4G3VA

Crystal structure of a. aeolicus nlh2 gaf domain in an inactive state
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
162
structure length
162
Chain Sequence
b'RLKLKEINVVNEITKILTGDYTFEESLKEVLKVLYSYLGVEHSFIAIREGNTLRIASSYGYFLNKDVAFKKGEGITGKVFQRGIPLVIPNVKHNSAFANKTGIGRLLTEKHALIAAPIKVGGEVKGVITIFKEFSDKESLENFYQTINVIGNLLGMFFKLRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator nlh2
publication title Structural mechanism of GAF-regulated delta(54) activators from Aquifex aeolicus
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription regulator
total genus 52
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4g3vA00
2B18A 2KOIA 4IUKA 3NOUC 1STZA 1YKDA 4Y2FA 3HCYA 1MKMA 4Q0HA 1YSQA 3D3OA 4QPRA 3OBFA 5L8MA 2QYBA 3NOTC 4R6LA 4ETZA 4G3WA 4MN7A 3S7OA 4E04A 2LB9A 2KLIA 2W1TB 2W3GA 2W1TA 4CQHA 2VEAA 3KSHA 3IBRA 4DMZA 3RFBA 3CI6A 2O9BA 4Q0JA 4O01A 4O8GA 2W3HA 4MDZA 5I5LA 2VZWA 4RQ9A 5DFYA 2W1RA 2OOLA 3LFVA 3MQ0A 5DFXA 3G6OA 2O0YA 4DN0A 2G7UA 2Y79A 3BJNA 2XROA 4FOFA 1TF1A 2K2NA 3S7NA 3KSGA 1F5MA 3E0YA 5AJGA 3O5YA 4EU0A 5HSQA 1MC0A 4G3KA 5K5BA 2GX5A 3R4KA 1VHMA 3E98A 3IBJA 4LRXC 4EUVA 3S7PA 2IA2A 2O9AA 2ZMFA 3KSIA 1TD5A 5TJJA 4Q0IA 4YNRA 2VJWA 2XSSA 4G3VA 3OOVA 4MCWA 4Z1WA 3W2ZA 4O0PA 3EEAA 5C5KA 5HPIA 3DBAA 4IUHA 2W3EA 3KO6A 1ZTUA 2W3DA 2O9CA 2O99A 4ETXA 4ME4A 3NOPC 3KSFA 2M7UA 3MF0A 3CITA 4LRYC 2XRNA 4Y3IA 2Y8HA 5HL6A 2LB5A 4IJGA 4PAUA 3K2NA 3TRCA 2VKSA 4LRZE 4Y5FA 4BWIA 4GW9A 4GLQA 2HGVA 1YSPA 2K31A 3C2WA 3MMHA 3NHQA 4ZRRA 3S7QA 3ZQ5A 4R70A 3VV4A 4YOFA 5LBRA 5HPFA 2W3FA 4MMNA 2M7VA
chains in the Genus database with same CATH superfamily
2W27A 4CLCA 4OPQA 2CC1A 4X55A 2BTFP 5M1AA 1YSQA 3C5AA 1VM1A 1FQGA 3ZG5A 4ETZA 3TSGA 2FZ0A 4P0MA 4RA7A 2LB9A 3MQOA 3K3CA 2ZM2A 4DMZA 3H82B 1SKOB 4CLCD 4GD6A 5TBMB 3PBQA 5A92A 4N1HA 1H5XA 2FH5A 2PYRA 2WGVA 1XGJA 1E25A 3M2KA 4DN0A 2PYPA 3QHYA 3W4QA 1TF1A 3IXDA 3PBNA 2H28A 1W63Q 2HJ9C 1PW1A 1DP9A 3UB8A 3MFXA 3BWLA 3ZCZA 5CRFA 2ZC6B 5FI7A 3GECA 4Y0TA 2ZJ9A 1VHMA 4KUKA 3LIDA 2AVXA 3SH9A 3WS4A 3P01A 4OLDA 3T1XA 5AQ9A 4P6ZM 3V39A 5HWWA 3Q1FA 4PKYG 5HD5A 1M6KA 4RYEA 1BSGA 2M1CA 2PD8A 3T4SA 2JHEA 3KO6A 4E6XA 3LR0A 2WGWA 4OQIA 2XFTA 3DAVA 4N92A 3NBLA 5FQQA 4E3NA 5DTKA 4U3TA 1F98A 4B4ZA 3SS5A 4WN5A 1BULA 4GLQA 1FCNA 1YSPA 2K7SA 3C8CA 3PBSA 3W8KA 3BFEA 3HLEA 3T1QB 5CTMA 2VGLS 1YKDA 4WEKA 4R4RA 3D3OA 2XR0A 2A2LA 2WYXA 3HBRA 5EM1A 5AQBA 4HP4A 4OH0A 1FILA 1PI4A 1ZG4A 1MWTA 3S7OA 1WA9A 2W1TA 4C3QA 1NWZA 4ARZA 3GVBA 4HHDA 1YLTA 4Q0JA 4IHQA 3LUQA 5I5LA 1P97A 1S67L 5EOEA 4OQHA 2Y79A 4I38A 2ZC3B 5AVFA 1PIOA 3V5MA 1T19A 4EEPA 3N8RA 2OLVA 4PHTA 2G2UA 3T4JA 4M3KA 4GHIB 1EW0A 5K5BA 4HOIA 3BQ8A 4DDYA 2RL3A 4EXOA 4UA6A 1U60A 3ITBA 2B02A 3HLBA 1OJ5A 2ZOHA 2BASA 3LIFA 1EROA 1N9LA 4BBVA 2GDNA 3A0SA 4B4XA 5FQKA 1OJGA 3EEAA 5C5KA 1PNEA 1TS7A 1ERMA 1BZAA 3ZG0A 2PT7A 4DF6A 4R3AA 4JF6A 5GLCA 4S2MA 5DTTA 3G35A 2Y2NA 2ZOIA 3FYZA 4LCMA 4ID4A 3UE6A 3MKEA 4O7DA 3LO7A 2VGLM 3LIEA 1J3WA 3M6HA 2QHKA 2J9PA 3LIAA 4X53A 3MBZA 3B47A 3NY4A 3FC7A 2R9WA 1XJ3A 4OPYA 4MN7A 1JTDA 1HLUP 1E4DA 2V1ZA 5J7EA 1OTIA 2EFUA 1HVBA 4DE0A 5DJTA 4O01A 4KZ9A 3BQAA 4HI4A 5CERA 1K57C 5IS1A 3BRMA 5FAOA 3R7WB 2XD5A 1ZHHB 2UWXA 4I5SA 2Y59A 5FL3A 3NC8A 3F1NA 3LGOA 3CHWP 3BFDA 3PAGA 1G6AA 3UMDA 4JGPA 5FAQA 3BY8A 1EWZA 3IX3A 1T1BA 4IEDA 1LLBA 1KDWA 3UB6A 4LV1A 2C5WB 2Y2MA 1NYMA 1K38A 3UE1A 4D60A 2W3EA 3VP2A 5CEDA 1ZTUA 4GDNA 1ALQA 5M19A 2OWHA 4CLCE 4CLCB 5HAPA 3M2JA 1MPLA 1VETA 3TW8A 2FFYA 5JYPA 4GCZA 2A24B 5MC7A 2HZ5A 3NDEA 3UY6A 2HGVA 1KVMA 3AGDA 3NHQA 3P98A 4BD0A 4YOFA 1CJFA 1ES3A 3EOIA 3E2KA 4MBFA 2Q9MA 4MN5A 2HP9A 4E3KA 2E8IA 4G3WA 3T4KA 1MWRA 4DKIA 1LL9A 4PM9A 2PR5A 3MSHA 5F69A 1K4EA 2A3UA 4R23A 2I9VA 2XA7S 4MNRA 2HDQA 3C30A 5AJGA 1S6RA 4DJ2A 1VEUB 3A3EA 3PBOA 3UNWA 3PBRA 4GN2A 3C4OA 3E4PA 5G4YA 2HV1A 4KZ7A 2JE5A 4X1LA 1FR6A 1CQAA 4EUZA 2PU2A 1H8ZA 4KZ4A 3VSLA 5FDSA 3UB7A 2HPBA 4F3LA 2V0WA 4O0PA 4BMWA 5HDSA 2O9CA 4MN6A 3NOPC 3ULFA 2ZMAA 3OPPA 5A90A 3O87A 1L0DA 3NI9A 1W5DA 1K55C 3WRZA 3GR2A 3IXHA 1ESUA 4GW9A 3FPVA 4OPZA 2P7JA 4FTXA 1V9ZA 2J8YA 4ARZB 1H8MA 2W0NA 5DTSA 2Y2PA 3Q82A 1NRJA 3UDFA 3D4FA 2Y4AA 3RH8B 3CPTA 3WS5A 2XDMA 5GHZA 2H5SA 3K3DA 3NIAA 1XGIA 3M6BA 3UB9A 2PHYA 4NXBA 1HD8A 3CWFA 5F5YA 3V3RA 3OC2A 3VP1A 4HNBA 4WZ4A 4WUJA 3CI6A 4MDZA 4UHUA 1GA0A 3TE8A 5HAQA 3LYXA 4OOMA 3Q7VA 3IS2A 2ZQ8A 1H3QA 4FUWA 2ZLYA 3UO9A 4DRTA 5F68A 5HWTA 3WRTA 1OT6A 5FA7A 4BBTA 5DJUA 3CUEA 2DMWA 1OTDA 1BT5A 3BM6A 1KVLA 4DE3A 2JKRM 3MQQA 2PRFA 1PWGA 1I2SA 2O9AA 2ZMFA 1TD5A 1YMSA 5CHUA 2R78A 3LI9A 4ZJ1A 4R3BA 3SH8A 1S0WA 3FV7A 2O99A 3CMZA 5L09A 3T4QA 3HJIA 3BLMA 1PI5A 1K57A 3PTEA 4S2NA 4DJ3A 1NJ4A 3GRJA 3FPWA 5DVAA 1ES2A 3F1OA 2L4RA 2XQZA 5CECA 3HLFA 5D3OA 2Y2QA 3LEQA 1M40A 1XX2A 1GHPA 4A5RA 4GKUA 5FDHA 1GHIA 3HL9A 3CAXA 1VQQA 5CGXA 4H6JB 4B9OA 3TG9A 5EECA 1LI0A 3MXRA 2EA9A 3IH8A 4D2OA 3F1NB 2V8CA 2QKPA 3G2YA 1OPXA 2BLSA 1EI5A 2FFFB 5EOOA 5GHXA 3RXXA 5HARA 2OAP1 1G6OA 5EVIC 1Q2PA 3BY9A 4S2PA 4HIAA 3ZNTA 1ODVA 2ZQAA 2ZQ9A 2PDRA 4PM7A 4OPRA 4QB8A 1MC0A 2Q0OA 3VMAA 3QP5A 2BG1A 4ZJ3A 2D02A 4XUZA 1XXMA 4E6WA 1VETB 1OTAA 3O3VA 2JKRI 3HUOA 3Q07A 3Q7ZA 4UA9A 5FASA 2Y2HA 4JXVA 3S4XA 2DNSA 2NUTC 1ES5A 3VSKA 5EVLA 4LV3A 3VP0A 3B42A 3VP4A 4WEJA 1PYYA 1PZPA 4UQIS 4WF0A 2Y2IA 1RP5A 4NXGA 4OOLA 3K2NA 3L9KA 2WKHA 5A91A 1Y28A 4OP5A 3LR5A 3A3FA 3C2WA 1T18A 1XFNA 3IF6A 1N9BA 2EX6A 3KYEA 2E8JA 3HVFA 5HDCA 4HEFA 3ICYA 1S1ZA 5FQJA 3HCYA 4X56A 1WYBA 2Y55A 3MFDA 1IEMA 5CX7A 4PM5A 1JVJA 3G31A 1ESIA 3KSHA 3QP2A 3T50A 2EX9A 4HH3A 3EWKA 3LR3A 2Y91A 1Y4OA 3JPUA 4EBLA 2OAQ1 4WELA 3MQ0A 1K55A 2G7UA 3ZNYA 3TOIA 1Q2QA 4F3LB 4MBHA 1E3UA 4NG2A 4EU0A 3T12B 1SHVA 2P04A 3O86A 2HP5A 2ZM8A 2KDKA 4JKTA 1E3UD 1YAXA 1YLPA 2PD7A 3OCLA 4Q0IA 1I5QA 4Z1WA 1KDSA 2X71A 4FH4A 4UQIM 4LCLA 3SH7A 4ETXA 1SCWA 3HLDA 2Y2JA 3ZFZA 4HQAA 2J7VA 3OPRA 3CPTB 1ONGA 3ZVTA 1GSWA 4R0QA 3BYDA 2V1BA 2ZMVA 1ZC2A 3CLOA 1LI9A 4OP8A 4R38A 4RX2A 1XFQA 5IU1A 1MXOA 3HLCA 3Q7VB 2KX6A 3IS2B 3HJKA 4NETA 5E2EA 4AFIA 1IOUA 4HY8A 4KZ3A 2WUQA 3BECA 5M18A 4S2OA 3LCEA 1DY6A 1SKFA 4PM8A 1ZKJA 2VV6A 3HREA 2JKTI 4KZ5A 2J9OA 2W3HA 4BD1A 2HDRA 2ZC4B 1RCJA 4DXBA 5DFXA 3TJZC 3EEHA 1OTEA 4GS9A 4OVDA 4IVKA 4S2JA 1OT9A 1IKIA 3S7NA 5CEBA 5L2FA 5HAIA 4KQDA 1YT4A 4WZ5C 3NECA 3D9YA 3IF5A 4XT2A 3CJMA 3RTYA 3VOZA 2P9VA 3BW6A 3G4PA 3GQZA 4KZAA 1TS6A 4KZ6A 5CGSA 4JGRA 4DXCA 4EQ1A 4LGWA 4E3OA 5JYOA 1PRQA 3W4OA 4NXEA 2VLGA 3F1OB 1QMFA 3UN7A 1N9OA 1ONHA 1P9WA 3MF0A 4KUOA 2IWCA 1J9MA 3PXPA 2DCFA 2XRNA 3HLWA 3A0RA 4EV4A 4IJGA 3TRCA 1XA1A 1XA7A 1L2SA 1Z6FA 3DTIA 1BUEA 2PBDP 1DJCA 2QMIA 4F94A 5DKLA 5LBRA 2W3FA 2KOIA 5U47A 3NOUC 5EVID 3A0VA 4RX3A 4HJ4A 3DW0A 4X69A 1SZVA 2QPNA 3MZDA 2OWJA 1IFQA 2W3GA 4CQHA 3UE3A 2X01A 4EQIA 2WAFA 2ZQ7A 2D01A 5GLDA 3MKFA 2XD1A 3DTMA 2WKIA 3MJQA 4E3LA 4BL2A 2V9AA 3N4IA 2H0TA 5IT5A 4Y0OA 4HBUA 4FOFA 5EM0A 4BQMA 3VE3A 3IX8A 3IWOA 1L0GA 3B33A 4G3KA 4CPKA 1H0MA 1O7EA 4R1GA 1QMEA 1KGGA 4ESPA 1G68A 4K0WA 1XJ4A 3IXBA 4OLGA 5HWVA 5FQ9A 2XF3A 4MLLA 4QU3A 3A3DA 3P7NA 3EGXC 3C4PA 1PWCA 4WL9A 3IF6B 2VGKA 2V0UA 3PBTA 3WS1A 2WGWB 5FSRA 1T1CA 4LRYC 3RXWA 3F1PA 5A93A 4ZJ2A 3EGDC 2LB5A 1N4OA 4Y0UA 5EE8A 4LRZE 4Y5FA 3JYIA 2ZL1A 5HPFA 4MMNA 3U2AA 3MXSA 1CF0A 3JVUA 4L0LA 3VFFA 1KE4A 5EV0A 4N1XA 4KQQA 2W1TB 5CXWA 3U4LP 3S1YA 3UPNA 1UWPX 5F83A 4L9GA 2OOLA 4ZTKA 3LFVA 4EERA 4JXGA 3OPLA 4JF4A 5E2GA 4FH2A 2Z2MB 1G5UA 1F5MA 5E2FA 1W63M 3ZVWA 2WKRA 4ZBEA 1D7EA 3UB5P 1K6SA 1TVFA 3IQAA 1P0ZA 1SDEA 4KG2A 3FG8A 4OQ0A 3S7PA 5F1FA 3E4OA 4WYYA 2XSSA 3OOVA 4MCWA 2ZQDA 2WK0A 1VB6A 1WYCA 4LENA 3VFHA 1D06A 1PFLA 3G34A 1PWDA 5E2HA 2M7UA 5CHMA 1FR1A 1L0EA 2A49A 4EEUA 4L9FA 4X6TA 3VOLA 3LY4A 4Y13A 4X1MA 2V2FF 2ZM0A 2Y2LA 4WZ5A 4E3JA 4IBXA 1F9IA 5A8BA 4P85A 2OSUA 3NDGA 5DKKA 5TFQA 2XEPA 3T1RA 1CEGA 4GS9B 5L8MA 1S66L 1YMXA 4MBKA 1P9RA 3N8LA 2EXAA 1JWZA 2WAEA 1F2KA 3E2LA 3FZCA 1W79A 1YLZA 3V50A 3RFBA 4U0XA 3ZG8B 5EVEA 3KYQA 4XT2B 4NXFA 2W1RA 3JVVA 3LI8A 4KG6A 4LV2A 3BJNA 1NYYA 4Y15A 1GSXA 1PW8A 3UPPA 2JCHA 2HDUA 3E4QA 3OPHA 4YFMA 3QP1A 3R7WA 4E3MA 4QY6A 4Y17A 3SOIA 4XXRA 2WGIA 4JF5A 2XFSA 2L1MA 4U0TA 2EWWA 4Y7PA 2XGNA 2WKQA 2QWSA 4NK3A 2VK3A 3T1SA 1K25A 2DRWA 4B93A 4GDBA 3EQUA 5FEGA 2Q9NA 3I7JA 1BYWA 3PYPA 1FCMA 2Z6CA 2ZC5B 3MXQA 4IUHA 5HPIA 5HFOA 2W3DA 3SS3A 4K08A 1OMEA 3D72A 2QJ7A 3NJAA 3KSFA 1LSXA 3T4TA 3BFGA 1HTZA 3P09A 4Y3IA 3N8SA 4HJ6A 4YWZA 2VX8A 4PAUA 2A24A 1MWUA 3OCNA 1JTGA 4B88A 5HX9A 5FAPA 4II7A 4R70A 4HJ3A 3PHYA 3QP4A 3A3IA 2B95A 3UMEA 5TR7A 1TEMA 1BTLA 4IUKA 5HD3A 2ZBBA 4KZBA 4K91A 2H0YA 4Q0HA 2CMNA 1KE0A 4KG5A 3MS6A 4QWOA 3IBRA 1YLYA 4ZAMA 4WM9A 4PKYA 2IWBA 1IYOA 4M4XA 5HW3A 1ZG6A 3H9WA 2ACGA 4EESA 1I2WA 1KE3A 1KGEA 2MJ6A 4RVAA 3G32A 2C6WB 3WS0A 5FI6A 4I3JA 4JGQA 1CI9A 1VEUA 4L9EA 4KZ8A 2JKTM 1IYQA 2V8FA 4FSFA 3BLSA 3R4KA 3CG5A 2WADA 3E98A 3H7WA 3IBJA 4LRXC 3F1PB 4EW7A 4C75A 3MZFA 2YKFA 3FKWA 4FCFA 4HESA 1V9YA 1K56A 1ES4A 3ZGAB 4NEED 5HZHA 3C7UA 2ZL1B 3LICA 1NXYA 5HDDA 2HF6A 5E43A 2QJ5A 1MZUA 2INWA 1L0FA 4XUXA 3CITA 4LV0A 4JGOA 1YQSA 1K56D 2Y8HA 2VKSA 3PAEA 2NUPC 2GZAA 1HZOA 1NZUA 4IVIA 1TS8A 1GCEA 1GA9A 1TDGA 1G28A 2WZXA 5EPHA 4DE1A 3NULA 2Z2LB 3GV9A 3UDXA 2VGJA 3GDIA 1MKMA 3LR4A 4E3IA 1JWVA 3GSGA 1LL8A 2KLIA 1CK3A 4BL3A 2XH9A 3DTKA 5FEFA 3WS2A 4JPMA 4IBRA 4QHCA 2J3TC 1K54C 2GJ3A 1YLJA 3IT9A 3Q81A 3W4PA 4DE2A 4OOYA 4EBPA 3FKVA 1TS0A 2O0YA 3PR6A 1X0OA 1K6RA 2XK1A 1N9NA 2EX2A 4KENB 3V3SA 3VE4A 3KSGA 3E0YA 3O5YA 5HSQA 2PU4A 4PM6A 4UAAA 1A0KA 3G30A 4OQGA 2JKFA 3QP8A 1BLSA 5F82A 4P87A 1FSWA 2EXBA 4EBNA 2P08A 1XJ6A 3KSIA 1IELA 1ACFA 4DDSA 3W2ZA 2Y2GA 2L0WA 1FIKA 1DJAA 1Z09A 3CZDA 3DBAA 5AQ7A 3CUEC 3AGEA 1NZOA 1OTBA 2G2WA 1AXBA 4R3JA 2UV0E 3EQVA 1RGYA 3QNCA 5HL6A 5F6AA 4BLMA 5CGWA 3IWIA 1YPRA 3MMHA 3ZQ5A 2H10A 3S7QA 5G18A 2XLNA 5GHYA 3VV4A 1S4SA 2OV5A 1XKZA 4HP9A 1Y54A 3N6IA 2VA0A 3N7WA 1IKGA 1STZA 1BLPA 1UWNX 2IWDA 4Y2FA 2JC7A 3B3XA 4S2NC 1FOFA 4OKPA 2JBFA 5F1GA 5KSCA 5EVIA 1CI8A 2R9XA 3NOTC 4I3IA 1BLCA 4H6JA 5L10A 3ZG7B 4E04A 5EUAA 5J3WA 2OLUA 3AGFA 4PPRA 1RGZA 4HH2A 5DFYA 3KYZA 4UEYA 2ZD8A 3ZHHA 4Q8IA 5J8XA 4LFUA 1JNUA 4EWFA 4GD8A 4EETB 5FQMA 1C3BA 3DWKA 4X68A 4K0XA 5DF9A 5FQIA 4BBUA 4JBFA 3H82A 1SKOA 1W8QA 5G4ZA 5TBMA 4WMCA 3KX0X 1K0KA 1T1AA 2EX8A 1DJBA 5L07A 4CLCC 5J4EA 1SDNA 4BENA 3A3JA 2WZZA 4I3AA 3ZG9B 2WKPA 3GMWA 4GOGA 4WMCD 1PZOA 5TGFA 4ME4A 3SW1A 3QNBA 1W7FA 1BLHA 2JN7A 3IHAA 5KZHA 1NRFA 4OONA 2VV8A 1L3LA 1WE4A 3LY3A 2J80A 1K4FA 1DRMA 1DP6A 1UGUA 2B18A 2PAVP 1TDLA 5CTNA 2B5RA 3C38A 3OBFA 4R6LA 1KOUA 4NKPA 2HJEA 4R4SA 4JXSA 3BEBA 5GLAA 1KGFA 1IYSA 3LEZA 3IF6C 2V20A 4O8GA 2EFXA 3H7WB 2ZQCA 2VZWA 4RQ9A 2VV7A 4GB7A 1LHYA 3SZTA 5KMWA 4LLOB 2K2NA 3ZDJA 3DWZA 5DF8A 1LSVA 1YM1A 4CJNA 1AWIA 2HP6A 1FSYA 3C7VA 1O07A 4GJ4A 4EUVA 4QD4A 1XPBA 2IA2A 3G2ZA 5TJJA 3IWQA 4JXWA 4G3VA 4KQRA 3V67A 1D1JA 3IHBA 4X25A 4JLFA 4PMAA 4HBTA 4GHIA 3IX4A 1K54A 3BFFA 1MKIA 3ITAA 3HUNA 4QY5A 3MZEA 4BJPA 2J3TD 3MR0A 2Y2KA 1H8YA 1IYPA 3T4OA 4MEZA 3RJUA 2XA7M 1MBLA 2M7VA 4GNUA 2PBYA 1NLZA 3VOYA 1NLYA 2I72A 1LSWA 3ISGA 2EWVA 4QPRA 1NY0A 1XP4A 3T4LA 2QYBA 5AQAA 3ZYTA 1S4RA 2YKHA 2ZC7A 2VEAA 5EFWA 5KIZA 4N9KA 4S2LA 2O9BA 5FI2A 1MWSA 4S2IA 5FATA 5DF7A 4C6YA 5CHJA 3DTEA 4GZBA 3G6OA 2XROA 3LIBA 2PR6A 2X02A 3OLOA 4QJGA 3IXGA 4FD8A 3OZHA 4P6BA 1LL5A 3QP6A 4WLAA 2Z6DA 2P74A 2GX5A 2HDSA 2WKEA 5KSHA 4KQOA 5AVEA 1XJ2A 3HUMA 4WBGA 1W8YA 4YINA 1GHMA 3FWLA 3L7HA 2P9VB 2RCXA 4ZDXA 5GL9A 4YNRA 1MY8A 2VJWA 4UA7A 1FCOA 1LT0A 2GNXA 1DP8A 5BOHA 3NCKA 4P6ZS 3GTCA 2J3WA 3O88A 1YLWA 2JKGA 4S2KA 3UDIA 3UPOA 3BFCA 4N9LA 2QZ6A 5I94A 1CEFA 5GLBA 5HL1A 1JWPA 2Y2OA 1GSVA 5EVIB 3IH9A 4H8RA 3SS4A 3WWXA 4BWIA 4LPZA 2K31A 4Z9QA 4ZRRA 3HLGA 3S22A 1ERQA 3UE0A 1S1YA 3VP3A 2V1AA 5IHVA 4I39A
chains in the Genus database with same CATH topology
2KOIA 3NOUC 2W27A 3A0VA 3RH8B 4CLCA 3GDIA 1MKMA 3LR4A 1YSQA 3K3DA 4HJ4A 4ETZA 3UB9A 1LL8A 2FZ0A 2PHYA 4NXBA 3CWFA 5F5YA 3OC2A 2LB9A 2OWJA 2KLIA 1IFQA 2W3GA 4CQHA 3UE3A 3MQOA 3K3CA 4DMZA 2D01A 3H82B 4HNBA 4WUJA 4CLCD 5TBMB 3CI6A 3PBQA 2J3TC 4MDZA 2GJ3A 2FH5A 3TE8A 2PYRA 3LYXA 3MJQA 4OOMA 3IS2A 1TS0A 2O0YA 4DN0A 2PYPA 2V9AA 1H3QA 1X0OA 3PR6A 5IT5A 5F68A 5HWTA 4FOFA 1TF1A 3VE3A 1N9NA 3PBNA 3VE4A 3KSGA 3E0YA 1OT6A 2H28A 1W63Q 4BBTA 2HJ9C 1DP9A 3O5YA 3UB8A 5DJUA 5HSQA 3CUEA 3MFXA 3B33A 4G3KA 3BWLA 2DMWA 3GECA 1OTDA 1XJ4A 1VHMA 4KUKA 3LIDA 5HWVA 3P01A 2JKRM 3MQQA 2O9AA 2P08A 1XJ6A 2ZMFA 3KSIA 1TD5A 4P6ZM 3P7NA 2R78A 3EGXC 3LI9A 5HWWA 3W2ZA 4PKYG 2L0WA 5HD5A 3DBAA 4WL9A 2PD8A 2M1CA 3T4SA 3CUEC 2JHEA 2V0UA 3KO6A 3PBTA 1OTBA 2O99A 3LR0A 3EQVA 3T4QA 3HJIA 1T1CA 4LRYC 3F1PA 4DJ3A 5HL6A 1F98A 5F6AA 3EGDC 2LB5A 4LRZE 4WN5A 4Y5FA 3FPWA 4GLQA 1YSPA 2K7SA 3C8CA 3PBSA 3MMHA 3ZQ5A 3S7QA 3F1OA 2L4RA 3VV4A 1S4SA 5HPFA 4HP9A 2VA0A 4MMNA 3U2AA 3JVUA 2VGLS 1STZA 1YKDA 1UWNX 4L0LA 4WEKA 4Y2FA 3D3OA 2A2LA 3NOTC 3CAXA 4I3IA 4HP4A 4H6JB 4H6JA 4B9OA 3S7OA 4E04A 1WA9A 2W1TB 2W1TA 1NWZA 4ARZA 2EA9A 5J3WA 4HHDA 3F1NB 1UWPX 4Q0JA 4IHQA 3LUQA 5I5LA 2QKPA 4HH2A 1P97A 5DFYA 3KYZA 4UEYA 1S67L 4L9GA 2OOLA 1OPXA 3LFVA 4EERA 2Y79A 4I38A 5AVFA 2OAP1 1G6OA 1T19A 4EEPA 3BY9A 1JNUA 4HIAA 1F5MA 4PHTA 4EETB 3T4JA 1ODVA 1W63M 2PDRA 2WKRA 1D7EA 1MC0A 4GHIB 1EW0A 5K5BA 5DF9A 4HOIA 4BBUA 3H82A 3BQ8A 5G4ZA 5TBMA 2D02A 4EXOA 3KX0X 1T1AA 2B02A 1P0ZA 1OTAA 3FG8A 4CLCC 1OJ5A 2ZOHA 3S7PA 2BASA 3LIFA 2JKRI 5J4EA 1N9LA 3E4OA 4BBVA 3A0SA 2XSSA 3OOVA 1OJGA 4MCWA 4I3AA 2NUTC 3EEAA 2WKPA 5C5KA 1TS7A 1VB6A 3B42A 1D06A 4WEJA 2PT7A 4ME4A 3SW1A 2M7UA 4R3AA 4UQIS 4WF0A 2JN7A 4EEUA 4NXGA 2VV8A 4L9FA 2ZOIA 4OOLA 3K2NA 1Y28A 3VOLA 2J80A 3UE6A 3LR5A 3C2WA 1T18A 1DRMA 1XFNA 2VGLM 3LIEA 2QHKA 1DP6A 3LIAA 1UGUA 1F9IA 5A8BA 2B18A 5HDCA 5DKKA 3ICYA 1S1ZA 3B47A 3HCYA 3FC7A 3C38A 4GS9B 3OBFA 5L8MA 1XJ3A 4R6LA 5CX7A 1S66L 1KOUA 1P9RA 4MN7A 4NKPA 2HJEA 5J7EA 3KSHA 3T50A 1OTIA 4HH3A 3EWKA 3LR3A 3RFBA 5DJTA 4O01A 4O8GA 3H7WB 3KYQA 2VZWA 4RQ9A 4XT2B 2OAQ1 4NXFA 2VV7A 2W1RA 3BQAA 3JVVA 4HI4A 3LI8A 4WELA 3MQ0A 2G7UA 3BJNA 1GSXA 4F3LB 5IS1A 3E4QA 4LLOB 2K2NA 3R7WB 3R7WA 1LSVA 4EU0A 1ZHHB 4I5SA 2P04A 5FL3A 2L1MA 3F1NA 2EWWA 3UMDA 4JGPA 2KDKA 3BY8A 2WKQA 4GJ4A 2QWSA 4EUVA 1YAXA 2IA2A 2PD7A 1T1BA 3OCLA 4B93A 5TJJA 4Q0IA 3EQUA 4G3VA 3UB6A 4Z1WA 3V67A 1BYWA 3PYPA 3MXQA 2Z6CA 5HPIA 4IUHA 2W3EA 4UQIM 1ZTUA 2W3DA 4GHIA 4K08A 2OWHA 4ETXA 3D72A 2QJ7A 3NJAA 3KSFA 4HQAA 4CLCE 4CLCB 1LSXA 3T4TA 1GSWA 4Y3IA 4HJ6A 4YWZA 2VX8A 4BJPA 3TW8A 4GCZA 4PAUA 2A24B 5MC7A 2A24A 3OCNA 2HGVA 2J3TD 2V1BA 2ZMVA 3MR0A 3CLOA 3NHQA 4II7A 4R70A 4HJ3A 4R38A 3PHYA 4YOFA 3T4OA 2XA7M 3UMEA 1XFQA 2M7VA 5IU1A 4IUKA 1NLZA 5HD3A 2ZBBA 2KX6A 3IS2B 3EOIA 1NLYA 3HJKA 4AFIA 1IOUA 4MN5A 4Q0HA 1LSWA 4QPRA 2EWVA 4HY8A 2CMNA 3T4LA 2QYBA 4G3WA 3T4KA 3ZYTA 1S4RA 2YKHA 2VEAA 3IBRA 5EFWA 5KIZA 2PR5A 2VV6A 2JKTI 2O9BA 4PKYA 4M4XA 2W3HA 5F69A 3H9WA 2I9VA 4EESA 5DFXA 3G6OA 2XA7S 3TJZC 2MJ6A 3EEHA 1OTEA 3C30A 2XROA 4GS9A 1OT9A 3LIBA 2PR6A 3OLOA 4I3JA 3S7NA 4JGQA 5AJGA 4DJ2A 3PBOA 4KQDA 4L9EA 4WLAA 2JKTM 2Z6DA 3PBRA 2GX5A 4FSFA 5KSHA 3R4KA 4KQOA 5AVEA 3E4PA 3E98A 5G4YA 2HV1A 1XJ2A 3H7WA 3IBJA 4LRXC 3F1PB 4XT2A 4EW7A 3RTYA 2YKFA 3BW6A 1TS6A 1V9YA 4JGRA 4YNRA 4EQ1A 2VJWA 3UB7A 4F3LA 2V0WA 1LT0A 4NEED 4NXEA 2VLGA 3F1OB 4O0PA 2GNXA 1DP8A 5HZHA 4BMWA 3LICA 4P6ZS 5HDSA 1N9OA 5HDDA 2HF6A 2O9CA 4MN6A 2J3WA 2QJ5A 1P9WA 1MZUA 2INWA 3NOPC 3MF0A 4KUOA 3CITA 4JGOA 3ULFA 3PXPA 2XRNA 3A0RA 2Y8HA 1GSVA 4IJGA 3TRCA 2VKSA 2NUPC 2GZAA 4BWIA 4GW9A 3FPVA 2P7JA 4LPZA 2K31A 1V9ZA 4ZRRA 4ARZB 1TS8A 1H8MA 2W0NA 1G28A 1S1YA 5DKLA 2V1AA 5LBRA 1NRJA 2W3FA 4I39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B18 A;  2KOI A;  4IUK A;  3NOU C;  1STZ A;  1YKD A;  4Y2F A;  3HCY A;  1MKM A;  4Q0H A;  1YSQ A;  3D3O A;  4QPR A;  3OBF A;  5L8M A;  2QYB A;  3NOT C;  4R6L A;  4ETZ A;  4G3W A;  4MN7 A;  3S7O A;  4E04 A;  2LB9 A;  2KLI A;  2W1T B;  2W3G A;  2W1T A;  4CQH A;  2VEA A;  3KSH A;  3IBR A;  4DMZ A;  3RFB A;  3CI6 A;  2O9B A;  4Q0J A;  4O01 A;  4O8G A;  2W3H A;  4MDZ A;  5I5L A;  2VZW A;  4RQ9 A;  5DFY A;  2W1R A;  2OOL A;  3LFV A;  3MQ0 A;  5DFX A;  3G6O A;  2O0Y A;  4DN0 A;  2G7U A;  2Y79 A;  3BJN A;  2XRO A;  4FOF A;  1TF1 A;  2K2N A;  3S7N A;  3KSG A;  1F5M A;  3E0Y A;  5AJG A;  3O5Y A;  4EU0 A;  5HSQ A;  1MC0 A;  4G3K A;  5K5B A;  2GX5 A;  3R4K A;  1VHM A;  3E98 A;  3IBJ A;  4LRX C;  4EUV A;  3S7P A;  2IA2 A;  2O9A A;  2ZMF A;  3KSI A;  1TD5 A;  5TJJ A;  4Q0I A;  4YNR A;  2VJW A;  2XSS A;  4G3V A;  3OOV A;  4MCW A;  4Z1W A;  3W2Z A;  4O0P A;  3EEA A;  5C5K A;  5HPI A;  3DBA A;  4IUH A;  2W3E A;  3KO6 A;  1ZTU A;  2W3D A;  2O9C A;  2O99 A;  4ETX A;  4ME4 A;  3NOP C;  3KSF A;  2M7U A;  3MF0 A;  3CIT A;  4LRY C;  2XRN A;  4Y3I A;  2Y8H A;  5HL6 A;  2LB5 A;  4IJG A;  4PAU A;  3K2N A;  3TRC A;  2VKS A;  4LRZ E;  4Y5F A;  4BWI A;  4GW9 A;  4GLQ A;  2HGV A;  1YSP A;  2K31 A;  3C2W A;  3MMH A;  3NHQ A;  4ZRR A;  3S7Q A;  3ZQ5 A;  4R70 A;  3VV4 A;  4YOF A;  5LBR A;  5HPF A;  2W3F A;  4MMN A;  2M7V A; 
#chains in the Genus database with same CATH topology
 2W27 A;  4CLC A;  4OPQ A;  2CC1 A;  4X55 A;  2BTF P;  5M1A A;  1YSQ A;  3C5A A;  1VM1 A;  1FQG A;  3ZG5 A;  4ETZ A;  3TSG A;  2FZ0 A;  4P0M A;  4RA7 A;  2LB9 A;  3MQO A;  3K3C A;  2ZM2 A;  4DMZ A;  3H82 B;  1SKO B;  4CLC D;  4GD6 A;  5TBM B;  3PBQ A;  5A92 A;  4N1H A;  1H5X A;  2FH5 A;  2PYR A;  2WGV A;  1XGJ A;  1E25 A;  3M2K A;  4DN0 A;  2PYP A;  3QHY A;  3W4Q A;  1TF1 A;  3IXD A;  3PBN A;  2H28 A;  1W63 Q;  2HJ9 C;  1PW1 A;  1DP9 A;  3UB8 A;  3MFX A;  3BWL A;  3ZCZ A;  5CRF A;  2ZC6 B;  5FI7 A;  3GEC A;  4Y0T A;  2ZJ9 A;  1VHM A;  4KUK A;  3LID A;  2AVX A;  3SH9 A;  3WS4 A;  3P01 A;  4OLD A;  3T1X A;  5AQ9 A;  4P6Z M;  3V39 A;  5HWW A;  3Q1F A;  4PKY G;  5HD5 A;  1M6K A;  4RYE A;  1BSG A;  2M1C A;  2PD8 A;  3T4S A;  2JHE A;  3KO6 A;  4E6X A;  3LR0 A;  2WGW A;  4OQI A;  2XFT A;  3DAV A;  4N92 A;  3NBL A;  5FQQ A;  4E3N A;  5DTK A;  4U3T A;  1F98 A;  4B4Z A;  3SS5 A;  4WN5 A;  1BUL A;  4GLQ A;  1FCN A;  1YSP A;  2K7S A;  3C8C A;  3PBS A;  3W8K A;  3BFE A;  3HLE A;  3T1Q B;  5CTM A;  2VGL S;  1YKD A;  4WEK A;  4R4R A;  3D3O A;  2XR0 A;  2A2L A;  2WYX A;  3HBR A;  5EM1 A;  5AQB A;  4HP4 A;  4OH0 A;  1FIL A;  1PI4 A;  1ZG4 A;  1MWT A;  3S7O A;  1WA9 A;  2W1T A;  4C3Q A;  1NWZ A;  4ARZ A;  3GVB A;  4HHD A;  1YLT A;  4Q0J A;  4IHQ A;  3LUQ A;  5I5L A;  1P97 A;  1S67 L;  5EOE A;  4OQH A;  2Y79 A;  4I38 A;  2ZC3 B;  5AVF A;  1PIO A;  3V5M A;  1T19 A;  4EEP A;  3N8R A;  2OLV A;  4PHT A;  2G2U A;  3T4J A;  4M3K A;  4GHI B;  1EW0 A;  5K5B A;  4HOI A;  3BQ8 A;  4DDY A;  2RL3 A;  4EXO A;  4UA6 A;  1U60 A;  3ITB A;  2B02 A;  3HLB A;  1OJ5 A;  2ZOH A;  2BAS A;  3LIF A;  1ERO A;  1N9L A;  4BBV A;  2GDN A;  3A0S A;  4B4X A;  5FQK A;  1OJG A;  3EEA A;  5C5K A;  1PNE A;  1TS7 A;  1ERM A;  1BZA A;  3ZG0 A;  2PT7 A;  4DF6 A;  4R3A A;  4JF6 A;  5GLC A;  4S2M A;  5DTT A;  3G35 A;  2Y2N A;  2ZOI A;  3FYZ A;  4LCM A;  4ID4 A;  3UE6 A;  3MKE A;  4O7D A;  3LO7 A;  2VGL M;  3LIE A;  1J3W A;  3M6H A;  2QHK A;  2J9P A;  3LIA A;  4X53 A;  3MBZ A;  3B47 A;  3NY4 A;  3FC7 A;  2R9W A;  1XJ3 A;  4OPY A;  4MN7 A;  1JTD A;  1HLU P;  1E4D A;  2V1Z A;  5J7E A;  1OTI A;  2EFU A;  1HVB A;  4DE0 A;  5DJT A;  4O01 A;  4KZ9 A;  3BQA A;  4HI4 A;  5CER A;  1K57 C;  5IS1 A;  3BRM A;  5FAO A;  3R7W B;  2XD5 A;  1ZHH B;  2UWX A;  4I5S A;  2Y59 A;  5FL3 A;  3NC8 A;  3F1N A;  3LGO A;  3CHW P;  3BFD A;  3PAG A;  1G6A A;  3UMD A;  4JGP A;  5FAQ A;  3BY8 A;  1EWZ A;  3IX3 A;  1T1B A;  4IED A;  1LLB A;  1KDW A;  3UB6 A;  4LV1 A;  2C5W B;  2Y2M A;  1NYM A;  1K38 A;  3UE1 A;  4D60 A;  2W3E A;  3VP2 A;  5CED A;  1ZTU A;  4GDN A;  1ALQ A;  5M19 A;  2OWH A;  4CLC E;  4CLC B;  5HAP A;  3M2J A;  1MPL A;  1VET A;  3TW8 A;  2FFY A;  5JYP A;  4GCZ A;  2A24 B;  5MC7 A;  2HZ5 A;  3NDE A;  3UY6 A;  2HGV A;  1KVM A;  3AGD A;  3NHQ A;  3P98 A;  4BD0 A;  4YOF A;  1CJF A;  1ES3 A;  3EOI A;  3E2K A;  4MBF A;  2Q9M A;  4MN5 A;  2HP9 A;  4E3K A;  2E8I A;  4G3W A;  3T4K A;  1MWR A;  4DKI A;  1LL9 A;  4PM9 A;  2PR5 A;  3MSH A;  5F69 A;  1K4E A;  2A3U A;  4R23 A;  2I9V A;  2XA7 S;  4MNR A;  2HDQ A;  3C30 A;  5AJG A;  1S6R A;  4DJ2 A;  1VEU B;  3A3E A;  3PBO A;  3UNW A;  3PBR A;  4GN2 A;  3C4O A;  3E4P A;  5G4Y A;  2HV1 A;  4KZ7 A;  2JE5 A;  4X1L A;  1FR6 A;  1CQA A;  4EUZ A;  2PU2 A;  1H8Z A;  4KZ4 A;  3VSL A;  5FDS A;  3UB7 A;  2HPB A;  4F3L A;  2V0W A;  4O0P A;  4BMW A;  5HDS A;  2O9C A;  4MN6 A;  3NOP C;  3ULF A;  2ZMA A;  3OPP A;  5A90 A;  3O87 A;  1L0D A;  3NI9 A;  1W5D A;  1K55 C;  3WRZ A;  3GR2 A;  3IXH A;  1ESU A;  4GW9 A;  3FPV A;  4OPZ A;  2P7J A;  4FTX A;  1V9Z A;  2J8Y A;  4ARZ B;  1H8M A;  2W0N A;  5DTS A;  2Y2P A;  3Q82 A;  1NRJ A;  3UDF A;  3D4F A;  2Y4A A;  3RH8 B;  3CPT A;  3WS5 A;  2XDM A;  5GHZ A;  2H5S A;  3K3D A;  3NIA A;  1XGI A;  3M6B A;  3UB9 A;  2PHY A;  4NXB A;  1HD8 A;  3CWF A;  5F5Y A;  3V3R A;  3OC2 A;  3VP1 A;  4HNB A;  4WZ4 A;  4WUJ A;  3CI6 A;  4MDZ A;  4UHU A;  1GA0 A;  3TE8 A;  5HAQ A;  3LYX A;  4OOM A;  3Q7V A;  3IS2 A;  2ZQ8 A;  1H3Q A;  4FUW A;  2ZLY A;  3UO9 A;  4DRT A;  5F68 A;  5HWT A;  3WRT A;  1OT6 A;  5FA7 A;  4BBT A;  5DJU A;  3CUE A;  2DMW A;  1OTD A;  1BT5 A;  3BM6 A;  1KVL A;  4DE3 A;  2JKR M;  3MQQ A;  2PRF A;  1PWG A;  1I2S A;  2O9A A;  2ZMF A;  1TD5 A;  1YMS A;  5CHU A;  2R78 A;  3LI9 A;  4ZJ1 A;  4R3B A;  3SH8 A;  1S0W A;  3FV7 A;  2O99 A;  3CMZ A;  5L09 A;  3T4Q A;  3HJI A;  3BLM A;  1PI5 A;  1K57 A;  3PTE A;  4S2N A;  4DJ3 A;  1NJ4 A;  3GRJ A;  3FPW A;  5DVA A;  1ES2 A;  3F1O A;  2L4R A;  2XQZ A;  5CEC A;  3HLF A;  5D3O A;  2Y2Q A;  3LEQ A;  1M40 A;  1XX2 A;  1GHP A;  4A5R A;  4GKU A;  5FDH A;  1GHI A;  3HL9 A;  3CAX A;  1VQQ A;  5CGX A;  4H6J B;  4B9O A;  3TG9 A;  5EEC A;  1LI0 A;  3MXR A;  2EA9 A;  3IH8 A;  4D2O A;  3F1N B;  2V8C A;  2QKP A;  3G2Y A;  1OPX A;  2BLS A;  1EI5 A;  2FFF B;  5EOO A;  5GHX A;  3RXX A;  5HAR A;  2OAP 1;  1G6O A;  5EVI C;  1Q2P A;  3BY9 A;  4S2P A;  4HIA A;  3ZNT A;  1ODV A;  2ZQA A;  2ZQ9 A;  2PDR A;  4PM7 A;  4OPR A;  4QB8 A;  1MC0 A;  2Q0O A;  3VMA A;  3QP5 A;  2BG1 A;  4ZJ3 A;  2D02 A;  4XUZ A;  1XXM A;  4E6W A;  1VET B;  1OTA A;  3O3V A;  2JKR I;  3HUO A;  3Q07 A;  3Q7Z A;  4UA9 A;  5FAS A;  2Y2H A;  4JXV A;  3S4X A;  2DNS A;  2NUT C;  1ES5 A;  3VSK A;  5EVL A;  4LV3 A;  3VP0 A;  3B42 A;  3VP4 A;  4WEJ A;  1PYY A;  1PZP A;  4UQI S;  4WF0 A;  2Y2I A;  1RP5 A;  4NXG A;  4OOL A;  3K2N A;  3L9K A;  2WKH A;  5A91 A;  1Y28 A;  4OP5 A;  3LR5 A;  3A3F A;  3C2W A;  1T18 A;  1XFN A;  3IF6 A;  1N9B A;  2EX6 A;  3KYE A;  2E8J A;  3HVF A;  5HDC A;  4HEF A;  3ICY A;  1S1Z A;  5FQJ A;  3HCY A;  4X56 A;  1WYB A;  2Y55 A;  3MFD A;  1IEM A;  5CX7 A;  4PM5 A;  1JVJ A;  3G31 A;  1ESI A;  3KSH A;  3QP2 A;  3T50 A;  2EX9 A;  4HH3 A;  3EWK A;  3LR3 A;  2Y91 A;  1Y4O A;  3JPU A;  4EBL A;  2OAQ 1;  4WEL A;  3MQ0 A;  1K55 A;  2G7U A;  3ZNY A;  3TOI A;  1Q2Q A;  4F3L B;  4MBH A;  1E3U A;  4NG2 A;  4EU0 A;  3T12 B;  1SHV A;  2P04 A;  3O86 A;  2HP5 A;  2ZM8 A;  2KDK A;  4JKT A;  1E3U D;  1YAX A;  1YLP A;  2PD7 A;  3OCL A;  4Q0I A;  1I5Q A;  4Z1W A;  1KDS A;  2X71 A;  4FH4 A;  4UQI M;  4LCL A;  3SH7 A;  4ETX A;  1SCW A;  3HLD A;  2Y2J A;  3ZFZ A;  4HQA A;  2J7V A;  3OPR A;  3CPT B;  1ONG A;  3ZVT A;  1GSW A;  4R0Q A;  3BYD A;  2V1B A;  2ZMV A;  1ZC2 A;  3CLO A;  1LI9 A;  4OP8 A;  4R38 A;  4RX2 A;  1XFQ A;  5IU1 A;  1MXO A;  3HLC A;  3Q7V B;  2KX6 A;  3IS2 B;  3HJK A;  4NET A;  5E2E A;  4AFI A;  1IOU A;  4HY8 A;  4KZ3 A;  2WUQ A;  3BEC A;  5M18 A;  4S2O A;  3LCE A;  1DY6 A;  1SKF A;  4PM8 A;  1ZKJ A;  2VV6 A;  3HRE A;  2JKT I;  4KZ5 A;  2J9O A;  2W3H A;  4BD1 A;  2HDR A;  2ZC4 B;  1RCJ A;  4DXB A;  5DFX A;  3TJZ C;  3EEH A;  1OTE A;  4GS9 A;  4OVD A;  4IVK A;  4S2J A;  1OT9 A;  1IKI A;  3S7N A;  5CEB A;  5L2F A;  5HAI A;  4KQD A;  1YT4 A;  4WZ5 C;  3NEC A;  3D9Y A;  3IF5 A;  4XT2 A;  3CJM A;  3RTY A;  3VOZ A;  2P9V A;  3BW6 A;  3G4P A;  3GQZ A;  4KZA A;  1TS6 A;  4KZ6 A;  5CGS A;  4JGR A;  4DXC A;  4EQ1 A;  4LGW A;  4E3O A;  5JYO A;  1PRQ A;  3W4O A;  4NXE A;  2VLG A;  3F1O B;  1QMF A;  3UN7 A;  1N9O A;  1ONH A;  1P9W A;  3MF0 A;  4KUO A;  2IWC A;  1J9M A;  3PXP A;  2DCF A;  2XRN A;  3HLW A;  3A0R A;  4EV4 A;  4IJG A;  3TRC A;  1XA1 A;  1XA7 A;  1L2S A;  1Z6F A;  3DTI A;  1BUE A;  2PBD P;  1DJC A;  2QMI A;  4F94 A;  5DKL A;  5LBR A;  2W3F A;  2KOI A;  5U47 A;  3NOU C;  5EVI D;  3A0V A;  4RX3 A;  4HJ4 A;  3DW0 A;  4X69 A;  1SZV A;  2QPN A;  3MZD A;  2OWJ A;  1IFQ A;  2W3G A;  4CQH A;  3UE3 A;  2X01 A;  4EQI A;  2WAF A;  2ZQ7 A;  2D01 A;  5GLD A;  3MKF A;  2XD1 A;  3DTM A;  2WKI A;  3MJQ A;  4E3L A;  4BL2 A;  2V9A A;  3N4I A;  2H0T A;  5IT5 A;  4Y0O A;  4HBU A;  4FOF A;  5EM0 A;  4BQM A;  3VE3 A;  3IX8 A;  3IWO A;  1L0G A;  3B33 A;  4G3K A;  4CPK A;  1H0M A;  1O7E A;  4R1G A;  1QME A;  1KGG A;  4ESP A;  1G68 A;  4K0W A;  1XJ4 A;  3IXB A;  4OLG A;  5HWV A;  5FQ9 A;  2XF3 A;  4MLL A;  4QU3 A;  3A3D A;  3P7N A;  3EGX C;  3C4P A;  1PWC A;  4WL9 A;  3IF6 B;  2VGK A;  2V0U A;  3PBT A;  3WS1 A;  2WGW B;  5FSR A;  1T1C A;  4LRY C;  3RXW A;  3F1P A;  5A93 A;  4ZJ2 A;  3EGD C;  2LB5 A;  1N4O A;  4Y0U A;  5EE8 A;  4LRZ E;  4Y5F A;  3JYI A;  2ZL1 A;  5HPF A;  4MMN A;  3U2A A;  3MXS A;  1CF0 A;  3JVU A;  4L0L A;  3VFF A;  1KE4 A;  5EV0 A;  4N1X A;  4KQQ A;  2W1T B;  5CXW A;  3U4L P;  3S1Y A;  3UPN A;  1UWP X;  5F83 A;  4L9G A;  2OOL A;  4ZTK A;  3LFV A;  4EER A;  4JXG A;  3OPL A;  4JF4 A;  5E2G A;  4FH2 A;  2Z2M B;  1G5U A;  1F5M A;  5E2F A;  1W63 M;  3ZVW A;  2WKR A;  4ZBE A;  1D7E A;  3UB5 P;  1K6S A;  1TVF A;  3IQA A;  1P0Z A;  1SDE A;  4KG2 A;  3FG8 A;  4OQ0 A;  3S7P A;  5F1F A;  3E4O A;  4WYY A;  2XSS A;  3OOV A;  4MCW A;  2ZQD A;  2WK0 A;  1VB6 A;  1WYC A;  4LEN A;  3VFH A;  1D06 A;  1PFL A;  3G34 A;  1PWD A;  5E2H A;  2M7U A;  5CHM A;  1FR1 A;  1L0E A;  2A49 A;  4EEU A;  4L9F A;  4X6T A;  3VOL A;  3LY4 A;  4Y13 A;  4X1M A;  2V2F F;  2ZM0 A;  2Y2L A;  4WZ5 A;  4E3J A;  4IBX A;  1F9I A;  5A8B A;  4P85 A;  2OSU A;  3NDG A;  5DKK A;  5TFQ A;  2XEP A;  3T1R A;  1CEG A;  4GS9 B;  5L8M A;  1S66 L;  1YMX A;  4MBK A;  1P9R A;  3N8L A;  2EXA A;  1JWZ A;  2WAE A;  1F2K A;  3E2L A;  3FZC A;  1W79 A;  1YLZ A;  3V50 A;  3RFB A;  4U0X A;  3ZG8 B;  5EVE A;  3KYQ A;  4XT2 B;  4NXF A;  2W1R A;  3JVV A;  3LI8 A;  4KG6 A;  4LV2 A;  3BJN A;  1NYY A;  4Y15 A;  1GSX A;  1PW8 A;  3UPP A;  2JCH A;  2HDU A;  3E4Q A;  3OPH A;  4YFM A;  3QP1 A;  3R7W A;  4E3M A;  4QY6 A;  4Y17 A;  3SOI A;  4XXR A;  2WGI A;  4JF5 A;  2XFS A;  2L1M A;  4U0T A;  2EWW A;  4Y7P A;  2XGN A;  2WKQ A;  2QWS A;  4NK3 A;  2VK3 A;  3T1S A;  1K25 A;  2DRW A;  4B93 A;  4GDB A;  3EQU A;  5FEG A;  2Q9N A;  3I7J A;  1BYW A;  3PYP A;  1FCM A;  2Z6C A;  2ZC5 B;  3MXQ A;  4IUH A;  5HPI A;  5HFO A;  2W3D A;  3SS3 A;  4K08 A;  1OME A;  3D72 A;  2QJ7 A;  3NJA A;  3KSF A;  1LSX A;  3T4T A;  3BFG A;  1HTZ A;  3P09 A;  4Y3I A;  3N8S A;  4HJ6 A;  4YWZ A;  2VX8 A;  4PAU A;  2A24 A;  1MWU A;  3OCN A;  1JTG A;  4B88 A;  5HX9 A;  5FAP A;  4II7 A;  4R70 A;  4HJ3 A;  3PHY A;  3QP4 A;  3A3I A;  2B95 A;  3UME A;  5TR7 A;  1TEM A;  1BTL A;  4IUK A;  5HD3 A;  2ZBB A;  4KZB A;  4K91 A;  2H0Y A;  4Q0H A;  2CMN A;  1KE0 A;  4KG5 A;  3MS6 A;  4QWO A;  3IBR A;  1YLY A;  4ZAM A;  4WM9 A;  4PKY A;  2IWB A;  1IYO A;  4M4X A;  5HW3 A;  1ZG6 A;  3H9W A;  2ACG A;  4EES A;  1I2W A;  1KE3 A;  1KGE A;  2MJ6 A;  4RVA A;  3G32 A;  2C6W B;  3WS0 A;  5FI6 A;  4I3J A;  4JGQ A;  1CI9 A;  1VEU A;  4L9E A;  4KZ8 A;  2JKT M;  1IYQ A;  2V8F A;  4FSF A;  3BLS A;  3R4K A;  3CG5 A;  2WAD A;  3E98 A;  3H7W A;  3IBJ A;  4LRX C;  3F1P B;  4EW7 A;  4C75 A;  3MZF A;  2YKF A;  3FKW A;  4FCF A;  4HES A;  1V9Y A;  1K56 A;  1ES4 A;  3ZGA B;  4NEE D;  5HZH A;  3C7U A;  2ZL1 B;  3LIC A;  1NXY A;  5HDD A;  2HF6 A;  5E43 A;  2QJ5 A;  1MZU A;  2INW A;  1L0F A;  4XUX A;  3CIT A;  4LV0 A;  4JGO A;  1YQS A;  1K56 D;  2Y8H A;  2VKS A;  3PAE A;  2NUP C;  2GZA A;  1HZO A;  1NZU A;  4IVI A;  1TS8 A;  1GCE A;  1GA9 A;  1TDG A;  1G28 A;  2WZX A;  5EPH A;  4DE1 A;  3NUL A;  2Z2L B;  3GV9 A;  3UDX A;  2VGJ A;  3GDI A;  1MKM A;  3LR4 A;  4E3I A;  1JWV A;  3GSG A;  1LL8 A;  2KLI A;  1CK3 A;  4BL3 A;  2XH9 A;  3DTK A;  5FEF A;  3WS2 A;  4JPM A;  4IBR A;  4QHC A;  2J3T C;  1K54 C;  2GJ3 A;  1YLJ A;  3IT9 A;  3Q81 A;  3W4P A;  4DE2 A;  4OOY A;  4EBP A;  3FKV A;  1TS0 A;  2O0Y A;  3PR6 A;  1X0O A;  1K6R A;  2XK1 A;  1N9N A;  2EX2 A;  4KEN B;  3V3S A;  3VE4 A;  3KSG A;  3E0Y A;  3O5Y A;  5HSQ A;  2PU4 A;  4PM6 A;  4UAA A;  1A0K A;  3G30 A;  4OQG A;  2JKF A;  3QP8 A;  1BLS A;  5F82 A;  4P87 A;  1FSW A;  2EXB A;  4EBN A;  2P08 A;  1XJ6 A;  3KSI A;  1IEL A;  1ACF A;  4DDS A;  3W2Z A;  2Y2G A;  2L0W A;  1FIK A;  1DJA A;  1Z09 A;  3CZD A;  3DBA A;  5AQ7 A;  3CUE C;  3AGE A;  1NZO A;  1OTB A;  2G2W A;  1AXB A;  4R3J A;  2UV0 E;  3EQV A;  1RGY A;  3QNC A;  5HL6 A;  5F6A A;  4BLM A;  5CGW A;  3IWI A;  1YPR A;  3MMH A;  3ZQ5 A;  2H10 A;  3S7Q A;  5G18 A;  2XLN A;  5GHY A;  3VV4 A;  1S4S A;  2OV5 A;  1XKZ A;  4HP9 A;  1Y54 A;  3N6I A;  2VA0 A;  3N7W A;  1IKG A;  1STZ A;  1BLP A;  1UWN X;  2IWD A;  4Y2F A;  2JC7 A;  3B3X A;  4S2N C;  1FOF A;  4OKP A;  2JBF A;  5F1G A;  5KSC A;  5EVI A;  1CI8 A;  2R9X A;  3NOT C;  4I3I A;  1BLC A;  4H6J A;  5L10 A;  3ZG7 B;  4E04 A;  5EUA A;  5J3W A;  2OLU A;  3AGF A;  4PPR A;  1RGZ A;  4HH2 A;  5DFY A;  3KYZ A;  4UEY A;  2ZD8 A;  3ZHH A;  4Q8I A;  5J8X A;  4LFU A;  1JNU A;  4EWF A;  4GD8 A;  4EET B;  5FQM A;  1C3B A;  3DWK A;  4X68 A;  4K0X A;  5DF9 A;  5FQI A;  4BBU A;  4JBF A;  3H82 A;  1SKO A;  1W8Q A;  5G4Z A;  5TBM A;  4WMC A;  3KX0 X;  1K0K A;  1T1A A;  2EX8 A;  1DJB A;  5L07 A;  4CLC C;  5J4E A;  1SDN A;  4BEN A;  3A3J A;  2WZZ A;  4I3A A;  3ZG9 B;  2WKP A;  3GMW A;  4GOG A;  4WMC D;  1PZO A;  5TGF A;  4ME4 A;  3SW1 A;  3QNB A;  1W7F A;  1BLH A;  2JN7 A;  3IHA A;  5KZH A;  1NRF A;  4OON A;  2VV8 A;  1L3L A;  1WE4 A;  3LY3 A;  2J80 A;  1K4F A;  1DRM A;  1DP6 A;  1UGU A;  2B18 A;  2PAV P;  1TDL A;  5CTN A;  2B5R A;  3C38 A;  3OBF A;  4R6L A;  1KOU A;  4NKP A;  2HJE A;  4R4S A;  4JXS A;  3BEB A;  5GLA A;  1KGF A;  1IYS A;  3LEZ A;  3IF6 C;  2V20 A;  4O8G A;  2EFX A;  3H7W B;  2ZQC A;  2VZW A;  4RQ9 A;  2VV7 A;  4GB7 A;  1LHY A;  3SZT A;  5KMW A;  4LLO B;  2K2N A;  3ZDJ A;  3DWZ A;  5DF8 A;  1LSV A;  1YM1 A;  4CJN A;  1AWI A;  2HP6 A;  1FSY A;  3C7V A;  1O07 A;  4GJ4 A;  4EUV A;  4QD4 A;  1XPB A;  2IA2 A;  3G2Z A;  5TJJ A;  3IWQ A;  4JXW A;  4G3V A;  4KQR A;  3V67 A;  1D1J A;  3IHB A;  4X25 A;  4JLF A;  4PMA A;  4HBT A;  4GHI A;  3IX4 A;  1K54 A;  3BFF A;  1MKI A;  3ITA A;  3HUN A;  4QY5 A;  3MZE A;  4BJP A;  2J3T D;  3MR0 A;  2Y2K A;  1H8Y A;  1IYP A;  3T4O A;  4MEZ A;  3RJU A;  2XA7 M;  1MBL A;  2M7V A;  4GNU A;  2PBY A;  1NLZ A;  3VOY A;  1NLY A;  2I72 A;  1LSW A;  3ISG A;  2EWV A;  4QPR A;  1NY0 A;  1XP4 A;  3T4L A;  2QYB A;  5AQA A;  3ZYT A;  1S4R A;  2YKH A;  2ZC7 A;  2VEA A;  5EFW A;  5KIZ A;  4N9K A;  4S2L A;  2O9B A;  5FI2 A;  1MWS A;  4S2I A;  5FAT A;  5DF7 A;  4C6Y A;  5CHJ A;  3DTE A;  4GZB A;  3G6O A;  2XRO A;  3LIB A;  2PR6 A;  2X02 A;  3OLO A;  4QJG A;  3IXG A;  4FD8 A;  3OZH A;  4P6B A;  1LL5 A;  3QP6 A;  4WLA A;  2Z6D A;  2P74 A;  2GX5 A;  2HDS A;  2WKE A;  5KSH A;  4KQO A;  5AVE A;  1XJ2 A;  3HUM A;  4WBG A;  1W8Y A;  4YIN A;  1GHM A;  3FWL A;  3L7H A;  2P9V B;  2RCX A;  4ZDX A;  5GL9 A;  4YNR A;  1MY8 A;  2VJW A;  4UA7 A;  1FCO A;  1LT0 A;  2GNX A;  1DP8 A;  5BOH A;  3NCK A;  4P6Z S;  3GTC A;  2J3W A;  3O88 A;  1YLW A;  2JKG A;  4S2K A;  3UDI A;  3UPO A;  3BFC A;  4N9L A;  2QZ6 A;  5I94 A;  1CEF A;  5GLB A;  5HL1 A;  1JWP A;  2Y2O A;  1GSV A;  5EVI B;  3IH9 A;  4H8R A;  3SS4 A;  3WWX A;  4BWI A;  4LPZ A;  2K31 A;  4Z9Q A;  4ZRR A;  3HLG A;  3S22 A;  1ERQ A;  3UE0 A;  1S1Y A;  3VP3 A;  2V1A A;  5IHV A;  4I39 A; 
#chains in the Genus database with same CATH homology
 2KOI A;  3NOU C;  2W27 A;  3A0V A;  3RH8 B;  4CLC A;  3GDI A;  1MKM A;  3LR4 A;  1YSQ A;  3K3D A;  4HJ4 A;  4ETZ A;  3UB9 A;  1LL8 A;  2FZ0 A;  2PHY A;  4NXB A;  3CWF A;  5F5Y A;  3OC2 A;  2LB9 A;  2OWJ A;  2KLI A;  1IFQ A;  2W3G A;  4CQH A;  3UE3 A;  3MQO A;  3K3C A;  4DMZ A;  2D01 A;  3H82 B;  4HNB A;  4WUJ A;  4CLC D;  5TBM B;  3CI6 A;  3PBQ A;  2J3T C;  4MDZ A;  2GJ3 A;  2FH5 A;  3TE8 A;  2PYR A;  3LYX A;  3MJQ A;  4OOM A;  3IS2 A;  1TS0 A;  2O0Y A;  4DN0 A;  2PYP A;  2V9A A;  1H3Q A;  1X0O A;  3PR6 A;  5IT5 A;  5F68 A;  5HWT A;  4FOF A;  1TF1 A;  3VE3 A;  1N9N A;  3PBN A;  3VE4 A;  3KSG A;  3E0Y A;  1OT6 A;  2H28 A;  1W63 Q;  4BBT A;  2HJ9 C;  1DP9 A;  3O5Y A;  3UB8 A;  5DJU A;  5HSQ A;  3CUE A;  3MFX A;  3B33 A;  4G3K A;  3BWL A;  2DMW A;  3GEC A;  1OTD A;  1XJ4 A;  1VHM A;  4KUK A;  3LID A;  5HWV A;  3P01 A;  2JKR M;  3MQQ A;  2O9A A;  2P08 A;  1XJ6 A;  2ZMF A;  3KSI A;  1TD5 A;  4P6Z M;  3P7N A;  2R78 A;  3EGX C;  3LI9 A;  5HWW A;  3W2Z A;  4PKY G;  2L0W A;  5HD5 A;  3DBA A;  4WL9 A;  2PD8 A;  2M1C A;  3T4S A;  3CUE C;  2JHE A;  2V0U A;  3KO6 A;  3PBT A;  1OTB A;  2O99 A;  3LR0 A;  3EQV A;  3T4Q A;  3HJI A;  1T1C A;  4LRY C;  3F1P A;  4DJ3 A;  5HL6 A;  1F98 A;  5F6A A;  3EGD C;  2LB5 A;  4LRZ E;  4WN5 A;  4Y5F A;  3FPW A;  4GLQ A;  1YSP A;  2K7S A;  3C8C A;  3PBS A;  3MMH A;  3ZQ5 A;  3S7Q A;  3F1O A;  2L4R A;  3VV4 A;  1S4S A;  5HPF A;  4HP9 A;  2VA0 A;  4MMN A;  3U2A A;  3JVU A;  2VGL S;  1STZ A;  1YKD A;  1UWN X;  4L0L A;  4WEK A;  4Y2F A;  3D3O A;  2A2L A;  3NOT C;  3CAX A;  4I3I A;  4HP4 A;  4H6J B;  4H6J A;  4B9O A;  3S7O A;  4E04 A;  1WA9 A;  2W1T B;  2W1T A;  1NWZ A;  4ARZ A;  2EA9 A;  5J3W A;  4HHD A;  3F1N B;  1UWP X;  4Q0J A;  4IHQ A;  3LUQ A;  5I5L A;  2QKP A;  4HH2 A;  1P97 A;  5DFY A;  3KYZ A;  4UEY A;  1S67 L;  4L9G A;  2OOL A;  1OPX A;  3LFV A;  4EER A;  2Y79 A;  4I38 A;  5AVF A;  2OAP 1;  1G6O A;  1T19 A;  4EEP A;  3BY9 A;  1JNU A;  4HIA A;  1F5M A;  4PHT A;  4EET B;  3T4J A;  1ODV A;  1W63 M;  2PDR A;  2WKR A;  1D7E A;  1MC0 A;  4GHI B;  1EW0 A;  5K5B A;  5DF9 A;  4HOI A;  4BBU A;  3H82 A;  3BQ8 A;  5G4Z A;  5TBM A;  2D02 A;  4EXO A;  3KX0 X;  1T1A A;  2B02 A;  1P0Z A;  1OTA A;  3FG8 A;  4CLC C;  1OJ5 A;  2ZOH A;  3S7P A;  2BAS A;  3LIF A;  2JKR I;  5J4E A;  1N9L A;  3E4O A;  4BBV A;  3A0S A;  2XSS A;  3OOV A;  1OJG A;  4MCW A;  4I3A A;  2NUT C;  3EEA A;  2WKP A;  5C5K A;  1TS7 A;  1VB6 A;  3B42 A;  1D06 A;  4WEJ A;  2PT7 A;  4ME4 A;  3SW1 A;  2M7U A;  4R3A A;  4UQI S;  4WF0 A;  2JN7 A;  4EEU A;  4NXG A;  2VV8 A;  4L9F A;  2ZOI A;  4OOL A;  3K2N A;  1Y28 A;  3VOL A;  2J80 A;  3UE6 A;  3LR5 A;  3C2W A;  1T18 A;  1DRM A;  1XFN A;  2VGL M;  3LIE A;  2QHK A;  1DP6 A;  3LIA A;  1UGU A;  1F9I A;  5A8B A;  2B18 A;  5HDC A;  5DKK A;  3ICY A;  1S1Z A;  3B47 A;  3HCY A;  3FC7 A;  3C38 A;  4GS9 B;  3OBF A;  5L8M A;  1XJ3 A;  4R6L A;  5CX7 A;  1S66 L;  1KOU A;  1P9R A;  4MN7 A;  4NKP A;  2HJE A;  5J7E A;  3KSH A;  3T50 A;  1OTI A;  4HH3 A;  3EWK A;  3LR3 A;  3RFB A;  5DJT A;  4O01 A;  4O8G A;  3H7W B;  3KYQ A;  2VZW A;  4RQ9 A;  4XT2 B;  2OAQ 1;  4NXF A;  2VV7 A;  2W1R A;  3BQA A;  3JVV A;  4HI4 A;  3LI8 A;  4WEL A;  3MQ0 A;  2G7U A;  3BJN A;  1GSX A;  4F3L B;  5IS1 A;  3E4Q A;  4LLO B;  2K2N A;  3R7W B;  3R7W A;  1LSV A;  4EU0 A;  1ZHH B;  4I5S A;  2P04 A;  5FL3 A;  2L1M A;  3F1N A;  2EWW A;  3UMD A;  4JGP A;  2KDK A;  3BY8 A;  2WKQ A;  4GJ4 A;  2QWS A;  4EUV A;  1YAX A;  2IA2 A;  2PD7 A;  1T1B A;  3OCL A;  4B93 A;  5TJJ A;  4Q0I A;  3EQU A;  4G3V A;  3UB6 A;  4Z1W A;  3V67 A;  1BYW A;  3PYP A;  3MXQ A;  2Z6C A;  5HPI A;  4IUH A;  2W3E A;  4UQI M;  1ZTU A;  2W3D A;  4GHI A;  4K08 A;  2OWH A;  4ETX A;  3D72 A;  2QJ7 A;  3NJA A;  3KSF A;  4HQA A;  4CLC E;  4CLC B;  1LSX A;  3T4T A;  1GSW A;  4Y3I A;  4HJ6 A;  4YWZ A;  2VX8 A;  4BJP A;  3TW8 A;  4GCZ A;  4PAU A;  2A24 B;  5MC7 A;  2A24 A;  3OCN A;  2HGV A;  2J3T D;  2V1B A;  2ZMV A;  3MR0 A;  3CLO A;  3NHQ A;  4II7 A;  4R70 A;  4HJ3 A;  4R38 A;  3PHY A;  4YOF A;  3T4O A;  2XA7 M;  3UME A;  1XFQ A;  2M7V A;  5IU1 A;  4IUK A;  1NLZ A;  5HD3 A;  2ZBB A;  2KX6 A;  3IS2 B;  3EOI A;  1NLY A;  3HJK A;  4AFI A;  1IOU A;  4MN5 A;  4Q0H A;  1LSW A;  4QPR A;  2EWV A;  4HY8 A;  2CMN A;  3T4L A;  2QYB A;  4G3W A;  3T4K A;  3ZYT A;  1S4R A;  2YKH A;  2VEA A;  3IBR A;  5EFW A;  5KIZ A;  2PR5 A;  2VV6 A;  2JKT I;  2O9B A;  4PKY A;  4M4X A;  2W3H A;  5F69 A;  3H9W A;  2I9V A;  4EES A;  5DFX A;  3G6O A;  2XA7 S;  3TJZ C;  2MJ6 A;  3EEH A;  1OTE A;  3C30 A;  2XRO A;  4GS9 A;  1OT9 A;  3LIB A;  2PR6 A;  3OLO A;  4I3J A;  3S7N A;  4JGQ A;  5AJG A;  4DJ2 A;  3PBO A;  4KQD A;  4L9E A;  4WLA A;  2JKT M;  2Z6D A;  3PBR A;  2GX5 A;  4FSF A;  5KSH A;  3R4K A;  4KQO A;  5AVE A;  3E4P A;  3E98 A;  5G4Y A;  2HV1 A;  1XJ2 A;  3H7W A;  3IBJ A;  4LRX C;  3F1P B;  4XT2 A;  4EW7 A;  3RTY A;  2YKF A;  3BW6 A;  1TS6 A;  1V9Y A;  4JGR A;  4YNR A;  4EQ1 A;  2VJW A;  3UB7 A;  4F3L A;  2V0W A;  1LT0 A;  4NEE D;  4NXE A;  2VLG A;  3F1O B;  4O0P A;  2GNX A;  1DP8 A;  5HZH A;  4BMW A;  3LIC A;  4P6Z S;  5HDS A;  1N9O A;  5HDD A;  2HF6 A;  2O9C A;  4MN6 A;  2J3W A;  2QJ5 A;  1P9W A;  1MZU A;  2INW A;  3NOP C;  3MF0 A;  4KUO A;  3CIT A;  4JGO A;  3ULF A;  3PXP A;  2XRN A;  3A0R A;  2Y8H A;  1GSV A;  4IJG A;  3TRC A;  2VKS A;  2NUP C;  2GZA A;  4BWI A;  4GW9 A;  3FPV A;  2P7J A;  4LPZ A;  2K31 A;  1V9Z A;  4ZRR A;  4ARZ B;  1TS8 A;  1H8M A;  2W0N A;  1G28 A;  1S1Y A;  5DKL A;  2V1A A;  5LBR A;  1NRJ A;  2W3F A;  4I39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...