4G3VA

Crystal structure of a. aeolicus nlh2 gaf domain in an inactive state
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
162
structure length
162
Chain Sequence
RLKLKEINVVNEITKILTGDYTFEESLKEVLKVLYSYLGVEHSFIAIREGNTLRIASSYGYFLNKDVAFKKGEGITGKVFQRGIPLVIPNVKHNSAFANKTGIGRLLTEKHALIAAPIKVGGEVKGVITIFKEFSDKESLENFYQTINVIGNLLGMFFKLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator nlh2
publication title Structural mechanism of GAF-regulated delta(54) activators from Aquifex aeolicus
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 52
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4g3vA00
2B18A 2M7VA 4PAUA 2G7UA 2W1TB 2KLIA 4Q0HA 4R6LA 2VKSA 1F5MA 4ME4A 4QPRA 3IBJA 4Y5FA 3KSFA 4LRYC 4ETZA 4IJGA 2Y79A 1TD5A 3NOUC 3CITA 2O9AA 3K2NA 2M7UA 4YNRA 3MQ0A 3MF0A 2GX5A 1STZA 3KO6A 2KOIA 4Y2FA 4G3WA 2LB5A 3OOVA 5HPFA 1YSQA 2IA2A 4IUKA 3S7OA 2W3GA 5LBRA 2QYBA 2W1TA 1MKMA 3CI6A 2O0YA 4MDZA 5HPIA 2VZWA 4FOFA 4MCWA 4EU0A 2W3EA 5DFXA 5L8MA 4ETXA 4R70A 2O9CA 2W1RA 5DFYA 4G3KA 4Q0IA 5I5LA 3BJNA 5AJGA 4DN0A 4O0PA 2W3DA 3EEAA 1MC0A 3KSIA 1YSPA 4CQHA 2Y8HA 2XSSA 4RQ9A 3NHQA 4Q0JA 5TJJA 2LB9A 3G6OA 2VJWA 2HGVA 3C2WA 2O99A 4MN7A 3LFVA 5K5BA 3IBRA 3ZQ5A 5HL6A 4DMZA 3RFBA 3E98A 4GLQA 4O8GA 4ZRRA 4BWIA 5HSQA 1TF1A 3S7PA 3OBFA 4Z1WA 3W2ZA 4Y3IA 4EUVA 3HCYA 1ZTUA 3DBAA 3KSHA 2W3FA 2OOLA 3NOTC 3NOPC 1YKDA 2K31A 3TRCA 1VHMA 2ZMFA 3S7NA 2XROA 3D3OA 2K2NA 4LRZE 3MMHA 4E04A 4GW9A 4MMNA 3O5YA 5C5KA 4G3VA 3R4KA 2W3HA 4O01A 4IUHA 4YOFA 2XRNA 3S7QA 2O9BA 3VV4A 3E0YA 3KSGA 4LRXC 2VEAA
chains in the Genus database with same CATH superfamily
3UE6A 4X1MA 1QMFA 2QJ7A 4LV2A 5U47A 4Y5FA 2L0WA 5KMWA 2H10A 1A0KA 2L1MA 1ZG4A 2Q9NA 4MNRA 2GX5A 4I3IA 3PR6A 1K38A 5FQIA 1BSGA 3R7WA 5L2FA 2JN7A 4BBVA 2HDRA 2OWJA 2O0YA 5HPIA 5FI6A 1ACFA 2Y55A 5DFXA 2K7SA 5I5LA 2Q0OA 4BJPA 2VLGA 5JYOA 5HAPA 2LB9A 4EW7A 3KX0X 2Q9MA 3NECA 4OP8A 1MZUA 3UB8A 3MXRA 1MWSA 5TGFA 2PHYA 4IEDA 3JPUA 4GDNA 2UV0E 2G2WA 4LCMA 3VFHA 1T1CA 4RVAA 1LL9A 3H7WA 5A8BA 3ZG9B 1ZG6A 2V9AA 2J7VA 1LT0A 4C75A 3VOYA 3ZVTA 4KQDA 4N9KA 3T1XA 2JBFA 1BYWA 3HLGA 1ESUA 2GJ3A 2V8CA 2XK1A 4FUWA 5I94A 1T1BA 3KSGA 1KOUA 3A3DA 1MXOA 2W1TB 3G2ZA 4PM8A 1LI0A 2XD5A 4ZJ1A 1G28A 2P04A 1ZHHB 2XFSA 3E4QA 1K57A 1L0EA 2M7UA 2PBYA 2QKPA 3VFFA 1PFLA 3LIAA 3GVBA 3HLDA 3FC7A 3HUNA 3MR0A 4DDSA 4IUKA 4JF4A 2RL3A 1K57C 3HVFA 2Y2MA 1CI9A 1YQSA 1Y54A 4KQOA 1L3LA 2W1RA 4KZ4A 2OLVA 1N9OA 3D4FA 3TW8A 1H5XA 4DE3A 1FSYA 5HD3A 2PDRA 1D1JA 3EEAA 5KIZA 1JTDA 4RQ9A 1VEUB 2MJ6A 4I39A 3VE3A 2VJWA 2C5WB 5M19A 2W0NA 4E3MA 2ZOIA 5HL6A 3HUOA 4OLDA 3P7NA 3IWQA 5JYPA 4P87A 1JWZA 1RP5A 3C4OA 3BY8A 2UWXA 3W2ZA 2WKPA 3HJKA 1JTGA 1XA7A 4E3NA 2KDKA 3NOPC 2VV8A 2Y2OA 5HWVA 2FZ0A 3D3OA 1P0ZA 2Z6CA 4LRZE 2PT7A 2WADA 3OPRA 3A3IA 4GW9A 4MMNA 1XFQA 3QP5A 1FCNA 3SZTA 4BBUA 2JC7A 5EM0A 5DVAA 3FWLA 4QWOA 2VEAA 3ZNTA 2Y4AA 5IU1A 2ZC6B 3ULFA 4KZAA 4GZBA 4OP5A 3BFGA 1L0FA 1PWDA 1BULA 5HPFA 4JF5A 3IXDA 5EVIA 1RGZA 2W3GA 4U0XA 3UB9A 1ES2A 1BLPA 4X53A 3WS0A 3UDFA 3LR4A 1ODVA 1S6RA 3MZFA 5DJTA 4JGOA 4JPMA 5EVIC 3VSLA 2HF6A 3Q07A 4R3BA 4OVDA 4O0PA 4XXRA 3V5MA 4HBUA 3B42A 4DRTA 2XSSA 1JWPA 2FH5A 4EETB 3V67A 4S2MA 3EQUA 2HGVA 4OH0A 4Y0UA 3Q1FA 2EX2A 4F3LB 3LIEA 4Z1WA 1TDGA 3G2YA 4OQGA 1IYPA 3UB6A 2EXAA 4OONA 3FV7A 5J3WA 5FSRA 2L4RA 2J9OA 5CEDA 3QNBA 3NY4A 4R1GA 5D3OA 4FD8A 4S2NA 1SKFA 2OAQ1 5GLBA 1XJ3A 2YKFA 3N4IA 2ZL1A 2BASA 3MMHA 4P6ZS 3PBTA 2NUPC 1IOUA 1G6OA 4GHIB 3RH8B 3HBRA 3HUMA 4EWFA 2NUTC 5HDSA 1XP4A 3IX8A 4O01A 3IXBA 3MKEA 4DE2A 1I5QA 2XLNA 4S2NC 3MKFA 4Y15A 3S1YA 4HEFA 2A24B 3CMZA 1XX2A 4H6JA 3ZG7B 3IX4A 5KSHA 2HP6A 1HD8A 1S0WA 1TD5A 1KE4A 3VOLA 3OZHA 1PWGA 2HDSA 4LGWA 3TG9A 4JGQA 1KE0A 3IQAA 4YFMA 3T1QB 1F9IA 3O86A 4EEUA 2VZWA 5EVLA 3ISGA 4UA6A 4KZ5A 1SKOA 1NZOA 4D2OA 3LYXA 5HFOA 1ZKJA 3HREA 4Q0IA 3ZHHA 2XH9A 1YLPA 2ZM8A 4MBKA 2CMNA 1MC0A 2E8IA 3KSIA 2WKIA 3MZDA 2VV7A 4WL9A 1I2SA 5TJJA 1CQAA 5HAIA 5FQJA 1BTLA 2J8YA 5A92A 4FCFA 5FA7A 3DW0A 3E98A 3S7PA 1OTEA 3VE4A 2I9VA 2PR6A 4DXCA 4R3JA 3WS2A 4GS9A 1L0GA 2WAEA 3IF5A 1PZOA 4UQIS 3T4JA 4K08A 1YMSA 4UA9A 4BL2A 4LLOB 1NRJA 3P98A 1T18A 2EA9A 5FQMA 5HX9A 4EEPA 2R78A 4OKPA 4IUHA 3HLBA 3QP4A 3UE3A 4KZ3A 2EX9A 1YM1A 4JXWA 4OPZA 5EVIB 2XA7S 4WN5A 1WE4A 3A0SA 4M4XA 1CEGA 1CEFA 1H0MA 4KQQA 1FIKA 2HV1A 2PU4A 1F5MA 3G31A 4QPRA 5E2GA 3SW1A 4HOIA 3MFXA 4KUKA 3CPTA 4HIAA 3OOVA 2ZC5B 4BL3A 2WYXA 3T4SA 3GECA 4L9GA 3W4OA 4EU0A 4QJGA 1VB6A 4Y0OA 3NBLA 3ZG0A 2O9CA 2V20A 3FZCA 3MJQA 3LR3A 4B4ZA 3AGDA 4MN6A 3G30A 3V50A 2Y2KA 2ZQ7A 3LY4A 4L9FA 3Q82A 4WEKA 5TBMA 3V3RA 3N7WA 3EWKA 4HH3A 3BFCA 4HQAA 1IYQA 4XT2B 5HZHA 4WYYA 4S2KA 1J9MA 5F6AA 5DTSA 4EBPA 4PMAA 5EECA 5DF9A 5DTTA 2JKFA 3M2JA 4DMZA 1G5UA 4ZRRA 4DKIA 1EW0A 5FAOA 4EESA 3MSHA 3BQAA 4I38A 1ES3A 2X01A 1O7EA 4R38A 1YPRA 4EQIA 1XA1A 2EX6A 1N4OA 4ID4A 2EX8A 5F1FA 1Y28A 4WUJA 1PZPA 3D9YA 3G4PA 1OT6A 5IHVA 2PR5A 2OWHA 2V8FA 2V0WA 3PHYA 5C5KA 2ZJ9A 4GJ4A 1GA0A 2XRNA 2WGIA 2I72A 5AQBA 4I3JA 3UB5P 3W4PA 1ESIA 1W63M 3SH8A 2XF3A 5KZHA 3ITBA 4R6LA 4BMWA 4O7DA 5EM1A 5GLDA 5AVEA 3IBJA 2WKEA 3MBZA 4X69A 5G18A 3KSFA 5GLAA 4ARZA 4NKPA 1DJBA 3D72A 5EUAA 2ZC4B 5L09A 3IF6A 3LIFA 3BM6A 3F1OB 2LB5A 4P6ZM 5J8XA 1MKMA 3CI6A 2WGWB 3LO7A 4WMCD 4CLCD 4ETXA 4R70A 4PPRA 1OTBA 3Q7ZA 2BTFP 3IF6C 4YINA 5CXWA 4GD8A 3DAVA 1W8YA 3C7UA 4EUZA 1K56D 3V3SA 3PAEA 3L7HA 4NEED 3ZYTA 3B33A 2O99A 3LFVA 1QMEA 5DKKA 1NYMA 1EWZA 4KQRA 2B95A 4JGRA 4Q8IA 4Y3IA 2JKRI 3NOTC 4OQ0A 5AVFA 5BOHA 3F1NB 2HJ9C 4UHUA 3MZEA 5FQQA 4E6XA 1L2SA 2VGKA 3CPTB 4MN5A 5DTKA 3FKVA 5A91A 1DP9A 5GL9A 4RX2A 1BT5A 1S4RA 2PAVP 2WZZA 3H82B 1ALQA 5GLCA 1XJ4A 2BG1A 1PI5A 1SCWA 4LRYC 3UB7A 3W8KA 4UQIM 3T12B 2JKTI 1E3UA 2O9AA 1K0KA 1DP6A 4HP9A 1MKIA 2ZOHA 4U3TA 2IA2A 3T1RA 2VV6A 3EQVA 3IS2B 1GHMA 2PYRA 3OPHA 5HD5A 1J3WA 1TDLA 3LEZA 1TVFA 5TFQA 2XA7M 3Q7VB 1BLHA 4P6BA 3CJMA 1OJGA 2WKQA 4K0XA 4DN0A 1PWCA 4HJ3A 1RGYA 3DTMA 5F1GA 3UMEA 2XD1A 3U2AA 4OLGA 1IKGA 1GHPA 2XR0A 5A90A 4KZ8A 2HP5A 4MN7A 4FH2A 4K91A 3VP3A 3RFBA 1H8YA 1XPBA 5F83A 4CLCE 3BFEA 5KSCA 2PBDP 3VSKA 4GKUA 3NCKA 3GRJA 1FOFA 3GR2A 2JE5A 4ZJ2A 2OOLA 1YAXA 4OOLA 5CEBA 4PKYG 3NULA 3GQZA 1IELA 2J3TD 2OSUA 3NIAA 4NXEA 3UDIA 1NRFA 4EXOA 5F68A 4QB8A 3O5YA 4BENA 3WS5A 4DE1A 1D06A 1PW8A 3LI9A 3M6BA 5AQAA 3S4XA 3B47A 2P9VA 1TS6A 4GNUA 4IHQA 2ZQ9A 5EOOA 3WS1A 1SHVA 2DRWA 3ITAA 3ZVWA 1YT4A 1N9NA 4IJGA 1DP8A 2V1ZA 1EI5A 3CITA 2DCFA 3PTEA 4OOMA 3OCNA 2HZ5A 3PYPA 3DTEA 1KVLA 1YSQA 3R7WB 4S2LA 3S7OA 5LBRA 4MDZA 2ZQCA 4ESPA 2W27A 1VETA 3HLCA 1WYCA 2VGJA 5AQ9A 1NLZA 2IWCA 3TOIA 3NJAA 4P85A 4WZ4A 1XXMA 3RXWA 1YSPA 1H8ZA 3QHYA 4BBTA 1NY0A 2Y8HA 2JKGA 4DDYA 5HAQA 3FPWA 3LR0A 3OCLA 5K5BA 3CLOA 4PKYA 1PIOA 1TF1A 3EEHA 3IXGA 1S4SA 3H7WB 1ZTUA 3IHBA 4DXBA 1HVBA 5HL1A 1H3QA 1SDNA 4Y0TA 3E4PA 4DE0A 4E04A 1MWTA 4KG5A 5DKLA 4JXVA 2HPBA 3OLOA 1CI8A 5EE8A 3S7QA 5IS1A 4R23A 3VV4A 4HESA 3ZNYA 5MC7A 1ES5A 3T4OA 3UMDA 2WZXA 3MS6A 3T4QA 2VGLS 1H8MA 3BEBA 2PRFA 4WBGA 2Y79A 3FYZA 3IHAA 1V9YA 5FI2A 2ACGA 1TS8A 3ZGAB 4WMCA 3B3XA 5G4YA 4CLCA 3GMWA 4OPQA 3SS3A 4BD0A 5F82A 1LSXA 3GV9A 3EOIA 2GZAA 2EXBA 1GHIA 3SS5A 1W5DA 1K56A 3N8RA 4IBRA 2XDMA 4CLCC 1GSWA 3TE8A 3T1SA 2Y91A 2ZD8A 3P09A 3HLEA 1MWUA 1AXBA 1K6RA 4HY8A 3EGXC 5FDHA 1E3UD 3C2WA 4WM9A 3QP6A 3A3EA 5E2EA 1W7FA 2HDQA 4MEZA 4O8GA 1KDSA 4HP4A 3WWXA 1W8QA 4EV4A 1KGGA 3LIDA 4FSFA 1LL8A 5FL3A 5EFWA 2W3FA 5E2HA 3TRCA 2Y2GA 3T4TA 1N9LA 2P08A 1DY6A 4OQHA 4EERA 3F1PA 3VP4A 1OTDA 5CGXA 4ZAMA 1O07A 1BLSA 4R4RA 5E43A 1TS0A 3TJZC 3C30A 4AFIA 5FASA 3ZCZA 1E4DA 4QU3A 2R9XA 1OPXA 1TEMA 2KLIA 1KGEA 3ZDJA 2XQZA 4RYEA 1LL5A 5EV0A 4MLLA 3PBSA 4NETA 2AVXA 3IWIA 3EGDC 3ZFZA 3K2NA 3MQ0A 1STZA 3KO6A 2Z6DA 4Y2FA 1XKZA 2Z2MB 3IH9A 4G3WA 5HDCA 3IXHA 4IVIA 2X02A 4FTXA 5FDSA 2Y2IA 3BW6A 2ZC7A 2X71A 1PNEA 4S2JA 4GOGA 5FEGA 2CC1A 3H9WA 4CJNA 4N92A 3SH9A 4WZ5A 1K54A 3NC8A 2M1CA 2Y2LA 3NDGA 4EBNA 1FR6A 3G6OA 4KG6A 5EVEA 3IBRA 1PI4A 5HSQA 4JXGA 1V9ZA 3LI8A 2V1BA 3MQQA 5CTMA 1C3BA 3OPPA 1PW1A 2VX8A 4HI4A 4JLFA 2D01A 4QY6A 2ZL1B 1ZC2A 4QD4A 5CGWA 3VP1A 3G35A 2J3TC 5J4EA 1Z6FA 4NXGA 5HWWA 2W3HA 4YOFA 2J3WA 4CLCB 3BY9A 4KG2A 1N9BA 4UA7A 3VOZA 2VKSA 4H6JB 3LICA 2JKRM 3UO9A 1LSWA 5CHJA 1AWIA 3PBRA 3BRMA 2GDNA 3NOUC 4PM9A 2ZMAA 2QMIA 1X0OA 5FEFA 1M6KA 1Z09A 3QNCA 3SS4A 5CECA 4YWZA 1DJAA 3PBNA 3K3CA 1SKOB 1U60A 5DFYA 3JVVA 4S2IA 2P7JA 1ONHA 3LGOA 3UY6A 4K0WA 2ZM0A 3UDXA 2PYPA 3QP2A 1I2WA 4OQIA 3RJUA 2JKTM 2G2UA 4HJ6A 3NHQA 3T4KA 1K6SA 1VEUA 1DJCA 3OC2A 2IWDA 3NI9A 1SZVA 2H28A 4L0LA 3ZG5A 3CG5A 1IEMA 3S22A 5GHZA 4GS9B 4IBXA 1W79A 4LENA 3UPOA 5FAQA 2WUQA 1VHMA 2Y2PA 1LHYA 1FILA 4E3LA 5GHXA 3JVUA 5M18A 1VM1A 1F2KA 2XFTA 3I7JA 1YLJA 4L9EA 4PHTA 3M6HA 4Q0HA 3AGFA 5J7EA 5L07A 3IH8A 5F5YA 3U4LP 3BLSA 1E25A 2FFFB 2XEPA 1NZUA 5CTNA 1S1ZA 1FCMA 4B88A 3RTYA 1BUEA 2VA0A 4HNBA 5HDDA 3BLMA 3T50A 3BFDA 4ZTKA 2EWWA 1W63Q 3A0VA 4LPZA 5L8MA 1S1YA 5FI7A 3IT9A 2PD7A 2A2LA 5AJGA 5E2FA 5TBMB 5G4ZA 1IKIA 3PXPA 2HDUA 1OTIA 1PYYA 4X1LA 1T1AA 2EFXA 3OPLA 5CHMA 2FFYA 4X6TA 2Y2NA 1YLWA 2BLSA 5GHYA 5A93A 2HJEA 4GLQA 2ZMVA 2V2FF 4KUOA 4F3LA 4F94A 3C38A 1ES4A 1P97A 2ZC3B 2D02A 1CK3A 1LLBA 4IVKA 3IWOA 5HARA 4E3OA 3PAGA 1NXYA 2EWVA 4P0MA 1KE3A 4A5RA 3O88A 1DRMA 1GSVA 2Z2LB 4DF6A 4LV3A 1D7EA 1WA9A 4GHIA 4X68A 3G34A 1IFQA 3UPNA 5FQKA 3QP1A 3WS4A 4C6YA 1RCJA 1K25A 4JKTA 2O9BA 5HW3A 1NYYA 1HLUP 2A24A 1ONGA 4ME4A 4E3JA 4XUZA 3FKWA 1XJ2A 3O87A 4ARZB 4II7A 4Y13A 1LSVA 4YNRA 3IF6B 3MF0A 4KZ6A 1XJ6A 3CUEA 1FQGA 1MWRA 4X56A 5L10A 4GD6A 3CHWP 4N1HA 4OPYA 4FH4A 4FOFA 2W3EA 1YLYA 5CERA 1P9WA 1Q2PA 1IYSA 5CHUA 3CUEC 1UWNX 2W3DA 4UAAA 1CF0A 2QZ6A 3V39A 1SDEA 3AGEA 1JNUA 1ERQA 3UE0A 3MQOA 2XGNA 4KENB 2A3UA 2Y2QA 3E2KA 2QPNA 4JF6A 3ZQ5A 3HLWA 4Z9QA 1KVMA 3C7VA 4WEJA 4BQMA 3KYZA 3BFFA 2H0YA 3GDIA 4EUVA 2V1AA 3DBAA 3O3VA 4HH2A 2K31A 3HLFA 4HBTA 3PBOA 5TR7A 3HJIA 4GN2A 3WRZA 4X25A 3N6IA 2OAP1 3PBQA 1G68A 2RCXA 3FPVA 4G3VA 1PRQA 1TS7A 4R3AA 2HP9A 4NK3A 3JYIA 3DTKA 3BQ8A 5CX7A 1G6AA 4GCZA 4N1XA 2A49A 2B18A 5EOEA 4WELA 1NWZA 2DMWA 2E8JA 3UNWA 5F69A 3CZDA 4R0QA 2YKHA 1K55A 2R9WA 1BLCA 1S66L 4PM7A 4ZBEA 2C6WB 2WAFA 3RXXA 4KZ9A 4X55A 2QYBA 2JHEA 1NLYA 4D60A 3M2KA 1KGFA 3ICYA 1Y4OA 4GDBA 1K55C 2DNSA 1HZOA 3C4PA 4Y17A 3N8LA 3C5AA 4XT2A 2ZBBA 2KX6A 4WLAA 3DTIA 2Y2JA 1K4EA 1JWVA 1T19A 1HTZA 5FATA 2J9PA 4BWIA 1CJFA 2J80A 2VK3A 3OBFA 4RA7A 3SH7A 3UPPA 3VP2A 4LFUA 5AQ7A 3GSGA 4JBFA 4LV0A 1UGUA 5DF8A 3TSGA 4B93A 3SOIA 4NG2A 3W4QA 3VP0A 2B5RA 1WYBA 1OMEA 1M40A 1JVJA 3E0YA 3UN7A 4C3QA 1FCOA 2P9VB 3LIBA 4HHDA 2G7UA 3CAXA 1OTAA 3BYDA 2ZQAA 3LY3A 3Q81A 2INWA 5FAPA 4RX3A 2OV5A 4ETZA 2ZQ8A 3MXQA 5IT5A 2IWBA 4CPKA 1GSXA 3A3JA 3CWFA 2PD8A 3F1OA 2P74A 4PM6A 2V0UA 2QHKA 3P01A 4DJ3A 2B02A 4B9OA 4NXFA 2WGWA 2WGVA 2OLUA 2ZLYA 1EROA 4I3AA 4MCWA 1VETB 3NDEA 3N8SA 1L0DA 4N9LA 1MY8A 5EPHA 1NJ4A 5CRFA 4Q0JA 4LCLA 1YMXA 4QHCA 3E4OA 3HL9A 2WK0A 4E3KA 4S2OA 5HWTA 3ZG8B 4OOYA 3DWZA 3T4LA 1Q2QA 3WRTA 1YKDA 3F1NA 1KDWA 2ZMFA 2EFUA 1GCEA 3MFDA 2K2NA 4E3IA 2Y2HA 4WZ5C 1VQQA 1OT9A 1K54C 4S2PA 4UEYA 1FSWA 4M3KA 3L9KA 1P9RA 3FG8A 1S67L 4HJ4A 3K3DA 3MXSA 4B4XA 2M7VA 4PAUA 3H82A 1IYOA 2QWSA 3LR5A 3UE1A 1YLZA 3A0RA 4U0TA 4I5SA 3DWKA 3A3FA 1XFNA 5M1AA 4H8RA 1BZAA 2KOIA 2Y59A 1OJ5A 2H0TA 4MBHA 1LI9A 4BLMA 4R4SA 2W1TA 1MPLA 3IS2A 2WKRA 4DJ2A 4ZJ3A 3VMAA 4E6WA 2WKHA 4LV1A 5CGSA 5EVID 3Q7VA 4XUXA 4G3KA 3LCEA 3BWLA 3BJNA 3GTCA 2JCHA 1F98A 4EQ1A 4JXSA 2ZM2A 4Y7PA 4CQHA 4BD1A 3KYQA 4QY5A 3QP8A 1K4FA 1XGIA 2PU2A 4ZDXA 4MBFA 1UWPX 3KYEA 4JGPA 4WF0A 3LUQA 4NXBA 4KZ7A 5FQ9A 3E2LA 1XGJA 2ZQDA 3C8CA 1ERMA 4OPRA 3G32A 2QJ5A 3HCYA 2VGLM 3KSHA 4EBLA 1YLTA 2GNXA 3S7NA 3IX3A 3LEQA 2XROA 4KZBA 3BECA 3F1PB 2H5SA 1GA9A 3R4KA 1MBLA 4GB7A 5DF7A 5DJUA 4LRXC 1FR1A 4PM5A
chains in the Genus database with same CATH topology
2A24A 3UE6A 2HV1A 1F5MA 4ME4A 4QPRA 4WN5A 3T4OA 3UMDA 2QJ7A 3T4QA 2VGLS 1H8MA 4Y5FA 1XJ2A 2L0WA 3SW1A 4HOIA 2Y79A 3MFXA 4ARZB 1V9YA 4KUKA 4II7A 2L1MA 4HIAA 1LSVA 1TS8A 4YNRA 3MF0A 2GX5A 1XJ6A 4I3IA 3PR6A 5G4YA 4CLCA 3CUEA 3OOVA 3R7WA 1LSXA 2JN7A 4BBVA 3T4SA 2OWJA 3GECA 3EOIA 2O0YA 5HPIA 4L9GA 4FOFA 4EU0A 2W3EA 5DFXA 2GZAA 1VB6A 1P9WA 2O9CA 2K7SA 3MJQA 3LR3A 4MN6A 5I5LA 4CLCC 3CUEC 4BJPA 2VLGA 1GSWA 4L9FA 3TE8A 1UWNX 4WEKA 2W3DA 5TBMA 3EWKA 4HH3A 4HQAA 4HY8A 1JNUA 4XT2B 5HZHA 2LB9A 4EW7A 5F6AA 3EGXC 3KX0X 3MQOA 1MZUA 3C2WA 3UB8A 5DF9A 3ZQ5A 2PHYA 4DMZA 4O8GA 4ZRRA 1EW0A 4HP4A 4WEJA 4EESA 1T1CA 3KYZA 3BQAA 4I38A 4FSFA 3LIDA 1LL8A 3GDIA 5FL3A 4EUVA 5EFWA 2V1AA 3H7WA 5A8BA 3DBAA 2W3FA 4R38A 4HH2A 2K31A 3TRCA 3T4TA 3PBOA 1N9LA 2V9AA 2P08A 1Y28A 3HJIA 1LT0A 4WUJA 1OT6A 4EERA 2PR5A 2OWHA 3F1PA 1OTDA 2OAP1 3PBQA 2V0WA 3PHYA 4KQDA 5C5KA 3FPVA 4G3VA 1TS0A 4GJ4A 3TJZC 1TS7A 2XRNA 4R3AA 1BYWA 3C30A 4AFIA 4I3JA 2GJ3A 1T1BA 3KSGA 3BQ8A 1KOUA 5CX7A 4GCZA 1OPXA 2B18A 2W1TB 1W63M 2KLIA 4WELA 1NWZA 4R6LA 4BMWA 5AVEA 3IBJA 2DMWA 1G28A 2P04A 1ZHHB 3E4QA 3PBSA 3KSFA 5F69A 4ARZA 4NKPA 3D72A 3EGDC 3K2NA 2M7UA 2QKPA 2YKHA 3MQ0A 1STZA 3F1OB 3KO6A 3LIAA 3LIFA 2Z6DA 4Y2FA 4G3WA 2LB5A 3FC7A 4P6ZM 5HDCA 1S66L 3MR0A 4IUKA 2QYBA 1MKMA 3CI6A 2JHEA 1NLYA 3BW6A 4CLCD 4ETXA 4R70A 3ICYA 4KQOA 1OTBA 2W1RA 1N9OA 3H9WA 3TW8A 5HD3A 2PDRA 2M1CA 3EEAA 5KIZA 4RQ9A 4XT2A 2ZBBA 2KX6A 2MJ6A 4I39A 3G6OA 4NEED 4WLAA 3ZYTA 3VE3A 3B33A 2VJWA 2O99A 2W0NA 3LFVA 3IBRA 5DKKA 2ZOIA 5HL6A 1T19A 3P7NA 5HSQA 4BWIA 2J80A 3OBFA 1V9ZA 3LI8A 3BY8A 2V1BA 3MQQA 3W2ZA 2WKPA 3HJKA 4JGRA 4Y3IA 2JKRI 2KDKA 3NOTC 5AVFA 3NOPC 2VV8A 2VX8A 3F1NB 2HJ9C 4HI4A 1UGUA 5HWVA 2FZ0A 2D01A 4B93A 3D3OA 1P0ZA 2Z6CA 4LRZE 2PT7A 4GW9A 2J3TC 4MMNA 5J4EA 1XFQA 4NXGA 5HWWA 2W3HA 4MN5A 4YOFA 4BBUA 2J3WA 4CLCB 1DP9A 3BY9A 3E0YA 2VEAA 1S4RA 3LIBA 4HHDA 3H82B 2G7UA 5IU1A 3CAXA 1OTAA 2VKSA 4H6JB 3LICA 2JKRM 1XJ4A 1LSWA 2INWA 4ETZA 4LRYC 3ULFA 3MXQA 3PBRA 3UB7A 5IT5A 4UQIM 3NOUC 2JKTI 1GSXA 2O9AA 3CWFA 2PD8A 1X0OA 3F1OA 2V0UA 2QHKA 5HPFA 3P01A 4DJ3A 1DP6A 2B02A 4HP9A 4B9OA 2ZOHA 2IA2A 4NXFA 2W3GA 3UB9A 2VV6A 3EQVA 3IS2B 2PYRA 3PBNA 4YWZA 4I3AA 4MCWA 5HD5A 3K3CA 2XA7M 3LR4A 1ODVA 5DFYA 3JVVA 5DJTA 2P7JA 1OJGA 4JGOA 2WKQA 4DN0A 2HF6A 2PYPA 4HJ3A 4O0PA 3B42A 2JKTM 4HJ6A 2XSSA 3UMEA 2FH5A 3U2AA 3NHQA 3T4KA 4Q0JA 3OC2A 4EETB 3V67A 3EQUA 2HGVA 3E4OA 4MN7A 2H28A 4L0LA 3RFBA 4F3LB 4CLCE 3LIEA 4Z1WA 3UB6A 5HWTA 4GS9B 5J3WA 3T4LA 2OOLA 1YAXA 2L4RA 1YKDA 4OOLA 4PKYG 3F1NA 1VHMA 2ZMFA 2J3TD 2OAQ1 1XJ3A 2YKFA 2K2NA 4NXEA 2BASA 3MMHA 4P6ZS 3PBTA 2NUPC 1IOUA 1G6OA 4GHIB 3RH8B 1OT9A 4EXOA 5F68A 2NUTC 5HDSA 4UEYA 3O5YA 3JVUA 4O01A 1P9RA 3FG8A 1D06A 4L9EA 1S67L 3LI9A 4HJ4A 3K3DA 4PHTA 3B47A 2M7VA 1TS6A 3H82A 4PAUA 4Q0HA 2A24B 2QWSA 4IHQA 3LR5A 4H6JA 5J7EA 5KSHA 5F5YA 3A0RA 1N9NA 4IJGA 4I5SA 1DP8A 1TD5A 1XFNA 3CITA 4OOMA 3VOLA 1S1ZA 3RTYA 2VA0A 3OCNA 4HNBA 2KOIA 5HDDA 3PYPA 3T50A 1OJ5A 4JGQA 1YSQA 1F9IA 3R7WB 3S7OA 2EWWA 4EEUA 1W63Q 5LBRA 2W1TA 4MDZA 3A0VA 2VZWA 3IS2A 2W27A 2WKRA 4LPZA 4DJ2A 5L8MA 1S1YA 3LYXA 1NLZA 4G3KA 3NJAA 4Q0IA 3BWLA 3BJNA 2PD7A 2A2LA 5AJGA 1F98A 2CMNA 4EQ1A 1MC0A 3KSIA 5TBMB 1YSPA 5G4ZA 4CQHA 2VV7A 4WL9A 3KYQA 4BBTA 3PXPA 2Y8HA 1OTIA 5TJJA 1T1AA 3FPWA 3LR0A 3OCLA 1UWPX 4WF0A 4JGPA 5K5BA 3LUQA 3CLOA 4PKYA 2HJEA 3E98A 4GLQA 2ZMVA 4KUOA 4NXBA 4F3LA 1TF1A 3C38A 3EEHA 3S7PA 1P97A 1S4SA 1OTEA 3VE4A 2I9VA 2PR6A 3C8CA 2D02A 2QJ5A 3HCYA 4GS9A 3H7WB 2VGLM 1ZTUA 3KSHA 2EWVA 4UQIS 3T4JA 2GNXA 4K08A 3S7NA 1DRMA 1H3QA 1GSVA 2XROA 4LLOB 1NRJA 3E4PA 1T18A 3F1PB 1D7EA 1WA9A 4GHIA 4E04A 2EA9A 1IFQA 5DKLA 3R4KA 4EEPA 2R78A 3OLOA 4IUHA 3S7QA 3UE3A 5IS1A 2O9BA 3VV4A 5DJUA 2XA7S 5MC7A 4LRXC 3A0SA 4M4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B18 A;  2M7V A;  4PAU A;  2G7U A;  2W1T B;  2KLI A;  4Q0H A;  4R6L A;  2VKS A;  1F5M A;  4ME4 A;  4QPR A;  3IBJ A;  4Y5F A;  3KSF A;  4LRY C;  4ETZ A;  4IJG A;  2Y79 A;  1TD5 A;  3NOU C;  3CIT A;  2O9A A;  3K2N A;  2M7U A;  4YNR A;  3MQ0 A;  3MF0 A;  2GX5 A;  1STZ A;  3KO6 A;  2KOI A;  4Y2F A;  4G3W A;  2LB5 A;  3OOV A;  5HPF A;  1YSQ A;  2IA2 A;  4IUK A;  3S7O A;  2W3G A;  5LBR A;  2QYB A;  2W1T A;  1MKM A;  3CI6 A;  2O0Y A;  4MDZ A;  5HPI A;  2VZW A;  4FOF A;  4MCW A;  4EU0 A;  2W3E A;  5DFX A;  5L8M A;  4ETX A;  4R70 A;  2O9C A;  2W1R A;  5DFY A;  4G3K A;  4Q0I A;  5I5L A;  3BJN A;  5AJG A;  4DN0 A;  4O0P A;  2W3D A;  3EEA A;  1MC0 A;  3KSI A;  1YSP A;  4CQH A;  2Y8H A;  2XSS A;  4RQ9 A;  3NHQ A;  4Q0J A;  5TJJ A;  2LB9 A;  3G6O A;  2VJW A;  2HGV A;  3C2W A;  2O99 A;  4MN7 A;  3LFV A;  5K5B A;  3IBR A;  3ZQ5 A;  5HL6 A;  4DMZ A;  3RFB A;  3E98 A;  4GLQ A;  4O8G A;  4ZRR A;  4BWI A;  5HSQ A;  1TF1 A;  3S7P A;  3OBF A;  4Z1W A;  3W2Z A;  4Y3I A;  4EUV A;  3HCY A;  1ZTU A;  3DBA A;  3KSH A;  2W3F A;  2OOL A;  3NOT C;  3NOP C;  1YKD A;  2K31 A;  3TRC A;  1VHM A;  2ZMF A;  3S7N A;  2XRO A;  3D3O A;  2K2N A;  4LRZ E;  3MMH A;  4E04 A;  4GW9 A;  4MMN A;  3O5Y A;  5C5K A;  4G3V A;  3R4K A;  2W3H A;  4O01 A;  4IUH A;  4YOF A;  2XRN A;  3S7Q A;  2O9B A;  3VV4 A;  3E0Y A;  3KSG A;  4LRX C;  2VEA A; 
#chains in the Genus database with same CATH topology
 3UE6 A;  4X1M A;  1QMF A;  2QJ7 A;  4LV2 A;  5U47 A;  4Y5F A;  2L0W A;  5KMW A;  2H10 A;  1A0K A;  2L1M A;  1ZG4 A;  2Q9N A;  4MNR A;  2GX5 A;  4I3I A;  3PR6 A;  1K38 A;  5FQI A;  1BSG A;  3R7W A;  5L2F A;  2JN7 A;  4BBV A;  2HDR A;  2OWJ A;  2O0Y A;  5HPI A;  5FI6 A;  1ACF A;  2Y55 A;  5DFX A;  2K7S A;  5I5L A;  2Q0O A;  4BJP A;  2VLG A;  5JYO A;  5HAP A;  2LB9 A;  4EW7 A;  3KX0 X;  2Q9M A;  3NEC A;  4OP8 A;  1MZU A;  3UB8 A;  3MXR A;  1MWS A;  5TGF A;  2PHY A;  4IED A;  3JPU A;  4GDN A;  2UV0 E;  2G2W A;  4LCM A;  3VFH A;  1T1C A;  4RVA A;  1LL9 A;  3H7W A;  5A8B A;  3ZG9 B;  1ZG6 A;  2V9A A;  2J7V A;  1LT0 A;  4C75 A;  3VOY A;  3ZVT A;  4KQD A;  4N9K A;  3T1X A;  2JBF A;  1BYW A;  3HLG A;  1ESU A;  2GJ3 A;  2V8C A;  2XK1 A;  4FUW A;  5I94 A;  1T1B A;  3KSG A;  1KOU A;  3A3D A;  1MXO A;  2W1T B;  3G2Z A;  4PM8 A;  1LI0 A;  2XD5 A;  4ZJ1 A;  1G28 A;  2P04 A;  1ZHH B;  2XFS A;  3E4Q A;  1K57 A;  1L0E A;  2M7U A;  2PBY A;  2QKP A;  3VFF A;  1PFL A;  3LIA A;  3GVB A;  3HLD A;  3FC7 A;  3HUN A;  3MR0 A;  4DDS A;  4IUK A;  4JF4 A;  2RL3 A;  1K57 C;  3HVF A;  2Y2M A;  1CI9 A;  1YQS A;  1Y54 A;  4KQO A;  1L3L A;  2W1R A;  4KZ4 A;  2OLV A;  1N9O A;  3D4F A;  3TW8 A;  1H5X A;  4DE3 A;  1FSY A;  5HD3 A;  2PDR A;  1D1J A;  3EEA A;  5KIZ A;  1JTD A;  4RQ9 A;  1VEU B;  2MJ6 A;  4I39 A;  3VE3 A;  2VJW A;  2C5W B;  5M19 A;  2W0N A;  4E3M A;  2ZOI A;  5HL6 A;  3HUO A;  4OLD A;  3P7N A;  3IWQ A;  5JYP A;  4P87 A;  1JWZ A;  1RP5 A;  3C4O A;  3BY8 A;  2UWX A;  3W2Z A;  2WKP A;  3HJK A;  1JTG A;  1XA7 A;  4E3N A;  2KDK A;  3NOP C;  2VV8 A;  2Y2O A;  5HWV A;  2FZ0 A;  3D3O A;  1P0Z A;  2Z6C A;  4LRZ E;  2PT7 A;  2WAD A;  3OPR A;  3A3I A;  4GW9 A;  4MMN A;  1XFQ A;  3QP5 A;  1FCN A;  3SZT A;  4BBU A;  2JC7 A;  5EM0 A;  5DVA A;  3FWL A;  4QWO A;  2VEA A;  3ZNT A;  2Y4A A;  5IU1 A;  2ZC6 B;  3ULF A;  4KZA A;  4GZB A;  4OP5 A;  3BFG A;  1L0F A;  1PWD A;  1BUL A;  5HPF A;  4JF5 A;  3IXD A;  5EVI A;  1RGZ A;  2W3G A;  4U0X A;  3UB9 A;  1ES2 A;  1BLP A;  4X53 A;  3WS0 A;  3UDF A;  3LR4 A;  1ODV A;  1S6R A;  3MZF A;  5DJT A;  4JGO A;  4JPM A;  5EVI C;  3VSL A;  2HF6 A;  3Q07 A;  4R3B A;  4OVD A;  4O0P A;  4XXR A;  3V5M A;  4HBU A;  3B42 A;  4DRT A;  2XSS A;  1JWP A;  2FH5 A;  4EET B;  3V67 A;  4S2M A;  3EQU A;  2HGV A;  4OH0 A;  4Y0U A;  3Q1F A;  2EX2 A;  4F3L B;  3LIE A;  4Z1W A;  1TDG A;  3G2Y A;  4OQG A;  1IYP A;  3UB6 A;  2EXA A;  4OON A;  3FV7 A;  5J3W A;  5FSR A;  2L4R A;  2J9O A;  5CED A;  3QNB A;  3NY4 A;  4R1G A;  5D3O A;  4FD8 A;  4S2N A;  1SKF A;  2OAQ 1;  5GLB A;  1XJ3 A;  2YKF A;  3N4I A;  2ZL1 A;  2BAS A;  3MMH A;  4P6Z S;  3PBT A;  2NUP C;  1IOU A;  1G6O A;  4GHI B;  3RH8 B;  3HBR A;  3HUM A;  4EWF A;  2NUT C;  5HDS A;  1XP4 A;  3IX8 A;  4O01 A;  3IXB A;  3MKE A;  4DE2 A;  1I5Q A;  2XLN A;  4S2N C;  3MKF A;  4Y15 A;  3S1Y A;  4HEF A;  2A24 B;  3CMZ A;  1XX2 A;  4H6J A;  3ZG7 B;  3IX4 A;  5KSH A;  2HP6 A;  1HD8 A;  1S0W A;  1TD5 A;  1KE4 A;  3VOL A;  3OZH A;  1PWG A;  2HDS A;  4LGW A;  3TG9 A;  4JGQ A;  1KE0 A;  3IQA A;  4YFM A;  3T1Q B;  1F9I A;  3O86 A;  4EEU A;  2VZW A;  5EVL A;  3ISG A;  4UA6 A;  4KZ5 A;  1SKO A;  1NZO A;  4D2O A;  3LYX A;  5HFO A;  1ZKJ A;  3HRE A;  4Q0I A;  3ZHH A;  2XH9 A;  1YLP A;  2ZM8 A;  4MBK A;  2CMN A;  1MC0 A;  2E8I A;  3KSI A;  2WKI A;  3MZD A;  2VV7 A;  4WL9 A;  1I2S A;  5TJJ A;  1CQA A;  5HAI A;  5FQJ A;  1BTL A;  2J8Y A;  5A92 A;  4FCF A;  5FA7 A;  3DW0 A;  3E98 A;  3S7P A;  1OTE A;  3VE4 A;  2I9V A;  2PR6 A;  4DXC A;  4R3J A;  3WS2 A;  4GS9 A;  1L0G A;  2WAE A;  3IF5 A;  1PZO A;  4UQI S;  3T4J A;  4K08 A;  1YMS A;  4UA9 A;  4BL2 A;  4LLO B;  1NRJ A;  3P98 A;  1T18 A;  2EA9 A;  5FQM A;  5HX9 A;  4EEP A;  2R78 A;  4OKP A;  4IUH A;  3HLB A;  3QP4 A;  3UE3 A;  4KZ3 A;  2EX9 A;  1YM1 A;  4JXW A;  4OPZ A;  5EVI B;  2XA7 S;  4WN5 A;  1WE4 A;  3A0S A;  4M4X A;  1CEG A;  1CEF A;  1H0M A;  4KQQ A;  1FIK A;  2HV1 A;  2PU4 A;  1F5M A;  3G31 A;  4QPR A;  5E2G A;  3SW1 A;  4HOI A;  3MFX A;  4KUK A;  3CPT A;  4HIA A;  3OOV A;  2ZC5 B;  4BL3 A;  2WYX A;  3T4S A;  3GEC A;  4L9G A;  3W4O A;  4EU0 A;  4QJG A;  1VB6 A;  4Y0O A;  3NBL A;  3ZG0 A;  2O9C A;  2V20 A;  3FZC A;  3MJQ A;  3LR3 A;  4B4Z A;  3AGD A;  4MN6 A;  3G30 A;  3V50 A;  2Y2K A;  2ZQ7 A;  3LY4 A;  4L9F A;  3Q82 A;  4WEK A;  5TBM A;  3V3R A;  3N7W A;  3EWK A;  4HH3 A;  3BFC A;  4HQA A;  1IYQ A;  4XT2 B;  5HZH A;  4WYY A;  4S2K A;  1J9M A;  5F6A A;  5DTS A;  4EBP A;  4PMA A;  5EEC A;  5DF9 A;  5DTT A;  2JKF A;  3M2J A;  4DMZ A;  1G5U A;  4ZRR A;  4DKI A;  1EW0 A;  5FAO A;  4EES A;  3MSH A;  3BQA A;  4I38 A;  1ES3 A;  2X01 A;  1O7E A;  4R38 A;  1YPR A;  4EQI A;  1XA1 A;  2EX6 A;  1N4O A;  4ID4 A;  2EX8 A;  5F1F A;  1Y28 A;  4WUJ A;  1PZP A;  3D9Y A;  3G4P A;  1OT6 A;  5IHV A;  2PR5 A;  2OWH A;  2V8F A;  2V0W A;  3PHY A;  5C5K A;  2ZJ9 A;  4GJ4 A;  1GA0 A;  2XRN A;  2WGI A;  2I72 A;  5AQB A;  4I3J A;  3UB5 P;  3W4P A;  1ESI A;  1W63 M;  3SH8 A;  2XF3 A;  5KZH A;  3ITB A;  4R6L A;  4BMW A;  4O7D A;  5EM1 A;  5GLD A;  5AVE A;  3IBJ A;  2WKE A;  3MBZ A;  4X69 A;  5G18 A;  3KSF A;  5GLA A;  4ARZ A;  4NKP A;  1DJB A;  3D72 A;  5EUA A;  2ZC4 B;  5L09 A;  3IF6 A;  3LIF A;  3BM6 A;  3F1O B;  2LB5 A;  4P6Z M;  5J8X A;  1MKM A;  3CI6 A;  2WGW B;  3LO7 A;  4WMC D;  4CLC D;  4ETX A;  4R70 A;  4PPR A;  1OTB A;  3Q7Z A;  2BTF P;  3IF6 C;  4YIN A;  5CXW A;  4GD8 A;  3DAV A;  1W8Y A;  3C7U A;  4EUZ A;  1K56 D;  3V3S A;  3PAE A;  3L7H A;  4NEE D;  3ZYT A;  3B33 A;  2O99 A;  3LFV A;  1QME A;  5DKK A;  1NYM A;  1EWZ A;  4KQR A;  2B95 A;  4JGR A;  4Q8I A;  4Y3I A;  2JKR I;  3NOT C;  4OQ0 A;  5AVF A;  5BOH A;  3F1N B;  2HJ9 C;  4UHU A;  3MZE A;  5FQQ A;  4E6X A;  1L2S A;  2VGK A;  3CPT B;  4MN5 A;  5DTK A;  3FKV A;  5A91 A;  1DP9 A;  5GL9 A;  4RX2 A;  1BT5 A;  1S4R A;  2PAV P;  2WZZ A;  3H82 B;  1ALQ A;  5GLC A;  1XJ4 A;  2BG1 A;  1PI5 A;  1SCW A;  4LRY C;  3UB7 A;  3W8K A;  4UQI M;  3T12 B;  2JKT I;  1E3U A;  2O9A A;  1K0K A;  1DP6 A;  4HP9 A;  1MKI A;  2ZOH A;  4U3T A;  2IA2 A;  3T1R A;  2VV6 A;  3EQV A;  3IS2 B;  1GHM A;  2PYR A;  3OPH A;  5HD5 A;  1J3W A;  1TDL A;  3LEZ A;  1TVF A;  5TFQ A;  2XA7 M;  3Q7V B;  1BLH A;  4P6B A;  3CJM A;  1OJG A;  2WKQ A;  4K0X A;  4DN0 A;  1PWC A;  4HJ3 A;  1RGY A;  3DTM A;  5F1G A;  3UME A;  2XD1 A;  3U2A A;  4OLG A;  1IKG A;  1GHP A;  2XR0 A;  5A90 A;  4KZ8 A;  2HP5 A;  4MN7 A;  4FH2 A;  4K91 A;  3VP3 A;  3RFB A;  1H8Y A;  1XPB A;  5F83 A;  4CLC E;  3BFE A;  5KSC A;  2PBD P;  3VSK A;  4GKU A;  3NCK A;  3GRJ A;  1FOF A;  3GR2 A;  2JE5 A;  4ZJ2 A;  2OOL A;  1YAX A;  4OOL A;  5CEB A;  4PKY G;  3NUL A;  3GQZ A;  1IEL A;  2J3T D;  2OSU A;  3NIA A;  4NXE A;  3UDI A;  1NRF A;  4EXO A;  5F68 A;  4QB8 A;  3O5Y A;  4BEN A;  3WS5 A;  4DE1 A;  1D06 A;  1PW8 A;  3LI9 A;  3M6B A;  5AQA A;  3S4X A;  3B47 A;  2P9V A;  1TS6 A;  4GNU A;  4IHQ A;  2ZQ9 A;  5EOO A;  3WS1 A;  1SHV A;  2DRW A;  3ITA A;  3ZVW A;  1YT4 A;  1N9N A;  4IJG A;  1DP8 A;  2V1Z A;  1EI5 A;  3CIT A;  2DCF A;  3PTE A;  4OOM A;  3OCN A;  2HZ5 A;  3PYP A;  3DTE A;  1KVL A;  1YSQ A;  3R7W B;  4S2L A;  3S7O A;  5LBR A;  4MDZ A;  2ZQC A;  4ESP A;  2W27 A;  1VET A;  3HLC A;  1WYC A;  2VGJ A;  5AQ9 A;  1NLZ A;  2IWC A;  3TOI A;  3NJA A;  4P85 A;  4WZ4 A;  1XXM A;  3RXW A;  1YSP A;  1H8Z A;  3QHY A;  4BBT A;  1NY0 A;  2Y8H A;  2JKG A;  4DDY A;  5HAQ A;  3FPW A;  3LR0 A;  3OCL A;  5K5B A;  3CLO A;  4PKY A;  1PIO A;  1TF1 A;  3EEH A;  3IXG A;  1S4S A;  3H7W B;  1ZTU A;  3IHB A;  4DXB A;  1HVB A;  5HL1 A;  1H3Q A;  1SDN A;  4Y0T A;  3E4P A;  4DE0 A;  4E04 A;  1MWT A;  4KG5 A;  5DKL A;  4JXV A;  2HPB A;  3OLO A;  1CI8 A;  5EE8 A;  3S7Q A;  5IS1 A;  4R23 A;  3VV4 A;  4HES A;  3ZNY A;  5MC7 A;  1ES5 A;  3T4O A;  3UMD A;  2WZX A;  3MS6 A;  3T4Q A;  2VGL S;  1H8M A;  3BEB A;  2PRF A;  4WBG A;  2Y79 A;  3FYZ A;  3IHA A;  1V9Y A;  5FI2 A;  2ACG A;  1TS8 A;  3ZGA B;  4WMC A;  3B3X A;  5G4Y A;  4CLC A;  3GMW A;  4OPQ A;  3SS3 A;  4BD0 A;  5F82 A;  1LSX A;  3GV9 A;  3EOI A;  2GZA A;  2EXB A;  1GHI A;  3SS5 A;  1W5D A;  1K56 A;  3N8R A;  4IBR A;  2XDM A;  4CLC C;  1GSW A;  3TE8 A;  3T1S A;  2Y91 A;  2ZD8 A;  3P09 A;  3HLE A;  1MWU A;  1AXB A;  1K6R A;  4HY8 A;  3EGX C;  5FDH A;  1E3U D;  3C2W A;  4WM9 A;  3QP6 A;  3A3E A;  5E2E A;  1W7F A;  2HDQ A;  4MEZ A;  4O8G A;  1KDS A;  4HP4 A;  3WWX A;  1W8Q A;  4EV4 A;  1KGG A;  3LID A;  4FSF A;  1LL8 A;  5FL3 A;  5EFW A;  2W3F A;  5E2H A;  3TRC A;  2Y2G A;  3T4T A;  1N9L A;  2P08 A;  1DY6 A;  4OQH A;  4EER A;  3F1P A;  3VP4 A;  1OTD A;  5CGX A;  4ZAM A;  1O07 A;  1BLS A;  4R4R A;  5E43 A;  1TS0 A;  3TJZ C;  3C30 A;  4AFI A;  5FAS A;  3ZCZ A;  1E4D A;  4QU3 A;  2R9X A;  1OPX A;  1TEM A;  2KLI A;  1KGE A;  3ZDJ A;  2XQZ A;  4RYE A;  1LL5 A;  5EV0 A;  4MLL A;  3PBS A;  4NET A;  2AVX A;  3IWI A;  3EGD C;  3ZFZ A;  3K2N A;  3MQ0 A;  1STZ A;  3KO6 A;  2Z6D A;  4Y2F A;  1XKZ A;  2Z2M B;  3IH9 A;  4G3W A;  5HDC A;  3IXH A;  4IVI A;  2X02 A;  4FTX A;  5FDS A;  2Y2I A;  3BW6 A;  2ZC7 A;  2X71 A;  1PNE A;  4S2J A;  4GOG A;  5FEG A;  2CC1 A;  3H9W A;  4CJN A;  4N92 A;  3SH9 A;  4WZ5 A;  1K54 A;  3NC8 A;  2M1C A;  2Y2L A;  3NDG A;  4EBN A;  1FR6 A;  3G6O A;  4KG6 A;  5EVE A;  3IBR A;  1PI4 A;  5HSQ A;  4JXG A;  1V9Z A;  3LI8 A;  2V1B A;  3MQQ A;  5CTM A;  1C3B A;  3OPP A;  1PW1 A;  2VX8 A;  4HI4 A;  4JLF A;  2D01 A;  4QY6 A;  2ZL1 B;  1ZC2 A;  4QD4 A;  5CGW A;  3VP1 A;  3G35 A;  2J3T C;  5J4E A;  1Z6F A;  4NXG A;  5HWW A;  2W3H A;  4YOF A;  2J3W A;  4CLC B;  3BY9 A;  4KG2 A;  1N9B A;  4UA7 A;  3VOZ A;  2VKS A;  4H6J B;  3LIC A;  2JKR M;  3UO9 A;  1LSW A;  5CHJ A;  1AWI A;  3PBR A;  3BRM A;  2GDN A;  3NOU C;  4PM9 A;  2ZMA A;  2QMI A;  1X0O A;  5FEF A;  1M6K A;  1Z09 A;  3QNC A;  3SS4 A;  5CEC A;  4YWZ A;  1DJA A;  3PBN A;  3K3C A;  1SKO B;  1U60 A;  5DFY A;  3JVV A;  4S2I A;  2P7J A;  1ONH A;  3LGO A;  3UY6 A;  4K0W A;  2ZM0 A;  3UDX A;  2PYP A;  3QP2 A;  1I2W A;  4OQI A;  3RJU A;  2JKT M;  2G2U A;  4HJ6 A;  3NHQ A;  3T4K A;  1K6S A;  1VEU A;  1DJC A;  3OC2 A;  2IWD A;  3NI9 A;  1SZV A;  2H28 A;  4L0L A;  3ZG5 A;  3CG5 A;  1IEM A;  3S22 A;  5GHZ A;  4GS9 B;  4IBX A;  1W79 A;  4LEN A;  3UPO A;  5FAQ A;  2WUQ A;  1VHM A;  2Y2P A;  1LHY A;  1FIL A;  4E3L A;  5GHX A;  3JVU A;  5M18 A;  1VM1 A;  1F2K A;  2XFT A;  3I7J A;  1YLJ A;  4L9E A;  4PHT A;  3M6H A;  4Q0H A;  3AGF A;  5J7E A;  5L07 A;  3IH8 A;  5F5Y A;  3U4L P;  3BLS A;  1E25 A;  2FFF B;  2XEP A;  1NZU A;  5CTN A;  1S1Z A;  1FCM A;  4B88 A;  3RTY A;  1BUE A;  2VA0 A;  4HNB A;  5HDD A;  3BLM A;  3T50 A;  3BFD A;  4ZTK A;  2EWW A;  1W63 Q;  3A0V A;  4LPZ A;  5L8M A;  1S1Y A;  5FI7 A;  3IT9 A;  2PD7 A;  2A2L A;  5AJG A;  5E2F A;  5TBM B;  5G4Z A;  1IKI A;  3PXP A;  2HDU A;  1OTI A;  1PYY A;  4X1L A;  1T1A A;  2EFX A;  3OPL A;  5CHM A;  2FFY A;  4X6T A;  2Y2N A;  1YLW A;  2BLS A;  5GHY A;  5A93 A;  2HJE A;  4GLQ A;  2ZMV A;  2V2F F;  4KUO A;  4F3L A;  4F94 A;  3C38 A;  1ES4 A;  1P97 A;  2ZC3 B;  2D02 A;  1CK3 A;  1LLB A;  4IVK A;  3IWO A;  5HAR A;  4E3O A;  3PAG A;  1NXY A;  2EWV A;  4P0M A;  1KE3 A;  4A5R A;  3O88 A;  1DRM A;  1GSV A;  2Z2L B;  4DF6 A;  4LV3 A;  1D7E A;  1WA9 A;  4GHI A;  4X68 A;  3G34 A;  1IFQ A;  3UPN A;  5FQK A;  3QP1 A;  3WS4 A;  4C6Y A;  1RCJ A;  1K25 A;  4JKT A;  2O9B A;  5HW3 A;  1NYY A;  1HLU P;  2A24 A;  1ONG A;  4ME4 A;  4E3J A;  4XUZ A;  3FKW A;  1XJ2 A;  3O87 A;  4ARZ B;  4II7 A;  4Y13 A;  1LSV A;  4YNR A;  3IF6 B;  3MF0 A;  4KZ6 A;  1XJ6 A;  3CUE A;  1FQG A;  1MWR A;  4X56 A;  5L10 A;  4GD6 A;  3CHW P;  4N1H A;  4OPY A;  4FH4 A;  4FOF A;  2W3E A;  1YLY A;  5CER A;  1P9W A;  1Q2P A;  1IYS A;  5CHU A;  3CUE C;  1UWN X;  2W3D A;  4UAA A;  1CF0 A;  2QZ6 A;  3V39 A;  1SDE A;  3AGE A;  1JNU A;  1ERQ A;  3UE0 A;  3MQO A;  2XGN A;  4KEN B;  2A3U A;  2Y2Q A;  3E2K A;  2QPN A;  4JF6 A;  3ZQ5 A;  3HLW A;  4Z9Q A;  1KVM A;  3C7V A;  4WEJ A;  4BQM A;  3KYZ A;  3BFF A;  2H0Y A;  3GDI A;  4EUV A;  2V1A A;  3DBA A;  3O3V A;  4HH2 A;  2K31 A;  3HLF A;  4HBT A;  3PBO A;  5TR7 A;  3HJI A;  4GN2 A;  3WRZ A;  4X25 A;  3N6I A;  2OAP 1;  3PBQ A;  1G68 A;  2RCX A;  3FPV A;  4G3V A;  1PRQ A;  1TS7 A;  4R3A A;  2HP9 A;  4NK3 A;  3JYI A;  3DTK A;  3BQ8 A;  5CX7 A;  1G6A A;  4GCZ A;  4N1X A;  2A49 A;  2B18 A;  5EOE A;  4WEL A;  1NWZ A;  2DMW A;  2E8J A;  3UNW A;  5F69 A;  3CZD A;  4R0Q A;  2YKH A;  1K55 A;  2R9W A;  1BLC A;  1S66 L;  4PM7 A;  4ZBE A;  2C6W B;  2WAF A;  3RXX A;  4KZ9 A;  4X55 A;  2QYB A;  2JHE A;  1NLY A;  4D60 A;  3M2K A;  1KGF A;  3ICY A;  1Y4O A;  4GDB A;  1K55 C;  2DNS A;  1HZO A;  3C4P A;  4Y17 A;  3N8L A;  3C5A A;  4XT2 A;  2ZBB A;  2KX6 A;  4WLA A;  3DTI A;  2Y2J A;  1K4E A;  1JWV A;  1T19 A;  1HTZ A;  5FAT A;  2J9P A;  4BWI A;  1CJF A;  2J80 A;  2VK3 A;  3OBF A;  4RA7 A;  3SH7 A;  3UPP A;  3VP2 A;  4LFU A;  5AQ7 A;  3GSG A;  4JBF A;  4LV0 A;  1UGU A;  5DF8 A;  3TSG A;  4B93 A;  3SOI A;  4NG2 A;  3W4Q A;  3VP0 A;  2B5R A;  1WYB A;  1OME A;  1M40 A;  1JVJ A;  3E0Y A;  3UN7 A;  4C3Q A;  1FCO A;  2P9V B;  3LIB A;  4HHD A;  2G7U A;  3CAX A;  1OTA A;  3BYD A;  2ZQA A;  3LY3 A;  3Q81 A;  2INW A;  5FAP A;  4RX3 A;  2OV5 A;  4ETZ A;  2ZQ8 A;  3MXQ A;  5IT5 A;  2IWB A;  4CPK A;  1GSX A;  3A3J A;  3CWF A;  2PD8 A;  3F1O A;  2P74 A;  4PM6 A;  2V0U A;  2QHK A;  3P01 A;  4DJ3 A;  2B02 A;  4B9O A;  4NXF A;  2WGW A;  2WGV A;  2OLU A;  2ZLY A;  1ERO A;  4I3A A;  4MCW A;  1VET B;  3NDE A;  3N8S A;  1L0D A;  4N9L A;  1MY8 A;  5EPH A;  1NJ4 A;  5CRF A;  4Q0J A;  4LCL A;  1YMX A;  4QHC A;  3E4O A;  3HL9 A;  2WK0 A;  4E3K A;  4S2O A;  5HWT A;  3ZG8 B;  4OOY A;  3DWZ A;  3T4L A;  1Q2Q A;  3WRT A;  1YKD A;  3F1N A;  1KDW A;  2ZMF A;  2EFU A;  1GCE A;  3MFD A;  2K2N A;  4E3I A;  2Y2H A;  4WZ5 C;  1VQQ A;  1OT9 A;  1K54 C;  4S2P A;  4UEY A;  1FSW A;  4M3K A;  3L9K A;  1P9R A;  3FG8 A;  1S67 L;  4HJ4 A;  3K3D A;  3MXS A;  4B4X A;  2M7V A;  4PAU A;  3H82 A;  1IYO A;  2QWS A;  3LR5 A;  3UE1 A;  1YLZ A;  3A0R A;  4U0T A;  4I5S A;  3DWK A;  3A3F A;  1XFN A;  5M1A A;  4H8R A;  1BZA A;  2KOI A;  2Y59 A;  1OJ5 A;  2H0T A;  4MBH A;  1LI9 A;  4BLM A;  4R4S A;  2W1T A;  1MPL A;  3IS2 A;  2WKR A;  4DJ2 A;  4ZJ3 A;  3VMA A;  4E6W A;  2WKH A;  4LV1 A;  5CGS A;  5EVI D;  3Q7V A;  4XUX A;  4G3K A;  3LCE A;  3BWL A;  3BJN A;  3GTC A;  2JCH A;  1F98 A;  4EQ1 A;  4JXS A;  2ZM2 A;  4Y7P A;  4CQH A;  4BD1 A;  3KYQ A;  4QY5 A;  3QP8 A;  1K4F A;  1XGI A;  2PU2 A;  4ZDX A;  4MBF A;  1UWP X;  3KYE A;  4JGP A;  4WF0 A;  3LUQ A;  4NXB A;  4KZ7 A;  5FQ9 A;  3E2L A;  1XGJ A;  2ZQD A;  3C8C A;  1ERM A;  4OPR A;  3G32 A;  2QJ5 A;  3HCY A;  2VGL M;  3KSH A;  4EBL A;  1YLT A;  2GNX A;  3S7N A;  3IX3 A;  3LEQ A;  2XRO A;  4KZB A;  3BEC A;  3F1P B;  2H5S A;  1GA9 A;  3R4K A;  1MBL A;  4GB7 A;  5DF7 A;  5DJU A;  4LRX C;  1FR1 A;  4PM5 A; 
#chains in the Genus database with same CATH homology
 2A24 A;  3UE6 A;  2HV1 A;  1F5M A;  4ME4 A;  4QPR A;  4WN5 A;  3T4O A;  3UMD A;  2QJ7 A;  3T4Q A;  2VGL S;  1H8M A;  4Y5F A;  1XJ2 A;  2L0W A;  3SW1 A;  4HOI A;  2Y79 A;  3MFX A;  4ARZ B;  1V9Y A;  4KUK A;  4II7 A;  2L1M A;  4HIA A;  1LSV A;  1TS8 A;  4YNR A;  3MF0 A;  2GX5 A;  1XJ6 A;  4I3I A;  3PR6 A;  5G4Y A;  4CLC A;  3CUE A;  3OOV A;  3R7W A;  1LSX A;  2JN7 A;  4BBV A;  3T4S A;  2OWJ A;  3GEC A;  3EOI A;  2O0Y A;  5HPI A;  4L9G A;  4FOF A;  4EU0 A;  2W3E A;  5DFX A;  2GZA A;  1VB6 A;  1P9W A;  2O9C A;  2K7S A;  3MJQ A;  3LR3 A;  4MN6 A;  5I5L A;  4CLC C;  3CUE C;  4BJP A;  2VLG A;  1GSW A;  4L9F A;  3TE8 A;  1UWN X;  4WEK A;  2W3D A;  5TBM A;  3EWK A;  4HH3 A;  4HQA A;  4HY8 A;  1JNU A;  4XT2 B;  5HZH A;  2LB9 A;  4EW7 A;  5F6A A;  3EGX C;  3KX0 X;  3MQO A;  1MZU A;  3C2W A;  3UB8 A;  5DF9 A;  3ZQ5 A;  2PHY A;  4DMZ A;  4O8G A;  4ZRR A;  1EW0 A;  4HP4 A;  4WEJ A;  4EES A;  1T1C A;  3KYZ A;  3BQA A;  4I38 A;  4FSF A;  3LID A;  1LL8 A;  3GDI A;  5FL3 A;  4EUV A;  5EFW A;  2V1A A;  3H7W A;  5A8B A;  3DBA A;  2W3F A;  4R38 A;  4HH2 A;  2K31 A;  3TRC A;  3T4T A;  3PBO A;  1N9L A;  2V9A A;  2P08 A;  1Y28 A;  3HJI A;  1LT0 A;  4WUJ A;  1OT6 A;  4EER A;  2PR5 A;  2OWH A;  3F1P A;  1OTD A;  2OAP 1;  3PBQ A;  2V0W A;  3PHY A;  4KQD A;  5C5K A;  3FPV A;  4G3V A;  1TS0 A;  4GJ4 A;  3TJZ C;  1TS7 A;  2XRN A;  4R3A A;  1BYW A;  3C30 A;  4AFI A;  4I3J A;  2GJ3 A;  1T1B A;  3KSG A;  3BQ8 A;  1KOU A;  5CX7 A;  4GCZ A;  1OPX A;  2B18 A;  2W1T B;  1W63 M;  2KLI A;  4WEL A;  1NWZ A;  4R6L A;  4BMW A;  5AVE A;  3IBJ A;  2DMW A;  1G28 A;  2P04 A;  1ZHH B;  3E4Q A;  3PBS A;  3KSF A;  5F69 A;  4ARZ A;  4NKP A;  3D72 A;  3EGD C;  3K2N A;  2M7U A;  2QKP A;  2YKH A;  3MQ0 A;  1STZ A;  3F1O B;  3KO6 A;  3LIA A;  3LIF A;  2Z6D A;  4Y2F A;  4G3W A;  2LB5 A;  3FC7 A;  4P6Z M;  5HDC A;  1S66 L;  3MR0 A;  4IUK A;  2QYB A;  1MKM A;  3CI6 A;  2JHE A;  1NLY A;  3BW6 A;  4CLC D;  4ETX A;  4R70 A;  3ICY A;  4KQO A;  1OTB A;  2W1R A;  1N9O A;  3H9W A;  3TW8 A;  5HD3 A;  2PDR A;  2M1C A;  3EEA A;  5KIZ A;  4RQ9 A;  4XT2 A;  2ZBB A;  2KX6 A;  2MJ6 A;  4I39 A;  3G6O A;  4NEE D;  4WLA A;  3ZYT A;  3VE3 A;  3B33 A;  2VJW A;  2O99 A;  2W0N A;  3LFV A;  3IBR A;  5DKK A;  2ZOI A;  5HL6 A;  1T19 A;  3P7N A;  5HSQ A;  4BWI A;  2J80 A;  3OBF A;  1V9Z A;  3LI8 A;  3BY8 A;  2V1B A;  3MQQ A;  3W2Z A;  2WKP A;  3HJK A;  4JGR A;  4Y3I A;  2JKR I;  2KDK A;  3NOT C;  5AVF A;  3NOP C;  2VV8 A;  2VX8 A;  3F1N B;  2HJ9 C;  4HI4 A;  1UGU A;  5HWV A;  2FZ0 A;  2D01 A;  4B93 A;  3D3O A;  1P0Z A;  2Z6C A;  4LRZ E;  2PT7 A;  4GW9 A;  2J3T C;  4MMN A;  5J4E A;  1XFQ A;  4NXG A;  5HWW A;  2W3H A;  4MN5 A;  4YOF A;  4BBU A;  2J3W A;  4CLC B;  1DP9 A;  3BY9 A;  3E0Y A;  2VEA A;  1S4R A;  3LIB A;  4HHD A;  3H82 B;  2G7U A;  5IU1 A;  3CAX A;  1OTA A;  2VKS A;  4H6J B;  3LIC A;  2JKR M;  1XJ4 A;  1LSW A;  2INW A;  4ETZ A;  4LRY C;  3ULF A;  3MXQ A;  3PBR A;  3UB7 A;  5IT5 A;  4UQI M;  3NOU C;  2JKT I;  1GSX A;  2O9A A;  3CWF A;  2PD8 A;  1X0O A;  3F1O A;  2V0U A;  2QHK A;  5HPF A;  3P01 A;  4DJ3 A;  1DP6 A;  2B02 A;  4HP9 A;  4B9O A;  2ZOH A;  2IA2 A;  4NXF A;  2W3G A;  3UB9 A;  2VV6 A;  3EQV A;  3IS2 B;  2PYR A;  3PBN A;  4YWZ A;  4I3A A;  4MCW A;  5HD5 A;  3K3C A;  2XA7 M;  3LR4 A;  1ODV A;  5DFY A;  3JVV A;  5DJT A;  2P7J A;  1OJG A;  4JGO A;  2WKQ A;  4DN0 A;  2HF6 A;  2PYP A;  4HJ3 A;  4O0P A;  3B42 A;  2JKT M;  4HJ6 A;  2XSS A;  3UME A;  2FH5 A;  3U2A A;  3NHQ A;  3T4K A;  4Q0J A;  3OC2 A;  4EET B;  3V67 A;  3EQU A;  2HGV A;  3E4O A;  4MN7 A;  2H28 A;  4L0L A;  3RFB A;  4F3L B;  4CLC E;  3LIE A;  4Z1W A;  3UB6 A;  5HWT A;  4GS9 B;  5J3W A;  3T4L A;  2OOL A;  1YAX A;  2L4R A;  1YKD A;  4OOL A;  4PKY G;  3F1N A;  1VHM A;  2ZMF A;  2J3T D;  2OAQ 1;  1XJ3 A;  2YKF A;  2K2N A;  4NXE A;  2BAS A;  3MMH A;  4P6Z S;  3PBT A;  2NUP C;  1IOU A;  1G6O A;  4GHI B;  3RH8 B;  1OT9 A;  4EXO A;  5F68 A;  2NUT C;  5HDS A;  4UEY A;  3O5Y A;  3JVU A;  4O01 A;  1P9R A;  3FG8 A;  1D06 A;  4L9E A;  1S67 L;  3LI9 A;  4HJ4 A;  3K3D A;  4PHT A;  3B47 A;  2M7V A;  1TS6 A;  3H82 A;  4PAU A;  4Q0H A;  2A24 B;  2QWS A;  4IHQ A;  3LR5 A;  4H6J A;  5J7E A;  5KSH A;  5F5Y A;  3A0R A;  1N9N A;  4IJG A;  4I5S A;  1DP8 A;  1TD5 A;  1XFN A;  3CIT A;  4OOM A;  3VOL A;  1S1Z A;  3RTY A;  2VA0 A;  3OCN A;  4HNB A;  2KOI A;  5HDD A;  3PYP A;  3T50 A;  1OJ5 A;  4JGQ A;  1YSQ A;  1F9I A;  3R7W B;  3S7O A;  2EWW A;  4EEU A;  1W63 Q;  5LBR A;  2W1T A;  4MDZ A;  3A0V A;  2VZW A;  3IS2 A;  2W27 A;  2WKR A;  4LPZ A;  4DJ2 A;  5L8M A;  1S1Y A;  3LYX A;  1NLZ A;  4G3K A;  3NJA A;  4Q0I A;  3BWL A;  3BJN A;  2PD7 A;  2A2L A;  5AJG A;  1F98 A;  2CMN A;  4EQ1 A;  1MC0 A;  3KSI A;  5TBM B;  1YSP A;  5G4Z A;  4CQH A;  2VV7 A;  4WL9 A;  3KYQ A;  4BBT A;  3PXP A;  2Y8H A;  1OTI A;  5TJJ A;  1T1A A;  3FPW A;  3LR0 A;  3OCL A;  1UWP X;  4WF0 A;  4JGP A;  5K5B A;  3LUQ A;  3CLO A;  4PKY A;  2HJE A;  3E98 A;  4GLQ A;  2ZMV A;  4KUO A;  4NXB A;  4F3L A;  1TF1 A;  3C38 A;  3EEH A;  3S7P A;  1P97 A;  1S4S A;  1OTE A;  3VE4 A;  2I9V A;  2PR6 A;  3C8C A;  2D02 A;  2QJ5 A;  3HCY A;  4GS9 A;  3H7W B;  2VGL M;  1ZTU A;  3KSH A;  2EWV A;  4UQI S;  3T4J A;  2GNX A;  4K08 A;  3S7N A;  1DRM A;  1H3Q A;  1GSV A;  2XRO A;  4LLO B;  1NRJ A;  3E4P A;  1T18 A;  3F1P B;  1D7E A;  1WA9 A;  4GHI A;  4E04 A;  2EA9 A;  1IFQ A;  5DKL A;  3R4K A;  4EEP A;  2R78 A;  3OLO A;  4IUH A;  3S7Q A;  3UE3 A;  5IS1 A;  2O9B A;  3VV4 A;  5DJU A;  2XA7 S;  5MC7 A;  4LRX C;  3A0S A;  4M4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...