3BFDA

Crystal structure of the class a beta-lactamase sed-g238c mutant from citrobacter sedlakii
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
b'DVQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGACDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A beta-lactamase Sed1
publication title acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
molecule tags Hydrolase
total genus 97
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bfdA00
2V20A 1XGJA 4BQMA 4DE2A 2Y55A 5GHXA 5EPHA 4JXSA 5GLBA 4OOMA 2XLNA 3W8KA 1ESUA 1XXMA 3IF6A 3HLDA 5CHJA 3IF5A 1TEMA 2Y2NA 1ZC2A 5HW3A 4NETA 5FQ9A 3Q07A 4EWFA 3IHAA 4OPRA 1FCNA 3VOZA 4IVIA 4K91A 2Y4AA 3DW0A 2DRWA 2XK1A 3M2KA 3N8LA 3M6HA 2BLSA 1K54A 4OQ0A 5CTMA 4MBFA 4BL2A 3HLCA 3BFEA 1KGEA 1FR6A 3N6IA 3IF6C 3ZG8B 4ZDXA 3P98A 1XPBA 2EFXA 3NI9A 3V50A 2V1ZA 4K0WA 5HFOA 1K55C 5TFQA 4LV1A 5E2HA 4BD0A 3OC2A 3ZVWA 3O86A 4Q8IA 1EROA 3N4IA 5HX9A 3C7VA 4DF6A 3PBOA 1KDSA 1M6KA 2DNSA 1LLBA 5F1FA 1YLZA 3BFFA 4B4XA 4DKIA 1DJBA 4X69A 4ZJ1A 3I7JA 5E2FA 3WWXA 1ES3A 5FDHA 5M19A 4R4RA 2Y2GA 5AQ9A 2XGNA 3RXXA 4Y0OA 3WS0A 2WZXA 4WYYA 2ZM2A 4HBUA 2X01A 5A92A 1IYSA 1VQQA 5HAPA 3GMWA 1E25A 2ZC7A 2J9OA 1NYMA 4DDSA 4IVKA 2DCFA 2B5RA 3IXHA 3UPOA 3ZG7B 4R23A 4QB8A 1W5DA 3UE3A 4EBLA 1M40A 4BD1A 2Y59A 3Q7VB 3P09A 1IYOA 4P87A 1J9MA 3MZEA 3MZFA 4S2OA 2Y2HA 1PYYA 2HDRA 3ITAA 1XA7A 2WK0A 1WYCA 3GTCA 1H5XA 2WADA 1EI5A 4HEFA 5HAIA 4E6WA 4JPMA 1JTGA 2WGWA 4GOGA 2EXAA 4IBRA 3AGFA 4LCMA 2I72A 2J7VA 3LO7A 4DE1A 4EBPA 3GSGA 5E2GA 1LI9A 1TDGA 2ZQ8A 2VGKA 1W8YA 4JF6A 1RGYA 3S1YA 2R9XA 4GKUA 3WS2A 4JKTA 4R0QA 2XF3A 3BLMA 5DF8A 1PWCA 4X53A 2ZQAA 4KQOA 4RA7A 4HESA 1I2SA 1HVBA 2X02A 5CHMA 2Q9MA 2ZC4B 4PM6A 3O3VA 3GV9A 1RCJA 3SS3A 3G4PA 3HUMA 4X55A 5A90A 5FQIA 1TVFA 3SH8A 5CEBA 1DJAA 5FATA 1MXOA 3ISGA 2RL3A 2H5SA 4WELA 3IQAA 3IXBA 3ZG9B 2WGVA 3G30A 1JTDA 4BLMA 4JBFA 3ZVTA 5EVIA 3Q7ZA 5GHZA 1K25A 4NK3A 2XR0A 3HLBA 1BSGA 1IKGA 1YLYA 3LEZA 3N7WA 3S22A 2ZLYA 4QJGA 5FAQA 1ONGA 1Y54A 3O88A 2XD5A 4YFMA 1IYQA 2BG1A 2JE5A 1N4OA 2ZM0A 1ES5A 3UPPA 4E3OA 3VMAA 1W7FA 4Y0TA 5EVLA 3PBSA 5EVIC 2A49A 4KQQA 4E3IA 5GLAA 2V2FF 3ZNYA 1G68A 4ID4A 1N9BA 2WZZA 1YLJA 2Y91A 4EV4A 1PWDA 2P9VA 1K56D 3BFCA 5DVAA 4B88A 4C75A 4RYEA 4KENB 2ZC5B 1GA0A 3A3IA 3PTEA 3RJUA 4DE0A 5EOEA 3FV7A 1CI9A 1K55A 2EX2A 4YINA 5AQ7A 2XFTA 4FCFA 1ES4A 3SH9A 2XH9A 5E43A 1BUEA 1AXBA 2OV5A 1QMFA 2QZ6A 2EXBA 3EQUA 2PU2A 2XFSA 4JLFA 4OQHA 1L0DA 1FSWA 3MKEA 4M3KA 2OLVA 3IF6B 2P9VB 1ZG4A 4B4ZA 1NZUA 1PZPA 4S2KA 1H8YA 5FQMA 1PWGA 4MBHA 4WMCD 1MKIA 3VOYA 2IWDA 3ZG5A 3IXGA 3FYZA 1K6RA 4LV3A 5HAQA 5I94A 2XDMA 3OCLA 4FSFA 5IHVA 1YMSA 3LY4A 1YT4A 1GHIA 1HZOA 1ONHA 2WKIA 3AGEA 3VP0A 3NIAA 4JXWA 4Y7PA 4P0MA 2Z2LB 3ZNTA 1NY0A 1YQSA 1MBLA 4OQIA 2WKEA 3BLSA 1NZOA 2H0TA 1E3UD 2P74A 5F83A 4KZ5A 4ZJ3A 2XEPA 4S2IA 3PBNA 4WEJA 3MKFA 3E2LA 5CEDA 5CERA 1IELA 5U47A 3ZHHA 1MPLA 4RX2A 4EBNA 1ERMA 2WGIA 4UAAA 1VM1A 3DWKA 2EX9A 4OVDA 4OP5A 2JBFA 4A5RA 4JF4A 1DJCA 1BT5A 4DXBA 5EE8A 4UA9A 3EQVA 5CGXA 1XA1A 3IH8A 2IWCA 3WRTA 1BLPA 1YLWA 4ZAMA 5CGSA 4QU3A 4UA7A 4OOLA 3V39A 3BYDA 1IEMA 4P6BA 5FQQA 1MWTA 2OSUA 1KE3A 1XKZA 3CMZA 2WAFA 1O07A 4KZ9A 3FKWA 4U0XA 3RXWA 3UDXA 3OPLA 4LV0A 4XUXA 5FAPA 3C4OA 4ZTKA 1YM1A 3HLFA 3UY6A 3JYIA 5A91A 3N8RA 4RX3A 3HREA 1NXYA 3FKVA 4PM9A 3VSLA 4OONA 3HLEA 3MXRA 3HVFA 3QHYA 1KDWA 1YLTA 4E3KA 4OP8A 5CRFA 3WS1A 1K6SA 4X6TA 4E6XA 3Q82A 4EUZA 3OPPA 3BM6A 3OPHA 4UA6A 5FI7A 2Z2MB 2Y2JA 4GD6A 1IYPA 3UO9A 2EX8A 3M2JA 3DWZA 5L2FA 1BTLA 3MXSA 4WZ4A 3IWIA 4QD4A 1MWSA 1ALQA 2WGWB 4WZ5A 4MEZA 5HARA 1KGFA 3BECA 5FAOA 4U0TA 4GNUA 3ZDJA 1ERQA 3A3EA 3HLGA 5FASA 4X68A 4O7DA 1YMXA 3FWLA 3PAGA 2IWBA 4CJNA 4KZBA 1IKIA 2EX6A 1XGIA 2J8YA 1JVJA 5BOHA 3N8SA 4MLLA 3UE0A 5FSRA 4WZ5C 1GHMA 1L2SA 1G6AA 3A3FA 4PM8A 2E8IA 2Y2PA 3D4FA 4KZAA 2HP6A 3SS5A 1O7EA 3V5MA 4DRTA 1PW8A 1SHVA 4KG6A 5TGFA 1GHPA 5FQJA 1FOFA 2HDQA 1SDEA 3GVBA 5JYOA 1WYBA 3G35A 3VP4A 3C4PA 3NY4A 2C5WB 1CI8A 5EVIB 2CC1A 3G2YA 3WRZA 5M18A 3BFGA 1H8ZA 4WBGA 5CTNA 4D2OA 3VFHA 1RGZA 1TDLA 4QY6A 1I5QA 2ZC6B 3ITBA 5CGWA 3B3XA 4GDBA 3VFFA 3WS4A 1OMEA 1PI5A 3ZCZA 2UWXA 3TSGA 2G2WA 1XP4A 3Q81A 4E3MA 1KVMA 3GRJA 3IH9A 2Q9NA 2ZQ7A 2QMIA 4PPRA 2WKHA 4FH2A 1BLHA 4R3BA 1GCEA 3W4QA 3GR2A 2JC7A 2FFYA 3BEBA 3CG5A 5GLDA 1GA9A 3LY3A 2HPBA 1KE0A 1PZOA 1Q2PA 4GD8A 4P85A 3IHBA 3NCKA 4S2NC 4OOYA 5GLCA 5M1AA 1CEFA 3TG9A 3WS5A 1S6RA 1C3BA 3S4XA 1CEGA 3M6BA 3PBTA 3G32A 3OZHA 2GDNA 3A3JA 2FFFB 5CXWA 4XUZA 4C3QA 2ZQCA 1BULA 4L0LA 1JWPA 4BJPA 4GDNA 3VSKA 5F1GA 2X71A 5CHUA 2ZD8A 4E3JA 2ZJ9A 5A93A 5TR7A 1WE4A 1KE4A 2WUQA 4OLDA 5F82A 4BENA 3UN7A 4KZ7A 3SH7A 1NRFA 4LENA 3OCNA 4UHUA 4F94A 2PBYA 4KG5A 2OLUA 3IXDA 3O87A 1DY6A 3Q1FA 3PBQA 1MY8A 3MZDA 1KVLA 1KGGA 4PMAA 1FSYA 4XXRA 2Y2QA 4JF5A 4JXVA 2QPNA 1HD8A 1U60A 1FCOA 2ZQ9A 3W4OA 1K56A 1W8QA 1CK3A 1K54C 1NJ4A 3G2ZA 3HUOA 4HBTA 3V3SA 1K4FA 2VGJA 1ZG6A 1FQGA 4WEKA 2Y2IA 3G31A 2WAEA 2ZM8A 4S2JA 1RP5A 5DTKA 4H8RA 5G18A 1JWZA 4OQGA 3C5AA 3HLWA 3A3DA 4Z9QA 1ZKJA 4Y0UA 5EECA 2ZMAA 5FA7A 3GQZA 4KZ4A 1I2WA 4U3TA 3SOIA 2WYXA 1K4EA 3Q7VA 2RCXA 3CJMA 1L0GA 4R4SA 4S2PA 2XD1A 5E2EA 1PIOA 4R3JA 4EQIA 2PU4A 3UDIA 3G34A 1QMEA 5DF7A 5HL1A 5FI2A 2J9PA 2H0YA 4WMCA 1FR1A 1LI0A 5DF9A 5GL9A 4ZJ2A 4WM9A 4FD8A 3NDEA 4IBXA 4QY5A 4BL3A 3UPNA 2HP9A 5J8XA 3PAEA 4KZ6A 3E2KA 4MBKA 1HTZA 4QHCA 5EUAA 5EVID 2R9WA 4FH4A 4KQRA 3HUNA 4JXGA 3UDFA 3QNCA 2HDSA 4K0XA 3W4PA 4DDYA 2Y2MA 1Z6FA 2G2UA 3AGDA 4GN2A 4LCLA 3TOIA 3VP3A 3NBLA 2HP5A 1E3UA 1BLCA 3IWOA 4OKPA 1PW1A 4MNRA 4S2LA 1S0WA 1SCWA 5CECA 4GB7A 1W79A 2A3UA 4CPKA 4DXCA 4GZBA 3VP2A 3QNBA 3V3RA 2Y2OA 1L0EA 1LL5A 1K57A 3HBRA 5EOOA 4E3NA 1JWVA 2Y2KA 1PI4A 1BZAA 1K38A 3LCEA 3OPRA 4OPQA 3MFDA 4N92A 1MWUA 3DTMA 1BLSA 3HL9A 4S2MA 1MWRA 5DTSA 4N1HA 3C7UA 4OPZA 2H10A 1E4DA 2HDUA 1L0FA 2EFUA 4N9KA 2ZC3B 1LL9A 3ZFZA 1Q2QA 5KZHA 5KSCA 3NC8A 3UE1A 4OPYA 3NDGA 1ES2A 1XX2A 3CZDA 1YLPA 1K57C 3IT9A 2ZQDA 2C6WB 3BRMA 5DTTA 4KZ8A 3IWQA 2JCHA 3BFDA 4N9LA 4ZBEA 3VP1A 4N1XA 5KMWA 1SKFA 5GHYA 4OLGA 4R1GA 5AQBA 4PM5A 1NYYA 3PBRA 3FZCA 5D3OA 5FI6A 1ESIA 4OH0A 1LHYA 3SS4A 4LV2A 1EWZA 5AQAA 4C6YA 4KZ3A 4S2NA 5FQKA 1FCMA 4RVAA 4IEDA 3ZGAB 5KSHA 1SDNA 4DE3A 4E3LA 2XQZA 3UNWA 4PM7A 3ZG0A 3MBZA 4KG2A 5JYPA 4X56A 2Y2LA
chains in the Genus database with same CATH superfamily
4GCZA 2V20A 1XGJA 3MQ0A 4DE2A 2Y55A 5GHXA 5EPHA 3LFVA 4JXSA 4BBUA 1ESUA 1XXMA 5HWTA 1ZC2A 4LGWA 4EW7A 4HJ6A 4CLCB 3T50A 3Q07A 4NXGA 1BYWA 5HDDA 2DRWA 2XK1A 3M2KA 3N8LA 1FR6A 3N6IA 3IF6C 3CPTB 3P98A 1XPBA 1YAXA 4BD0A 3O86A 3PXPA 3FPWA 3C7VA 1Y28A 4F3LA 1PRQA 1KDSA 3BFFA 3E0YA 4XT2A 4DKIA 4ZJ1A 1L3LA 5FDHA 4R4RA 2Y2GA 2XGNA 3RXXA 2K7SA 4Y0OA 3WS0A 4WYYA 4HNBA 5HAPA 2M7VA 2ZC7A 2Z6CA 4Y13A 3CUEC 3NOTC 2B5RA 2GX5A 4R23A 3KYZA 4QB8A 1W5DA 3UE3A 4EBLA 5CX7A 2XRNA 3Q7VB 3P09A 1IYOA 2J3TD 3MZFA 2MJ6A 5DKKA 2W3GA 3ICYA 1S67L 1PNEA 1G5UA 1W63Q 4HEFA 4E6WA 4LRZE 2K2NA 2EXAA 2I72A 2J7VA 3LO7A 1LI9A 1TDGA 3EGDC 5F69A 3ULFA 4HI4A 2R9XA 1Y4OA 4JKTA 3MMHA 4X53A 4HESA 3C2WA 5MC7A 2X02A 2ZC4B 3O3VA 3GV9A 3BWLA 1RCJA 3S7NA 1UWPX 4X55A 5TJJA 5CEBA 5FATA 1MXOA 3BJNA 2RL3A 4ME4A 3ZVTA 3EOIA 3HLBA 4YWZA 1YLYA 1Y54A 3O88A 1KOUA 2LB5A 2KX6A 2G7UA 1ES5A 4P6ZM 3PBSA 2A49A 4KQQA 4E3IA 2V2FF 3RTYA 2WZZA 4EV4A 3MF0A 1PWDA 1X0OA 4O8GA 2ZC5B 1GA0A 2QHKA 4L9FA 3A3IA 5LBRA 3RJUA 1K55A 5AQ7A 1XFQA 4FOFA 2OOLA 3F1NA 3T1QB 2OV5A 2EXBA 2PU2A 4JLFA 4CQHA 4MBHA 3TE8A 3ZG5A 5I94A 2XDMA 3OCLA 4FSFA 1YMSA 1ONHA 2VV8A 5AVEA 2Z2LB 2O9CA 4OQIA 3LGOA 3BLSA 2XEPA 3LI9A 3PBNA 2Z6DA 4RX2A 1ERMA 2WGIA 4UAAA 4OVDA 1DP6A 4JF4A 2YKFA 4DXBA 1XJ6A 5EE8A 1CF0A 5CGXA 5IS1A 3PHYA 5CGSA 4QU3A 1IEMA 3C38A 2OSUA 4YOFA 4KZ9A 4U0XA 2O99A 3QP4A 4LV0A 3KSFA 5A91A 3BY9A 4OONA 3HLEA 5EVEA 5CRFA 4UA6A 1J3WA 2Z2MB 4GD6A 1IYPA 3L9KA 4JGOA 3IWIA 1ALQA 4WZ5A 3BECA 5FAOA 4U0TA 4GNUA 5AVFA 2WKPA 3NOUC 4O7DA 3PAGA 3FWLA 4PKYG 1T1CA 3N8SA 1H8MA 3GECA 1GHMA 1G6AA 3UB6A 2E8IA 3E98A 3SS5A 4DRTA 5TGFA 2V1AA 2HDQA 4G3KA 1V9YA 1VETA 3VE3A 4I3IA 3C4PA 1GSXA 2PD8A 2C5WB 3NY4A 5EVIB 2CC1A 5M18A 5DFXA 1NLYA 3F1PA 3VFFA 4GDBA 1FIKA 1PI5A 3T4TA 4E3MA 5F6AA 2QMIA 4FH2A 1BLHA 4Q0JA 1Z09A 1GA9A 3LY3A 3NULA 3PYPA 4DMZA 2ZOHA 1S6RA 3LR4A 2ZMFA 1N9NA 4CLCC 3PBTA 5CXWA 4C3QA 4ESPA 1JWPA 2ZD8A 2ZJ9A 3UB8A 1KE4A 2WUQA 3OOVA 1A0KA 3OCNA 3IXDA 1FSYA 2Y2QA 4JXVA 5HD3A 1U60A 1FCOA 3HJIA 3W4OA 4IJGA 3V3SA 2PBDP 3F1OA 4JGPA 3LR0A 2VGJA 3G31A 2WAEA 5G18A 1JWZA 3T12B 3BQ8A 1ZKJA 4HOIA 5FA7A 2ZMAA 5FEGA 3GQZA 1I2WA 4GHIB 1K4EA 2W3DA 2RCXA 1L0GA 4FTXA 4R4SA 5HL1A 3LICA 4G3VA 1LI0A 4ETXA 4BL3A 3NDEA 4IBXA 2INWA 3PAEA 2I9VA 3FPVA 4QHCA 5EUAA 4JXGA 2PR5A 4K0XA 1Z6FA 3AGDA 2PT7A 3TOIA 4PHTA 1S0WA 5CECA 4GB7A 4DXCA 4GW9A 2Y2OA 3LR5A 5EFWA 2PDRA 1K57A 1JWVA 1PI4A 3OPRA 4P6ZS 1TS7A 4S2MA 4N1HA 5I5LA 1DRMA 2EFUA 2ZC3B 3ZFZA 2ZL1A 1YLPA 3IT9A 2VJWA 3BRMA 4EESA 5DTTA 3H7WB 4KZ8A 3IWQA 3P7NA 2JCHA 3VP1A 4OLGA 1NYYA 2VV7A 5D3OA 3FZCA 1ESIA 4OH0A 1EWZA 5AQAA 1NWZA 3A0VA 4RVAA 1CQAA 4DE3A 3MSHA 2XQZA 5HWVA 3R7WB 1FILA 3IF6A 5CHJA 4HH2A 2Y2NA 5FQ9A 1MC0A 4GS9A 3IHAA 3MQOA 3DW0A 1K54A 5CTMA 4X1LA 3HLCA 3BFEA 2PAVP 1S4RA 3NI9A 1WA9A 3V50A 4K0WA 1T1AA 1LSXA 4JGQA 4EETB 1EROA 5HX9A 3RH8B 1OT9A 3CUEA 5F1FA 4PAUA 1DJBA 5M19A 1S66L 2XA7S 2ZM2A 4HBUA 5A92A 3G6OA 1IYSA 1MKMA 1SKOA 2QYBA 3IXHA 4Z1WA 2W1TA 4BD1A 5L8MA 3OLOA 2VK3A 4G3WA 4JPMA 2PYPA 3EWKA 4LCMA 4DE1A 4I39A 2K31A 1T18A 1P97A 3V67A 1XJ4A 1RGYA 3WS2A 2PHYA 4L9EA 5DF8A 4UQIM 4RA7A 1HVBA 2A24B 3G4PA 3HUMA 5FQIA 1TVFA 2H5SA 3IQAA 1XFNA 5GHZA 1D7EA 4NK3A 1BSGA 1IKGA 4MDZA 3LEZA 3N7WA 4QJGA 2VA0A 4YFMA 2BG1A 2L0WA 2JE5A 2ZM0A 4E3OA 3VMAA 1W7FA 1H0MA 5EVLA 5EVIC 4NXEA 1G68A 1N9BA 1YLJA 4C75A 2P9VA 3BFCA 4RYEA 5EOEA 3FV7A 2B95A 2XFTA 4EU0A 1ES4A 3SH9A 5E43A 1AXBA 4WLAA 1QMFA 2XFSA 4M3KA 2OLVA 3E4OA 4B4ZA 1NZUA 4S2KA 1PWGA 4WMCD 1MKIA 1VEUB 3FYZA 2D01A 3FG8A 3LY4A 1F5MA 3IX8A 3F1NB 1P0ZA 3ZNTA 1S4SA 1NY0A 1YQSA 1MBLA 4B9OA 1E3UD 4KZ5A 4S2IA 1OTAA 3MKFA 5CEDA 1MPLA 3VOLA 2QJ5A 3ZQ5A 3T4SA 4OP5A 2JBFA 4A5RA 1DJCA 3IX3A 1BT5A 5TBMA 1YLWA 4OOLA 4P6BA 5FQQA 1MWTA 2JKFA 1TD5A 2AVXA 3CMZA 2W27A 3MXQA 3OPLA 5FAPA 1YM1A 3HLFA 1OTIA 3JYIA 3N8RA 3HREA 3FKVA 4PM9A 1NLZA 1H3QA 1UGUA 3T4QA 1KDWA 2PR6A 4EUZA 4NXFA 3Q82A 3OPPA 3BM6A 3OPHA 3K3DA 3UO9A 3DWZA 5L2FA 1BTLA 2WGWB 1KGFA 2BASA 1G6OA 1ERQA 3A3EA 1OTBA 5FASA 2IWBA 4CJNA 1IKIA 1XGIA 2J8YA 5FSRA 5F68A 2Y2PA 3D4FA 1YPRA 4KZAA 1YSPA 1SHVA 4KG6A 1GHPA 5FQJA 1SDEA 3C30A 3G35A 1N9OA 3UB7A 4K08A 3G2YA 3W2ZA 3BFGA 3KSIA 1H8ZA 2J3TC 5CTNA 4D2OA 1TDLA 4QY6A 1I5QA 2ZC6B 3B3XA 2G2WA 1XP4A 4CLCA 2KDKA 2Q9NA 2ZQ7A 2O9BA 2V8CA 4EERA 3GR2A 3BEBA 3P01A 2HPBA 1Q2PA 4GD8A 4P85A 3IHBA 4S2NC 4OOYA 3WS5A 1OTDA 3S4XA 3G32A 3OZHA 3S7OA 3A3JA 4XUZA 1BULA 4L0LA 4BJPA 4GDNA 3MFXA 2X71A 5TR7A 1WE4A 2J80A 4O0PA 4BENA 2FZ0A 2OLUA 3KYQA 2HJ9C 3O87A 3FC7A 1DY6A 3PBQA 2OAQ1 3MZDA 1KGGA 2HZ5A 4XXRA 2QPNA 3A0SA 1HD8A 1K56A 5HD5A 4WL9A 2VKSA 1IFQA 1K4FA 4WEKA 1RP5A 5DTKA 4H8RA 1OJGA 4UEYA 3HLWA 3A3DA 4KZ4A 4U3TA 2WYXA 2H28A 3Q7VA 4UQIS 4S2PA 5E2EA 4EQIA 1QMEA 2BTFP 2J9PA 4ZJ2A 1FR1A 4QY5A 3UPNA 3QP6A 4KZ6A 1MZUA 4FH4A 4KQRA 3UDFA 3QNCA 2HDSA 4DDYA 3QP1A 4GJ4A 3VP3A 4EXOA 3NBLA 2HP5A 2XA7M 3IWOA 3IBRA 4CPKA 3LIBA 1L0EA 3LI8A 3HBRA 3SW1A 2XROA 2Y2KA 4Y15A 3MR0A 1MWRA 3U2AA 2HDUA 1L0FA 2ACGA 1Q2QA 5KZHA 5KSCA 3UE1A 3NDGA 1ES2A 1XX2A 3CZDA 2M7UA 3LEQA 2ZQDA 2C6WB 1IOUA 2V0WA 4NKPA 3VV4A 1DP9A 1FCMA 4IEDA 3ZGAB 5KSHA 5FEFA 3IBJA 1P9WA 3ZG0A 1OPXA 4X56A 1STZA 2Y2LA 4BQMA 5GLBA 3IS2B 4OOMA 3W8KA 5HW3A 4YNRA 4OPRA 3VOZA 4GLQA 4IUHA 4IVIA 3M6HA 3KX0X 4BL2A 2PD7A 4R6LA 4KUKA 3ZG8B 3E4QA 4AFIA 1LT0A 1K55C 4Q0HA 3OC2A 1YKDA 3L7HA 2GJ3A 4DF6A 1M6KA 1LLBA 1YLZA 4CLCE 3LR3A 4B4XA 3D3OA 4X69A 5E2FA 4ARZA 5AQ9A 1TF1A 2X01A 4HJ4A 1VQQA 1NRJA 3KSHA 3RFBA 1E25A 2J9OA 4DDSA 4IVKA 2DCFA 4HH3A 5KIZA 2FH5A 3TJZC 4P87A 4S2OA 2Y2HA 2NUPC 2HDRA 3D72A 1XA7A 3CI6A 3GTCA 1EI5A 5HAIA 2VZWA 1VHMA 4BMWA 5E2GA 2VGKA 3PR6A 1W8YA 4R0QA 2XF3A 1PWCA 2Y8HA 4Y5FA 1YSQA 1I2SA 2Q9MA 2KOIA 4HP4A 3SH8A 1DJAA 3K2NA 3ISGA 5HDSA 3IXBA 4BLMA 2WGVA 1JTDA 4JBFA 5EVIA 4ETZA 1K25A 3BW6A 3BQAA 5FAQA 2XD5A 1IYQA 3UMDA 3UPPA 3MQQA 4Y0TA 3CWFA 4ID4A 1ACFA 5DVAA 4LRYC 3PTEA 4FCFA 2XH9A 3HJKA 3MJQA 3S7PA 1BUEA 3EQUA 3H82A 1FSWA 2P9VB 3B42A 3HCYA 5DJUA 3C8CA 1H8YA 3VOYA 5A8BA 2IWDA 5HAQA 1K6RA 1VB6A 4HY8A 1YT4A 1GHIA 1HZOA 2WKIA 2OAP1 3AGEA 4JXWA 1ODVA 4P0MA 3NJAA 4LFUA 1AWIA 2H0TA 2P74A 2B02A 4PKYA 4ZJ3A 5CERA 2J3WA 1IELA 5U47A 4EBNA 4EQ1A 1VM1A 3D9YA 3DWKA 3EGXC 4F3LB 4UA9A 3EQVA 1XA1A 2IWCA 3WRTA 4XT2B 3CAXA 4EEUA 4I38A 3T1SA 4UA7A 4HJ3A 1KE3A 1XKZA 2NUTC 1T1BA 3FKWA 3UDXA 3UY6A 1NXYA 5TBMB 3MXRA 3HVFA 1LSWA 3QHYA 3WS1A 4E6XA 3LIEA 4X6TA 5F5YA 5FI7A 4IUKA 2Y2JA 3S7QA 2EX8A 1TS8A 2B18A 4HIAA 1S1ZA 2EA9A 3ZDJA 3HLGA 5HWWA 3H7WA 5J4EA 3DAVA 2W0NA 2EX6A 5BOHA 3UE0A 5J3WA 4O01A 3A3FA 5EM1A 1XJ2A 3V5MA 4I3AA 5HDCA 1PW8A 5JYOA 1WYBA 2GZAA 1CI8A 2O9AA 3WRZA 4WBGA 3R7WA 3VFHA 5CGWA 3H9WA 3LIDA 4IHQA 2UWXA 3TSGA 2Q0OA 3EEAA 3GRJA 3IH9A 4PPRA 2WKHA 4R3BA 2FFYA 3CG5A 5GLDA 1KE0A 1PZOA 4R38A 5M1AA 1CEFA 4B93A 2GDNA 2ZQCA 3VSKA 5CHUA 4E3JA 3SH7A 4QWOA 4LENA 4UHUA 4F94A 3KSGA 3Q1FA 2L1MA 1KVLA 2P08A 4JF5A 4L9GA 1W8QA 1CK3A 1K54C 1NJ4A 3HUOA 2IA2A 3O5YA 2CMNA 4HHDA 3DBAA 4QPRA 4Z9QA 1HLUP 4Y0UA 5EECA 5L07A 3CJMA 1XJ3A 3UDIA 3G34A 5DF7A 5GL9A 2JKTM 4WM9A 4BBTA 4FD8A 2HP9A 3E2KA 4MBKA 1D06A 4I3JA 1UWNX 5EV0A 2R9WA 5DFYA 3IX4A 2Y2MA 2G2UA 4GN2A 1BLCA 1PW1A 4S2LA 1SCWA 1W79A 2VV6A 4GZBA 3NECA 3VP2A 3QNBA 5L09A 4NXBA 3LYXA 2A24A 1BZAA 3LCEA 2JN7A 4OPQA 4MN6A 1MWUA 3DTMA 3HL9A 4OPZA 3C7UA 1E4DA 4N9KA 1TS0A 4OPYA 2GNXA 3T4LA 3TW8A 3CHWP 3BFDA 2HV1A 5KMWA 1SKFA 5G4YA 5C5KA 5AQBA 4H6JA 3PBRA 5FI6A 1F9IA 4R3AA 4ZRRA 4WUJA 2VGLM 3R4KA 4KZ3A 4HP9A 5FQKA 2OWJA 1VETB 4E3LA 4M4XA 4Y3IA 5JYPA 2D02A 3E4PA 3F1PB 4RQ9A 2XLNA 3HLDA 3CPTA 3IF5A 1TEMA 4E04A 3VE4A 4NETA 1VEUA 4EWFA 4I5SA 2QKPA 1FCNA 4K91A 2Y4AA 2BLSA 4OQ0A 2JKRM 4MBFA 1KGEA 4ZDXA 3UMEA 4Q0IA 2EFXA 2V1ZA 5HFOA 4DJ2A 5TFQA 4LV1A 2A2LA 5E2HA 5FL3A 1LSVA 3ZVWA 4Q8IA 3N4IA 4KUOA 3T4OA 3PBOA 2DNSA 4D60A 4BBVA 2V8FA 1V9ZA 3I7JA 3WWXA 1ES3A 2WZXA 3NHQA 3GMWA 1DP8A 4MN7A 1NYMA 3F1OB 2OWHA 1GSWA 2P7JA 1OTEA 3UPOA 3ZG7B 5IU1A 4ARZB 1M40A 2Y59A 1J9MA 3MZEA 1PYYA 1GSVA 3ITAA 4LLOB 2WK0A 1WYCA 1H5XA 2WADA 1JTGA 2WGWA 5FDSA 4GOGA 4IBRA 4HQAA 3AGFA 4EBPA 3GSGA 2ZQ8A 4JF6A 4LPZA 3S1YA 4GKUA 2XSSA 3BLMA 2ZQAA 4KQOA 5CHMA 4CLCD 4PM6A 2V0UA 3SS3A 5A90A 3UB5P 2HJEA 1ZTUA 4WELA 3ZG9B 3G30A 3DTKA 3QP5A 2ZL1B 5HZHA 3Q7ZA 4EUVA 2XR0A 3S22A 2ZLYA 1ONGA 1S1YA 1P9RA 3DTEA 4DN0A 1N4OA 3GDIA 2M1CA 4MMNA 1ZHHB 5GLAA 3ZNYA 2Y91A 4LRXC 4B88A 1K56D 4KQDA 4KENB 3JVUA 2R78A 4DE0A 1CI9A 2EX2A 4YINA 3U4LP 3UB9A 4X25A 2QZ6A 4OQHA 1L0DA 3MKEA 3IF6B 1ZG4A 1JNUA 1PZPA 5FQMA 3BY8A 2VLGA 3IXGA 4LV3A 4GS9B 5IHVA 3LUQA 5G4ZA 5HPIA 3B33A 3KO6A 3A0RA 3VP0A 4EEPA 1OJ5A 3NIAA 4Y17A 4Y7PA 5HL6A 5J7EA 2YKHA 3H82B 2WKEA 5HSQA 1NZOA 2W3FA 5F83A 2DMWA 4WEJA 3E2LA 3ZHHA 3B47A 2EX9A 3MS6A 3T4JA 3IH8A 1BLPA 1SZVA 4ZAMA 5AJGA 4BWIA 3V39A 3BYDA 1TS6A 4DJ3A 2WAFA 1O07A 1W63M 3RXWA 2ZBBA 3ZYTA 2W3EA 4XUXA 3C4OA 4ZTKA 1SKOB 4RX3A 3VSLA 2ZOIA 1F98A 1YLTA 4WN5A 4E3KA 4OP8A 2W1TB 1G28A 1K6SA 3EEHA 3CITA 3LIFA 3M2JA 3MXSA 4WZ4A 4QD4A 1MWSA 3KYEA 2VGLS 4MEZA 5K5BA 5HARA 3CLOA 2Y79A 4X68A 3JPUA 1YMXA 4KZBA 1JVJA 4MLLA 4WZ5C 1L2SA 4PM8A 2HP6A 2W1RA 1O7EA 2LB9A 5IT5A 2EWWA 2EWVA 1FOFA 3GVBA 1PFLA 3VP4A 1F2KA 2UV0E 3QP8A 1RGZA 3IS2A 3WS4A 3ITBA 1OMEA 2JKTI 3ZCZA 3Q81A 1KVMA 1K0KA 1GCEA 2V1BA 3W4QA 2JC7A 4WF0A 3NCKA 5GLCA 3TG9A 1C3BA 3JVVA 3SZTA 1CEGA 2PRFA 3M6BA 2FFFB 2HF6A 5F1GA 5A93A 2E8JA 4OLDA 5F82A 3UN7A 4KZ7A 5DKLA 1NRFA 2PBYA 4KG5A 3T1RA 1MY8A 3TRCA 4PMAA 4GHIA 1EW0A 2ZQ9A 3G2ZA 4HBTA 1ZG6A 1FQGA 2Y2IA 2ZM8A 4S2JA 4JGRA 4OQGA 3C5AA 3SOIA 4II7A 2XD1A 1PIOA 4R3JA 2PU4A 5FI2A 3DTIA 2H0YA 4WMCA 5DF9A 5J8XA 2KLIA 3UE6A 4R70A 1HTZA 5EVID 2V9AA 3HUNA 3W4PA 2QWSA 4LCLA 1T19A 3K3CA 3T1XA 1E3UA 4OKPA 4Y2FA 2JHEA 4MNRA 1N9LA 1D1JA 2A3UA 2PYRA 1OT6A 3V3RA 2W3HA 1LL5A 5EOOA 1CJFA 2JKRI 4E3NA 2O0YA 3QP2A 2WKQA 5HPFA 2VX8A 1K38A 3MFDA 2P04A 4N92A 1BLSA 5DTSA 3NOPC 2H10A 2WKRA 2QJ7A 4MN5A 1LL9A 3NC8A 3OBFA 1K57C 4FUWA 4MCWA 5L10A 1LL8A 2JKGA 4N9LA 4N1XA 5EM0A 4ZBEA 5GHYA 4R1GA 4PM5A 5DJTA 3LIAA 1LHYA 3SS4A 4LV2A 4C6YA 4S2NA 4NEED 2HGVA 4NG2A 1SDNA 3UNWA 4X1MA 2ZMVA 4PM7A 4H6JB 3MBZA 4KG2A 2VEAA 2L4RA 3T4KA
chains in the Genus database with same CATH topology
2V20A 1XGJA 4BQMA 4DE2A 2Y55A 5GHXA 5EPHA 4JXSA 5GLBA 4OOMA 2XLNA 3W8KA 1ESUA 1XXMA 3IF6A 3HLDA 5CHJA 3IF5A 1TEMA 2Y2NA 1ZC2A 5HW3A 4NETA 5FQ9A 3Q07A 4EWFA 3IHAA 4OPRA 1FCNA 3VOZA 4IVIA 4K91A 2Y4AA 3DW0A 2DRWA 2XK1A 3M2KA 3N8LA 3M6HA 2BLSA 1K54A 4OQ0A 5CTMA 4MBFA 4BL2A 3HLCA 3BFEA 1KGEA 1FR6A 3N6IA 3IF6C 3ZG8B 4ZDXA 3P98A 1XPBA 2EFXA 3NI9A 3V50A 2V1ZA 4K0WA 5HFOA 1K55C 5TFQA 4LV1A 5E2HA 4BD0A 3OC2A 3ZVWA 3O86A 4Q8IA 1EROA 3N4IA 5HX9A 3C7VA 4DF6A 3PBOA 1KDSA 1M6KA 2DNSA 1LLBA 5F1FA 1YLZA 3BFFA 4B4XA 4DKIA 1DJBA 4X69A 4ZJ1A 3I7JA 5E2FA 3WWXA 1ES3A 5FDHA 5M19A 4R4RA 2Y2GA 5AQ9A 2XGNA 3RXXA 4Y0OA 3WS0A 2WZXA 4WYYA 2ZM2A 4HBUA 2X01A 5A92A 1IYSA 1VQQA 5HAPA 3GMWA 1E25A 2ZC7A 2J9OA 1NYMA 4DDSA 4IVKA 2DCFA 2B5RA 3IXHA 3UPOA 3ZG7B 4R23A 4QB8A 1W5DA 3UE3A 4EBLA 1M40A 4BD1A 2Y59A 3Q7VB 3P09A 1IYOA 4P87A 1J9MA 3MZEA 3MZFA 4S2OA 2Y2HA 1PYYA 2HDRA 3ITAA 1XA7A 2WK0A 1WYCA 3GTCA 1H5XA 2WADA 1EI5A 4HEFA 5HAIA 4E6WA 4JPMA 1JTGA 2WGWA 4GOGA 2EXAA 4IBRA 3AGFA 4LCMA 2I72A 2J7VA 3LO7A 4DE1A 4EBPA 3GSGA 5E2GA 1LI9A 1TDGA 2ZQ8A 2VGKA 1W8YA 4JF6A 1RGYA 3S1YA 2R9XA 4GKUA 3WS2A 4JKTA 4R0QA 2XF3A 3BLMA 5DF8A 1PWCA 4X53A 2ZQAA 4KQOA 4RA7A 4HESA 1I2SA 1HVBA 2X02A 5CHMA 2Q9MA 2ZC4B 4PM6A 3O3VA 3GV9A 1RCJA 3SS3A 3G4PA 3HUMA 4X55A 5A90A 5FQIA 1TVFA 3SH8A 5CEBA 1DJAA 5FATA 1MXOA 3ISGA 2RL3A 2H5SA 4WELA 3IQAA 3IXBA 3ZG9B 2WGVA 3G30A 1JTDA 4BLMA 4JBFA 3ZVTA 5EVIA 3Q7ZA 5GHZA 1K25A 4NK3A 2XR0A 3HLBA 1BSGA 1IKGA 1YLYA 3LEZA 3N7WA 3S22A 2ZLYA 4QJGA 5FAQA 1ONGA 1Y54A 3O88A 2XD5A 4YFMA 1IYQA 2BG1A 2JE5A 1N4OA 2ZM0A 1ES5A 3UPPA 4E3OA 3VMAA 1W7FA 4Y0TA 5EVLA 3PBSA 5EVIC 2A49A 4KQQA 4E3IA 5GLAA 2V2FF 3ZNYA 1G68A 4ID4A 1N9BA 2WZZA 1YLJA 2Y91A 4EV4A 1PWDA 2P9VA 1K56D 3BFCA 5DVAA 4B88A 4C75A 4RYEA 4KENB 2ZC5B 1GA0A 3A3IA 3PTEA 3RJUA 4DE0A 5EOEA 3FV7A 1CI9A 1K55A 2EX2A 4YINA 5AQ7A 2XFTA 4FCFA 1ES4A 3SH9A 2XH9A 5E43A 1BUEA 1AXBA 2OV5A 1QMFA 2QZ6A 2EXBA 3EQUA 2PU2A 2XFSA 4JLFA 4OQHA 1L0DA 1FSWA 3MKEA 4M3KA 2OLVA 3IF6B 2P9VB 1ZG4A 4B4ZA 1NZUA 1PZPA 4S2KA 1H8YA 5FQMA 1PWGA 4MBHA 4WMCD 1MKIA 3VOYA 2IWDA 3ZG5A 3IXGA 3FYZA 1K6RA 4LV3A 5HAQA 5I94A 2XDMA 3OCLA 4FSFA 5IHVA 1YMSA 3LY4A 1YT4A 1GHIA 1HZOA 1ONHA 2WKIA 3AGEA 3VP0A 3NIAA 4JXWA 4Y7PA 4P0MA 2Z2LB 3ZNTA 1NY0A 1YQSA 1MBLA 4OQIA 2WKEA 3BLSA 1NZOA 2H0TA 1E3UD 2P74A 5F83A 4KZ5A 4ZJ3A 2XEPA 4S2IA 3PBNA 4WEJA 3MKFA 3E2LA 5CEDA 5CERA 1IELA 5U47A 3ZHHA 1MPLA 4RX2A 4EBNA 1ERMA 2WGIA 4UAAA 1VM1A 3DWKA 2EX9A 4OVDA 4OP5A 2JBFA 4A5RA 4JF4A 1DJCA 1BT5A 4DXBA 5EE8A 4UA9A 3EQVA 5CGXA 1XA1A 3IH8A 2IWCA 3WRTA 1BLPA 1YLWA 4ZAMA 5CGSA 4QU3A 4UA7A 4OOLA 3V39A 3BYDA 1IEMA 4P6BA 5FQQA 1MWTA 2OSUA 1KE3A 1XKZA 3CMZA 2WAFA 1O07A 4KZ9A 3FKWA 4U0XA 3RXWA 3UDXA 3OPLA 4LV0A 4XUXA 5FAPA 3C4OA 4ZTKA 1YM1A 3HLFA 3UY6A 3JYIA 5A91A 3N8RA 4RX3A 3HREA 1NXYA 3FKVA 4PM9A 3VSLA 4OONA 3HLEA 3MXRA 3HVFA 3QHYA 1KDWA 1YLTA 4E3KA 4OP8A 5CRFA 3WS1A 1K6SA 4X6TA 4E6XA 3Q82A 4EUZA 3OPPA 3BM6A 3OPHA 4UA6A 5FI7A 2Z2MB 2Y2JA 4GD6A 1IYPA 3UO9A 2EX8A 3M2JA 3DWZA 5L2FA 1BTLA 3MXSA 4WZ4A 3IWIA 4QD4A 1MWSA 1ALQA 2WGWB 4WZ5A 4MEZA 5HARA 1KGFA 3BECA 5FAOA 4U0TA 4GNUA 3ZDJA 1ERQA 3A3EA 3HLGA 5FASA 4X68A 4O7DA 1YMXA 3FWLA 3PAGA 2IWBA 4CJNA 4KZBA 1IKIA 2EX6A 1XGIA 2J8YA 1JVJA 5BOHA 3N8SA 4MLLA 3UE0A 5FSRA 4WZ5C 1GHMA 1L2SA 1G6AA 3A3FA 4PM8A 2E8IA 2Y2PA 3D4FA 4KZAA 2HP6A 3SS5A 1O7EA 3V5MA 4DRTA 1PW8A 1SHVA 4KG6A 5TGFA 1GHPA 5FQJA 1FOFA 2HDQA 1SDEA 3GVBA 5JYOA 1WYBA 3G35A 3VP4A 3C4PA 3NY4A 2C5WB 1CI8A 5EVIB 2CC1A 3G2YA 3WRZA 5M18A 3BFGA 1H8ZA 4WBGA 5CTNA 4D2OA 3VFHA 1RGZA 1TDLA 4QY6A 1I5QA 2ZC6B 3ITBA 5CGWA 3B3XA 4GDBA 3VFFA 3WS4A 1OMEA 1PI5A 3ZCZA 2UWXA 3TSGA 2G2WA 1XP4A 3Q81A 4E3MA 1KVMA 3GRJA 3IH9A 2Q9NA 2ZQ7A 2QMIA 4PPRA 2WKHA 4FH2A 1BLHA 4R3BA 1GCEA 3W4QA 3GR2A 2JC7A 2FFYA 3BEBA 3CG5A 5GLDA 1GA9A 3LY3A 2HPBA 1KE0A 1PZOA 1Q2PA 4GD8A 4P85A 3IHBA 3NCKA 4S2NC 4OOYA 5GLCA 5M1AA 1CEFA 3TG9A 3WS5A 1S6RA 1C3BA 3S4XA 1CEGA 3M6BA 3PBTA 3G32A 3OZHA 2GDNA 3A3JA 2FFFB 5CXWA 4XUZA 4C3QA 2ZQCA 1BULA 4L0LA 1JWPA 4BJPA 4GDNA 3VSKA 5F1GA 2X71A 5CHUA 2ZD8A 4E3JA 2ZJ9A 5A93A 5TR7A 1WE4A 1KE4A 2WUQA 4OLDA 5F82A 4BENA 3UN7A 4KZ7A 3SH7A 1NRFA 4LENA 3OCNA 4UHUA 4F94A 2PBYA 4KG5A 2OLUA 3IXDA 3O87A 1DY6A 3Q1FA 3PBQA 1MY8A 3MZDA 1KVLA 1KGGA 4PMAA 1FSYA 4XXRA 2Y2QA 4JF5A 4JXVA 2QPNA 1HD8A 1U60A 1FCOA 2ZQ9A 3W4OA 1K56A 1W8QA 1CK3A 1K54C 1NJ4A 3G2ZA 3HUOA 4HBTA 3V3SA 1K4FA 2VGJA 1ZG6A 1FQGA 4WEKA 2Y2IA 3G31A 2WAEA 2ZM8A 4S2JA 1RP5A 5DTKA 4H8RA 5G18A 1JWZA 4OQGA 3C5AA 3HLWA 3A3DA 4Z9QA 1ZKJA 4Y0UA 5EECA 2ZMAA 5FA7A 3GQZA 4KZ4A 1I2WA 4U3TA 3SOIA 2WYXA 1K4EA 3Q7VA 2RCXA 3CJMA 1L0GA 4R4SA 4S2PA 2XD1A 5E2EA 1PIOA 4R3JA 4EQIA 2PU4A 3UDIA 3G34A 1QMEA 5DF7A 5HL1A 5FI2A 2J9PA 2H0YA 4WMCA 1FR1A 1LI0A 5DF9A 5GL9A 4ZJ2A 4WM9A 4FD8A 3NDEA 4IBXA 4QY5A 4BL3A 3UPNA 2HP9A 5J8XA 3PAEA 4KZ6A 3E2KA 4MBKA 1HTZA 4QHCA 5EUAA 5EVID 2R9WA 4FH4A 4KQRA 3HUNA 4JXGA 3UDFA 3QNCA 2HDSA 4K0XA 3W4PA 4DDYA 2Y2MA 1Z6FA 2G2UA 3AGDA 4GN2A 4LCLA 3TOIA 3VP3A 3NBLA 2HP5A 1E3UA 1BLCA 3IWOA 4OKPA 1PW1A 4MNRA 4S2LA 1S0WA 1SCWA 5CECA 4GB7A 1W79A 2A3UA 4CPKA 4DXCA 4GZBA 3VP2A 3QNBA 3V3RA 2Y2OA 1L0EA 1LL5A 1K57A 3HBRA 5EOOA 4E3NA 1JWVA 2Y2KA 1PI4A 1BZAA 1K38A 3LCEA 3OPRA 4OPQA 3MFDA 4N92A 1MWUA 3DTMA 1BLSA 3HL9A 4S2MA 1MWRA 5DTSA 4N1HA 3C7UA 4OPZA 2H10A 1E4DA 2HDUA 1L0FA 2EFUA 4N9KA 2ZC3B 1LL9A 3ZFZA 1Q2QA 5KZHA 5KSCA 3NC8A 3UE1A 4OPYA 3NDGA 1ES2A 1XX2A 3CZDA 1YLPA 1K57C 3IT9A 2ZQDA 2C6WB 3BRMA 5DTTA 4KZ8A 3IWQA 2JCHA 3BFDA 4N9LA 4ZBEA 3VP1A 4N1XA 5KMWA 1SKFA 5GHYA 4OLGA 4R1GA 5AQBA 4PM5A 1NYYA 3PBRA 3FZCA 5D3OA 5FI6A 1ESIA 4OH0A 1LHYA 3SS4A 4LV2A 1EWZA 5AQAA 4C6YA 4KZ3A 4S2NA 5FQKA 1FCMA 4RVAA 4IEDA 3ZGAB 5KSHA 1SDNA 4DE3A 4E3LA 2XQZA 3UNWA 4PM7A 3ZG0A 3MBZA 4KG2A 5JYPA 4X56A 2Y2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V20 A;  1XGJ A;  4BQM A;  4DE2 A;  2Y55 A;  5GHX A;  5EPH A;  4JXS A;  5GLB A;  4OOM A;  2XLN A;  3W8K A;  1ESU A;  1XXM A;  3IF6 A;  3HLD A;  5CHJ A;  3IF5 A;  1TEM A;  2Y2N A;  1ZC2 A;  5HW3 A;  4NET A;  5FQ9 A;  3Q07 A;  4EWF A;  3IHA A;  4OPR A;  1FCN A;  3VOZ A;  4IVI A;  4K91 A;  2Y4A A;  3DW0 A;  2DRW A;  2XK1 A;  3M2K A;  3N8L A;  3M6H A;  2BLS A;  1K54 A;  4OQ0 A;  5CTM A;  4MBF A;  4BL2 A;  3HLC A;  3BFE A;  1KGE A;  1FR6 A;  3N6I A;  3IF6 C;  3ZG8 B;  4ZDX A;  3P98 A;  1XPB A;  2EFX A;  3NI9 A;  3V50 A;  2V1Z A;  4K0W A;  5HFO A;  1K55 C;  5TFQ A;  4LV1 A;  5E2H A;  4BD0 A;  3OC2 A;  3ZVW A;  3O86 A;  4Q8I A;  1ERO A;  3N4I A;  5HX9 A;  3C7V A;  4DF6 A;  3PBO A;  1KDS A;  1M6K A;  2DNS A;  1LLB A;  5F1F A;  1YLZ A;  3BFF A;  4B4X A;  4DKI A;  1DJB A;  4X69 A;  4ZJ1 A;  3I7J A;  5E2F A;  3WWX A;  1ES3 A;  5FDH A;  5M19 A;  4R4R A;  2Y2G A;  5AQ9 A;  2XGN A;  3RXX A;  4Y0O A;  3WS0 A;  2WZX A;  4WYY A;  2ZM2 A;  4HBU A;  2X01 A;  5A92 A;  1IYS A;  1VQQ A;  5HAP A;  3GMW A;  1E25 A;  2ZC7 A;  2J9O A;  1NYM A;  4DDS A;  4IVK A;  2DCF A;  2B5R A;  3IXH A;  3UPO A;  3ZG7 B;  4R23 A;  4QB8 A;  1W5D A;  3UE3 A;  4EBL A;  1M40 A;  4BD1 A;  2Y59 A;  3Q7V B;  3P09 A;  1IYO A;  4P87 A;  1J9M A;  3MZE A;  3MZF A;  4S2O A;  2Y2H A;  1PYY A;  2HDR A;  3ITA A;  1XA7 A;  2WK0 A;  1WYC A;  3GTC A;  1H5X A;  2WAD A;  1EI5 A;  4HEF A;  5HAI A;  4E6W A;  4JPM A;  1JTG A;  2WGW A;  4GOG A;  2EXA A;  4IBR A;  3AGF A;  4LCM A;  2I72 A;  2J7V A;  3LO7 A;  4DE1 A;  4EBP A;  3GSG A;  5E2G A;  1LI9 A;  1TDG A;  2ZQ8 A;  2VGK A;  1W8Y A;  4JF6 A;  1RGY A;  3S1Y A;  2R9X A;  4GKU A;  3WS2 A;  4JKT A;  4R0Q A;  2XF3 A;  3BLM A;  5DF8 A;  1PWC A;  4X53 A;  2ZQA A;  4KQO A;  4RA7 A;  4HES A;  1I2S A;  1HVB A;  2X02 A;  5CHM A;  2Q9M A;  2ZC4 B;  4PM6 A;  3O3V A;  3GV9 A;  1RCJ A;  3SS3 A;  3G4P A;  3HUM A;  4X55 A;  5A90 A;  5FQI A;  1TVF A;  3SH8 A;  5CEB A;  1DJA A;  5FAT A;  1MXO A;  3ISG A;  2RL3 A;  2H5S A;  4WEL A;  3IQA A;  3IXB A;  3ZG9 B;  2WGV A;  3G30 A;  1JTD A;  4BLM A;  4JBF A;  3ZVT A;  5EVI A;  3Q7Z A;  5GHZ A;  1K25 A;  4NK3 A;  2XR0 A;  3HLB A;  1BSG A;  1IKG A;  1YLY A;  3LEZ A;  3N7W A;  3S22 A;  2ZLY A;  4QJG A;  5FAQ A;  1ONG A;  1Y54 A;  3O88 A;  2XD5 A;  4YFM A;  1IYQ A;  2BG1 A;  2JE5 A;  1N4O A;  2ZM0 A;  1ES5 A;  3UPP A;  4E3O A;  3VMA A;  1W7F A;  4Y0T A;  5EVL A;  3PBS A;  5EVI C;  2A49 A;  4KQQ A;  4E3I A;  5GLA A;  2V2F F;  3ZNY A;  1G68 A;  4ID4 A;  1N9B A;  2WZZ A;  1YLJ A;  2Y91 A;  4EV4 A;  1PWD A;  2P9V A;  1K56 D;  3BFC A;  5DVA A;  4B88 A;  4C75 A;  4RYE A;  4KEN B;  2ZC5 B;  1GA0 A;  3A3I A;  3PTE A;  3RJU A;  4DE0 A;  5EOE A;  3FV7 A;  1CI9 A;  1K55 A;  2EX2 A;  4YIN A;  5AQ7 A;  2XFT A;  4FCF A;  1ES4 A;  3SH9 A;  2XH9 A;  5E43 A;  1BUE A;  1AXB A;  2OV5 A;  1QMF A;  2QZ6 A;  2EXB A;  3EQU A;  2PU2 A;  2XFS A;  4JLF A;  4OQH A;  1L0D A;  1FSW A;  3MKE A;  4M3K A;  2OLV A;  3IF6 B;  2P9V B;  1ZG4 A;  4B4Z A;  1NZU A;  1PZP A;  4S2K A;  1H8Y A;  5FQM A;  1PWG A;  4MBH A;  4WMC D;  1MKI A;  3VOY A;  2IWD A;  3ZG5 A;  3IXG A;  3FYZ A;  1K6R A;  4LV3 A;  5HAQ A;  5I94 A;  2XDM A;  3OCL A;  4FSF A;  5IHV A;  1YMS A;  3LY4 A;  1YT4 A;  1GHI A;  1HZO A;  1ONH A;  2WKI A;  3AGE A;  3VP0 A;  3NIA A;  4JXW A;  4Y7P A;  4P0M A;  2Z2L B;  3ZNT A;  1NY0 A;  1YQS A;  1MBL A;  4OQI A;  2WKE A;  3BLS A;  1NZO A;  2H0T A;  1E3U D;  2P74 A;  5F83 A;  4KZ5 A;  4ZJ3 A;  2XEP A;  4S2I A;  3PBN A;  4WEJ A;  3MKF A;  3E2L A;  5CED A;  5CER A;  1IEL A;  5U47 A;  3ZHH A;  1MPL A;  4RX2 A;  4EBN A;  1ERM A;  2WGI A;  4UAA A;  1VM1 A;  3DWK A;  2EX9 A;  4OVD A;  4OP5 A;  2JBF A;  4A5R A;  4JF4 A;  1DJC A;  1BT5 A;  4DXB A;  5EE8 A;  4UA9 A;  3EQV A;  5CGX A;  1XA1 A;  3IH8 A;  2IWC A;  3WRT A;  1BLP A;  1YLW A;  4ZAM A;  5CGS A;  4QU3 A;  4UA7 A;  4OOL A;  3V39 A;  3BYD A;  1IEM A;  4P6B A;  5FQQ A;  1MWT A;  2OSU A;  1KE3 A;  1XKZ A;  3CMZ A;  2WAF A;  1O07 A;  4KZ9 A;  3FKW A;  4U0X A;  3RXW A;  3UDX A;  3OPL A;  4LV0 A;  4XUX A;  5FAP A;  3C4O A;  4ZTK A;  1YM1 A;  3HLF A;  3UY6 A;  3JYI A;  5A91 A;  3N8R A;  4RX3 A;  3HRE A;  1NXY A;  3FKV A;  4PM9 A;  3VSL A;  4OON A;  3HLE A;  3MXR A;  3HVF A;  3QHY A;  1KDW A;  1YLT A;  4E3K A;  4OP8 A;  5CRF A;  3WS1 A;  1K6S A;  4X6T A;  4E6X A;  3Q82 A;  4EUZ A;  3OPP A;  3BM6 A;  3OPH A;  4UA6 A;  5FI7 A;  2Z2M B;  2Y2J A;  4GD6 A;  1IYP A;  3UO9 A;  2EX8 A;  3M2J A;  3DWZ A;  5L2F A;  1BTL A;  3MXS A;  4WZ4 A;  3IWI A;  4QD4 A;  1MWS A;  1ALQ A;  2WGW B;  4WZ5 A;  4MEZ A;  5HAR A;  1KGF A;  3BEC A;  5FAO A;  4U0T A;  4GNU A;  3ZDJ A;  1ERQ A;  3A3E A;  3HLG A;  5FAS A;  4X68 A;  4O7D A;  1YMX A;  3FWL A;  3PAG A;  2IWB A;  4CJN A;  4KZB A;  1IKI A;  2EX6 A;  1XGI A;  2J8Y A;  1JVJ A;  5BOH A;  3N8S A;  4MLL A;  3UE0 A;  5FSR A;  4WZ5 C;  1GHM A;  1L2S A;  1G6A A;  3A3F A;  4PM8 A;  2E8I A;  2Y2P A;  3D4F A;  4KZA A;  2HP6 A;  3SS5 A;  1O7E A;  3V5M A;  4DRT A;  1PW8 A;  1SHV A;  4KG6 A;  5TGF A;  1GHP A;  5FQJ A;  1FOF A;  2HDQ A;  1SDE A;  3GVB A;  5JYO A;  1WYB A;  3G35 A;  3VP4 A;  3C4P A;  3NY4 A;  2C5W B;  1CI8 A;  5EVI B;  2CC1 A;  3G2Y A;  3WRZ A;  5M18 A;  3BFG A;  1H8Z A;  4WBG A;  5CTN A;  4D2O A;  3VFH A;  1RGZ A;  1TDL A;  4QY6 A;  1I5Q A;  2ZC6 B;  3ITB A;  5CGW A;  3B3X A;  4GDB A;  3VFF A;  3WS4 A;  1OME A;  1PI5 A;  3ZCZ A;  2UWX A;  3TSG A;  2G2W A;  1XP4 A;  3Q81 A;  4E3M A;  1KVM A;  3GRJ A;  3IH9 A;  2Q9N A;  2ZQ7 A;  2QMI A;  4PPR A;  2WKH A;  4FH2 A;  1BLH A;  4R3B A;  1GCE A;  3W4Q A;  3GR2 A;  2JC7 A;  2FFY A;  3BEB A;  3CG5 A;  5GLD A;  1GA9 A;  3LY3 A;  2HPB A;  1KE0 A;  1PZO A;  1Q2P A;  4GD8 A;  4P85 A;  3IHB A;  3NCK A;  4S2N C;  4OOY A;  5GLC A;  5M1A A;  1CEF A;  3TG9 A;  3WS5 A;  1S6R A;  1C3B A;  3S4X A;  1CEG A;  3M6B A;  3PBT A;  3G32 A;  3OZH A;  2GDN A;  3A3J A;  2FFF B;  5CXW A;  4XUZ A;  4C3Q A;  2ZQC A;  1BUL A;  4L0L A;  1JWP A;  4BJP A;  4GDN A;  3VSK A;  5F1G A;  2X71 A;  5CHU A;  2ZD8 A;  4E3J A;  2ZJ9 A;  5A93 A;  5TR7 A;  1WE4 A;  1KE4 A;  2WUQ A;  4OLD A;  5F82 A;  4BEN A;  3UN7 A;  4KZ7 A;  3SH7 A;  1NRF A;  4LEN A;  3OCN A;  4UHU A;  4F94 A;  2PBY A;  4KG5 A;  2OLU A;  3IXD A;  3O87 A;  1DY6 A;  3Q1F A;  3PBQ A;  1MY8 A;  3MZD A;  1KVL A;  1KGG A;  4PMA A;  1FSY A;  4XXR A;  2Y2Q A;  4JF5 A;  4JXV A;  2QPN A;  1HD8 A;  1U60 A;  1FCO A;  2ZQ9 A;  3W4O A;  1K56 A;  1W8Q A;  1CK3 A;  1K54 C;  1NJ4 A;  3G2Z A;  3HUO A;  4HBT A;  3V3S A;  1K4F A;  2VGJ A;  1ZG6 A;  1FQG A;  4WEK A;  2Y2I A;  3G31 A;  2WAE A;  2ZM8 A;  4S2J A;  1RP5 A;  5DTK A;  4H8R A;  5G18 A;  1JWZ A;  4OQG A;  3C5A A;  3HLW A;  3A3D A;  4Z9Q A;  1ZKJ A;  4Y0U A;  5EEC A;  2ZMA A;  5FA7 A;  3GQZ A;  4KZ4 A;  1I2W A;  4U3T A;  3SOI A;  2WYX A;  1K4E A;  3Q7V A;  2RCX A;  3CJM A;  1L0G A;  4R4S A;  4S2P A;  2XD1 A;  5E2E A;  1PIO A;  4R3J A;  4EQI A;  2PU4 A;  3UDI A;  3G34 A;  1QME A;  5DF7 A;  5HL1 A;  5FI2 A;  2J9P A;  2H0Y A;  4WMC A;  1FR1 A;  1LI0 A;  5DF9 A;  5GL9 A;  4ZJ2 A;  4WM9 A;  4FD8 A;  3NDE A;  4IBX A;  4QY5 A;  4BL3 A;  3UPN A;  2HP9 A;  5J8X A;  3PAE A;  4KZ6 A;  3E2K A;  4MBK A;  1HTZ A;  4QHC A;  5EUA A;  5EVI D;  2R9W A;  4FH4 A;  4KQR A;  3HUN A;  4JXG A;  3UDF A;  3QNC A;  2HDS A;  4K0X A;  3W4P A;  4DDY A;  2Y2M A;  1Z6F A;  2G2U A;  3AGD A;  4GN2 A;  4LCL A;  3TOI A;  3VP3 A;  3NBL A;  2HP5 A;  1E3U A;  1BLC A;  3IWO A;  4OKP A;  1PW1 A;  4MNR A;  4S2L A;  1S0W A;  1SCW A;  5CEC A;  4GB7 A;  1W79 A;  2A3U A;  4CPK A;  4DXC A;  4GZB A;  3VP2 A;  3QNB A;  3V3R A;  2Y2O A;  1L0E A;  1LL5 A;  1K57 A;  3HBR A;  5EOO A;  4E3N A;  1JWV A;  2Y2K A;  1PI4 A;  1BZA A;  1K38 A;  3LCE A;  3OPR A;  4OPQ A;  3MFD A;  4N92 A;  1MWU A;  3DTM A;  1BLS A;  3HL9 A;  4S2M A;  1MWR A;  5DTS A;  4N1H A;  3C7U A;  4OPZ A;  2H10 A;  1E4D A;  2HDU A;  1L0F A;  2EFU A;  4N9K A;  2ZC3 B;  1LL9 A;  3ZFZ A;  1Q2Q A;  5KZH A;  5KSC A;  3NC8 A;  3UE1 A;  4OPY A;  3NDG A;  1ES2 A;  1XX2 A;  3CZD A;  1YLP A;  1K57 C;  3IT9 A;  2ZQD A;  2C6W B;  3BRM A;  5DTT A;  4KZ8 A;  3IWQ A;  2JCH A;  3BFD A;  4N9L A;  4ZBE A;  3VP1 A;  4N1X A;  5KMW A;  1SKF A;  5GHY A;  4OLG A;  4R1G A;  5AQB A;  4PM5 A;  1NYY A;  3PBR A;  3FZC A;  5D3O A;  5FI6 A;  1ESI A;  4OH0 A;  1LHY A;  3SS4 A;  4LV2 A;  1EWZ A;  5AQA A;  4C6Y A;  4KZ3 A;  4S2N A;  5FQK A;  1FCM A;  4RVA A;  4IED A;  3ZGA B;  5KSH A;  1SDN A;  4DE3 A;  4E3L A;  2XQZ A;  3UNW A;  4PM7 A;  3ZG0 A;  3MBZ A;  4KG2 A;  5JYP A;  4X56 A;  2Y2L A; 
#chains in the Genus database with same CATH topology
 4GCZ A;  2V20 A;  1XGJ A;  3MQ0 A;  4DE2 A;  2Y55 A;  5GHX A;  5EPH A;  3LFV A;  4JXS A;  4BBU A;  1ESU A;  1XXM A;  5HWT A;  1ZC2 A;  4LGW A;  4EW7 A;  4HJ6 A;  4CLC B;  3T50 A;  3Q07 A;  4NXG A;  1BYW A;  5HDD A;  2DRW A;  2XK1 A;  3M2K A;  3N8L A;  1FR6 A;  3N6I A;  3IF6 C;  3CPT B;  3P98 A;  1XPB A;  1YAX A;  4BD0 A;  3O86 A;  3PXP A;  3FPW A;  3C7V A;  1Y28 A;  4F3L A;  1PRQ A;  1KDS A;  3BFF A;  3E0Y A;  4XT2 A;  4DKI A;  4ZJ1 A;  1L3L A;  5FDH A;  4R4R A;  2Y2G A;  2XGN A;  3RXX A;  2K7S A;  4Y0O A;  3WS0 A;  4WYY A;  4HNB A;  5HAP A;  2M7V A;  2ZC7 A;  2Z6C A;  4Y13 A;  3CUE C;  3NOT C;  2B5R A;  2GX5 A;  4R23 A;  3KYZ A;  4QB8 A;  1W5D A;  3UE3 A;  4EBL A;  5CX7 A;  2XRN A;  3Q7V B;  3P09 A;  1IYO A;  2J3T D;  3MZF A;  2MJ6 A;  5DKK A;  2W3G A;  3ICY A;  1S67 L;  1PNE A;  1G5U A;  1W63 Q;  4HEF A;  4E6W A;  4LRZ E;  2K2N A;  2EXA A;  2I72 A;  2J7V A;  3LO7 A;  1LI9 A;  1TDG A;  3EGD C;  5F69 A;  3ULF A;  4HI4 A;  2R9X A;  1Y4O A;  4JKT A;  3MMH A;  4X53 A;  4HES A;  3C2W A;  5MC7 A;  2X02 A;  2ZC4 B;  3O3V A;  3GV9 A;  3BWL A;  1RCJ A;  3S7N A;  1UWP X;  4X55 A;  5TJJ A;  5CEB A;  5FAT A;  1MXO A;  3BJN A;  2RL3 A;  4ME4 A;  3ZVT A;  3EOI A;  3HLB A;  4YWZ A;  1YLY A;  1Y54 A;  3O88 A;  1KOU A;  2LB5 A;  2KX6 A;  2G7U A;  1ES5 A;  4P6Z M;  3PBS A;  2A49 A;  4KQQ A;  4E3I A;  2V2F F;  3RTY A;  2WZZ A;  4EV4 A;  3MF0 A;  1PWD A;  1X0O A;  4O8G A;  2ZC5 B;  1GA0 A;  2QHK A;  4L9F A;  3A3I A;  5LBR A;  3RJU A;  1K55 A;  5AQ7 A;  1XFQ A;  4FOF A;  2OOL A;  3F1N A;  3T1Q B;  2OV5 A;  2EXB A;  2PU2 A;  4JLF A;  4CQH A;  4MBH A;  3TE8 A;  3ZG5 A;  5I94 A;  2XDM A;  3OCL A;  4FSF A;  1YMS A;  1ONH A;  2VV8 A;  5AVE A;  2Z2L B;  2O9C A;  4OQI A;  3LGO A;  3BLS A;  2XEP A;  3LI9 A;  3PBN A;  2Z6D A;  4RX2 A;  1ERM A;  2WGI A;  4UAA A;  4OVD A;  1DP6 A;  4JF4 A;  2YKF A;  4DXB A;  1XJ6 A;  5EE8 A;  1CF0 A;  5CGX A;  5IS1 A;  3PHY A;  5CGS A;  4QU3 A;  1IEM A;  3C38 A;  2OSU A;  4YOF A;  4KZ9 A;  4U0X A;  2O99 A;  3QP4 A;  4LV0 A;  3KSF A;  5A91 A;  3BY9 A;  4OON A;  3HLE A;  5EVE A;  5CRF A;  4UA6 A;  1J3W A;  2Z2M B;  4GD6 A;  1IYP A;  3L9K A;  4JGO A;  3IWI A;  1ALQ A;  4WZ5 A;  3BEC A;  5FAO A;  4U0T A;  4GNU A;  5AVF A;  2WKP A;  3NOU C;  4O7D A;  3PAG A;  3FWL A;  4PKY G;  1T1C A;  3N8S A;  1H8M A;  3GEC A;  1GHM A;  1G6A A;  3UB6 A;  2E8I A;  3E98 A;  3SS5 A;  4DRT A;  5TGF A;  2V1A A;  2HDQ A;  4G3K A;  1V9Y A;  1VET A;  3VE3 A;  4I3I A;  3C4P A;  1GSX A;  2PD8 A;  2C5W B;  3NY4 A;  5EVI B;  2CC1 A;  5M18 A;  5DFX A;  1NLY A;  3F1P A;  3VFF A;  4GDB A;  1FIK A;  1PI5 A;  3T4T A;  4E3M A;  5F6A A;  2QMI A;  4FH2 A;  1BLH A;  4Q0J A;  1Z09 A;  1GA9 A;  3LY3 A;  3NUL A;  3PYP A;  4DMZ A;  2ZOH A;  1S6R A;  3LR4 A;  2ZMF A;  1N9N A;  4CLC C;  3PBT A;  5CXW A;  4C3Q A;  4ESP A;  1JWP A;  2ZD8 A;  2ZJ9 A;  3UB8 A;  1KE4 A;  2WUQ A;  3OOV A;  1A0K A;  3OCN A;  3IXD A;  1FSY A;  2Y2Q A;  4JXV A;  5HD3 A;  1U60 A;  1FCO A;  3HJI A;  3W4O A;  4IJG A;  3V3S A;  2PBD P;  3F1O A;  4JGP A;  3LR0 A;  2VGJ A;  3G31 A;  2WAE A;  5G18 A;  1JWZ A;  3T12 B;  3BQ8 A;  1ZKJ A;  4HOI A;  5FA7 A;  2ZMA A;  5FEG A;  3GQZ A;  1I2W A;  4GHI B;  1K4E A;  2W3D A;  2RCX A;  1L0G A;  4FTX A;  4R4S A;  5HL1 A;  3LIC A;  4G3V A;  1LI0 A;  4ETX A;  4BL3 A;  3NDE A;  4IBX A;  2INW A;  3PAE A;  2I9V A;  3FPV A;  4QHC A;  5EUA A;  4JXG A;  2PR5 A;  4K0X A;  1Z6F A;  3AGD A;  2PT7 A;  3TOI A;  4PHT A;  1S0W A;  5CEC A;  4GB7 A;  4DXC A;  4GW9 A;  2Y2O A;  3LR5 A;  5EFW A;  2PDR A;  1K57 A;  1JWV A;  1PI4 A;  3OPR A;  4P6Z S;  1TS7 A;  4S2M A;  4N1H A;  5I5L A;  1DRM A;  2EFU A;  2ZC3 B;  3ZFZ A;  2ZL1 A;  1YLP A;  3IT9 A;  2VJW A;  3BRM A;  4EES A;  5DTT A;  3H7W B;  4KZ8 A;  3IWQ A;  3P7N A;  2JCH A;  3VP1 A;  4OLG A;  1NYY A;  2VV7 A;  5D3O A;  3FZC A;  1ESI A;  4OH0 A;  1EWZ A;  5AQA A;  1NWZ A;  3A0V A;  4RVA A;  1CQA A;  4DE3 A;  3MSH A;  2XQZ A;  5HWV A;  3R7W B;  1FIL A;  3IF6 A;  5CHJ A;  4HH2 A;  2Y2N A;  5FQ9 A;  1MC0 A;  4GS9 A;  3IHA A;  3MQO A;  3DW0 A;  1K54 A;  5CTM A;  4X1L A;  3HLC A;  3BFE A;  2PAV P;  1S4R A;  3NI9 A;  1WA9 A;  3V50 A;  4K0W A;  1T1A A;  1LSX A;  4JGQ A;  4EET B;  1ERO A;  5HX9 A;  3RH8 B;  1OT9 A;  3CUE A;  5F1F A;  4PAU A;  1DJB A;  5M19 A;  1S66 L;  2XA7 S;  2ZM2 A;  4HBU A;  5A92 A;  3G6O A;  1IYS A;  1MKM A;  1SKO A;  2QYB A;  3IXH A;  4Z1W A;  2W1T A;  4BD1 A;  5L8M A;  3OLO A;  2VK3 A;  4G3W A;  4JPM A;  2PYP A;  3EWK A;  4LCM A;  4DE1 A;  4I39 A;  2K31 A;  1T18 A;  1P97 A;  3V67 A;  1XJ4 A;  1RGY A;  3WS2 A;  2PHY A;  4L9E A;  5DF8 A;  4UQI M;  4RA7 A;  1HVB A;  2A24 B;  3G4P A;  3HUM A;  5FQI A;  1TVF A;  2H5S A;  3IQA A;  1XFN A;  5GHZ A;  1D7E A;  4NK3 A;  1BSG A;  1IKG A;  4MDZ A;  3LEZ A;  3N7W A;  4QJG A;  2VA0 A;  4YFM A;  2BG1 A;  2L0W A;  2JE5 A;  2ZM0 A;  4E3O A;  3VMA A;  1W7F A;  1H0M A;  5EVL A;  5EVI C;  4NXE A;  1G68 A;  1N9B A;  1YLJ A;  4C75 A;  2P9V A;  3BFC A;  4RYE A;  5EOE A;  3FV7 A;  2B95 A;  2XFT A;  4EU0 A;  1ES4 A;  3SH9 A;  5E43 A;  1AXB A;  4WLA A;  1QMF A;  2XFS A;  4M3K A;  2OLV A;  3E4O A;  4B4Z A;  1NZU A;  4S2K A;  1PWG A;  4WMC D;  1MKI A;  1VEU B;  3FYZ A;  2D01 A;  3FG8 A;  3LY4 A;  1F5M A;  3IX8 A;  3F1N B;  1P0Z A;  3ZNT A;  1S4S A;  1NY0 A;  1YQS A;  1MBL A;  4B9O A;  1E3U D;  4KZ5 A;  4S2I A;  1OTA A;  3MKF A;  5CED A;  1MPL A;  3VOL A;  2QJ5 A;  3ZQ5 A;  3T4S A;  4OP5 A;  2JBF A;  4A5R A;  1DJC A;  3IX3 A;  1BT5 A;  5TBM A;  1YLW A;  4OOL A;  4P6B A;  5FQQ A;  1MWT A;  2JKF A;  1TD5 A;  2AVX A;  3CMZ A;  2W27 A;  3MXQ A;  3OPL A;  5FAP A;  1YM1 A;  3HLF A;  1OTI A;  3JYI A;  3N8R A;  3HRE A;  3FKV A;  4PM9 A;  1NLZ A;  1H3Q A;  1UGU A;  3T4Q A;  1KDW A;  2PR6 A;  4EUZ A;  4NXF A;  3Q82 A;  3OPP A;  3BM6 A;  3OPH A;  3K3D A;  3UO9 A;  3DWZ A;  5L2F A;  1BTL A;  2WGW B;  1KGF A;  2BAS A;  1G6O A;  1ERQ A;  3A3E A;  1OTB A;  5FAS A;  2IWB A;  4CJN A;  1IKI A;  1XGI A;  2J8Y A;  5FSR A;  5F68 A;  2Y2P A;  3D4F A;  1YPR A;  4KZA A;  1YSP A;  1SHV A;  4KG6 A;  1GHP A;  5FQJ A;  1SDE A;  3C30 A;  3G35 A;  1N9O A;  3UB7 A;  4K08 A;  3G2Y A;  3W2Z A;  3BFG A;  3KSI A;  1H8Z A;  2J3T C;  5CTN A;  4D2O A;  1TDL A;  4QY6 A;  1I5Q A;  2ZC6 B;  3B3X A;  2G2W A;  1XP4 A;  4CLC A;  2KDK A;  2Q9N A;  2ZQ7 A;  2O9B A;  2V8C A;  4EER A;  3GR2 A;  3BEB A;  3P01 A;  2HPB A;  1Q2P A;  4GD8 A;  4P85 A;  3IHB A;  4S2N C;  4OOY A;  3WS5 A;  1OTD A;  3S4X A;  3G32 A;  3OZH A;  3S7O A;  3A3J A;  4XUZ A;  1BUL A;  4L0L A;  4BJP A;  4GDN A;  3MFX A;  2X71 A;  5TR7 A;  1WE4 A;  2J80 A;  4O0P A;  4BEN A;  2FZ0 A;  2OLU A;  3KYQ A;  2HJ9 C;  3O87 A;  3FC7 A;  1DY6 A;  3PBQ A;  2OAQ 1;  3MZD A;  1KGG A;  2HZ5 A;  4XXR A;  2QPN A;  3A0S A;  1HD8 A;  1K56 A;  5HD5 A;  4WL9 A;  2VKS A;  1IFQ A;  1K4F A;  4WEK A;  1RP5 A;  5DTK A;  4H8R A;  1OJG A;  4UEY A;  3HLW A;  3A3D A;  4KZ4 A;  4U3T A;  2WYX A;  2H28 A;  3Q7V A;  4UQI S;  4S2P A;  5E2E A;  4EQI A;  1QME A;  2BTF P;  2J9P A;  4ZJ2 A;  1FR1 A;  4QY5 A;  3UPN A;  3QP6 A;  4KZ6 A;  1MZU A;  4FH4 A;  4KQR A;  3UDF A;  3QNC A;  2HDS A;  4DDY A;  3QP1 A;  4GJ4 A;  3VP3 A;  4EXO A;  3NBL A;  2HP5 A;  2XA7 M;  3IWO A;  3IBR A;  4CPK A;  3LIB A;  1L0E A;  3LI8 A;  3HBR A;  3SW1 A;  2XRO A;  2Y2K A;  4Y15 A;  3MR0 A;  1MWR A;  3U2A A;  2HDU A;  1L0F A;  2ACG A;  1Q2Q A;  5KZH A;  5KSC A;  3UE1 A;  3NDG A;  1ES2 A;  1XX2 A;  3CZD A;  2M7U A;  3LEQ A;  2ZQD A;  2C6W B;  1IOU A;  2V0W A;  4NKP A;  3VV4 A;  1DP9 A;  1FCM A;  4IED A;  3ZGA B;  5KSH A;  5FEF A;  3IBJ A;  1P9W A;  3ZG0 A;  1OPX A;  4X56 A;  1STZ A;  2Y2L A;  4BQM A;  5GLB A;  3IS2 B;  4OOM A;  3W8K A;  5HW3 A;  4YNR A;  4OPR A;  3VOZ A;  4GLQ A;  4IUH A;  4IVI A;  3M6H A;  3KX0 X;  4BL2 A;  2PD7 A;  4R6L A;  4KUK A;  3ZG8 B;  3E4Q A;  4AFI A;  1LT0 A;  1K55 C;  4Q0H A;  3OC2 A;  1YKD A;  3L7H A;  2GJ3 A;  4DF6 A;  1M6K A;  1LLB A;  1YLZ A;  4CLC E;  3LR3 A;  4B4X A;  3D3O A;  4X69 A;  5E2F A;  4ARZ A;  5AQ9 A;  1TF1 A;  2X01 A;  4HJ4 A;  1VQQ A;  1NRJ A;  3KSH A;  3RFB A;  1E25 A;  2J9O A;  4DDS A;  4IVK A;  2DCF A;  4HH3 A;  5KIZ A;  2FH5 A;  3TJZ C;  4P87 A;  4S2O A;  2Y2H A;  2NUP C;  2HDR A;  3D72 A;  1XA7 A;  3CI6 A;  3GTC A;  1EI5 A;  5HAI A;  2VZW A;  1VHM A;  4BMW A;  5E2G A;  2VGK A;  3PR6 A;  1W8Y A;  4R0Q A;  2XF3 A;  1PWC A;  2Y8H A;  4Y5F A;  1YSQ A;  1I2S A;  2Q9M A;  2KOI A;  4HP4 A;  3SH8 A;  1DJA A;  3K2N A;  3ISG A;  5HDS A;  3IXB A;  4BLM A;  2WGV A;  1JTD A;  4JBF A;  5EVI A;  4ETZ A;  1K25 A;  3BW6 A;  3BQA A;  5FAQ A;  2XD5 A;  1IYQ A;  3UMD A;  3UPP A;  3MQQ A;  4Y0T A;  3CWF A;  4ID4 A;  1ACF A;  5DVA A;  4LRY C;  3PTE A;  4FCF A;  2XH9 A;  3HJK A;  3MJQ A;  3S7P A;  1BUE A;  3EQU A;  3H82 A;  1FSW A;  2P9V B;  3B42 A;  3HCY A;  5DJU A;  3C8C A;  1H8Y A;  3VOY A;  5A8B A;  2IWD A;  5HAQ A;  1K6R A;  1VB6 A;  4HY8 A;  1YT4 A;  1GHI A;  1HZO A;  2WKI A;  2OAP 1;  3AGE A;  4JXW A;  1ODV A;  4P0M A;  3NJA A;  4LFU A;  1AWI A;  2H0T A;  2P74 A;  2B02 A;  4PKY A;  4ZJ3 A;  5CER A;  2J3W A;  1IEL A;  5U47 A;  4EBN A;  4EQ1 A;  1VM1 A;  3D9Y A;  3DWK A;  3EGX C;  4F3L B;  4UA9 A;  3EQV A;  1XA1 A;  2IWC A;  3WRT A;  4XT2 B;  3CAX A;  4EEU A;  4I38 A;  3T1S A;  4UA7 A;  4HJ3 A;  1KE3 A;  1XKZ A;  2NUT C;  1T1B A;  3FKW A;  3UDX A;  3UY6 A;  1NXY A;  5TBM B;  3MXR A;  3HVF A;  1LSW A;  3QHY A;  3WS1 A;  4E6X A;  3LIE A;  4X6T A;  5F5Y A;  5FI7 A;  4IUK A;  2Y2J A;  3S7Q A;  2EX8 A;  1TS8 A;  2B18 A;  4HIA A;  1S1Z A;  2EA9 A;  3ZDJ A;  3HLG A;  5HWW A;  3H7W A;  5J4E A;  3DAV A;  2W0N A;  2EX6 A;  5BOH A;  3UE0 A;  5J3W A;  4O01 A;  3A3F A;  5EM1 A;  1XJ2 A;  3V5M A;  4I3A A;  5HDC A;  1PW8 A;  5JYO A;  1WYB A;  2GZA A;  1CI8 A;  2O9A A;  3WRZ A;  4WBG A;  3R7W A;  3VFH A;  5CGW A;  3H9W A;  3LID A;  4IHQ A;  2UWX A;  3TSG A;  2Q0O A;  3EEA A;  3GRJ A;  3IH9 A;  4PPR A;  2WKH A;  4R3B A;  2FFY A;  3CG5 A;  5GLD A;  1KE0 A;  1PZO A;  4R38 A;  5M1A A;  1CEF A;  4B93 A;  2GDN A;  2ZQC A;  3VSK A;  5CHU A;  4E3J A;  3SH7 A;  4QWO A;  4LEN A;  4UHU A;  4F94 A;  3KSG A;  3Q1F A;  2L1M A;  1KVL A;  2P08 A;  4JF5 A;  4L9G A;  1W8Q A;  1CK3 A;  1K54 C;  1NJ4 A;  3HUO A;  2IA2 A;  3O5Y A;  2CMN A;  4HHD A;  3DBA A;  4QPR A;  4Z9Q A;  1HLU P;  4Y0U A;  5EEC A;  5L07 A;  3CJM A;  1XJ3 A;  3UDI A;  3G34 A;  5DF7 A;  5GL9 A;  2JKT M;  4WM9 A;  4BBT A;  4FD8 A;  2HP9 A;  3E2K A;  4MBK A;  1D06 A;  4I3J A;  1UWN X;  5EV0 A;  2R9W A;  5DFY A;  3IX4 A;  2Y2M A;  2G2U A;  4GN2 A;  1BLC A;  1PW1 A;  4S2L A;  1SCW A;  1W79 A;  2VV6 A;  4GZB A;  3NEC A;  3VP2 A;  3QNB A;  5L09 A;  4NXB A;  3LYX A;  2A24 A;  1BZA A;  3LCE A;  2JN7 A;  4OPQ A;  4MN6 A;  1MWU A;  3DTM A;  3HL9 A;  4OPZ A;  3C7U A;  1E4D A;  4N9K A;  1TS0 A;  4OPY A;  2GNX A;  3T4L A;  3TW8 A;  3CHW P;  3BFD A;  2HV1 A;  5KMW A;  1SKF A;  5G4Y A;  5C5K A;  5AQB A;  4H6J A;  3PBR A;  5FI6 A;  1F9I A;  4R3A A;  4ZRR A;  4WUJ A;  2VGL M;  3R4K A;  4KZ3 A;  4HP9 A;  5FQK A;  2OWJ A;  1VET B;  4E3L A;  4M4X A;  4Y3I A;  5JYP A;  2D02 A;  3E4P A;  3F1P B;  4RQ9 A;  2XLN A;  3HLD A;  3CPT A;  3IF5 A;  1TEM A;  4E04 A;  3VE4 A;  4NET A;  1VEU A;  4EWF A;  4I5S A;  2QKP A;  1FCN A;  4K91 A;  2Y4A A;  2BLS A;  4OQ0 A;  2JKR M;  4MBF A;  1KGE A;  4ZDX A;  3UME A;  4Q0I A;  2EFX A;  2V1Z A;  5HFO A;  4DJ2 A;  5TFQ A;  4LV1 A;  2A2L A;  5E2H A;  5FL3 A;  1LSV A;  3ZVW A;  4Q8I A;  3N4I A;  4KUO A;  3T4O A;  3PBO A;  2DNS A;  4D60 A;  4BBV A;  2V8F A;  1V9Z A;  3I7J A;  3WWX A;  1ES3 A;  2WZX A;  3NHQ A;  3GMW A;  1DP8 A;  4MN7 A;  1NYM A;  3F1O B;  2OWH A;  1GSW A;  2P7J A;  1OTE A;  3UPO A;  3ZG7 B;  5IU1 A;  4ARZ B;  1M40 A;  2Y59 A;  1J9M A;  3MZE A;  1PYY A;  1GSV A;  3ITA A;  4LLO B;  2WK0 A;  1WYC A;  1H5X A;  2WAD A;  1JTG A;  2WGW A;  5FDS A;  4GOG A;  4IBR A;  4HQA A;  3AGF A;  4EBP A;  3GSG A;  2ZQ8 A;  4JF6 A;  4LPZ A;  3S1Y A;  4GKU A;  2XSS A;  3BLM A;  2ZQA A;  4KQO A;  5CHM A;  4CLC D;  4PM6 A;  2V0U A;  3SS3 A;  5A90 A;  3UB5 P;  2HJE A;  1ZTU A;  4WEL A;  3ZG9 B;  3G30 A;  3DTK A;  3QP5 A;  2ZL1 B;  5HZH A;  3Q7Z A;  4EUV A;  2XR0 A;  3S22 A;  2ZLY A;  1ONG A;  1S1Y A;  1P9R A;  3DTE A;  4DN0 A;  1N4O A;  3GDI A;  2M1C A;  4MMN A;  1ZHH B;  5GLA A;  3ZNY A;  2Y91 A;  4LRX C;  4B88 A;  1K56 D;  4KQD A;  4KEN B;  3JVU A;  2R78 A;  4DE0 A;  1CI9 A;  2EX2 A;  4YIN A;  3U4L P;  3UB9 A;  4X25 A;  2QZ6 A;  4OQH A;  1L0D A;  3MKE A;  3IF6 B;  1ZG4 A;  1JNU A;  1PZP A;  5FQM A;  3BY8 A;  2VLG A;  3IXG A;  4LV3 A;  4GS9 B;  5IHV A;  3LUQ A;  5G4Z A;  5HPI A;  3B33 A;  3KO6 A;  3A0R A;  3VP0 A;  4EEP A;  1OJ5 A;  3NIA A;  4Y17 A;  4Y7P A;  5HL6 A;  5J7E A;  2YKH A;  3H82 B;  2WKE A;  5HSQ A;  1NZO A;  2W3F A;  5F83 A;  2DMW A;  4WEJ A;  3E2L A;  3ZHH A;  3B47 A;  2EX9 A;  3MS6 A;  3T4J A;  3IH8 A;  1BLP A;  1SZV A;  4ZAM A;  5AJG A;  4BWI A;  3V39 A;  3BYD A;  1TS6 A;  4DJ3 A;  2WAF A;  1O07 A;  1W63 M;  3RXW A;  2ZBB A;  3ZYT A;  2W3E A;  4XUX A;  3C4O A;  4ZTK A;  1SKO B;  4RX3 A;  3VSL A;  2ZOI A;  1F98 A;  1YLT A;  4WN5 A;  4E3K A;  4OP8 A;  2W1T B;  1G28 A;  1K6S A;  3EEH A;  3CIT A;  3LIF A;  3M2J A;  3MXS A;  4WZ4 A;  4QD4 A;  1MWS A;  3KYE A;  2VGL S;  4MEZ A;  5K5B A;  5HAR A;  3CLO A;  2Y79 A;  4X68 A;  3JPU A;  1YMX A;  4KZB A;  1JVJ A;  4MLL A;  4WZ5 C;  1L2S A;  4PM8 A;  2HP6 A;  2W1R A;  1O7E A;  2LB9 A;  5IT5 A;  2EWW A;  2EWV A;  1FOF A;  3GVB A;  1PFL A;  3VP4 A;  1F2K A;  2UV0 E;  3QP8 A;  1RGZ A;  3IS2 A;  3WS4 A;  3ITB A;  1OME A;  2JKT I;  3ZCZ A;  3Q81 A;  1KVM A;  1K0K A;  1GCE A;  2V1B A;  3W4Q A;  2JC7 A;  4WF0 A;  3NCK A;  5GLC A;  3TG9 A;  1C3B A;  3JVV A;  3SZT A;  1CEG A;  2PRF A;  3M6B A;  2FFF B;  2HF6 A;  5F1G A;  5A93 A;  2E8J A;  4OLD A;  5F82 A;  3UN7 A;  4KZ7 A;  5DKL A;  1NRF A;  2PBY A;  4KG5 A;  3T1R A;  1MY8 A;  3TRC A;  4PMA A;  4GHI A;  1EW0 A;  2ZQ9 A;  3G2Z A;  4HBT A;  1ZG6 A;  1FQG A;  2Y2I A;  2ZM8 A;  4S2J A;  4JGR A;  4OQG A;  3C5A A;  3SOI A;  4II7 A;  2XD1 A;  1PIO A;  4R3J A;  2PU4 A;  5FI2 A;  3DTI A;  2H0Y A;  4WMC A;  5DF9 A;  5J8X A;  2KLI A;  3UE6 A;  4R70 A;  1HTZ A;  5EVI D;  2V9A A;  3HUN A;  3W4P A;  2QWS A;  4LCL A;  1T19 A;  3K3C A;  3T1X A;  1E3U A;  4OKP A;  4Y2F A;  2JHE A;  4MNR A;  1N9L A;  1D1J A;  2A3U A;  2PYR A;  1OT6 A;  3V3R A;  2W3H A;  1LL5 A;  5EOO A;  1CJF A;  2JKR I;  4E3N A;  2O0Y A;  3QP2 A;  2WKQ A;  5HPF A;  2VX8 A;  1K38 A;  3MFD A;  2P04 A;  4N92 A;  1BLS A;  5DTS A;  3NOP C;  2H10 A;  2WKR A;  2QJ7 A;  4MN5 A;  1LL9 A;  3NC8 A;  3OBF A;  1K57 C;  4FUW A;  4MCW A;  5L10 A;  1LL8 A;  2JKG A;  4N9L A;  4N1X A;  5EM0 A;  4ZBE A;  5GHY A;  4R1G A;  4PM5 A;  5DJT A;  3LIA A;  1LHY A;  3SS4 A;  4LV2 A;  4C6Y A;  4S2N A;  4NEE D;  2HGV A;  4NG2 A;  1SDN A;  3UNW A;  4X1M A;  2ZMV A;  4PM7 A;  4H6J B;  3MBZ A;  4KG2 A;  2VEA A;  2L4R A;  3T4K A; 
#chains in the Genus database with same CATH homology
 2V20 A;  1XGJ A;  4BQM A;  4DE2 A;  2Y55 A;  5GHX A;  5EPH A;  4JXS A;  5GLB A;  4OOM A;  2XLN A;  3W8K A;  1ESU A;  1XXM A;  3IF6 A;  3HLD A;  5CHJ A;  3IF5 A;  1TEM A;  2Y2N A;  1ZC2 A;  5HW3 A;  4NET A;  5FQ9 A;  3Q07 A;  4EWF A;  3IHA A;  4OPR A;  1FCN A;  3VOZ A;  4IVI A;  4K91 A;  2Y4A A;  3DW0 A;  2DRW A;  2XK1 A;  3M2K A;  3N8L A;  3M6H A;  2BLS A;  1K54 A;  4OQ0 A;  5CTM A;  4MBF A;  4BL2 A;  3HLC A;  3BFE A;  1KGE A;  1FR6 A;  3N6I A;  3IF6 C;  3ZG8 B;  4ZDX A;  3P98 A;  1XPB A;  2EFX A;  3NI9 A;  3V50 A;  2V1Z A;  4K0W A;  5HFO A;  1K55 C;  5TFQ A;  4LV1 A;  5E2H A;  4BD0 A;  3OC2 A;  3ZVW A;  3O86 A;  4Q8I A;  1ERO A;  3N4I A;  5HX9 A;  3C7V A;  4DF6 A;  3PBO A;  1KDS A;  1M6K A;  2DNS A;  1LLB A;  5F1F A;  1YLZ A;  3BFF A;  4B4X A;  4DKI A;  1DJB A;  4X69 A;  4ZJ1 A;  3I7J A;  5E2F A;  3WWX A;  1ES3 A;  5FDH A;  5M19 A;  4R4R A;  2Y2G A;  5AQ9 A;  2XGN A;  3RXX A;  4Y0O A;  3WS0 A;  2WZX A;  4WYY A;  2ZM2 A;  4HBU A;  2X01 A;  5A92 A;  1IYS A;  1VQQ A;  5HAP A;  3GMW A;  1E25 A;  2ZC7 A;  2J9O A;  1NYM A;  4DDS A;  4IVK A;  2DCF A;  2B5R A;  3IXH A;  3UPO A;  3ZG7 B;  4R23 A;  4QB8 A;  1W5D A;  3UE3 A;  4EBL A;  1M40 A;  4BD1 A;  2Y59 A;  3Q7V B;  3P09 A;  1IYO A;  4P87 A;  1J9M A;  3MZE A;  3MZF A;  4S2O A;  2Y2H A;  1PYY A;  2HDR A;  3ITA A;  1XA7 A;  2WK0 A;  1WYC A;  3GTC A;  1H5X A;  2WAD A;  1EI5 A;  4HEF A;  5HAI A;  4E6W A;  4JPM A;  1JTG A;  2WGW A;  4GOG A;  2EXA A;  4IBR A;  3AGF A;  4LCM A;  2I72 A;  2J7V A;  3LO7 A;  4DE1 A;  4EBP A;  3GSG A;  5E2G A;  1LI9 A;  1TDG A;  2ZQ8 A;  2VGK A;  1W8Y A;  4JF6 A;  1RGY A;  3S1Y A;  2R9X A;  4GKU A;  3WS2 A;  4JKT A;  4R0Q A;  2XF3 A;  3BLM A;  5DF8 A;  1PWC A;  4X53 A;  2ZQA A;  4KQO A;  4RA7 A;  4HES A;  1I2S A;  1HVB A;  2X02 A;  5CHM A;  2Q9M A;  2ZC4 B;  4PM6 A;  3O3V A;  3GV9 A;  1RCJ A;  3SS3 A;  3G4P A;  3HUM A;  4X55 A;  5A90 A;  5FQI A;  1TVF A;  3SH8 A;  5CEB A;  1DJA A;  5FAT A;  1MXO A;  3ISG A;  2RL3 A;  2H5S A;  4WEL A;  3IQA A;  3IXB A;  3ZG9 B;  2WGV A;  3G30 A;  1JTD A;  4BLM A;  4JBF A;  3ZVT A;  5EVI A;  3Q7Z A;  5GHZ A;  1K25 A;  4NK3 A;  2XR0 A;  3HLB A;  1BSG A;  1IKG A;  1YLY A;  3LEZ A;  3N7W A;  3S22 A;  2ZLY A;  4QJG A;  5FAQ A;  1ONG A;  1Y54 A;  3O88 A;  2XD5 A;  4YFM A;  1IYQ A;  2BG1 A;  2JE5 A;  1N4O A;  2ZM0 A;  1ES5 A;  3UPP A;  4E3O A;  3VMA A;  1W7F A;  4Y0T A;  5EVL A;  3PBS A;  5EVI C;  2A49 A;  4KQQ A;  4E3I A;  5GLA A;  2V2F F;  3ZNY A;  1G68 A;  4ID4 A;  1N9B A;  2WZZ A;  1YLJ A;  2Y91 A;  4EV4 A;  1PWD A;  2P9V A;  1K56 D;  3BFC A;  5DVA A;  4B88 A;  4C75 A;  4RYE A;  4KEN B;  2ZC5 B;  1GA0 A;  3A3I A;  3PTE A;  3RJU A;  4DE0 A;  5EOE A;  3FV7 A;  1CI9 A;  1K55 A;  2EX2 A;  4YIN A;  5AQ7 A;  2XFT A;  4FCF A;  1ES4 A;  3SH9 A;  2XH9 A;  5E43 A;  1BUE A;  1AXB A;  2OV5 A;  1QMF A;  2QZ6 A;  2EXB A;  3EQU A;  2PU2 A;  2XFS A;  4JLF A;  4OQH A;  1L0D A;  1FSW A;  3MKE A;  4M3K A;  2OLV A;  3IF6 B;  2P9V B;  1ZG4 A;  4B4Z A;  1NZU A;  1PZP A;  4S2K A;  1H8Y A;  5FQM A;  1PWG A;  4MBH A;  4WMC D;  1MKI A;  3VOY A;  2IWD A;  3ZG5 A;  3IXG A;  3FYZ A;  1K6R A;  4LV3 A;  5HAQ A;  5I94 A;  2XDM A;  3OCL A;  4FSF A;  5IHV A;  1YMS A;  3LY4 A;  1YT4 A;  1GHI A;  1HZO A;  1ONH A;  2WKI A;  3AGE A;  3VP0 A;  3NIA A;  4JXW A;  4Y7P A;  4P0M A;  2Z2L B;  3ZNT A;  1NY0 A;  1YQS A;  1MBL A;  4OQI A;  2WKE A;  3BLS A;  1NZO A;  2H0T A;  1E3U D;  2P74 A;  5F83 A;  4KZ5 A;  4ZJ3 A;  2XEP A;  4S2I A;  3PBN A;  4WEJ A;  3MKF A;  3E2L A;  5CED A;  5CER A;  1IEL A;  5U47 A;  3ZHH A;  1MPL A;  4RX2 A;  4EBN A;  1ERM A;  2WGI A;  4UAA A;  1VM1 A;  3DWK A;  2EX9 A;  4OVD A;  4OP5 A;  2JBF A;  4A5R A;  4JF4 A;  1DJC A;  1BT5 A;  4DXB A;  5EE8 A;  4UA9 A;  3EQV A;  5CGX A;  1XA1 A;  3IH8 A;  2IWC A;  3WRT A;  1BLP A;  1YLW A;  4ZAM A;  5CGS A;  4QU3 A;  4UA7 A;  4OOL A;  3V39 A;  3BYD A;  1IEM A;  4P6B A;  5FQQ A;  1MWT A;  2OSU A;  1KE3 A;  1XKZ A;  3CMZ A;  2WAF A;  1O07 A;  4KZ9 A;  3FKW A;  4U0X A;  3RXW A;  3UDX A;  3OPL A;  4LV0 A;  4XUX A;  5FAP A;  3C4O A;  4ZTK A;  1YM1 A;  3HLF A;  3UY6 A;  3JYI A;  5A91 A;  3N8R A;  4RX3 A;  3HRE A;  1NXY A;  3FKV A;  4PM9 A;  3VSL A;  4OON A;  3HLE A;  3MXR A;  3HVF A;  3QHY A;  1KDW A;  1YLT A;  4E3K A;  4OP8 A;  5CRF A;  3WS1 A;  1K6S A;  4X6T A;  4E6X A;  3Q82 A;  4EUZ A;  3OPP A;  3BM6 A;  3OPH A;  4UA6 A;  5FI7 A;  2Z2M B;  2Y2J A;  4GD6 A;  1IYP A;  3UO9 A;  2EX8 A;  3M2J A;  3DWZ A;  5L2F A;  1BTL A;  3MXS A;  4WZ4 A;  3IWI A;  4QD4 A;  1MWS A;  1ALQ A;  2WGW B;  4WZ5 A;  4MEZ A;  5HAR A;  1KGF A;  3BEC A;  5FAO A;  4U0T A;  4GNU A;  3ZDJ A;  1ERQ A;  3A3E A;  3HLG A;  5FAS A;  4X68 A;  4O7D A;  1YMX A;  3FWL A;  3PAG A;  2IWB A;  4CJN A;  4KZB A;  1IKI A;  2EX6 A;  1XGI A;  2J8Y A;  1JVJ A;  5BOH A;  3N8S A;  4MLL A;  3UE0 A;  5FSR A;  4WZ5 C;  1GHM A;  1L2S A;  1G6A A;  3A3F A;  4PM8 A;  2E8I A;  2Y2P A;  3D4F A;  4KZA A;  2HP6 A;  3SS5 A;  1O7E A;  3V5M A;  4DRT A;  1PW8 A;  1SHV A;  4KG6 A;  5TGF A;  1GHP A;  5FQJ A;  1FOF A;  2HDQ A;  1SDE A;  3GVB A;  5JYO A;  1WYB A;  3G35 A;  3VP4 A;  3C4P A;  3NY4 A;  2C5W B;  1CI8 A;  5EVI B;  2CC1 A;  3G2Y A;  3WRZ A;  5M18 A;  3BFG A;  1H8Z A;  4WBG A;  5CTN A;  4D2O A;  3VFH A;  1RGZ A;  1TDL A;  4QY6 A;  1I5Q A;  2ZC6 B;  3ITB A;  5CGW A;  3B3X A;  4GDB A;  3VFF A;  3WS4 A;  1OME A;  1PI5 A;  3ZCZ A;  2UWX A;  3TSG A;  2G2W A;  1XP4 A;  3Q81 A;  4E3M A;  1KVM A;  3GRJ A;  3IH9 A;  2Q9N A;  2ZQ7 A;  2QMI A;  4PPR A;  2WKH A;  4FH2 A;  1BLH A;  4R3B A;  1GCE A;  3W4Q A;  3GR2 A;  2JC7 A;  2FFY A;  3BEB A;  3CG5 A;  5GLD A;  1GA9 A;  3LY3 A;  2HPB A;  1KE0 A;  1PZO A;  1Q2P A;  4GD8 A;  4P85 A;  3IHB A;  3NCK A;  4S2N C;  4OOY A;  5GLC A;  5M1A A;  1CEF A;  3TG9 A;  3WS5 A;  1S6R A;  1C3B A;  3S4X A;  1CEG A;  3M6B A;  3PBT A;  3G32 A;  3OZH A;  2GDN A;  3A3J A;  2FFF B;  5CXW A;  4XUZ A;  4C3Q A;  2ZQC A;  1BUL A;  4L0L A;  1JWP A;  4BJP A;  4GDN A;  3VSK A;  5F1G A;  2X71 A;  5CHU A;  2ZD8 A;  4E3J A;  2ZJ9 A;  5A93 A;  5TR7 A;  1WE4 A;  1KE4 A;  2WUQ A;  4OLD A;  5F82 A;  4BEN A;  3UN7 A;  4KZ7 A;  3SH7 A;  1NRF A;  4LEN A;  3OCN A;  4UHU A;  4F94 A;  2PBY A;  4KG5 A;  2OLU A;  3IXD A;  3O87 A;  1DY6 A;  3Q1F A;  3PBQ A;  1MY8 A;  3MZD A;  1KVL A;  1KGG A;  4PMA A;  1FSY A;  4XXR A;  2Y2Q A;  4JF5 A;  4JXV A;  2QPN A;  1HD8 A;  1U60 A;  1FCO A;  2ZQ9 A;  3W4O A;  1K56 A;  1W8Q A;  1CK3 A;  1K54 C;  1NJ4 A;  3G2Z A;  3HUO A;  4HBT A;  3V3S A;  1K4F A;  2VGJ A;  1ZG6 A;  1FQG A;  4WEK A;  2Y2I A;  3G31 A;  2WAE A;  2ZM8 A;  4S2J A;  1RP5 A;  5DTK A;  4H8R A;  5G18 A;  1JWZ A;  4OQG A;  3C5A A;  3HLW A;  3A3D A;  4Z9Q A;  1ZKJ A;  4Y0U A;  5EEC A;  2ZMA A;  5FA7 A;  3GQZ A;  4KZ4 A;  1I2W A;  4U3T A;  3SOI A;  2WYX A;  1K4E A;  3Q7V A;  2RCX A;  3CJM A;  1L0G A;  4R4S A;  4S2P A;  2XD1 A;  5E2E A;  1PIO A;  4R3J A;  4EQI A;  2PU4 A;  3UDI A;  3G34 A;  1QME A;  5DF7 A;  5HL1 A;  5FI2 A;  2J9P A;  2H0Y A;  4WMC A;  1FR1 A;  1LI0 A;  5DF9 A;  5GL9 A;  4ZJ2 A;  4WM9 A;  4FD8 A;  3NDE A;  4IBX A;  4QY5 A;  4BL3 A;  3UPN A;  2HP9 A;  5J8X A;  3PAE A;  4KZ6 A;  3E2K A;  4MBK A;  1HTZ A;  4QHC A;  5EUA A;  5EVI D;  2R9W A;  4FH4 A;  4KQR A;  3HUN A;  4JXG A;  3UDF A;  3QNC A;  2HDS A;  4K0X A;  3W4P A;  4DDY A;  2Y2M A;  1Z6F A;  2G2U A;  3AGD A;  4GN2 A;  4LCL A;  3TOI A;  3VP3 A;  3NBL A;  2HP5 A;  1E3U A;  1BLC A;  3IWO A;  4OKP A;  1PW1 A;  4MNR A;  4S2L A;  1S0W A;  1SCW A;  5CEC A;  4GB7 A;  1W79 A;  2A3U A;  4CPK A;  4DXC A;  4GZB A;  3VP2 A;  3QNB A;  3V3R A;  2Y2O A;  1L0E A;  1LL5 A;  1K57 A;  3HBR A;  5EOO A;  4E3N A;  1JWV A;  2Y2K A;  1PI4 A;  1BZA A;  1K38 A;  3LCE A;  3OPR A;  4OPQ A;  3MFD A;  4N92 A;  1MWU A;  3DTM A;  1BLS A;  3HL9 A;  4S2M A;  1MWR A;  5DTS A;  4N1H A;  3C7U A;  4OPZ A;  2H10 A;  1E4D A;  2HDU A;  1L0F A;  2EFU A;  4N9K A;  2ZC3 B;  1LL9 A;  3ZFZ A;  1Q2Q A;  5KZH A;  5KSC A;  3NC8 A;  3UE1 A;  4OPY A;  3NDG A;  1ES2 A;  1XX2 A;  3CZD A;  1YLP A;  1K57 C;  3IT9 A;  2ZQD A;  2C6W B;  3BRM A;  5DTT A;  4KZ8 A;  3IWQ A;  2JCH A;  3BFD A;  4N9L A;  4ZBE A;  3VP1 A;  4N1X A;  5KMW A;  1SKF A;  5GHY A;  4OLG A;  4R1G A;  5AQB A;  4PM5 A;  1NYY A;  3PBR A;  3FZC A;  5D3O A;  5FI6 A;  1ESI A;  4OH0 A;  1LHY A;  3SS4 A;  4LV2 A;  1EWZ A;  5AQA A;  4C6Y A;  4KZ3 A;  4S2N A;  5FQK A;  1FCM A;  4RVA A;  4IED A;  3ZGA B;  5KSH A;  1SDN A;  4DE3 A;  4E3L A;  2XQZ A;  3UNW A;  4PM7 A;  3ZG0 A;  3MBZ A;  4KG2 A;  5JYP A;  4X56 A;  2Y2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...