3BFDA

Crystal structure of the class a beta-lactamase sed-g238c mutant from citrobacter sedlakii
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
DVQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGACDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class A beta-lactamase Sed1
publication title acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
total genus 97
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bfdA00
3HUNA 4RYEA 2Y2GA 3IWOA 4XXRA 2WGWB 1Q2QA 1XA7A 4K0XA 1QMEA 4NK3A 1C3BA 4WEKA 2UWXA 2R9XA 3GR2A 5CRFA 1FQGA 1L0DA 1CI9A 1BUEA 3ZGAB 3MXRA 3PBTA 4P87A 3C5AA 1GCEA 3G2ZA 2X01A 2Y2LA 3G2YA 4DE2A 4MBKA 3A3JA 3OPRA 2VGJA 3ZVTA 4ZAMA 1MWUA 2ZMAA 1RP5A 1KE4A 1YLZA 3IHBA 1BLSA 5EOEA 3SH7A 2OV5A 1IYPA 3HVFA 3P98A 1WE4A 3PBOA 4P85A 5EVIA 2XK1A 4ZJ1A 3I7JA 4LCMA 3CMZA 3N8LA 4MEZA 5FA7A 3RXWA 4OP8A 2XD5A 1H5XA 2ZC5B 3DWZA 3FV7A 1LL9A 3A3FA 2HP6A 3HL9A 4WMCA 4X56A 3ZHHA 4Y0OA 2ZD8A 1NXYA 3WRTA 3N8SA 1YLJA 3ZCZA 5HX9A 2A49A 3G4PA 4C6YA 1YLTA 1BLCA 4BENA 2EFUA 2BLSA 1PW8A 3RXXA 3FKWA 3ZG5A 1TDLA 1KGEA 1PI5A 5HL1A 3BFGA 2EXAA 3MZFA 3WS0A 2WGVA 3ZNTA 3VOYA 1W79A 1NYYA 2Y2HA 4FSFA 3M6BA 1MKIA 4ID4A 2V1ZA 3MZDA 1WYBA 4QU3A 3WWXA 5HW3A 1MPLA 1E3UD 2WUQA 4HESA 4WYYA 5DF8A 2Y2NA 5JYOA 5JYPA 1K4FA 3W4QA 1S0WA 3NBLA 4UA7A 3UN7A 3HUOA 4FH2A 3HUMA 1HD8A 1YMSA 4ZBEA 1KVLA 3Q7VB 4GD8A 3Q07A 4DXBA 1VM1A 3FWLA 3FZCA 3VSLA 4U0XA 2WYXA 4XUZA 3AGFA 1K6SA 1U60A 4WM9A 4WZ4A 1WYCA 2HDRA 2Y2OA 3IQAA 4E3OA 5AQ9A 3IXBA 4UA6A 4ZJ3A 1H8YA 4JPMA 3UE1A 1K25A 2G2WA 4MBFA 4OVDA 2EFXA 4N92A 3UY6A 2H5SA 1PWGA 3HLDA 1ZKJA 2J9PA 4JXSA 2HDQA 2JBFA 1XPBA 1FCNA 3GVBA 1LLBA 1PYYA 4E3MA 3N8RA 3BLMA 3UPNA 1IEMA 2JC7A 5EUAA 1MWRA 3OC2A 2HPBA 1TDGA 4X69A 2QPNA 5D3OA 4OLDA 1ZC2A 1KE0A 3P09A 5CGXA 2PBYA 5A91A 5M19A 3PAEA 1S6RA 5EVLA 3AGEA 1ES4A 2BG1A 1PWDA 2VGKA 1BT5A 1XP4A 5DTTA 2WKIA 5F1FA 1K56A 2V20A 3HLBA 2WKHA 1OMEA 4U0TA 5CTNA 5M1AA 2OSUA 1EI5A 5E2GA 1BLHA 4KZ8A 2XQZA 4S2KA 5E2FA 2EX8A 5G18A 4GOGA 3BFEA 5EVIB 2G2UA 1IYQA 4LV2A 2OLVA 4OQ0A 5GHYA 2WKEA 5EECA 5HARA 3VP1A 3ZDJA 1CK3A 3FYZA 5I94A 4BJPA 4NETA 2FFFB 3EQVA 4QHCA 3LCEA 5GL9A 3AGDA 3IH8A 4WBGA 4Y0UA 1KVMA 2XF3A 5GLBA 4E6XA 3SS4A 1ONHA 4R3JA 3WS2A 4JBFA 3BYDA 3MFDA 4EV4A 1CEFA 4BLMA 4R3BA 2XR0A 2JE5A 3OPLA 4U3TA 4R23A 3ZFZA 5FQQA 2V2FF 4Z9QA 2A3UA 4QJGA 3G30A 5CEDA 3M2KA 4BL3A 3UPOA 3Q81A 4E3NA 2Y2KA 3SH8A 4EWFA 2FFYA 3RJUA 5GLAA 1FR6A 5KMWA 4FCFA 5FSRA 1ESIA 3TOIA 4R1GA 3G34A 3IHAA 3IWQA 3SS3A 4PMAA 5KSCA 3LY4A 1YM1A 1HTZA 4P6BA 4S2OA 4XUXA 1XGJA 4YINA 4JKTA 2P9VB 2XD1A 3PTEA 4DF6A 3VP4A 4GDNA 3MBZA 4P0MA 4X6TA 4GN2A 1LI9A 4KENB 3S1YA 1W5DA 4EQIA 5TFQA 4PM6A 4C3QA 4C75A 2XLNA 3M2JA 5L2FA 3MZEA 4KZAA 4HBTA 3HLGA 4S2NA 4L0LA 4MLLA 4WELA 3CZDA 2ZC4B 5CHJA 1ES3A 5FQMA 1I2SA 4KG6A 3ITAA 1BZAA 1HVBA 3IF5A 3LO7A 4GKUA 3GMWA 4RVAA 5A90A 3GSGA 1FOFA 1MWTA 3IWIA 3O3VA 3EQUA 4JF4A 5HAQA 4OONA 5GLCA 3LEZA 4R0QA 3VSKA 1NJ4A 1BULA 3HLFA 2Y59A 3IF6A 4QY6A 5FATA 5TR7A 4S2PA 4DDSA 2DNSA 3V39A 5HAPA 2ZM8A 4R4SA 3ZG9B 4EUZA 1DY6A 4RX3A 5FI6A 3C4PA 2ZQCA 2E8IA 2ZC3B 5HAIA 2WAFA 4OPQA 3TSGA 4UAAA 1L0GA 2EX9A 3V3RA 1Q2PA 2Y4AA 1GHMA 2EXBA 1ONGA 3SH9A 5CERA 5GHZA 3PBQA 5DVAA 4MBHA 3BFFA 4BL2A 5F82A 1IYOA 3BRMA 4OOYA 2HP9A 3VFHA 3BLSA 3ZNYA 2R9WA 4OQIA 1NYMA 5HFOA 4WEJA 4PM7A 1EWZA 3PBNA 2WGWA 1DJAA 1XXMA 5BOHA 1MWSA 1BTLA 1ALQA 2H0YA 1I5QA 5KZHA 5J8XA 5CECA 1K4EA 2H0TA 4B88A 4BD1A 1NRFA 3N4IA 5FAPA 5IHVA 3PAGA 3VOZA 2X71A 3NI9A 2J9OA 3NIAA 4R4RA 5CHUA 1SHVA 3TG9A 3WRZA 1ERQA 4HBUA 1FSYA 2Y2PA 4N9LA 4IBRA 4QY5A 1K55C 1W8YA 1ERMA 3IH9A 4UA9A 4GZBA 4X68A 4KZ3A 5F83A 2XFSA 2ZQAA 1HZOA 2DRWA 3Q7ZA 3NC8A 2ZM0A 5E2EA 1FCMA 3MKEA 4N9KA 1E3UA 1CEGA 1G68A 2XDMA 3PBSA 2WK0A 4IVIA 3VP3A 1RGYA 4Y0TA 3UE3A 3CJMA 5E43A 4E6WA 1MXOA 1YLWA 3O87A 1GA0A 2Q9NA 2H10A 2XGNA 2J8YA 1ES5A 2XEPA 4PM9A 2Y2IA 4IVKA 1BSGA 1YMXA 3E2KA 4S2MA 1M6KA 1YQSA 5CGSA 1PI4A 2EX2A 2QZ6A 1LHYA 3ZG8B 3W8KA 1FR1A 3G35A 4BD0A 4S2NC 1PZPA 1EROA 1SDNA 4KQQA 1NZUA 1DJBA 3C7VA 4QB8A 1Y54A 1IKIA 2DCFA 4DKIA 3IXDA 1KGGA 3OPPA 1N4OA 4KZ9A 3Q7VA 4PM5A 2WZXA 3HREA 3MXSA 1MY8A 5TGFA 3IF6C 2ZQ8A 4OPZA 3GTCA 4EBLA 5DTSA 1KGFA 1PW1A 4K91A 1JVJA 5GHXA 2C5WB 2Z2MB 1K38A 4JF6A 3ZVWA 2Y2JA 3V50A 1K55A 1W8QA 5EVID 3HBRA 3V3SA 4JF5A 1PZOA 2IWDA 3BFCA 3PBRA 1W7FA 3BEBA 4KZ7A 4S2LA 4EBPA 3NY4A 3M6HA 5FDHA 4E3IA 1KDWA 1O7EA 1Z6FA 4OQHA 4OPYA 1G6AA 4MNRA 5CHMA 4OLGA 1SDEA 2HDSA 5KSHA 1QMFA 1ZG6A 4FH4A 4OQGA 1JTGA 2J7VA 1H8ZA 1N9BA 3WS4A 1MBLA 2Y2MA 4N1XA 1KE3A 1SKFA 4HEFA 4Y7PA 1GA9A 1M40A 3BM6A 2XH9A 4QD4A 2IWCA 3W4PA 1NZOA 5A92A 4OOMA 2ZQ7A 3IXHA 4X53A 1PIOA 3ZG0A 4K0WA 4RX2A 3G32A 5E2HA 2ZJ9A 2ZM2A 3WS5A 1XKZA 1JWPA 4WZ5A 3BFDA 3DWKA 2IWBA 5F1GA 5DF9A 4S2JA 2ZC6B 3JYIA 2Y2QA 3SOIA 3WS1A 5DF7A 2HP5A 1K57A 4KZ4A 3NDGA 1SCWA 2Y55A 3CG5A 5CXWA 4CJNA 1TEMA 1K54C 1VQQA 4O7DA 4B4XA 3O88A 4UHUA 4JLFA 4RA7A 2Y91A 2ZQ9A 2EX6A 1GHPA 4BQMA 1IYSA 4M3KA 3W4OA 4GNUA 4DE1A 4PM8A 4KQOA 1L0FA 5CGWA 1YLYA 3BECA 1ES2A 3LY3A 5M18A 1NY0A 3G31A 3MKFA 4LV3A 4JXVA 1IELA 1GHIA 3A3EA 3ISGA 1E25A 1PWCA 3D4FA 5FQ9A 2ZLYA 4LV1A 4OH0A 5EOOA 4OPRA 4DDYA 3NCKA 2WGIA 4E3LA 3NDEA 4GB7A 5AQBA 1JWVA 4CPKA 4DE3A 2X02A 4ZJ2A 1K6RA 4KZ5A 2P74A 3VP0A 3HLWA 5EPHA 1DJCA 1J9MA 3HLEA 5FQJA 4A5RA 3OZHA 3VFFA 1K56D 2ZC7A 2Q9MA 5CEBA 3VP2A 3UDFA 3FKVA 1JTDA 3B3XA 1LL5A 2P9VA 3IT9A 3V5MA 4N1HA 4F94A 3Q82A 4JXWA 4KG2A 2ZQDA 4ZDXA 1FCOA 4OKPA 4DXCA 1ZG4A 4KG5A 1XA1A 4E3KA 5GLDA 4GDBA 1BLPA 1XX2A 3UNWA 4EBNA 2XFTA 4FD8A 4H8RA 2RCXA 1YT4A 3C7UA 4LV0A 5EE8A 1K54A 4GD6A 3ZG7B 3ITBA 5FQKA 5AQ7A 1KDSA 2PU2A 4D2OA 4Q8IA 1LI0A 3DTMA 1AXBA 4KZ6A 2QMIA 3SS5A 4IEDA 3OCLA 4OP5A 3QNCA 4PPRA 2GDNA 4B4ZA 3UDIA 1YLPA 1I2WA 1FSWA 5FAQA 4WZ5C 3UO9A 2OLUA 3VMAA 2Z2LB 3UDXA 5EVIC 3GV9A 4OOLA 3S22A 3N6IA 5U47A 1ESUA 3N7WA 3UE0A 3UPPA 4DE0A 2WAEA 3DW0A 3A3IA 1E4DA 3OPHA 4S2IA 1K57C 5FASA 3OCNA 4YFMA 2WZZA 4DRTA 2B5RA 1L2SA 3IF6B 5CTMA 2HDUA 2JCHA 3C4OA 4X55A 3QNBA 5FI7A 3S4XA 4IBXA 5AQAA 5DTKA 3O86A 4KZBA 1IKGA 1CI8A 3Q1FA 4LENA 4ZTKA 5FAOA 5A93A 5FI2A 2C6WB 2RL3A 3HLCA 4WMCD 1RCJA 1L0EA 2I72A 2CC1A 3A3DA 3QHYA 4LCLA 1TVFA 1RGZA 1XGIA 4KQRA 1O07A 3GQZA 1JWZA 3IXGA 2PU4A 2WADA 5FQIA 3E2LA 4JXGA 3GRJA 4E3JA
chains in the Genus database with same CATH superfamily
3HUNA 2Y2GA 3IWOA 5TJJA 1Q2QA 4K0XA 5CRFA 1CI9A 1BUEA 4Y17A 2XA7M 1GCEA 2DMWA 2VGJA 4XT2A 3ZVTA 1MWUA 2ZMAA 1VEUB 1YLZA 1BLSA 1IYPA 3P98A 4ZJ1A 4P85A 2W3EA 2YKFA 3I7JA 3N8LA 4OP8A 3CHWP 2ZC5B 3FV7A 4Y0OA 2ZD8A 3WRTA 1YLJA 3ZCZA 4BENA 1PW8A 3UB6A 2KDKA 1PI5A 5HL1A 4CQHA 2WGVA 3VOYA 2Y2HA 4YNRA 1MKIA 3MZDA 4QU3A 1E3UD 4HESA 4UQIS 1S0WA 1SZVA 3W4QA 3HUOA 4FH2A 1HD8A 4I3AA 4YOFA 3FC7A 2BTFP 1TS0A 1K6SA 1U60A 3B33A 2HDRA 4ZJ3A 2H5SA 3HLDA 4JXSA 2J9PA 4H6JB 3N8RA 4L9EA 3UPNA 2JC7A 1T1AA 1ZC2A 5A91A 5M19A 5EVLA 3AGEA 1PWDA 2VGKA 5DTTA 3A0RA 2WKHA 4MN6A 2V0UA 5E2GA 1HLUP 4HP9A 3H7WB 2EX8A 5G18A 4GOGA 1YSPA 3E98A 2ZOHA 5GHYA 1OJ5A 3ZDJA 3FYZA 4NETA 5GL9A 2H28A 1V9ZA 3AGDA 4WBGA 4GLQA 4R3JA 3BYDA 3T12B 4PAUA 2R78A 2JE5A 2XR0A 3OPLA 2A3UA 4QJGA 3M2KA 3D72A 4Q0JA 3DAVA 5KMWA 5FSRA 2P7JA 1ESIA 3G34A 3IHAA 3IWQA 3BQ8A 3LY4A 4ARZA 4XUXA 1XGJA 3PTEA 2M1CA 3VP4A 4P0MA 2JN7A 4EQIA 4EESA 1VETA 4PM6A 3CWFA 3MZEA 3NOPC 4Q0HA 3HLGA 4L0LA 4WELA 2ZC4B 2V1BA 5CHJA 1ES3A 4EETB 1HVBA 3LO7A 4GKUA 1MWTA 1D06A 3LEZA 3VSKA 2B95A 2PD8A 3V39A 3A0SA 3IBJA 1DY6A 1F5MA 5DJTA 2ZC3B 3F1PA 4UAAA 1L0GA 2EX9A 3V3RA 1Q2PA 2Y4AA 1GHMA 2EXBA 3PBQA 5DVAA 1LL8A 3BFFA 3U4LP 3ZNYA 1NYMA 3PBNA 4GW9A 1MWSA 4BD1A 2A24B 5FAPA 3VOZA 3T4TA 3NI9A 4R4RA 4EQ1A 1ERQA 3MR0A 2JHEA 2PR6A 2XSSA 4GZBA 4UQIM 1VEUA 5E2EA 3NJAA 1FCMA 3MKEA 4BMWA 1E3UA 1CEGA 3PBSA 2WK0A 2J3TC 1RGYA 5TBMB 4E6WA 1YLWA 3O87A 1GA0A 2XGNA 4MMNA 2Y2IA 4IVKA 1BSGA 3E2KA 1YKDA 5CGSA 1W63M 1LHYA 3G35A 4BD0A 1CQAA 5LBRA 2PRFA 1PZPA 3PR6A 1SDNA 4KQQA 3C7VA 5J3WA 1IKIA 3L9KA 1N4OA 3KSFA 2WZXA 3HREA 3MXSA 4BWIA 3E4PA 2JKTI 3GTCA 5DTSA 1KGFA 5GHXA 3ZVWA 2K2NA 1W8QA 3V3SA 1PZOA 3BEBA 5FDHA 3FPWA 4OPYA 1G6AA 3E4QA 4GS9A 4EEUA 2EWWA 1JTGA 3VV4A 1SKFA 4DJ3A 4HEFA 5L10A 1M40A 3BM6A 2IWCA 2L4RA 4CLCE 1PIOA 4K0WA 3H7WA 5AVEA 2ZJ9A 5EFWA 5MC7A 1EW0A 4HHDA 4X1LA 4P6ZS 2Y2QA 2HP5A 3NDGA 5CXWA 2Y55A 3T4KA 3T1XA 4JLFA 2ZQ9A 4PHTA 3U2AA 2HZ5A 4BQMA 5L07A 3W4OA 4KQOA 1L0FA 3BECA 4EUVA 3G31A 1IELA 4IHQA 2W0NA 1UWPX 4BBVA 2OWHA 4OH0A 4E3LA 1IOUA 3NDEA 1JWVA 2X02A 2B18A 1K6RA 5HPIA 1DJCA 1J9MA 4DMZA 3OZHA 3UDFA 3FKVA 2HF6A 4L9GA 1H0MA 4F94A 4JXWA 4ZDXA 4KG5A 2P04A 4HY8A 1PRQA 4H8RA 5EE8A 3ZG7B 3ITBA 2PU2A 3G6OA 4DJ2A 4MN7A 2QMIA 4PPRA 3B47A 1YLPA 3F1NB 5FAQA 4WZ5C 1ESUA 2J80A 3UE0A 4DE0A 2O9CA 1SKOB 1L2SA 5HPFA 3IF6B 3K2NA 4DN0A 3QP6A 4HI4A 5FI7A 3S4XA 2A24A 5A93A 4KZBA 1CI8A 2KX6A 2I72A 3LICA 4LCLA 2AVXA 3GQZA 1VHMA 3E2LA 4FOFA 1XA7A 2R9XA 5G4ZA 2PBDP 3EOIA 5TBMA 4HP4A 2MJ6A 3HJIA 4IUHA 2Y2LA 2OOLA 3G2YA 3BY9A 2EA9A 1KE4A 5EOEA 2VV6A 2OV5A 1MC0A 1T18A 2XK1A 4LCMA 3CMZA 3RXWA 3T4JA 2CMNA 2XD5A 1LL9A 3A3FA 3HL9A 1NXYA 3G4PA 4C6YA 3ZG5A 3BQAA 1KGEA 3K3CA 4HJ6A 3CUEA 2EXAA 1W79A 1NYYA 2JKGA 3M6BA 1D7EA 4WL9A 2V1ZA 1MPLA 4WYYA 1NLYA 3TJZC 3VE4A 3T4SA 5HWWA 3FZCA 1T1CA 3A0VA 5AVFA 1LSXA 3VOLA 4FUWA 1H8YA 3JPUA 2BASA 4MBFA 3PYPA 4OVDA 2EFXA 4LRYC 1XPBA 2VZWA 4E3MA 1K0KA 3BLMA 1IEMA 5EM1A 3OC2A 2QPNA 3C2WA 3LFVA 3L7HA 5CGXA 1X0OA 2ACGA 2PBYA 3PAEA 1ES4A 4G3KA 1BT5A 2VGLM 4M4XA 1P97A 2V20A 1OMEA 4CLCB 5CTNA 1XJ4A 1BLHA 2W1RA 3LIEA 5E2FA 5EVIB 1L3LA 1IYQA 2O9AA 4LV2A 1WA9A 1H8MA 2WKEA 4NXGA 5EECA 3FPVA 5HARA 4R38A 3T1SA 2FFFB 1OTDA 4Y0UA 1KVMA 1BYWA 3SS4A 1UWNX 1V9YA 1CEFA 3UB8A 4U3TA 5F6AA 2V2FF 4JGQA 3G30A 5CEDA 4BL3A 3KYZA 5FEGA 3RJUA 4JGPA 3SS3A 2B02A 4PMAA 5KSCA 1YM1A 1HTZA 2V8FA 3QP4A 3LI9A 4YINA 2P9VB 2XD1A 4DF6A 3KSGA 5DFYA 4GN2A 1LI9A 2Z6CA 5TFQA 5L2FA 1J3WA 1TS8A 3CZDA 5FQMA 3ITAA 3OOVA 1BZAA 5A90A 3GSGA 3O3VA 4JF4A 1SKOA 5HAQA 2VLGA 4R0QA 1NJ4A 2P08A 4O0PA 3IF6A 5FATA 4DDSA 2DNSA 3MSHA 4EUZA 3UB7A 5FI6A 5L8MA 4OPQA 2OWJA 5GHZA 4MBHA 1IYOA 4WEJA 4PM7A 3RH8B 1DJAA 4GCZA 2H0YA 1I5QA 4G3WA 5KZHA 5CECA 3V67A 2H0TA 5DKKA 4B88A 5HL6A 3T1QB 2J9OA 3TRCA 3C8CA 2W1TB 4HBUA 1FSYA 4N9LA 4IBRA 4YWZA 1DP8A 1ERMA 4X68A 4KZ3A 2XFSA 2DRWA 3NC8A 4ME4A 2ZM0A 1G68A 4BBTA 1MZUA 1IFQA 3VP3A 2XROA 3UE3A 3CJMA 5E43A 2ZL1B 2H10A 1S67L 3H9WA 2XEPA 1YMXA 1M6KA 3W8KA 2K31A 4IJGA 1EROA 4FTXA 4QB8A 3QP5A 3OPPA 5TGFA 1MY8A 4OPZA 3ZYTA 1S4SA 4JF6A 1XFNA 3HBRA 4L9FA 2IWDA 4KZ7A 1KDWA 1O7EA 4OQHA 4Y15A 1SDEA 5KSHA 5DFXA 1QMFA 1ZG6A 5G4YA 4OQGA 1G5UA 3TE8A 1N9BA 4N1XA 2UV0E 2PT7A 2M7UA 4OOMA 3IXHA 4X53A 1XKZA 1JWPA 2GZAA 3IS2B 2NUTC 3SOIA 3ULFA 4KZ4A 1SCWA 1TEMA 4O7DA 1VQQA 4UHUA 2NUPC 5FEFA 4NXBA 1IYSA 3D3OA 3MKFA 1LSVA 1PWCA 4OPRA 4DDYA 3NCKA 1OT6A 3O5YA 4KZ5A 2P74A 1MKMA 1G28A 3KYQA 1JTDA 3LR5A 4AFIA 2P9VA 3V5MA 4N1HA 2WKQA 4EEPA 1DRMA 4DXCA 3RFBA 1ZTUA 1ZG4A 4GDBA 4WF0A 4EBNA 2XFTA 3DBAA 4LV0A 4GD6A 2Y8HA 5FQKA 3MJQA 4EU0A 5KIZA 4D60A 4Z1WA 3DTKA 4KZ6A 4IEDA 5A8BA 3QNCA 4B4ZA 3PXPA 4OOLA 3S22A 4X1MA 1P9RA 3N7WA 4GHIB 4O8GA 3OPHA 4S2IA 2WZZA 4DRTA 2JKTM 3OBFA 4IUKA 5AJGA 5AQAA 4ZTKA 5FAOA 1XJ6A 2C6WB 4H6JA 3CPTB 3HLCA 2L0WA 1TS7A 2W1TA 1S1ZA 2CC1A 3QHYA 4KQRA 1RGZA 1XGIA 3CI6A 3T1RA 1JWZA 4Q0IA 3R4KA 2WADA 5FDSA 4JXGA 4RYEA 4XXRA 2Q0OA 3GR2A 1FQGA 4LGWA 4P87A 2ZL1A 3A3JA 1OTEA 4ZAMA 3H82B 3P7NA 1RP5A 3IHBA 4GJ4A 4DE2A 3SH7A 2JKRI 2LB5A 1CJFA 4MEZA 1FIKA 4MCWA 2W3FA 3DWZA 4JGRA 2KLIA 2HP6A 1LSWA 4KUKA 3MMHA 3N8SA 1XJ3A 2FH5A 1NRJA 1NWZA 2A49A 1YLTA 1DP6A 3RXXA 4ESPA 3FKWA 1TDLA 3BFGA 4JGOA 3MZFA 3ZNTA 4FSFA 2HJ9C 3RTYA 4ID4A 3R7WB 5J4EA 4QPRA 5HW3A 2QJ7A 2HJEA 2WUQA 4LLOB 5JYPA 1Z09A 3UN7A 3HUMA 1OTAA 1VB6A 4ZBEA 1KVLA 1G6OA 3Q7VB 2VX8A 3Q07A 1VM1A 3LR4A 2WKPA 3BWLA 4U0XA 4XUZA 3AGFA 4WM9A 1WYCA 3IQAA 5AQ9A 3IXBA 4UA6A 4JPMA 3UE1A 2G2WA 3UY6A 3QP2A 2HDQA 3GVBA 1LLBA 1S4RA 2GX5A 1MWRA 2HPBA 1H3QA 1TDGA 4X69A 5D3OA 1KE0A 3IS2A 1S6RA 2BG1A 4Y13A 2WKIA 4HIAA 4U0TA 5M1AA 3IBRA 1EI5A 5HZHA 4KZ8A 4XT2B 3BFEA 2G2UA 3LIDA 2OLVA 3VP1A 1CK3A 1OPXA 3FG8A 3CUEC 3LGOA 3EQVA 3EGXC 4E6XA 3MQOA 3B42A 2W3HA 4EV4A 4R3BA 2W3DA 2K7SA 3UPOA 3UB5P 4UEYA 4EWFA 4FCFA 3TOIA 5C5KA 4PKYG 1YAXA 4JKTA 5DKLA 3MBZA 3S1YA 4KENB 3GECA 4C75A 2XLNA 4KZAA 4HBTA 3T4LA 3LIBA 4S2NA 4LRXC 4MLLA 2ZBBA 1I2SA 2VK3A 3IF5A 4I3JA 4EW7A 1UGUA 3JVUA 1BULA 5TR7A 4S2PA 2ZM8A 4R4SA 3S7QA 3C4PA 2ZQCA 2E8IA 2WAFA 4P6ZM 3UMDA 4KUOA 5CERA 4HH3A 4QWOA 3VFHA 4OQIA 5HFOA 2Y79A 1XXMA 1ALQA 3N4IA 2ZMFA 3NIAA 5CHUA 4UA9A 1K55C 3H82A 3W2ZA 4ZRRA 2ZQAA 1GSWA 2QKPA 2INWA 4N9KA 5L09A 1S1YA 3F1OB 4IVIA 1MXOA 2PD7A 4PM9A 2D01A 4X25A 1YQSA 1F2KA 3NECA 2EX2A 2QZ6A 1FR1A 2M7VA 4DKIA 3IXDA 4KZ9A 3Q7VA 4EERA 3IF6C 2ZQ8A 1N9NA 4CLCD 1PFLA 1LT0A 3E0YA 1PW1A 1JVJA 4ETZA 3KSIA 2Y2JA 3V50A 1K55A 5EVID 3PBRA 1W7FA 4EBPA 3ICYA 3M6HA 4II7A 4I3IA 2HDSA 4ETXA 4FH4A 2G7UA 4G3VA 1A0KA 3WS4A 1MBLA 3LR3A 2Y2MA 1KE3A 3F1NA 4Y7PA 4QD4A 2Z6DA 2XH9A 3W4PA 5A92A 1NZOA 4HJ4A 2ZQ7A 4B9OA 1DP9A 3ZG0A 3G32A 3WS5A 1F98A 5DF9A 2J3WA 4S2JA 2ZC6B 4BBUA 3WS1A 5DF7A 3S7OA 1K57A 3CG5A 1K54C 4B4XA 5CX7A 5F68A 2Y91A 4F3LB 4HH2A 4DE1A 4PKYA 5CGWA 1XJ2A 1YLYA 1ES2A 3A3EA 1JNUA 1E25A 2O99A 3D4FA 3ISGA 2ZLYA 5EOOA 5FQ9A 4GB7A 4CPKA 3JVVA 4ZJ2A 1OTBA 2HV1A 2V9AA 3KO6A 3VFFA 1K56D 5CEBA 3VP2A 3LI8A 2QYBA 3KSHA 3B3XA 4NG2A 1Y28A 1P9WA 1LL5A 3IT9A 3NULA 2ZQDA 3BJNA 5HD3A 1FCOA 4OKPA 3LYXA 1GSXA 1YSQA 5GLDA 1BLPA 1XX2A 3UNWA 4FD8A 1YT4A 3C7UA 1K54A 4GS9B 3MS6A 1KDSA 4D2OA 1TF1A 3DTMA 1AXBA 4CLCC 3C38A 2GDNA 1P0ZA 2I9VA 2OLUA 3VMAA 3UDXA 5EVIC 3GV9A 2VJWA 3N6IA 2PHYA 4R6LA 3UPPA 2WAEA 3DW0A 3A3IA 1E4DA 2J3TD 3EEHA 4YFMA 2B5RA 5CTMA 2HDUA 2JCHA 4IBXA 5DTKA 4LENA 1IKGA 1F9IA 5FI2A 3BW6A 4I39A 3IX3A 2IA2A 1TVFA 3QP8A 1O07A 3IXGA 3MFXA 2PU4A 1N9OA 3GRJA 2WGWB 1QMEA 4NK3A 1C3BA 3C30A 2UWXA 1W63Q 3F1OA 4WEKA 1L0DA 3ZGAB 3MXRA 3PBTA 3C5AA 3G2ZA 4CLCA 2X01A 4MBKA 3OPRA 4Y3IA 1T1BA 5FASA 3HVFA 1WE4A 3PBOA 5EVIA 5FA7A 3UMEA 2XRNA 1H5XA 2VV8A 4WMCA 4X56A 3ZHHA 1GSVA 5F5YA 5HX9A 1BLCA 2EFUA 2BLSA 1S66L 1OT9A 3GDIA 3WS0A 3DTIA 3IX8A 3TW8A 2LB9A 2GNXA 1WYBA 3WWXA 2PR5A 5DF8A 2Y2NA 5JYOA 1K4FA 4UA7A 3NBLA 3BY8A 4I5SA 1YMSA 2QJ5A 3CITA 4GD8A 4DXBA 3IX4A 3FWLA 5HSQA 3VSLA 2PAVP 2WYXA 1STZA 1ACFA 4WZ4A 2Y2OA 4E3OA 1K25A 1TD5A 3MF0A 4N92A 1PWGA 1ZKJA 4R70A 2JBFA 1FCNA 1PYYA 5HDCA 5EUAA 4OLDA 3P09A 3KYEA 2OAQ1 1XP4A 4K08A 4I38A 1TS6A 1K56A 5F1FA 3HLBA 2PDRA 2PYPA 4F3LA 5IU1A 1KOUA 2OSUA 1FILA 2XQZA 4S2KA 3K3DA 3EEAA 4OQ0A 5I94A 4BJPA 4HNBA 4QHCA 3LCEA 3IH8A 5GLBA 2XF3A 1ONHA 2W3GA 3S7NA 4JBFA 3MFDA 3WS2A 4O01A 4BLMA 4R23A 3ZFZA 5FQQA 3MQQA 4Z9QA 4EXOA 3DTEA 2KOIA 3Q81A 2O0YA 2Y2KA 4E3NA 3SH8A 2YKHA 2QWSA 4LFUA 2FFYA 5GLAA 1FR6A 3CLOA 3LIFA 4R1GA 1NLZA 3P01A 2W27A 4P6BA 4S2OA 2GJ3A 2V1AA 4WUJA 4Y2FA 2V8CA 5F69A 1AWIA 3T4QA 4GDNA 3QP1A 4X6TA 3E4OA 1W5DA 3OLOA 1T19A 2JKRM 4C3QA 3M2JA 3LR0A 4HOIA 1D1JA 4KG6A 1ZHHB 3GMWA 4RVAA 1FOFA 3IWIA 3EQUA 4OONA 5GLCA 4QY6A 3HLFA 2Y59A 5HAPA 3ZG9B 5IS1A 4RX3A 3TSGA 5HAIA 3LEQA 3NOTC 1ONGA 3SH9A 5HDSA 3UE6A 4BL2A 1XFQA 5F82A 3VE3A 3BRMA 4OOYA 2HP9A 3BLSA 2R9WA 1EWZA 1OJGA 2WGWA 5BOHA 2VEAA 1BTLA 5J8XA 1K4EA 1NRFA 5I5LA 5IHVA 3PAGA 2X71A 1SHVA 3TG9A 3WRZA 2Y2PA 4QY5A 5EM0A 1W8YA 3HCYA 3IH9A 5F83A 1HZOA 3Q7ZA 1OTIA 4E04A 3NHQA 4B93A 2VGLS 2JKFA 2XDMA 2PYRA 2WKRA 1N9LA 3MXQA 4Y0TA 4WN5A 2Q9NA 5HWVA 2J8YA 1ES5A 4LRZE 4S2MA 1PI4A 1PNEA 3ZG8B 4NXEA 4S2NC 1NZUA 3MQ0A 1DJBA 1Y54A 2DCFA 1ODVA 1KGGA 2ZMVA 4PM5A 4EBLA 4K91A 2L1MA 2C5WB 3SW1A 2Z2MB 1K38A 2V0WA 2ZOIA 2XA7S 1YPRA 4JF5A 3BFCA 4S2LA 5IT5A 3ZQ5A 4LPZA 3HJKA 3NY4A 4E3IA 1Z6FA 4HJ3A 4MNRA 5CHMA 4OLGA 2VKSA 5FL3A 5HD5A 2J7VA 1H8ZA 3LIAA 5J7EA 4R3AA 3EWKA 5EVEA 1GA9A 3KX0X 4RX2A 5HDDA 5E2HA 4GHIA 3CAXA 2ZM2A 4WZ5A 3BFDA 3DWKA 2IWBA 5F1GA 3EGDC 3JYIA 2E8JA 4Y5FA 4NEED 5DJUA 4CJNA 3CPTA 3NOUC 3O88A 4RA7A 2EX6A 1GHPA 3T4OA 4M3KA 4GNUA 4PM8A 4HQAA 3LY3A 5M18A 3PHYA 1NY0A 5HWTA 4LV3A 4JXVA 1GHIA 4LV1A 2WGIA 5AQBA 4DE3A 2A2LA 3VP0A 3HLWA 5EPHA 4NKPA 3HLEA 5FQJA 4A5RA 2ZC7A 2Q9MA 1CF0A 3LUQA 4RQ9A 4KQDA 3Q82A 4KG2A 3SZTA 1XA1A 4E3KA 4WLAA 2RCXA 2VV7A 5K5BA 5AQ7A 4ARZB 4Q8IA 1LI0A 3R7WA 3SS5A 3OCLA 2EWVA 4OP5A 2O9BA 1Y4OA 1VETB 3UDIA 1I2WA 1FSWA 2D02A 3UO9A 2OAP1 3D9YA 2Z2LB 4NXFA 3UB9A 5U47A 3S7PA 3T50A 2HGVA 1K57C 3OCNA 5EV0A 3C4OA 4X55A 2FZ0A 3QNBA 2QHKA 3O86A 3Q1FA 2RL3A 3F1PB 4WMCD 1RCJA 1L0EA 3A3DA 4MN5A 2VA0A 4MDZA 5FQIA 4E3JA
chains in the Genus database with same CATH topology
3HUNA 4RYEA 2Y2GA 3IWOA 4XXRA 2WGWB 1Q2QA 1XA7A 4K0XA 1QMEA 4NK3A 1C3BA 4WEKA 2UWXA 2R9XA 3GR2A 5CRFA 1FQGA 1L0DA 1CI9A 1BUEA 3ZGAB 3MXRA 3PBTA 4P87A 3C5AA 1GCEA 3G2ZA 2X01A 2Y2LA 3G2YA 4DE2A 4MBKA 3A3JA 3OPRA 2VGJA 3ZVTA 4ZAMA 1MWUA 2ZMAA 1RP5A 1KE4A 1YLZA 3IHBA 1BLSA 5EOEA 3SH7A 2OV5A 1IYPA 3HVFA 3P98A 1WE4A 3PBOA 4P85A 5EVIA 2XK1A 4ZJ1A 3I7JA 4LCMA 3CMZA 3N8LA 4MEZA 5FA7A 3RXWA 4OP8A 2XD5A 1H5XA 2ZC5B 3DWZA 3FV7A 1LL9A 3A3FA 2HP6A 3HL9A 4WMCA 4X56A 3ZHHA 4Y0OA 2ZD8A 1NXYA 3WRTA 3N8SA 1YLJA 3ZCZA 5HX9A 2A49A 3G4PA 4C6YA 1YLTA 1BLCA 4BENA 2EFUA 2BLSA 1PW8A 3RXXA 3FKWA 3ZG5A 1TDLA 1KGEA 1PI5A 5HL1A 3BFGA 2EXAA 3MZFA 3WS0A 2WGVA 3ZNTA 3VOYA 1W79A 1NYYA 2Y2HA 4FSFA 3M6BA 1MKIA 4ID4A 2V1ZA 3MZDA 1WYBA 4QU3A 3WWXA 5HW3A 1MPLA 1E3UD 2WUQA 4HESA 4WYYA 5DF8A 2Y2NA 5JYOA 5JYPA 1K4FA 3W4QA 1S0WA 3NBLA 4UA7A 3UN7A 3HUOA 4FH2A 3HUMA 1HD8A 1YMSA 4ZBEA 1KVLA 3Q7VB 4GD8A 3Q07A 4DXBA 1VM1A 3FWLA 3FZCA 3VSLA 4U0XA 2WYXA 4XUZA 3AGFA 1K6SA 1U60A 4WM9A 4WZ4A 1WYCA 2HDRA 2Y2OA 3IQAA 4E3OA 5AQ9A 3IXBA 4UA6A 4ZJ3A 1H8YA 4JPMA 3UE1A 1K25A 2G2WA 4MBFA 4OVDA 2EFXA 4N92A 3UY6A 2H5SA 1PWGA 3HLDA 1ZKJA 2J9PA 4JXSA 2HDQA 2JBFA 1XPBA 1FCNA 3GVBA 1LLBA 1PYYA 4E3MA 3N8RA 3BLMA 3UPNA 1IEMA 2JC7A 5EUAA 1MWRA 3OC2A 2HPBA 1TDGA 4X69A 2QPNA 5D3OA 4OLDA 1ZC2A 1KE0A 3P09A 5CGXA 2PBYA 5A91A 5M19A 3PAEA 1S6RA 5EVLA 3AGEA 1ES4A 2BG1A 1PWDA 2VGKA 1BT5A 1XP4A 5DTTA 2WKIA 5F1FA 1K56A 2V20A 3HLBA 2WKHA 1OMEA 4U0TA 5CTNA 5M1AA 2OSUA 1EI5A 5E2GA 1BLHA 4KZ8A 2XQZA 4S2KA 5E2FA 2EX8A 5G18A 4GOGA 3BFEA 5EVIB 2G2UA 1IYQA 4LV2A 2OLVA 4OQ0A 5GHYA 2WKEA 5EECA 5HARA 3VP1A 3ZDJA 1CK3A 3FYZA 5I94A 4BJPA 4NETA 2FFFB 3EQVA 4QHCA 3LCEA 5GL9A 3AGDA 3IH8A 4WBGA 4Y0UA 1KVMA 2XF3A 5GLBA 4E6XA 3SS4A 1ONHA 4R3JA 3WS2A 4JBFA 3BYDA 3MFDA 4EV4A 1CEFA 4BLMA 4R3BA 2XR0A 2JE5A 3OPLA 4U3TA 4R23A 3ZFZA 5FQQA 2V2FF 4Z9QA 2A3UA 4QJGA 3G30A 5CEDA 3M2KA 4BL3A 3UPOA 3Q81A 4E3NA 2Y2KA 3SH8A 4EWFA 2FFYA 3RJUA 5GLAA 1FR6A 5KMWA 4FCFA 5FSRA 1ESIA 3TOIA 4R1GA 3G34A 3IHAA 3IWQA 3SS3A 4PMAA 5KSCA 3LY4A 1YM1A 1HTZA 4P6BA 4S2OA 4XUXA 1XGJA 4YINA 4JKTA 2P9VB 2XD1A 3PTEA 4DF6A 3VP4A 4GDNA 3MBZA 4P0MA 4X6TA 4GN2A 1LI9A 4KENB 3S1YA 1W5DA 4EQIA 5TFQA 4PM6A 4C3QA 4C75A 2XLNA 3M2JA 5L2FA 3MZEA 4KZAA 4HBTA 3HLGA 4S2NA 4L0LA 4MLLA 4WELA 3CZDA 2ZC4B 5CHJA 1ES3A 5FQMA 1I2SA 4KG6A 3ITAA 1BZAA 1HVBA 3IF5A 3LO7A 4GKUA 3GMWA 4RVAA 5A90A 3GSGA 1FOFA 1MWTA 3IWIA 3O3VA 3EQUA 4JF4A 5HAQA 4OONA 5GLCA 3LEZA 4R0QA 3VSKA 1NJ4A 1BULA 3HLFA 2Y59A 3IF6A 4QY6A 5FATA 5TR7A 4S2PA 4DDSA 2DNSA 3V39A 5HAPA 2ZM8A 4R4SA 3ZG9B 4EUZA 1DY6A 4RX3A 5FI6A 3C4PA 2ZQCA 2E8IA 2ZC3B 5HAIA 2WAFA 4OPQA 3TSGA 4UAAA 1L0GA 2EX9A 3V3RA 1Q2PA 2Y4AA 1GHMA 2EXBA 1ONGA 3SH9A 5CERA 5GHZA 3PBQA 5DVAA 4MBHA 3BFFA 4BL2A 5F82A 1IYOA 3BRMA 4OOYA 2HP9A 3VFHA 3BLSA 3ZNYA 2R9WA 4OQIA 1NYMA 5HFOA 4WEJA 4PM7A 1EWZA 3PBNA 2WGWA 1DJAA 1XXMA 5BOHA 1MWSA 1BTLA 1ALQA 2H0YA 1I5QA 5KZHA 5J8XA 5CECA 1K4EA 2H0TA 4B88A 4BD1A 1NRFA 3N4IA 5FAPA 5IHVA 3PAGA 3VOZA 2X71A 3NI9A 2J9OA 3NIAA 4R4RA 5CHUA 1SHVA 3TG9A 3WRZA 1ERQA 4HBUA 1FSYA 2Y2PA 4N9LA 4IBRA 4QY5A 1K55C 1W8YA 1ERMA 3IH9A 4UA9A 4GZBA 4X68A 4KZ3A 5F83A 2XFSA 2ZQAA 1HZOA 2DRWA 3Q7ZA 3NC8A 2ZM0A 5E2EA 1FCMA 3MKEA 4N9KA 1E3UA 1CEGA 1G68A 2XDMA 3PBSA 2WK0A 4IVIA 3VP3A 1RGYA 4Y0TA 3UE3A 3CJMA 5E43A 4E6WA 1MXOA 1YLWA 3O87A 1GA0A 2Q9NA 2H10A 2XGNA 2J8YA 1ES5A 2XEPA 4PM9A 2Y2IA 4IVKA 1BSGA 1YMXA 3E2KA 4S2MA 1M6KA 1YQSA 5CGSA 1PI4A 2EX2A 2QZ6A 1LHYA 3ZG8B 3W8KA 1FR1A 3G35A 4BD0A 4S2NC 1PZPA 1EROA 1SDNA 4KQQA 1NZUA 1DJBA 3C7VA 4QB8A 1Y54A 1IKIA 2DCFA 4DKIA 3IXDA 1KGGA 3OPPA 1N4OA 4KZ9A 3Q7VA 4PM5A 2WZXA 3HREA 3MXSA 1MY8A 5TGFA 3IF6C 2ZQ8A 4OPZA 3GTCA 4EBLA 5DTSA 1KGFA 1PW1A 4K91A 1JVJA 5GHXA 2C5WB 2Z2MB 1K38A 4JF6A 3ZVWA 2Y2JA 3V50A 1K55A 1W8QA 5EVID 3HBRA 3V3SA 4JF5A 1PZOA 2IWDA 3BFCA 3PBRA 1W7FA 3BEBA 4KZ7A 4S2LA 4EBPA 3NY4A 3M6HA 5FDHA 4E3IA 1KDWA 1O7EA 1Z6FA 4OQHA 4OPYA 1G6AA 4MNRA 5CHMA 4OLGA 1SDEA 2HDSA 5KSHA 1QMFA 1ZG6A 4FH4A 4OQGA 1JTGA 2J7VA 1H8ZA 1N9BA 3WS4A 1MBLA 2Y2MA 4N1XA 1KE3A 1SKFA 4HEFA 4Y7PA 1GA9A 1M40A 3BM6A 2XH9A 4QD4A 2IWCA 3W4PA 1NZOA 5A92A 4OOMA 2ZQ7A 3IXHA 4X53A 1PIOA 3ZG0A 4K0WA 4RX2A 3G32A 5E2HA 2ZJ9A 2ZM2A 3WS5A 1XKZA 1JWPA 4WZ5A 3BFDA 3DWKA 2IWBA 5F1GA 5DF9A 4S2JA 2ZC6B 3JYIA 2Y2QA 3SOIA 3WS1A 5DF7A 2HP5A 1K57A 4KZ4A 3NDGA 1SCWA 2Y55A 3CG5A 5CXWA 4CJNA 1TEMA 1K54C 1VQQA 4O7DA 4B4XA 3O88A 4UHUA 4JLFA 4RA7A 2Y91A 2ZQ9A 2EX6A 1GHPA 4BQMA 1IYSA 4M3KA 3W4OA 4GNUA 4DE1A 4PM8A 4KQOA 1L0FA 5CGWA 1YLYA 3BECA 1ES2A 3LY3A 5M18A 1NY0A 3G31A 3MKFA 4LV3A 4JXVA 1IELA 1GHIA 3A3EA 3ISGA 1E25A 1PWCA 3D4FA 5FQ9A 2ZLYA 4LV1A 4OH0A 5EOOA 4OPRA 4DDYA 3NCKA 2WGIA 4E3LA 3NDEA 4GB7A 5AQBA 1JWVA 4CPKA 4DE3A 2X02A 4ZJ2A 1K6RA 4KZ5A 2P74A 3VP0A 3HLWA 5EPHA 1DJCA 1J9MA 3HLEA 5FQJA 4A5RA 3OZHA 3VFFA 1K56D 2ZC7A 2Q9MA 5CEBA 3VP2A 3UDFA 3FKVA 1JTDA 3B3XA 1LL5A 2P9VA 3IT9A 3V5MA 4N1HA 4F94A 3Q82A 4JXWA 4KG2A 2ZQDA 4ZDXA 1FCOA 4OKPA 4DXCA 1ZG4A 4KG5A 1XA1A 4E3KA 5GLDA 4GDBA 1BLPA 1XX2A 3UNWA 4EBNA 2XFTA 4FD8A 4H8RA 2RCXA 1YT4A 3C7UA 4LV0A 5EE8A 1K54A 4GD6A 3ZG7B 3ITBA 5FQKA 5AQ7A 1KDSA 2PU2A 4D2OA 4Q8IA 1LI0A 3DTMA 1AXBA 4KZ6A 2QMIA 3SS5A 4IEDA 3OCLA 4OP5A 3QNCA 4PPRA 2GDNA 4B4ZA 3UDIA 1YLPA 1I2WA 1FSWA 5FAQA 4WZ5C 3UO9A 2OLUA 3VMAA 2Z2LB 3UDXA 5EVIC 3GV9A 4OOLA 3S22A 3N6IA 5U47A 1ESUA 3N7WA 3UE0A 3UPPA 4DE0A 2WAEA 3DW0A 3A3IA 1E4DA 3OPHA 4S2IA 1K57C 5FASA 3OCNA 4YFMA 2WZZA 4DRTA 2B5RA 1L2SA 3IF6B 5CTMA 2HDUA 2JCHA 3C4OA 4X55A 3QNBA 5FI7A 3S4XA 4IBXA 5AQAA 5DTKA 3O86A 4KZBA 1IKGA 1CI8A 3Q1FA 4LENA 4ZTKA 5FAOA 5A93A 5FI2A 2C6WB 2RL3A 3HLCA 4WMCD 1RCJA 1L0EA 2I72A 2CC1A 3A3DA 3QHYA 4LCLA 1TVFA 1RGZA 1XGIA 4KQRA 1O07A 3GQZA 1JWZA 3IXGA 2PU4A 2WADA 5FQIA 3E2LA 4JXGA 3GRJA 4E3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUN A;  4RYE A;  2Y2G A;  3IWO A;  4XXR A;  2WGW B;  1Q2Q A;  1XA7 A;  4K0X A;  1QME A;  4NK3 A;  1C3B A;  4WEK A;  2UWX A;  2R9X A;  3GR2 A;  5CRF A;  1FQG A;  1L0D A;  1CI9 A;  1BUE A;  3ZGA B;  3MXR A;  3PBT A;  4P87 A;  3C5A A;  1GCE A;  3G2Z A;  2X01 A;  2Y2L A;  3G2Y A;  4DE2 A;  4MBK A;  3A3J A;  3OPR A;  2VGJ A;  3ZVT A;  4ZAM A;  1MWU A;  2ZMA A;  1RP5 A;  1KE4 A;  1YLZ A;  3IHB A;  1BLS A;  5EOE A;  3SH7 A;  2OV5 A;  1IYP A;  3HVF A;  3P98 A;  1WE4 A;  3PBO A;  4P85 A;  5EVI A;  2XK1 A;  4ZJ1 A;  3I7J A;  4LCM A;  3CMZ A;  3N8L A;  4MEZ A;  5FA7 A;  3RXW A;  4OP8 A;  2XD5 A;  1H5X A;  2ZC5 B;  3DWZ A;  3FV7 A;  1LL9 A;  3A3F A;  2HP6 A;  3HL9 A;  4WMC A;  4X56 A;  3ZHH A;  4Y0O A;  2ZD8 A;  1NXY A;  3WRT A;  3N8S A;  1YLJ A;  3ZCZ A;  5HX9 A;  2A49 A;  3G4P A;  4C6Y A;  1YLT A;  1BLC A;  4BEN A;  2EFU A;  2BLS A;  1PW8 A;  3RXX A;  3FKW A;  3ZG5 A;  1TDL A;  1KGE A;  1PI5 A;  5HL1 A;  3BFG A;  2EXA A;  3MZF A;  3WS0 A;  2WGV A;  3ZNT A;  3VOY A;  1W79 A;  1NYY A;  2Y2H A;  4FSF A;  3M6B A;  1MKI A;  4ID4 A;  2V1Z A;  3MZD A;  1WYB A;  4QU3 A;  3WWX A;  5HW3 A;  1MPL A;  1E3U D;  2WUQ A;  4HES A;  4WYY A;  5DF8 A;  2Y2N A;  5JYO A;  5JYP A;  1K4F A;  3W4Q A;  1S0W A;  3NBL A;  4UA7 A;  3UN7 A;  3HUO A;  4FH2 A;  3HUM A;  1HD8 A;  1YMS A;  4ZBE A;  1KVL A;  3Q7V B;  4GD8 A;  3Q07 A;  4DXB A;  1VM1 A;  3FWL A;  3FZC A;  3VSL A;  4U0X A;  2WYX A;  4XUZ A;  3AGF A;  1K6S A;  1U60 A;  4WM9 A;  4WZ4 A;  1WYC A;  2HDR A;  2Y2O A;  3IQA A;  4E3O A;  5AQ9 A;  3IXB A;  4UA6 A;  4ZJ3 A;  1H8Y A;  4JPM A;  3UE1 A;  1K25 A;  2G2W A;  4MBF A;  4OVD A;  2EFX A;  4N92 A;  3UY6 A;  2H5S A;  1PWG A;  3HLD A;  1ZKJ A;  2J9P A;  4JXS A;  2HDQ A;  2JBF A;  1XPB A;  1FCN A;  3GVB A;  1LLB A;  1PYY A;  4E3M A;  3N8R A;  3BLM A;  3UPN A;  1IEM A;  2JC7 A;  5EUA A;  1MWR A;  3OC2 A;  2HPB A;  1TDG A;  4X69 A;  2QPN A;  5D3O A;  4OLD A;  1ZC2 A;  1KE0 A;  3P09 A;  5CGX A;  2PBY A;  5A91 A;  5M19 A;  3PAE A;  1S6R A;  5EVL A;  3AGE A;  1ES4 A;  2BG1 A;  1PWD A;  2VGK A;  1BT5 A;  1XP4 A;  5DTT A;  2WKI A;  5F1F A;  1K56 A;  2V20 A;  3HLB A;  2WKH A;  1OME A;  4U0T A;  5CTN A;  5M1A A;  2OSU A;  1EI5 A;  5E2G A;  1BLH A;  4KZ8 A;  2XQZ A;  4S2K A;  5E2F A;  2EX8 A;  5G18 A;  4GOG A;  3BFE A;  5EVI B;  2G2U A;  1IYQ A;  4LV2 A;  2OLV A;  4OQ0 A;  5GHY A;  2WKE A;  5EEC A;  5HAR A;  3VP1 A;  3ZDJ A;  1CK3 A;  3FYZ A;  5I94 A;  4BJP A;  4NET A;  2FFF B;  3EQV A;  4QHC A;  3LCE A;  5GL9 A;  3AGD A;  3IH8 A;  4WBG A;  4Y0U A;  1KVM A;  2XF3 A;  5GLB A;  4E6X A;  3SS4 A;  1ONH A;  4R3J A;  3WS2 A;  4JBF A;  3BYD A;  3MFD A;  4EV4 A;  1CEF A;  4BLM A;  4R3B A;  2XR0 A;  2JE5 A;  3OPL A;  4U3T A;  4R23 A;  3ZFZ A;  5FQQ A;  2V2F F;  4Z9Q A;  2A3U A;  4QJG A;  3G30 A;  5CED A;  3M2K A;  4BL3 A;  3UPO A;  3Q81 A;  4E3N A;  2Y2K A;  3SH8 A;  4EWF A;  2FFY A;  3RJU A;  5GLA A;  1FR6 A;  5KMW A;  4FCF A;  5FSR A;  1ESI A;  3TOI A;  4R1G A;  3G34 A;  3IHA A;  3IWQ A;  3SS3 A;  4PMA A;  5KSC A;  3LY4 A;  1YM1 A;  1HTZ A;  4P6B A;  4S2O A;  4XUX A;  1XGJ A;  4YIN A;  4JKT A;  2P9V B;  2XD1 A;  3PTE A;  4DF6 A;  3VP4 A;  4GDN A;  3MBZ A;  4P0M A;  4X6T A;  4GN2 A;  1LI9 A;  4KEN B;  3S1Y A;  1W5D A;  4EQI A;  5TFQ A;  4PM6 A;  4C3Q A;  4C75 A;  2XLN A;  3M2J A;  5L2F A;  3MZE A;  4KZA A;  4HBT A;  3HLG A;  4S2N A;  4L0L A;  4MLL A;  4WEL A;  3CZD A;  2ZC4 B;  5CHJ A;  1ES3 A;  5FQM A;  1I2S A;  4KG6 A;  3ITA A;  1BZA A;  1HVB A;  3IF5 A;  3LO7 A;  4GKU A;  3GMW A;  4RVA A;  5A90 A;  3GSG A;  1FOF A;  1MWT A;  3IWI A;  3O3V A;  3EQU A;  4JF4 A;  5HAQ A;  4OON A;  5GLC A;  3LEZ A;  4R0Q A;  3VSK A;  1NJ4 A;  1BUL A;  3HLF A;  2Y59 A;  3IF6 A;  4QY6 A;  5FAT A;  5TR7 A;  4S2P A;  4DDS A;  2DNS A;  3V39 A;  5HAP A;  2ZM8 A;  4R4S A;  3ZG9 B;  4EUZ A;  1DY6 A;  4RX3 A;  5FI6 A;  3C4P A;  2ZQC A;  2E8I A;  2ZC3 B;  5HAI A;  2WAF A;  4OPQ A;  3TSG A;  4UAA A;  1L0G A;  2EX9 A;  3V3R A;  1Q2P A;  2Y4A A;  1GHM A;  2EXB A;  1ONG A;  3SH9 A;  5CER A;  5GHZ A;  3PBQ A;  5DVA A;  4MBH A;  3BFF A;  4BL2 A;  5F82 A;  1IYO A;  3BRM A;  4OOY A;  2HP9 A;  3VFH A;  3BLS A;  3ZNY A;  2R9W A;  4OQI A;  1NYM A;  5HFO A;  4WEJ A;  4PM7 A;  1EWZ A;  3PBN A;  2WGW A;  1DJA A;  1XXM A;  5BOH A;  1MWS A;  1BTL A;  1ALQ A;  2H0Y A;  1I5Q A;  5KZH A;  5J8X A;  5CEC A;  1K4E A;  2H0T A;  4B88 A;  4BD1 A;  1NRF A;  3N4I A;  5FAP A;  5IHV A;  3PAG A;  3VOZ A;  2X71 A;  3NI9 A;  2J9O A;  3NIA A;  4R4R A;  5CHU A;  1SHV A;  3TG9 A;  3WRZ A;  1ERQ A;  4HBU A;  1FSY A;  2Y2P A;  4N9L A;  4IBR A;  4QY5 A;  1K55 C;  1W8Y A;  1ERM A;  3IH9 A;  4UA9 A;  4GZB A;  4X68 A;  4KZ3 A;  5F83 A;  2XFS A;  2ZQA A;  1HZO A;  2DRW A;  3Q7Z A;  3NC8 A;  2ZM0 A;  5E2E A;  1FCM A;  3MKE A;  4N9K A;  1E3U A;  1CEG A;  1G68 A;  2XDM A;  3PBS A;  2WK0 A;  4IVI A;  3VP3 A;  1RGY A;  4Y0T A;  3UE3 A;  3CJM A;  5E43 A;  4E6W A;  1MXO A;  1YLW A;  3O87 A;  1GA0 A;  2Q9N A;  2H10 A;  2XGN A;  2J8Y A;  1ES5 A;  2XEP A;  4PM9 A;  2Y2I A;  4IVK A;  1BSG A;  1YMX A;  3E2K A;  4S2M A;  1M6K A;  1YQS A;  5CGS A;  1PI4 A;  2EX2 A;  2QZ6 A;  1LHY A;  3ZG8 B;  3W8K A;  1FR1 A;  3G35 A;  4BD0 A;  4S2N C;  1PZP A;  1ERO A;  1SDN A;  4KQQ A;  1NZU A;  1DJB A;  3C7V A;  4QB8 A;  1Y54 A;  1IKI A;  2DCF A;  4DKI A;  3IXD A;  1KGG A;  3OPP A;  1N4O A;  4KZ9 A;  3Q7V A;  4PM5 A;  2WZX A;  3HRE A;  3MXS A;  1MY8 A;  5TGF A;  3IF6 C;  2ZQ8 A;  4OPZ A;  3GTC A;  4EBL A;  5DTS A;  1KGF A;  1PW1 A;  4K91 A;  1JVJ A;  5GHX A;  2C5W B;  2Z2M B;  1K38 A;  4JF6 A;  3ZVW A;  2Y2J A;  3V50 A;  1K55 A;  1W8Q A;  5EVI D;  3HBR A;  3V3S A;  4JF5 A;  1PZO A;  2IWD A;  3BFC A;  3PBR A;  1W7F A;  3BEB A;  4KZ7 A;  4S2L A;  4EBP A;  3NY4 A;  3M6H A;  5FDH A;  4E3I A;  1KDW A;  1O7E A;  1Z6F A;  4OQH A;  4OPY A;  1G6A A;  4MNR A;  5CHM A;  4OLG A;  1SDE A;  2HDS A;  5KSH A;  1QMF A;  1ZG6 A;  4FH4 A;  4OQG A;  1JTG A;  2J7V A;  1H8Z A;  1N9B A;  3WS4 A;  1MBL A;  2Y2M A;  4N1X A;  1KE3 A;  1SKF A;  4HEF A;  4Y7P A;  1GA9 A;  1M40 A;  3BM6 A;  2XH9 A;  4QD4 A;  2IWC A;  3W4P A;  1NZO A;  5A92 A;  4OOM A;  2ZQ7 A;  3IXH A;  4X53 A;  1PIO A;  3ZG0 A;  4K0W A;  4RX2 A;  3G32 A;  5E2H A;  2ZJ9 A;  2ZM2 A;  3WS5 A;  1XKZ A;  1JWP A;  4WZ5 A;  3BFD A;  3DWK A;  2IWB A;  5F1G A;  5DF9 A;  4S2J A;  2ZC6 B;  3JYI A;  2Y2Q A;  3SOI A;  3WS1 A;  5DF7 A;  2HP5 A;  1K57 A;  4KZ4 A;  3NDG A;  1SCW A;  2Y55 A;  3CG5 A;  5CXW A;  4CJN A;  1TEM A;  1K54 C;  1VQQ A;  4O7D A;  4B4X A;  3O88 A;  4UHU A;  4JLF A;  4RA7 A;  2Y91 A;  2ZQ9 A;  2EX6 A;  1GHP A;  4BQM A;  1IYS A;  4M3K A;  3W4O A;  4GNU A;  4DE1 A;  4PM8 A;  4KQO A;  1L0F A;  5CGW A;  1YLY A;  3BEC A;  1ES2 A;  3LY3 A;  5M18 A;  1NY0 A;  3G31 A;  3MKF A;  4LV3 A;  4JXV A;  1IEL A;  1GHI A;  3A3E A;  3ISG A;  1E25 A;  1PWC A;  3D4F A;  5FQ9 A;  2ZLY A;  4LV1 A;  4OH0 A;  5EOO A;  4OPR A;  4DDY A;  3NCK A;  2WGI A;  4E3L A;  3NDE A;  4GB7 A;  5AQB A;  1JWV A;  4CPK A;  4DE3 A;  2X02 A;  4ZJ2 A;  1K6R A;  4KZ5 A;  2P74 A;  3VP0 A;  3HLW A;  5EPH A;  1DJC A;  1J9M A;  3HLE A;  5FQJ A;  4A5R A;  3OZH A;  3VFF A;  1K56 D;  2ZC7 A;  2Q9M A;  5CEB A;  3VP2 A;  3UDF A;  3FKV A;  1JTD A;  3B3X A;  1LL5 A;  2P9V A;  3IT9 A;  3V5M A;  4N1H A;  4F94 A;  3Q82 A;  4JXW A;  4KG2 A;  2ZQD A;  4ZDX A;  1FCO A;  4OKP A;  4DXC A;  1ZG4 A;  4KG5 A;  1XA1 A;  4E3K A;  5GLD A;  4GDB A;  1BLP A;  1XX2 A;  3UNW A;  4EBN A;  2XFT A;  4FD8 A;  4H8R A;  2RCX A;  1YT4 A;  3C7U A;  4LV0 A;  5EE8 A;  1K54 A;  4GD6 A;  3ZG7 B;  3ITB A;  5FQK A;  5AQ7 A;  1KDS A;  2PU2 A;  4D2O A;  4Q8I A;  1LI0 A;  3DTM A;  1AXB A;  4KZ6 A;  2QMI A;  3SS5 A;  4IED A;  3OCL A;  4OP5 A;  3QNC A;  4PPR A;  2GDN A;  4B4Z A;  3UDI A;  1YLP A;  1I2W A;  1FSW A;  5FAQ A;  4WZ5 C;  3UO9 A;  2OLU A;  3VMA A;  2Z2L B;  3UDX A;  5EVI C;  3GV9 A;  4OOL A;  3S22 A;  3N6I A;  5U47 A;  1ESU A;  3N7W A;  3UE0 A;  3UPP A;  4DE0 A;  2WAE A;  3DW0 A;  3A3I A;  1E4D A;  3OPH A;  4S2I A;  1K57 C;  5FAS A;  3OCN A;  4YFM A;  2WZZ A;  4DRT A;  2B5R A;  1L2S A;  3IF6 B;  5CTM A;  2HDU A;  2JCH A;  3C4O A;  4X55 A;  3QNB A;  5FI7 A;  3S4X A;  4IBX A;  5AQA A;  5DTK A;  3O86 A;  4KZB A;  1IKG A;  1CI8 A;  3Q1F A;  4LEN A;  4ZTK A;  5FAO A;  5A93 A;  5FI2 A;  2C6W B;  2RL3 A;  3HLC A;  4WMC D;  1RCJ A;  1L0E A;  2I72 A;  2CC1 A;  3A3D A;  3QHY A;  4LCL A;  1TVF A;  1RGZ A;  1XGI A;  4KQR A;  1O07 A;  3GQZ A;  1JWZ A;  3IXG A;  2PU4 A;  2WAD A;  5FQI A;  3E2L A;  4JXG A;  3GRJ A;  4E3J A; 
#chains in the Genus database with same CATH topology
 3HUN A;  2Y2G A;  3IWO A;  5TJJ A;  1Q2Q A;  4K0X A;  5CRF A;  1CI9 A;  1BUE A;  4Y17 A;  2XA7 M;  1GCE A;  2DMW A;  2VGJ A;  4XT2 A;  3ZVT A;  1MWU A;  2ZMA A;  1VEU B;  1YLZ A;  1BLS A;  1IYP A;  3P98 A;  4ZJ1 A;  4P85 A;  2W3E A;  2YKF A;  3I7J A;  3N8L A;  4OP8 A;  3CHW P;  2ZC5 B;  3FV7 A;  4Y0O A;  2ZD8 A;  3WRT A;  1YLJ A;  3ZCZ A;  4BEN A;  1PW8 A;  3UB6 A;  2KDK A;  1PI5 A;  5HL1 A;  4CQH A;  2WGV A;  3VOY A;  2Y2H A;  4YNR A;  1MKI A;  3MZD A;  4QU3 A;  1E3U D;  4HES A;  4UQI S;  1S0W A;  1SZV A;  3W4Q A;  3HUO A;  4FH2 A;  1HD8 A;  4I3A A;  4YOF A;  3FC7 A;  2BTF P;  1TS0 A;  1K6S A;  1U60 A;  3B33 A;  2HDR A;  4ZJ3 A;  2H5S A;  3HLD A;  4JXS A;  2J9P A;  4H6J B;  3N8R A;  4L9E A;  3UPN A;  2JC7 A;  1T1A A;  1ZC2 A;  5A91 A;  5M19 A;  5EVL A;  3AGE A;  1PWD A;  2VGK A;  5DTT A;  3A0R A;  2WKH A;  4MN6 A;  2V0U A;  5E2G A;  1HLU P;  4HP9 A;  3H7W B;  2EX8 A;  5G18 A;  4GOG A;  1YSP A;  3E98 A;  2ZOH A;  5GHY A;  1OJ5 A;  3ZDJ A;  3FYZ A;  4NET A;  5GL9 A;  2H28 A;  1V9Z A;  3AGD A;  4WBG A;  4GLQ A;  4R3J A;  3BYD A;  3T12 B;  4PAU A;  2R78 A;  2JE5 A;  2XR0 A;  3OPL A;  2A3U A;  4QJG A;  3M2K A;  3D72 A;  4Q0J A;  3DAV A;  5KMW A;  5FSR A;  2P7J A;  1ESI A;  3G34 A;  3IHA A;  3IWQ A;  3BQ8 A;  3LY4 A;  4ARZ A;  4XUX A;  1XGJ A;  3PTE A;  2M1C A;  3VP4 A;  4P0M A;  2JN7 A;  4EQI A;  4EES A;  1VET A;  4PM6 A;  3CWF A;  3MZE A;  3NOP C;  4Q0H A;  3HLG A;  4L0L A;  4WEL A;  2ZC4 B;  2V1B A;  5CHJ A;  1ES3 A;  4EET B;  1HVB A;  3LO7 A;  4GKU A;  1MWT A;  1D06 A;  3LEZ A;  3VSK A;  2B95 A;  2PD8 A;  3V39 A;  3A0S A;  3IBJ A;  1DY6 A;  1F5M A;  5DJT A;  2ZC3 B;  3F1P A;  4UAA A;  1L0G A;  2EX9 A;  3V3R A;  1Q2P A;  2Y4A A;  1GHM A;  2EXB A;  3PBQ A;  5DVA A;  1LL8 A;  3BFF A;  3U4L P;  3ZNY A;  1NYM A;  3PBN A;  4GW9 A;  1MWS A;  4BD1 A;  2A24 B;  5FAP A;  3VOZ A;  3T4T A;  3NI9 A;  4R4R A;  4EQ1 A;  1ERQ A;  3MR0 A;  2JHE A;  2PR6 A;  2XSS A;  4GZB A;  4UQI M;  1VEU A;  5E2E A;  3NJA A;  1FCM A;  3MKE A;  4BMW A;  1E3U A;  1CEG A;  3PBS A;  2WK0 A;  2J3T C;  1RGY A;  5TBM B;  4E6W A;  1YLW A;  3O87 A;  1GA0 A;  2XGN A;  4MMN A;  2Y2I A;  4IVK A;  1BSG A;  3E2K A;  1YKD A;  5CGS A;  1W63 M;  1LHY A;  3G35 A;  4BD0 A;  1CQA A;  5LBR A;  2PRF A;  1PZP A;  3PR6 A;  1SDN A;  4KQQ A;  3C7V A;  5J3W A;  1IKI A;  3L9K A;  1N4O A;  3KSF A;  2WZX A;  3HRE A;  3MXS A;  4BWI A;  3E4P A;  2JKT I;  3GTC A;  5DTS A;  1KGF A;  5GHX A;  3ZVW A;  2K2N A;  1W8Q A;  3V3S A;  1PZO A;  3BEB A;  5FDH A;  3FPW A;  4OPY A;  1G6A A;  3E4Q A;  4GS9 A;  4EEU A;  2EWW A;  1JTG A;  3VV4 A;  1SKF A;  4DJ3 A;  4HEF A;  5L10 A;  1M40 A;  3BM6 A;  2IWC A;  2L4R A;  4CLC E;  1PIO A;  4K0W A;  3H7W A;  5AVE A;  2ZJ9 A;  5EFW A;  5MC7 A;  1EW0 A;  4HHD A;  4X1L A;  4P6Z S;  2Y2Q A;  2HP5 A;  3NDG A;  5CXW A;  2Y55 A;  3T4K A;  3T1X A;  4JLF A;  2ZQ9 A;  4PHT A;  3U2A A;  2HZ5 A;  4BQM A;  5L07 A;  3W4O A;  4KQO A;  1L0F A;  3BEC A;  4EUV A;  3G31 A;  1IEL A;  4IHQ A;  2W0N A;  1UWP X;  4BBV A;  2OWH A;  4OH0 A;  4E3L A;  1IOU A;  3NDE A;  1JWV A;  2X02 A;  2B18 A;  1K6R A;  5HPI A;  1DJC A;  1J9M A;  4DMZ A;  3OZH A;  3UDF A;  3FKV A;  2HF6 A;  4L9G A;  1H0M A;  4F94 A;  4JXW A;  4ZDX A;  4KG5 A;  2P04 A;  4HY8 A;  1PRQ A;  4H8R A;  5EE8 A;  3ZG7 B;  3ITB A;  2PU2 A;  3G6O A;  4DJ2 A;  4MN7 A;  2QMI A;  4PPR A;  3B47 A;  1YLP A;  3F1N B;  5FAQ A;  4WZ5 C;  1ESU A;  2J80 A;  3UE0 A;  4DE0 A;  2O9C A;  1SKO B;  1L2S A;  5HPF A;  3IF6 B;  3K2N A;  4DN0 A;  3QP6 A;  4HI4 A;  5FI7 A;  3S4X A;  2A24 A;  5A93 A;  4KZB A;  1CI8 A;  2KX6 A;  2I72 A;  3LIC A;  4LCL A;  2AVX A;  3GQZ A;  1VHM A;  3E2L A;  4FOF A;  1XA7 A;  2R9X A;  5G4Z A;  2PBD P;  3EOI A;  5TBM A;  4HP4 A;  2MJ6 A;  3HJI A;  4IUH A;  2Y2L A;  2OOL A;  3G2Y A;  3BY9 A;  2EA9 A;  1KE4 A;  5EOE A;  2VV6 A;  2OV5 A;  1MC0 A;  1T18 A;  2XK1 A;  4LCM A;  3CMZ A;  3RXW A;  3T4J A;  2CMN A;  2XD5 A;  1LL9 A;  3A3F A;  3HL9 A;  1NXY A;  3G4P A;  4C6Y A;  3ZG5 A;  3BQA A;  1KGE A;  3K3C A;  4HJ6 A;  3CUE A;  2EXA A;  1W79 A;  1NYY A;  2JKG A;  3M6B A;  1D7E A;  4WL9 A;  2V1Z A;  1MPL A;  4WYY A;  1NLY A;  3TJZ C;  3VE4 A;  3T4S A;  5HWW A;  3FZC A;  1T1C A;  3A0V A;  5AVF A;  1LSX A;  3VOL A;  4FUW A;  1H8Y A;  3JPU A;  2BAS A;  4MBF A;  3PYP A;  4OVD A;  2EFX A;  4LRY C;  1XPB A;  2VZW A;  4E3M A;  1K0K A;  3BLM A;  1IEM A;  5EM1 A;  3OC2 A;  2QPN A;  3C2W A;  3LFV A;  3L7H A;  5CGX A;  1X0O A;  2ACG A;  2PBY A;  3PAE A;  1ES4 A;  4G3K A;  1BT5 A;  2VGL M;  4M4X A;  1P97 A;  2V20 A;  1OME A;  4CLC B;  5CTN A;  1XJ4 A;  1BLH A;  2W1R A;  3LIE A;  5E2F A;  5EVI B;  1L3L A;  1IYQ A;  2O9A A;  4LV2 A;  1WA9 A;  1H8M A;  2WKE A;  4NXG A;  5EEC A;  3FPV A;  5HAR A;  4R38 A;  3T1S A;  2FFF B;  1OTD A;  4Y0U A;  1KVM A;  1BYW A;  3SS4 A;  1UWN X;  1V9Y A;  1CEF A;  3UB8 A;  4U3T A;  5F6A A;  2V2F F;  4JGQ A;  3G30 A;  5CED A;  4BL3 A;  3KYZ A;  5FEG A;  3RJU A;  4JGP A;  3SS3 A;  2B02 A;  4PMA A;  5KSC A;  1YM1 A;  1HTZ A;  2V8F A;  3QP4 A;  3LI9 A;  4YIN A;  2P9V B;  2XD1 A;  4DF6 A;  3KSG A;  5DFY A;  4GN2 A;  1LI9 A;  2Z6C A;  5TFQ A;  5L2F A;  1J3W A;  1TS8 A;  3CZD A;  5FQM A;  3ITA A;  3OOV A;  1BZA A;  5A90 A;  3GSG A;  3O3V A;  4JF4 A;  1SKO A;  5HAQ A;  2VLG A;  4R0Q A;  1NJ4 A;  2P08 A;  4O0P A;  3IF6 A;  5FAT A;  4DDS A;  2DNS A;  3MSH A;  4EUZ A;  3UB7 A;  5FI6 A;  5L8M A;  4OPQ A;  2OWJ A;  5GHZ A;  4MBH A;  1IYO A;  4WEJ A;  4PM7 A;  3RH8 B;  1DJA A;  4GCZ A;  2H0Y A;  1I5Q A;  4G3W A;  5KZH A;  5CEC A;  3V67 A;  2H0T A;  5DKK A;  4B88 A;  5HL6 A;  3T1Q B;  2J9O A;  3TRC A;  3C8C A;  2W1T B;  4HBU A;  1FSY A;  4N9L A;  4IBR A;  4YWZ A;  1DP8 A;  1ERM A;  4X68 A;  4KZ3 A;  2XFS A;  2DRW A;  3NC8 A;  4ME4 A;  2ZM0 A;  1G68 A;  4BBT A;  1MZU A;  1IFQ A;  3VP3 A;  2XRO A;  3UE3 A;  3CJM A;  5E43 A;  2ZL1 B;  2H10 A;  1S67 L;  3H9W A;  2XEP A;  1YMX A;  1M6K A;  3W8K A;  2K31 A;  4IJG A;  1ERO A;  4FTX A;  4QB8 A;  3QP5 A;  3OPP A;  5TGF A;  1MY8 A;  4OPZ A;  3ZYT A;  1S4S A;  4JF6 A;  1XFN A;  3HBR A;  4L9F A;  2IWD A;  4KZ7 A;  1KDW A;  1O7E A;  4OQH A;  4Y15 A;  1SDE A;  5KSH A;  5DFX A;  1QMF A;  1ZG6 A;  5G4Y A;  4OQG A;  1G5U A;  3TE8 A;  1N9B A;  4N1X A;  2UV0 E;  2PT7 A;  2M7U A;  4OOM A;  3IXH A;  4X53 A;  1XKZ A;  1JWP A;  2GZA A;  3IS2 B;  2NUT C;  3SOI A;  3ULF A;  4KZ4 A;  1SCW A;  1TEM A;  4O7D A;  1VQQ A;  4UHU A;  2NUP C;  5FEF A;  4NXB A;  1IYS A;  3D3O A;  3MKF A;  1LSV A;  1PWC A;  4OPR A;  4DDY A;  3NCK A;  1OT6 A;  3O5Y A;  4KZ5 A;  2P74 A;  1MKM A;  1G28 A;  3KYQ A;  1JTD A;  3LR5 A;  4AFI A;  2P9V A;  3V5M A;  4N1H A;  2WKQ A;  4EEP A;  1DRM A;  4DXC A;  3RFB A;  1ZTU A;  1ZG4 A;  4GDB A;  4WF0 A;  4EBN A;  2XFT A;  3DBA A;  4LV0 A;  4GD6 A;  2Y8H A;  5FQK A;  3MJQ A;  4EU0 A;  5KIZ A;  4D60 A;  4Z1W A;  3DTK A;  4KZ6 A;  4IED A;  5A8B A;  3QNC A;  4B4Z A;  3PXP A;  4OOL A;  3S22 A;  4X1M A;  1P9R A;  3N7W A;  4GHI B;  4O8G A;  3OPH A;  4S2I A;  2WZZ A;  4DRT A;  2JKT M;  3OBF A;  4IUK A;  5AJG A;  5AQA A;  4ZTK A;  5FAO A;  1XJ6 A;  2C6W B;  4H6J A;  3CPT B;  3HLC A;  2L0W A;  1TS7 A;  2W1T A;  1S1Z A;  2CC1 A;  3QHY A;  4KQR A;  1RGZ A;  1XGI A;  3CI6 A;  3T1R A;  1JWZ A;  4Q0I A;  3R4K A;  2WAD A;  5FDS A;  4JXG A;  4RYE A;  4XXR A;  2Q0O A;  3GR2 A;  1FQG A;  4LGW A;  4P87 A;  2ZL1 A;  3A3J A;  1OTE A;  4ZAM A;  3H82 B;  3P7N A;  1RP5 A;  3IHB A;  4GJ4 A;  4DE2 A;  3SH7 A;  2JKR I;  2LB5 A;  1CJF A;  4MEZ A;  1FIK A;  4MCW A;  2W3F A;  3DWZ A;  4JGR A;  2KLI A;  2HP6 A;  1LSW A;  4KUK A;  3MMH A;  3N8S A;  1XJ3 A;  2FH5 A;  1NRJ A;  1NWZ A;  2A49 A;  1YLT A;  1DP6 A;  3RXX A;  4ESP A;  3FKW A;  1TDL A;  3BFG A;  4JGO A;  3MZF A;  3ZNT A;  4FSF A;  2HJ9 C;  3RTY A;  4ID4 A;  3R7W B;  5J4E A;  4QPR A;  5HW3 A;  2QJ7 A;  2HJE A;  2WUQ A;  4LLO B;  5JYP A;  1Z09 A;  3UN7 A;  3HUM A;  1OTA A;  1VB6 A;  4ZBE A;  1KVL A;  1G6O A;  3Q7V B;  2VX8 A;  3Q07 A;  1VM1 A;  3LR4 A;  2WKP A;  3BWL A;  4U0X A;  4XUZ A;  3AGF A;  4WM9 A;  1WYC A;  3IQA A;  5AQ9 A;  3IXB A;  4UA6 A;  4JPM A;  3UE1 A;  2G2W A;  3UY6 A;  3QP2 A;  2HDQ A;  3GVB A;  1LLB A;  1S4R A;  2GX5 A;  1MWR A;  2HPB A;  1H3Q A;  1TDG A;  4X69 A;  5D3O A;  1KE0 A;  3IS2 A;  1S6R A;  2BG1 A;  4Y13 A;  2WKI A;  4HIA A;  4U0T A;  5M1A A;  3IBR A;  1EI5 A;  5HZH A;  4KZ8 A;  4XT2 B;  3BFE A;  2G2U A;  3LID A;  2OLV A;  3VP1 A;  1CK3 A;  1OPX A;  3FG8 A;  3CUE C;  3LGO A;  3EQV A;  3EGX C;  4E6X A;  3MQO A;  3B42 A;  2W3H A;  4EV4 A;  4R3B A;  2W3D A;  2K7S A;  3UPO A;  3UB5 P;  4UEY A;  4EWF A;  4FCF A;  3TOI A;  5C5K A;  4PKY G;  1YAX A;  4JKT A;  5DKL A;  3MBZ A;  3S1Y A;  4KEN B;  3GEC A;  4C75 A;  2XLN A;  4KZA A;  4HBT A;  3T4L A;  3LIB A;  4S2N A;  4LRX C;  4MLL A;  2ZBB A;  1I2S A;  2VK3 A;  3IF5 A;  4I3J A;  4EW7 A;  1UGU A;  3JVU A;  1BUL A;  5TR7 A;  4S2P A;  2ZM8 A;  4R4S A;  3S7Q A;  3C4P A;  2ZQC A;  2E8I A;  2WAF A;  4P6Z M;  3UMD A;  4KUO A;  5CER A;  4HH3 A;  4QWO A;  3VFH A;  4OQI A;  5HFO A;  2Y79 A;  1XXM A;  1ALQ A;  3N4I A;  2ZMF A;  3NIA A;  5CHU A;  4UA9 A;  1K55 C;  3H82 A;  3W2Z A;  4ZRR A;  2ZQA A;  1GSW A;  2QKP A;  2INW A;  4N9K A;  5L09 A;  1S1Y A;  3F1O B;  4IVI A;  1MXO A;  2PD7 A;  4PM9 A;  2D01 A;  4X25 A;  1YQS A;  1F2K A;  3NEC A;  2EX2 A;  2QZ6 A;  1FR1 A;  2M7V A;  4DKI A;  3IXD A;  4KZ9 A;  3Q7V A;  4EER A;  3IF6 C;  2ZQ8 A;  1N9N A;  4CLC D;  1PFL A;  1LT0 A;  3E0Y A;  1PW1 A;  1JVJ A;  4ETZ A;  3KSI A;  2Y2J A;  3V50 A;  1K55 A;  5EVI D;  3PBR A;  1W7F A;  4EBP A;  3ICY A;  3M6H A;  4II7 A;  4I3I A;  2HDS A;  4ETX A;  4FH4 A;  2G7U A;  4G3V A;  1A0K A;  3WS4 A;  1MBL A;  3LR3 A;  2Y2M A;  1KE3 A;  3F1N A;  4Y7P A;  4QD4 A;  2Z6D A;  2XH9 A;  3W4P A;  5A92 A;  1NZO A;  4HJ4 A;  2ZQ7 A;  4B9O A;  1DP9 A;  3ZG0 A;  3G32 A;  3WS5 A;  1F98 A;  5DF9 A;  2J3W A;  4S2J A;  2ZC6 B;  4BBU A;  3WS1 A;  5DF7 A;  3S7O A;  1K57 A;  3CG5 A;  1K54 C;  4B4X A;  5CX7 A;  5F68 A;  2Y91 A;  4F3L B;  4HH2 A;  4DE1 A;  4PKY A;  5CGW A;  1XJ2 A;  1YLY A;  1ES2 A;  3A3E A;  1JNU A;  1E25 A;  2O99 A;  3D4F A;  3ISG A;  2ZLY A;  5EOO A;  5FQ9 A;  4GB7 A;  4CPK A;  3JVV A;  4ZJ2 A;  1OTB A;  2HV1 A;  2V9A A;  3KO6 A;  3VFF A;  1K56 D;  5CEB A;  3VP2 A;  3LI8 A;  2QYB A;  3KSH A;  3B3X A;  4NG2 A;  1Y28 A;  1P9W A;  1LL5 A;  3IT9 A;  3NUL A;  2ZQD A;  3BJN A;  5HD3 A;  1FCO A;  4OKP A;  3LYX A;  1GSX A;  1YSQ A;  5GLD A;  1BLP A;  1XX2 A;  3UNW A;  4FD8 A;  1YT4 A;  3C7U A;  1K54 A;  4GS9 B;  3MS6 A;  1KDS A;  4D2O A;  1TF1 A;  3DTM A;  1AXB A;  4CLC C;  3C38 A;  2GDN A;  1P0Z A;  2I9V A;  2OLU A;  3VMA A;  3UDX A;  5EVI C;  3GV9 A;  2VJW A;  3N6I A;  2PHY A;  4R6L A;  3UPP A;  2WAE A;  3DW0 A;  3A3I A;  1E4D A;  2J3T D;  3EEH A;  4YFM A;  2B5R A;  5CTM A;  2HDU A;  2JCH A;  4IBX A;  5DTK A;  4LEN A;  1IKG A;  1F9I A;  5FI2 A;  3BW6 A;  4I39 A;  3IX3 A;  2IA2 A;  1TVF A;  3QP8 A;  1O07 A;  3IXG A;  3MFX A;  2PU4 A;  1N9O A;  3GRJ A;  2WGW B;  1QME A;  4NK3 A;  1C3B A;  3C30 A;  2UWX A;  1W63 Q;  3F1O A;  4WEK A;  1L0D A;  3ZGA B;  3MXR A;  3PBT A;  3C5A A;  3G2Z A;  4CLC A;  2X01 A;  4MBK A;  3OPR A;  4Y3I A;  1T1B A;  5FAS A;  3HVF A;  1WE4 A;  3PBO A;  5EVI A;  5FA7 A;  3UME A;  2XRN A;  1H5X A;  2VV8 A;  4WMC A;  4X56 A;  3ZHH A;  1GSV A;  5F5Y A;  5HX9 A;  1BLC A;  2EFU A;  2BLS A;  1S66 L;  1OT9 A;  3GDI A;  3WS0 A;  3DTI A;  3IX8 A;  3TW8 A;  2LB9 A;  2GNX A;  1WYB A;  3WWX A;  2PR5 A;  5DF8 A;  2Y2N A;  5JYO A;  1K4F A;  4UA7 A;  3NBL A;  3BY8 A;  4I5S A;  1YMS A;  2QJ5 A;  3CIT A;  4GD8 A;  4DXB A;  3IX4 A;  3FWL A;  5HSQ A;  3VSL A;  2PAV P;  2WYX A;  1STZ A;  1ACF A;  4WZ4 A;  2Y2O A;  4E3O A;  1K25 A;  1TD5 A;  3MF0 A;  4N92 A;  1PWG A;  1ZKJ A;  4R70 A;  2JBF A;  1FCN A;  1PYY A;  5HDC A;  5EUA A;  4OLD A;  3P09 A;  3KYE A;  2OAQ 1;  1XP4 A;  4K08 A;  4I38 A;  1TS6 A;  1K56 A;  5F1F A;  3HLB A;  2PDR A;  2PYP A;  4F3L A;  5IU1 A;  1KOU A;  2OSU A;  1FIL A;  2XQZ A;  4S2K A;  3K3D A;  3EEA A;  4OQ0 A;  5I94 A;  4BJP A;  4HNB A;  4QHC A;  3LCE A;  3IH8 A;  5GLB A;  2XF3 A;  1ONH A;  2W3G A;  3S7N A;  4JBF A;  3MFD A;  3WS2 A;  4O01 A;  4BLM A;  4R23 A;  3ZFZ A;  5FQQ A;  3MQQ A;  4Z9Q A;  4EXO A;  3DTE A;  2KOI A;  3Q81 A;  2O0Y A;  2Y2K A;  4E3N A;  3SH8 A;  2YKH A;  2QWS A;  4LFU A;  2FFY A;  5GLA A;  1FR6 A;  3CLO A;  3LIF A;  4R1G A;  1NLZ A;  3P01 A;  2W27 A;  4P6B A;  4S2O A;  2GJ3 A;  2V1A A;  4WUJ A;  4Y2F A;  2V8C A;  5F69 A;  1AWI A;  3T4Q A;  4GDN A;  3QP1 A;  4X6T A;  3E4O A;  1W5D A;  3OLO A;  1T19 A;  2JKR M;  4C3Q A;  3M2J A;  3LR0 A;  4HOI A;  1D1J A;  4KG6 A;  1ZHH B;  3GMW A;  4RVA A;  1FOF A;  3IWI A;  3EQU A;  4OON A;  5GLC A;  4QY6 A;  3HLF A;  2Y59 A;  5HAP A;  3ZG9 B;  5IS1 A;  4RX3 A;  3TSG A;  5HAI A;  3LEQ A;  3NOT C;  1ONG A;  3SH9 A;  5HDS A;  3UE6 A;  4BL2 A;  1XFQ A;  5F82 A;  3VE3 A;  3BRM A;  4OOY A;  2HP9 A;  3BLS A;  2R9W A;  1EWZ A;  1OJG A;  2WGW A;  5BOH A;  2VEA A;  1BTL A;  5J8X A;  1K4E A;  1NRF A;  5I5L A;  5IHV A;  3PAG A;  2X71 A;  1SHV A;  3TG9 A;  3WRZ A;  2Y2P A;  4QY5 A;  5EM0 A;  1W8Y A;  3HCY A;  3IH9 A;  5F83 A;  1HZO A;  3Q7Z A;  1OTI A;  4E04 A;  3NHQ A;  4B93 A;  2VGL S;  2JKF A;  2XDM A;  2PYR A;  2WKR A;  1N9L A;  3MXQ A;  4Y0T A;  4WN5 A;  2Q9N A;  5HWV A;  2J8Y A;  1ES5 A;  4LRZ E;  4S2M A;  1PI4 A;  1PNE A;  3ZG8 B;  4NXE A;  4S2N C;  1NZU A;  3MQ0 A;  1DJB A;  1Y54 A;  2DCF A;  1ODV A;  1KGG A;  2ZMV A;  4PM5 A;  4EBL A;  4K91 A;  2L1M A;  2C5W B;  3SW1 A;  2Z2M B;  1K38 A;  2V0W A;  2ZOI A;  2XA7 S;  1YPR A;  4JF5 A;  3BFC A;  4S2L A;  5IT5 A;  3ZQ5 A;  4LPZ A;  3HJK A;  3NY4 A;  4E3I A;  1Z6F A;  4HJ3 A;  4MNR A;  5CHM A;  4OLG A;  2VKS A;  5FL3 A;  5HD5 A;  2J7V A;  1H8Z A;  3LIA A;  5J7E A;  4R3A A;  3EWK A;  5EVE A;  1GA9 A;  3KX0 X;  4RX2 A;  5HDD A;  5E2H A;  4GHI A;  3CAX A;  2ZM2 A;  4WZ5 A;  3BFD A;  3DWK A;  2IWB A;  5F1G A;  3EGD C;  3JYI A;  2E8J A;  4Y5F A;  4NEE D;  5DJU A;  4CJN A;  3CPT A;  3NOU C;  3O88 A;  4RA7 A;  2EX6 A;  1GHP A;  3T4O A;  4M3K A;  4GNU A;  4PM8 A;  4HQA A;  3LY3 A;  5M18 A;  3PHY A;  1NY0 A;  5HWT A;  4LV3 A;  4JXV A;  1GHI A;  4LV1 A;  2WGI A;  5AQB A;  4DE3 A;  2A2L A;  3VP0 A;  3HLW A;  5EPH A;  4NKP A;  3HLE A;  5FQJ A;  4A5R A;  2ZC7 A;  2Q9M A;  1CF0 A;  3LUQ A;  4RQ9 A;  4KQD A;  3Q82 A;  4KG2 A;  3SZT A;  1XA1 A;  4E3K A;  4WLA A;  2RCX A;  2VV7 A;  5K5B A;  5AQ7 A;  4ARZ B;  4Q8I A;  1LI0 A;  3R7W A;  3SS5 A;  3OCL A;  2EWV A;  4OP5 A;  2O9B A;  1Y4O A;  1VET B;  3UDI A;  1I2W A;  1FSW A;  2D02 A;  3UO9 A;  2OAP 1;  3D9Y A;  2Z2L B;  4NXF A;  3UB9 A;  5U47 A;  3S7P A;  3T50 A;  2HGV A;  1K57 C;  3OCN A;  5EV0 A;  3C4O A;  4X55 A;  2FZ0 A;  3QNB A;  2QHK A;  3O86 A;  3Q1F A;  2RL3 A;  3F1P B;  4WMC D;  1RCJ A;  1L0E A;  3A3D A;  4MN5 A;  2VA0 A;  4MDZ A;  5FQI A;  4E3J A; 
#chains in the Genus database with same CATH homology
 3HUN A;  4RYE A;  2Y2G A;  3IWO A;  4XXR A;  2WGW B;  1Q2Q A;  1XA7 A;  4K0X A;  1QME A;  4NK3 A;  1C3B A;  4WEK A;  2UWX A;  2R9X A;  3GR2 A;  5CRF A;  1FQG A;  1L0D A;  1CI9 A;  1BUE A;  3ZGA B;  3MXR A;  3PBT A;  4P87 A;  3C5A A;  1GCE A;  3G2Z A;  2X01 A;  2Y2L A;  3G2Y A;  4DE2 A;  4MBK A;  3A3J A;  3OPR A;  2VGJ A;  3ZVT A;  4ZAM A;  1MWU A;  2ZMA A;  1RP5 A;  1KE4 A;  1YLZ A;  3IHB A;  1BLS A;  5EOE A;  3SH7 A;  2OV5 A;  1IYP A;  3HVF A;  3P98 A;  1WE4 A;  3PBO A;  4P85 A;  5EVI A;  2XK1 A;  4ZJ1 A;  3I7J A;  4LCM A;  3CMZ A;  3N8L A;  4MEZ A;  5FA7 A;  3RXW A;  4OP8 A;  2XD5 A;  1H5X A;  2ZC5 B;  3DWZ A;  3FV7 A;  1LL9 A;  3A3F A;  2HP6 A;  3HL9 A;  4WMC A;  4X56 A;  3ZHH A;  4Y0O A;  2ZD8 A;  1NXY A;  3WRT A;  3N8S A;  1YLJ A;  3ZCZ A;  5HX9 A;  2A49 A;  3G4P A;  4C6Y A;  1YLT A;  1BLC A;  4BEN A;  2EFU A;  2BLS A;  1PW8 A;  3RXX A;  3FKW A;  3ZG5 A;  1TDL A;  1KGE A;  1PI5 A;  5HL1 A;  3BFG A;  2EXA A;  3MZF A;  3WS0 A;  2WGV A;  3ZNT A;  3VOY A;  1W79 A;  1NYY A;  2Y2H A;  4FSF A;  3M6B A;  1MKI A;  4ID4 A;  2V1Z A;  3MZD A;  1WYB A;  4QU3 A;  3WWX A;  5HW3 A;  1MPL A;  1E3U D;  2WUQ A;  4HES A;  4WYY A;  5DF8 A;  2Y2N A;  5JYO A;  5JYP A;  1K4F A;  3W4Q A;  1S0W A;  3NBL A;  4UA7 A;  3UN7 A;  3HUO A;  4FH2 A;  3HUM A;  1HD8 A;  1YMS A;  4ZBE A;  1KVL A;  3Q7V B;  4GD8 A;  3Q07 A;  4DXB A;  1VM1 A;  3FWL A;  3FZC A;  3VSL A;  4U0X A;  2WYX A;  4XUZ A;  3AGF A;  1K6S A;  1U60 A;  4WM9 A;  4WZ4 A;  1WYC A;  2HDR A;  2Y2O A;  3IQA A;  4E3O A;  5AQ9 A;  3IXB A;  4UA6 A;  4ZJ3 A;  1H8Y A;  4JPM A;  3UE1 A;  1K25 A;  2G2W A;  4MBF A;  4OVD A;  2EFX A;  4N92 A;  3UY6 A;  2H5S A;  1PWG A;  3HLD A;  1ZKJ A;  2J9P A;  4JXS A;  2HDQ A;  2JBF A;  1XPB A;  1FCN A;  3GVB A;  1LLB A;  1PYY A;  4E3M A;  3N8R A;  3BLM A;  3UPN A;  1IEM A;  2JC7 A;  5EUA A;  1MWR A;  3OC2 A;  2HPB A;  1TDG A;  4X69 A;  2QPN A;  5D3O A;  4OLD A;  1ZC2 A;  1KE0 A;  3P09 A;  5CGX A;  2PBY A;  5A91 A;  5M19 A;  3PAE A;  1S6R A;  5EVL A;  3AGE A;  1ES4 A;  2BG1 A;  1PWD A;  2VGK A;  1BT5 A;  1XP4 A;  5DTT A;  2WKI A;  5F1F A;  1K56 A;  2V20 A;  3HLB A;  2WKH A;  1OME A;  4U0T A;  5CTN A;  5M1A A;  2OSU A;  1EI5 A;  5E2G A;  1BLH A;  4KZ8 A;  2XQZ A;  4S2K A;  5E2F A;  2EX8 A;  5G18 A;  4GOG A;  3BFE A;  5EVI B;  2G2U A;  1IYQ A;  4LV2 A;  2OLV A;  4OQ0 A;  5GHY A;  2WKE A;  5EEC A;  5HAR A;  3VP1 A;  3ZDJ A;  1CK3 A;  3FYZ A;  5I94 A;  4BJP A;  4NET A;  2FFF B;  3EQV A;  4QHC A;  3LCE A;  5GL9 A;  3AGD A;  3IH8 A;  4WBG A;  4Y0U A;  1KVM A;  2XF3 A;  5GLB A;  4E6X A;  3SS4 A;  1ONH A;  4R3J A;  3WS2 A;  4JBF A;  3BYD A;  3MFD A;  4EV4 A;  1CEF A;  4BLM A;  4R3B A;  2XR0 A;  2JE5 A;  3OPL A;  4U3T A;  4R23 A;  3ZFZ A;  5FQQ A;  2V2F F;  4Z9Q A;  2A3U A;  4QJG A;  3G30 A;  5CED A;  3M2K A;  4BL3 A;  3UPO A;  3Q81 A;  4E3N A;  2Y2K A;  3SH8 A;  4EWF A;  2FFY A;  3RJU A;  5GLA A;  1FR6 A;  5KMW A;  4FCF A;  5FSR A;  1ESI A;  3TOI A;  4R1G A;  3G34 A;  3IHA A;  3IWQ A;  3SS3 A;  4PMA A;  5KSC A;  3LY4 A;  1YM1 A;  1HTZ A;  4P6B A;  4S2O A;  4XUX A;  1XGJ A;  4YIN A;  4JKT A;  2P9V B;  2XD1 A;  3PTE A;  4DF6 A;  3VP4 A;  4GDN A;  3MBZ A;  4P0M A;  4X6T A;  4GN2 A;  1LI9 A;  4KEN B;  3S1Y A;  1W5D A;  4EQI A;  5TFQ A;  4PM6 A;  4C3Q A;  4C75 A;  2XLN A;  3M2J A;  5L2F A;  3MZE A;  4KZA A;  4HBT A;  3HLG A;  4S2N A;  4L0L A;  4MLL A;  4WEL A;  3CZD A;  2ZC4 B;  5CHJ A;  1ES3 A;  5FQM A;  1I2S A;  4KG6 A;  3ITA A;  1BZA A;  1HVB A;  3IF5 A;  3LO7 A;  4GKU A;  3GMW A;  4RVA A;  5A90 A;  3GSG A;  1FOF A;  1MWT A;  3IWI A;  3O3V A;  3EQU A;  4JF4 A;  5HAQ A;  4OON A;  5GLC A;  3LEZ A;  4R0Q A;  3VSK A;  1NJ4 A;  1BUL A;  3HLF A;  2Y59 A;  3IF6 A;  4QY6 A;  5FAT A;  5TR7 A;  4S2P A;  4DDS A;  2DNS A;  3V39 A;  5HAP A;  2ZM8 A;  4R4S A;  3ZG9 B;  4EUZ A;  1DY6 A;  4RX3 A;  5FI6 A;  3C4P A;  2ZQC A;  2E8I A;  2ZC3 B;  5HAI A;  2WAF A;  4OPQ A;  3TSG A;  4UAA A;  1L0G A;  2EX9 A;  3V3R A;  1Q2P A;  2Y4A A;  1GHM A;  2EXB A;  1ONG A;  3SH9 A;  5CER A;  5GHZ A;  3PBQ A;  5DVA A;  4MBH A;  3BFF A;  4BL2 A;  5F82 A;  1IYO A;  3BRM A;  4OOY A;  2HP9 A;  3VFH A;  3BLS A;  3ZNY A;  2R9W A;  4OQI A;  1NYM A;  5HFO A;  4WEJ A;  4PM7 A;  1EWZ A;  3PBN A;  2WGW A;  1DJA A;  1XXM A;  5BOH A;  1MWS A;  1BTL A;  1ALQ A;  2H0Y A;  1I5Q A;  5KZH A;  5J8X A;  5CEC A;  1K4E A;  2H0T A;  4B88 A;  4BD1 A;  1NRF A;  3N4I A;  5FAP A;  5IHV A;  3PAG A;  3VOZ A;  2X71 A;  3NI9 A;  2J9O A;  3NIA A;  4R4R A;  5CHU A;  1SHV A;  3TG9 A;  3WRZ A;  1ERQ A;  4HBU A;  1FSY A;  2Y2P A;  4N9L A;  4IBR A;  4QY5 A;  1K55 C;  1W8Y A;  1ERM A;  3IH9 A;  4UA9 A;  4GZB A;  4X68 A;  4KZ3 A;  5F83 A;  2XFS A;  2ZQA A;  1HZO A;  2DRW A;  3Q7Z A;  3NC8 A;  2ZM0 A;  5E2E A;  1FCM A;  3MKE A;  4N9K A;  1E3U A;  1CEG A;  1G68 A;  2XDM A;  3PBS A;  2WK0 A;  4IVI A;  3VP3 A;  1RGY A;  4Y0T A;  3UE3 A;  3CJM A;  5E43 A;  4E6W A;  1MXO A;  1YLW A;  3O87 A;  1GA0 A;  2Q9N A;  2H10 A;  2XGN A;  2J8Y A;  1ES5 A;  2XEP A;  4PM9 A;  2Y2I A;  4IVK A;  1BSG A;  1YMX A;  3E2K A;  4S2M A;  1M6K A;  1YQS A;  5CGS A;  1PI4 A;  2EX2 A;  2QZ6 A;  1LHY A;  3ZG8 B;  3W8K A;  1FR1 A;  3G35 A;  4BD0 A;  4S2N C;  1PZP A;  1ERO A;  1SDN A;  4KQQ A;  1NZU A;  1DJB A;  3C7V A;  4QB8 A;  1Y54 A;  1IKI A;  2DCF A;  4DKI A;  3IXD A;  1KGG A;  3OPP A;  1N4O A;  4KZ9 A;  3Q7V A;  4PM5 A;  2WZX A;  3HRE A;  3MXS A;  1MY8 A;  5TGF A;  3IF6 C;  2ZQ8 A;  4OPZ A;  3GTC A;  4EBL A;  5DTS A;  1KGF A;  1PW1 A;  4K91 A;  1JVJ A;  5GHX A;  2C5W B;  2Z2M B;  1K38 A;  4JF6 A;  3ZVW A;  2Y2J A;  3V50 A;  1K55 A;  1W8Q A;  5EVI D;  3HBR A;  3V3S A;  4JF5 A;  1PZO A;  2IWD A;  3BFC A;  3PBR A;  1W7F A;  3BEB A;  4KZ7 A;  4S2L A;  4EBP A;  3NY4 A;  3M6H A;  5FDH A;  4E3I A;  1KDW A;  1O7E A;  1Z6F A;  4OQH A;  4OPY A;  1G6A A;  4MNR A;  5CHM A;  4OLG A;  1SDE A;  2HDS A;  5KSH A;  1QMF A;  1ZG6 A;  4FH4 A;  4OQG A;  1JTG A;  2J7V A;  1H8Z A;  1N9B A;  3WS4 A;  1MBL A;  2Y2M A;  4N1X A;  1KE3 A;  1SKF A;  4HEF A;  4Y7P A;  1GA9 A;  1M40 A;  3BM6 A;  2XH9 A;  4QD4 A;  2IWC A;  3W4P A;  1NZO A;  5A92 A;  4OOM A;  2ZQ7 A;  3IXH A;  4X53 A;  1PIO A;  3ZG0 A;  4K0W A;  4RX2 A;  3G32 A;  5E2H A;  2ZJ9 A;  2ZM2 A;  3WS5 A;  1XKZ A;  1JWP A;  4WZ5 A;  3BFD A;  3DWK A;  2IWB A;  5F1G A;  5DF9 A;  4S2J A;  2ZC6 B;  3JYI A;  2Y2Q A;  3SOI A;  3WS1 A;  5DF7 A;  2HP5 A;  1K57 A;  4KZ4 A;  3NDG A;  1SCW A;  2Y55 A;  3CG5 A;  5CXW A;  4CJN A;  1TEM A;  1K54 C;  1VQQ A;  4O7D A;  4B4X A;  3O88 A;  4UHU A;  4JLF A;  4RA7 A;  2Y91 A;  2ZQ9 A;  2EX6 A;  1GHP A;  4BQM A;  1IYS A;  4M3K A;  3W4O A;  4GNU A;  4DE1 A;  4PM8 A;  4KQO A;  1L0F A;  5CGW A;  1YLY A;  3BEC A;  1ES2 A;  3LY3 A;  5M18 A;  1NY0 A;  3G31 A;  3MKF A;  4LV3 A;  4JXV A;  1IEL A;  1GHI A;  3A3E A;  3ISG A;  1E25 A;  1PWC A;  3D4F A;  5FQ9 A;  2ZLY A;  4LV1 A;  4OH0 A;  5EOO A;  4OPR A;  4DDY A;  3NCK A;  2WGI A;  4E3L A;  3NDE A;  4GB7 A;  5AQB A;  1JWV A;  4CPK A;  4DE3 A;  2X02 A;  4ZJ2 A;  1K6R A;  4KZ5 A;  2P74 A;  3VP0 A;  3HLW A;  5EPH A;  1DJC A;  1J9M A;  3HLE A;  5FQJ A;  4A5R A;  3OZH A;  3VFF A;  1K56 D;  2ZC7 A;  2Q9M A;  5CEB A;  3VP2 A;  3UDF A;  3FKV A;  1JTD A;  3B3X A;  1LL5 A;  2P9V A;  3IT9 A;  3V5M A;  4N1H A;  4F94 A;  3Q82 A;  4JXW A;  4KG2 A;  2ZQD A;  4ZDX A;  1FCO A;  4OKP A;  4DXC A;  1ZG4 A;  4KG5 A;  1XA1 A;  4E3K A;  5GLD A;  4GDB A;  1BLP A;  1XX2 A;  3UNW A;  4EBN A;  2XFT A;  4FD8 A;  4H8R A;  2RCX A;  1YT4 A;  3C7U A;  4LV0 A;  5EE8 A;  1K54 A;  4GD6 A;  3ZG7 B;  3ITB A;  5FQK A;  5AQ7 A;  1KDS A;  2PU2 A;  4D2O A;  4Q8I A;  1LI0 A;  3DTM A;  1AXB A;  4KZ6 A;  2QMI A;  3SS5 A;  4IED A;  3OCL A;  4OP5 A;  3QNC A;  4PPR A;  2GDN A;  4B4Z A;  3UDI A;  1YLP A;  1I2W A;  1FSW A;  5FAQ A;  4WZ5 C;  3UO9 A;  2OLU A;  3VMA A;  2Z2L B;  3UDX A;  5EVI C;  3GV9 A;  4OOL A;  3S22 A;  3N6I A;  5U47 A;  1ESU A;  3N7W A;  3UE0 A;  3UPP A;  4DE0 A;  2WAE A;  3DW0 A;  3A3I A;  1E4D A;  3OPH A;  4S2I A;  1K57 C;  5FAS A;  3OCN A;  4YFM A;  2WZZ A;  4DRT A;  2B5R A;  1L2S A;  3IF6 B;  5CTM A;  2HDU A;  2JCH A;  3C4O A;  4X55 A;  3QNB A;  5FI7 A;  3S4X A;  4IBX A;  5AQA A;  5DTK A;  3O86 A;  4KZB A;  1IKG A;  1CI8 A;  3Q1F A;  4LEN A;  4ZTK A;  5FAO A;  5A93 A;  5FI2 A;  2C6W B;  2RL3 A;  3HLC A;  4WMC D;  1RCJ A;  1L0E A;  2I72 A;  2CC1 A;  3A3D A;  3QHY A;  4LCL A;  1TVF A;  1RGZ A;  1XGI A;  4KQR A;  1O07 A;  3GQZ A;  1JWZ A;  3IXG A;  2PU4 A;  2WAD A;  5FQI A;  3E2L A;  4JXG A;  3GRJ A;  4E3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...