z9QA 5DTTA 2OSUA 3IF6C 4UA6A 3WRTA 2ZLYA 3FV7A 2C5WB 2ZMAA 2ZC3B 1FR6A 2VGKA 3CJMA 1NXYA 4RVAA 2WGWA 3M6HA 3S22A 1MKIA 4BQMA 1PZOA 1CEFA 1RGZA 3UNWA 3ZVTA 1ZG4A 4KZ3A 3Q07A 4MNRA 4GKUA 2Y4AA 4RYEA 2Y91A 2J9OA 1FOFA 2H0YA 2ZQCA 3P09A 3SH8A 3HVFA 5E2GA 5EVIC 3ZG7B 3O88A 5IHVA 3HL9A 3PBOA 1WYBA 1GCEA 2XR0A 3IH9A 3LEZA 4R4SA 1OMEA 1K56A 4HEFA 1BLSA 2J7VA 2J8YA 4S2KA 4OONA 1XA1A 4B88A 4KZ6A 1EWZA 4S2OA 2FFFB 5F82A 3DW0A 1YLYA 3BYDA 1MWSA 2WZZA 4BD1A 3VP0A 1KDWA 2XQZA 4KQOA 5CTMA 2OLVA 1XPBA 5TFQA 4S2JA 3PBNA 3QHYA 4QY6A 2R9XA 3ZNTA 3VP4A 4E3KA 4JXWA 3N8SA 1O07A 4GNUA 4OOMA 3IT9A 3HLBA 1XKZA 4EBPA 5HAPA 3BFEA 1YLTA 4OKPA 1K57C 5HW3A 3UE0A 3ZG0A 2ZC5B 1YLWA 2ZQAA 1K54C 5EOEA 2XEPA 3O3VA 5DTKA 3S4XA 3V39A 5HAQA 3UO9A 3MKFA 4K0WA 1IEMA 4GDNA 2HDUA 1M6KA 4OOYA 5FAPA 1XA7A 4F94A 1NYYA 2QZ6A 3G31A 3GVBA 3UE1A 1BLCA 1FSYA 1L2SA 4DF6A 3TSGA 5M1AA 1PI5A 1HZOA 2Y2IA 5FSRA 5CEBA 1JVJA 3HUMA 3EQVA 3OCNA 4BD0A 3SH7A 2WGIA 4D2OA 1YQSA 2EX6A 4ID4A 4X53A 1W5DA 2HDRA 1LLBA 2PU4A 4O7DA 3ZG8B 3BFGA 4X68A 1GA9A 1MWTA 1S0WA 3MXRA 1YMSA 3ZFZA 1DJAA 1JTGA 1JWPA 4QHCA 3Q7ZA 1RGYA 2J9PA 5L2FA 2Y2PA 5FAQA 1G6AA 3BECA 4BL2A 2WGVA 3IQAA 3W4OA 2HP6A 4JF5A 1HVBA 2JE5A 4DE1A 3HREA 4QJGA 4HBTA 5I94A 2JCHA 2WADA 1ALQA 1XXMA 2EX8A 4MEZA 4OLGA 2QPNA 4YFMA 3M6BA 2A3UA 3ZCZA 3GRJA 2WGWB 3BFCA 4Q8IA 2GDNA 3DWZA 1J9MA 2XD5A 3HLEA 4EWFA 5JYPA 4OPYA 4FH4A 4RA7A 5CXWA 5A92A 4JBFA 1W7FA 1EI5A 3MXSA 2ZQ8A 2ZD8A 4GD8A 1FCOA 4LCLA 3FWLA 3BFFA 3LY3A 1QMEA 3VSKA 2QMIA 5DF9A 2EX2A 2V1ZA 3G2YA 1TVFA 5EE8A 3A3EA 1ESIA 3NCKA 1KDSA 3IF6B 3IXDA 5FQKA 4N9LA 4R3BA 5FI6A 4ZJ3A 3VOZA 2XD1A 4OP5A 3I7JA 1PWGA 3ZVWA 4DE2A 5GL9A 5A91A 2RL3A 4WMCA 3S1YA 4GD6A 1BULA 1BUEA 1PW1A 4KZ9A 1I2WA 3HLGA 4R0QA 4Y0OA 4OQGA 2EFXA 3W4PA 2Y2KA 4MBFA 1BZAA 2XH9A 3AGFA 3Q7VA 4LV2A 3LY4A 5HFOA 4OPQA 3GV9A 5CTNA 3MZEA 1XGJA 5EPHA 1YLZA 4LV1A 2P9VA 5FAOA 3UPPA 1GHMA 1CI9A 3UPNA 2WAFA 3DTMA 5HAIA 2Y2GA 5M19A 4E3IA 3FKVA 1XX2A 3ZG5A 3CZDA 2Y2HA 4P87A 1N9BA 1YT4A 4E3NA 3E2KA 4R23A 5CGSA 5CEDA 3OPLA 4PM7A 3G30A 4ZBEA 2OV5A 3SH9A 1YM1A 1K25A 3PBRA 3GTCA 1LL9A 3BM6A 3G32A 5FQQA 4N9KA 4MBHA 3IWQA 3WS2A 4QD4A 1NY0A 3QNBA 4XUZA 1IYPA 1K4EA 3Q7VB 1C3BA 1JWVA 4WMCD 2ZM2A 3VOYA 1IYOA 1WE4A 1ES5A 4KZBA 3PAGA 4X6TA 1TEMA 4R3JA 3NC8A 3WS5A 1W8QA 3V3RA 2ZC6B 3GMWA 3OZHA 1PWCA 2HP5A 1HTZA 1Z6FA 4H8RA 4OQHA 2XDMA 2HP9A 4OP8A 3Q1FA 1K6SA 1E3UD 3MZFA 5G18A 3ZHHA 5TR7A 2CC1A 1L0DA 2H0TA 4IBRA 2Y55A 3SS4A 5KSCA 2Y2MA 4JLFA 3GQZA 3PBTA 5FQIA 2EXAA 4KZ8A 2ZQ7A 2I72A 4KQQA 4X55A 4BLMA 5JYOA 5CHUA 3QNCA 3UPOA 4S2MA 4JXGA 3IWIA 3HUNA 2DRWA 4S2LA 5CGWA 3LCEA 2PBYA 2WZXA 2XGNA 2Z2LB 3PTEA 5HARA 2WAEA 3ZGAB 1K55C 2WUQA 5CGXA 4DRTA 5A90A 1ES2A 3FKWA 1PWDA 3DWKA 1I5QA 3HLDA 1LHYA 1ZG6A 1W79A 4JXVA 5E2HA 2VGJA 4E6WA 5FQJA 4OVDA 4R1GA 1TDLA 2RCXA 4WBGA 3VFHA 4R4RA 3MZDA 4XXRA 1ESUA 4DXCA 1JTDA 2FFYA 3MKEA 5GLBA 5KSHA 1SDNA 3NBLA 2G2UA 4XUXA 4YINA 3VFFA 5GHZA 1G68A 4E3JA 3UDFA 5EECA 2C6WB 3SOIA 3IF5A 1K4FA 5U47A 3OCLA 2Y2NA 3WWXA 5EUAA 4BL3A 1W8YA 4NK3A 4P85A 5AQAA 3MBZA 1I2SA 5E2EA 2IWCA 5F1FA 1KE0A 4WYYA 5EOOA 4DE0A 1SDEA 3CMZA 3UDXA 4QY5A 1SKFA 4ZJ1A 1K57A 3OPHA 1NRFA 4FD8A 3IF6A 5CHMA 1L0FA 2X02A 1VM1A 3NDEA 1HD8A 4JKTA 4JPMA 4KZAA 2Q9NA 3BLMA 4M3KA 5GHXA 3W4QA 3W8KA 4Y0UA 4PM8A 3NY4A 4S2IA 4WEKA 4IVKA 4OLDA 1S6RA 1E4DA 2IWBA 1ERMA 1K38A 3IHAA 4HBUA 5GLCA 4CJNA 1LI0A 4GN2A 2BLSA 3HBRA 4OPZA 5AQ7A 5FA7A 3N7WA 2WKIA 4IBXA 4PM6A 2X01A 1KGFA 4QB8A 4DDYA 4DE3A 3HUOA 4KENB 4UA9A 5F83A 2X71A 1GHPA 1QMFA 2Q9MA 2ZM0A 4P6BA 4IEDA 1MXOA 4Y7PA 5E43A 3HLFA 4K0XA 1EROA 2P74A 1CEGA 1H5XA 3E2LA 3IXGA 1MPLA 1SCWA 1IELA 3LO7A 2UWXA 1YLPA 4DXBA 3A3FA 1H8ZA 1Y54A 1MWRA 2WKEA 1GA0A 4UHUA 4ZAMA 1RCJA 3ITBA 4HESA 2WYXA 3O87A 2H10A 1NZOA 1FR1A 3VSLA 1TDGA 4GDBA 4GZBA 3WS4A 3BLSA 1ES3A 4RX3A 4KZ5A 4UAAA 5EVID 4ZJ2A 1H8YA 4LV0A 1FCNA 4ZDXA 4FCFA 4P0MA 5E2FA 3IHBA 3TG9A 1L0GA 2XF3A 5GHYA 4BENA 4DDSA 4S2NC 1PZPA 5KZHA 3B3XA 5KMWA 4KZ4A 1ERQA 2XLNA 5HL1A 5EVIB 5GLDA 1IYSA 1PYYA 1GHIA 1IKIA 2DCFA 3G35A 1PW8A 4A5RA 3VP2A 1FCMA 5CHJA 2HPBA 3AGEA 3O86A 1E3UA 4JXSA 4U0TA 2Y59A 4IVIA 1KE3A 4B4ZA 3ZDJA 2R9WA 3UN7A 5F1GA 3C4OA 3PAEA 4GB7A 4WZ5C 1XGIA 2XK1A 3ZG9B 2HDQA 4X56A 4N92A 4OQIA 2WK0A 2Y2JA 4E3MA 3IWOA 3WS1A 5DVAA 5FI2A 1AXBA 3C5AA 1BLPA 1IYQA 1DJCA 5CRFA 1Q2PA 2EXBA 1FQGA 4U0XA 1WYCA 3N8LA 3V5MA 3A3IA 4B4XA 3A3DA 3C4PA 1SHVA 3G2ZA 3Q82A 5D3OA 4FSFA 1DJBA 1ES4A 1M40A 3NIAA 3SS5A 4EQIA 5EVIA 4KZ7A 3EQUA 3N8RA 4C6YA 2ZC7A 2A49A 1BLHA 2JBFA 4JF4A 4K91A 3N6IA 4EUZA 2EFUA 1ZC2A 4PPRA 2B5RA 1CI8A 3OC2A 3MFDA 3RXWA 3BRMA 3G34A 4KG6A 3FZCA 5J8XA 2Y2LA 1K54A 2ZC4B 2E8IA 2DNSA 2Y2OA 3BFDA 4WZ5A 4NETA 2WKHA 1NZUA 1FSWA 3CG5A 3OPRA 2EX9A 1KVLA 3Q81A 1KGEA 4LENA 3FYZA 1DY6A 3P98A 1MY8A 4WM9A 4L0LA 5DF8A 5DF7A 3M2JA 4UA7A 1BTLA 2IWDA 1PI4A 1IKGA 2ZJ9A 3HLCA 5EVLA 1N4OA 3G4PA 3ISGA 4JF6A 4E3OA 3NDGA 5FATA 3PBSA 2Z2MB 3AGDA 2HDSA 1O7EA 4LV3A 5CECA 5FI7A 5FDHA 5A93A 1BSGA 5CERA 3TOIA 2JC7A 3UE3A 3C7VA 4PM5A 2P9VB 2BG1A 4OQ0A 3WRZA 3RXXA 3GSGA 1LI9A 1MWUA 1L0EA 2XFSA 3SS3A 3WS0A 1PIOA 5GLAA 4KG5A 1YMXA 5AQ9A 1Q2QA 4C3QA 3UDIA 3IXHA 4N1XA 2G2WA 1ONHA 3M2KA 1NYMA 3OPPA 4EBLA 4WZ4A 1YLJA 3N4IA 2H5SA 4MBKA 2V20A 5BOHA 2Y2QA 4Y0TA 4WELA 1KVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A3J A;  3D4F A;  3IXB A;  2ZQD A;  3ITA A;  4OH0 A;  5DTS A;  5HX9 A;  4EV4 A;  4E3L A;  4CPK A;  4RX2 A;  5FQM A;  4U3T A;  2OLU A;  4N1H A;  1CK3 A;  5AQB A;  3NI9 A;  1U60 A;  5M18 A;  1K55 A;  1JWZ A;  3PBQ A;  4WEJ A;  4ZTK A;  1RP5 A;  1ZKJ A;  4EBN A;  2XFT A;  1KE4 A;  1K6R A;  1KGG A;  1LL5 A;  1NJ4 A;  3HLW A;  4MLL A;  4PM9 A;  3GR2 A;  4LCM A;  4PMA A;  1ONG A;  1XP4 A;  3V50 A;  2V2F F;  3V3S A;  3VMA A;  5FAS A;  4BJP A;  1K56 D;  3C7U A;  4S2P A;  2PU2 A;  4DKI A;  4KG2 A;  4X69 A;  4OPR A;  3UY6 A;  3RJU A;  4FH2 A;  3VP1 A;  4C75 A;  1MBL A;  4GOG A;  4OOL A;  4QU3 A;  4E6X A;  4S2N A;  3JYI A;  3VP3 A;  1BT5 A;  4KQR A;  1E25 A;  3IH8 A;  2ZM8 A;  1VQQ A;  3BEB A;  2ZQ9 A;  5FQ9 A;  5TGF A;  3ZNY A;  4Z9Q A;  5DTT A;  2OSU A;  3IF6 C;  4UA6 A;  3WRT A;  2ZLY A;  3FV7 A;  2C5W B;  2ZMA A;  2ZC3 B;  1FR6 A;  2VGK A;  3CJM A;  1NXY A;  4RVA A;  2WGW A;  3M6H A;  3S22 A;  1MKI A;  4BQM A;  1PZO A;  1CEF A;  1RGZ A;  3UNW A;  3ZVT A;  1ZG4 A;  4KZ3 A;  3Q07 A;  4MNR A;  4GKU A;  2Y4A A;  4RYE A;  2Y91 A;  2J9O A;  1FOF A;  2H0Y A;  2ZQC A;  3P09 A;  3SH8 A;  3HVF A;  5E2G A;  5EVI C;  3ZG7 B;  3O88 A;  5IHV A;  3HL9 A;  3PBO A;  1WYB A;  1GCE A;  2XR0 A;  3IH9 A;  3LEZ A;  4R4S A;  1OME A;  1K56 A;  4HEF A;  1BLS A;  2J7V A;  2J8Y A;  4S2K A;  4OON A;  1XA1 A;  4B88 A;  4KZ6 A;  1EWZ A;  4S2O A;  2FFF B;  5F82 A;  3DW0 A;  1YLY A;  3BYD A;  1MWS A;  2WZZ A;  4BD1 A;  3VP0 A;  1KDW A;  2XQZ A;  4KQO A;  5CTM A;  2OLV A;  1XPB A;  5TFQ A;  4S2J A;  3PBN A;  3QHY A;  4QY6 A;  2R9X A;  3ZNT A;  3VP4 A;  4E3K A;  4JXW A;  3N8S A;  1O07 A;  4GNU A;  4OOM A;  3IT9 A;  3HLB A;  1XKZ A;  4EBP A;  5HAP A;  3BFE A;  1YLT A;  4OKP A;  1K57 C;  5HW3 A;  3UE0 A;  3ZG0 A;  2ZC5 B;  1YLW A;  2ZQA A;  1K54 C;  5EOE A;  2XEP A;  3O3V A;  5DTK A;  3S4X A;  3V39 A;  5HAQ A;  3UO9 A;  3MKF A;  4K0W A;  1IEM A;  4GDN A;  2HDU A;  1M6K A;  4OOY A;  5FAP A;  1XA7 A;  4F94 A;  1NYY A;  2QZ6 A;  3G31 A;  3GVB A;  3UE1 A;  1BLC A;  1FSY A;  1L2S A;  4DF6 A;  3TSG A;  5M1A A;  1PI5 A;  1HZO A;  2Y2I A;  5FSR A;  5CEB A;  1JVJ A;  3HUM A;  3EQV A;  3OCN A;  4BD0 A;  3SH7 A;  2WGI A;  4D2O A;  1YQS A;  2EX6 A;  4ID4 A;  4X53 A;  1W5D A;  2HDR A;  1LLB A;  2PU4 A;  4O7D A;  3ZG8 B;  3BFG A;  4X68 A;  1GA9 A;  1MWT A;  1S0W A;  3MXR A;  1YMS A;  3ZFZ A;  1DJA A;  1JTG A;  1JWP A;  4QHC A;  3Q7Z A;  1RGY A;  2J9P A;  5L2F A;  2Y2P A;  5FAQ A;  1G6A A;  3BEC A;  4BL2 A;  2WGV A;  3IQA A;  3W4O A;  2HP6 A;  4JF5 A;  1HVB A;  2JE5 A;  4DE1 A;  3HRE A;  4QJG A;  4HBT A;  5I94 A;  2JCH A;  2WAD A;  1ALQ A;  1XXM A;  2EX8 A;  4MEZ A;  4OLG A;  2QPN A;  4YFM A;  3M6B A;  2A3U A;  3ZCZ A;  3GRJ A;  2WGW B;  3BFC A;  4Q8I A;  2GDN A;  3DWZ A;  1J9M A;  2XD5 A;  3HLE A;  4EWF A;  5JYP A;  4OPY A;  4FH4 A;  4RA7 A;  5CXW A;  5A92 A;  4JBF A;  1W7F A;  1EI5 A;  3MXS A;  2ZQ8 A;  2ZD8 A;  4GD8 A;  1FCO A;  4LCL A;  3FWL A;  3BFF A;  3LY3 A;  1QME A;  3VSK A;  2QMI A;  5DF9 A;  2EX2 A;  2V1Z A;  3G2Y A;  1TVF A;  5EE8 A;  3A3E A;  1ESI A;  3NCK A;  1KDS A;  3IF6 B;  3IXD A;  5FQK A;  4N9L A;  4R3B A;  5FI6 A;  4ZJ3 A;  3VOZ A;  2XD1 A;  4OP5 A;  3I7J A;  1PWG A;  3ZVW A;  4DE2 A;  5GL9 A;  5A91 A;  2RL3 A;  4WMC A;  3S1Y A;  4GD6 A;  1BUL A;  1BUE A;  1PW1 A;  4KZ9 A;  1I2W A;  3HLG A;  4R0Q A;  4Y0O A;  4OQG A;  2EFX A;  3W4P A;  2Y2K A;  4MBF A;  1BZA A;  2XH9 A;  3AGF A;  3Q7V A;  4LV2 A;  3LY4 A;  5HFO A;  4OPQ A;  3GV9 A;  5CTN A;  3MZE A;  1XGJ A;  5EPH A;  1YLZ A;  4LV1 A;  2P9V A;  5FAO A;  3UPP A;  1GHM A;  1CI9 A;  3UPN A;  2WAF A;  3DTM A;  5HAI A;  2Y2G A;  5M19 A;  4E3I A;  3FKV A;  1XX2 A;  3ZG5 A;  3CZD A;  2Y2H A;  4P87 A;  1N9B A;  1YT4 A;  4E3N A;  3E2K A;  4R23 A;  5CGS A;  5CED A;  3OPL A;  4PM7 A;  3G30 A;  4ZBE A;  2OV5 A;  3SH9 A;  1YM1 A;  1K25 A;  3PBR A;  3GTC A;  1LL9 A;  3BM6 A;  3G32 A;  5FQQ A;  4N9K A;  4MBH A;  3IWQ A;  3WS2 A;  4QD4 A;  1NY0 A;  3QNB A;  4XUZ A;  1IYP A;  1K4E A;  3Q7V B;  1C3B A;  1JWV A;  4WMC D;  2ZM2 A;  3VOY A;  1IYO A;  1WE4 A;  1ES5 A;  4KZB A;  3PAG A;  4X6T A;  1TEM A;  4R3J A;  3NC8 A;  3WS5 A;  1W8Q A;  3V3R A;  2ZC6 B;  3GMW A;  3OZH A;  1PWC A;  2HP5 A;  1HTZ A;  1Z6F A;  4H8R A;  4OQH A;  2XDM A;  2HP9 A;  4OP8 A;  3Q1F A;  1K6S A;  1E3U D;  3MZF A;  5G18 A;  3ZHH A;  5TR7 A;  2CC1 A;  1L0D A;  2H0T A;  4IBR A;  2Y55 A;  3SS4 A;  5KSC A;  2Y2M A;  4JLF A;  3GQZ A;  3PBT A;  5FQI A;  2EXA A;  4KZ8 A;  2ZQ7 A;  2I72 A;  4KQQ A;  4X55 A;  4BLM A;  5JYO A;  5CHU A;  3QNC A;  3UPO A;  4S2M A;  4JXG A;  3IWI A;  3HUN A;  2DRW A;  4S2L A;  5CGW A;  3LCE A;  2PBY A;  2WZX A;  2XGN A;  2Z2L B;  3PTE A;  5HAR A;  2WAE A;  3ZGA B;  1K55 C;  2WUQ A;  5CGX A;  4DRT A;  5A90 A;  1ES2 A;  3FKW A;  1PWD A;  3DWK A;  1I5Q A;  3HLD A;  1LHY A;  1ZG6 A;  1W79 A;  4JXV A;  5E2H A;  2VGJ A;  4E6W A;  5FQJ A;  4OVD A;  4R1G A;  1TDL A;  2RCX A;  4WBG A;  3VFH A;  4R4R A;  3MZD A;  4XXR A;  1ESU A;  4DXC A;  1JTD A;  2FFY A;  3MKE A;  5GLB A;  5KSH A;  1SDN A;  3NBL A;  2G2U A;  4XUX A;  4YIN A;  3VFF A;  5GHZ A;  1G68 A;  4E3J A;  3UDF A;  5EEC A;  2C6W B;  3SOI A;  3IF5 A;  1K4F A;  5U47 A;  3OCL A;  2Y2N A;  3WWX A;  5EUA A;  4BL3 A;  1W8Y A;  4NK3 A;  4P85 A;  5AQA A;  3MBZ A;  1I2S A;  5E2E A;  2IWC A;  5F1F A;  1KE0 A;  4WYY A;  5EOO A;  4DE0 A;  1SDE A;  3CMZ A;  3UDX A;  4QY5 A;  1SKF A;  4ZJ1 A;  1K57 A;  3OPH A;  1NRF A;  4FD8 A;  3IF6 A;  5CHM A;  1L0F A;  2X02 A;  1VM1 A;  3NDE A;  1HD8 A;  4JKT A;  4JPM A;  4KZA A;  2Q9N A;  3BLM A;  4M3K A;  5GHX A;  3W4Q A;  3W8K A;  4Y0U A;  4PM8 A;  3NY4 A;  4S2I A;  4WEK A;  4IVK A;  4OLD A;  1S6R A;  1E4D A;  2IWB A;  1ERM A;  1K38 A;  3IHA A;  4HBU A;  5GLC A;  4CJN A;  1LI0 A;  4GN2 A;  2BLS A;  3HBR A;  4OPZ A;  5AQ7 A;  5FA7 A;  3N7W A;  2WKI A;  4IBX A;  4PM6 A;  2X01 A;  1KGF A;  4QB8 A;  4DDY A;  4DE3 A;  3HUO A;  4KEN B;  4UA9 A;  5F83 A;  2X71 A;  1GHP A;  1QMF A;  2Q9M A;  2ZM0 A;  4P6B A;  4IED A;  1MXO A;  4Y7P A;  5E43 A;  3HLF A;  4K0X A;  1ERO A;  2P74 A;  1CEG A;  1H5X A;  3E2L A;  3IXG A;  1MPL A;  1SCW A;  1IEL A;  3LO7 A;  2UWX A;  1YLP A;  4DXB A;  3A3F A;  1H8Z A;  1Y54 A;  1MWR A;  2WKE A;  1GA0 A;  4UHU A;  4ZAM A;  1RCJ A;  3ITB A;  4HES A;  2WYX A;  3O87 A;  2H10 A;  1NZO A;  1FR1 A;  3VSL A;  1TDG A;  4GDB A;  4GZB A;  3WS4 A;  3BLS A;  1ES3 A;  4RX3 A;  4KZ5 A;  4UAA A;  5EVI D;  4ZJ2 A;  1H8Y A;  4LV0 A;  1FCN A;  4ZDX A;  4FCF A;  4P0M A;  5E2F A;  3IHB A;  3TG9 A;  1L0G A;  2XF3 A;  5GHY A;  4BEN A;  4DDS A;  4S2N C;  1PZP A;  5KZH A;  3B3X A;  5KMW A;  4KZ4 A;  1ERQ A;  2XLN A;  5HL1 A;  5EVI B;  5GLD A;  1IYS A;  1PYY A;  1GHI A;  1IKI A;  2DCF A;  3G35 A;  1PW8 A;  4A5R A;  3VP2 A;  1FCM A;  5CHJ A;  2HPB A;  3AGE A;  3O86 A;  1E3U A;  4JXS A;  4U0T A;  2Y59 A;  4IVI A;  1KE3 A;  4B4Z A;  3ZDJ A;  2R9W A;  3UN7 A;  5F1G A;  3C4O A;  3PAE A;  4GB7 A;  4WZ5 C;  1XGI A;  2XK1 A;  3ZG9 B;  2HDQ A;  4X56 A;  4N92 A;  4OQI A;  2WK0 A;  2Y2J A;  4E3M A;  3IWO A;  3WS1 A;  5DVA A;  5FI2 A;  1AXB A;  3C5A A;  1BLP A;  1IYQ A;  1DJC A;  5CRF A;  1Q2P A;  2EXB A;  1FQG A;  4U0X A;  1WYC A;  3N8L A;  3V5M A;  3A3I A;  4B4X A;  3A3D A;  3C4P A;  1SHV A;  3G2Z A;  3Q82 A;  5D3O A;  4FSF A;  1DJB A;  1ES4 A;  1M40 A;  3NIA A;  3SS5 A;  4EQI A;  5EVI A;  4KZ7 A;  3EQU A;  3N8R A;  4C6Y A;  2ZC7 A;  2A49 A;  1BLH A;  2JBF A;  4JF4 A;  4K91 A;  3N6I A;  4EUZ A;  2EFU A;  1ZC2 A;  4PPR A;  2B5R A;  1CI8 A;  3OC2 A;  3MFD A;  3RXW A;  3BRM A;  3G34 A;  4KG6 A;  3FZC A;  5J8X A;  2Y2L A;  1K54 A;  2ZC4 B;  2E8I A;  2DNS A;  2Y2O A;  3BFD A;  4WZ5 A;  4NET A;  2WKH A;  1NZU A;  1FSW A;  3CG5 A;  3OPR A;  2EX9 A;  1KVL A;  3Q81 A;  1KGE A;  4LEN A;  3FYZ A;  1DY6 A;  3P98 A;  1MY8 A;  4WM9 A;  4L0L A;  5DF8 A;  5DF7 A;  3M2J A;  4UA7 A;  1BTL A;  2IWD A;  1PI4 A;  1IKG A;  2ZJ9 A;  3HLC A;  5EVL A;  1N4O A;  3G4P A;  3ISG A;  4JF6 A;  4E3O A;  3NDG A;  5FAT A;  3PBS A;  2Z2M B;  3AGD A;  2HDS A;  1O7E A;  4LV3 A;  5CEC A;  5FI7 A;  5FDH A;  5A93 A;  1BSG A;  5CER A;  3TOI A;  2JC7 A;  3UE3 A;  3C7V A;  4PM5 A;  2P9V B;  2BG1 A;  4OQ0 A;  3WRZ A;  3RXX A;  3GSG A;  1LI9 A;  1MWU A;  1L0E A;  2XFS A;  3SS3 A;  3WS0 A;  1PIO A;  5GLA A;  4KG5 A;  1YMX A;  5AQ9 A;  1Q2Q A;  4C3Q A;  3UDI A;  3IXH A;  4N1X A;  2G2W A;  1ONH A;  3M2K A;  1NYM A;  3OPP A;  4EBL A;  4WZ4 A;  1YLJ A;  3N4I A;  2H5S A;  4MBK A;  2V20 A;  5BOH A;  2Y2Q A;  4Y0T A;  4WEL A;  1KVM A; 
#chains in the Genus database with same CATH topology
 3A3J A;  1CJF A;  3ITA A;  4OH0 A;  2PYR A;  3D72 A;  1K55 A;  4WEJ A;  2J3W A;  4I5S A;  1K6R A;  1KGG A;  1LL5 A;  2KLI A;  3DBA A;  4PM9 A;  4PMA A;  4LCM A;  3V50 A;  1ONG A;  2V0W A;  3F1O B;  4NXB A;  3KYZ A;  4C75 A;  1MBL A;  5DJU A;  4S2N A;  3MXQ A;  4KQR A;  5FQ9 A;  5TGF A;  4UA6 A;  3WRT A;  3CJM A;  3M6H A;  2ZBB A;  2HJ9 C;  1RGZ A;  3UNW A;  4Y3I A;  2A24 A;  3DTE A;  3Q07 A;  4MNR A;  2J9O A;  2ZQC A;  2H0Y A;  3ZG7 B;  3HL9 A;  1L3L A;  1WYB A;  4R4S A;  3EWK A;  2V1B A;  4S2K A;  4Q0I A;  2BTF P;  3GEC A;  2FFF B;  1YLY A;  3DTK A;  5HDC A;  1KDW A;  2XQZ A;  4NKP A;  5TFQ A;  3T4T A;  4PKY A;  2R9X A;  3L7H A;  3F1P A;  4P6Z M;  3IT9 A;  3BFE A;  4GS9 B;  5DKL A;  3ZG0 A;  3IX4 A;  3QP6 A;  5DFX A;  3UO9 A;  4K0W A;  2M7V A;  1IEM A;  4GDN A;  4OOY A;  1XA7 A;  4F94 A;  1FSY A;  2BAS A;  3HUM A;  4BD0 A;  4O8G A;  3ZG8 B;  3BFG A;  1OT9 A;  1MWT A;  3KSH A;  3MXR A;  3HCY A;  3ZFZ A;  3LIB A;  4QHC A;  2J9P A;  4Z1W A;  1G6A A;  4BL2 A;  2INW A;  2HP6 A;  2JE5 A;  3HRE A;  5DKK A;  5I94 A;  2WAD A;  1XXM A;  4UEY A;  3GRJ A;  2WGW B;  1NLZ A;  3DWZ A;  5L07 A;  4FH4 A;  2ZQ8 A;  2Q0O A;  4YNR A;  1FCO A;  3FWL A;  3LY3 A;  2QMI A;  2WKP A;  2OAP 1;  5DF9 A;  2EX2 A;  3BQ8 A;  3A3E A;  2UV0 E;  1KDS A;  2B02 A;  4ARZ A;  2DMW A;  4N9L A;  2W1T B;  1G28 A;  5K5B A;  2NUP C;  4ZJ3 A;  4OP5 A;  3I7J A;  3ZVW A;  4PHT A;  3T1Q B;  1P9R A;  4HIA A;  3CI6 A;  3F1N B;  1BUE A;  1I2W A;  3W4P A;  5HFO A;  1XGJ A;  5FAO A;  2PT7 A;  2VA0 A;  4E3I A;  5F69 A;  4E3N A;  5CED A;  5CGS A;  3OPL A;  3G30 A;  2OV5 A;  1K25 A;  4NXF A;  3WS2 A;  4QD4 A;  3D9Y A;  3VOY A;  1IYO A;  4ESP A;  1MC0 A;  3EGD C;  3WS5 A;  3GMW A;  3LR3 A;  3UB6 A;  4OQH A;  3MS6 A;  1K6S A;  5G18 A;  3ZHH A;  3PBT A;  1Y28 A;  4KZ8 A;  3VOL A;  4BLM A;  4LRZ E;  4I38 A;  5JYO A;  3UMD A;  4HP4 A;  4S2M A;  3HUN A;  5CGW A;  4S2L A;  2B95 A;  1JNU A;  4DRT A;  1G6O A;  3H82 A;  4NXG A;  5A90 A;  3T4S A;  3FKW A;  3DWK A;  1ZG6 A;  3UME A;  4Y17 A;  4OVD A;  1TDL A;  4WBG A;  2ACG A;  1JTD A;  1SDN A;  5GHZ A;  1XFN A;  1W8Y A;  1DP8 A;  4WYY A;  4QWO A;  5HD3 A;  1K57 A;  1NRF A;  3S7Q A;  1L0F A;  4M3K A;  3BLM A;  1STZ A;  3QP8 A;  3W8K A;  3NY4 A;  4FUW A;  2IWB A;  3IHA A;  1K38 A;  5GLC A;  4HBU A;  1LI0 A;  4GN2 A;  1OTI A;  3HBR A;  4IBX A;  2QJ5 A;  1KGF A;  4DE3 A;  4I3A A;  2Q9M A;  3LEQ A;  3H82 B;  2EWV A;  3CUE C;  5G4Y A;  5E43 A;  3VE4 A;  4K0X A;  3T4L A;  3IXG A;  3E2L A;  4DXB A;  4NEE D;  3NJA A;  4HES A;  2WYX A;  3O87 A;  3WS4 A;  4RX3 A;  5EVI D;  4KZ5 A;  1H8Y A;  4HH2 A;  1FCN A;  4HNB A;  4LV0 A;  4FCF A;  3CWF A;  5EM1 A;  5IT5 A;  2XF3 A;  4DDS A;  5KZH A;  3BY9 A;  5KMW A;  1ERQ A;  2XLN A;  1GHI A;  1IKI A;  3G35 A;  4KQD A;  1OTA A;  1VEU A;  5CHJ A;  2HPB A;  4U0T A;  4IVI A;  3ZDJ A;  1LSV A;  5J4E A;  2VGL M;  2JKR I;  4WZ5 C;  5F5Y A;  1XGI A;  2VZW A;  3ZG9 B;  4OQI A;  2WK0 A;  1DP6 A;  2CMN A;  5DVA A;  3NUL A;  1OT6 A;  1LL8 A;  2AVX A;  1FQG A;  1LSW A;  4U0X A;  3V5M A;  4B4X A;  3A3I A;  3CPT A;  2JKG A;  2PHY A;  4HQA A;  1BLH A;  4JF4 A;  3MF0 A;  4K91 A;  3N6I A;  4MN7 A;  5F68 A;  2QWS A;  3JPU A;  3OC2 A;  5J8X A;  2V1A A;  5IS1 A;  2E8I A;  2Y2O A;  3BFD A;  3CLO A;  3OPR A;  2EX9 A;  1KVL A;  4LEN A;  1DY6 A;  1MY8 A;  5DF7 A;  3M2J A;  4JGR A;  4UA7 A;  4WLA A;  5EVL A;  2IWD A;  1IKG A;  1IFQ A;  3KSG A;  2VEA A;  5FDH A;  1XJ3 A;  1S4S A;  1ACF A;  3LID A;  3WRZ A;  4LLO B;  3RXX A;  1L0E A;  1PIO A;  4KG5 A;  1Q2Q A;  4N1X A;  2G2W A;  3OPP A;  1NYM A;  2JKF A;  5G4Z A;  1OJG A;  1YLJ A;  2H5S A;  3NOU C;  5BOH A;  1KVM A;  5KIZ A;  3D4F A;  4CPK A;  3KO6 A;  3EEA A;  1JWZ A;  4ZTK A;  2VV8 A;  3GR2 A;  1XP4 A;  3TE8 A;  4BJP A;  1K56 D;  4JGP A;  4X69 A;  3SW1 A;  4E6X A;  4OOL A;  3B33 A;  2ZM8 A;  1OTD A;  4GLQ A;  1W63 Q;  2ZMA A;  2ZC3 B;  2VGK A;  4RVA A;  1MKI A;  4UQI S;  1CEF A;  2WKR A;  4IHQ A;  1ZG4 A;  4KZ3 A;  5HSQ A;  4GKU A;  5E2G A;  3LEZ A;  4HEF A;  2J8Y A;  4KZ6 A;  1EWZ A;  4S2O A;  3DW0 A;  2V9A A;  5HWT A;  2ZOH A;  3B42 A;  2OLV A;  2KOI A;  1OJ5 A;  4O0P A;  3N8S A;  4GNU A;  3HLB A;  3L9K A;  2VK3 A;  4KUK A;  5HAP A;  1YLT A;  4OKP A;  1K57 C;  3UE0 A;  3LFV A;  3H9W A;  3CPT B;  4Q0H A;  5EOE A;  2XSS A;  5DTK A;  3R7W A;  2XA7 M;  2XA7 S;  3S4X A;  3V39 A;  3MKF A;  3E4Q A;  1NYY A;  3GVB A;  3UE1 A;  1BLC A;  4DF6 A;  5M1A A;  1LT0 A;  5CEB A;  2NUT C;  1JVJ A;  3EQV A;  3SH7 A;  2WGI A;  2EX6 A;  3U2A A;  4X68 A;  1S0W A;  1YMS A;  1DJA A;  4L9E A;  4QPR A;  5FAQ A;  3IQA A;  4DE1 A;  2EX8 A;  3BQA A;  5FL3 A;  2HZ5 A;  3BFC A;  4DN0 A;  1J9M A;  3HLE A;  5JYP A;  2L0W A;  5A92 A;  2J80 A;  2ZD8 A;  1MZU A;  3BFF A;  2OWJ A;  3VSK A;  3G2Y A;  1TVF A;  5L8M A;  1EW0 A;  3NOT C;  3RH8 B;  4GCZ A;  3KYE A;  4NG2 A;  2XD1 A;  1PWG A;  4DE2 A;  1T1A A;  5GL9 A;  5A91 A;  2K31 A;  2W0N A;  3S1Y A;  4ARZ B;  1BUL A;  5AVE A;  1PW1 A;  3PR6 A;  4OQG A;  4MBF A;  1BZA A;  5J3W A;  1W63 M;  2XH9 A;  3LY4 A;  2O0Y A;  2QHK A;  5EPH A;  1YLZ A;  3UPN A;  3TW8 A;  3DTM A;  1OPX A;  2Y2G A;  3ZG5 A;  4G3K A;  3CZD A;  3K2N A;  4P87 A;  3LR4 A;  3IS2 A;  4ZBE A;  3UB7 A;  1YM1 A;  3PBR A;  4HI4 A;  4N9K A;  3IWQ A;  1NY0 A;  3QNB A;  1K4E A;  1JWV A;  1C3B A;  2ZM2 A;  4LRX C;  1X0O A;  1WE4 A;  3PAG A;  4CQH A;  1TEM A;  3NC8 A;  1YKD A;  3S7O A;  3BWL A;  2HP5 A;  1HTZ A;  1F98 A;  2HP9 A;  2XDM A;  3LIC A;  1P9W A;  5TR7 A;  3P7N A;  5FQI A;  1PNE A;  2I72 A;  4L9F A;  3QNC A;  3UPO A;  3T1X A;  2XGN A;  3PTE A;  3ZGA B;  2WAE A;  2WUQ A;  2JKT M;  1ES2 A;  3D3O A;  2W3E A;  3HLD A;  4JXV A;  5E2H A;  4WN5 A;  2VGJ A;  3H7W B;  3EGX C;  3VFH A;  4R4R A;  4DXC A;  2FFY A;  5GLB A;  5KSH A;  4XUX A;  1CF0 A;  2VKS A;  4E3J A;  5EEC A;  3IF5 A;  4FOF A;  3FG8 A;  4M4X A;  5U47 A;  3T4O A;  3E98 A;  4NK3 A;  4P85 A;  5E2E A;  2L4R A;  4MN5 A;  1S1Z A;  1KE0 A;  5EOO A;  4DE0 A;  1VET A;  1TS6 A;  1SDE A;  3UDX A;  4Y2F A;  1SKF A;  3OPH A;  2PYP A;  1GSW A;  4JKT A;  3IX8 A;  3W4Q A;  3E4P A;  4HY8 A;  2V8C A;  4EEU A;  1N9O A;  3KSI A;  3OLO A;  4PM8 A;  4G3W A;  4IVK A;  4Q0J A;  1ERM A;  2WKI A;  4QB8 A;  1N9N A;  5MC7 A;  4UA9 A;  5F83 A;  1GHP A;  1QMF A;  2ZM0 A;  1UGU A;  4ETZ A;  4HJ3 A;  3T4K A;  1SCW A;  3A3F A;  3MFX A;  1MWR A;  2WKE A;  1GA0 A;  1YPR A;  2PBD P;  1V9Z A;  3VSL A;  3CAX A;  2G7U A;  3BLS A;  1ES3 A;  4UAA A;  5E2F A;  2ZOI A;  3TG9 A;  4XT2 B;  2E8J A;  4S2N C;  4H6J B;  4ME4 A;  5HL1 A;  1IYS A;  3LR5 A;  4A5R A;  3VP2 A;  2GNX A;  3O86 A;  1E3U A;  4R3A A;  2LB9 A;  4GB7 A;  2XK1 A;  2HDQ A;  4X56 A;  2Y2J A;  5HPI A;  3WS1 A;  1AXB A;  3C5A A;  1BLP A;  3FPW A;  5CRF A;  3DAV A;  4X1L A;  2EXB A;  1WYC A;  3A3D A;  1SHV A;  5D3O A;  1M40 A;  3NIA A;  3SS5 A;  4EQI A;  3OBF A;  3C2W A;  4KZ7 A;  4I3J A;  2ZC7 A;  4GS9 A;  4EUZ A;  4BWI A;  2B5R A;  3DTI A;  3A0S A;  4CLC A;  1CQA A;  3TJZ C;  3Q81 A;  1GSX A;  1BTL A;  2ZJ9 A;  3MSH A;  1NLY A;  4E3O A;  5FAT A;  2JHE A;  3AGD A;  3OOV A;  2Y79 A;  4LV3 A;  4F3L A;  5CEC A;  3LYX A;  4R70 A;  2FH5 A;  2JC7 A;  4HHD A;  3GSG A;  2XFS A;  2PD7 A;  3IXH A;  4WZ4 A;  3N4I A;  4Y0T A;  3UB8 A;  5DTS A;  4EV4 A;  2LB5 A;  5HX9 A;  4E3L A;  3NI9 A;  5M18 A;  3PBQ A;  4PKY G;  1RP5 A;  4EBN A;  3VV4 A;  2XFT A;  3P01 A;  4MLL A;  3VMA A;  3V3S A;  2V2F F;  5FAS A;  3IX3 A;  3C7U A;  4S2P A;  2PU2 A;  2ZMF A;  4OPR A;  2ZMV A;  3VP1 A;  1P0Z A;  4FH2 A;  3RJU A;  4GOG A;  4QU3 A;  3JYI A;  1E25 A;  1Z09 A;  1VQQ A;  3ZNY A;  2ZQ9 A;  4Z9Q A;  2C5W B;  4DJ3 A;  1NXY A;  2VGL S;  1UWP X;  3KYQ A;  4H6J A;  3ZVT A;  1PFL A;  2Y4A A;  2Z6D A;  5EVI C;  3T50 A;  3EEH A;  5IHV A;  3PBO A;  3IH9 A;  3UB5 P;  1BLS A;  4OON A;  1XA1 A;  4B88 A;  5F82 A;  1T1B A;  2M1C A;  1MWS A;  3U4L P;  3VP0 A;  1AWI A;  4KQO A;  3IBR A;  3PBN A;  3QHY A;  1ZHH B;  4QY6 A;  4JGO A;  3MQQ A;  2YKH A;  2P04 A;  4E3K A;  3VP4 A;  4JXW A;  4OOM A;  1F2K A;  1XKZ A;  3NHQ A;  2KX6 A;  4Y5F A;  2ZQA A;  4GHI B;  1K54 C;  1TS0 A;  4DMZ A;  2I9V A;  3O3V A;  4F3L B;  5HAQ A;  1P97 A;  2PDR A;  5FAP A;  1M6K A;  2QZ6 A;  3G31 A;  1H0M A;  3TSG A;  1HZO A;  2Y2I A;  3LR0 A;  3LIE A;  2HV1 A;  4B93 A;  5FDS A;  4ID4 A;  1T1C A;  4X53 A;  1W5D A;  2XRN A;  2PU4 A;  4O7D A;  1GA9 A;  1D7E A;  3CIT A;  3MQO A;  2IA2 A;  3G6O A;  3H7W A;  1JTG A;  3Q7Z A;  2JN7 A;  3W4O A;  4JF5 A;  4HBT A;  2Y8H A;  4MEZ A;  1ALQ A;  4YFM A;  4HJ6 A;  2W1R A;  3O5Y A;  4YOF A;  2V8F A;  2XD5 A;  4EWF A;  2VJW A;  4CLC C;  4RA7 A;  1W7F A;  3MXS A;  1S66 L;  2EWW A;  4HOI A;  4GD8 A;  3PYP A;  1QME A;  2XRO A;  5EE8 A;  4XT2 A;  1ESI A;  2PRF A;  3IF6 B;  5FI6 A;  1NRJ A;  2RL3 A;  4BMW A;  4GD6 A;  4JGQ A;  2A2L A;  4BBU A;  4R0Q A;  4Y0O A;  4CLC E;  3A0V A;  2Y2K A;  3AGF A;  4LV2 A;  2W3F A;  4LRY C;  3MZE A;  3VE3 A;  4LV1 A;  3UPP A;  1CI9 A;  4EQ1 A;  2HJE A;  1N9B A;  1YT4 A;  4R23 A;  3SH9 A;  3BM6 A;  4MBH A;  4Y15 A;  2KDK A;  1SKO B;  3T4Q A;  1ZTU A;  4XUZ A;  5J7E A;  3Q7V B;  1ES5 A;  4KZB A;  5FEF A;  4X6T A;  4R3J A;  3V3R A;  2ZC6 B;  3LIF A;  3OZH A;  1PWC A;  4IUK A;  1Z6F A;  4H8R A;  3MZF A;  4D60 A;  2L1M A;  3MMH A;  4YWZ A;  4IBR A;  2Y55 A;  2W3G A;  2OWH A;  3HJI A;  5KSC A;  1SKO A;  4RQ9 A;  1LSX A;  2JKT I;  1T19 A;  4KQQ A;  4X55 A;  5CHU A;  4JXG A;  3IWI A;  5HZH A;  2PBY A;  3ZYT A;  1S4R A;  2Z2L B;  5HAR A;  1K55 C;  5CGX A;  1PWD A;  1W79 A;  4E6W A;  1VEU B;  2QKP A;  1Y4O A;  3W2Z A;  2PR5 A;  1VB6 A;  1H8M A;  4AFI A;  3MZD A;  4XXR A;  3MKE A;  3NBL A;  1G68 A;  3SOI A;  3WWX A;  3F1O A;  4BL3 A;  3MBZ A;  1I2S A;  4ZRR A;  4MDZ A;  4IJG A;  4Y13 A;  2IWC A;  3LI8 A;  4QY5 A;  4ZJ1 A;  4HP9 A;  2HGV A;  4FD8 A;  2X02 A;  1VM1 A;  4JPM A;  1HD8 A;  4KZA A;  4ETX A;  3QP1 A;  4GW9 A;  5FEG A;  4S2I A;  1E4D A;  1GSV A;  2J3T D;  2A24 B;  3LUQ A;  2FZ0 A;  5FA7 A;  4GHI A;  3JVV A;  1ERO A;  1MKM A;  2P74 A;  4P6Z S;  1H5X A;  1MPL A;  4B9O A;  3LO7 A;  2UWX A;  2HF6 A;  3A0R A;  2QYB A;  1YSP A;  1RCJ A;  3ITB A;  3RFB A;  1NZO A;  1FR1 A;  4GDB A;  5EFW A;  4GZB A;  5CX7 A;  3FPV A;  1DP9 A;  3IHB A;  3R4K A;  3BW6 A;  5GHY A;  4EW7 A;  1PZP A;  3B3X A;  1PYY A;  2DCF A;  4KUO A;  3AGE A;  2Y59 A;  3T4J A;  4B4Z A;  2R9W A;  2V0U A;  3MJQ A;  5IU1 A;  3BJN A;  2ZL1 B;  4E3M A;  1IYQ A;  4LFU A;  2QJ7 A;  4FSF A;  1DJB A;  1ES4 A;  4EER A;  5EVI A;  4CLC B;  3EQU A;  4C6Y A;  2A49 A;  3RTY A;  2EFU A;  3RXW A;  3MFD A;  3BRM A;  3G34 A;  4KG6 A;  1XJ6 A;  4NXE A;  1K54 A;  2ZC4 B;  2W1T A;  4WZ5 A;  3PXP A;  4NET A;  2W3D A;  5I5L A;  4GJ4 A;  3EOI A;  3GDI A;  3ZQ5 A;  3FYZ A;  2OOL A;  4WM9 A;  3HLC A;  3G4P A;  3ISG A;  4JF6 A;  3T1R A;  5F6A A;  3NDG A;  2MJ6 A;  3PBS A;  5HD5 A;  5A93 A;  5C5K A;  4MN6 A;  3UE3 A;  3C7V A;  4IUH A;  2BG1 A;  4OQ0 A;  1LI9 A;  1MWU A;  3SS3 A;  3WS0 A;  5GLA A;  1YMX A;  5AQ9 A;  1D06 A;  4C3Q A;  5HDD A;  1VET B;  3M2K A;  5AVF A;  4EBL A;  2PD8 A;  3K3C A;  4MBK A;  2V20 A;  4WEL A;  3IXB A;  1F5M A;  2ZQD A;  4RX2 A;  3JVU A;  4U3T A;  5FQM A;  2OLU A;  4N1H A;  1CK3 A;  5AQB A;  1U60 A;  1ZKJ A;  1KE4 A;  3HLW A;  1NJ4 A;  3F1P B;  5HPF A;  4DKI A;  2D02 A;  1VHM A;  4KG2 A;  3UY6 A;  3TRC A;  3VP3 A;  1BT5 A;  3IH8 A;  3BEB A;  3MQ0 A;  5DTT A;  2OSU A;  3IF6 C;  3ICY A;  2ZLY A;  1N9L A;  3FV7 A;  1YSQ A;  1FR6 A;  1HLU P;  4EES A;  2WGW A;  3S22 A;  3R7W B;  4I3I A;  4BQM A;  1PZO A;  3PHY A;  4RYE A;  1V9Y A;  2Y91 A;  1FOF A;  3SH8 A;  3P09 A;  3HVF A;  1BYW A;  3O88 A;  2XR0 A;  1GCE A;  2J3T C;  1OME A;  1K56 A;  2J7V A;  3BYD A;  4LGW A;  2WZZ A;  4BD1 A;  5LBR A;  5CTM A;  1XPB A;  4S2J A;  3BY8 A;  3ZNT A;  1O07 A;  4EBP A;  4G3V A;  5HW3 A;  3C30 A;  2ZC5 B;  1YLW A;  4MCW A;  4WF0 A;  2XEP A;  3ULF A;  5HDS A;  4WUJ A;  2ZL1 A;  4E04 A;  2HDU A;  3IS2 B;  1L2S A;  1PI5 A;  5FSR A;  5TJJ A;  3OCN A;  5TBM A;  4D2O A;  1YQS A;  2P08 A;  5EM0 A;  3NOP C;  2HDR A;  1LLB A;  1PRQ A;  1F9I A;  2O9B A;  1JWP A;  1RGY A;  5L2F A;  4R6L A;  4EXO A;  2Y2P A;  2Z6C A;  3BEC A;  2WGV A;  3CHW P;  1HVB A;  4X25 A;  4QJG A;  1A0K A;  2JKR M;  2JCH A;  2K7S A;  4OLG A;  2QPN A;  3M6B A;  2A3U A;  3IBJ A;  3ZCZ A;  4Q8I A;  3MR0 A;  2GDN A;  1DRM A;  1TD5 A;  2P7J A;  4OPY A;  5CXW A;  5L10 A;  3T1S A;  4JBF A;  1EI5 A;  3SZT A;  1K0K A;  1H3Q A;  4LCL A;  1G5U A;  4HJ4 A;  4O01 A;  2V1Z A;  3NCK A;  2EA9 A;  2GZA A;  3IXD A;  5FQK A;  2O9C A;  4R3B A;  3VOZ A;  3LIA A;  4WMC A;  1FIL A;  5HWW A;  4KZ9 A;  3HLG A;  5TBM B;  2O99 A;  1J3W A;  2EFX A;  1OTE A;  2OAQ 1;  3Q7V A;  2H28 A;  4OPQ A;  3GV9 A;  5CTN A;  3QP4 A;  2P9V A;  1GHM A;  2WAF A;  4L9G A;  5HAI A;  2VX8 A;  5M19 A;  3FKV A;  1XX2 A;  2Y2H A;  3E2K A;  1D1J A;  4PM7 A;  3GTC A;  1LL9 A;  3G32 A;  5FQQ A;  5L09 A;  5DJT A;  2D01 A;  1IYP A;  2B18 A;  3QP5 A;  4WMC D;  1XJ2 A;  1KOU A;  5AJG A;  4II7 A;  1W8Q A;  3S7P A;  4OP8 A;  3Q1F A;  4HH3 A;  1E3U D;  4BBV A;  4K08 A;  3C8C A;  2CC1 A;  1L0D A;  2H0T A;  3SS4 A;  2Y2M A;  3B47 A;  4JLF A;  3GQZ A;  2EXA A;  2ZQ7 A;  1SZV A;  1ODV A;  3KX0 X;  3UB9 A;  2DRW A;  3LCE A;  2WZX A;  2K2N A;  1I5Q A;  3S7N A;  1LHY A;  5FQJ A;  4R1G A;  5DFY A;  4MMN A;  2RCX A;  4X1M A;  3E4O A;  1ESU A;  2G2U A;  4YIN A;  3VFF A;  3F1N A;  3UDF A;  2C6W B;  1K4F A;  2GX5 A;  3OCL A;  2Y2N A;  3E0Y A;  4UQI M;  5EUA A;  4EUV A;  5AQA A;  5F1F A;  5A8B A;  1IOU A;  2YKF A;  3CMZ A;  2W3H A;  3IF6 A;  5CHM A;  4BBT A;  3NDE A;  5GHX A;  2Q9N A;  3HJK A;  2W27 A;  4Y0U A;  4WEK A;  4OLD A;  1S6R A;  2PR6 A;  4CJN A;  1S67 L;  2BLS A;  4FTX A;  4OPZ A;  5AQ7 A;  5EV0 A;  4EEP A;  3N7W A;  4PM6 A;  2X01 A;  4DDY A;  3HUO A;  4KEN B;  4WL9 A;  4EET B;  2X71 A;  4P6B A;  4IED A;  1MXO A;  4Y7P A;  3HLF A;  1CEG A;  1S1Y A;  1IEL A;  2M7U A;  1YLP A;  1H8Z A;  1Y54 A;  3CUE A;  5HWV A;  2VV6 A;  4UHU A;  4ZAM A;  4I39 A;  2H10 A;  3LI9 A;  1TDG A;  2GJ3 A;  2WKQ A;  4ZJ2 A;  4DJ2 A;  1OTB A;  4ZDX A;  4P0M A;  1L0G A;  4BEN A;  2O9A A;  4EU0 A;  4KZ4 A;  5EVI B;  5GLD A;  1PW8 A;  1FCM A;  4JXS A;  1XFQ A;  1KE3 A;  3UN7 A;  5F1G A;  3C4O A;  3PAE A;  1T18 A;  5HL6 A;  3LGO A;  4N92 A;  2VLG A;  3IWO A;  5FI2 A;  1XJ4 A;  1DJC A;  1Q2P A;  3V67 A;  3N8L A;  3C4P A;  3QP2 A;  3G2Z A;  3Q82 A;  3N8R A;  2JBF A;  3K3D A;  4PPR A;  1ZC2 A;  3FC7 A;  1CI8 A;  4LPZ A;  3FZC A;  2Y2L A;  2DNS A;  2R78 A;  2WKH A;  1NZU A;  1FSW A;  3CG5 A;  3C38 A;  3KSF A;  1KGE A;  1FIK A;  3P98 A;  1WA9 A;  1TS8 A;  4L0L A;  5DF8 A;  4R38 A;  2PAV P;  1YAX A;  1PI4 A;  1NWZ A;  1N4O A;  3NEC A;  2Z2M B;  2HDS A;  1TF1 A;  1O7E A;  5FI7 A;  2VV7 A;  5EVE A;  1BSG A;  1UWN X;  5CER A;  3TOI A;  4PM5 A;  2P9V B;  1TS7 A;  3UE6 A;  3T12 B;  3UDI A;  1ONH A;  4PAU A;  4CLC D;  2Y2Q A; 
#chains in the Genus database with same CATH homology
 3A3J A;  3D4F A;  3IXB A;  2ZQD A;  3ITA A;  4OH0 A;  5DTS A;  5HX9 A;  4EV4 A;  4E3L A;  4CPK A;  4RX2 A;  5FQM A;  4U3T A;  2OLU A;  4N1H A;  1CK3 A;  5AQB A;  3NI9 A;  1U60 A;  5M18 A;  1K55 A;  1JWZ A;  3PBQ A;  4WEJ A;  4ZTK A;  1RP5 A;  1ZKJ A;  4EBN A;  2XFT A;  1KE4 A;  1K6R A;  1KGG A;  1LL5 A;  1NJ4 A;  3HLW A;  4MLL A;  4PM9 A;  3GR2 A;  4LCM A;  4PMA A;  1ONG A;  1XP4 A;  3V50 A;  2V2F F;  3V3S A;  3VMA A;  5FAS A;  4BJP A;  1K56 D;  3C7U A;  4S2P A;  2PU2 A;  4DKI A;  4KG2 A;  4X69 A;  4OPR A;  3UY6 A;  3RJU A;  4FH2 A;  3VP1 A;  4C75 A;  1MBL A;  4GOG A;  4OOL A;  4QU3 A;  4E6X A;  4S2N A;  3JYI A;  3VP3 A;  1BT5 A;  4KQR A;  1E25 A;  3IH8 A;  2ZM8 A;  1VQQ A;  3BEB A;  2ZQ9 A;  5FQ9 A;  5TGF A;  3ZNY A;  4Z9Q A;  5DTT A;  2OSU A;  3IF6 C;  4UA6 A;  3WRT A;  2ZLY A;  3FV7 A;  2C5W B;  2ZMA A;  2ZC3 B;  1FR6 A;  2VGK A;  3CJM A;  1NXY A;  4RVA A;  2WGW A;  3M6H A;  3S22 A;  1MKI A;  4BQM A;  1PZO A;  1CEF A;  1RGZ A;  3UNW A;  3ZVT A;  1ZG4 A;  4KZ3 A;  3Q07 A;  4MNR A;  4GKU A;  2Y4A A;  4RYE A;  2Y91 A;  2J9O A;  1FOF A;  2H0Y A;  2ZQC A;  3P09 A;  3SH8 A;  3HVF A;  5E2G A;  5EVI C;  3ZG7 B;  3O88 A;  5IHV A;  3HL9 A;  3PBO A;  1WYB A;  1GCE A;  2XR0 A;  3IH9 A;  3LEZ A;  4R4S A;  1OME A;  1K56 A;  4HEF A;  1BLS A;  2J7V A;  2J8Y A;  4S2K A;  4OON A;  1XA1 A;  4B88 A;  4KZ6 A;  1EWZ A;  4S2O A;  2FFF B;  5F82 A;  3DW0 A;  1YLY A;  3BYD A;  1MWS A;  2WZZ A;  4BD1 A;  3VP0 A;  1KDW A;  2XQZ A;  4KQO A;  5CTM A;  2OLV A;  1XPB A;  5TFQ A;  4S2J A;  3PBN A;  3QHY A;  4QY6 A;  2R9X A;  3ZNT A;  3VP4 A;  4E3K A;  4JXW A;  3N8S A;  1O07 A;  4GNU A;  4OOM A;  3IT9 A;  3HLB A;  1XKZ A;  4EBP A;  5HAP A;  3BFE A;  1YLT A;  4OKP A;  1K57 C;  5HW3 A;  3UE0 A;  3ZG0 A;  2ZC5 B;  1YLW A;  2ZQA A;  1K54 C;  5EOE A;  2XEP A;  3O3V A;  5DTK A;  3S4X A;  3V39 A;  5HAQ A;  3UO9 A;  3MKF A;  4K0W A;  1IEM A;  4GDN A;  2HDU A;  1M6K A;  4OOY A;  5FAP A;  1XA7 A;  4F94 A;  1NYY A;  2QZ6 A;  3G31 A;  3GVB A;  3UE1 A;  1BLC A;  1FSY A;  1L2S A;  4DF6 A;  3TSG A;  5M1A A;  1PI5 A;  1HZO A;  2Y2I A;  5FSR A;  5CEB A;  1JVJ A;  3HUM A;  3EQV A;  3OCN A;  4BD0 A;  3SH7 A;  2WGI A;  4D2O A;  1YQS A;  2EX6 A;  4ID4 A;  4X53 A;  1W5D A;  2HDR A;  1LLB A;  2PU4 A;  4O7D A;  3ZG8 B;  3BFG A;  4X68 A;  1GA9 A;  1MWT A;  1S0W A;  3MXR A;  1YMS A;  3ZFZ A;  1DJA A;  1JTG A;  1JWP A;  4QHC A;  3Q7Z A;  1RGY A;  2J9P A;  5L2F A;  2Y2P A;  5FAQ A;  1G6A A;  3BEC A;  4BL2 A;  2WGV A;  3IQA A;  3W4O A;  2HP6 A;  4JF5 A;  1HVB A;  2JE5 A;  4DE1 A;  3HRE A;  4QJG A;  4HBT A;  5I94 A;  2JCH A;  2WAD A;  1ALQ A;  1XXM A;  2EX8 A;  4MEZ A;  4OLG A;  2QPN A;  4YFM A;  3M6B A;  2A3U A;  3ZCZ A;  3GRJ A;  2WGW B;  3BFC A;  4Q8I A;  2GDN A;  3DWZ A;  1J9M A;  2XD5 A;  3HLE A;  4EWF A;  5JYP A;  4OPY A;  4FH4 A;  4RA7 A;  5CXW A;  5A92 A;  4JBF A;  1W7F A;  1EI5 A;  3MXS A;  2ZQ8 A;  2ZD8 A;  4GD8 A;  1FCO A;  4LCL A;  3FWL A;  3BFF A;  3LY3 A;  1QME A;  3VSK A;  2QMI A;  5DF9 A;  2EX2 A;  2V1Z A;  3G2Y A;  1TVF A;  5EE8 A;  3A3E A;  1ESI A;  3NCK A;  1KDS A;  3IF6 B;  3IXD A;  5FQK A;  4N9L A;  4R3B A;  5FI6 A;  4ZJ3 A;  3VOZ A;  2XD1 A;  4OP5 A;  3I7J A;  1PWG A;  3ZVW A;  4DE2 A;  5GL9 A;  5A91 A;  2RL3 A;  4WMC A;  3S1Y A;  4GD6 A;  1BUL A;  1BUE A;  1PW1 A;  4KZ9 A;  1I2W A;  3HLG A;  4R0Q A;  4Y0O A;  4OQG A;  2EFX A;  3W4P A;  2Y2K A;  4MBF A;  1BZA A;  2XH9 A;  3AGF A;  3Q7V A;  4LV2 A;  3LY4 A;  5HFO A;  4OPQ A;  3GV9 A;  5CTN A;  3MZE A;  1XGJ A;  5EPH A;  1YLZ A;  4LV1 A;  2P9V A;  5FAO A;  3UPP A;  1GHM A;  1CI9 A;  3UPN A;  2WAF A;  3DTM A;  5HAI A;  2Y2G A;  5M19 A;  4E3I A;  3FKV A;  1XX2 A;  3ZG5 A;  3CZD A;  2Y2H A;  4P87 A;  1N9B A;  1YT4 A;  4E3N A;  3E2K A;  4R23 A;  5CGS A;  5CED A;  3OPL A;  4PM7 A;  3G30 A;  4ZBE A;  2OV5 A;  3SH9 A;  1YM1 A;  1K25 A;  3PBR A;  3GTC A;  1LL9 A;  3BM6 A;  3G32 A;  5FQQ A;  4N9K A;  4MBH A;  3IWQ A;  3WS2 A;  4QD4 A;  1NY0 A;  3QNB A;  4XUZ A;  1IYP A;  1K4E A;  3Q7V B;  1C3B A;  1JWV A;  4WMC D;  2ZM2 A;  3VOY A;  1IYO A;  1WE4 A;  1ES5 A;  4KZB A;  3PAG A;  4X6T A;  1TEM A;  4R3J A;  3NC8 A;  3WS5 A;  1W8Q A;  3V3R A;  2ZC6 B;  3GMW A;  3OZH A;  1PWC A;  2HP5 A;  1HTZ A;  1Z6F A;  4H8R A;  4OQH A;  2XDM A;  2HP9 A;  4OP8 A;  3Q1F A;  1K6S A;  1E3U D;  3MZF A;  5G18 A;  3ZHH A;  5TR7 A;  2CC1 A;  1L0D A;  2H0T A;  4IBR A;  2Y55 A;  3SS4 A;  5KSC A;  2Y2M A;  4JLF A;  3GQZ A;  3PBT A;  5FQI A;  2EXA A;  4KZ8 A;  2ZQ7 A;  2I72 A;  4KQQ A;  4X55 A;  4BLM A;  5JYO A;  5CHU A;  3QNC A;  3UPO A;  4S2M A;  4JXG A;  3IWI A;  3HUN A;  2DRW A;  4S2L A;  5CGW A;  3LCE A;  2PBY A;  2WZX A;  2XGN A;  2Z2L B;  3PTE A;  5HAR A;  2WAE A;  3ZGA B;  1K55 C;  2WUQ A;  5CGX A;  4DRT A;  5A90 A;  1ES2 A;  3FKW A;  1PWD A;  3DWK A;  1I5Q A;  3HLD A;  1LHY A;  1ZG6 A;  1W79 A;  4JXV A;  5E2H A;  2VGJ A;  4E6W A;  5FQJ A;  4OVD A;  4R1G A;  1TDL A;  2RCX A;  4WBG A;  3VFH A;  4R4R A;  3MZD A;  4XXR A;  1ESU A;  4DXC A;  1JTD A;  2FFY A;  3MKE A;  5GLB A;  5KSH A;  1SDN A;  3NBL A;  2G2U A;  4XUX A;  4YIN A;  3VFF A;  5GHZ A;  1G68 A;  4E3J A;  3UDF A;  5EEC A;  2C6W B;  3SOI A;  3IF5 A;  1K4F A;  5U47 A;  3OCL A;  2Y2N A;  3WWX A;  5EUA A;  4BL3 A;  1W8Y A;  4NK3 A;  4P85 A;  5AQA A;  3MBZ A;  1I2S A;  5E2E A;  2IWC A;  5F1F A;  1KE0 A;  4WYY A;  5EOO A;  4DE0 A;  1SDE A;  3CMZ A;  3UDX A;  4QY5 A;  1SKF A;  4ZJ1 A;  1K57 A;  3OPH A;  1NRF A;  4FD8 A;  3IF6 A;  5CHM A;  1L0F A;  2X02 A;  1VM1 A;  3NDE A;  1HD8 A;  4JKT A;  4JPM A;  4KZA A;  2Q9N A;  3BLM A;  4M3K A;  5GHX A;  3W4Q A;  3W8K A;  4Y0U A;  4PM8 A;  3NY4 A;  4S2I A;  4WEK A;  4IVK A;  4OLD A;  1S6R A;  1E4D A;  2IWB A;  1ERM A;  1K38 A;  3IHA A;  4HBU A;  5GLC A;  4CJN A;  1LI0 A;  4GN2 A;  2BLS A;  3HBR A;  4OPZ A;  5AQ7 A;  5FA7 A;  3N7W A;  2WKI A;  4IBX A;  4PM6 A;  2X01 A;  1KGF A;  4QB8 A;  4DDY A;  4DE3 A;  3HUO A;  4KEN B;  4UA9 A;  5F83 A;  2X71 A;  1GHP A;  1QMF A;  2Q9M A;  2ZM0 A;  4P6B A;  4IED A;  1MXO A;  4Y7P A;  5E43 A;  3HLF A;  4K0X A;  1ERO A;  2P74 A;  1CEG A;  1H5X A;  3E2L A;  3IXG A;  1MPL A;  1SCW A;  1IEL A;  3LO7 A;  2UWX A;  1YLP A;  4DXB A;  3A3F A;  1H8Z A;  1Y54 A;  1MWR A;  2WKE A;  1GA0 A;  4UHU A;  4ZAM A;  1RCJ A;  3ITB A;  4HES A;  2WYX A;  3O87 A;  2H10 A;  1NZO A;  1FR1 A;  3VSL A;  1TDG A;  4GDB A;  4GZB A;  3WS4 A;  3BLS A;  1ES3 A;  4RX3 A;  4KZ5 A;  4UAA A;  5EVI D;  4ZJ2 A;  1H8Y A;  4LV0 A;  1FCN A;  4ZDX A;  4FCF A;  4P0M A;  5E2F A;  3IHB A;  3TG9 A;  1L0G A;  2XF3 A;  5GHY A;  4BEN A;  4DDS A;  4S2N C;  1PZP A;  5KZH A;  3B3X A;  5KMW A;  4KZ4 A;  1ERQ A;  2XLN A;  5HL1 A;  5EVI B;  5GLD A;  1IYS A;  1PYY A;  1GHI A;  1IKI A;  2DCF A;  3G35 A;  1PW8 A;  4A5R A;  3VP2 A;  1FCM A;  5CHJ A;  2HPB A;  3AGE A;  3O86 A;  1E3U A;  4JXS A;  4U0T A;  2Y59 A;  4IVI A;  1KE3 A;  4B4Z A;  3ZDJ A;  2R9W A;  3UN7 A;  5F1G A;  3C4O A;  3PAE A;  4GB7 A;  4WZ5 C;  1XGI A;  2XK1 A;  3ZG9 B;  2HDQ A;  4X56 A;  4N92 A;  4OQI A;  2WK0 A;  2Y2J A;  4E3M A;  3IWO A;  3WS1 A;  5DVA A;  5FI2 A;  1AXB A;  3C5A A;  1BLP A;  1IYQ A;  1DJC A;  5CRF A;  1Q2P A;  2EXB A;  1FQG A;  4U0X A;  1WYC A;  3N8L A;  3V5M A;  3A3I A;  4B4X A;  3A3D A;  3C4P A;  1SHV A;  3G2Z A;  3Q82 A;  5D3O A;  4FSF A;  1DJB A;  1ES4 A;  1M40 A;  3NIA A;  3SS5 A;  4EQI A;  5EVI A;  4KZ7 A;  3EQU A;  3N8R A;  4C6Y A;  2ZC7 A;  2A49 A;  1BLH A;  2JBF A;  4JF4 A;  4K91 A;  3N6I A;  4EUZ A;  2EFU A;  1ZC2 A;  4PPR A;  2B5R A;  1CI8 A;  3OC2 A;  3MFD A;  3RXW A;  3BRM A;  3G34 A;  4KG6 A;  3FZC A;  5J8X A;  2Y2L A;  1K54 A;  2ZC4 B;  2E8I A;  2DNS A;  2Y2O A;  3BFD A;  4WZ5 A;  4NET A;  2WKH A;  1NZU A;  1FSW A;  3CG5 A;  3OPR A;  2EX9 A;  1KVL A;  3Q81 A;  1KGE A;  4LEN A;  3FYZ A;  1DY6 A;  3P98 A;  1MY8 A;  4WM9 A;  4L0L A;  5DF8 A;  5DF7 A;  3M2J A;  4UA7 A;  1BTL A;  2IWD A;  1PI4 A;  1IKG A;  2ZJ9 A;  3HLC A;  5EVL A;  1N4O A;  3G4P A;  3ISG A;  4JF6 A;  4E3O A;  3NDG A;  5FAT A;  3PBS A;  2Z2M B;  3AGD A;  2HDS A;  1O7E A;  4LV3 A;  5CEC A;  5FI7 A;  5FDH A;  5A93 A;  1BSG A;  5CER A;  3TOI A;  2JC7 A;  3UE3 A;  3C7V A;  4PM5 A;  2P9V B;  2BG1 A;  4OQ0 A;  3WRZ A;  3RXX A;  3GSG A;  1LI9 A;  1MWU A;  1L0E A;  2XFS A;  3SS3 A;  3WS0 A;  1PIO A;  5GLA A;  4KG5 A;  1YMX A;  5AQ9 A;  1Q2Q A;  4C3Q A;  3UDI A;  3IXH A;  4N1X A;  2G2W A;  1ONH A;  3M2K A;  1NYM A;  3OPP A;  4EBL A;  4WZ4 A;  1YLJ A;  3N4I A;  2H5S A;  4MBK A;  2V20 A;  5BOH A;  2Y2Q A;  4Y0T A;  4WEL A;  1KVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...