4G3VA

Crystal structure of a. aeolicus nlh2 gaf domain in an inactive state
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
162
structure length
162
Chain Sequence
RLKLKEINVVNEITKILTGDYTFEESLKEVLKVLYSYLGVEHSFIAIREGNTLRIASSYGYFLNKDVAFKKGEGITGKVFQRGIPLVIPNVKHNSAFANKTGIGRLLTEKHALIAAPIKVGGEVKGVITIFKEFSDKESLENFYQTINVIGNLLGMFFKLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator nlh2
publication title Structural mechanism of GAF-regulated delta(54) activators from Aquifex aeolicus
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription regulator
total genus 52
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4g3vA00
4GLQA 3TRCA 2IA2A 4GW9A 2LB5A 2LB9A 2VJWA 3LFVA 4EU0A 5DFXA 1VHMA 5TJJA 4G3KA 2W3GA 3KO6A 3KSGA 4YOFA 3MF0A 4O01A 4LRYC 4IJGA 1F5MA 3R4KA 4R6LA 3S7OA 3NHQA 4E04A 4ZRRA 2K31A 3E0YA 4MMNA 2M7VA 3CITA 4RQ9A 3EEAA 4Q0HA 2VEAA 1ZTUA 5K5BA 3S7NA 4DMZA 4MN7A 5HPIA 4MCWA 4R70A 4Y5FA 5C5KA 1YSPA 2Y79A 3G6OA 2O9AA 1TF1A 2ZMFA 3NOPC 3MQ0A 2B18A 3NOUC 3D3OA 3E98A 2QYBA 2W3EA 3MMHA 4G3WA 5HPFA 3HCYA 5LBRA 4Y3IA 5AJGA 2G7UA 2OOLA 3S7PA 3ZQ5A 2GX5A 2XROA 4ME4A 3NOTC 1YKDA 5HL6A 2KLIA 3C2WA 3IBRA 2VZWA 2W3FA 5L8MA 4IUHA 2O9CA 4O8GA 3W2ZA 4Z1WA 4QPRA 1TD5A 2W1RA 3CI6A 3IBJA 1YSQA 4EUVA 4YNRA 3O5YA 3BJNA 4LRXC 2VKSA 4PAUA 4ETZA 3OBFA 5I5LA 4LRZE 2O99A 2Y8HA 1MKMA 4MDZA 2M7UA 4BWIA 3KSFA 4FOFA 3VV4A 2O9BA 4Q0JA 1STZA 2W3HA 4O0PA 4ETXA 4CQHA 2W3DA 2XRNA 1MC0A 4Q0IA 5DFYA 2KOIA 2XSSA 4Y2FA 5HSQA 3DBAA 2W1TB 2K2NA 3OOVA 3S7QA 3KSHA 3KSIA 2W1TA 2O0YA 3RFBA 4G3VA 4DN0A 2HGVA 3K2NA 4IUKA
chains in the Genus database with same CATH superfamily
4UA6A 3Q7ZA 5HX9A 2VJWA 3LFVA 3VP2A 4B93A 2A24A 3LIEA 4QHCA 4S2JA 2Y2MA 3K3CA 1TDLA 3NDEA 5AQBA 4RA7A 4R6LA 4JF6A 5F69A 2XGNA 1OTEA 2EWVA 4FH2A 3UPPA 3CPTA 4HY8A 4RYEA 5EVIB 3AGFA 3C38A 1L0DA 4X55A 2V1BA 1K54C 3F1NB 4OH0A 3LI8A 2HDQA 4Q8IA 3IF5A 1LI0A 2W27A 5TR7A 5FQQA 1MPLA 1P9RA 3JVUA 4ZDXA 1JNUA 3PTEA 2OOLA 5E43A 1BULA 4BENA 4OPQA 1KE4A 1EW0A 3T4TA 1FSYA 2ZM2A 1TD5A 4OQ0A 3A3EA 4R23A 4IBXA 4QY5A 3C7VA 3O88A 4LV1A 4WBGA 4KZBA 3WS2A 2XH9A 3HLWA 1TS6A 1WYCA 1DJCA 4CLCD 1JVJA 1FOFA 2W1TA 1XJ6A 3LYXA 1P97A 3ZG5A 1HD8A 2LB5A 1YPRA 2WUQA 4HOIA 4UHUA 5DTKA 1XFNA 4NG2A 3RXWA 3FZCA 2PBDP 4WZ5A 3LO7A 3BM6A 2H0YA 4KG5A 4U0XA 2DCFA 1SHVA 1XGIA 4KQRA 2OWHA 3P01A 2HV1A 2M1CA 1NXYA 3IF6A 3ZNYA 3S7NA 3H82A 3OLOA 1K56A 1RGYA 4DJ2A 3V5MA 3RTYA 5FQ9A 4EEUA 3NOPC 1ALQA 3V67A 3EQUA 4P85A 3HL9A 3WS0A 3IX8A 2WAEA 4N1HA 3DW0A 1YLYA 2XR0A 4NEED 1GCEA 2YKHA 4Z9QA 1JWPA 3NULA 1ZG6A 3OPPA 1YSQA 4YNRA 1K55C 1LSXA 1PW1A 3A0SA 3FPWA 5KMWA 4QU3A 1YLWA 2R9WA 5CEDA 5JYPA 3W8KA 3KSFA 4H6JB 3LEQA 4X53A 2W3HA 4HP4A 1ESUA 4OLGA 3ZHHA 4EQIA 1EI5A 2WKRA 3T4JA 1ZG4A 1WE4A 5TBMA 3T4QA 2XEPA 4GB7A 4OQGA 4FH4A 3QNCA 2Y2PA 5HAPA 1H0MA 3EWKA 4HIAA 2EX8A 4YOFA 3W4OA 2FZ0A 4S2NA 1E4DA 4OOLA 3BY8A 3CAXA 4XUXA 5FATA 4LRYC 3BQAA 2WAFA 4KZ8A 4MBKA 3VP0A 2A49A 2J3TD 1PRQA 3CJMA 4X6TA 4OOMA 2CC1A 4P87A 2ZMAA 1S6RA 3O3VA 5DKLA 5HW3A 1N9BA 4EV4A 1A0KA 3BFGA 3ZCZA 1J3WA 2Y2JA 3N7WA 2ZC7A 5LBRA 5AJGA 2VV8A 2GDNA 3ZQ5A 4KZ6A 3T1RA 1YQSA 2DMWA 5HAQA 1OMEA 1IELA 3C8CA 4WEKA 2VV6A 3M2KA 4B4XA 2Z2LB 3LIBA 4B4ZA 1YT4A 3NC8A 5FEFA 3BLMA 4LRXC 2Q0OA 3P09A 4E3OA 3BQ8A 5GLAA 2JKFA 2WGWB 3FYZA 4CQHA 4NXBA 4JGOA 2Q9MA 3UDFA 2ZM8A 1FSWA 1BT5A 3CUEC 1LI9A 3Q7VA 4N92A 3G30A 3KSIA 2WKPA 3MFDA 3SH9A 3FC7A 2XFTA 2ZQAA 4X1LA 2ZQDA 3OPLA 4WELA 1XJ4A 5EOOA 1OTBA 1O7EA 2E8IA 3SH7A 2JKRM 2WGWA 3TJZC 3DTMA 2XA7M 3C4PA 4U0TA 3QHYA 4BBVA 1F5MA 1IKIA 1TVFA 3NHQA 1K4EA 1E25A 4UA9A 3WRZA 2DNSA 5AQAA 4EETB 3CITA 2NUTC 2ZOIA 2VEAA 3HJKA 1ODVA 1NZOA 4KQDA 5HPIA 2V1ZA 2P9VB 5E2FA 1G5UA 1TF1A 2ZL1A 4YFMA 3GTCA 1K6SA 2GZAA 3NOUC 1H8MA 2W3EA 3FG8A 3VMAA 1IYQA 4WMCA 4R0QA 3Q07A 3IBRA 2J8YA 1O07A 2IWDA 5CECA 3MKEA 2D02A 5L07A 2Y2QA 3CHWP 1AXBA 1LLBA 2O99A 4R38A 4GHIA 1LL5A 1N4OA 1P0ZA 3HJIA 4EWFA 5CGWA 3GSGA 3ZG0A 2HF6A 5EM0A 2XRNA 3UMEA 5F68A 4GS9B 4JKTA 1J9MA 2HP9A 2JCHA 4IHQA 1XXMA 4E3KA 3EGDC 4WZ4A 1GA0A 3TW8A 4B9OA 2PYRA 5EVID 4R4RA 4EBNA 2ZQ7A 4X25A 3UN7A 3GMWA 3EGXC 4PMAA 4HJ3A 5M18A 4WEJA 4UAAA 3G32A 5FEGA 3HUNA 5EVIC 2BASA 2D01A 4FCFA 3G2YA 4K91A 1UWNX 1NRJA 1ERMA 1SKOB 3S7OA 2HP6A 3MBZA 2V8FA 4E04A 1K38A 5A92A 2QMIA 3O86A 4PKYA 3UE6A 4FTXA 3PXPA 4GDBA 5KSHA 3UPOA 1W5DA 4DJ3A 4OOYA 4WYYA 1MWSA 2P74A 4R70A 4BLMA 3EQVA 1HTZA 2EFXA 4DE1A 3A3FA 2BLSA 1G6OA 3SZTA 4Y17A 2ZMFA 2Y2OA 3HLFA 2H0TA 3VSLA 4MBFA 3LIDA 3PBQA 2W0NA 3QNBA 4HH2A 5HL6A 2V1AA 5HL1A 3C2WA 2VZWA 1BZAA 1ERQA 3VSKA 1XP4A 2R78A 3ZG9B 3CI6A 3DTKA 4EUVA 4WZ5C 3BJNA 1S67L 1ONGA 1W8YA 1K56D 4GJ4A 2Y8HA 2K7SA 1PFLA 5HAIA 3R7WA 3BY9A 3H7WB 3LR4A 3IF6C 5DFYA 4D2OA 3S1YA 3PR6A 1TEMA 3UB5P 4ZJ3A 5F82A 4OP5A 2GNXA 3IHAA 4QJGA 4F3LB 2P08A 2O0YA 4HJ4A 2ZJ9A 4KZ4A 1FCNA 4DKIA 4PM9A 2A24B 3I7JA 4WN5A 1G68A 4GKUA 4HBUA 3MF0A 5A8BA 3IWIA 4S2OA 2PBYA 3R4KA 3CPTB 5A90A 2ZQ8A 1E3UA 4LV0A 3UE3A 3EEAA 5EV0A 5IHVA 3D72A 1MKIA 1T18A 2G2UA 4HEFA 5A93A 5HARA 3HBRA 1M40A 1YMXA 4P6ZM 1KVMA 4II7A 1S66L 3BFCA 3MQ0A 1OPXA 3CG5A 4RVAA 2QYBA 3VP1A 5DJTA 3E4QA 4S2PA 2ZC5B 5CRFA 1PWDA 3VP3A 2Z6DA 2XROA 2WKIA 4R3JA 4N9LA 1DY6A 3LICA 4EBPA 5HD5A 4WM9A 2ZLYA 3HLCA 5DVAA 4IUHA 3B33A 3W2ZA 1F98A 2H5SA 4LFUA 5AVFA 5CHMA 3WS1A 4KENB 2YKFA 5IU1A 3OPRA 1DJAA 4C6YA 5M19A 1FILA 2Y55A 3DWZA 2DRWA 5HD3A 4DE2A 4MDZA 2EWWA 3MXQA 1CI9A 2ACGA 1GHMA 3E4PA 2OWJA 1YLPA 4DXCA 3IXBA 4DRTA 4ETXA 2W3DA 3AGDA 3SS4A 3FKWA 1XA1A 2W1TB 1MY8A 3TSGA 1OJ5A 2OLVA 2WGVA 2UV0E 1I2WA 1SZVA 2Z6CA 2WKHA 5CXWA 1KOUA 3ISGA 4PM8A 4KUKA 3TRCA 4Y0TA 4JF4A 5CHUA 3QP2A 1WA9A 4Y0OA 5TJJA 2Y4AA 3KSGA 3V50A 1NWZA 3NDGA 1DJBA 4KZ9A 2B02A 3OZHA 1V9YA 5AVEA 3IF6B 3IXGA 3MZDA 2H10A 2HJ9C 3T4OA 3H82B 4IEDA 3FKVA 5L2FA 1S4RA 1VEUA 4MN7A 1LSVA 4Y5FA 3MQQA 4E3LA 5KIZA 4JXWA 2IWCA 5IS1A 1HVBA 4EERA 2QJ7A 3D3OA 5F1GA 3HVFA 3GVBA 1JTGA 4NKPA 1RCJA 3MFXA 4EUZA 3G31A 4BMWA 4Z1WA 3DTIA 2MJ6A 2PD7A 3GDIA 1ZKJA 2VKSA 4ZBEA 5I5LA 4LPZA 4I3AA 5CHJA 1BLSA 2NUPC 3BW6A 4NK3A 3LR5A 2VLGA 1K6RA 3T1SA 3N8RA 5TBMB 4P6ZS 1S4SA 3C7UA 3SH8A 4I3IA 4ID4A 3WWXA 2EX9A 4JBFA 3S7QA 4HHDA 3OPHA 4DN0A 3LY3A 3M2JA 1DRMA 1PWCA 4DDYA 5EFWA 1VHMA 4R3AA 1GHIA 3A3IA 5FA7A 1M6KA 2JKRI 5HWVA 1V9ZA 4K0XA 3IH9A 1N9OA 3UE0A 3V39A 1BTLA 2WADA 2HZ5A 3N4IA 4L9GA 2V8CA 2QPNA 2I72A 2V20A 1PWGA 1Q2PA 3TOIA 3VP4A 3BECA 3D9YA 5CEBA 2QJ5A 5J8XA 5M1AA 4DE3A 2Y2NA 1KE3A 2O9AA 3KYZA 4OPYA 4OPZA 1TS7A 2B18A 3HLBA 5F5YA 3ZGAB 2VGLS 3S7PA 3W4PA 3ZG7B 5EPHA 4RX3A 5IT5A 1S1ZA 2IWBA 5FDSA 4O8GA 2L4RA 3HLDA 4CLCE 5DF8A 1X0OA 3HUOA 4ZTKA 2P04A 1K57A 4PAUA 3IX4A 3PAEA 3NIAA 1SDEA 5GHXA 4YWZA 1VM1A 1Y4OA 3K3DA 4IBRA 4KZ5A 3Q7VB 4JXSA 2V0WA 2GJ3A 4A5RA 1NYMA 3H9WA 4GCZA 1LL9A 3OOVA 4DDSA 1SCWA 2WKEA 5E2EA 3IXDA 3LR3A 3HREA 1D7EA 3RFBA 3LY4A 3K2NA 2EXAA 3G2ZA 4M3KA 4GW9A 1I5QA 3KYEA 4MN6A 1DP9A 1JTDA 1OT6A 1IYOA 2QKPA 3S22A 4OPRA 2UWXA 5I94A 3DAVA 3NI9A 4FSFA 4CLCA 4BBUA 4JGRA 2EA9A 3FV7A 3NBLA 5HDCA 3A3DA 2A2LA 1IFQA 3ZVTA 3PBOA 2Y79A 2ZL1B 4AFIA 4MEZA 4QD4A 4BQMA 4LCLA 3W4QA 3B3XA 2AVXA 3MMHA 3HCYA 4EEPA 5L10A 1GHPA 3NOTC 3UNWA 1W79A 2PU2A 2KLIA 3QP5A 4HQAA 1TDGA 5BOHA 1MBLA 4OLDA 2CMNA 3O5YA 4OQIA 1CJFA 4NETA 3M6HA 2OAP1 4GHIB 2X02A 2E8JA 1OTAA 3T12B 4FOFA 2J9PA 1YMSA 3OCNA 4Q0JA 4O0PA 2FH5A 1W8QA 4JXGA 4Y2FA 3N8SA 1K55A 2RL3A 3T50A 3BEBA 5G4ZA 2HGVA 1FR1A 1T1AA 3F1PA 4EBLA 2FFYA 5FSRA 4XT2A 3WS5A 1G6AA 4BL2A 3ZYTA 3E4OA 4O01A 4KZAA 2EFUA 4QWOA 1MXOA 2VGKA 4WLAA 3BWLA 1AWIA 3CWFA 3UB7A 2XLNA 2WZZA 5DKKA 3M6BA 5K5BA 4LCMA 5G4YA 1JWVA 3ZNTA 3G4PA 4Y0UA 5C5KA 3UMDA 3LIFA 5EUAA 1FIKA 3Q1FA 1T1BA 2EXBA 3G6OA 2FFFB 4JGPA 3QP8A 3N8LA 4KZ7A 1IYPA 3BFDA 4G3WA 4FUWA 4I39A 3ITAA 4Y13A 4DE0A 5J3WA 4DF6A 1SDNA 3L7HA 4S2KA 3PBNA 4GN2A 2INWA 5FQMA 1KGEA 2L0WA 5HZHA 3O87A 3QP4A 4ETZA 3R7WB 1N9NA 4ESPA 2VA0A 4PPRA 3MZFA 4GD6A 3T4KA 2Y2LA 4O7DA 2QHKA 1L2SA 4ARZA 2ZQ9A 4Q0IA 1BUEA 4BD1A 5EM1A 1ESIA 4PHTA 5HSQA 4FD8A 3UE1A 5D3OA 3ZDJA 5HFOA 1NZUA 3WS4A 5GHYA 1Q2QA 1Z09A 5FAPA 1RGZA 3PBRA 4IVKA 4OP8A 2PD8A 5FDHA 3SS3A 3F1OA 5GLCA 1NY0A 3QP6A 4E3NA 4G3KA 1XJ2A 1HZOA 4KUOA 1EROA 4K0WA 2WKQA 3U2AA 1VB6A 3Q81A 1H3QA 1NRFA 2Y2GA 1BLHA 4UQIM 5E2GA 2JE5A 4IJGA 2PU4A 3IWOA 2K31A 1XPBA 1DP8A 3OCLA 4KZ3A 1L0FA 1ZTUA 5GLBA 1K4FA 4DMZA 3BRMA 2HP5A 1YLZA 1ES2A 1SKFA 1PZPA 4LGWA 1VETA 5GHZA 3T1XA 2HDUA 2G2WA 3A0VA 5DTTA 4E3IA 3CMZA 2X01A 4Y15A 5HWWA 1ACFA 3VFHA 1TS8A 3G35A 2V2FF 3SS5A 4WF0A 3BFFA 1S0WA 2WZXA 4JGQA 5DTSA 3IH8A 5L8MA 4R4SA 2O9CA 2WYXA 3RJUA 3IHBA 1MZUA 3IBJA 3LR0A 3MS6A 4MBHA 3HLGA 5FQJA 5CGSA 3UO9A 1MKMA 3LI9A 1OJGA 1KGGA 1KVLA 2R9XA 2KOIA 4PM5A 3JPUA 4S2NC 4UA7A 1L0EA 1ZHHB 2RCXA 3IQAA 5FI6A 1CEFA 4LENA 1QMFA 2QZ6A 4JF5A 4LLOB 3GR2A 4GD8A 2KX6A 4NXGA 2LB9A 4EU0A 1CK3A 4BBTA 2W3GA 5EE8A 5FL3A 3VOZA 1RP5A 2A3UA 3V3RA 3VE3A 3ZFZA 2QWSA 2WGIA 4BL3A 5TFQA 4X68A 4YINA 1K57C 4JXVA 5EECA 1BLCA 1ES3A 1LT0A 2BTFP 1OTIA 4KQQA 2X71A 5FQKA 2M7VA 4RQ9A 4XUZA 4I38A 1GSVA 1VEUB 2JKGA 3FWLA 2OV5A 5EVIA 3IS2B 2VGLM 3BFEA 2ZMVA 5AQ9A 5G18A 3F1NA 3MR0A 3C5AA 5KSCA 3BYDA 1P9WA 4M4XA 5FAOA 1BSGA 3NJAA 3D4FA 1OTDA 5L09A 4GOGA 2XK1A 4X56A 3TE8A 1NLZA 4UQIS 5CGXA 5DF9A 1NLYA 3IS2A 4X69A 4E3MA 2XFSA 3OBFA 1CF0A 1ES4A 2H28A 4PM7A 3MKFA 1NYYA 4CLCC 2M7UA 2PYPA 3NCKA 1MC0A 3CLOA 4I5SA 2ZOHA 3GV9A 3CZDA 2C5WB 2Z2MB 3MXSA 2ZBBA 4N1XA 3IX3A 1PW8A 1U60A 5EVEA 1K25A 1LL8A 3L9KA 4JPMA 4HJ6A 1W7FA 3VOYA 4GDNA 3UB6A 3SW1A 1EWZA 3Q82A 4GLQA 3MZEA 3S4XA 4KG6A 1JWZA 5FI7A 4XXRA 1TS0A 3LCEA 3P98A 4LV2A 2JKTI 4MN5A 3ZG8B 2ZD8A 4WMCD 1GSXA 3EOIA 1DP6A 2JHEA 3UPNA 1CEGA 1W63M 5GLDA 2JBFA 3KX0X 3GQZA 3P7NA 4S2LA 3PAGA 3E2KA 2Y59A 1VQQA 2J7VA 4HESA 4OVDA 2GX5A 3DTEA 4ME4A 5CX7A 1FR6A 4S2IA 1GSWA 4U3TA 3RH8B 5TGFA 5EVLA 1KE0A 4EXOA 5E2HA 1K0KA 3PHYA 4OONA 3NECA 4HNBA 2XD5A 3ZVWA 5DJUA 1MWTA 3WRTA 3OC2A 4KQOA 4L0LA 1PYYA 1K54A 5FASA 4H6JA 3T4SA 3A3JA 2C6WB 3PBTA 4E6WA 4S2MA 1N9LA 2XF3A 2IA2A 1F2KA 2VV7A 3KO6A 3UB8A 2HDSA 2J9OA 4CJNA 2Y2HA 2ZM0A 5MC7A 2J3TC 4CLCB 4E6XA 1PI4A 3ULFA 1UWPX 1T1CA 4LV3A 3C30A 1Y28A 1OT9A 3T1QB 4WUJA 1FQGA 2ZC4B 4HP9A 2ZC3B 2JKTM 4C75A 5FQIA 1T19A 2EX6A 3UY6A 4P6BA 5CERA 4L9EA 4Y3IA 1MWUA 2G7UA 2PDRA 3VE4A 2L1MA 3JYIA 2Y91A 1XKZA 1YKDA 5FI2A 2PR5A 3FPVA 4CPKA 2W3FA 1C3BA 3JVVA 1YM1A 2VGJA 1CI8A 4QPRA 3IT9A 2V0UA 4R3BA 1I2SA 3A0RA 1ES5A 4GZBA 2PRFA 4N9KA 2KDKA 2XSSA 1KDWA 4OKPA 4D60A 5KZHA 4EW7A 2K2NA 1E3UD 2PR6A 2ZC6B 4HI4A 1IYSA 4R1GA 3VFFA 2WK0A 1XJ3A 3F1PB 4G3VA 4IVIA 4XT2B 1IEMA 3N6IA 4B88A 1PZOA 2JN7A 1HLUP 2P7JA 1F9IA 3SOIA 4JLFA 4ZJ1A 2J80A 3KYQA 2Y2KA 1G28A 5DF7A 1KDSA 3E0YA 3MQOA 3GECA 2I9VA 1BLPA 3LGOA 4Q0HA 5CTNA 2VK3A 3C4OA 1NJ4A 1PNEA 3TG9A 1YLTA 1YSPA 3T4LA 2JC7A 2P9VA 5GL9A 4PM6A 1H8ZA 4P0MA 4UEYA 5AQ7A 5HWTA 2OSUA 1CQAA 4WL9A 4GNUA 1L0GA 5EOEA 2EX2A 1QMEA 5A91A 4ZAMA 1IKGA 4OQHA 3U4LP 3E2LA 3MSHA 1LHYA 1XGJA 2XQZA 4LRZE 4ARZB 4BWIA 2HJEA 1UGUA 4Y7PA 1KGFA 2O9BA 2XD1A 1H5XA 4F94A 3G34A 1ONHA 2HPBA 4GS9A 1WYBA 3V3SA 3QP1A 4RX2A 5J7EA 4PKYG 4I3JA 1PI5A 3NY4A 3MJQA 3F1OB 4MLLA 4E3JA 4MNRA 4IUKA 1Y54A 2V9AA 2J3WA 5DFXA 4BJPA 3RXXA 1BYWA 1YAXA 2OAQ1 1PIOA 4DXBA 3LIAA 1FCMA 4HH3A 4EESA 3PYPA 3ITBA 2Y2IA 4L9FA 4ZRRA 1SKOA 5F1FA 4MMNA 2Q9NA 3B47A 4QY6A 2XDMA 5FAQA 2OLUA 3EEHA 5JYOA 2XA7S 5HDSA 1XFQA 4MCWA 3UDXA 3CUEA 1VETB 3HLEA 2B5RA 4QB8A 4NXEA 1L3LA 5F83A 1FCOA 3E98A 1D06A 5HPFA 3B42A 4K08A 1D1JA 3ICYA 1IOUA 2ZQCA 2BG1A 3HUMA 3AGEA 5CTMA 3DWKA 1GA9A 4EQ1A 2B95A 1XA7A 3UDIA 2W1RA 3PBSA 1MWRA 2PT7A 2PAVP 2VX8A 4KG2A 1H8YA 5F6AA 3MXRA 4ZJ2A 4C3QA 3VV4A 1LSWA 1S1YA 3IXHA 3VOLA 1STZA 5U47A 1ZC2A 1XX2A 1YLJA 3GRJA 3H7WA 2HDRA 3DBAA 3BLSA 4X1MA 1Z6FA 3IWQA 4NXFA 3KSHA 3LEZA 3LUQA 1W63Q 5J4EA 3UB9A 4BD0A 4HBTA 4F3LA 4H8RA 2PHYA 5HDDA
chains in the Genus database with same CATH topology
3EGXC 4HJ3A 4GLQA 4WEJA 4GW9A 2VJWA 3LFVA 4B93A 2A24A 3LIEA 1TS0A 3K3CA 4MN6A 1DP9A 2BASA 1OT6A 2D01A 2JKTI 4MN5A 2QKPA 1UWNX 1NRJA 4R6LA 5F69A 3S7OA 1GSXA 3EOIA 1DP6A 4E04A 4FSFA 1OTEA 2JHEA 2EWVA 4CLCA 4HY8A 4BBUA 4PKYA 3UE6A 4JGRA 2EA9A 3PXPA 5HDCA 1W63M 3C38A 5KSHA 2V1BA 3F1NB 4DJ3A 3LI8A 2A2LA 1IFQA 4R70A 3KX0X 3PBOA 3EQVA 2Y79A 4AFIA 3P7NA 2W27A 1G6OA 1P9RA 2ZMFA 3JVUA 1JNUA 3MMHA 3HCYA 4EEPA 3LIDA 3PBQA 2W0NA 2OOLA 4HH2A 2GX5A 4ME4A 5CX7A 1EW0A 3NOTC 5HL6A 3T4TA 2V1AA 1GSWA 3RH8B 2KLIA 3C2WA 4HQAA 2VZWA 4EXOA 2R78A 1TD5A 3CI6A 2CMNA 4EUVA 3PHYA 3O5YA 3BJNA 2OAP1 4GHIB 1S67L 4HNBA 4GJ4A 2Y8HA 1OTAA 2K7SA 3R7WA 5DJUA 3BY9A 4FOFA 3OCNA 3OC2A 4KQOA 3H7WB 4L0LA 3LR4A 4Q0JA 4O0PA 2FH5A 5DFYA 4H6JA 3T4SA 3PR6A 1TS6A 4Y2FA 4CLCD 2GNXA 3PBTA 4F3LB 3T50A 2W1TA 2P08A 2O0YA 4HJ4A 1XJ6A 1N9LA 3LYXA 5G4ZA 2HGVA 1P97A 2A24B 1T1AA 2IA2A 3F1PA 4WN5A 2LB5A 4XT2A 3ZYTA 2VV7A 3KO6A 4HOIA 3E4OA 3MF0A 3UB8A 5A8BA 4O01A 1XFNA 5MC7A 2J3TC 3R4KA 4CLCB 4WLAA 3BWLA 3CWFA 3ULFA 3UB7A 1UWPX 2OWHA 1T1CA 3UE3A 3EEAA 3P01A 2HV1A 2M1CA 3C30A 1Y28A 5DKKA 1OT9A 5K5BA 3S7NA 3H82A 3SW1A 5G4YA 3D72A 4WUJA 3OLOA 5C5KA 1T18A 4DJ2A 3UMDA 3LIFA 4HP9A 2JKTM 3RTYA 1T1BA 4P6ZM 3G6OA 1T19A 4II7A 3NOPC 4JGPA 4EEUA 1S66L 3MQ0A 3V67A 1OPXA 3EQUA 2QYBA 4G3WA 5DJTA 4L9EA 4Y3IA 2G7UA 2PDRA 3E4QA 3VE4A 2L1MA 4I39A 2Z6DA 2XROA 5J3WA 1YKDA 3LICA 5HD5A 2PR5A 3FPVA 3PBNA 4NEED 2W3FA 3JVVA 4IUHA 2INWA 2YKHA 3B33A 3W2ZA 4QPRA 1F98A 5AVFA 2V0UA 2L0WA 2YKFA 5HZHA 1YSQA 5IU1A 4YNRA 1LSXA 3FPWA 3A0SA 4ETZA 3R7WB 1N9NA 2VA0A 3A0RA 5HD3A 4MDZA 2EWWA 3MXQA 3T4KA 3KSFA 2QHKA 4H6JB 3E4PA 2OWJA 2W3HA 4HP4A 4ARZA 4ETXA 2W3DA 4Q0IA 2KDKA 2XSSA 2WKRA 3T4JA 4PHTA 4EW7A 5HSQA 5TBMA 3T4QA 2W1TB 2K2NA 1OJ5A 2PR6A 4HI4A 2Z6CA 1XJ3A 3F1PB 4G3VA 4XT2B 3PBRA 1KOUA 4KUKA 3TRCA 2PD8A 3F1OA 3EWKA 1WA9A 5TJJA 4G3KA 1XJ2A 4HIAA 4KUOA 3KSGA 4YOFA 2FZ0A 2JN7A 2WKQA 1NWZA 3U2AA 1VB6A 2P7JA 1F9IA 2J80A 4OOLA 3BY8A 3CAXA 1H3QA 2B02A 4UQIM 4LRYC 4IJGA 3KYQA 3BQAA 1G28A 2K31A 3E0YA 3MQOA 1V9YA 1DP8A 3OCLA 5AVEA 3GECA 2I9VA 2HJ9C 3T4OA 4Q0HA 3H82B 2J3TD 1ZTUA 1S4RA 4DMZA 4MN7A 1LSVA 4Y5FA 4OOMA 1YSPA 3MQQA 3T4LA 5KIZA 5DKLA 5IS1A 4EERA 2QJ7A 3D3OA 4UEYA 3A0VA 5LBRA 5AJGA 2VV8A 3ZQ5A 5HWTA 5HWWA 1TS8A 2DMWA 4WF0A 3C8CA 4WEKA 4WL9A 2VV6A 4JGQA 4NKPA 3MFXA 5L8MA 4BMWA 2O9CA 3LIBA 1MZUA 4Z1WA 3IBJA 3LR0A 2MJ6A 2PD7A 3GDIA 4LRXC 2VKSA 5I5LA 4LPZA 4LRZE 4I3AA 1MKMA 4ARZB 4BWIA 2HJEA 3BQ8A 1UGUA 3LI9A 2NUPC 3BW6A 2O9BA 1OJGA 3LR5A 2VLGA 4CQHA 4NXBA 5TBMB 4JGOA 4P6ZS 1S4SA 2KOIA 4I3IA 3CUEC 4GS9A 1ZHHB 3S7QA 4HHDA 3KSIA 5J7EA 2WKPA 4PKYG 4I3JA 3FC7A 4DN0A 3MJQA 3F1OB 4IUKA 2V9AA 1XJ4A 4LLOB 4WELA 1OTBA 2KX6A 4NXGA 1DRMA 2LB9A 4EU0A 2J3WA 5DFXA 5EFWA 4BBTA 1VHMA 4R3AA 4BJPA 2W3GA 1BYWA 5FL3A 1YAXA 2JKRM 3VE3A 2OAQ1 2JKRI 2QWSA 5HWVA 1V9ZA 3LIAA 3TJZC 1N9OA 2XA7M 4HH3A 4BBVA 4EESA 3PYPA 1F5MA 4L9GA 3NHQA 1LT0A 4L9FA 4ZRRA 1OTIA 4MMNA 3B47A 4EETB 2M7VA 3CITA 4RQ9A 2NUTC 4I38A 1GSVA 2ZOIA 2VEAA 3EEHA 3HJKA 1ODVA 3IS2B 2XA7S 4KQDA 5HDSA 2VGLM 1XFQA 2ZMVA 2QJ5A 5HPIA 4MCWA 3CUEA 3F1NA 3MR0A 2O9AA 4NXEA 1TF1A 3KYZA 2GZAA 1TS7A 2B18A 3NOUC 5F5YA 3E98A 1D06A 1H8MA 2W3EA 5HPFA 3B42A 4K08A 3ICYA 2VGLS 1IOUA 3S7PA 3FG8A 1P9WA 4M4XA 3NJAA 1OTDA 5IT5A 3TE8A 1S1ZA 1NLZA 3IBRA 4UQIS 4EQ1A 5DF9A 4O8GA 1NLYA 2L4RA 3IS2A 4CLCE 2W1RA 3PBSA 1X0OA 2P04A 2PT7A 2D02A 2VX8A 4PAUA 3OBFA 2H28A 2O99A 4R38A 4YWZA 4GHIA 2M7UA 5F6AA 4CLCC 1P0ZA 3HJIA 2PYPA 3VV4A 3K3DA 1LSWA 1S1YA 3VOLA 1STZA 2HF6A 2XRNA 1MC0A 3UMEA 5F68A 4GS9B 3CLOA 4I5SA 2ZOHA 2V0WA 3H7WA 2GJ3A 2ZBBA 4IHQA 3H9WA 3DBAA 4GCZA 1LL8A 3EGDC 3OOVA 4NXFA 3KSHA 3TW8A 3LUQA 4B9OA 2PYRA 1W63Q 3LR3A 3RFBA 1D7EA 5J4EA 3UB9A 4HJ6A 4F3LA 3K2NA 2PHYA 3UB6A 5HDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLQ A;  3TRC A;  2IA2 A;  4GW9 A;  2LB5 A;  2LB9 A;  2VJW A;  3LFV A;  4EU0 A;  5DFX A;  1VHM A;  5TJJ A;  4G3K A;  2W3G A;  3KO6 A;  3KSG A;  4YOF A;  3MF0 A;  4O01 A;  4LRY C;  4IJG A;  1F5M A;  3R4K A;  4R6L A;  3S7O A;  3NHQ A;  4E04 A;  4ZRR A;  2K31 A;  3E0Y A;  4MMN A;  2M7V A;  3CIT A;  4RQ9 A;  3EEA A;  4Q0H A;  2VEA A;  1ZTU A;  5K5B A;  3S7N A;  4DMZ A;  4MN7 A;  5HPI A;  4MCW A;  4R70 A;  4Y5F A;  5C5K A;  1YSP A;  2Y79 A;  3G6O A;  2O9A A;  1TF1 A;  2ZMF A;  3NOP C;  3MQ0 A;  2B18 A;  3NOU C;  3D3O A;  3E98 A;  2QYB A;  2W3E A;  3MMH A;  4G3W A;  5HPF A;  3HCY A;  5LBR A;  4Y3I A;  5AJG A;  2G7U A;  2OOL A;  3S7P A;  3ZQ5 A;  2GX5 A;  2XRO A;  4ME4 A;  3NOT C;  1YKD A;  5HL6 A;  2KLI A;  3C2W A;  3IBR A;  2VZW A;  2W3F A;  5L8M A;  4IUH A;  2O9C A;  4O8G A;  3W2Z A;  4Z1W A;  4QPR A;  1TD5 A;  2W1R A;  3CI6 A;  3IBJ A;  1YSQ A;  4EUV A;  4YNR A;  3O5Y A;  3BJN A;  4LRX C;  2VKS A;  4PAU A;  4ETZ A;  3OBF A;  5I5L A;  4LRZ E;  2O99 A;  2Y8H A;  1MKM A;  4MDZ A;  2M7U A;  4BWI A;  3KSF A;  4FOF A;  3VV4 A;  2O9B A;  4Q0J A;  1STZ A;  2W3H A;  4O0P A;  4ETX A;  4CQH A;  2W3D A;  2XRN A;  1MC0 A;  4Q0I A;  5DFY A;  2KOI A;  2XSS A;  4Y2F A;  5HSQ A;  3DBA A;  2W1T B;  2K2N A;  3OOV A;  3S7Q A;  3KSH A;  3KSI A;  2W1T A;  2O0Y A;  3RFB A;  4G3V A;  4DN0 A;  2HGV A;  3K2N A;  4IUK A; 
#chains in the Genus database with same CATH topology
 4UA6 A;  3Q7Z A;  5HX9 A;  2VJW A;  3LFV A;  3VP2 A;  4B93 A;  2A24 A;  3LIE A;  4QHC A;  4S2J A;  2Y2M A;  3K3C A;  1TDL A;  3NDE A;  5AQB A;  4RA7 A;  4R6L A;  4JF6 A;  5F69 A;  2XGN A;  1OTE A;  2EWV A;  4FH2 A;  3UPP A;  3CPT A;  4HY8 A;  4RYE A;  5EVI B;  3AGF A;  3C38 A;  1L0D A;  4X55 A;  2V1B A;  1K54 C;  3F1N B;  4OH0 A;  3LI8 A;  2HDQ A;  4Q8I A;  3IF5 A;  1LI0 A;  2W27 A;  5TR7 A;  5FQQ A;  1MPL A;  1P9R A;  3JVU A;  4ZDX A;  1JNU A;  3PTE A;  2OOL A;  5E43 A;  1BUL A;  4BEN A;  4OPQ A;  1KE4 A;  1EW0 A;  3T4T A;  1FSY A;  2ZM2 A;  1TD5 A;  4OQ0 A;  3A3E A;  4R23 A;  4IBX A;  4QY5 A;  3C7V A;  3O88 A;  4LV1 A;  4WBG A;  4KZB A;  3WS2 A;  2XH9 A;  3HLW A;  1TS6 A;  1WYC A;  1DJC A;  4CLC D;  1JVJ A;  1FOF A;  2W1T A;  1XJ6 A;  3LYX A;  1P97 A;  3ZG5 A;  1HD8 A;  2LB5 A;  1YPR A;  2WUQ A;  4HOI A;  4UHU A;  5DTK A;  1XFN A;  4NG2 A;  3RXW A;  3FZC A;  2PBD P;  4WZ5 A;  3LO7 A;  3BM6 A;  2H0Y A;  4KG5 A;  4U0X A;  2DCF A;  1SHV A;  1XGI A;  4KQR A;  2OWH A;  3P01 A;  2HV1 A;  2M1C A;  1NXY A;  3IF6 A;  3ZNY A;  3S7N A;  3H82 A;  3OLO A;  1K56 A;  1RGY A;  4DJ2 A;  3V5M A;  3RTY A;  5FQ9 A;  4EEU A;  3NOP C;  1ALQ A;  3V67 A;  3EQU A;  4P85 A;  3HL9 A;  3WS0 A;  3IX8 A;  2WAE A;  4N1H A;  3DW0 A;  1YLY A;  2XR0 A;  4NEE D;  1GCE A;  2YKH A;  4Z9Q A;  1JWP A;  3NUL A;  1ZG6 A;  3OPP A;  1YSQ A;  4YNR A;  1K55 C;  1LSX A;  1PW1 A;  3A0S A;  3FPW A;  5KMW A;  4QU3 A;  1YLW A;  2R9W A;  5CED A;  5JYP A;  3W8K A;  3KSF A;  4H6J B;  3LEQ A;  4X53 A;  2W3H A;  4HP4 A;  1ESU A;  4OLG A;  3ZHH A;  4EQI A;  1EI5 A;  2WKR A;  3T4J A;  1ZG4 A;  1WE4 A;  5TBM A;  3T4Q A;  2XEP A;  4GB7 A;  4OQG A;  4FH4 A;  3QNC A;  2Y2P A;  5HAP A;  1H0M A;  3EWK A;  4HIA A;  2EX8 A;  4YOF A;  3W4O A;  2FZ0 A;  4S2N A;  1E4D A;  4OOL A;  3BY8 A;  3CAX A;  4XUX A;  5FAT A;  4LRY C;  3BQA A;  2WAF A;  4KZ8 A;  4MBK A;  3VP0 A;  2A49 A;  2J3T D;  1PRQ A;  3CJM A;  4X6T A;  4OOM A;  2CC1 A;  4P87 A;  2ZMA A;  1S6R A;  3O3V A;  5DKL A;  5HW3 A;  1N9B A;  4EV4 A;  1A0K A;  3BFG A;  3ZCZ A;  1J3W A;  2Y2J A;  3N7W A;  2ZC7 A;  5LBR A;  5AJG A;  2VV8 A;  2GDN A;  3ZQ5 A;  4KZ6 A;  3T1R A;  1YQS A;  2DMW A;  5HAQ A;  1OME A;  1IEL A;  3C8C A;  4WEK A;  2VV6 A;  3M2K A;  4B4X A;  2Z2L B;  3LIB A;  4B4Z A;  1YT4 A;  3NC8 A;  5FEF A;  3BLM A;  4LRX C;  2Q0O A;  3P09 A;  4E3O A;  3BQ8 A;  5GLA A;  2JKF A;  2WGW B;  3FYZ A;  4CQH A;  4NXB A;  4JGO A;  2Q9M A;  3UDF A;  2ZM8 A;  1FSW A;  1BT5 A;  3CUE C;  1LI9 A;  3Q7V A;  4N92 A;  3G30 A;  3KSI A;  2WKP A;  3MFD A;  3SH9 A;  3FC7 A;  2XFT A;  2ZQA A;  4X1L A;  2ZQD A;  3OPL A;  4WEL A;  1XJ4 A;  5EOO A;  1OTB A;  1O7E A;  2E8I A;  3SH7 A;  2JKR M;  2WGW A;  3TJZ C;  3DTM A;  2XA7 M;  3C4P A;  4U0T A;  3QHY A;  4BBV A;  1F5M A;  1IKI A;  1TVF A;  3NHQ A;  1K4E A;  1E25 A;  4UA9 A;  3WRZ A;  2DNS A;  5AQA A;  4EET B;  3CIT A;  2NUT C;  2ZOI A;  2VEA A;  3HJK A;  1ODV A;  1NZO A;  4KQD A;  5HPI A;  2V1Z A;  2P9V B;  5E2F A;  1G5U A;  1TF1 A;  2ZL1 A;  4YFM A;  3GTC A;  1K6S A;  2GZA A;  3NOU C;  1H8M A;  2W3E A;  3FG8 A;  3VMA A;  1IYQ A;  4WMC A;  4R0Q A;  3Q07 A;  3IBR A;  2J8Y A;  1O07 A;  2IWD A;  5CEC A;  3MKE A;  2D02 A;  5L07 A;  2Y2Q A;  3CHW P;  1AXB A;  1LLB A;  2O99 A;  4R38 A;  4GHI A;  1LL5 A;  1N4O A;  1P0Z A;  3HJI A;  4EWF A;  5CGW A;  3GSG A;  3ZG0 A;  2HF6 A;  5EM0 A;  2XRN A;  3UME A;  5F68 A;  4GS9 B;  4JKT A;  1J9M A;  2HP9 A;  2JCH A;  4IHQ A;  1XXM A;  4E3K A;  3EGD C;  4WZ4 A;  1GA0 A;  3TW8 A;  4B9O A;  2PYR A;  5EVI D;  4R4R A;  4EBN A;  2ZQ7 A;  4X25 A;  3UN7 A;  3GMW A;  3EGX C;  4PMA A;  4HJ3 A;  5M18 A;  4WEJ A;  4UAA A;  3G32 A;  5FEG A;  3HUN A;  5EVI C;  2BAS A;  2D01 A;  4FCF A;  3G2Y A;  4K91 A;  1UWN X;  1NRJ A;  1ERM A;  1SKO B;  3S7O A;  2HP6 A;  3MBZ A;  2V8F A;  4E04 A;  1K38 A;  5A92 A;  2QMI A;  3O86 A;  4PKY A;  3UE6 A;  4FTX A;  3PXP A;  4GDB A;  5KSH A;  3UPO A;  1W5D A;  4DJ3 A;  4OOY A;  4WYY A;  1MWS A;  2P74 A;  4R70 A;  4BLM A;  3EQV A;  1HTZ A;  2EFX A;  4DE1 A;  3A3F A;  2BLS A;  1G6O A;  3SZT A;  4Y17 A;  2ZMF A;  2Y2O A;  3HLF A;  2H0T A;  3VSL A;  4MBF A;  3LID A;  3PBQ A;  2W0N A;  3QNB A;  4HH2 A;  5HL6 A;  2V1A A;  5HL1 A;  3C2W A;  2VZW A;  1BZA A;  1ERQ A;  3VSK A;  1XP4 A;  2R78 A;  3ZG9 B;  3CI6 A;  3DTK A;  4EUV A;  4WZ5 C;  3BJN A;  1S67 L;  1ONG A;  1W8Y A;  1K56 D;  4GJ4 A;  2Y8H A;  2K7S A;  1PFL A;  5HAI A;  3R7W A;  3BY9 A;  3H7W B;  3LR4 A;  3IF6 C;  5DFY A;  4D2O A;  3S1Y A;  3PR6 A;  1TEM A;  3UB5 P;  4ZJ3 A;  5F82 A;  4OP5 A;  2GNX A;  3IHA A;  4QJG A;  4F3L B;  2P08 A;  2O0Y A;  4HJ4 A;  2ZJ9 A;  4KZ4 A;  1FCN A;  4DKI A;  4PM9 A;  2A24 B;  3I7J A;  4WN5 A;  1G68 A;  4GKU A;  4HBU A;  3MF0 A;  5A8B A;  3IWI A;  4S2O A;  2PBY A;  3R4K A;  3CPT B;  5A90 A;  2ZQ8 A;  1E3U A;  4LV0 A;  3UE3 A;  3EEA A;  5EV0 A;  5IHV A;  3D72 A;  1MKI A;  1T18 A;  2G2U A;  4HEF A;  5A93 A;  5HAR A;  3HBR A;  1M40 A;  1YMX A;  4P6Z M;  1KVM A;  4II7 A;  1S66 L;  3BFC A;  3MQ0 A;  1OPX A;  3CG5 A;  4RVA A;  2QYB A;  3VP1 A;  5DJT A;  3E4Q A;  4S2P A;  2ZC5 B;  5CRF A;  1PWD A;  3VP3 A;  2Z6D A;  2XRO A;  2WKI A;  4R3J A;  4N9L A;  1DY6 A;  3LIC A;  4EBP A;  5HD5 A;  4WM9 A;  2ZLY A;  3HLC A;  5DVA A;  4IUH A;  3B33 A;  3W2Z A;  1F98 A;  2H5S A;  4LFU A;  5AVF A;  5CHM A;  3WS1 A;  4KEN B;  2YKF A;  5IU1 A;  3OPR A;  1DJA A;  4C6Y A;  5M19 A;  1FIL A;  2Y55 A;  3DWZ A;  2DRW A;  5HD3 A;  4DE2 A;  4MDZ A;  2EWW A;  3MXQ A;  1CI9 A;  2ACG A;  1GHM A;  3E4P A;  2OWJ A;  1YLP A;  4DXC A;  3IXB A;  4DRT A;  4ETX A;  2W3D A;  3AGD A;  3SS4 A;  3FKW A;  1XA1 A;  2W1T B;  1MY8 A;  3TSG A;  1OJ5 A;  2OLV A;  2WGV A;  2UV0 E;  1I2W A;  1SZV A;  2Z6C A;  2WKH A;  5CXW A;  1KOU A;  3ISG A;  4PM8 A;  4KUK A;  3TRC A;  4Y0T A;  4JF4 A;  5CHU A;  3QP2 A;  1WA9 A;  4Y0O A;  5TJJ A;  2Y4A A;  3KSG A;  3V50 A;  1NWZ A;  3NDG A;  1DJB A;  4KZ9 A;  2B02 A;  3OZH A;  1V9Y A;  5AVE A;  3IF6 B;  3IXG A;  3MZD A;  2H10 A;  2HJ9 C;  3T4O A;  3H82 B;  4IED A;  3FKV A;  5L2F A;  1S4R A;  1VEU A;  4MN7 A;  1LSV A;  4Y5F A;  3MQQ A;  4E3L A;  5KIZ A;  4JXW A;  2IWC A;  5IS1 A;  1HVB A;  4EER A;  2QJ7 A;  3D3O A;  5F1G A;  3HVF A;  3GVB A;  1JTG A;  4NKP A;  1RCJ A;  3MFX A;  4EUZ A;  3G31 A;  4BMW A;  4Z1W A;  3DTI A;  2MJ6 A;  2PD7 A;  3GDI A;  1ZKJ A;  2VKS A;  4ZBE A;  5I5L A;  4LPZ A;  4I3A A;  5CHJ A;  1BLS A;  2NUP C;  3BW6 A;  4NK3 A;  3LR5 A;  2VLG A;  1K6R A;  3T1S A;  3N8R A;  5TBM B;  4P6Z S;  1S4S A;  3C7U A;  3SH8 A;  4I3I A;  4ID4 A;  3WWX A;  2EX9 A;  4JBF A;  3S7Q A;  4HHD A;  3OPH A;  4DN0 A;  3LY3 A;  3M2J A;  1DRM A;  1PWC A;  4DDY A;  5EFW A;  1VHM A;  4R3A A;  1GHI A;  3A3I A;  5FA7 A;  1M6K A;  2JKR I;  5HWV A;  1V9Z A;  4K0X A;  3IH9 A;  1N9O A;  3UE0 A;  3V39 A;  1BTL A;  2WAD A;  2HZ5 A;  3N4I A;  4L9G A;  2V8C A;  2QPN A;  2I72 A;  2V20 A;  1PWG A;  1Q2P A;  3TOI A;  3VP4 A;  3BEC A;  3D9Y A;  5CEB A;  2QJ5 A;  5J8X A;  5M1A A;  4DE3 A;  2Y2N A;  1KE3 A;  2O9A A;  3KYZ A;  4OPY A;  4OPZ A;  1TS7 A;  2B18 A;  3HLB A;  5F5Y A;  3ZGA B;  2VGL S;  3S7P A;  3W4P A;  3ZG7 B;  5EPH A;  4RX3 A;  5IT5 A;  1S1Z A;  2IWB A;  5FDS A;  4O8G A;  2L4R A;  3HLD A;  4CLC E;  5DF8 A;  1X0O A;  3HUO A;  4ZTK A;  2P04 A;  1K57 A;  4PAU A;  3IX4 A;  3PAE A;  3NIA A;  1SDE A;  5GHX A;  4YWZ A;  1VM1 A;  1Y4O A;  3K3D A;  4IBR A;  4KZ5 A;  3Q7V B;  4JXS A;  2V0W A;  2GJ3 A;  4A5R A;  1NYM A;  3H9W A;  4GCZ A;  1LL9 A;  3OOV A;  4DDS A;  1SCW A;  2WKE A;  5E2E A;  3IXD A;  3LR3 A;  3HRE A;  1D7E A;  3RFB A;  3LY4 A;  3K2N A;  2EXA A;  3G2Z A;  4M3K A;  4GW9 A;  1I5Q A;  3KYE A;  4MN6 A;  1DP9 A;  1JTD A;  1OT6 A;  1IYO A;  2QKP A;  3S22 A;  4OPR A;  2UWX A;  5I94 A;  3DAV A;  3NI9 A;  4FSF A;  4CLC A;  4BBU A;  4JGR A;  2EA9 A;  3FV7 A;  3NBL A;  5HDC A;  3A3D A;  2A2L A;  1IFQ A;  3ZVT A;  3PBO A;  2Y79 A;  2ZL1 B;  4AFI A;  4MEZ A;  4QD4 A;  4BQM A;  4LCL A;  3W4Q A;  3B3X A;  2AVX A;  3MMH A;  3HCY A;  4EEP A;  5L10 A;  1GHP A;  3NOT C;  3UNW A;  1W79 A;  2PU2 A;  2KLI A;  3QP5 A;  4HQA A;  1TDG A;  5BOH A;  1MBL A;  4OLD A;  2CMN A;  3O5Y A;  4OQI A;  1CJF A;  4NET A;  3M6H A;  2OAP 1;  4GHI B;  2X02 A;  2E8J A;  1OTA A;  3T12 B;  4FOF A;  2J9P A;  1YMS A;  3OCN A;  4Q0J A;  4O0P A;  2FH5 A;  1W8Q A;  4JXG A;  4Y2F A;  3N8S A;  1K55 A;  2RL3 A;  3T50 A;  3BEB A;  5G4Z A;  2HGV A;  1FR1 A;  1T1A A;  3F1P A;  4EBL A;  2FFY A;  5FSR A;  4XT2 A;  3WS5 A;  1G6A A;  4BL2 A;  3ZYT A;  3E4O A;  4O01 A;  4KZA A;  2EFU A;  4QWO A;  1MXO A;  2VGK A;  4WLA A;  3BWL A;  1AWI A;  3CWF A;  3UB7 A;  2XLN A;  2WZZ A;  5DKK A;  3M6B A;  5K5B A;  4LCM A;  5G4Y A;  1JWV A;  3ZNT A;  3G4P A;  4Y0U A;  5C5K A;  3UMD A;  3LIF A;  5EUA A;  1FIK A;  3Q1F A;  1T1B A;  2EXB A;  3G6O A;  2FFF B;  4JGP A;  3QP8 A;  3N8L A;  4KZ7 A;  1IYP A;  3BFD A;  4G3W A;  4FUW A;  4I39 A;  3ITA A;  4Y13 A;  4DE0 A;  5J3W A;  4DF6 A;  1SDN A;  3L7H A;  4S2K A;  3PBN A;  4GN2 A;  2INW A;  5FQM A;  1KGE A;  2L0W A;  5HZH A;  3O87 A;  3QP4 A;  4ETZ A;  3R7W B;  1N9N A;  4ESP A;  2VA0 A;  4PPR A;  3MZF A;  4GD6 A;  3T4K A;  2Y2L A;  4O7D A;  2QHK A;  1L2S A;  4ARZ A;  2ZQ9 A;  4Q0I A;  1BUE A;  4BD1 A;  5EM1 A;  1ESI A;  4PHT A;  5HSQ A;  4FD8 A;  3UE1 A;  5D3O A;  3ZDJ A;  5HFO A;  1NZU A;  3WS4 A;  5GHY A;  1Q2Q A;  1Z09 A;  5FAP A;  1RGZ A;  3PBR A;  4IVK A;  4OP8 A;  2PD8 A;  5FDH A;  3SS3 A;  3F1O A;  5GLC A;  1NY0 A;  3QP6 A;  4E3N A;  4G3K A;  1XJ2 A;  1HZO A;  4KUO A;  1ERO A;  4K0W A;  2WKQ A;  3U2A A;  1VB6 A;  3Q81 A;  1H3Q A;  1NRF A;  2Y2G A;  1BLH A;  4UQI M;  5E2G A;  2JE5 A;  4IJG A;  2PU4 A;  3IWO A;  2K31 A;  1XPB A;  1DP8 A;  3OCL A;  4KZ3 A;  1L0F A;  1ZTU A;  5GLB A;  1K4F A;  4DMZ A;  3BRM A;  2HP5 A;  1YLZ A;  1ES2 A;  1SKF A;  1PZP A;  4LGW A;  1VET A;  5GHZ A;  3T1X A;  2HDU A;  2G2W A;  3A0V A;  5DTT A;  4E3I A;  3CMZ A;  2X01 A;  4Y15 A;  5HWW A;  1ACF A;  3VFH A;  1TS8 A;  3G35 A;  2V2F F;  3SS5 A;  4WF0 A;  3BFF A;  1S0W A;  2WZX A;  4JGQ A;  5DTS A;  3IH8 A;  5L8M A;  4R4S A;  2O9C A;  2WYX A;  3RJU A;  3IHB A;  1MZU A;  3IBJ A;  3LR0 A;  3MS6 A;  4MBH A;  3HLG A;  5FQJ A;  5CGS A;  3UO9 A;  1MKM A;  3LI9 A;  1OJG A;  1KGG A;  1KVL A;  2R9X A;  2KOI A;  4PM5 A;  3JPU A;  4S2N C;  4UA7 A;  1L0E A;  1ZHH B;  2RCX A;  3IQA A;  5FI6 A;  1CEF A;  4LEN A;  1QMF A;  2QZ6 A;  4JF5 A;  4LLO B;  3GR2 A;  4GD8 A;  2KX6 A;  4NXG A;  2LB9 A;  4EU0 A;  1CK3 A;  4BBT A;  2W3G A;  5EE8 A;  5FL3 A;  3VOZ A;  1RP5 A;  2A3U A;  3V3R A;  3VE3 A;  3ZFZ A;  2QWS A;  2WGI A;  4BL3 A;  5TFQ A;  4X68 A;  4YIN A;  1K57 C;  4JXV A;  5EEC A;  1BLC A;  1ES3 A;  1LT0 A;  2BTF P;  1OTI A;  4KQQ A;  2X71 A;  5FQK A;  2M7V A;  4RQ9 A;  4XUZ A;  4I38 A;  1GSV A;  1VEU B;  2JKG A;  3FWL A;  2OV5 A;  5EVI A;  3IS2 B;  2VGL M;  3BFE A;  2ZMV A;  5AQ9 A;  5G18 A;  3F1N A;  3MR0 A;  3C5A A;  5KSC A;  3BYD A;  1P9W A;  4M4X A;  5FAO A;  1BSG A;  3NJA A;  3D4F A;  1OTD A;  5L09 A;  4GOG A;  2XK1 A;  4X56 A;  3TE8 A;  1NLZ A;  4UQI S;  5CGX A;  5DF9 A;  1NLY A;  3IS2 A;  4X69 A;  4E3M A;  2XFS A;  3OBF A;  1CF0 A;  1ES4 A;  2H28 A;  4PM7 A;  3MKF A;  1NYY A;  4CLC C;  2M7U A;  2PYP A;  3NCK A;  1MC0 A;  3CLO A;  4I5S A;  2ZOH A;  3GV9 A;  3CZD A;  2C5W B;  2Z2M B;  3MXS A;  2ZBB A;  4N1X A;  3IX3 A;  1PW8 A;  1U60 A;  5EVE A;  1K25 A;  1LL8 A;  3L9K A;  4JPM A;  4HJ6 A;  1W7F A;  3VOY A;  4GDN A;  3UB6 A;  3SW1 A;  1EWZ A;  3Q82 A;  4GLQ A;  3MZE A;  3S4X A;  4KG6 A;  1JWZ A;  5FI7 A;  4XXR A;  1TS0 A;  3LCE A;  3P98 A;  4LV2 A;  2JKT I;  4MN5 A;  3ZG8 B;  2ZD8 A;  4WMC D;  1GSX A;  3EOI A;  1DP6 A;  2JHE A;  3UPN A;  1CEG A;  1W63 M;  5GLD A;  2JBF A;  3KX0 X;  3GQZ A;  3P7N A;  4S2L A;  3PAG A;  3E2K A;  2Y59 A;  1VQQ A;  2J7V A;  4HES A;  4OVD A;  2GX5 A;  3DTE A;  4ME4 A;  5CX7 A;  1FR6 A;  4S2I A;  1GSW A;  4U3T A;  3RH8 B;  5TGF A;  5EVL A;  1KE0 A;  4EXO A;  5E2H A;  1K0K A;  3PHY A;  4OON A;  3NEC A;  4HNB A;  2XD5 A;  3ZVW A;  5DJU A;  1MWT A;  3WRT A;  3OC2 A;  4KQO A;  4L0L A;  1PYY A;  1K54 A;  5FAS A;  4H6J A;  3T4S A;  3A3J A;  2C6W B;  3PBT A;  4E6W A;  4S2M A;  1N9L A;  2XF3 A;  2IA2 A;  1F2K A;  2VV7 A;  3KO6 A;  3UB8 A;  2HDS A;  2J9O A;  4CJN A;  2Y2H A;  2ZM0 A;  5MC7 A;  2J3T C;  4CLC B;  4E6X A;  1PI4 A;  3ULF A;  1UWP X;  1T1C A;  4LV3 A;  3C30 A;  1Y28 A;  1OT9 A;  3T1Q B;  4WUJ A;  1FQG A;  2ZC4 B;  4HP9 A;  2ZC3 B;  2JKT M;  4C75 A;  5FQI A;  1T19 A;  2EX6 A;  3UY6 A;  4P6B A;  5CER A;  4L9E A;  4Y3I A;  1MWU A;  2G7U A;  2PDR A;  3VE4 A;  2L1M A;  3JYI A;  2Y91 A;  1XKZ A;  1YKD A;  5FI2 A;  2PR5 A;  3FPV A;  4CPK A;  2W3F A;  1C3B A;  3JVV A;  1YM1 A;  2VGJ A;  1CI8 A;  4QPR A;  3IT9 A;  2V0U A;  4R3B A;  1I2S A;  3A0R A;  1ES5 A;  4GZB A;  2PRF A;  4N9K A;  2KDK A;  2XSS A;  1KDW A;  4OKP A;  4D60 A;  5KZH A;  4EW7 A;  2K2N A;  1E3U D;  2PR6 A;  2ZC6 B;  4HI4 A;  1IYS A;  4R1G A;  3VFF A;  2WK0 A;  1XJ3 A;  3F1P B;  4G3V A;  4IVI A;  4XT2 B;  1IEM A;  3N6I A;  4B88 A;  1PZO A;  2JN7 A;  1HLU P;  2P7J A;  1F9I A;  3SOI A;  4JLF A;  4ZJ1 A;  2J80 A;  3KYQ A;  2Y2K A;  1G28 A;  5DF7 A;  1KDS A;  3E0Y A;  3MQO A;  3GEC A;  2I9V A;  1BLP A;  3LGO A;  4Q0H A;  5CTN A;  2VK3 A;  3C4O A;  1NJ4 A;  1PNE A;  3TG9 A;  1YLT A;  1YSP A;  3T4L A;  2JC7 A;  2P9V A;  5GL9 A;  4PM6 A;  1H8Z A;  4P0M A;  4UEY A;  5AQ7 A;  5HWT A;  2OSU A;  1CQA A;  4WL9 A;  4GNU A;  1L0G A;  5EOE A;  2EX2 A;  1QME A;  5A91 A;  4ZAM A;  1IKG A;  4OQH A;  3U4L P;  3E2L A;  3MSH A;  1LHY A;  1XGJ A;  2XQZ A;  4LRZ E;  4ARZ B;  4BWI A;  2HJE A;  1UGU A;  4Y7P A;  1KGF A;  2O9B A;  2XD1 A;  1H5X A;  4F94 A;  3G34 A;  1ONH A;  2HPB A;  4GS9 A;  1WYB A;  3V3S A;  3QP1 A;  4RX2 A;  5J7E A;  4PKY G;  4I3J A;  1PI5 A;  3NY4 A;  3MJQ A;  3F1O B;  4MLL A;  4E3J A;  4MNR A;  4IUK A;  1Y54 A;  2V9A A;  2J3W A;  5DFX A;  4BJP A;  3RXX A;  1BYW A;  1YAX A;  2OAQ 1;  1PIO A;  4DXB A;  3LIA A;  1FCM A;  4HH3 A;  4EES A;  3PYP A;  3ITB A;  2Y2I A;  4L9F A;  4ZRR A;  1SKO A;  5F1F A;  4MMN A;  2Q9N A;  3B47 A;  4QY6 A;  2XDM A;  5FAQ A;  2OLU A;  3EEH A;  5JYO A;  2XA7 S;  5HDS A;  1XFQ A;  4MCW A;  3UDX A;  3CUE A;  1VET B;  3HLE A;  2B5R A;  4QB8 A;  4NXE A;  1L3L A;  5F83 A;  1FCO A;  3E98 A;  1D06 A;  5HPF A;  3B42 A;  4K08 A;  1D1J A;  3ICY A;  1IOU A;  2ZQC A;  2BG1 A;  3HUM A;  3AGE A;  5CTM A;  3DWK A;  1GA9 A;  4EQ1 A;  2B95 A;  1XA7 A;  3UDI A;  2W1R A;  3PBS A;  1MWR A;  2PT7 A;  2PAV P;  2VX8 A;  4KG2 A;  1H8Y A;  5F6A A;  3MXR A;  4ZJ2 A;  4C3Q A;  3VV4 A;  1LSW A;  1S1Y A;  3IXH A;  3VOL A;  1STZ A;  5U47 A;  1ZC2 A;  1XX2 A;  1YLJ A;  3GRJ A;  3H7W A;  2HDR A;  3DBA A;  3BLS A;  4X1M A;  1Z6F A;  3IWQ A;  4NXF A;  3KSH A;  3LEZ A;  3LUQ A;  1W63 Q;  5J4E A;  3UB9 A;  4BD0 A;  4HBT A;  4F3L A;  4H8R A;  2PHY A;  5HDD A; 
#chains in the Genus database with same CATH homology
 3EGX C;  4HJ3 A;  4GLQ A;  4WEJ A;  4GW9 A;  2VJW A;  3LFV A;  4B93 A;  2A24 A;  3LIE A;  1TS0 A;  3K3C A;  4MN6 A;  1DP9 A;  2BAS A;  1OT6 A;  2D01 A;  2JKT I;  4MN5 A;  2QKP A;  1UWN X;  1NRJ A;  4R6L A;  5F69 A;  3S7O A;  1GSX A;  3EOI A;  1DP6 A;  4E04 A;  4FSF A;  1OTE A;  2JHE A;  2EWV A;  4CLC A;  4HY8 A;  4BBU A;  4PKY A;  3UE6 A;  4JGR A;  2EA9 A;  3PXP A;  5HDC A;  1W63 M;  3C38 A;  5KSH A;  2V1B A;  3F1N B;  4DJ3 A;  3LI8 A;  2A2L A;  1IFQ A;  4R70 A;  3KX0 X;  3PBO A;  3EQV A;  2Y79 A;  4AFI A;  3P7N A;  2W27 A;  1G6O A;  1P9R A;  2ZMF A;  3JVU A;  1JNU A;  3MMH A;  3HCY A;  4EEP A;  3LID A;  3PBQ A;  2W0N A;  2OOL A;  4HH2 A;  2GX5 A;  4ME4 A;  5CX7 A;  1EW0 A;  3NOT C;  5HL6 A;  3T4T A;  2V1A A;  1GSW A;  3RH8 B;  2KLI A;  3C2W A;  4HQA A;  2VZW A;  4EXO A;  2R78 A;  1TD5 A;  3CI6 A;  2CMN A;  4EUV A;  3PHY A;  3O5Y A;  3BJN A;  2OAP 1;  4GHI B;  1S67 L;  4HNB A;  4GJ4 A;  2Y8H A;  1OTA A;  2K7S A;  3R7W A;  5DJU A;  3BY9 A;  4FOF A;  3OCN A;  3OC2 A;  4KQO A;  3H7W B;  4L0L A;  3LR4 A;  4Q0J A;  4O0P A;  2FH5 A;  5DFY A;  4H6J A;  3T4S A;  3PR6 A;  1TS6 A;  4Y2F A;  4CLC D;  2GNX A;  3PBT A;  4F3L B;  3T50 A;  2W1T A;  2P08 A;  2O0Y A;  4HJ4 A;  1XJ6 A;  1N9L A;  3LYX A;  5G4Z A;  2HGV A;  1P97 A;  2A24 B;  1T1A A;  2IA2 A;  3F1P A;  4WN5 A;  2LB5 A;  4XT2 A;  3ZYT A;  2VV7 A;  3KO6 A;  4HOI A;  3E4O A;  3MF0 A;  3UB8 A;  5A8B A;  4O01 A;  1XFN A;  5MC7 A;  2J3T C;  3R4K A;  4CLC B;  4WLA A;  3BWL A;  3CWF A;  3ULF A;  3UB7 A;  1UWP X;  2OWH A;  1T1C A;  3UE3 A;  3EEA A;  3P01 A;  2HV1 A;  2M1C A;  3C30 A;  1Y28 A;  5DKK A;  1OT9 A;  5K5B A;  3S7N A;  3H82 A;  3SW1 A;  5G4Y A;  3D72 A;  4WUJ A;  3OLO A;  5C5K A;  1T18 A;  4DJ2 A;  3UMD A;  3LIF A;  4HP9 A;  2JKT M;  3RTY A;  1T1B A;  4P6Z M;  3G6O A;  1T19 A;  4II7 A;  3NOP C;  4JGP A;  4EEU A;  1S66 L;  3MQ0 A;  3V67 A;  1OPX A;  3EQU A;  2QYB A;  4G3W A;  5DJT A;  4L9E A;  4Y3I A;  2G7U A;  2PDR A;  3E4Q A;  3VE4 A;  2L1M A;  4I39 A;  2Z6D A;  2XRO A;  5J3W A;  1YKD A;  3LIC A;  5HD5 A;  2PR5 A;  3FPV A;  3PBN A;  4NEE D;  2W3F A;  3JVV A;  4IUH A;  2INW A;  2YKH A;  3B33 A;  3W2Z A;  4QPR A;  1F98 A;  5AVF A;  2V0U A;  2L0W A;  2YKF A;  5HZH A;  1YSQ A;  5IU1 A;  4YNR A;  1LSX A;  3FPW A;  3A0S A;  4ETZ A;  3R7W B;  1N9N A;  2VA0 A;  3A0R A;  5HD3 A;  4MDZ A;  2EWW A;  3MXQ A;  3T4K A;  3KSF A;  2QHK A;  4H6J B;  3E4P A;  2OWJ A;  2W3H A;  4HP4 A;  4ARZ A;  4ETX A;  2W3D A;  4Q0I A;  2KDK A;  2XSS A;  2WKR A;  3T4J A;  4PHT A;  4EW7 A;  5HSQ A;  5TBM A;  3T4Q A;  2W1T B;  2K2N A;  1OJ5 A;  2PR6 A;  4HI4 A;  2Z6C A;  1XJ3 A;  3F1P B;  4G3V A;  4XT2 B;  3PBR A;  1KOU A;  4KUK A;  3TRC A;  2PD8 A;  3F1O A;  3EWK A;  1WA9 A;  5TJJ A;  4G3K A;  1XJ2 A;  4HIA A;  4KUO A;  3KSG A;  4YOF A;  2FZ0 A;  2JN7 A;  2WKQ A;  1NWZ A;  3U2A A;  1VB6 A;  2P7J A;  1F9I A;  2J80 A;  4OOL A;  3BY8 A;  3CAX A;  1H3Q A;  2B02 A;  4UQI M;  4LRY C;  4IJG A;  3KYQ A;  3BQA A;  1G28 A;  2K31 A;  3E0Y A;  3MQO A;  1V9Y A;  1DP8 A;  3OCL A;  5AVE A;  3GEC A;  2I9V A;  2HJ9 C;  3T4O A;  4Q0H A;  3H82 B;  2J3T D;  1ZTU A;  1S4R A;  4DMZ A;  4MN7 A;  1LSV A;  4Y5F A;  4OOM A;  1YSP A;  3MQQ A;  3T4L A;  5KIZ A;  5DKL A;  5IS1 A;  4EER A;  2QJ7 A;  3D3O A;  4UEY A;  3A0V A;  5LBR A;  5AJG A;  2VV8 A;  3ZQ5 A;  5HWT A;  5HWW A;  1TS8 A;  2DMW A;  4WF0 A;  3C8C A;  4WEK A;  4WL9 A;  2VV6 A;  4JGQ A;  4NKP A;  3MFX A;  5L8M A;  4BMW A;  2O9C A;  3LIB A;  1MZU A;  4Z1W A;  3IBJ A;  3LR0 A;  2MJ6 A;  2PD7 A;  3GDI A;  4LRX C;  2VKS A;  5I5L A;  4LPZ A;  4LRZ E;  4I3A A;  1MKM A;  4ARZ B;  4BWI A;  2HJE A;  3BQ8 A;  1UGU A;  3LI9 A;  2NUP C;  3BW6 A;  2O9B A;  1OJG A;  3LR5 A;  2VLG A;  4CQH A;  4NXB A;  5TBM B;  4JGO A;  4P6Z S;  1S4S A;  2KOI A;  4I3I A;  3CUE C;  4GS9 A;  1ZHH B;  3S7Q A;  4HHD A;  3KSI A;  5J7E A;  2WKP A;  4PKY G;  4I3J A;  3FC7 A;  4DN0 A;  3MJQ A;  3F1O B;  4IUK A;  2V9A A;  1XJ4 A;  4LLO B;  4WEL A;  1OTB A;  2KX6 A;  4NXG A;  1DRM A;  2LB9 A;  4EU0 A;  2J3W A;  5DFX A;  5EFW A;  4BBT A;  1VHM A;  4R3A A;  4BJP A;  2W3G A;  1BYW A;  5FL3 A;  1YAX A;  2JKR M;  3VE3 A;  2OAQ 1;  2JKR I;  2QWS A;  5HWV A;  1V9Z A;  3LIA A;  3TJZ C;  1N9O A;  2XA7 M;  4HH3 A;  4BBV A;  4EES A;  3PYP A;  1F5M A;  4L9G A;  3NHQ A;  1LT0 A;  4L9F A;  4ZRR A;  1OTI A;  4MMN A;  3B47 A;  4EET B;  2M7V A;  3CIT A;  4RQ9 A;  2NUT C;  4I38 A;  1GSV A;  2ZOI A;  2VEA A;  3EEH A;  3HJK A;  1ODV A;  3IS2 B;  2XA7 S;  4KQD A;  5HDS A;  2VGL M;  1XFQ A;  2ZMV A;  2QJ5 A;  5HPI A;  4MCW A;  3CUE A;  3F1N A;  3MR0 A;  2O9A A;  4NXE A;  1TF1 A;  3KYZ A;  2GZA A;  1TS7 A;  2B18 A;  3NOU C;  5F5Y A;  3E98 A;  1D06 A;  1H8M A;  2W3E A;  5HPF A;  3B42 A;  4K08 A;  3ICY A;  2VGL S;  1IOU A;  3S7P A;  3FG8 A;  1P9W A;  4M4X A;  3NJA A;  1OTD A;  5IT5 A;  3TE8 A;  1S1Z A;  1NLZ A;  3IBR A;  4UQI S;  4EQ1 A;  5DF9 A;  4O8G A;  1NLY A;  2L4R A;  3IS2 A;  4CLC E;  2W1R A;  3PBS A;  1X0O A;  2P04 A;  2PT7 A;  2D02 A;  2VX8 A;  4PAU A;  3OBF A;  2H28 A;  2O99 A;  4R38 A;  4YWZ A;  4GHI A;  2M7U A;  5F6A A;  4CLC C;  1P0Z A;  3HJI A;  2PYP A;  3VV4 A;  3K3D A;  1LSW A;  1S1Y A;  3VOL A;  1STZ A;  2HF6 A;  2XRN A;  1MC0 A;  3UME A;  5F68 A;  4GS9 B;  3CLO A;  4I5S A;  2ZOH A;  2V0W A;  3H7W A;  2GJ3 A;  2ZBB A;  4IHQ A;  3H9W A;  3DBA A;  4GCZ A;  1LL8 A;  3EGD C;  3OOV A;  4NXF A;  3KSH A;  3TW8 A;  3LUQ A;  4B9O A;  2PYR A;  1W63 Q;  3LR3 A;  3RFB A;  1D7E A;  5J4E A;  3UB9 A;  4HJ6 A;  4F3L A;  3K2N A;  2PHY A;  3UB6 A;  5HDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...