3A0SA

Pas domain of histidine kinase thka (tm1359)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
METAIITLSKDGRITEWNKKAEQLFGLKKENVLGRRLKDLPDFEEIGSVAESVFENKEPVFLNFYKFGERYFNIRFSPFRNAKTQLLEGVIITIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 27
structure length 96
sequence length 96
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3a0sA00
3MFXA 3UMDA 4BBVA 3E4QA 1UWNX 3LI8A 2W0NA 4NXGA 5HDDA 3E4OA 4XT2A 3VE4A 3NOUC 2V0UA 1LSVA 3G6OA 2I9VA 2OWHA 3CWFA 1XJ6A 4XT2B 4LPZA 5F69A 2BASA 1XJ3A 4EERA 2OWJA 3ZQ5A 3LIBA 5KIZA 1F9IA 1D06A 5IS1A 1N9OA 2PR5A 5J3WA 4H6JA 4M4XA 1VB6A 1T18A 3KX0X 4I3AA 3CAXA 5DKKA 2PHYA 4JGPA 4H6JB 2VV8A 5AVEA 1GSXA 2QHKA 2PYPA 1TS6A 1OJGA 4PKYA 3BY9A 3IBRA 4LRXC 4HOIA 3LI9A 4EW7A 3H9WA 2H28A 3MJQA 1DRMA 1WA9A 4L9FA 1XJ2A 2PR6A 2D01A 2ZOIA 4HP9A 4JGOA 4YWZA 3E4PA 3RTYA 3UB8A 2D02A 4EEUA 5HD5A 4B9OA 4NXBA 5IU1A 2PD7A 2L4RA 1V9ZA 3ULFA 4I3IA 1D7EA 2L0WA 3HJIA 4R70A 2B02A 2L1MA 1NWZA 1TS7A 1UGUA 3F1OA 1ODVA 4DJ2A 1JNUA 1P0ZA 3EEHA 3BWLA 2GJ3A 2EA9A 4HQAA 3CLOA 2V1AA 2HV1A 2V0WA 4JGQA 3F1PA 1LL8A 5DJUA 4BBTA 1S67L 3F1PB 4WLAA 4KUKA 2V9AA 4I39A 4RQ9A 4BBUA 2P7JA 4WN5A 1V9YA 3LIEA 1LSWA 5HWTA 3ICYA 1TS8A 2VV7A 2W27A 1S1YA 3H82B 4GCZA 1OTIA 1DP6A 2PDRA 3LIFA 2INWA 4R3AA 2VLGA 3LYXA 4NXFA 1TS0A 3SW1A 1N9NA 3FC7A 3GECA 3FG8A 4GHIA 2YKFA 4PKYG 2CMNA 4HJ4A 4GHIB 5HDSA 4NXEA 1N9LA 3F1NA 2KX6A 3LIDA 3GDIA 3OLOA 5TBMB 1T19A 4HIAA 3F1NB 2ZOHA 4K08A 4EXOA 4EESA 2JHEA 3C8CA 3UB6A 4R6LA 1DP9A 5G4YA 5J7EA 4GW9A 3NOTC 4I38A 2VV6A 3MQQA 2V1BA 1GSVA 3VOLA 4I3JA 4HHDA 1S4RA 1OTEA 1P97A 2QWSA 2J80A 3K3CA 3PHYA 4HH2A 1XJ4A 4I5SA 4HNBA 5I5LA 2WKPA 4R38A 4DJ3A 5HWWA 4KQDA 5EFWA 1KOUA 4MN5A 2K7SA 4HJ6A 3T50A 3EWKA 1OTAA 3MR0A 4L9GA 4E04A 3LICA 2QJ5A 1MZUA 2ZBBA 4EETB 5HWVA 4KUOA 5HSQA 5HD3A 5DJTA 4WF0A 5F68A 1OJ5A 3C2WA 3LIAA 3VE3A 1OTBA 2WKRA 3MXQA 5F6AA 2VEAA 4HI4A 1F98A 3MQOA 3IS2B 1GSWA 4WL9A 4LRYC 3UE6A 3H82A 2WKQA 3A0VA 3K3DA 4HP4A 4HY8A 1OTDA 1S66L 2YKHA 4LRZE 1T1AA 1XFNA 1Y28A 1LSXA 4MN6A 4WUJA 2Z6CA 3HJKA 5DKLA 3D72A 1T1CA 3B33A 3NHQA 5J4EA 5TBMA 3NJAA 5F5YA 2OOLA 4L9EA 5A8BA 2KDKA 4EEPA 1OT9A 4LLOB 2R78A 3PYPA 4F3LA 3H7WA 1S4SA 3P7NA 2Z6DA 3NOPC 4JGRA 1S1ZA 3UMEA 4F3LB 3BY8A 5AVFA 2QJ7A 1XFQA 3H7WB 3RH8B 1T1BA 5G4ZA 1UWPX 4GS9A 1DP8A 3UB9A 2JN7A 3A0RA 4GS9B 1LT0A 2M1CA 5HDCA 3UB7A 5HZHA 1X0OA 4HH3A 3A0SA 4HJ3A 4EQ1A 2A24A 2QKPA 1EW0A 2PD8A 3IS2A 3LUQA 1BYWA 2PYRA 1OT6A 1G28A 2A24B 3F1OB
chains in the Genus database with same CATH superfamily
2XLNA 3KSHA 1PWDA 1IYPA 3UE3A 1WE4A 5FDHA 2GZAA 5E2HA 5A91A 1WYCA 3M6HA 5EVID 4QB8A 3S22A 3VE4A 4XT2A 2WGVA 4BMWA 4IVKA 5LBRA 4GD6A 3BLSA 3Q1FA 4KG6A 2OWHA 4EBPA 1KE4A 4LPZA 3WWXA 2XEPA 1IYSA 3C4PA 4JXWA 2BASA 3UE1A 3D3OA 3O86A 3L9KA 5DF9A 2W3DA 3LIBA 2Y59A 1XP4A 1VHMA 1F9IA 2WKHA 1K0KA 1D06A 4FCFA 5F82A 4RA7A 3OBFA 2PR5A 5HL6A 4LV2A 1YAXA 5FI2A 2A49A 1VB6A 1TVFA 3KX0X 4I3AA 2PHYA 4E3OA 2OV5A 5EECA 2WAEA 4DDSA 4Z1WA 1FILA 1Y4OA 1PWGA 2XA7S 2XFTA 1TS6A 1QMEA 2Z2LB 3DW0A 3IBRA 1XX2A 5EOOA 4LRXC 4HOIA 5DVAA 3LI9A 3IF6B 4PM7A 1L2SA 4JF6A 5HX9A 4L9FA 4QU3A 2PR6A 3K2NA 5HAIA 4YWZA 2ZQ9A 5FQ9A 3GRJA 1FCMA 2D02A 4EEUA 4P6BA 4KQRA 4B9OA 3S7QA 2HDQA 1OMEA 2PD7A 1RGZA 2G2WA 2DNSA 1Q2QA 5DTTA 1MPLA 4I3IA 1MKMA 3HJIA 4WZ5C 3IX3A 3RXWA 3LR4A 4KZ9A 4E3KA 1HZOA 3MBZA 1NWZA 1UGUA 3DTEA 5EVIA 1ODVA 1JNUA 2W3FA 3EEHA 2GJ3A 5FQJA 3CLOA 4LGWA 3EGXC 3VOYA 2MJ6A 5GLDA 1P9RA 2HV1A 4EQIA 2Y2QA 2V0WA 4Y0UA 1LL8A 3UPPA 1S67L 3MZEA 5HL1A 1M6KA 3F1PB 4KUKA 3SZTA 4KZBA 5CTNA 1K6RA 3ZVWA 2V9AA 3KYZA 1FCOA 1G6OA 1JVJA 1FIKA 1V9YA 1SCWA 5CERA 2ZC6B 2ZM8A 4CJNA 4KQQA 1TS8A 1NXYA 3IXHA 1DP6A 2EXBA 3HLWA 1RCJA 1VQQA 4OP5A 4X25A 2Y91A 4NXFA 1N9NA 3WS5A 1NZUA 3GECA 5CEDA 3WRZA 4JXSA 1ESUA 1KE3A 1ZG4A 4N92A 2YKFA 2EWWA 5FL3A 4GHIB 1ES4A 3IF6C 3VP4A 5TFQA 1HLUP 3NCKA 4WYYA 2PU2A 3LIDA 3C30A 3GDIA 3DTKA 1DY6A 4EXOA 1YMSA 4RVAA 4B93A 3UB6A 3DBAA 4OPZA 4C6YA 2J3TC 1XA1A 3ISGA 3BEBA 2Y2NA 5GLCA 3ZNYA 4HESA 3PHYA 4C3QA 2JKRM 3O88A 1SHVA 5E2GA 5CRFA 2VGKA 4HNBA 4KG5A 5HAPA 1YLPA 1GHPA 2C5WB 3L7HA 4MBHA 3I7JA 4PPRA 2K7SA 1YM1A 5L07A 4QPRA 4NG2A 3GVBA 1FSWA 4IJGA 5GHZA 4L9GA 4FH4A 3PBSA 5HSQA 4OONA 5DJTA 4X68A 3C2WA 3CMZA 1OTBA 3MXQA 5F6AA 4FOFA 1SDNA 4HI4A 2FFFB 1F98A 2ZL1B 4JKTA 4S2LA 4YFMA 3UE6A 3LY4A 3H82A 5FI7A 2ZQCA 4BLMA 5CECA 2J9OA 3K3DA 4JLFA 4B88A 3PBTA 4PM5A 2IWBA 4UA7A 1Y28A 2P9VA 3SS4A 4UA9A 4F94A 4R0QA 3G4PA 3D72A 1H8YA 5FEGA 1I2WA 3AGDA 4CLCE 2Y2PA 1T1CA 4R4RA 5J4EA 4S2OA 4RX2A 2QPNA 4PM6A 3G32A 2OOLA 4OQGA 4DE0A 2W1TA 4X69A 2HDSA 3DWZA 2EX9A 4X55A 3MXSA 4LLOB 2HP6A 5EPHA 4DE3A 3B47A 1H8ZA 4OVDA 3V3SA 1CI9A 4NEED 4Q8IA 1NYMA 4R23A 3A3DA 3OPHA 3IHBA 4JBFA 5EM0A 4BJPA 4X1MA 4Y17A 2WAFA 1T1BA 1GA9A 1UWPX 4ZTKA 4GS9A 3Q07A 1PI5A 4QY5A 3TJZC 3LR5A 4OLGA 1SKOB 2M1CA 2G2UA 1U60A 5DTSA 5L09A 3P09A 2A24A 3BFDA 4JPMA 3IS2A 3ITBA 1K54A 3T4OA 2ZC3B 5JYOA 1D1JA 2XQZA 3N8RA 4KZ7A 2ZJ9A 2ZLYA 2H0YA 3MFXA 3UMDA 1S6RA 4H8RA 1UWNX 1CI8A 1FSYA 1BULA 4CLCD 1QMFA 3RJUA 2DCFA 5FQKA 3BLMA 2P08A 3GQZA 1JWVA 3LI8A 4NXGA 4EWFA 3PR6A 2V0UA 3UY6A 2Q9NA 5FSRA 3G6OA 4IUHA 1XJ6A 2WK0A 3QHYA 1G5UA 5F69A 4DXCA 4LENA 2UWXA 1BLSA 1HD8A 1LI0A 2OWJA 4GNUA 4XUXA 3CUEA 1IKGA 3ZQ5A 2IWCA 2XF3A 2PT7A 3AGFA 2JKGA 3QP8A 2HZ5A 4P85A 1K6SA 1N9OA 5K5BA 3QP6A 5FQMA 3W4PA 1AXBA 3V50A 4R3JA 3WS4A 1HTZA 2ZC4B 1IYOA 3DWKA 3CAXA 2B18A 3MFDA 2B95A 4H6JB 4G3VA 2LB9A 2XSSA 3G35A 4BD0A 1GSXA 3C4OA 1KE0A 1BUEA 4PKYA 1TF1A 1K25A 2ZQDA 4DE1A 4EW7A 3H9WA 2Y2OA 2HJ9C 1MWRA 2H28A 3PAGA 4MEZA 1BLPA 2ZOIA 2VGLS 3RXXA 4R1GA 3QP5A 4QD4A 3VMAA 3FV7A 3CPTA 3CJMA 4E3LA 1K57A 2O9BA 1KGGA 1PFLA 5CGWA 4K0XA 2VX8A 4E6WA 2QYBA 3LO7A 1K55C 4ZJ2A 2PU4A 4UAAA 3ULFA 2GX5A 2Y2JA 1CJFA 1STZA 3HLFA 5FAOA 2L1MA 4Y3IA 5U47A 4S2PA 2Y8HA 2WYXA 2WGWB 1YLTA 3VP0A 3ZNTA 3WS0A 3CHWP 4LV3A 2Y79A 3OPRA 4QJGA 2XR0A 3P01A 4JGQA 1XPBA 2X02A 3QP1A 3BQAA 2X71A 5JYPA 1BLHA 4Q0IA 5DJUA 1ERMA 2XD5A 4BBTA 2ZM0A 3U2AA 3IF5A 3EQVA 4ARZA 4DF6A 4I39A 1TD5A 4RQ9A 4BBUA 1KDWA 4KZ3A 4PHTA 3LGOA 3LIEA 2VJWA 2ZMVA 5HWTA 3SH9A 4GDNA 3CG5A 4KZ8A 3UDXA 5I94A 1S1YA 1Z09A 3H82B 3ITAA 3UPNA 2PDRA 3C5AA 3LIFA 2INWA 3JYIA 4R3AA 5DTKA 4ZDXA 1GA0A 2J7VA 5E2FA 3MKEA 4NK3A 3FC7A 4S2JA 3FG8A 3BRMA 3HLBA 3G30A 1K4EA 4PKYG 1KDSA 1TDLA 4YNRA 3VFHA 2CMNA 2Y2KA 2OAP1 5HDSA 2W3EA 5GLAA 2P74A 4G3KA 1MC0A 3HUMA 4FSFA 4MN7A 4IVIA 1N9LA 3G31A 3F1NA 2KX6A 2HJEA 3OLOA 2HPBA 4Y0OA 5HW3A 4Q0HA 3E2KA 3E98A 1SKFA 4BL2A 4DRTA 4R6LA 1VEUB 3GMWA 5G4YA 4GW9A 2V1ZA 2JKFA 4HBUA 2VV6A 4K91A 4KG2A 1GSVA 3T4JA 3ZG7B 4HHDA 1S4RA 2H10A 1MXOA 3K3CA 4HH2A 2BG1A 3T12B 4Y5FA 4I5SA 2G7UA 2WKPA 4R38A 4DJ3A 5FEFA 3KO6A 3JVUA 3IWIA 1YLWA 5EFWA 4PMAA 5A90A 2LB5A 1FCNA 1G68A 5TJJA 4E04A 1L3LA 2QZ6A 4R4SA 1LLBA 4GB7A 5MC7A 1ZG6A 5HWVA 1I5QA 2OAQ1 4X56A 3N7WA 1XA7A 1H3QA 3LFVA 5F68A 3DTMA 3LEQA 1OJ5A 3HLEA 4M3KA 1KVLA 3LIAA 3G2ZA 3R7WA 2EWVA 4JF4A 3W8KA 4OOLA 4EUZA 2JKRI 3IS2B 2ZMFA 1GSWA 4WL9A 2EXAA 4GZBA 3PAEA 2X01A 3VP1A 2WKEA 3A0VA 3EQUA 5CHMA 5C5KA 2QMIA 4HP4A 4K0WA 3IXDA 5F1GA 1ZC2A 3T4KA 3M6BA 3NULA 2PAVP 4MN6A 3AGEA 4OH0A 4QY6A 2XFSA 4DN0A 3UNWA 1GHIA 3ZYTA 4ZAMA 2M7UA 3B33A 3TSGA 2XA7M 3G2YA 5TBMA 1CEFA 1Z6FA 2NUPC 2FH5A 4A5RA 2GDNA 1MBLA 4P6ZS 1PYYA 4CPKA 3S1YA 2HP9A 4JXGA 5AQ7A 4EEPA 3C38A 1IFQA 3V39A 4RYEA 3S7OA 4GDBA 3MZFA 2R78A 4ZJ1A 3GR2A 1VETB 3HREA 3IQAA 1EWZA 4E3IA 3ZG8B 1YT4A 4PM8A 3H7WA 3LCEA 3E2LA 3P7NA 3UMEA 1YSQA 4F3LB 2W3GA 2QJ7A 2ACGA 2O0YA 1ES3A 3SS5A 3IXBA 1MKIA 3T1SA 2WZXA 2DRWA 1DP8A 3PTEA 3CPTB 3UB9A 2K31A 3A3EA 4E3MA 4WZ5A 3HBRA 3HLCA 3A0RA 3ZGAB 1K38A 2XK1A 4QHCA 1PI4A 2NUTC 5EOEA 3A0SA 2QKPA 3Q7VB 5M18A 3UPOA 5HFOA 3LUQA 5FI6A 4CLCB 1CF0A 3WRTA 2Z2MB 2A2LA 2Y2LA 3W4OA 5FAPA 2Y4AA 2JKTM 4BBVA 3E4QA 1W5DA 4E3NA 2JC7A 5TR7A 3O87A 4S2NC 2W0NA 3VV4A 3E4OA 3NOUC 4P87A 3CI6A 1LSVA 4AFIA 4R3BA 3CWFA 5G18A 4XT2B 5DF7A 5HAQA 1NRFA 1XJ3A 3UE0A 3KYQA 2O99A 1MWTA 1L0EA 2PRFA 1W7FA 2ZM2A 5KIZA 3BM6A 3EGDC 2ZQAA 2J3WA 4LCLA 4OQIA 4O01A 3U4LP 5E2EA 5DKKA 4JGPA 3LR3A 3OPLA 4S2KA 5AVEA 5A93A 1NJ4A 3IF6A 3D9YA 4NETA 3Q7ZA 2IWDA 3OCNA 1PZOA 5FASA 4N1XA 4WEKA 4IUKA 3MJQA 3B3XA 1DRMA 4DMZA 1XJ2A 2D01A 4HP9A 4KQOA 4JGOA 4ETXA 4P0MA 1RP5A 3E4PA 1KGEA 3UB8A 1EI5A 3W2ZA 2VK3A 5HD5A 3MZDA 1EROA 5EUAA 4BENA 2ZMAA 2L4RA 1V9ZA 4MBKA 5CHJA 3VFFA 3V67A 4B4XA 2L0WA 3N8LA 3GTCA 2Y2IA 4O8GA 3NDGA 2W1RA 5A92A 3CZDA 3F1OA 2OLUA 4CLCC 4DJ2A 4XXRA 1FOFA 4LV1A 1PWCA 3JPUA 5EVIB 2EX2A 4GOGA 3FWLA 1O07A 2V1AA 3BJNA 3IH8A 3M2KA 3Q82A 5AQAA 3MF0A 3F1PA 1K4FA 3IWOA 4N1HA 4PAUA 4Y15A 5IHVA 2ZQ8A 1FR6A 3TW8A 1LL5A 4ZJ3A 2WGIA 3ZFZA 4WZ4A 2P7JA 1L0GA 2VGJA 1ONGA 1LL9A 4MMNA 3CITA 1DJCA 1LSWA 2JBFA 3ICYA 2VV7A 5GL9A 3RFBA 3BFEA 2M7VA 4GCZA 3N6IA 1ACFA 4GKUA 1I2SA 1XXMA 4CQHA 3G34A 3T4TA 3LYXA 1TS0A 3SW1A 3E0YA 1O7EA 1YKDA 2FFYA 4GHIA 4MCWA 1PNEA 3MMHA 3FPWA 3HUNA 4EBLA 4D60A 4OOMA 2EFUA 5M19A 4MNRA 4DKIA 1PZPA 1ZHHB 4Q0JA 1W79A 4IBXA 4X6TA 3HLDA 4UEYA 3DAVA 5TBMB 4RX3A 4OPQA 2V8CA 1T19A 4HIAA 2ZOHA 4K08A 3BW6A 1YPRA 1J9MA 1JTDA 2JHEA 4E6XA 1S0WA 3A3JA 1DP9A 5EVLA 5J7EA 3NOTC 3MQQA 4ID4A 1KVMA 4UA6A 2J80A 3IWQA 5CEBA 1NLZA 2JE5A 5J8XA 3KSFA 5L8MA 3UN7A 1PW8A 5I5LA 3WS2A 3MSHA 1NZOA 5EVIC 1RGYA 3IXGA 4MN5A 4N9KA 4BD1A 1PIOA 4FH2A 3EWKA 3WS1A 1OTAA 3LICA 2QJ5A 2ZBBA 3EEAA 4BL3A 1CQAA 5EV0A 1H8MA 4KUOA 5L10A 4WF0A 1PW1A 3VE3A 4Z9QA 2VEAA 2K2NA 3ZVTA 5AQ9A 3MQOA 1IKIA 3GV9A 5HARA 3UDIA 1ES5A 3T1RA 1JTGA 3V3RA 4LRYC 2GNXA 3HLGA 1L0DA 2W3HA 4OQHA 3HUOA 4HY8A 3VSKA 1F5MA 3LEZA 1ZTUA 2YKHA 4OKPA 4OOYA 5DFXA 2H0TA 1XFNA 1LSXA 1W8YA 4U0XA 3KSGA 3HCYA 2IA2A 2Z6CA 5FAQA 5DKLA 2P9VB 1Y54A 3IHAA 2OSUA 3NJAA 4ME4A 4EV4A 1FQGA 5A8BA 1ESIA 2J8YA 1PRQA 4MDZA 3S7PA 1BZAA 2W1TB 2VGLM 1SDEA 3QNCA 3MS6A 3MQ0A 2WUQA 1N4OA 5TGFA 4FTXA 2ZQ7A 3DTIA 3NIAA 3TE8A 1S4SA 5IT5A 4GJ4A 2Z6DA 3TRCA 3NOPC 1S1ZA 3BY8A 2XROA 4O0PA 5EM1A 1N9BA 5G4ZA 2WZZA 4KENB 1SKOA 3QP4A 1K55A 2Y55A 4WELA 2JN7A 2XD1A 4Y0TA 1XGJA 4GS9B 3HL9A 5HDCA 3UB7A 4HH3A 3OOVA 2O9CA 3N4IA 2PYRA 1G28A 2A24B 3F1OB 5GHXA 3V5MA 4DXBA 5AQBA 1FR1A 4HBTA 4ESPA 1NY0A 3IX8A 3PBRA 5DFYA 1LHYA 1MY8A 5CXWA 2OLVA 3KSIA 5CHUA 3T1XA 4GLQA 3M2JA 1F2KA 5HDDA 4MBFA 3NC8A 4WMCD 5GHYA 3HVFA 2I9VA 2EX8A 2HGVA 5L2FA 1GHMA 1MWSA 4NKPA 3T1QB 4EERA 1M40A 1LI9A 4N9LA 3MKFA 5FQQA 3OPPA 1H5XA 2HDRA 4ZRRA 2PBDP 3QP2A 5IS1A 1YSPA 2BTFP 4GD8A 3TOIA 1XKZA 1G6AA 5EVEA 2JKTI 1ALQA 2XRNA 5J3WA 4H6JA 2HP5A 1W63M 4M4XA 2H5SA 1T18A 5CTMA 4LFUA 5FATA 3FKVA 5GLBA 2VV8A 4EUVA 4YINA 2QHKA 2PYPA 1OJGA 4Y13A 2V20A 3BY9A 3UO9A 3GSGA 1K56D 3PXPA 3T4QA 2DMWA 3NI9A 1WA9A 4U0TA 3PBNA 3P98A 3RTYA 1E25A 1MWUA 4U3TA 2Y2GA 3N8SA 4OP8A 1E4DA 2VZWA 4KZ4A 4NXBA 3T4LA 5IU1A 1CK3A 3ZCZA 2XH9A 4BWIA 4O7DA 1AWIA 1YLZA 4S2MA 1D7EA 3O3VA 4WEJA 2J3TD 4R70A 2B02A 2BLSA 3FYZA 1JWZA 5E43A 2Q0OA 5HPFA 1TS7A 3BECA 1H0MA 2WGWA 4MLLA 5D3OA 1P0ZA 3NY4A 4IHQA 1W63Q 3BWLA 4WMCA 2EA9A 4QWOA 4HQAA 1K54C 1TDGA 3ZHHA 3VOZA 4KZAA 3FKWA 4JF5A 1ES2A 2V2FF 4L0LA 2Q9MA 3B42A 2WKIA 3O5YA 3KYEA 3VP2A 4WLAA 2R9WA 2EFXA 3EOIA 1NYYA 4IEDA 4ARZB 4WN5A 1IELA 1BSGA 2W27A 3SH8A 1BTLA 3C7VA 3CUEC 1OTIA 1VM1A 1NRJA 3QNBA 5FDSA 3PBOA 5CGXA 4E3JA 3OC2A 2VLGA 1NLYA 5FA7A 3VSLA 1K56A 3D4FA 5KSHA 1C3BA 1JWPA 4LCMA 4P6ZM 4II7A 1XGIA 3MXRA 4C75A 4HJ4A 2HDUA 3LR0A 3LY3A 4NXEA 3NBLA 2Y2MA 4Y7PA 2PBYA 3BFGA 3ZG9B 1E3UD 3F1NB 1VEUA 3IT9A 4EESA 2XGNA 5BOHA 2XDMA 1WYBA 3C8CA 3ZG0A 1ONHA 2E8JA 1DJAA 4I38A 2V1BA 5M1AA 3VOLA 4B4ZA 4I3JA 1KGFA 3FPVA 1K57C 3IH9A 1DJBA 2V8FA 1OTEA 1P97A 1OPXA 2QWSA 4UQIS 3A3IA 2RL3A 2J9PA 5AJGA 1IYQA 1YQSA 1W8QA 1GCEA 1XJ4A 2A3UA 2B5RA 5FQIA 4KZ5A 2KLIA 4FUWA 5HWWA 1BT5A 4KQDA 3S7NA 1KOUA 4HJ6A 4KZ6A 3SS3A 3T50A 3MR0A 2O9AA 4UHUA 1MZUA 4OQ0A 4EETB 5HD3A 4OLDA 2WKRA 4X53A 3FZCA 2UV0E 3R7WB 3TG9A 5CX7A 1CEGA 4XUZA 4EU0A 4S2NA 5EE8A 5KSCA 2WKQA 3IX4A 3SOIA 2EX6A 3T4SA 1ERQA 3ZG5A 1OTDA 2FZ0A 1S66L 4FD8A 4LRZE 1BLCA 1T1AA 4ZBEA 2I72A 3R4KA 4G3WA 1A0KA 3Q81A 4PM9A 2E8IA 5KMWA 1TEMA 3C7UA 1HVBA 4WUJA 1E3UA 4S2IA 3BFFA 3HJKA 2VA0A 2VKSA 2HF6A 1Q2PA 4DE2A 1YLYA 5KZHA 4DDYA 3NHQA 4LV0A 1IEMA 1J3WA 3OCLA 3NECA 5F5YA 3UB5P 1L0FA 1ZKJA 4L9EA 4Y2FA 2KDKA 2RCXA 3JVVA 3IBJA 4OPYA 1OT9A 3OZHA 2WADA 3A3FA 2CC1A 1SZVA 4BQMA 1VETA 5F1FA 5HPIA 3PYPA 4EBNA 4F3LA 4JXVA 4OPRA 3NDEA 2ZD8A 4JGRA 4UQIM 5F83A 5AVFA 1P9WA 1XFQA 3SH7A 3H7WB 3RH8B 3BFCA 5CGSA 3UDFA 3W4QA 2P04A 3BQ8A 4WBGA 1YLJA 4GN2A 3S4XA 2Y2HA 1LT0A 1IOUA 2ZC7A 1YMXA 3ZDJA 3Q7VA 3VP3A 5HZHA 2R9XA 1X0OA 4IBRA 4CLCA 2KOIA 2ZL1A 4HJ3A 4EQ1A 4HEFA 4WM9A 2ZC5B 1EW0A 2PD8A 3PBQA 2JCHA 1BYWA 4D2OA 4ETZA 1OT6A 3BYDA 4X1LA 2AVXA 2C6WB 4YOFA 5DF8A
chains in the Genus database with same CATH topology
3KSHA 3PBRA 3UE3A 2JKTM 3MFXA 3UMDA 5DFYA 4BBVA 3E4QA 2GZAA 1UWNX 3KSIA 4CLCD 4GLQA 2P08A 3LI8A 2W0NA 4NXGA 5HDDA 3E4OA 4XT2A 3VE4A 3VV4A 4BMWA 3PR6A 3NOUC 5LBRA 3CI6A 2V0UA 1LSVA 4AFIA 3G6OA 2I9VA 2OWHA 4IUHA 3CWFA 2HGVA 1XJ6A 4XT2B 4LPZA 5F69A 2BASA 3D3OA 4NKPA 1XJ3A 4EERA 3KYQA 5DF9A 2OWJA 2O99A 3CUEA 2W3DA 3ZQ5A 3LIBA 1VHMA 5KIZA 1F9IA 4ZRRA 2PT7A 3EGDC 1D06A 5IS1A 1YSPA 3OBFA 1N9OA 2PR5A 5HL6A 5K5BA 2J3WA 2JKTI 2XRNA 5J3WA 1YAXA 4H6JA 4O01A 1W63M 4M4XA 1VB6A 1T18A 3KX0X 4I3AA 3CAXA 2B18A 5DKKA 2PHYA 4JGPA 4Z1WA 3LR3A 4H6JB 4G3VA 2VV8A 4EUVA 2LB9A 2XSSA 5AVEA 2XA7S 1GSXA 2QHKA 2PYPA 1TS6A 1OJGA 4PKYA 3BY9A 3IBRA 3OCNA 1TF1A 4LRXC 4HOIA 3LI9A 4WEKA 4EW7A 3H9WA 2HJ9C 3PXPA 3T4QA 2DMWA 4IUKA 2H28A 3MJQA 1DRMA 1WA9A 4L9FA 4DMZA 1XJ2A 2PR6A 3K2NA 2D01A 2ZOIA 4HP9A 4KQOA 2VGLS 4JGOA 4ETXA 4YWZA 3PBNA 3E4PA 3RTYA 3UB8A 3W2ZA 2D02A 2VZWA 4EEUA 5HD5A 2O9BA 4B9OA 3S7QA 4NXBA 3T4LA 5IU1A 2PD7A 2VX8A 2L4RA 2QYBA 1V9ZA 4BWIA 3ULFA 2GX5A 4I3IA 3V67A 1D7EA 1MKMA 2L0WA 3HJIA 1STZA 4WEJA 2J3TD 3LR4A 4R70A 2B02A 4O8GA 2L1MA 2W1RA 5HPFA 1NWZA 1TS7A 1UGUA 4Y3IA 3F1OA 1ODVA 4CLCC 4DJ2A 2Y8HA 1JNUA 1P0ZA 2W3FA 3EEHA 4IHQA 1W63Q 3BWLA 2GJ3A 2EA9A 4HQAA 3CLOA 3EGXC 2V1AA 2MJ6A 3BJNA 1P9RA 2HV1A 2Y79A 3MF0A 3P01A 2V0WA 4JGQA 3BQAA 3F1PA 4PAUA 1LL8A 4Q0IA 5DJUA 4BBTA 4L0LA 1S67L 3U2AA 3B42A 3TW8A 3O5YA 3F1PB 4WLAA 3EQVA 4KUKA 4ARZA 2V9AA 3KYZA 3EOIA 1TD5A 4I39A 1G6OA 4RQ9A 4BBUA 2P7JA 4ARZB 4WN5A 4PHTA 1V9YA 3LIEA 2VJWA 4MMNA 3CITA 1LSWA 2ZMVA 3ICYA 5HWTA 1TS8A 2VV7A 2W27A 3RFBA 3CUEC 1S1YA 3H82B 2M7VA 4GCZA 1OTIA 1NRJA 1DP6A 2PDRA 3PBOA 3LIFA 2INWA 4R3AA 4CQHA 3OC2A 2VLGA 1NLYA 3T4TA 3LYXA 4NXFA 1TS0A 3SW1A 1N9NA 3E0YA 1YKDA 3FC7A 3GECA 3FG8A 4GHIA 5KSHA 4MCWA 3MMHA 3FPWA 2YKFA 2EWWA 4PKYG 4YNRA 4P6ZM 4II7A 2CMNA 2OAP1 4OOMA 4HJ4A 5FL3A 4GHIB 5HDSA 3LR0A 2W3EA 4G3KA 1MC0A 4NXEA 4FSFA 4MN7A 1ZHHB 1N9LA 4Q0JA 3F1NA 2KX6A 3LIDA 2HJEA 3C30A 3GDIA 3OLOA 4UEYA 5TBMB 1T19A 4HIAA 4Q0HA 3F1NB 2ZOHA 3E98A 4K08A 4EXOA 3BW6A 4EESA 4B93A 2JHEA 3C8CA 3UB6A 3DBAA 4R6LA 1DP9A 2J3TC 5G4YA 5J7EA 4GW9A 3NOTC 4I38A 2VV6A 3MQQA 2V1BA 1GSVA 3T4JA 3VOLA 4I3JA 3FPVA 4HHDA 1S4RA 1OTEA 1P97A 1OPXA 2QWSA 2J80A 3K3CA 4UQIS 1NLZA 3PHYA 4HH2A 5AJGA 2JKRM 3KSFA 5L8MA 1XJ4A 4Y5FA 4I5SA 4HNBA 2G7UA 2KLIA 5I5LA 2WKPA 4R38A 4DJ3A 3KO6A 5HWWA 3JVUA 4KQDA 5EFWA 3S7NA 1KOUA 4MN5A 2K7SA 4HJ6A 2LB5A 4QPRA 5TJJA 3T50A 3EWKA 4IJGA 1OTAA 3MR0A 4L9GA 4E04A 3LICA 2QJ5A 2O9AA 1MZUA 2ZBBA 3EEAA 5MC7A 4EETB 1H8MA 4KUOA 5HWVA 3PBSA 2OAQ1 5HSQA 5HD3A 5DJTA 1H3QA 3LFVA 4WF0A 5F68A 1OJ5A 3C2WA 3LIAA 3VE3A 1OTBA 2WKRA 3MXQA 5F6AA 4FOFA 2VEAA 2K2NA 3R7WA 4HI4A 2EWVA 1F98A 3MQOA 4OOLA 2JKRI 3IS2B 3R7WB 2ZMFA 1GSWA 4WL9A 4LRYC 3UE6A 2GNXA 5CX7A 3H82A 4EU0A 2WKQA 3A0VA 3EQUA 2W3HA 3T4SA 5C5KA 3K3DA 4HP4A 4HY8A 1OTDA 2FZ0A 3T4KA 1F5MA 1S66L 1ZTUA 3PBTA 2YKHA 4LRZE 1T1AA 3R4KA 4G3WA 5DFXA 1XFNA 1Y28A 1LSXA 4MN6A 3KSGA 3HCYA 2IA2A 4WUJA 2Z6CA 3HJKA 2VA0A 2VKSA 3D72A 5DKLA 2HF6A 4DN0A 4CLCE 3ZYTA 1T1CA 2M7UA 3B33A 3NHQA 2XA7M 5J4EA 5TBMA 3NJAA 3OCLA 2NUPC 5F5YA 2FH5A 4ME4A 4P6ZS 2OOLA 4L9EA 5A8BA 4Y2FA 2W1TA 2KDKA 4MDZA 3S7PA 3JVVA 3IBJA 4EEPA 2W1TB 1OT9A 3C38A 4LLOB 1IFQA 3B47A 2VGLM 4NEED 3S7OA 3MQ0A 5HPIA 2R78A 3PYPA 4F3LA 3H7WA 3TE8A 4BJPA 1S4SA 3P7NA 5IT5A 4GJ4A 2Z6DA 3TRCA 3NOPC 4JGRA 1S1ZA 3UMEA 4UQIM 1YSQA 4F3LB 3BY8A 5AVFA 2XROA 1P9WA 2W3GA 2QJ7A 1XFQA 4O0PA 3H7WB 2O0YA 3RH8B 1T1BA 5G4ZA 1UWPX 4GS9A 1DP8A 2P04A 3BQ8A 3UB9A 4WELA 2JN7A 3TJZC 2K31A 3LR5A 3A0RA 4GS9B 1LT0A 2M1CA 5HDCA 3UB7A 1IOUA 5HZHA 1X0OA 2NUTC 4HH3A 3A0SA 4CLCA 2KOIA 4HJ3A 4EQ1A 3OOVA 2A24A 2O9CA 2QKPA 1EW0A 2PD8A 3PBQA 3IS2A 3LUQA 1BYWA 2PYRA 4ETZA 4CLCB 1OT6A 2A2LA 1G28A 3T4OA 2A24B 3F1OB 4YOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MFX A;  3UMD A;  4BBV A;  3E4Q A;  1UWN X;  3LI8 A;  2W0N A;  4NXG A;  5HDD A;  3E4O A;  4XT2 A;  3VE4 A;  3NOU C;  2V0U A;  1LSV A;  3G6O A;  2I9V A;  2OWH A;  3CWF A;  1XJ6 A;  4XT2 B;  4LPZ A;  5F69 A;  2BAS A;  1XJ3 A;  4EER A;  2OWJ A;  3ZQ5 A;  3LIB A;  5KIZ A;  1F9I A;  1D06 A;  5IS1 A;  1N9O A;  2PR5 A;  5J3W A;  4H6J A;  4M4X A;  1VB6 A;  1T18 A;  3KX0 X;  4I3A A;  3CAX A;  5DKK A;  2PHY A;  4JGP A;  4H6J B;  2VV8 A;  5AVE A;  1GSX A;  2QHK A;  2PYP A;  1TS6 A;  1OJG A;  4PKY A;  3BY9 A;  3IBR A;  4LRX C;  4HOI A;  3LI9 A;  4EW7 A;  3H9W A;  2H28 A;  3MJQ A;  1DRM A;  1WA9 A;  4L9F A;  1XJ2 A;  2PR6 A;  2D01 A;  2ZOI A;  4HP9 A;  4JGO A;  4YWZ A;  3E4P A;  3RTY A;  3UB8 A;  2D02 A;  4EEU A;  5HD5 A;  4B9O A;  4NXB A;  5IU1 A;  2PD7 A;  2L4R A;  1V9Z A;  3ULF A;  4I3I A;  1D7E A;  2L0W A;  3HJI A;  4R70 A;  2B02 A;  2L1M A;  1NWZ A;  1TS7 A;  1UGU A;  3F1O A;  1ODV A;  4DJ2 A;  1JNU A;  1P0Z A;  3EEH A;  3BWL A;  2GJ3 A;  2EA9 A;  4HQA A;  3CLO A;  2V1A A;  2HV1 A;  2V0W A;  4JGQ A;  3F1P A;  1LL8 A;  5DJU A;  4BBT A;  1S67 L;  3F1P B;  4WLA A;  4KUK A;  2V9A A;  4I39 A;  4RQ9 A;  4BBU A;  2P7J A;  4WN5 A;  1V9Y A;  3LIE A;  1LSW A;  5HWT A;  3ICY A;  1TS8 A;  2VV7 A;  2W27 A;  1S1Y A;  3H82 B;  4GCZ A;  1OTI A;  1DP6 A;  2PDR A;  3LIF A;  2INW A;  4R3A A;  2VLG A;  3LYX A;  4NXF A;  1TS0 A;  3SW1 A;  1N9N A;  3FC7 A;  3GEC A;  3FG8 A;  4GHI A;  2YKF A;  4PKY G;  2CMN A;  4HJ4 A;  4GHI B;  5HDS A;  4NXE A;  1N9L A;  3F1N A;  2KX6 A;  3LID A;  3GDI A;  3OLO A;  5TBM B;  1T19 A;  4HIA A;  3F1N B;  2ZOH A;  4K08 A;  4EXO A;  4EES A;  2JHE A;  3C8C A;  3UB6 A;  4R6L A;  1DP9 A;  5G4Y A;  5J7E A;  4GW9 A;  3NOT C;  4I38 A;  2VV6 A;  3MQQ A;  2V1B A;  1GSV A;  3VOL A;  4I3J A;  4HHD A;  1S4R A;  1OTE A;  1P97 A;  2QWS A;  2J80 A;  3K3C A;  3PHY A;  4HH2 A;  1XJ4 A;  4I5S A;  4HNB A;  5I5L A;  2WKP A;  4R38 A;  4DJ3 A;  5HWW A;  4KQD A;  5EFW A;  1KOU A;  4MN5 A;  2K7S A;  4HJ6 A;  3T50 A;  3EWK A;  1OTA A;  3MR0 A;  4L9G A;  4E04 A;  3LIC A;  2QJ5 A;  1MZU A;  2ZBB A;  4EET B;  5HWV A;  4KUO A;  5HSQ A;  5HD3 A;  5DJT A;  4WF0 A;  5F68 A;  1OJ5 A;  3C2W A;  3LIA A;  3VE3 A;  1OTB A;  2WKR A;  3MXQ A;  5F6A A;  2VEA A;  4HI4 A;  1F98 A;  3MQO A;  3IS2 B;  1GSW A;  4WL9 A;  4LRY C;  3UE6 A;  3H82 A;  2WKQ A;  3A0V A;  3K3D A;  4HP4 A;  4HY8 A;  1OTD A;  1S66 L;  2YKH A;  4LRZ E;  1T1A A;  1XFN A;  1Y28 A;  1LSX A;  4MN6 A;  4WUJ A;  2Z6C A;  3HJK A;  5DKL A;  3D72 A;  1T1C A;  3B33 A;  3NHQ A;  5J4E A;  5TBM A;  3NJA A;  5F5Y A;  2OOL A;  4L9E A;  5A8B A;  2KDK A;  4EEP A;  1OT9 A;  4LLO B;  2R78 A;  3PYP A;  4F3L A;  3H7W A;  1S4S A;  3P7N A;  2Z6D A;  3NOP C;  4JGR A;  1S1Z A;  3UME A;  4F3L B;  3BY8 A;  5AVF A;  2QJ7 A;  1XFQ A;  3H7W B;  3RH8 B;  1T1B A;  5G4Z A;  1UWP X;  4GS9 A;  1DP8 A;  3UB9 A;  2JN7 A;  3A0R A;  4GS9 B;  1LT0 A;  2M1C A;  5HDC A;  3UB7 A;  5HZH A;  1X0O A;  4HH3 A;  3A0S A;  4HJ3 A;  4EQ1 A;  2A24 A;  2QKP A;  1EW0 A;  2PD8 A;  3IS2 A;  3LUQ A;  1BYW A;  2PYR A;  1OT6 A;  1G28 A;  2A24 B;  3F1O B; 
#chains in the Genus database with same CATH topology
 2XLN A;  3KSH A;  1PWD A;  1IYP A;  3UE3 A;  1WE4 A;  5FDH A;  2GZA A;  5E2H A;  5A91 A;  1WYC A;  3M6H A;  5EVI D;  4QB8 A;  3S22 A;  3VE4 A;  4XT2 A;  2WGV A;  4BMW A;  4IVK A;  5LBR A;  4GD6 A;  3BLS A;  3Q1F A;  4KG6 A;  2OWH A;  4EBP A;  1KE4 A;  4LPZ A;  3WWX A;  2XEP A;  1IYS A;  3C4P A;  4JXW A;  2BAS A;  3UE1 A;  3D3O A;  3O86 A;  3L9K A;  5DF9 A;  2W3D A;  3LIB A;  2Y59 A;  1XP4 A;  1VHM A;  1F9I A;  2WKH A;  1K0K A;  1D06 A;  4FCF A;  5F82 A;  4RA7 A;  3OBF A;  2PR5 A;  5HL6 A;  4LV2 A;  1YAX A;  5FI2 A;  2A49 A;  1VB6 A;  1TVF A;  3KX0 X;  4I3A A;  2PHY A;  4E3O A;  2OV5 A;  5EEC A;  2WAE A;  4DDS A;  4Z1W A;  1FIL A;  1Y4O A;  1PWG A;  2XA7 S;  2XFT A;  1TS6 A;  1QME A;  2Z2L B;  3DW0 A;  3IBR A;  1XX2 A;  5EOO A;  4LRX C;  4HOI A;  5DVA A;  3LI9 A;  3IF6 B;  4PM7 A;  1L2S A;  4JF6 A;  5HX9 A;  4L9F A;  4QU3 A;  2PR6 A;  3K2N A;  5HAI A;  4YWZ A;  2ZQ9 A;  5FQ9 A;  3GRJ A;  1FCM A;  2D02 A;  4EEU A;  4P6B A;  4KQR A;  4B9O A;  3S7Q A;  2HDQ A;  1OME A;  2PD7 A;  1RGZ A;  2G2W A;  2DNS A;  1Q2Q A;  5DTT A;  1MPL A;  4I3I A;  1MKM A;  3HJI A;  4WZ5 C;  3IX3 A;  3RXW A;  3LR4 A;  4KZ9 A;  4E3K A;  1HZO A;  3MBZ A;  1NWZ A;  1UGU A;  3DTE A;  5EVI A;  1ODV A;  1JNU A;  2W3F A;  3EEH A;  2GJ3 A;  5FQJ A;  3CLO A;  4LGW A;  3EGX C;  3VOY A;  2MJ6 A;  5GLD A;  1P9R A;  2HV1 A;  4EQI A;  2Y2Q A;  2V0W A;  4Y0U A;  1LL8 A;  3UPP A;  1S67 L;  3MZE A;  5HL1 A;  1M6K A;  3F1P B;  4KUK A;  3SZT A;  4KZB A;  5CTN A;  1K6R A;  3ZVW A;  2V9A A;  3KYZ A;  1FCO A;  1G6O A;  1JVJ A;  1FIK A;  1V9Y A;  1SCW A;  5CER A;  2ZC6 B;  2ZM8 A;  4CJN A;  4KQQ A;  1TS8 A;  1NXY A;  3IXH A;  1DP6 A;  2EXB A;  3HLW A;  1RCJ A;  1VQQ A;  4OP5 A;  4X25 A;  2Y91 A;  4NXF A;  1N9N A;  3WS5 A;  1NZU A;  3GEC A;  5CED A;  3WRZ A;  4JXS A;  1ESU A;  1KE3 A;  1ZG4 A;  4N92 A;  2YKF A;  2EWW A;  5FL3 A;  4GHI B;  1ES4 A;  3IF6 C;  3VP4 A;  5TFQ A;  1HLU P;  3NCK A;  4WYY A;  2PU2 A;  3LID A;  3C30 A;  3GDI A;  3DTK A;  1DY6 A;  4EXO A;  1YMS A;  4RVA A;  4B93 A;  3UB6 A;  3DBA A;  4OPZ A;  4C6Y A;  2J3T C;  1XA1 A;  3ISG A;  3BEB A;  2Y2N A;  5GLC A;  3ZNY A;  4HES A;  3PHY A;  4C3Q A;  2JKR M;  3O88 A;  1SHV A;  5E2G A;  5CRF A;  2VGK A;  4HNB A;  4KG5 A;  5HAP A;  1YLP A;  1GHP A;  2C5W B;  3L7H A;  4MBH A;  3I7J A;  4PPR A;  2K7S A;  1YM1 A;  5L07 A;  4QPR A;  4NG2 A;  3GVB A;  1FSW A;  4IJG A;  5GHZ A;  4L9G A;  4FH4 A;  3PBS A;  5HSQ A;  4OON A;  5DJT A;  4X68 A;  3C2W A;  3CMZ A;  1OTB A;  3MXQ A;  5F6A A;  4FOF A;  1SDN A;  4HI4 A;  2FFF B;  1F98 A;  2ZL1 B;  4JKT A;  4S2L A;  4YFM A;  3UE6 A;  3LY4 A;  3H82 A;  5FI7 A;  2ZQC A;  4BLM A;  5CEC A;  2J9O A;  3K3D A;  4JLF A;  4B88 A;  3PBT A;  4PM5 A;  2IWB A;  4UA7 A;  1Y28 A;  2P9V A;  3SS4 A;  4UA9 A;  4F94 A;  4R0Q A;  3G4P A;  3D72 A;  1H8Y A;  5FEG A;  1I2W A;  3AGD A;  4CLC E;  2Y2P A;  1T1C A;  4R4R A;  5J4E A;  4S2O A;  4RX2 A;  2QPN A;  4PM6 A;  3G32 A;  2OOL A;  4OQG A;  4DE0 A;  2W1T A;  4X69 A;  2HDS A;  3DWZ A;  2EX9 A;  4X55 A;  3MXS A;  4LLO B;  2HP6 A;  5EPH A;  4DE3 A;  3B47 A;  1H8Z A;  4OVD A;  3V3S A;  1CI9 A;  4NEE D;  4Q8I A;  1NYM A;  4R23 A;  3A3D A;  3OPH A;  3IHB A;  4JBF A;  5EM0 A;  4BJP A;  4X1M A;  4Y17 A;  2WAF A;  1T1B A;  1GA9 A;  1UWP X;  4ZTK A;  4GS9 A;  3Q07 A;  1PI5 A;  4QY5 A;  3TJZ C;  3LR5 A;  4OLG A;  1SKO B;  2M1C A;  2G2U A;  1U60 A;  5DTS A;  5L09 A;  3P09 A;  2A24 A;  3BFD A;  4JPM A;  3IS2 A;  3ITB A;  1K54 A;  3T4O A;  2ZC3 B;  5JYO A;  1D1J A;  2XQZ A;  3N8R A;  4KZ7 A;  2ZJ9 A;  2ZLY A;  2H0Y A;  3MFX A;  3UMD A;  1S6R A;  4H8R A;  1UWN X;  1CI8 A;  1FSY A;  1BUL A;  4CLC D;  1QMF A;  3RJU A;  2DCF A;  5FQK A;  3BLM A;  2P08 A;  3GQZ A;  1JWV A;  3LI8 A;  4NXG A;  4EWF A;  3PR6 A;  2V0U A;  3UY6 A;  2Q9N A;  5FSR A;  3G6O A;  4IUH A;  1XJ6 A;  2WK0 A;  3QHY A;  1G5U A;  5F69 A;  4DXC A;  4LEN A;  2UWX A;  1BLS A;  1HD8 A;  1LI0 A;  2OWJ A;  4GNU A;  4XUX A;  3CUE A;  1IKG A;  3ZQ5 A;  2IWC A;  2XF3 A;  2PT7 A;  3AGF A;  2JKG A;  3QP8 A;  2HZ5 A;  4P85 A;  1K6S A;  1N9O A;  5K5B A;  3QP6 A;  5FQM A;  3W4P A;  1AXB A;  3V50 A;  4R3J A;  3WS4 A;  1HTZ A;  2ZC4 B;  1IYO A;  3DWK A;  3CAX A;  2B18 A;  3MFD A;  2B95 A;  4H6J B;  4G3V A;  2LB9 A;  2XSS A;  3G35 A;  4BD0 A;  1GSX A;  3C4O A;  1KE0 A;  1BUE A;  4PKY A;  1TF1 A;  1K25 A;  2ZQD A;  4DE1 A;  4EW7 A;  3H9W A;  2Y2O A;  2HJ9 C;  1MWR A;  2H28 A;  3PAG A;  4MEZ A;  1BLP A;  2ZOI A;  2VGL S;  3RXX A;  4R1G A;  3QP5 A;  4QD4 A;  3VMA A;  3FV7 A;  3CPT A;  3CJM A;  4E3L A;  1K57 A;  2O9B A;  1KGG A;  1PFL A;  5CGW A;  4K0X A;  2VX8 A;  4E6W A;  2QYB A;  3LO7 A;  1K55 C;  4ZJ2 A;  2PU4 A;  4UAA A;  3ULF A;  2GX5 A;  2Y2J A;  1CJF A;  1STZ A;  3HLF A;  5FAO A;  2L1M A;  4Y3I A;  5U47 A;  4S2P A;  2Y8H A;  2WYX A;  2WGW B;  1YLT A;  3VP0 A;  3ZNT A;  3WS0 A;  3CHW P;  4LV3 A;  2Y79 A;  3OPR A;  4QJG A;  2XR0 A;  3P01 A;  4JGQ A;  1XPB A;  2X02 A;  3QP1 A;  3BQA A;  2X71 A;  5JYP A;  1BLH A;  4Q0I A;  5DJU A;  1ERM A;  2XD5 A;  4BBT A;  2ZM0 A;  3U2A A;  3IF5 A;  3EQV A;  4ARZ A;  4DF6 A;  4I39 A;  1TD5 A;  4RQ9 A;  4BBU A;  1KDW A;  4KZ3 A;  4PHT A;  3LGO A;  3LIE A;  2VJW A;  2ZMV A;  5HWT A;  3SH9 A;  4GDN A;  3CG5 A;  4KZ8 A;  3UDX A;  5I94 A;  1S1Y A;  1Z09 A;  3H82 B;  3ITA A;  3UPN A;  2PDR A;  3C5A A;  3LIF A;  2INW A;  3JYI A;  4R3A A;  5DTK A;  4ZDX A;  1GA0 A;  2J7V A;  5E2F A;  3MKE A;  4NK3 A;  3FC7 A;  4S2J A;  3FG8 A;  3BRM A;  3HLB A;  3G30 A;  1K4E A;  4PKY G;  1KDS A;  1TDL A;  4YNR A;  3VFH A;  2CMN A;  2Y2K A;  2OAP 1;  5HDS A;  2W3E A;  5GLA A;  2P74 A;  4G3K A;  1MC0 A;  3HUM A;  4FSF A;  4MN7 A;  4IVI A;  1N9L A;  3G31 A;  3F1N A;  2KX6 A;  2HJE A;  3OLO A;  2HPB A;  4Y0O A;  5HW3 A;  4Q0H A;  3E2K A;  3E98 A;  1SKF A;  4BL2 A;  4DRT A;  4R6L A;  1VEU B;  3GMW A;  5G4Y A;  4GW9 A;  2V1Z A;  2JKF A;  4HBU A;  2VV6 A;  4K91 A;  4KG2 A;  1GSV A;  3T4J A;  3ZG7 B;  4HHD A;  1S4R A;  2H10 A;  1MXO A;  3K3C A;  4HH2 A;  2BG1 A;  3T12 B;  4Y5F A;  4I5S A;  2G7U A;  2WKP A;  4R38 A;  4DJ3 A;  5FEF A;  3KO6 A;  3JVU A;  3IWI A;  1YLW A;  5EFW A;  4PMA A;  5A90 A;  2LB5 A;  1FCN A;  1G68 A;  5TJJ A;  4E04 A;  1L3L A;  2QZ6 A;  4R4S A;  1LLB A;  4GB7 A;  5MC7 A;  1ZG6 A;  5HWV A;  1I5Q A;  2OAQ 1;  4X56 A;  3N7W A;  1XA7 A;  1H3Q A;  3LFV A;  5F68 A;  3DTM A;  3LEQ A;  1OJ5 A;  3HLE A;  4M3K A;  1KVL A;  3LIA A;  3G2Z A;  3R7W A;  2EWV A;  4JF4 A;  3W8K A;  4OOL A;  4EUZ A;  2JKR I;  3IS2 B;  2ZMF A;  1GSW A;  4WL9 A;  2EXA A;  4GZB A;  3PAE A;  2X01 A;  3VP1 A;  2WKE A;  3A0V A;  3EQU A;  5CHM A;  5C5K A;  2QMI A;  4HP4 A;  4K0W A;  3IXD A;  5F1G A;  1ZC2 A;  3T4K A;  3M6B A;  3NUL A;  2PAV P;  4MN6 A;  3AGE A;  4OH0 A;  4QY6 A;  2XFS A;  4DN0 A;  3UNW A;  1GHI A;  3ZYT A;  4ZAM A;  2M7U A;  3B33 A;  3TSG A;  2XA7 M;  3G2Y A;  5TBM A;  1CEF A;  1Z6F A;  2NUP C;  2FH5 A;  4A5R A;  2GDN A;  1MBL A;  4P6Z S;  1PYY A;  4CPK A;  3S1Y A;  2HP9 A;  4JXG A;  5AQ7 A;  4EEP A;  3C38 A;  1IFQ A;  3V39 A;  4RYE A;  3S7O A;  4GDB A;  3MZF A;  2R78 A;  4ZJ1 A;  3GR2 A;  1VET B;  3HRE A;  3IQA A;  1EWZ A;  4E3I A;  3ZG8 B;  1YT4 A;  4PM8 A;  3H7W A;  3LCE A;  3E2L A;  3P7N A;  3UME A;  1YSQ A;  4F3L B;  2W3G A;  2QJ7 A;  2ACG A;  2O0Y A;  1ES3 A;  3SS5 A;  3IXB A;  1MKI A;  3T1S A;  2WZX A;  2DRW A;  1DP8 A;  3PTE A;  3CPT B;  3UB9 A;  2K31 A;  3A3E A;  4E3M A;  4WZ5 A;  3HBR A;  3HLC A;  3A0R A;  3ZGA B;  1K38 A;  2XK1 A;  4QHC A;  1PI4 A;  2NUT C;  5EOE A;  3A0S A;  2QKP A;  3Q7V B;  5M18 A;  3UPO A;  5HFO A;  3LUQ A;  5FI6 A;  4CLC B;  1CF0 A;  3WRT A;  2Z2M B;  2A2L A;  2Y2L A;  3W4O A;  5FAP A;  2Y4A A;  2JKT M;  4BBV A;  3E4Q A;  1W5D A;  4E3N A;  2JC7 A;  5TR7 A;  3O87 A;  4S2N C;  2W0N A;  3VV4 A;  3E4O A;  3NOU C;  4P87 A;  3CI6 A;  1LSV A;  4AFI A;  4R3B A;  3CWF A;  5G18 A;  4XT2 B;  5DF7 A;  5HAQ A;  1NRF A;  1XJ3 A;  3UE0 A;  3KYQ A;  2O99 A;  1MWT A;  1L0E A;  2PRF A;  1W7F A;  2ZM2 A;  5KIZ A;  3BM6 A;  3EGD C;  2ZQA A;  2J3W A;  4LCL A;  4OQI A;  4O01 A;  3U4L P;  5E2E A;  5DKK A;  4JGP A;  3LR3 A;  3OPL A;  4S2K A;  5AVE A;  5A93 A;  1NJ4 A;  3IF6 A;  3D9Y A;  4NET A;  3Q7Z A;  2IWD A;  3OCN A;  1PZO A;  5FAS A;  4N1X A;  4WEK A;  4IUK A;  3MJQ A;  3B3X A;  1DRM A;  4DMZ A;  1XJ2 A;  2D01 A;  4HP9 A;  4KQO A;  4JGO A;  4ETX A;  4P0M A;  1RP5 A;  3E4P A;  1KGE A;  3UB8 A;  1EI5 A;  3W2Z A;  2VK3 A;  5HD5 A;  3MZD A;  1ERO A;  5EUA A;  4BEN A;  2ZMA A;  2L4R A;  1V9Z A;  4MBK A;  5CHJ A;  3VFF A;  3V67 A;  4B4X A;  2L0W A;  3N8L A;  3GTC A;  2Y2I A;  4O8G A;  3NDG A;  2W1R A;  5A92 A;  3CZD A;  3F1O A;  2OLU A;  4CLC C;  4DJ2 A;  4XXR A;  1FOF A;  4LV1 A;  1PWC A;  3JPU A;  5EVI B;  2EX2 A;  4GOG A;  3FWL A;  1O07 A;  2V1A A;  3BJN A;  3IH8 A;  3M2K A;  3Q82 A;  5AQA A;  3MF0 A;  3F1P A;  1K4F A;  3IWO A;  4N1H A;  4PAU A;  4Y15 A;  5IHV A;  2ZQ8 A;  1FR6 A;  3TW8 A;  1LL5 A;  4ZJ3 A;  2WGI A;  3ZFZ A;  4WZ4 A;  2P7J A;  1L0G A;  2VGJ A;  1ONG A;  1LL9 A;  4MMN A;  3CIT A;  1DJC A;  1LSW A;  2JBF A;  3ICY A;  2VV7 A;  5GL9 A;  3RFB A;  3BFE A;  2M7V A;  4GCZ A;  3N6I A;  1ACF A;  4GKU A;  1I2S A;  1XXM A;  4CQH A;  3G34 A;  3T4T A;  3LYX A;  1TS0 A;  3SW1 A;  3E0Y A;  1O7E A;  1YKD A;  2FFY A;  4GHI A;  4MCW A;  1PNE A;  3MMH A;  3FPW A;  3HUN A;  4EBL A;  4D60 A;  4OOM A;  2EFU A;  5M19 A;  4MNR A;  4DKI A;  1PZP A;  1ZHH B;  4Q0J A;  1W79 A;  4IBX A;  4X6T A;  3HLD A;  4UEY A;  3DAV A;  5TBM B;  4RX3 A;  4OPQ A;  2V8C A;  1T19 A;  4HIA A;  2ZOH A;  4K08 A;  3BW6 A;  1YPR A;  1J9M A;  1JTD A;  2JHE A;  4E6X A;  1S0W A;  3A3J A;  1DP9 A;  5EVL A;  5J7E A;  3NOT C;  3MQQ A;  4ID4 A;  1KVM A;  4UA6 A;  2J80 A;  3IWQ A;  5CEB A;  1NLZ A;  2JE5 A;  5J8X A;  3KSF A;  5L8M A;  3UN7 A;  1PW8 A;  5I5L A;  3WS2 A;  3MSH A;  1NZO A;  5EVI C;  1RGY A;  3IXG A;  4MN5 A;  4N9K A;  4BD1 A;  1PIO A;  4FH2 A;  3EWK A;  3WS1 A;  1OTA A;  3LIC A;  2QJ5 A;  2ZBB A;  3EEA A;  4BL3 A;  1CQA A;  5EV0 A;  1H8M A;  4KUO A;  5L10 A;  4WF0 A;  1PW1 A;  3VE3 A;  4Z9Q A;  2VEA A;  2K2N A;  3ZVT A;  5AQ9 A;  3MQO A;  1IKI A;  3GV9 A;  5HAR A;  3UDI A;  1ES5 A;  3T1R A;  1JTG A;  3V3R A;  4LRY C;  2GNX A;  3HLG A;  1L0D A;  2W3H A;  4OQH A;  3HUO A;  4HY8 A;  3VSK A;  1F5M A;  3LEZ A;  1ZTU A;  2YKH A;  4OKP A;  4OOY A;  5DFX A;  2H0T A;  1XFN A;  1LSX A;  1W8Y A;  4U0X A;  3KSG A;  3HCY A;  2IA2 A;  2Z6C A;  5FAQ A;  5DKL A;  2P9V B;  1Y54 A;  3IHA A;  2OSU A;  3NJA A;  4ME4 A;  4EV4 A;  1FQG A;  5A8B A;  1ESI A;  2J8Y A;  1PRQ A;  4MDZ A;  3S7P A;  1BZA A;  2W1T B;  2VGL M;  1SDE A;  3QNC A;  3MS6 A;  3MQ0 A;  2WUQ A;  1N4O A;  5TGF A;  4FTX A;  2ZQ7 A;  3DTI A;  3NIA A;  3TE8 A;  1S4S A;  5IT5 A;  4GJ4 A;  2Z6D A;  3TRC A;  3NOP C;  1S1Z A;  3BY8 A;  2XRO A;  4O0P A;  5EM1 A;  1N9B A;  5G4Z A;  2WZZ A;  4KEN B;  1SKO A;  3QP4 A;  1K55 A;  2Y55 A;  4WEL A;  2JN7 A;  2XD1 A;  4Y0T A;  1XGJ A;  4GS9 B;  3HL9 A;  5HDC A;  3UB7 A;  4HH3 A;  3OOV A;  2O9C A;  3N4I A;  2PYR A;  1G28 A;  2A24 B;  3F1O B;  5GHX A;  3V5M A;  4DXB A;  5AQB A;  1FR1 A;  4HBT A;  4ESP A;  1NY0 A;  3IX8 A;  3PBR A;  5DFY A;  1LHY A;  1MY8 A;  5CXW A;  2OLV A;  3KSI A;  5CHU A;  3T1X A;  4GLQ A;  3M2J A;  1F2K A;  5HDD A;  4MBF A;  3NC8 A;  4WMC D;  5GHY A;  3HVF A;  2I9V A;  2EX8 A;  2HGV A;  5L2F A;  1GHM A;  1MWS A;  4NKP A;  3T1Q B;  4EER A;  1M40 A;  1LI9 A;  4N9L A;  3MKF A;  5FQQ A;  3OPP A;  1H5X A;  2HDR A;  4ZRR A;  2PBD P;  3QP2 A;  5IS1 A;  1YSP A;  2BTF P;  4GD8 A;  3TOI A;  1XKZ A;  1G6A A;  5EVE A;  2JKT I;  1ALQ A;  2XRN A;  5J3W A;  4H6J A;  2HP5 A;  1W63 M;  4M4X A;  2H5S A;  1T18 A;  5CTM A;  4LFU A;  5FAT A;  3FKV A;  5GLB A;  2VV8 A;  4EUV A;  4YIN A;  2QHK A;  2PYP A;  1OJG A;  4Y13 A;  2V20 A;  3BY9 A;  3UO9 A;  3GSG A;  1K56 D;  3PXP A;  3T4Q A;  2DMW A;  3NI9 A;  1WA9 A;  4U0T A;  3PBN A;  3P98 A;  3RTY A;  1E25 A;  1MWU A;  4U3T A;  2Y2G A;  3N8S A;  4OP8 A;  1E4D A;  2VZW A;  4KZ4 A;  4NXB A;  3T4L A;  5IU1 A;  1CK3 A;  3ZCZ A;  2XH9 A;  4BWI A;  4O7D A;  1AWI A;  1YLZ A;  4S2M A;  1D7E A;  3O3V A;  4WEJ A;  2J3T D;  4R70 A;  2B02 A;  2BLS A;  3FYZ A;  1JWZ A;  5E43 A;  2Q0O A;  5HPF A;  1TS7 A;  3BEC A;  1H0M A;  2WGW A;  4MLL A;  5D3O A;  1P0Z A;  3NY4 A;  4IHQ A;  1W63 Q;  3BWL A;  4WMC A;  2EA9 A;  4QWO A;  4HQA A;  1K54 C;  1TDG A;  3ZHH A;  3VOZ A;  4KZA A;  3FKW A;  4JF5 A;  1ES2 A;  2V2F F;  4L0L A;  2Q9M A;  3B42 A;  2WKI A;  3O5Y A;  3KYE A;  3VP2 A;  4WLA A;  2R9W A;  2EFX A;  3EOI A;  1NYY A;  4IED A;  4ARZ B;  4WN5 A;  1IEL A;  1BSG A;  2W27 A;  3SH8 A;  1BTL A;  3C7V A;  3CUE C;  1OTI A;  1VM1 A;  1NRJ A;  3QNB A;  5FDS A;  3PBO A;  5CGX A;  4E3J A;  3OC2 A;  2VLG A;  1NLY A;  5FA7 A;  3VSL A;  1K56 A;  3D4F A;  5KSH A;  1C3B A;  1JWP A;  4LCM A;  4P6Z M;  4II7 A;  1XGI A;  3MXR A;  4C75 A;  4HJ4 A;  2HDU A;  3LR0 A;  3LY3 A;  4NXE A;  3NBL A;  2Y2M A;  4Y7P A;  2PBY A;  3BFG A;  3ZG9 B;  1E3U D;  3F1N B;  1VEU A;  3IT9 A;  4EES A;  2XGN A;  5BOH A;  2XDM A;  1WYB A;  3C8C A;  3ZG0 A;  1ONH A;  2E8J A;  1DJA A;  4I38 A;  2V1B A;  5M1A A;  3VOL A;  4B4Z A;  4I3J A;  1KGF A;  3FPV A;  1K57 C;  3IH9 A;  1DJB A;  2V8F A;  1OTE A;  1P97 A;  1OPX A;  2QWS A;  4UQI S;  3A3I A;  2RL3 A;  2J9P A;  5AJG A;  1IYQ A;  1YQS A;  1W8Q A;  1GCE A;  1XJ4 A;  2A3U A;  2B5R A;  5FQI A;  4KZ5 A;  2KLI A;  4FUW A;  5HWW A;  1BT5 A;  4KQD A;  3S7N A;  1KOU A;  4HJ6 A;  4KZ6 A;  3SS3 A;  3T50 A;  3MR0 A;  2O9A A;  4UHU A;  1MZU A;  4OQ0 A;  4EET B;  5HD3 A;  4OLD A;  2WKR A;  4X53 A;  3FZC A;  2UV0 E;  3R7W B;  3TG9 A;  5CX7 A;  1CEG A;  4XUZ A;  4EU0 A;  4S2N A;  5EE8 A;  5KSC A;  2WKQ A;  3IX4 A;  3SOI A;  2EX6 A;  3T4S A;  1ERQ A;  3ZG5 A;  1OTD A;  2FZ0 A;  1S66 L;  4FD8 A;  4LRZ E;  1BLC A;  1T1A A;  4ZBE A;  2I72 A;  3R4K A;  4G3W A;  1A0K A;  3Q81 A;  4PM9 A;  2E8I A;  5KMW A;  1TEM A;  3C7U A;  1HVB A;  4WUJ A;  1E3U A;  4S2I A;  3BFF A;  3HJK A;  2VA0 A;  2VKS A;  2HF6 A;  1Q2P A;  4DE2 A;  1YLY A;  5KZH A;  4DDY A;  3NHQ A;  4LV0 A;  1IEM A;  1J3W A;  3OCL A;  3NEC A;  5F5Y A;  3UB5 P;  1L0F A;  1ZKJ A;  4L9E A;  4Y2F A;  2KDK A;  2RCX A;  3JVV A;  3IBJ A;  4OPY A;  1OT9 A;  3OZH A;  2WAD A;  3A3F A;  2CC1 A;  1SZV A;  4BQM A;  1VET A;  5F1F A;  5HPI A;  3PYP A;  4EBN A;  4F3L A;  4JXV A;  4OPR A;  3NDE A;  2ZD8 A;  4JGR A;  4UQI M;  5F83 A;  5AVF A;  1P9W A;  1XFQ A;  3SH7 A;  3H7W B;  3RH8 B;  3BFC A;  5CGS A;  3UDF A;  3W4Q A;  2P04 A;  3BQ8 A;  4WBG A;  1YLJ A;  4GN2 A;  3S4X A;  2Y2H A;  1LT0 A;  1IOU A;  2ZC7 A;  1YMX A;  3ZDJ A;  3Q7V A;  3VP3 A;  5HZH A;  2R9X A;  1X0O A;  4IBR A;  4CLC A;  2KOI A;  2ZL1 A;  4HJ3 A;  4EQ1 A;  4HEF A;  4WM9 A;  2ZC5 B;  1EW0 A;  2PD8 A;  3PBQ A;  2JCH A;  1BYW A;  4D2O A;  4ETZ A;  1OT6 A;  3BYD A;  4X1L A;  2AVX A;  2C6W B;  4YOF A;  5DF8 A; 
#chains in the Genus database with same CATH homology
 3KSH A;  3PBR A;  3UE3 A;  2JKT M;  3MFX A;  3UMD A;  5DFY A;  4BBV A;  3E4Q A;  2GZA A;  1UWN X;  3KSI A;  4CLC D;  4GLQ A;  2P08 A;  3LI8 A;  2W0N A;  4NXG A;  5HDD A;  3E4O A;  4XT2 A;  3VE4 A;  3VV4 A;  4BMW A;  3PR6 A;  3NOU C;  5LBR A;  3CI6 A;  2V0U A;  1LSV A;  4AFI A;  3G6O A;  2I9V A;  2OWH A;  4IUH A;  3CWF A;  2HGV A;  1XJ6 A;  4XT2 B;  4LPZ A;  5F69 A;  2BAS A;  3D3O A;  4NKP A;  1XJ3 A;  4EER A;  3KYQ A;  5DF9 A;  2OWJ A;  2O99 A;  3CUE A;  2W3D A;  3ZQ5 A;  3LIB A;  1VHM A;  5KIZ A;  1F9I A;  4ZRR A;  2PT7 A;  3EGD C;  1D06 A;  5IS1 A;  1YSP A;  3OBF A;  1N9O A;  2PR5 A;  5HL6 A;  5K5B A;  2J3W A;  2JKT I;  2XRN A;  5J3W A;  1YAX A;  4H6J A;  4O01 A;  1W63 M;  4M4X A;  1VB6 A;  1T18 A;  3KX0 X;  4I3A A;  3CAX A;  2B18 A;  5DKK A;  2PHY A;  4JGP A;  4Z1W A;  3LR3 A;  4H6J B;  4G3V A;  2VV8 A;  4EUV A;  2LB9 A;  2XSS A;  5AVE A;  2XA7 S;  1GSX A;  2QHK A;  2PYP A;  1TS6 A;  1OJG A;  4PKY A;  3BY9 A;  3IBR A;  3OCN A;  1TF1 A;  4LRX C;  4HOI A;  3LI9 A;  4WEK A;  4EW7 A;  3H9W A;  2HJ9 C;  3PXP A;  3T4Q A;  2DMW A;  4IUK A;  2H28 A;  3MJQ A;  1DRM A;  1WA9 A;  4L9F A;  4DMZ A;  1XJ2 A;  2PR6 A;  3K2N A;  2D01 A;  2ZOI A;  4HP9 A;  4KQO A;  2VGL S;  4JGO A;  4ETX A;  4YWZ A;  3PBN A;  3E4P A;  3RTY A;  3UB8 A;  3W2Z A;  2D02 A;  2VZW A;  4EEU A;  5HD5 A;  2O9B A;  4B9O A;  3S7Q A;  4NXB A;  3T4L A;  5IU1 A;  2PD7 A;  2VX8 A;  2L4R A;  2QYB A;  1V9Z A;  4BWI A;  3ULF A;  2GX5 A;  4I3I A;  3V67 A;  1D7E A;  1MKM A;  2L0W A;  3HJI A;  1STZ A;  4WEJ A;  2J3T D;  3LR4 A;  4R70 A;  2B02 A;  4O8G A;  2L1M A;  2W1R A;  5HPF A;  1NWZ A;  1TS7 A;  1UGU A;  4Y3I A;  3F1O A;  1ODV A;  4CLC C;  4DJ2 A;  2Y8H A;  1JNU A;  1P0Z A;  2W3F A;  3EEH A;  4IHQ A;  1W63 Q;  3BWL A;  2GJ3 A;  2EA9 A;  4HQA A;  3CLO A;  3EGX C;  2V1A A;  2MJ6 A;  3BJN A;  1P9R A;  2HV1 A;  2Y79 A;  3MF0 A;  3P01 A;  2V0W A;  4JGQ A;  3BQA A;  3F1P A;  4PAU A;  1LL8 A;  4Q0I A;  5DJU A;  4BBT A;  4L0L A;  1S67 L;  3U2A A;  3B42 A;  3TW8 A;  3O5Y A;  3F1P B;  4WLA A;  3EQV A;  4KUK A;  4ARZ A;  2V9A A;  3KYZ A;  3EOI A;  1TD5 A;  4I39 A;  1G6O A;  4RQ9 A;  4BBU A;  2P7J A;  4ARZ B;  4WN5 A;  4PHT A;  1V9Y A;  3LIE A;  2VJW A;  4MMN A;  3CIT A;  1LSW A;  2ZMV A;  3ICY A;  5HWT A;  1TS8 A;  2VV7 A;  2W27 A;  3RFB A;  3CUE C;  1S1Y A;  3H82 B;  2M7V A;  4GCZ A;  1OTI A;  1NRJ A;  1DP6 A;  2PDR A;  3PBO A;  3LIF A;  2INW A;  4R3A A;  4CQH A;  3OC2 A;  2VLG A;  1NLY A;  3T4T A;  3LYX A;  4NXF A;  1TS0 A;  3SW1 A;  1N9N A;  3E0Y A;  1YKD A;  3FC7 A;  3GEC A;  3FG8 A;  4GHI A;  5KSH A;  4MCW A;  3MMH A;  3FPW A;  2YKF A;  2EWW A;  4PKY G;  4YNR A;  4P6Z M;  4II7 A;  2CMN A;  2OAP 1;  4OOM A;  4HJ4 A;  5FL3 A;  4GHI B;  5HDS A;  3LR0 A;  2W3E A;  4G3K A;  1MC0 A;  4NXE A;  4FSF A;  4MN7 A;  1ZHH B;  1N9L A;  4Q0J A;  3F1N A;  2KX6 A;  3LID A;  2HJE A;  3C30 A;  3GDI A;  3OLO A;  4UEY A;  5TBM B;  1T19 A;  4HIA A;  4Q0H A;  3F1N B;  2ZOH A;  3E98 A;  4K08 A;  4EXO A;  3BW6 A;  4EES A;  4B93 A;  2JHE A;  3C8C A;  3UB6 A;  3DBA A;  4R6L A;  1DP9 A;  2J3T C;  5G4Y A;  5J7E A;  4GW9 A;  3NOT C;  4I38 A;  2VV6 A;  3MQQ A;  2V1B A;  1GSV A;  3T4J A;  3VOL A;  4I3J A;  3FPV A;  4HHD A;  1S4R A;  1OTE A;  1P97 A;  1OPX A;  2QWS A;  2J80 A;  3K3C A;  4UQI S;  1NLZ A;  3PHY A;  4HH2 A;  5AJG A;  2JKR M;  3KSF A;  5L8M A;  1XJ4 A;  4Y5F A;  4I5S A;  4HNB A;  2G7U A;  2KLI A;  5I5L A;  2WKP A;  4R38 A;  4DJ3 A;  3KO6 A;  5HWW A;  3JVU A;  4KQD A;  5EFW A;  3S7N A;  1KOU A;  4MN5 A;  2K7S A;  4HJ6 A;  2LB5 A;  4QPR A;  5TJJ A;  3T50 A;  3EWK A;  4IJG A;  1OTA A;  3MR0 A;  4L9G A;  4E04 A;  3LIC A;  2QJ5 A;  2O9A A;  1MZU A;  2ZBB A;  3EEA A;  5MC7 A;  4EET B;  1H8M A;  4KUO A;  5HWV A;  3PBS A;  2OAQ 1;  5HSQ A;  5HD3 A;  5DJT A;  1H3Q A;  3LFV A;  4WF0 A;  5F68 A;  1OJ5 A;  3C2W A;  3LIA A;  3VE3 A;  1OTB A;  2WKR A;  3MXQ A;  5F6A A;  4FOF A;  2VEA A;  2K2N A;  3R7W A;  4HI4 A;  2EWV A;  1F98 A;  3MQO A;  4OOL A;  2JKR I;  3IS2 B;  3R7W B;  2ZMF A;  1GSW A;  4WL9 A;  4LRY C;  3UE6 A;  2GNX A;  5CX7 A;  3H82 A;  4EU0 A;  2WKQ A;  3A0V A;  3EQU A;  2W3H A;  3T4S A;  5C5K A;  3K3D A;  4HP4 A;  4HY8 A;  1OTD A;  2FZ0 A;  3T4K A;  1F5M A;  1S66 L;  1ZTU A;  3PBT A;  2YKH A;  4LRZ E;  1T1A A;  3R4K A;  4G3W A;  5DFX A;  1XFN A;  1Y28 A;  1LSX A;  4MN6 A;  3KSG A;  3HCY A;  2IA2 A;  4WUJ A;  2Z6C A;  3HJK A;  2VA0 A;  2VKS A;  3D72 A;  5DKL A;  2HF6 A;  4DN0 A;  4CLC E;  3ZYT A;  1T1C A;  2M7U A;  3B33 A;  3NHQ A;  2XA7 M;  5J4E A;  5TBM A;  3NJA A;  3OCL A;  2NUP C;  5F5Y A;  2FH5 A;  4ME4 A;  4P6Z S;  2OOL A;  4L9E A;  5A8B A;  4Y2F A;  2W1T A;  2KDK A;  4MDZ A;  3S7P A;  3JVV A;  3IBJ A;  4EEP A;  2W1T B;  1OT9 A;  3C38 A;  4LLO B;  1IFQ A;  3B47 A;  2VGL M;  4NEE D;  3S7O A;  3MQ0 A;  5HPI A;  2R78 A;  3PYP A;  4F3L A;  3H7W A;  3TE8 A;  4BJP A;  1S4S A;  3P7N A;  5IT5 A;  4GJ4 A;  2Z6D A;  3TRC A;  3NOP C;  4JGR A;  1S1Z A;  3UME A;  4UQI M;  1YSQ A;  4F3L B;  3BY8 A;  5AVF A;  2XRO A;  1P9W A;  2W3G A;  2QJ7 A;  1XFQ A;  4O0P A;  3H7W B;  2O0Y A;  3RH8 B;  1T1B A;  5G4Z A;  1UWP X;  4GS9 A;  1DP8 A;  2P04 A;  3BQ8 A;  3UB9 A;  4WEL A;  2JN7 A;  3TJZ C;  2K31 A;  3LR5 A;  3A0R A;  4GS9 B;  1LT0 A;  2M1C A;  5HDC A;  3UB7 A;  1IOU A;  5HZH A;  1X0O A;  2NUT C;  4HH3 A;  3A0S A;  4CLC A;  2KOI A;  4HJ3 A;  4EQ1 A;  3OOV A;  2A24 A;  2O9C A;  2QKP A;  1EW0 A;  2PD8 A;  3PBQ A;  3IS2 A;  3LUQ A;  1BYW A;  2PYR A;  4ETZ A;  4CLC B;  1OT6 A;  2A2L A;  1G28 A;  3T4O A;  2A24 B;  3F1O B;  4YOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...