3BFDA

Crystal structure of the class a beta-lactamase sed-g238c mutant from citrobacter sedlakii
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
DVQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGACDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A beta-lactamase Sed1
publication title acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
molecule tags Hydrolase
total genus 97
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bfdA00
4KZ6A 5DTKA 4JXWA 5EVIB 5FQJA 1FCNA 5FDHA 1E3UA 2BLSA 3GR2A 3IH8A 1IYSA 4BD0A 2IWDA 3BEBA 4C3QA 4MBKA 4DF6A 1ESUA 2R9WA 2Y91A 5DVAA 4ZJ1A 3SH9A 1K6SA 1IYOA 4E3IA 2ZQ8A 1IKIA 2Y2GA 2ZQAA 1S0WA 2A3UA 4IBRA 4XUZA 1ONGA 3C7UA 3TOIA 3I7JA 5I94A 1H8ZA 3JYIA 3LCEA 5E43A 1PWCA 2ZM0A 3GSGA 1YQSA 3WWXA 1MBLA 4NETA 4F94A 4JF5A 2RCXA 4RX3A 4S2NC 4B88A 5EUAA 4H8RA 4LCMA 1PWDA 1VM1A 1J9MA 1SDNA 1Y54A 3S4XA 1K56D 4MEZA 1FQGA 2V2FF 3HLEA 4OPRA 1FSYA 2ZQDA 2UWXA 4PM7A 4OP8A 5FQMA 3HUOA 1ERMA 2Y55A 1MWRA 5E2EA 1YLJA 2WAFA 1K6RA 4DE2A 1KDSA 4BENA 2WADA 4QB8A 4UHUA 1NZUA 4OOMA 5GHYA 5CHMA 4KZ5A 3ZG7B 3ITBA 3PBRA 5E2GA 2Q9MA 1CEGA 5TR7A 3IF6B 4PM9A 5EVLA 5HW3A 1XGJA 3OCLA 3WRTA 3G34A 5AQBA 3VFFA 4DE1A 5FAOA 3V39A 4PM5A 5EVIA 3C4PA 3WS1A 2IWBA 2XGNA 3EQVA 4P6BA 2C6WB 4X6TA 3O88A 1FCOA 4HEFA 1ERQA 1CK3A 1KVMA 2Y2PA 5EVIC 1WYCA 1IKGA 3ZG5A 2EX2A 1PZOA 4OPZA 1G68A 2H10A 3ISGA 3V5MA 1W79A 3IXGA 2ZLYA 2WKHA 3SS5A 4PMAA 4K91A 4DDSA 3VFHA 4QU3A 1G6AA 2I72A 3ZG8B 4RX2A 3A3DA 4JLFA 2XFTA 4LENA 1JWZA 5A91A 3VSLA 1DY6A 3CJMA 3DWZA 4FH2A 1KGFA 3BECA 4ZTKA 2HDSA 4GZBA 3ZCZA 3WRZA 1RGYA 4X56A 4OQIA 1TDGA 4EQIA 1GHPA 2Y2KA 4JPMA 1FR1A 1PZPA 1W8QA 1O07A 2HDRA 1U60A 2QPNA 3ZNYA 4EBNA 1DJCA 4UA7A 2JC7A 3HUMA 5IHVA 2Y59A 1BTLA 3IF5A 1WYBA 4YFMA 3UY6A 3BLSA 2EX8A 2XD5A 1K25A 3BFFA 5FI6A 4ZJ2A 4JXVA 3N6IA 3HVFA 3UPOA 3G4PA 3O86A 4KZBA 4OLDA 2EXBA 3VOZA 1KE3A 4BL2A 2Y2HA 3OZHA 1FOFA 2XFSA 1SDEA 4DRTA 1XPBA 2WGWB 3IF6A 2HP5A 1BLPA 2R9XA 2WYXA 4JXSA 4UA9A 5E2HA 5EVID 1ONHA 5GLAA 5TFQA 3UE0A 1CEFA 3TG9A 1GHMA 4Z9QA 4WZ5A 4QY6A 2JBFA 3PBOA 5HX9A 3SH7A 2ZC3B 3BFEA 2A49A 3G2YA 3IF6C 3Q7ZA 1L0EA 5DTSA 3W8KA 1LI9A 1BZAA 3C5AA 3D4FA 3M6HA 3N8LA 4FSFA 3PAEA 1E4DA 2P74A 4JF6A 1DJAA 3NIAA 4JKTA 4QY5A 4KQRA 3VP3A 3VP2A 5M19A 3M2JA 3V50A 2VGKA 3M6BA 4C75A 5CECA 4WEJA 3FZCA 3HL9A 2ZQ7A 1GA9A 3MZDA 1MPLA 4IBXA 3ZGAB 3A3EA 5AQAA 1ES3A 3S1YA 3BFGA 1TEMA 2XDMA 3MXRA 4OLGA 4HBTA 2ZJ9A 5FQKA 4KZAA 4DE3A 1YLWA 5HL1A 2J9OA 2WGVA 1SKFA 4DXCA 2Y2QA 4PPRA 4Y0OA 2Z2LB 4UAAA 3LO7A 3N8SA 2J7VA 3PTEA 5GHZA 4N9KA 5DTTA 4OH0A 2ZC4B 4XXRA 5FQQA 3G31A 2J8YA 4CPKA 2Q9NA 1ESIA 4KZ4A 4GB7A 1NJ4A 1L0DA 4OQHA 4KG6A 5FASA 4EV4A 3MZEA 1OMEA 5JYPA 1H5XA 2H5SA 5F1FA 5CGWA 1K4FA 1K55A 3G35A 4ZBEA 5FATA 1JTDA 4EUZA 1ZKJA 4DE0A 1NRFA 4WBGA 3W4QA 1PI4A 3V3RA 1MXOA 4QD4A 1ES4A 4N1XA 4R3JA 3RXWA 1BLHA 4LV3A 3AGDA 3IHBA 1K55C 1KDWA 3E2LA 3S22A 3MXSA 3OPLA 4WEKA 3FKVA 4CJNA 1LL9A 3HLDA 5CHJA 3Q1FA 4E3OA 4EBPA 1Q2QA 4BL3A 2WGWA 4E3NA 2BG1A 3QNCA 4GOGA 1C3BA 5CRFA 4A5RA 5AQ9A 2ZC5B 4QJGA 1XKZA 2XLNA 2HPBA 4OKPA 1NYMA 2PU4A 5HARA 5KSCA 3OPPA 5CHUA 4KQOA 2XK1A 4BJPA 3W4OA 1KE4A 1LLBA 2ZQCA 4RA7A 4U0XA 1E3UD 1MKIA 2XF3A 4U3TA 4KZ9A 5EOEA 2Y2IA 4E3MA 2V1ZA 3BRMA 2WAEA 3SS4A 4S2IA 4JF4A 5FQ9A 3BFCA 3G32A 2XD1A 2WUQA 3NI9A 5CGXA 5CXWA 3UE3A 1YLTA 3OC2A 3NDEA 2WZZA 1DJBA 1YMXA 2ZM8A 3PBQA 3A3JA 2PU2A 3PAGA 5HFOA 2ZC6B 4E6WA 4P85A 3UO9A 4DXBA 1VQQA 2Y2NA 1TVFA 3GTCA 2J9PA 1FSWA 3W4PA 4ZAMA 3B3XA 1BLSA 3N7WA 4Y0UA 4R4RA 1BT5A 1SHVA 1PI5A 1IEMA 3GMWA 5FQIA 1JWPA 3ZVTA 2ZMAA 3Q07A 4KG5A 2XR0A 3IH9A 3RJUA 4HESA 3Q81A 5EE8A 5GHXA 2JCHA 5FI7A 1W7FA 1ALQA 4L0LA 5L2FA 1I2SA 1JTGA 3PBSA 3IXBA 1I5QA 4UA6A 2ZQ9A 4X69A 1L0GA 2EFXA 5A92A 4OVDA 4MNRA 5FA7A 1PIOA 4Y0TA 3A3IA 5JYOA 3VOYA 4LV2A 2G2UA 3MBZA 4R0QA 2EXAA 1L2SA 1EI5A 4LCLA 3UN7A 1PW1A 5FAPA 3N8RA 1PWGA 1QMEA 2ZC7A 5CERA 1PW8A 1RCJA 1XA1A 3FYZA 3HLWA 5KZHA 4GDBA 1MY8A 4S2LA 2WGIA 4OP5A 1M40A 3FKWA 2B5RA 2FFFB 3ZVWA 1QMFA 4GDNA 4WMCA 4K0XA 2X01A 3ITAA 1K38A 3Q7VA 3DWKA 1WE4A 3UDXA 3IQAA 5DF9A 3LEZA 2Y2LA 5GLCA 3EQUA 3G30A 2GDNA 1ES5A 3NCKA 4WZ5C 4JBFA 3AGEA 2OLUA 1S6RA 3N4IA 5HAPA 3IWOA 2XEPA 5HAQA 1KGGA 4GN2A 4KENB 3A3FA 4MBFA 4D2OA 5DF7A 1EWZA 1ZG6A 5HAIA 4N9LA 4E3JA 2OSUA 2PBYA 2P9VB 5CGSA 1N4OA 1XXMA 5KSHA 2Y2OA 2VGJA 1ZC2A 3HLCA 2OLVA 3SS3A 4BQMA 2Y4AA 4PM6A 1YLYA 3IHAA 1RP5A 2CC1A 4IVIA 4OONA 1L0FA 4B4XA 4B4ZA 3SH8A 3ZFZA 2Y2MA 4FCFA 1FR6A 3FV7A 5U47A 1NXYA 4X55A 1ZG4A 1N9BA 3GRJA 3UPPA 2HP9A 1NY0A 3C4OA 4GD6A 1LI0A 4KZ7A 3O3VA 4OOYA 5G18A 4LV1A 4ZDXA 3WS4A 3VSKA 1YMSA 4IEDA 2EX6A 5KMWA 4XUXA 2WZXA 1O7EA 2Z2MB 4WMCD 3IWIA 5FI2A 4OOLA 4DDYA 3UE1A 4PM8A 4KZ8A 1YM1A 3ZG9B 4EWFA 4S2NA 1NZOA 3GVBA 1FCMA 3CG5A 4OQGA 5D3OA 4K0WA 5EPHA 5F82A 4KQQA 3MKEA 5GLBA 4E3LA 5M18A 2XQZA 4P0MA 4WM9A 3P98A 3Q82A 5EECA 2QZ6A 1IYPA 3AGFA 2XH9A 3DW0A 4R4SA 5CEBA 3HBRA 3DTMA 2IWCA 2JE5A 4KG2A 4P87A 3WS5A 3NC8A 4EBLA 5CTNA 3VP4A 4R1GA 3MKFA 3E2KA 2ZM2A 3VP1A 1BUEA 2WKIA 3IT9A 2EFUA 3Q7VB 3BM6A 5FAQA 4U0TA 5CTMA 1E25A 2E8IA 1JWVA 2ZD8A 3HREA 5F83A 4C6YA 3P09A 4O7DA 3UPNA 2HP6A 3FWLA 5DF8A 3LY4A 1LHYA 1M6KA 1YT4A 1IELA 4RYEA 1YLPA 4MBHA 2RL3A 3LY3A 2WK0A 3MZFA 2P9VA 3M2KA 4S2PA 3SOIA 3V3SA 3UDIA 2DCFA 3GQZA 4N1HA 4WELA 4S2JA 1HTZA 3GV9A 4R23A 1K4EA 2C5WB 4GKUA 3WS0A 5M1AA 1W8YA 1CI9A 1JVJA 1YLZA 1K54A 1AXBA 2WKEA 4N92A 3QNBA 4S2MA 3WS2A 3BLMA 1H8YA 1K54C 3ZHHA 3TSGA 1BSGA 2FFYA 5CEDA 4RVAA 3PBNA 5GL9A 4DKIA 1I2WA 2HDUA 4Y7PA 2V20A 1XX2A 3NBLA 3O87A 4GD8A 2G2WA 4OPYA 3RXXA 1SCWA 4Q8IA 1Q2PA 4JXGA 4MLLA 4ZJ3A 3HLBA 4HBUA 5A90A 1BLCA 3IXHA 1HZOA 1BULA 1TDLA 1K57A 5FSRA 2HDQA 1KVLA 4X53A 2H0TA 4X68A 1MWUA 4YINA 4WYYA 1KE0A 3G2ZA 3VP0A 2OV5A 2DRWA 4R3BA 3BYDA 1K57C 3OPHA 3PBTA 4KZ3A 4LV0A 2QMIA 2X02A 3HLGA 2H0YA 5BOHA 2DNSA 3HUNA 4FD8A 4GNUA 3IWQA 3HLFA 1KGEA 1HVBA 1Z6FA 2Y2JA 3UNWA 3CMZA 1W5DA 4E6XA 3ZNTA 4OPQA 1HD8A 2EX9A 1CI8A 1IYQA 1GCEA 1EROA 1PYYA 1RGZA 1XGIA 3OCNA 3OPRA 1K56A 1NYYA 4NK3A 4WZ4A 1GA0A 3QHYA 3CZDA 5A93A 4FH4A 5GLDA 4QHCA 3MFDA 4E3KA 3NY4A 5TGFA 2X71A 4IVKA 3VMAA 3NDGA 4M3KA 5EOOA 4S2KA 3BFDA 3IXDA 1ES2A 4OQ0A 1GHIA 3C7VA 5E2FA 3ZG0A 5F1GA 4S2OA 4BLMA 1MWTA 5AQ7A 1LL5A 5J8XA 1MWSA 3UDFA 4BD1A 4ID4A 1XP4A 3ZDJA 1XA7A
chains in the Genus database with same CATH superfamily
3VV4A 5FDHA 3GR2A 4Y3IA 2R9WA 3O5YA 1ZHHB 1K6SA 1IKIA 1S0WA 3I7JA 5I94A 3JYIA 1MBLA 4L9GA 1J3WA 3MQQA 4B88A 4LCMA 1SDNA 3S4XA 3R7WB 1FQGA 2V2FF 4OPRA 2VK3A 3V67A 4IUHA 2Y55A 2KDKA 5E2EA 3KYQA 4QB8A 2OWJA 4KZ5A 3PBRA 2Q9MA 1V9YA 1CEGA 1XGJA 3OCLA 5AQBA 3VFFA 2W3FA 2V8FA 2O9BA 2M7UA 3C4PA 3EQVA 4P6BA 2O99A 4HEFA 1CK3A 2Y2PA 4HJ6A 2ZLYA 3SS5A 4K91A 4RX2A 3A3DA 4LENA 3QP2A 2OWHA 3DWZA 1OTAA 4EUVA 3KO6A 2HDSA 3OBFA 3LFVA 3WRZA 3IX3A 1TDGA 4JPMA 1FR1A 1PZPA 1W8QA 1TS7A 3BQAA 4EBNA 1DJCA 5IHVA 1BTLA 3IF5A 5DFYA 4YFMA 3UY6A 4DN0A 4I3IA 3BFFA 4HH2A 4KZBA 3LIAA 4OLDA 1FOFA 2I9VA 2XFSA 1XPBA 3D3OA 1BLPA 2HV1A 5GLAA 1EW0A 1CEFA 4DJ2A 1T1CA 4QY6A 2J3TC 2ZC3B 5DTSA 1LI9A 1BZAA 3C5AA 2IA2A 4FSFA 1DJAA 4QY5A 5M19A 2PD7A 2JKTM 4C75A 4WEJA 3HL9A 5HZHA 4K08A 1MPLA 4IBXA 5AQAA 5AVFA 4HBTA 4NXGA 1YLWA 5HL1A 2WGVA 4DXCA 4MCWA 1GSWA 3N8SA 3LUQA 2ZC4B 5FQQA 3G31A 1PFLA 1ESIA 2VGLM 4O0PA 5FASA 4B93A 1K0KA 4FOFA 1K55A 4II7A 5FATA 4ZBEA 4CLCA 4IJGA 1PI4A 1MXOA 3AGDA 1K55C 3NJAA 2W0NA 3S22A 2ZOHA 5FL3A 3FKVA 1LL9A 5CHJA 4EBPA 4BL3A 2BG1A 3QNCA 4GOGA 5CRFA 3LI8A 4G3WA 3KYEA 5KSCA 5F68A 1KE4A 3HJKA 4RA7A 1E3UD 4B9OA 4E3MA 4GCZA 2WAEA 3SS4A 4JF4A 3BFCA 3G32A 3UE3A 3NI9A 5L09A 1YLTA 3OC2A 2ZM8A 3A3JA 2PU2A 3PAGA 2ZC6B 3EEHA 4NG2A 4P85A 1VQQA 1W63M 1TVFA 3GTCA 2J9PA 3W4PA 3TW8A 3B3XA 4Y0UA 3N7WA 4R4RA 1BT5A 1IEMA 4LRZE 1JWPA 3ZVTA 3KX0X 4KG5A 2ZMFA 3IH9A 3UB7A 2W3HA 3Q81A 4Y5FA 2JCHA 4WUJA 5FI7A 3LEQA 1CJFA 5L2FA 2ZQ9A 4MNRA 2XRNA 4Y0TA 3MBZA 2EXAA 3UN7A 2ZL1B 1PW8A 5KZHA 4GDBA 1MY8A 1OTDA 3FKWA 2FFFB 4WMCA 3K3CA 3UDXA 3C38A 5DF9A 1P9WA 2Z6CA 3G30A 2GDNA 4JBFA 2XEPA 1NLYA 2K7SA 4EETB 4MBFA 4D2OA 5DF7A 4E3JA 2Y2OA 3W2ZA 3F1NB 1XFNA 2Y4AA 4PM6A 2PRFA 1RP5A 4OONA 2HJEA 2BASA 4G3VA 4UEYA 3ZFZA 1Y4OA 3T4KA 1N9BA 1OJ5A 4X1LA 2HP9A 3C4OA 4KZ7A 2VV7A 4OOYA 3WS4A 1YMSA 2EX6A 3T4LA 2V0WA 2WZXA 1O7EA 4EXOA 2ZL1A 2J80A 4XT2B 3LR4A 4EWFA 1FCMA 4OQGA 4K0WA 4E3LA 5F82A 2J3WA 4WM9A 3P98A 3Q82A 1T19A 1VETB 5TBMB 3PR6A 2IWCA 4P87A 4PAUA 2WKIA 3IT9A 4Y15A 3Q7VB 5FAQA 3JVUA 2ZD8A 3HREA 1AWIA 1CF0A 5DF8A 2WK0A 3MZFA 3M2KA 3GQZA 3F1NA 5J7EA 4FTXA 1K4EA 1JVJA 2YKFA 3QNBA 3ULFA 4S2MA 2PT7A 1OJGA 1VB6A 3CLOA 5CEDA 3PBNA 4DKIA 2A2LA 2HDUA 3NBLA 1XX2A 2G2WA 4XT2A 1SCWA 2ZBBA 5AJGA 1BULA 1VETA 5TBMA 1K57A 5FSRA 2V8CA 2H0TA 1OTIA 1MWUA 4YINA 1K57C 3PBTA 5A8BA 3HLGA 5BOHA 1OPXA 2DNSA 1YSQA 3HUNA 3CUEA 4FD8A 1HVBA 4E6XA 3T4OA 5J3WA 1N9NA 3CUEC 3E4PA 1PYYA 3OCNA 1N9LA 4NK3A 1RGZA 1NYYA 2W1TB 3QHYA 2NUPC 5GLDA 4QHCA 4HIAA 1ES2A 4PKYG 5J8XA 1YAXA 3QP8A 3FC7A 4ID4A 1XP4A 3LYXA 3IS2B 5DTKA 5FQJA 5HPFA 2YKHA 3K3DA 1E3UA 1IYSA 3T50A 1F5MA 4MBKA 1ESUA 5DVAA 2H28A 4EEPA 1JNUA 3C7UA 3LCEA 4JGQA 3S7PA 3FPWA 5HL6A 3WWXA 4JF5A 5HDDA 4S2NC 5EUAA 1PWDA 1VM1A 1K56D 3CAXA 2A24A 4I39A 2ZQDA 2UWXA 4DE2A 1KDSA 3DTKA 1NZUA 1TS0A 4OOMA 5GHYA 3ITBA 5MC7A 5EVEA 5TR7A 2JN7A 5EVLA 2INWA 5HW3A 3G34A 4GS9B 1GSXA 4D60A 3V39A 4NKPA 3H9WA 2C6WB 4X6TA 3O88A 3E98A 1ERQA 1KVMA 3NOPC 1TS6A 4OPZA 3H82B 1W79A 4PMAA 2GX5A 3CJMA 3MS6A 1KGFA 3BECA 4ZTKA 4GZBA 3D9YA 3ZCZA 2V1AA 2JKRI 2Y2KA 4NXEA 1FIKA 1O07A 2HDRA 5G4ZA 2P7JA 1A0KA 4UA7A 2JC7A 3DAVA 1WYBA 1K25A 2G7UA 4ZJ2A 4JXVA 3N6IA 3KSGA 3UPOA 1KE3A 2XROA 1N9OA 1SDEA 2WGWB 4JXSA 4UA9A 3B47A 2VZWA 5EVID 3UE0A 2L4RA 3TG9A 4Z9QA 4WZ5A 4GS9A 1MC0A 3PBOA 3BFEA 4JF6A 3PAEA 1W63Q 4JKTA 3VP3A 4WN5A 2KLIA 5CECA 2GZAA 2ZQ7A 1GA9A 2WKQA 4GHIB 4EEUA 3H82A 3VE4A 4OLGA 5FQKA 4HH3A 2V1BA 2Y2QA 4PPRA 4UAAA 4HQAA 4OH0A 2Q9NA 3NOTC 3D72A 4GB7A 4OQHA 1L0DA 3F1PB 4ETXA 2L0WA 5JYPA 3PYPA 5F1FA 4KQDA 5CGWA 1F98A 2B02A 3DTIA 2VGLS 3TE8A 1T1AA 3RXWA 4R3JA 3G6OA 2VLGA 1S67L 1KDWA 3E2LA 3OPLA 3HLDA 2Q0OA 2P08A 2WGWA 4A5RA 4QJGA 5AQ9A 2ZC5B 2XLNA 2HPBA 5HARA 4UQIM 1STZA 2QJ5A 4HY8A 3ICYA 3JPUA 3W4OA 1LLBA 3UMDA 2ZQCA 2XF3A 4KZ9A 3MXQA 4Y2FA 4WL9A 5EOEA 2V1ZA 4GHIA 5FQ9A 3K2NA 2XD1A 4BBVA 3NDEA 3LR3A 2WZZA 2K2NA 2GNXA 5HDCA 3UO9A 4DXBA 1FSWA 3T1QB 1SHVA 4I5SA 3F1PA 1T18A 2DMWA 2KX6A 3NOUC 4NXBA 5EE8A 5GHXA 4L0LA 4HJ4A 3IXBA 4UA6A 4CLCB 5DKLA 1PIOA 3A3IA 5JYOA 2G2UA 1Z09A 2XA7M 3N8RA 3UB8A 3ZYTA 1XA1A 2PDRA 2WGIA 2B5RA 3ZVWA 1S4SA 1QMFA 3NULA 4GDNA 3ITAA 2KOIA 3JVVA 1P9RA 3LEZA 4EESA 2Y2LA 5GLCA 1ES5A 3NCKA 4R70A 3N4IA 5HAPA 4EW7A 3MJQA 5HAQA 4LLOB 1Y28A 2PR5A 2W1RA 4N9LA 2PBYA 5CGSA 4JGPA 1N4OA 5KSHA 1ZC2A 5C5KA 4JGRA 3SS3A 5FEGA 3BJNA 2CC1A 4IVIA 2PHYA 1L0FA 2VX8A 2GJ3A 4HJ3A 1OT6A 4X25A 5U47A 4X55A 5HDSA 5TJJA 2O9AA 4GD6A 1SKOB 3O3VA 4LV1A 3P7NA 4YNRA 4CLCC 4RQ9A 3UE1A 3S7NA 3CG5A 4CLCE 1LL8A 5EPHA 5GLBA 4KQQA 2XQZA 3CPTB 3DW0A 2XH9A 4HI4A 3BWLA 2HF6A 3VP4A 3MKFA 3E2KA 3S7OA 2ZM2A 3VP1A 1BUEA 3BM6A 3T1XA 5KIZA 3P09A 4WF0A 1M6KA 1YT4A 3VOLA 3V3SA 3UDIA 4N1HA 4HOIA 1HTZA 3GV9A 2C5WB 1W8YA 1YLZA 1K54A 1AXBA 3B42A 3SZTA 3BLMA 1SKOA 1K54C 1BSGA 4MN7A 2FFYA 4WLAA 4Y7PA 2V20A 1ACFA 4MLLA 4HBUA 3CPTA 3IXHA 4JGOA 4P6ZM 3HJIA 4X53A 3CITA 4X68A 4WYYA 3BYDA 4KZ3A 4LV0A 3IBJA 1KGEA 1Z6FA 3CMZA 1VEUB 3MFXA 5HWVA 1EROA 2E8JA 3L7HA 3MFDA 4E3KA 3NY4A 5IT5A 4M3KA 4OQ0A 1D06A 5E2FA 1G5UA 3C7VA 4AFIA 1S1ZA 1X0OA 4BLMA 1LL5A 3UDFA 4BD1A 4L9FA 3ZDJA 5I5LA 5F5YA 3IH8A 3BEBA 4ZJ1A 1XFQA 3QP1A 5L07A 1IYOA 2VV8A 2ZQ8A 2Y2GA 2A3UA 4XUZA 3TOIA 3MMHA 1PWCA 1YQSA 1UWPX 4NETA 4F94A 1G6OA 1H3QA 2RCXA 3C2WA 4RX3A 4O8GA 2OAP1 3QP6A 5F69A 2JKTI 1SZVA 1Y54A 4MEZA 3KYZA 5DKKA 5FQMA 3HUOA 1VEUA 1ERMA 4ME4A 1LSWA 2WAFA 4BENA 4UHUA 5CHMA 3ZG7B 3LIEA 5E2GA 5J4EA 4Q0JA 3IF6B 3DBAA 5G4YA 3PXPA 3KSFA 5FAOA 4PM5A 2O0YA 2IWBA 5DFXA 4Y13A 3RFBA 1FCOA 3UE6A 2WKPA 1NWZA 3CHWP 3S7QA 1WYCA 3ZG5A 2EX2A 1G68A 3V5MA 3RH8B 2WKHA 4DDSA 4QU3A 3ZG8B 4JLFA 3LGOA 2XFTA 5A91A 1DY6A 1UGUA 2W3DA 2CMNA 4EQIA 1GHPA 3BW6A 1U60A 3ZNYA 2FZ0A 2W3GA 3BLSA 2XD5A 5FI6A 2A24B 3G4PA 3O86A 2EXBA 4BL2A 3OZHA 4DRTA 5HWWA 3IF6A 2HP5A 2WYXA 1TD5A 3FG8A 3SH7A 5HX9A 2A49A 3G2YA 3IF6C 3Q7ZA 3W8KA 3EWKA 3D4FA 3M6HA 5E43A 3UNWA 1E4DA 2P74A 3NIAA 4EQ1A 3VP2A 4HP4A 3V50A 3FZCA 4I3JA 3ZGAB 3A3EA 3S1YA 5HSQA 4DJ3A 2XDMA 3T4SA 5F6AA 4KZAA 2J9OA 4Y0OA 2Z2LB 3LO7A 3PTEA 2J7VA 5GHZA 1F9IA 4XXRA 4CPKA 4GLQA 4IHQA 4KG6A 4EV4A 3MZEA 1OMEA 1H5XA 2H5SA 4HNBA 2VJWA 1K4FA 3G35A 1NRFA 2J3TD 4QD4A 1ES4A 4LV3A 4CJNA 3Q1FA 4E3OA 4IUKA 1XKZA 1IFQA 2PU4A 1L3LA 3OPPA 4MN5A 5CHUA 2XK1A 3LR5A 4BJPA 3KSHA 5HD5A 4UQIS 4EU0A 3GECA 2QWSA 4S2IA 1S4RA 4PHTA 4LFUA 4HP9A 1PNEA 1DJBA 2HZ5A 3A0SA 1IOUA 3GMWA 2ZMAA 2XR0A 3F1OB 1PRQA 1ZTUA 1ALQA 4O01A 3B33A 1JTGA 3PBSA 2Y79A 4X69A 2EFXA 4OVDA 2ZMVA 1F2KA 3VOYA 4Q0IA 4R0QA 1L2SA 1EI5A 4LCLA 1PW1A 5FAPA 1QMEA 3DTEA 4GJ4A 1DRMA 2ZC7A 3FYZA 1RCJA 3HLWA 4HHDA 4KUOA 3UB5P 2XA7S 1K38A 3DWKA 3IQAA 3EQUA 4WZ5C 5L8MA 1XJ2A 4GN2A 3EGXC 3A3FA 3U4LP 2L1MA 1KOUA 1EWZA 1ZG6A 1OTEA 2OSUA 2P9VB 1XXMA 2VGJA 3HLCA 4BQMA 3IHAA 4M4XA 2PBDP 3A0VA 2VA0A 3F1OA 4B4ZA 4FCFA 4BBTA 1ZG4A 3UPPA 5IU1A 1LI0A 4ZDXA 4QPRA 3VSKA 3P01A 4IEDA 3T1SA 4XUXA 2M7VA 2Z2MB 4WMCD 2JHEA 4OOLA 4DDYA 5FDSA 4KZ8A 5D3OA 3MKEA 4Q0HA 5M18A 4P0MA 3T12B 5EECA 4R4SA 3AGFA 5CEBA 3HBRA 4EBLA 3NC8A 4R1GA 5EV0A 2VEAA 1UWNX 4U0TA 2E8IA 1OT9A 2M1CA 2JKFA 2ZOIA 3LY4A 1LHYA 1IELA 1YLPA 3LY3A 4S2PA 2P9VA 5EM1A 2QKPA 3LIDA 4GW9A 4GKUA 3WS0A 4Y17A 4ETZA 3VE3A 1CI9A 4N92A 2HJ9C 1XJ4A 1H8YA 3ZHHA 3EGDC 2QYBA 5GL9A 2P04A 4GD8A 4OPYA 3FPVA 1FILA 4Q8IA 4JXGA 2EWWA 5A90A 3T4TA 1HZOA 2PYPA 2HDQA 1KVLA 3EEAA 1KE0A 3VP0A 2OV5A 2DRWA 4R3BA 3R7WA 3RTYA 2X02A 1D1JA 2BTFP 4P6ZS 4MN6A 4GNUA 3HLFA 3LR0A 1CQAA 3NECA 3GDIA 3UB6A 4OPQA 1GCEA 3R4KA 1ODVA 2WKRA 1IYQA 5AVEA 3OPRA 1K56A 4YOFA 2NUTC 5TGFA 2X71A 4MMNA 2LB9A 3NDGA 5EOOA 4S2KA 3BFDA 3IXDA 4I3AA 3E0YA 1GHIA 3ZG0A 4S2OA 5AQ7A 1MWSA 3C30A 1XA7A 4KZ6A 4JXWA 5EVIB 1FCNA 4ZRRA 2BLSA 4R38A 4BD0A 2IWDA 4X1MA 4C3QA 5HPIA 4DF6A 2Y91A 3SH9A 3UMEA 4E3IA 2ZQAA 4IBRA 1ONGA 1LSXA 1H8ZA 2ZM0A 3GSGA 3T1RA 1BYWA 2LB5A 2O9CA 4H8RA 1J9MA 3MSHA 3HLEA 1FSYA 2QHKA 4PM7A 4OP8A 4LRYC 1YSPA 1MWRA 1YLJA 2VKSA 1S66L 1K6RA 4E04A 2WADA 2OOLA 3E4QA 2OAQ1 4LRXC 2Y8HA 4PM9A 1D7EA 5K5BA 1MZUA 3WRTA 3T4QA 4DE1A 4MDZA 1H8MA 1VHMA 5EVIA 3WS1A 1HLUP 2XGNA 5EVIC 1IKGA 1PZOA 2H10A 3ISGA 3IXGA 1P0ZA 3VFHA 1G6AA 2I72A 1JWZA 3VSLA 3QP4A 4FH2A 3L9KA 3OOVA 3BQ8A 1RGYA 4X56A 4OQIA 3MR0A 3MF0A 5IS1A 2QPNA 1GSVA 3HUMA 1YKDA 2Y59A 2EX8A 4LGWA 3HVFA 4QWOA 3VOZA 2Y2HA 5E2HA 2R9XA 4CQHA 5TFQA 1ONHA 1LT0A 1GHMA 4R3AA 2JBFA 3SW1A 1S1YA 3ZQ5A 3EOIA 1L0EA 4R23A 3N8LA 4KQRA 3M2JA 2VGKA 3M6BA 3MZDA 2B18A 1ES3A 2W27A 3BFGA 1TEMA 3T4JA 3MXRA 4ESPA 2ZJ9A 1DP6A 4DE3A 4YWZA 1SKFA 4N9KA 5DTTA 2J8YA 4KZ4A 1NRJA 1G28A 2VV6A 1NJ4A 1JTDA 4EUZA 1ZKJA 4DE0A 4WBGA 3W4QA 5LBRA 3V3RA 4N1XA 1BLHA 3IHBA 3MXSA 4WEKA 1Q2QA 4E3NA 2MJ6A 3HCYA 1C3BA 4OKPA 1NYMA 4KQOA 4U0XA 2JKRM 1MKIA 4U3TA 2R78A 2Y2IA 4G3KA 3BRMA 1WA9A 2WUQA 5CGXA 5CXWA 4DMZA 1YMXA 2PYRA 3PBQA 5HFOA 3IX8A 3TRCA 3QP5A 2D02A 4E6WA 2PR6A 2Y2NA 4ZAMA 3TJZC 1BLSA 2HGVA 2V9AA 1PI5A 3LIFA 5FQIA 3Q07A 3RJUA 1T1BA 4HESA 1W7FA 1I2SA 2XSSA 1I5QA 1L0GA 4NEED 5A92A 5FA7A 2EWVA 2ACGA 4LV2A 1PWGA 1DP8A 3C8CA 5CERA 4BBUA 4S2LA 4OP5A 1M40A 5HWTA 4K0XA 4EERA 4PKYA 2X01A 2B95A 1LSVA 3Q7VA 1WE4A 4NXFA 5CX7A 3AGEA 4L9EA 3NHQA 2OLUA 1S6RA 3LI9A 3IWOA 5L10A 2V0UA 1KGGA 4KENB 4H6JB 3A0RA 5HAIA 2PAVP 2OLVA 1YLYA 4I38A 4LPZA 4B4XA 3H7WB 3SH8A 1V9ZA 3CWFA 3CI6A 2Y2MA 2K31A 1FR6A 3FV7A 1NXYA 3GRJA 1MKMA 5DJUA 1NY0A 5G18A 1YPRA 3IX4A 3LIBA 5KMWA 1TS8A 2UV0E 3IWIA 5FI2A 4PM8A 1YM1A 3ZG9B 4S2NA 1NZOA 3GVBA 5EM0A 4F3LB 2QZ6A 1IYPA 5HD3A 3DTMA 2JE5A 4KG2A 3WS5A 5FEFA 5CTNA 4FUWA 2EA9A 3U2AA 2EFUA 1OTBA 5CTMA 1E25A 5EFWA 1JWVA 2W3EA 5F83A 4Z1WA 2W1TA 4C6YA 4O7DA 3UPNA 3BY9A 4H6JA 2HP6A 1XJ6A 3FWLA 4RYEA 3MQOA 3BY8A 4MBHA 2RL3A 3SOIA 2DCFA 1H0MA 4WELA 4S2JA 3LICA 1TF1A 2FH5A 3OLOA 5M1AA 4CLCD 3H7WA 1NLZA 2Z6DA 3IS2A 2WKEA 3WS2A 2AVXA 4ARZB 3TSGA 4KUKA 1XJ3A 3IBRA 4RVAA 1I2WA 3O87A 3RXXA 4BMWA 1Q2PA 1DP9A 4ZJ3A 3HLBA 1P97A 1BLCA 1TDLA 4F3LA 2JKGA 3G2ZA 3PHYA 5DJTA 3OPHA 2QMIA 3MQ0A 2H0YA 3IWQA 2Y2JA 4BWIA 3UB9A 1W5DA 3ZNTA 2D01A 1HD8A 2EX9A 1CI8A 1XGIA 2QJ7A 4WZ4A 1GA0A 3CZDA 5A93A 4R6LA 4FH4A 4IVKA 3VMAA 2PD8A 3KSIA 5F1GA 3E4OA 1MWTA 4ARZA
chains in the Genus database with same CATH topology
4KZ6A 5DTKA 4JXWA 5EVIB 5FQJA 1FCNA 5FDHA 1E3UA 2BLSA 3GR2A 3IH8A 1IYSA 4BD0A 2IWDA 3BEBA 4C3QA 4MBKA 4DF6A 1ESUA 2R9WA 2Y91A 5DVAA 4ZJ1A 3SH9A 1K6SA 1IYOA 4E3IA 2ZQ8A 1IKIA 2Y2GA 2ZQAA 1S0WA 2A3UA 4IBRA 4XUZA 1ONGA 3C7UA 3TOIA 3I7JA 5I94A 1H8ZA 3JYIA 3LCEA 5E43A 1PWCA 2ZM0A 3GSGA 1YQSA 3WWXA 1MBLA 4NETA 4F94A 4JF5A 2RCXA 4RX3A 4S2NC 4B88A 5EUAA 4H8RA 4LCMA 1PWDA 1VM1A 1J9MA 1SDNA 1Y54A 3S4XA 1K56D 4MEZA 1FQGA 2V2FF 3HLEA 4OPRA 1FSYA 2ZQDA 2UWXA 4PM7A 4OP8A 5FQMA 3HUOA 1ERMA 2Y55A 1MWRA 5E2EA 1YLJA 2WAFA 1K6RA 4DE2A 1KDSA 4BENA 2WADA 4QB8A 4UHUA 1NZUA 4OOMA 5GHYA 5CHMA 4KZ5A 3ZG7B 3ITBA 3PBRA 5E2GA 2Q9MA 1CEGA 5TR7A 3IF6B 4PM9A 5EVLA 5HW3A 1XGJA 3OCLA 3WRTA 3G34A 5AQBA 3VFFA 4DE1A 5FAOA 3V39A 4PM5A 5EVIA 3C4PA 3WS1A 2IWBA 2XGNA 3EQVA 4P6BA 2C6WB 4X6TA 3O88A 1FCOA 4HEFA 1ERQA 1CK3A 1KVMA 2Y2PA 5EVIC 1WYCA 1IKGA 3ZG5A 2EX2A 1PZOA 4OPZA 1G68A 2H10A 3ISGA 3V5MA 1W79A 3IXGA 2ZLYA 2WKHA 3SS5A 4PMAA 4K91A 4DDSA 3VFHA 4QU3A 1G6AA 2I72A 3ZG8B 4RX2A 3A3DA 4JLFA 2XFTA 4LENA 1JWZA 5A91A 3VSLA 1DY6A 3CJMA 3DWZA 4FH2A 1KGFA 3BECA 4ZTKA 2HDSA 4GZBA 3ZCZA 3WRZA 1RGYA 4X56A 4OQIA 1TDGA 4EQIA 1GHPA 2Y2KA 4JPMA 1FR1A 1PZPA 1W8QA 1O07A 2HDRA 1U60A 2QPNA 3ZNYA 4EBNA 1DJCA 4UA7A 2JC7A 3HUMA 5IHVA 2Y59A 1BTLA 3IF5A 1WYBA 4YFMA 3UY6A 3BLSA 2EX8A 2XD5A 1K25A 3BFFA 5FI6A 4ZJ2A 4JXVA 3N6IA 3HVFA 3UPOA 3G4PA 3O86A 4KZBA 4OLDA 2EXBA 3VOZA 1KE3A 4BL2A 2Y2HA 3OZHA 1FOFA 2XFSA 1SDEA 4DRTA 1XPBA 2WGWB 3IF6A 2HP5A 1BLPA 2R9XA 2WYXA 4JXSA 4UA9A 5E2HA 5EVID 1ONHA 5GLAA 5TFQA 3UE0A 1CEFA 3TG9A 1GHMA 4Z9QA 4WZ5A 4QY6A 2JBFA 3PBOA 5HX9A 3SH7A 2ZC3B 3BFEA 2A49A 3G2YA 3IF6C 3Q7ZA 1L0EA 5DTSA 3W8KA 1LI9A 1BZAA 3C5AA 3D4FA 3M6HA 3N8LA 4FSFA 3PAEA 1E4DA 2P74A 4JF6A 1DJAA 3NIAA 4JKTA 4QY5A 4KQRA 3VP3A 3VP2A 5M19A 3M2JA 3V50A 2VGKA 3M6BA 4C75A 5CECA 4WEJA 3FZCA 3HL9A 2ZQ7A 1GA9A 3MZDA 1MPLA 4IBXA 3ZGAB 3A3EA 5AQAA 1ES3A 3S1YA 3BFGA 1TEMA 2XDMA 3MXRA 4OLGA 4HBTA 2ZJ9A 5FQKA 4KZAA 4DE3A 1YLWA 5HL1A 2J9OA 2WGVA 1SKFA 4DXCA 2Y2QA 4PPRA 4Y0OA 2Z2LB 4UAAA 3LO7A 3N8SA 2J7VA 3PTEA 5GHZA 4N9KA 5DTTA 4OH0A 2ZC4B 4XXRA 5FQQA 3G31A 2J8YA 4CPKA 2Q9NA 1ESIA 4KZ4A 4GB7A 1NJ4A 1L0DA 4OQHA 4KG6A 5FASA 4EV4A 3MZEA 1OMEA 5JYPA 1H5XA 2H5SA 5F1FA 5CGWA 1K4FA 1K55A 3G35A 4ZBEA 5FATA 1JTDA 4EUZA 1ZKJA 4DE0A 1NRFA 4WBGA 3W4QA 1PI4A 3V3RA 1MXOA 4QD4A 1ES4A 4N1XA 4R3JA 3RXWA 1BLHA 4LV3A 3AGDA 3IHBA 1K55C 1KDWA 3E2LA 3S22A 3MXSA 3OPLA 4WEKA 3FKVA 4CJNA 1LL9A 3HLDA 5CHJA 3Q1FA 4E3OA 4EBPA 1Q2QA 4BL3A 2WGWA 4E3NA 2BG1A 3QNCA 4GOGA 1C3BA 5CRFA 4A5RA 5AQ9A 2ZC5B 4QJGA 1XKZA 2XLNA 2HPBA 4OKPA 1NYMA 2PU4A 5HARA 5KSCA 3OPPA 5CHUA 4KQOA 2XK1A 4BJPA 3W4OA 1KE4A 1LLBA 2ZQCA 4RA7A 4U0XA 1E3UD 1MKIA 2XF3A 4U3TA 4KZ9A 5EOEA 2Y2IA 4E3MA 2V1ZA 3BRMA 2WAEA 3SS4A 4S2IA 4JF4A 5FQ9A 3BFCA 3G32A 2XD1A 2WUQA 3NI9A 5CGXA 5CXWA 3UE3A 1YLTA 3OC2A 3NDEA 2WZZA 1DJBA 1YMXA 2ZM8A 3PBQA 3A3JA 2PU2A 3PAGA 5HFOA 2ZC6B 4E6WA 4P85A 3UO9A 4DXBA 1VQQA 2Y2NA 1TVFA 3GTCA 2J9PA 1FSWA 3W4PA 4ZAMA 3B3XA 1BLSA 3N7WA 4Y0UA 4R4RA 1BT5A 1SHVA 1PI5A 1IEMA 3GMWA 5FQIA 1JWPA 3ZVTA 2ZMAA 3Q07A 4KG5A 2XR0A 3IH9A 3RJUA 4HESA 3Q81A 5EE8A 5GHXA 2JCHA 5FI7A 1W7FA 1ALQA 4L0LA 5L2FA 1I2SA 1JTGA 3PBSA 3IXBA 1I5QA 4UA6A 2ZQ9A 4X69A 1L0GA 2EFXA 5A92A 4OVDA 4MNRA 5FA7A 1PIOA 4Y0TA 3A3IA 5JYOA 3VOYA 4LV2A 2G2UA 3MBZA 4R0QA 2EXAA 1L2SA 1EI5A 4LCLA 3UN7A 1PW1A 5FAPA 3N8RA 1PWGA 1QMEA 2ZC7A 5CERA 1PW8A 1RCJA 1XA1A 3FYZA 3HLWA 5KZHA 4GDBA 1MY8A 4S2LA 2WGIA 4OP5A 1M40A 3FKWA 2B5RA 2FFFB 3ZVWA 1QMFA 4GDNA 4WMCA 4K0XA 2X01A 3ITAA 1K38A 3Q7VA 3DWKA 1WE4A 3UDXA 3IQAA 5DF9A 3LEZA 2Y2LA 5GLCA 3EQUA 3G30A 2GDNA 1ES5A 3NCKA 4WZ5C 4JBFA 3AGEA 2OLUA 1S6RA 3N4IA 5HAPA 3IWOA 2XEPA 5HAQA 1KGGA 4GN2A 4KENB 3A3FA 4MBFA 4D2OA 5DF7A 1EWZA 1ZG6A 5HAIA 4N9LA 4E3JA 2OSUA 2PBYA 2P9VB 5CGSA 1N4OA 1XXMA 5KSHA 2Y2OA 2VGJA 1ZC2A 3HLCA 2OLVA 3SS3A 4BQMA 2Y4AA 4PM6A 1YLYA 3IHAA 1RP5A 2CC1A 4IVIA 4OONA 1L0FA 4B4XA 4B4ZA 3SH8A 3ZFZA 2Y2MA 4FCFA 1FR6A 3FV7A 5U47A 1NXYA 4X55A 1ZG4A 1N9BA 3GRJA 3UPPA 2HP9A 1NY0A 3C4OA 4GD6A 1LI0A 4KZ7A 3O3VA 4OOYA 5G18A 4LV1A 4ZDXA 3WS4A 3VSKA 1YMSA 4IEDA 2EX6A 5KMWA 4XUXA 2WZXA 1O7EA 2Z2MB 4WMCD 3IWIA 5FI2A 4OOLA 4DDYA 3UE1A 4PM8A 4KZ8A 1YM1A 3ZG9B 4EWFA 4S2NA 1NZOA 3GVBA 1FCMA 3CG5A 4OQGA 5D3OA 4K0WA 5EPHA 5F82A 4KQQA 3MKEA 5GLBA 4E3LA 5M18A 2XQZA 4P0MA 4WM9A 3P98A 3Q82A 5EECA 2QZ6A 1IYPA 3AGFA 2XH9A 3DW0A 4R4SA 5CEBA 3HBRA 3DTMA 2IWCA 2JE5A 4KG2A 4P87A 3WS5A 3NC8A 4EBLA 5CTNA 3VP4A 4R1GA 3MKFA 3E2KA 2ZM2A 3VP1A 1BUEA 2WKIA 3IT9A 2EFUA 3Q7VB 3BM6A 5FAQA 4U0TA 5CTMA 1E25A 2E8IA 1JWVA 2ZD8A 3HREA 5F83A 4C6YA 3P09A 4O7DA 3UPNA 2HP6A 3FWLA 5DF8A 3LY4A 1LHYA 1M6KA 1YT4A 1IELA 4RYEA 1YLPA 4MBHA 2RL3A 3LY3A 2WK0A 3MZFA 2P9VA 3M2KA 4S2PA 3SOIA 3V3SA 3UDIA 2DCFA 3GQZA 4N1HA 4WELA 4S2JA 1HTZA 3GV9A 4R23A 1K4EA 2C5WB 4GKUA 3WS0A 5M1AA 1W8YA 1CI9A 1JVJA 1YLZA 1K54A 1AXBA 2WKEA 4N92A 3QNBA 4S2MA 3WS2A 3BLMA 1H8YA 1K54C 3ZHHA 3TSGA 1BSGA 2FFYA 5CEDA 4RVAA 3PBNA 5GL9A 4DKIA 1I2WA 2HDUA 4Y7PA 2V20A 1XX2A 3NBLA 3O87A 4GD8A 2G2WA 4OPYA 3RXXA 1SCWA 4Q8IA 1Q2PA 4JXGA 4MLLA 4ZJ3A 3HLBA 4HBUA 5A90A 1BLCA 3IXHA 1HZOA 1BULA 1TDLA 1K57A 5FSRA 2HDQA 1KVLA 4X53A 2H0TA 4X68A 1MWUA 4YINA 4WYYA 1KE0A 3G2ZA 3VP0A 2OV5A 2DRWA 4R3BA 3BYDA 1K57C 3OPHA 3PBTA 4KZ3A 4LV0A 2QMIA 2X02A 3HLGA 2H0YA 5BOHA 2DNSA 3HUNA 4FD8A 4GNUA 3IWQA 3HLFA 1KGEA 1HVBA 1Z6FA 2Y2JA 3UNWA 3CMZA 1W5DA 4E6XA 3ZNTA 4OPQA 1HD8A 2EX9A 1CI8A 1IYQA 1GCEA 1EROA 1PYYA 1RGZA 1XGIA 3OCNA 3OPRA 1K56A 1NYYA 4NK3A 4WZ4A 1GA0A 3QHYA 3CZDA 5A93A 4FH4A 5GLDA 4QHCA 3MFDA 4E3KA 3NY4A 5TGFA 2X71A 4IVKA 3VMAA 3NDGA 4M3KA 5EOOA 4S2KA 3BFDA 3IXDA 1ES2A 4OQ0A 1GHIA 3C7VA 5E2FA 3ZG0A 5F1GA 4S2OA 4BLMA 1MWTA 5AQ7A 1LL5A 5J8XA 1MWSA 3UDFA 4BD1A 4ID4A 1XP4A 3ZDJA 1XA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ6 A;  5DTK A;  4JXW A;  5EVI B;  5FQJ A;  1FCN A;  5FDH A;  1E3U A;  2BLS A;  3GR2 A;  3IH8 A;  1IYS A;  4BD0 A;  2IWD A;  3BEB A;  4C3Q A;  4MBK A;  4DF6 A;  1ESU A;  2R9W A;  2Y91 A;  5DVA A;  4ZJ1 A;  3SH9 A;  1K6S A;  1IYO A;  4E3I A;  2ZQ8 A;  1IKI A;  2Y2G A;  2ZQA A;  1S0W A;  2A3U A;  4IBR A;  4XUZ A;  1ONG A;  3C7U A;  3TOI A;  3I7J A;  5I94 A;  1H8Z A;  3JYI A;  3LCE A;  5E43 A;  1PWC A;  2ZM0 A;  3GSG A;  1YQS A;  3WWX A;  1MBL A;  4NET A;  4F94 A;  4JF5 A;  2RCX A;  4RX3 A;  4S2N C;  4B88 A;  5EUA A;  4H8R A;  4LCM A;  1PWD A;  1VM1 A;  1J9M A;  1SDN A;  1Y54 A;  3S4X A;  1K56 D;  4MEZ A;  1FQG A;  2V2F F;  3HLE A;  4OPR A;  1FSY A;  2ZQD A;  2UWX A;  4PM7 A;  4OP8 A;  5FQM A;  3HUO A;  1ERM A;  2Y55 A;  1MWR A;  5E2E A;  1YLJ A;  2WAF A;  1K6R A;  4DE2 A;  1KDS A;  4BEN A;  2WAD A;  4QB8 A;  4UHU A;  1NZU A;  4OOM A;  5GHY A;  5CHM A;  4KZ5 A;  3ZG7 B;  3ITB A;  3PBR A;  5E2G A;  2Q9M A;  1CEG A;  5TR7 A;  3IF6 B;  4PM9 A;  5EVL A;  5HW3 A;  1XGJ A;  3OCL A;  3WRT A;  3G34 A;  5AQB A;  3VFF A;  4DE1 A;  5FAO A;  3V39 A;  4PM5 A;  5EVI A;  3C4P A;  3WS1 A;  2IWB A;  2XGN A;  3EQV A;  4P6B A;  2C6W B;  4X6T A;  3O88 A;  1FCO A;  4HEF A;  1ERQ A;  1CK3 A;  1KVM A;  2Y2P A;  5EVI C;  1WYC A;  1IKG A;  3ZG5 A;  2EX2 A;  1PZO A;  4OPZ A;  1G68 A;  2H10 A;  3ISG A;  3V5M A;  1W79 A;  3IXG A;  2ZLY A;  2WKH A;  3SS5 A;  4PMA A;  4K91 A;  4DDS A;  3VFH A;  4QU3 A;  1G6A A;  2I72 A;  3ZG8 B;  4RX2 A;  3A3D A;  4JLF A;  2XFT A;  4LEN A;  1JWZ A;  5A91 A;  3VSL A;  1DY6 A;  3CJM A;  3DWZ A;  4FH2 A;  1KGF A;  3BEC A;  4ZTK A;  2HDS A;  4GZB A;  3ZCZ A;  3WRZ A;  1RGY A;  4X56 A;  4OQI A;  1TDG A;  4EQI A;  1GHP A;  2Y2K A;  4JPM A;  1FR1 A;  1PZP A;  1W8Q A;  1O07 A;  2HDR A;  1U60 A;  2QPN A;  3ZNY A;  4EBN A;  1DJC A;  4UA7 A;  2JC7 A;  3HUM A;  5IHV A;  2Y59 A;  1BTL A;  3IF5 A;  1WYB A;  4YFM A;  3UY6 A;  3BLS A;  2EX8 A;  2XD5 A;  1K25 A;  3BFF A;  5FI6 A;  4ZJ2 A;  4JXV A;  3N6I A;  3HVF A;  3UPO A;  3G4P A;  3O86 A;  4KZB A;  4OLD A;  2EXB A;  3VOZ A;  1KE3 A;  4BL2 A;  2Y2H A;  3OZH A;  1FOF A;  2XFS A;  1SDE A;  4DRT A;  1XPB A;  2WGW B;  3IF6 A;  2HP5 A;  1BLP A;  2R9X A;  2WYX A;  4JXS A;  4UA9 A;  5E2H A;  5EVI D;  1ONH A;  5GLA A;  5TFQ A;  3UE0 A;  1CEF A;  3TG9 A;  1GHM A;  4Z9Q A;  4WZ5 A;  4QY6 A;  2JBF A;  3PBO A;  5HX9 A;  3SH7 A;  2ZC3 B;  3BFE A;  2A49 A;  3G2Y A;  3IF6 C;  3Q7Z A;  1L0E A;  5DTS A;  3W8K A;  1LI9 A;  1BZA A;  3C5A A;  3D4F A;  3M6H A;  3N8L A;  4FSF A;  3PAE A;  1E4D A;  2P74 A;  4JF6 A;  1DJA A;  3NIA A;  4JKT A;  4QY5 A;  4KQR A;  3VP3 A;  3VP2 A;  5M19 A;  3M2J A;  3V50 A;  2VGK A;  3M6B A;  4C75 A;  5CEC A;  4WEJ A;  3FZC A;  3HL9 A;  2ZQ7 A;  1GA9 A;  3MZD A;  1MPL A;  4IBX A;  3ZGA B;  3A3E A;  5AQA A;  1ES3 A;  3S1Y A;  3BFG A;  1TEM A;  2XDM A;  3MXR A;  4OLG A;  4HBT A;  2ZJ9 A;  5FQK A;  4KZA A;  4DE3 A;  1YLW A;  5HL1 A;  2J9O A;  2WGV A;  1SKF A;  4DXC A;  2Y2Q A;  4PPR A;  4Y0O A;  2Z2L B;  4UAA A;  3LO7 A;  3N8S A;  2J7V A;  3PTE A;  5GHZ A;  4N9K A;  5DTT A;  4OH0 A;  2ZC4 B;  4XXR A;  5FQQ A;  3G31 A;  2J8Y A;  4CPK A;  2Q9N A;  1ESI A;  4KZ4 A;  4GB7 A;  1NJ4 A;  1L0D A;  4OQH A;  4KG6 A;  5FAS A;  4EV4 A;  3MZE A;  1OME A;  5JYP A;  1H5X A;  2H5S A;  5F1F A;  5CGW A;  1K4F A;  1K55 A;  3G35 A;  4ZBE A;  5FAT A;  1JTD A;  4EUZ A;  1ZKJ A;  4DE0 A;  1NRF A;  4WBG A;  3W4Q A;  1PI4 A;  3V3R A;  1MXO A;  4QD4 A;  1ES4 A;  4N1X A;  4R3J A;  3RXW A;  1BLH A;  4LV3 A;  3AGD A;  3IHB A;  1K55 C;  1KDW A;  3E2L A;  3S22 A;  3MXS A;  3OPL A;  4WEK A;  3FKV A;  4CJN A;  1LL9 A;  3HLD A;  5CHJ A;  3Q1F A;  4E3O A;  4EBP A;  1Q2Q A;  4BL3 A;  2WGW A;  4E3N A;  2BG1 A;  3QNC A;  4GOG A;  1C3B A;  5CRF A;  4A5R A;  5AQ9 A;  2ZC5 B;  4QJG A;  1XKZ A;  2XLN A;  2HPB A;  4OKP A;  1NYM A;  2PU4 A;  5HAR A;  5KSC A;  3OPP A;  5CHU A;  4KQO A;  2XK1 A;  4BJP A;  3W4O A;  1KE4 A;  1LLB A;  2ZQC A;  4RA7 A;  4U0X A;  1E3U D;  1MKI A;  2XF3 A;  4U3T A;  4KZ9 A;  5EOE A;  2Y2I A;  4E3M A;  2V1Z A;  3BRM A;  2WAE A;  3SS4 A;  4S2I A;  4JF4 A;  5FQ9 A;  3BFC A;  3G32 A;  2XD1 A;  2WUQ A;  3NI9 A;  5CGX A;  5CXW A;  3UE3 A;  1YLT A;  3OC2 A;  3NDE A;  2WZZ A;  1DJB A;  1YMX A;  2ZM8 A;  3PBQ A;  3A3J A;  2PU2 A;  3PAG A;  5HFO A;  2ZC6 B;  4E6W A;  4P85 A;  3UO9 A;  4DXB A;  1VQQ A;  2Y2N A;  1TVF A;  3GTC A;  2J9P A;  1FSW A;  3W4P A;  4ZAM A;  3B3X A;  1BLS A;  3N7W A;  4Y0U A;  4R4R A;  1BT5 A;  1SHV A;  1PI5 A;  1IEM A;  3GMW A;  5FQI A;  1JWP A;  3ZVT A;  2ZMA A;  3Q07 A;  4KG5 A;  2XR0 A;  3IH9 A;  3RJU A;  4HES A;  3Q81 A;  5EE8 A;  5GHX A;  2JCH A;  5FI7 A;  1W7F A;  1ALQ A;  4L0L A;  5L2F A;  1I2S A;  1JTG A;  3PBS A;  3IXB A;  1I5Q A;  4UA6 A;  2ZQ9 A;  4X69 A;  1L0G A;  2EFX A;  5A92 A;  4OVD A;  4MNR A;  5FA7 A;  1PIO A;  4Y0T A;  3A3I A;  5JYO A;  3VOY A;  4LV2 A;  2G2U A;  3MBZ A;  4R0Q A;  2EXA A;  1L2S A;  1EI5 A;  4LCL A;  3UN7 A;  1PW1 A;  5FAP A;  3N8R A;  1PWG A;  1QME A;  2ZC7 A;  5CER A;  1PW8 A;  1RCJ A;  1XA1 A;  3FYZ A;  3HLW A;  5KZH A;  4GDB A;  1MY8 A;  4S2L A;  2WGI A;  4OP5 A;  1M40 A;  3FKW A;  2B5R A;  2FFF B;  3ZVW A;  1QMF A;  4GDN A;  4WMC A;  4K0X A;  2X01 A;  3ITA A;  1K38 A;  3Q7V A;  3DWK A;  1WE4 A;  3UDX A;  3IQA A;  5DF9 A;  3LEZ A;  2Y2L A;  5GLC A;  3EQU A;  3G30 A;  2GDN A;  1ES5 A;  3NCK A;  4WZ5 C;  4JBF A;  3AGE A;  2OLU A;  1S6R A;  3N4I A;  5HAP A;  3IWO A;  2XEP A;  5HAQ A;  1KGG A;  4GN2 A;  4KEN B;  3A3F A;  4MBF A;  4D2O A;  5DF7 A;  1EWZ A;  1ZG6 A;  5HAI A;  4N9L A;  4E3J A;  2OSU A;  2PBY A;  2P9V B;  5CGS A;  1N4O A;  1XXM A;  5KSH A;  2Y2O A;  2VGJ A;  1ZC2 A;  3HLC A;  2OLV A;  3SS3 A;  4BQM A;  2Y4A A;  4PM6 A;  1YLY A;  3IHA A;  1RP5 A;  2CC1 A;  4IVI A;  4OON A;  1L0F A;  4B4X A;  4B4Z A;  3SH8 A;  3ZFZ A;  2Y2M A;  4FCF A;  1FR6 A;  3FV7 A;  5U47 A;  1NXY A;  4X55 A;  1ZG4 A;  1N9B A;  3GRJ A;  3UPP A;  2HP9 A;  1NY0 A;  3C4O A;  4GD6 A;  1LI0 A;  4KZ7 A;  3O3V A;  4OOY A;  5G18 A;  4LV1 A;  4ZDX A;  3WS4 A;  3VSK A;  1YMS A;  4IED A;  2EX6 A;  5KMW A;  4XUX A;  2WZX A;  1O7E A;  2Z2M B;  4WMC D;  3IWI A;  5FI2 A;  4OOL A;  4DDY A;  3UE1 A;  4PM8 A;  4KZ8 A;  1YM1 A;  3ZG9 B;  4EWF A;  4S2N A;  1NZO A;  3GVB A;  1FCM A;  3CG5 A;  4OQG A;  5D3O A;  4K0W A;  5EPH A;  5F82 A;  4KQQ A;  3MKE A;  5GLB A;  4E3L A;  5M18 A;  2XQZ A;  4P0M A;  4WM9 A;  3P98 A;  3Q82 A;  5EEC A;  2QZ6 A;  1IYP A;  3AGF A;  2XH9 A;  3DW0 A;  4R4S A;  5CEB A;  3HBR A;  3DTM A;  2IWC A;  2JE5 A;  4KG2 A;  4P87 A;  3WS5 A;  3NC8 A;  4EBL A;  5CTN A;  3VP4 A;  4R1G A;  3MKF A;  3E2K A;  2ZM2 A;  3VP1 A;  1BUE A;  2WKI A;  3IT9 A;  2EFU A;  3Q7V B;  3BM6 A;  5FAQ A;  4U0T A;  5CTM A;  1E25 A;  2E8I A;  1JWV A;  2ZD8 A;  3HRE A;  5F83 A;  4C6Y A;  3P09 A;  4O7D A;  3UPN A;  2HP6 A;  3FWL A;  5DF8 A;  3LY4 A;  1LHY A;  1M6K A;  1YT4 A;  1IEL A;  4RYE A;  1YLP A;  4MBH A;  2RL3 A;  3LY3 A;  2WK0 A;  3MZF A;  2P9V A;  3M2K A;  4S2P A;  3SOI A;  3V3S A;  3UDI A;  2DCF A;  3GQZ A;  4N1H A;  4WEL A;  4S2J A;  1HTZ A;  3GV9 A;  4R23 A;  1K4E A;  2C5W B;  4GKU A;  3WS0 A;  5M1A A;  1W8Y A;  1CI9 A;  1JVJ A;  1YLZ A;  1K54 A;  1AXB A;  2WKE A;  4N92 A;  3QNB A;  4S2M A;  3WS2 A;  3BLM A;  1H8Y A;  1K54 C;  3ZHH A;  3TSG A;  1BSG A;  2FFY A;  5CED A;  4RVA A;  3PBN A;  5GL9 A;  4DKI A;  1I2W A;  2HDU A;  4Y7P A;  2V20 A;  1XX2 A;  3NBL A;  3O87 A;  4GD8 A;  2G2W A;  4OPY A;  3RXX A;  1SCW A;  4Q8I A;  1Q2P A;  4JXG A;  4MLL A;  4ZJ3 A;  3HLB A;  4HBU A;  5A90 A;  1BLC A;  3IXH A;  1HZO A;  1BUL A;  1TDL A;  1K57 A;  5FSR A;  2HDQ A;  1KVL A;  4X53 A;  2H0T A;  4X68 A;  1MWU A;  4YIN A;  4WYY A;  1KE0 A;  3G2Z A;  3VP0 A;  2OV5 A;  2DRW A;  4R3B A;  3BYD A;  1K57 C;  3OPH A;  3PBT A;  4KZ3 A;  4LV0 A;  2QMI A;  2X02 A;  3HLG A;  2H0Y A;  5BOH A;  2DNS A;  3HUN A;  4FD8 A;  4GNU A;  3IWQ A;  3HLF A;  1KGE A;  1HVB A;  1Z6F A;  2Y2J A;  3UNW A;  3CMZ A;  1W5D A;  4E6X A;  3ZNT A;  4OPQ A;  1HD8 A;  2EX9 A;  1CI8 A;  1IYQ A;  1GCE A;  1ERO A;  1PYY A;  1RGZ A;  1XGI A;  3OCN A;  3OPR A;  1K56 A;  1NYY A;  4NK3 A;  4WZ4 A;  1GA0 A;  3QHY A;  3CZD A;  5A93 A;  4FH4 A;  5GLD A;  4QHC A;  3MFD A;  4E3K A;  3NY4 A;  5TGF A;  2X71 A;  4IVK A;  3VMA A;  3NDG A;  4M3K A;  5EOO A;  4S2K A;  3BFD A;  3IXD A;  1ES2 A;  4OQ0 A;  1GHI A;  3C7V A;  5E2F A;  3ZG0 A;  5F1G A;  4S2O A;  4BLM A;  1MWT A;  5AQ7 A;  1LL5 A;  5J8X A;  1MWS A;  3UDF A;  4BD1 A;  4ID4 A;  1XP4 A;  3ZDJ A;  1XA7 A; 
#chains in the Genus database with same CATH topology
 3VV4 A;  5FDH A;  3GR2 A;  4Y3I A;  2R9W A;  3O5Y A;  1ZHH B;  1K6S A;  1IKI A;  1S0W A;  3I7J A;  5I94 A;  3JYI A;  1MBL A;  4L9G A;  1J3W A;  3MQQ A;  4B88 A;  4LCM A;  1SDN A;  3S4X A;  3R7W B;  1FQG A;  2V2F F;  4OPR A;  2VK3 A;  3V67 A;  4IUH A;  2Y55 A;  2KDK A;  5E2E A;  3KYQ A;  4QB8 A;  2OWJ A;  4KZ5 A;  3PBR A;  2Q9M A;  1V9Y A;  1CEG A;  1XGJ A;  3OCL A;  5AQB A;  3VFF A;  2W3F A;  2V8F A;  2O9B A;  2M7U A;  3C4P A;  3EQV A;  4P6B A;  2O99 A;  4HEF A;  1CK3 A;  2Y2P A;  4HJ6 A;  2ZLY A;  3SS5 A;  4K91 A;  4RX2 A;  3A3D A;  4LEN A;  3QP2 A;  2OWH A;  3DWZ A;  1OTA A;  4EUV A;  3KO6 A;  2HDS A;  3OBF A;  3LFV A;  3WRZ A;  3IX3 A;  1TDG A;  4JPM A;  1FR1 A;  1PZP A;  1W8Q A;  1TS7 A;  3BQA A;  4EBN A;  1DJC A;  5IHV A;  1BTL A;  3IF5 A;  5DFY A;  4YFM A;  3UY6 A;  4DN0 A;  4I3I A;  3BFF A;  4HH2 A;  4KZB A;  3LIA A;  4OLD A;  1FOF A;  2I9V A;  2XFS A;  1XPB A;  3D3O A;  1BLP A;  2HV1 A;  5GLA A;  1EW0 A;  1CEF A;  4DJ2 A;  1T1C A;  4QY6 A;  2J3T C;  2ZC3 B;  5DTS A;  1LI9 A;  1BZA A;  3C5A A;  2IA2 A;  4FSF A;  1DJA A;  4QY5 A;  5M19 A;  2PD7 A;  2JKT M;  4C75 A;  4WEJ A;  3HL9 A;  5HZH A;  4K08 A;  1MPL A;  4IBX A;  5AQA A;  5AVF A;  4HBT A;  4NXG A;  1YLW A;  5HL1 A;  2WGV A;  4DXC A;  4MCW A;  1GSW A;  3N8S A;  3LUQ A;  2ZC4 B;  5FQQ A;  3G31 A;  1PFL A;  1ESI A;  2VGL M;  4O0P A;  5FAS A;  4B93 A;  1K0K A;  4FOF A;  1K55 A;  4II7 A;  5FAT A;  4ZBE A;  4CLC A;  4IJG A;  1PI4 A;  1MXO A;  3AGD A;  1K55 C;  3NJA A;  2W0N A;  3S22 A;  2ZOH A;  5FL3 A;  3FKV A;  1LL9 A;  5CHJ A;  4EBP A;  4BL3 A;  2BG1 A;  3QNC A;  4GOG A;  5CRF A;  3LI8 A;  4G3W A;  3KYE A;  5KSC A;  5F68 A;  1KE4 A;  3HJK A;  4RA7 A;  1E3U D;  4B9O A;  4E3M A;  4GCZ A;  2WAE A;  3SS4 A;  4JF4 A;  3BFC A;  3G32 A;  3UE3 A;  3NI9 A;  5L09 A;  1YLT A;  3OC2 A;  2ZM8 A;  3A3J A;  2PU2 A;  3PAG A;  2ZC6 B;  3EEH A;  4NG2 A;  4P85 A;  1VQQ A;  1W63 M;  1TVF A;  3GTC A;  2J9P A;  3W4P A;  3TW8 A;  3B3X A;  4Y0U A;  3N7W A;  4R4R A;  1BT5 A;  1IEM A;  4LRZ E;  1JWP A;  3ZVT A;  3KX0 X;  4KG5 A;  2ZMF A;  3IH9 A;  3UB7 A;  2W3H A;  3Q81 A;  4Y5F A;  2JCH A;  4WUJ A;  5FI7 A;  3LEQ A;  1CJF A;  5L2F A;  2ZQ9 A;  4MNR A;  2XRN A;  4Y0T A;  3MBZ A;  2EXA A;  3UN7 A;  2ZL1 B;  1PW8 A;  5KZH A;  4GDB A;  1MY8 A;  1OTD A;  3FKW A;  2FFF B;  4WMC A;  3K3C A;  3UDX A;  3C38 A;  5DF9 A;  1P9W A;  2Z6C A;  3G30 A;  2GDN A;  4JBF A;  2XEP A;  1NLY A;  2K7S A;  4EET B;  4MBF A;  4D2O A;  5DF7 A;  4E3J A;  2Y2O A;  3W2Z A;  3F1N B;  1XFN A;  2Y4A A;  4PM6 A;  2PRF A;  1RP5 A;  4OON A;  2HJE A;  2BAS A;  4G3V A;  4UEY A;  3ZFZ A;  1Y4O A;  3T4K A;  1N9B A;  1OJ5 A;  4X1L A;  2HP9 A;  3C4O A;  4KZ7 A;  2VV7 A;  4OOY A;  3WS4 A;  1YMS A;  2EX6 A;  3T4L A;  2V0W A;  2WZX A;  1O7E A;  4EXO A;  2ZL1 A;  2J80 A;  4XT2 B;  3LR4 A;  4EWF A;  1FCM A;  4OQG A;  4K0W A;  4E3L A;  5F82 A;  2J3W A;  4WM9 A;  3P98 A;  3Q82 A;  1T19 A;  1VET B;  5TBM B;  3PR6 A;  2IWC A;  4P87 A;  4PAU A;  2WKI A;  3IT9 A;  4Y15 A;  3Q7V B;  5FAQ A;  3JVU A;  2ZD8 A;  3HRE A;  1AWI A;  1CF0 A;  5DF8 A;  2WK0 A;  3MZF A;  3M2K A;  3GQZ A;  3F1N A;  5J7E A;  4FTX A;  1K4E A;  1JVJ A;  2YKF A;  3QNB A;  3ULF A;  4S2M A;  2PT7 A;  1OJG A;  1VB6 A;  3CLO A;  5CED A;  3PBN A;  4DKI A;  2A2L A;  2HDU A;  3NBL A;  1XX2 A;  2G2W A;  4XT2 A;  1SCW A;  2ZBB A;  5AJG A;  1BUL A;  1VET A;  5TBM A;  1K57 A;  5FSR A;  2V8C A;  2H0T A;  1OTI A;  1MWU A;  4YIN A;  1K57 C;  3PBT A;  5A8B A;  3HLG A;  5BOH A;  1OPX A;  2DNS A;  1YSQ A;  3HUN A;  3CUE A;  4FD8 A;  1HVB A;  4E6X A;  3T4O A;  5J3W A;  1N9N A;  3CUE C;  3E4P A;  1PYY A;  3OCN A;  1N9L A;  4NK3 A;  1RGZ A;  1NYY A;  2W1T B;  3QHY A;  2NUP C;  5GLD A;  4QHC A;  4HIA A;  1ES2 A;  4PKY G;  5J8X A;  1YAX A;  3QP8 A;  3FC7 A;  4ID4 A;  1XP4 A;  3LYX A;  3IS2 B;  5DTK A;  5FQJ A;  5HPF A;  2YKH A;  3K3D A;  1E3U A;  1IYS A;  3T50 A;  1F5M A;  4MBK A;  1ESU A;  5DVA A;  2H28 A;  4EEP A;  1JNU A;  3C7U A;  3LCE A;  4JGQ A;  3S7P A;  3FPW A;  5HL6 A;  3WWX A;  4JF5 A;  5HDD A;  4S2N C;  5EUA A;  1PWD A;  1VM1 A;  1K56 D;  3CAX A;  2A24 A;  4I39 A;  2ZQD A;  2UWX A;  4DE2 A;  1KDS A;  3DTK A;  1NZU A;  1TS0 A;  4OOM A;  5GHY A;  3ITB A;  5MC7 A;  5EVE A;  5TR7 A;  2JN7 A;  5EVL A;  2INW A;  5HW3 A;  3G34 A;  4GS9 B;  1GSX A;  4D60 A;  3V39 A;  4NKP A;  3H9W A;  2C6W B;  4X6T A;  3O88 A;  3E98 A;  1ERQ A;  1KVM A;  3NOP C;  1TS6 A;  4OPZ A;  3H82 B;  1W79 A;  4PMA A;  2GX5 A;  3CJM A;  3MS6 A;  1KGF A;  3BEC A;  4ZTK A;  4GZB A;  3D9Y A;  3ZCZ A;  2V1A A;  2JKR I;  2Y2K A;  4NXE A;  1FIK A;  1O07 A;  2HDR A;  5G4Z A;  2P7J A;  1A0K A;  4UA7 A;  2JC7 A;  3DAV A;  1WYB A;  1K25 A;  2G7U A;  4ZJ2 A;  4JXV A;  3N6I A;  3KSG A;  3UPO A;  1KE3 A;  2XRO A;  1N9O A;  1SDE A;  2WGW B;  4JXS A;  4UA9 A;  3B47 A;  2VZW A;  5EVI D;  3UE0 A;  2L4R A;  3TG9 A;  4Z9Q A;  4WZ5 A;  4GS9 A;  1MC0 A;  3PBO A;  3BFE A;  4JF6 A;  3PAE A;  1W63 Q;  4JKT A;  3VP3 A;  4WN5 A;  2KLI A;  5CEC A;  2GZA A;  2ZQ7 A;  1GA9 A;  2WKQ A;  4GHI B;  4EEU A;  3H82 A;  3VE4 A;  4OLG A;  5FQK A;  4HH3 A;  2V1B A;  2Y2Q A;  4PPR A;  4UAA A;  4HQA A;  4OH0 A;  2Q9N A;  3NOT C;  3D72 A;  4GB7 A;  4OQH A;  1L0D A;  3F1P B;  4ETX A;  2L0W A;  5JYP A;  3PYP A;  5F1F A;  4KQD A;  5CGW A;  1F98 A;  2B02 A;  3DTI A;  2VGL S;  3TE8 A;  1T1A A;  3RXW A;  4R3J A;  3G6O A;  2VLG A;  1S67 L;  1KDW A;  3E2L A;  3OPL A;  3HLD A;  2Q0O A;  2P08 A;  2WGW A;  4A5R A;  4QJG A;  5AQ9 A;  2ZC5 B;  2XLN A;  2HPB A;  5HAR A;  4UQI M;  1STZ A;  2QJ5 A;  4HY8 A;  3ICY A;  3JPU A;  3W4O A;  1LLB A;  3UMD A;  2ZQC A;  2XF3 A;  4KZ9 A;  3MXQ A;  4Y2F A;  4WL9 A;  5EOE A;  2V1Z A;  4GHI A;  5FQ9 A;  3K2N A;  2XD1 A;  4BBV A;  3NDE A;  3LR3 A;  2WZZ A;  2K2N A;  2GNX A;  5HDC A;  3UO9 A;  4DXB A;  1FSW A;  3T1Q B;  1SHV A;  4I5S A;  3F1P A;  1T18 A;  2DMW A;  2KX6 A;  3NOU C;  4NXB A;  5EE8 A;  5GHX A;  4L0L A;  4HJ4 A;  3IXB A;  4UA6 A;  4CLC B;  5DKL A;  1PIO A;  3A3I A;  5JYO A;  2G2U A;  1Z09 A;  2XA7 M;  3N8R A;  3UB8 A;  3ZYT A;  1XA1 A;  2PDR A;  2WGI A;  2B5R A;  3ZVW A;  1S4S A;  1QMF A;  3NUL A;  4GDN A;  3ITA A;  2KOI A;  3JVV A;  1P9R A;  3LEZ A;  4EES A;  2Y2L A;  5GLC A;  1ES5 A;  3NCK A;  4R70 A;  3N4I A;  5HAP A;  4EW7 A;  3MJQ A;  5HAQ A;  4LLO B;  1Y28 A;  2PR5 A;  2W1R A;  4N9L A;  2PBY A;  5CGS A;  4JGP A;  1N4O A;  5KSH A;  1ZC2 A;  5C5K A;  4JGR A;  3SS3 A;  5FEG A;  3BJN A;  2CC1 A;  4IVI A;  2PHY A;  1L0F A;  2VX8 A;  2GJ3 A;  4HJ3 A;  1OT6 A;  4X25 A;  5U47 A;  4X55 A;  5HDS A;  5TJJ A;  2O9A A;  4GD6 A;  1SKO B;  3O3V A;  4LV1 A;  3P7N A;  4YNR A;  4CLC C;  4RQ9 A;  3UE1 A;  3S7N A;  3CG5 A;  4CLC E;  1LL8 A;  5EPH A;  5GLB A;  4KQQ A;  2XQZ A;  3CPT B;  3DW0 A;  2XH9 A;  4HI4 A;  3BWL A;  2HF6 A;  3VP4 A;  3MKF A;  3E2K A;  3S7O A;  2ZM2 A;  3VP1 A;  1BUE A;  3BM6 A;  3T1X A;  5KIZ A;  3P09 A;  4WF0 A;  1M6K A;  1YT4 A;  3VOL A;  3V3S A;  3UDI A;  4N1H A;  4HOI A;  1HTZ A;  3GV9 A;  2C5W B;  1W8Y A;  1YLZ A;  1K54 A;  1AXB A;  3B42 A;  3SZT A;  3BLM A;  1SKO A;  1K54 C;  1BSG A;  4MN7 A;  2FFY A;  4WLA A;  4Y7P A;  2V20 A;  1ACF A;  4MLL A;  4HBU A;  3CPT A;  3IXH A;  4JGO A;  4P6Z M;  3HJI A;  4X53 A;  3CIT A;  4X68 A;  4WYY A;  3BYD A;  4KZ3 A;  4LV0 A;  3IBJ A;  1KGE A;  1Z6F A;  3CMZ A;  1VEU B;  3MFX A;  5HWV A;  1ERO A;  2E8J A;  3L7H A;  3MFD A;  4E3K A;  3NY4 A;  5IT5 A;  4M3K A;  4OQ0 A;  1D06 A;  5E2F A;  1G5U A;  3C7V A;  4AFI A;  1S1Z A;  1X0O A;  4BLM A;  1LL5 A;  3UDF A;  4BD1 A;  4L9F A;  3ZDJ A;  5I5L A;  5F5Y A;  3IH8 A;  3BEB A;  4ZJ1 A;  1XFQ A;  3QP1 A;  5L07 A;  1IYO A;  2VV8 A;  2ZQ8 A;  2Y2G A;  2A3U A;  4XUZ A;  3TOI A;  3MMH A;  1PWC A;  1YQS A;  1UWP X;  4NET A;  4F94 A;  1G6O A;  1H3Q A;  2RCX A;  3C2W A;  4RX3 A;  4O8G A;  2OAP 1;  3QP6 A;  5F69 A;  2JKT I;  1SZV A;  1Y54 A;  4MEZ A;  3KYZ A;  5DKK A;  5FQM A;  3HUO A;  1VEU A;  1ERM A;  4ME4 A;  1LSW A;  2WAF A;  4BEN A;  4UHU A;  5CHM A;  3ZG7 B;  3LIE A;  5E2G A;  5J4E A;  4Q0J A;  3IF6 B;  3DBA A;  5G4Y A;  3PXP A;  3KSF A;  5FAO A;  4PM5 A;  2O0Y A;  2IWB A;  5DFX A;  4Y13 A;  3RFB A;  1FCO A;  3UE6 A;  2WKP A;  1NWZ A;  3CHW P;  3S7Q A;  1WYC A;  3ZG5 A;  2EX2 A;  1G68 A;  3V5M A;  3RH8 B;  2WKH A;  4DDS A;  4QU3 A;  3ZG8 B;  4JLF A;  3LGO A;  2XFT A;  5A91 A;  1DY6 A;  1UGU A;  2W3D A;  2CMN A;  4EQI A;  1GHP A;  3BW6 A;  1U60 A;  3ZNY A;  2FZ0 A;  2W3G A;  3BLS A;  2XD5 A;  5FI6 A;  2A24 B;  3G4P A;  3O86 A;  2EXB A;  4BL2 A;  3OZH A;  4DRT A;  5HWW A;  3IF6 A;  2HP5 A;  2WYX A;  1TD5 A;  3FG8 A;  3SH7 A;  5HX9 A;  2A49 A;  3G2Y A;  3IF6 C;  3Q7Z A;  3W8K A;  3EWK A;  3D4F A;  3M6H A;  5E43 A;  3UNW A;  1E4D A;  2P74 A;  3NIA A;  4EQ1 A;  3VP2 A;  4HP4 A;  3V50 A;  3FZC A;  4I3J A;  3ZGA B;  3A3E A;  3S1Y A;  5HSQ A;  4DJ3 A;  2XDM A;  3T4S A;  5F6A A;  4KZA A;  2J9O A;  4Y0O A;  2Z2L B;  3LO7 A;  3PTE A;  2J7V A;  5GHZ A;  1F9I A;  4XXR A;  4CPK A;  4GLQ A;  4IHQ A;  4KG6 A;  4EV4 A;  3MZE A;  1OME A;  1H5X A;  2H5S A;  4HNB A;  2VJW A;  1K4F A;  3G35 A;  1NRF A;  2J3T D;  4QD4 A;  1ES4 A;  4LV3 A;  4CJN A;  3Q1F A;  4E3O A;  4IUK A;  1XKZ A;  1IFQ A;  2PU4 A;  1L3L A;  3OPP A;  4MN5 A;  5CHU A;  2XK1 A;  3LR5 A;  4BJP A;  3KSH A;  5HD5 A;  4UQI S;  4EU0 A;  3GEC A;  2QWS A;  4S2I A;  1S4R A;  4PHT A;  4LFU A;  4HP9 A;  1PNE A;  1DJB A;  2HZ5 A;  3A0S A;  1IOU A;  3GMW A;  2ZMA A;  2XR0 A;  3F1O B;  1PRQ A;  1ZTU A;  1ALQ A;  4O01 A;  3B33 A;  1JTG A;  3PBS A;  2Y79 A;  4X69 A;  2EFX A;  4OVD A;  2ZMV A;  1F2K A;  3VOY A;  4Q0I A;  4R0Q A;  1L2S A;  1EI5 A;  4LCL A;  1PW1 A;  5FAP A;  1QME A;  3DTE A;  4GJ4 A;  1DRM A;  2ZC7 A;  3FYZ A;  1RCJ A;  3HLW A;  4HHD A;  4KUO A;  3UB5 P;  2XA7 S;  1K38 A;  3DWK A;  3IQA A;  3EQU A;  4WZ5 C;  5L8M A;  1XJ2 A;  4GN2 A;  3EGX C;  3A3F A;  3U4L P;  2L1M A;  1KOU A;  1EWZ A;  1ZG6 A;  1OTE A;  2OSU A;  2P9V B;  1XXM A;  2VGJ A;  3HLC A;  4BQM A;  3IHA A;  4M4X A;  2PBD P;  3A0V A;  2VA0 A;  3F1O A;  4B4Z A;  4FCF A;  4BBT A;  1ZG4 A;  3UPP A;  5IU1 A;  1LI0 A;  4ZDX A;  4QPR A;  3VSK A;  3P01 A;  4IED A;  3T1S A;  4XUX A;  2M7V A;  2Z2M B;  4WMC D;  2JHE A;  4OOL A;  4DDY A;  5FDS A;  4KZ8 A;  5D3O A;  3MKE A;  4Q0H A;  5M18 A;  4P0M A;  3T12 B;  5EEC A;  4R4S A;  3AGF A;  5CEB A;  3HBR A;  4EBL A;  3NC8 A;  4R1G A;  5EV0 A;  2VEA A;  1UWN X;  4U0T A;  2E8I A;  1OT9 A;  2M1C A;  2JKF A;  2ZOI A;  3LY4 A;  1LHY A;  1IEL A;  1YLP A;  3LY3 A;  4S2P A;  2P9V A;  5EM1 A;  2QKP A;  3LID A;  4GW9 A;  4GKU A;  3WS0 A;  4Y17 A;  4ETZ A;  3VE3 A;  1CI9 A;  4N92 A;  2HJ9 C;  1XJ4 A;  1H8Y A;  3ZHH A;  3EGD C;  2QYB A;  5GL9 A;  2P04 A;  4GD8 A;  4OPY A;  3FPV A;  1FIL A;  4Q8I A;  4JXG A;  2EWW A;  5A90 A;  3T4T A;  1HZO A;  2PYP A;  2HDQ A;  1KVL A;  3EEA A;  1KE0 A;  3VP0 A;  2OV5 A;  2DRW A;  4R3B A;  3R7W A;  3RTY A;  2X02 A;  1D1J A;  2BTF P;  4P6Z S;  4MN6 A;  4GNU A;  3HLF A;  3LR0 A;  1CQA A;  3NEC A;  3GDI A;  3UB6 A;  4OPQ A;  1GCE A;  3R4K A;  1ODV A;  2WKR A;  1IYQ A;  5AVE A;  3OPR A;  1K56 A;  4YOF A;  2NUT C;  5TGF A;  2X71 A;  4MMN A;  2LB9 A;  3NDG A;  5EOO A;  4S2K A;  3BFD A;  3IXD A;  4I3A A;  3E0Y A;  1GHI A;  3ZG0 A;  4S2O A;  5AQ7 A;  1MWS A;  3C30 A;  1XA7 A;  4KZ6 A;  4JXW A;  5EVI B;  1FCN A;  4ZRR A;  2BLS A;  4R38 A;  4BD0 A;  2IWD A;  4X1M A;  4C3Q A;  5HPI A;  4DF6 A;  2Y91 A;  3SH9 A;  3UME A;  4E3I A;  2ZQA A;  4IBR A;  1ONG A;  1LSX A;  1H8Z A;  2ZM0 A;  3GSG A;  3T1R A;  1BYW A;  2LB5 A;  2O9C A;  4H8R A;  1J9M A;  3MSH A;  3HLE A;  1FSY A;  2QHK A;  4PM7 A;  4OP8 A;  4LRY C;  1YSP A;  1MWR A;  1YLJ A;  2VKS A;  1S66 L;  1K6R A;  4E04 A;  2WAD A;  2OOL A;  3E4Q A;  2OAQ 1;  4LRX C;  2Y8H A;  4PM9 A;  1D7E A;  5K5B A;  1MZU A;  3WRT A;  3T4Q A;  4DE1 A;  4MDZ A;  1H8M A;  1VHM A;  5EVI A;  3WS1 A;  1HLU P;  2XGN A;  5EVI C;  1IKG A;  1PZO A;  2H10 A;  3ISG A;  3IXG A;  1P0Z A;  3VFH A;  1G6A A;  2I72 A;  1JWZ A;  3VSL A;  3QP4 A;  4FH2 A;  3L9K A;  3OOV A;  3BQ8 A;  1RGY A;  4X56 A;  4OQI A;  3MR0 A;  3MF0 A;  5IS1 A;  2QPN A;  1GSV A;  3HUM A;  1YKD A;  2Y59 A;  2EX8 A;  4LGW A;  3HVF A;  4QWO A;  3VOZ A;  2Y2H A;  5E2H A;  2R9X A;  4CQH A;  5TFQ A;  1ONH A;  1LT0 A;  1GHM A;  4R3A A;  2JBF A;  3SW1 A;  1S1Y A;  3ZQ5 A;  3EOI A;  1L0E A;  4R23 A;  3N8L A;  4KQR A;  3M2J A;  2VGK A;  3M6B A;  3MZD A;  2B18 A;  1ES3 A;  2W27 A;  3BFG A;  1TEM A;  3T4J A;  3MXR A;  4ESP A;  2ZJ9 A;  1DP6 A;  4DE3 A;  4YWZ A;  1SKF A;  4N9K A;  5DTT A;  2J8Y A;  4KZ4 A;  1NRJ A;  1G28 A;  2VV6 A;  1NJ4 A;  1JTD A;  4EUZ A;  1ZKJ A;  4DE0 A;  4WBG A;  3W4Q A;  5LBR A;  3V3R A;  4N1X A;  1BLH A;  3IHB A;  3MXS A;  4WEK A;  1Q2Q A;  4E3N A;  2MJ6 A;  3HCY A;  1C3B A;  4OKP A;  1NYM A;  4KQO A;  4U0X A;  2JKR M;  1MKI A;  4U3T A;  2R78 A;  2Y2I A;  4G3K A;  3BRM A;  1WA9 A;  2WUQ A;  5CGX A;  5CXW A;  4DMZ A;  1YMX A;  2PYR A;  3PBQ A;  5HFO A;  3IX8 A;  3TRC A;  3QP5 A;  2D02 A;  4E6W A;  2PR6 A;  2Y2N A;  4ZAM A;  3TJZ C;  1BLS A;  2HGV A;  2V9A A;  1PI5 A;  3LIF A;  5FQI A;  3Q07 A;  3RJU A;  1T1B A;  4HES A;  1W7F A;  1I2S A;  2XSS A;  1I5Q A;  1L0G A;  4NEE D;  5A92 A;  5FA7 A;  2EWV A;  2ACG A;  4LV2 A;  1PWG A;  1DP8 A;  3C8C A;  5CER A;  4BBU A;  4S2L A;  4OP5 A;  1M40 A;  5HWT A;  4K0X A;  4EER A;  4PKY A;  2X01 A;  2B95 A;  1LSV A;  3Q7V A;  1WE4 A;  4NXF A;  5CX7 A;  3AGE A;  4L9E A;  3NHQ A;  2OLU A;  1S6R A;  3LI9 A;  3IWO A;  5L10 A;  2V0U A;  1KGG A;  4KEN B;  4H6J B;  3A0R A;  5HAI A;  2PAV P;  2OLV A;  1YLY A;  4I38 A;  4LPZ A;  4B4X A;  3H7W B;  3SH8 A;  1V9Z A;  3CWF A;  3CI6 A;  2Y2M A;  2K31 A;  1FR6 A;  3FV7 A;  1NXY A;  3GRJ A;  1MKM A;  5DJU A;  1NY0 A;  5G18 A;  1YPR A;  3IX4 A;  3LIB A;  5KMW A;  1TS8 A;  2UV0 E;  3IWI A;  5FI2 A;  4PM8 A;  1YM1 A;  3ZG9 B;  4S2N A;  1NZO A;  3GVB A;  5EM0 A;  4F3L B;  2QZ6 A;  1IYP A;  5HD3 A;  3DTM A;  2JE5 A;  4KG2 A;  3WS5 A;  5FEF A;  5CTN A;  4FUW A;  2EA9 A;  3U2A A;  2EFU A;  1OTB A;  5CTM A;  1E25 A;  5EFW A;  1JWV A;  2W3E A;  5F83 A;  4Z1W A;  2W1T A;  4C6Y A;  4O7D A;  3UPN A;  3BY9 A;  4H6J A;  2HP6 A;  1XJ6 A;  3FWL A;  4RYE A;  3MQO A;  3BY8 A;  4MBH A;  2RL3 A;  3SOI A;  2DCF A;  1H0M A;  4WEL A;  4S2J A;  3LIC A;  1TF1 A;  2FH5 A;  3OLO A;  5M1A A;  4CLC D;  3H7W A;  1NLZ A;  2Z6D A;  3IS2 A;  2WKE A;  3WS2 A;  2AVX A;  4ARZ B;  3TSG A;  4KUK A;  1XJ3 A;  3IBR A;  4RVA A;  1I2W A;  3O87 A;  3RXX A;  4BMW A;  1Q2P A;  1DP9 A;  4ZJ3 A;  3HLB A;  1P97 A;  1BLC A;  1TDL A;  4F3L A;  2JKG A;  3G2Z A;  3PHY A;  5DJT A;  3OPH A;  2QMI A;  3MQ0 A;  2H0Y A;  3IWQ A;  2Y2J A;  4BWI A;  3UB9 A;  1W5D A;  3ZNT A;  2D01 A;  1HD8 A;  2EX9 A;  1CI8 A;  1XGI A;  2QJ7 A;  4WZ4 A;  1GA0 A;  3CZD A;  5A93 A;  4R6L A;  4FH4 A;  4IVK A;  3VMA A;  2PD8 A;  3KSI A;  5F1G A;  3E4O A;  1MWT A;  4ARZ A; 
#chains in the Genus database with same CATH homology
 4KZ6 A;  5DTK A;  4JXW A;  5EVI B;  5FQJ A;  1FCN A;  5FDH A;  1E3U A;  2BLS A;  3GR2 A;  3IH8 A;  1IYS A;  4BD0 A;  2IWD A;  3BEB A;  4C3Q A;  4MBK A;  4DF6 A;  1ESU A;  2R9W A;  2Y91 A;  5DVA A;  4ZJ1 A;  3SH9 A;  1K6S A;  1IYO A;  4E3I A;  2ZQ8 A;  1IKI A;  2Y2G A;  2ZQA A;  1S0W A;  2A3U A;  4IBR A;  4XUZ A;  1ONG A;  3C7U A;  3TOI A;  3I7J A;  5I94 A;  1H8Z A;  3JYI A;  3LCE A;  5E43 A;  1PWC A;  2ZM0 A;  3GSG A;  1YQS A;  3WWX A;  1MBL A;  4NET A;  4F94 A;  4JF5 A;  2RCX A;  4RX3 A;  4S2N C;  4B88 A;  5EUA A;  4H8R A;  4LCM A;  1PWD A;  1VM1 A;  1J9M A;  1SDN A;  1Y54 A;  3S4X A;  1K56 D;  4MEZ A;  1FQG A;  2V2F F;  3HLE A;  4OPR A;  1FSY A;  2ZQD A;  2UWX A;  4PM7 A;  4OP8 A;  5FQM A;  3HUO A;  1ERM A;  2Y55 A;  1MWR A;  5E2E A;  1YLJ A;  2WAF A;  1K6R A;  4DE2 A;  1KDS A;  4BEN A;  2WAD A;  4QB8 A;  4UHU A;  1NZU A;  4OOM A;  5GHY A;  5CHM A;  4KZ5 A;  3ZG7 B;  3ITB A;  3PBR A;  5E2G A;  2Q9M A;  1CEG A;  5TR7 A;  3IF6 B;  4PM9 A;  5EVL A;  5HW3 A;  1XGJ A;  3OCL A;  3WRT A;  3G34 A;  5AQB A;  3VFF A;  4DE1 A;  5FAO A;  3V39 A;  4PM5 A;  5EVI A;  3C4P A;  3WS1 A;  2IWB A;  2XGN A;  3EQV A;  4P6B A;  2C6W B;  4X6T A;  3O88 A;  1FCO A;  4HEF A;  1ERQ A;  1CK3 A;  1KVM A;  2Y2P A;  5EVI C;  1WYC A;  1IKG A;  3ZG5 A;  2EX2 A;  1PZO A;  4OPZ A;  1G68 A;  2H10 A;  3ISG A;  3V5M A;  1W79 A;  3IXG A;  2ZLY A;  2WKH A;  3SS5 A;  4PMA A;  4K91 A;  4DDS A;  3VFH A;  4QU3 A;  1G6A A;  2I72 A;  3ZG8 B;  4RX2 A;  3A3D A;  4JLF A;  2XFT A;  4LEN A;  1JWZ A;  5A91 A;  3VSL A;  1DY6 A;  3CJM A;  3DWZ A;  4FH2 A;  1KGF A;  3BEC A;  4ZTK A;  2HDS A;  4GZB A;  3ZCZ A;  3WRZ A;  1RGY A;  4X56 A;  4OQI A;  1TDG A;  4EQI A;  1GHP A;  2Y2K A;  4JPM A;  1FR1 A;  1PZP A;  1W8Q A;  1O07 A;  2HDR A;  1U60 A;  2QPN A;  3ZNY A;  4EBN A;  1DJC A;  4UA7 A;  2JC7 A;  3HUM A;  5IHV A;  2Y59 A;  1BTL A;  3IF5 A;  1WYB A;  4YFM A;  3UY6 A;  3BLS A;  2EX8 A;  2XD5 A;  1K25 A;  3BFF A;  5FI6 A;  4ZJ2 A;  4JXV A;  3N6I A;  3HVF A;  3UPO A;  3G4P A;  3O86 A;  4KZB A;  4OLD A;  2EXB A;  3VOZ A;  1KE3 A;  4BL2 A;  2Y2H A;  3OZH A;  1FOF A;  2XFS A;  1SDE A;  4DRT A;  1XPB A;  2WGW B;  3IF6 A;  2HP5 A;  1BLP A;  2R9X A;  2WYX A;  4JXS A;  4UA9 A;  5E2H A;  5EVI D;  1ONH A;  5GLA A;  5TFQ A;  3UE0 A;  1CEF A;  3TG9 A;  1GHM A;  4Z9Q A;  4WZ5 A;  4QY6 A;  2JBF A;  3PBO A;  5HX9 A;  3SH7 A;  2ZC3 B;  3BFE A;  2A49 A;  3G2Y A;  3IF6 C;  3Q7Z A;  1L0E A;  5DTS A;  3W8K A;  1LI9 A;  1BZA A;  3C5A A;  3D4F A;  3M6H A;  3N8L A;  4FSF A;  3PAE A;  1E4D A;  2P74 A;  4JF6 A;  1DJA A;  3NIA A;  4JKT A;  4QY5 A;  4KQR A;  3VP3 A;  3VP2 A;  5M19 A;  3M2J A;  3V50 A;  2VGK A;  3M6B A;  4C75 A;  5CEC A;  4WEJ A;  3FZC A;  3HL9 A;  2ZQ7 A;  1GA9 A;  3MZD A;  1MPL A;  4IBX A;  3ZGA B;  3A3E A;  5AQA A;  1ES3 A;  3S1Y A;  3BFG A;  1TEM A;  2XDM A;  3MXR A;  4OLG A;  4HBT A;  2ZJ9 A;  5FQK A;  4KZA A;  4DE3 A;  1YLW A;  5HL1 A;  2J9O A;  2WGV A;  1SKF A;  4DXC A;  2Y2Q A;  4PPR A;  4Y0O A;  2Z2L B;  4UAA A;  3LO7 A;  3N8S A;  2J7V A;  3PTE A;  5GHZ A;  4N9K A;  5DTT A;  4OH0 A;  2ZC4 B;  4XXR A;  5FQQ A;  3G31 A;  2J8Y A;  4CPK A;  2Q9N A;  1ESI A;  4KZ4 A;  4GB7 A;  1NJ4 A;  1L0D A;  4OQH A;  4KG6 A;  5FAS A;  4EV4 A;  3MZE A;  1OME A;  5JYP A;  1H5X A;  2H5S A;  5F1F A;  5CGW A;  1K4F A;  1K55 A;  3G35 A;  4ZBE A;  5FAT A;  1JTD A;  4EUZ A;  1ZKJ A;  4DE0 A;  1NRF A;  4WBG A;  3W4Q A;  1PI4 A;  3V3R A;  1MXO A;  4QD4 A;  1ES4 A;  4N1X A;  4R3J A;  3RXW A;  1BLH A;  4LV3 A;  3AGD A;  3IHB A;  1K55 C;  1KDW A;  3E2L A;  3S22 A;  3MXS A;  3OPL A;  4WEK A;  3FKV A;  4CJN A;  1LL9 A;  3HLD A;  5CHJ A;  3Q1F A;  4E3O A;  4EBP A;  1Q2Q A;  4BL3 A;  2WGW A;  4E3N A;  2BG1 A;  3QNC A;  4GOG A;  1C3B A;  5CRF A;  4A5R A;  5AQ9 A;  2ZC5 B;  4QJG A;  1XKZ A;  2XLN A;  2HPB A;  4OKP A;  1NYM A;  2PU4 A;  5HAR A;  5KSC A;  3OPP A;  5CHU A;  4KQO A;  2XK1 A;  4BJP A;  3W4O A;  1KE4 A;  1LLB A;  2ZQC A;  4RA7 A;  4U0X A;  1E3U D;  1MKI A;  2XF3 A;  4U3T A;  4KZ9 A;  5EOE A;  2Y2I A;  4E3M A;  2V1Z A;  3BRM A;  2WAE A;  3SS4 A;  4S2I A;  4JF4 A;  5FQ9 A;  3BFC A;  3G32 A;  2XD1 A;  2WUQ A;  3NI9 A;  5CGX A;  5CXW A;  3UE3 A;  1YLT A;  3OC2 A;  3NDE A;  2WZZ A;  1DJB A;  1YMX A;  2ZM8 A;  3PBQ A;  3A3J A;  2PU2 A;  3PAG A;  5HFO A;  2ZC6 B;  4E6W A;  4P85 A;  3UO9 A;  4DXB A;  1VQQ A;  2Y2N A;  1TVF A;  3GTC A;  2J9P A;  1FSW A;  3W4P A;  4ZAM A;  3B3X A;  1BLS A;  3N7W A;  4Y0U A;  4R4R A;  1BT5 A;  1SHV A;  1PI5 A;  1IEM A;  3GMW A;  5FQI A;  1JWP A;  3ZVT A;  2ZMA A;  3Q07 A;  4KG5 A;  2XR0 A;  3IH9 A;  3RJU A;  4HES A;  3Q81 A;  5EE8 A;  5GHX A;  2JCH A;  5FI7 A;  1W7F A;  1ALQ A;  4L0L A;  5L2F A;  1I2S A;  1JTG A;  3PBS A;  3IXB A;  1I5Q A;  4UA6 A;  2ZQ9 A;  4X69 A;  1L0G A;  2EFX A;  5A92 A;  4OVD A;  4MNR A;  5FA7 A;  1PIO A;  4Y0T A;  3A3I A;  5JYO A;  3VOY A;  4LV2 A;  2G2U A;  3MBZ A;  4R0Q A;  2EXA A;  1L2S A;  1EI5 A;  4LCL A;  3UN7 A;  1PW1 A;  5FAP A;  3N8R A;  1PWG A;  1QME A;  2ZC7 A;  5CER A;  1PW8 A;  1RCJ A;  1XA1 A;  3FYZ A;  3HLW A;  5KZH A;  4GDB A;  1MY8 A;  4S2L A;  2WGI A;  4OP5 A;  1M40 A;  3FKW A;  2B5R A;  2FFF B;  3ZVW A;  1QMF A;  4GDN A;  4WMC A;  4K0X A;  2X01 A;  3ITA A;  1K38 A;  3Q7V A;  3DWK A;  1WE4 A;  3UDX A;  3IQA A;  5DF9 A;  3LEZ A;  2Y2L A;  5GLC A;  3EQU A;  3G30 A;  2GDN A;  1ES5 A;  3NCK A;  4WZ5 C;  4JBF A;  3AGE A;  2OLU A;  1S6R A;  3N4I A;  5HAP A;  3IWO A;  2XEP A;  5HAQ A;  1KGG A;  4GN2 A;  4KEN B;  3A3F A;  4MBF A;  4D2O A;  5DF7 A;  1EWZ A;  1ZG6 A;  5HAI A;  4N9L A;  4E3J A;  2OSU A;  2PBY A;  2P9V B;  5CGS A;  1N4O A;  1XXM A;  5KSH A;  2Y2O A;  2VGJ A;  1ZC2 A;  3HLC A;  2OLV A;  3SS3 A;  4BQM A;  2Y4A A;  4PM6 A;  1YLY A;  3IHA A;  1RP5 A;  2CC1 A;  4IVI A;  4OON A;  1L0F A;  4B4X A;  4B4Z A;  3SH8 A;  3ZFZ A;  2Y2M A;  4FCF A;  1FR6 A;  3FV7 A;  5U47 A;  1NXY A;  4X55 A;  1ZG4 A;  1N9B A;  3GRJ A;  3UPP A;  2HP9 A;  1NY0 A;  3C4O A;  4GD6 A;  1LI0 A;  4KZ7 A;  3O3V A;  4OOY A;  5G18 A;  4LV1 A;  4ZDX A;  3WS4 A;  3VSK A;  1YMS A;  4IED A;  2EX6 A;  5KMW A;  4XUX A;  2WZX A;  1O7E A;  2Z2M B;  4WMC D;  3IWI A;  5FI2 A;  4OOL A;  4DDY A;  3UE1 A;  4PM8 A;  4KZ8 A;  1YM1 A;  3ZG9 B;  4EWF A;  4S2N A;  1NZO A;  3GVB A;  1FCM A;  3CG5 A;  4OQG A;  5D3O A;  4K0W A;  5EPH A;  5F82 A;  4KQQ A;  3MKE A;  5GLB A;  4E3L A;  5M18 A;  2XQZ A;  4P0M A;  4WM9 A;  3P98 A;  3Q82 A;  5EEC A;  2QZ6 A;  1IYP A;  3AGF A;  2XH9 A;  3DW0 A;  4R4S A;  5CEB A;  3HBR A;  3DTM A;  2IWC A;  2JE5 A;  4KG2 A;  4P87 A;  3WS5 A;  3NC8 A;  4EBL A;  5CTN A;  3VP4 A;  4R1G A;  3MKF A;  3E2K A;  2ZM2 A;  3VP1 A;  1BUE A;  2WKI A;  3IT9 A;  2EFU A;  3Q7V B;  3BM6 A;  5FAQ A;  4U0T A;  5CTM A;  1E25 A;  2E8I A;  1JWV A;  2ZD8 A;  3HRE A;  5F83 A;  4C6Y A;  3P09 A;  4O7D A;  3UPN A;  2HP6 A;  3FWL A;  5DF8 A;  3LY4 A;  1LHY A;  1M6K A;  1YT4 A;  1IEL A;  4RYE A;  1YLP A;  4MBH A;  2RL3 A;  3LY3 A;  2WK0 A;  3MZF A;  2P9V A;  3M2K A;  4S2P A;  3SOI A;  3V3S A;  3UDI A;  2DCF A;  3GQZ A;  4N1H A;  4WEL A;  4S2J A;  1HTZ A;  3GV9 A;  4R23 A;  1K4E A;  2C5W B;  4GKU A;  3WS0 A;  5M1A A;  1W8Y A;  1CI9 A;  1JVJ A;  1YLZ A;  1K54 A;  1AXB A;  2WKE A;  4N92 A;  3QNB A;  4S2M A;  3WS2 A;  3BLM A;  1H8Y A;  1K54 C;  3ZHH A;  3TSG A;  1BSG A;  2FFY A;  5CED A;  4RVA A;  3PBN A;  5GL9 A;  4DKI A;  1I2W A;  2HDU A;  4Y7P A;  2V20 A;  1XX2 A;  3NBL A;  3O87 A;  4GD8 A;  2G2W A;  4OPY A;  3RXX A;  1SCW A;  4Q8I A;  1Q2P A;  4JXG A;  4MLL A;  4ZJ3 A;  3HLB A;  4HBU A;  5A90 A;  1BLC A;  3IXH A;  1HZO A;  1BUL A;  1TDL A;  1K57 A;  5FSR A;  2HDQ A;  1KVL A;  4X53 A;  2H0T A;  4X68 A;  1MWU A;  4YIN A;  4WYY A;  1KE0 A;  3G2Z A;  3VP0 A;  2OV5 A;  2DRW A;  4R3B A;  3BYD A;  1K57 C;  3OPH A;  3PBT A;  4KZ3 A;  4LV0 A;  2QMI A;  2X02 A;  3HLG A;  2H0Y A;  5BOH A;  2DNS A;  3HUN A;  4FD8 A;  4GNU A;  3IWQ A;  3HLF A;  1KGE A;  1HVB A;  1Z6F A;  2Y2J A;  3UNW A;  3CMZ A;  1W5D A;  4E6X A;  3ZNT A;  4OPQ A;  1HD8 A;  2EX9 A;  1CI8 A;  1IYQ A;  1GCE A;  1ERO A;  1PYY A;  1RGZ A;  1XGI A;  3OCN A;  3OPR A;  1K56 A;  1NYY A;  4NK3 A;  4WZ4 A;  1GA0 A;  3QHY A;  3CZD A;  5A93 A;  4FH4 A;  5GLD A;  4QHC A;  3MFD A;  4E3K A;  3NY4 A;  5TGF A;  2X71 A;  4IVK A;  3VMA A;  3NDG A;  4M3K A;  5EOO A;  4S2K A;  3BFD A;  3IXD A;  1ES2 A;  4OQ0 A;  1GHI A;  3C7V A;  5E2F A;  3ZG0 A;  5F1G A;  4S2O A;  4BLM A;  1MWT A;  5AQ7 A;  1LL5 A;  5J8X A;  1MWS A;  3UDF A;  4BD1 A;  4ID4 A;  1XP4 A;  3ZDJ A;  1XA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...