3A0SA

Pas domain of histidine kinase thka (tm1359)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
METAIITLSKDGRITEWNKKAEQLFGLKKENVLGRRLKDLPDFEEIGSVAESVFENKEPVFLNFYKFGERYFNIRFSPFRNAKTQLLEGVIITIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor protein
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
total genus 27
structure length 96
sequence length 96
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3a0sA00
3LIBA 1T18A 3LYXA 2GJ3A 2PYPA 4BBUA 4H6JB 3VE4A 1N9OA 2JHEA 2L0WA 3ZQ5A 2QJ5A 4HOIA 1S67L 2VLGA 4F3LA 3IS2B 4JGRA 5F68A 5J3WA 5J7EA 1S4RA 1OTBA 4HJ3A 5F6AA 4L9EA 4HP4A 3EEHA 4LLOB 2K7SA 2A24A 4I39A 3ICYA 4EQ1A 4XT2B 3FC7A 3F1NA 1LSVA 1XFQA 2OWJA 4YWZA 1F9IA 3GECA 3H7WA 1DP8A 1LL8A 3UB6A 4KUKA 1LSXA 1OT6A 5F5YA 2KDKA 5IS1A 3NOTC 2ZBBA 4HH3A 4WN5A 4EETB 3F1PB 2QHKA 3RTYA 4NXFA 1LSWA 1F98A 2D02A 2YKFA 2V1BA 3UMDA 2EA9A 1OTEA 5IU1A 4F3LB 1UWPX 3UB7A 4PKYA 5F69A 1GSWA 1VB6A 1S1ZA 4WF0A 1T1AA 4NXBA 2ZOIA 4DJ3A 2A24B 2PDRA 2YKHA 1WA9A 5HWWA 2I9VA 3E4OA 5EFWA 5DJTA 2OOLA 2WKPA 1TS7A 4R38A 2W27A 4WLAA 3F1OA 2KX6A 1V9YA 4EEUA 3OLOA 1TS6A 1OTIA 5DJUA 2QKPA 1T1CA 5TBMA 4R70A 1OJ5A 1N9LA 4GS9A 3ULFA 1DP6A 2BASA 2R78A 4LRZE 4I38A 5A8BA 3NJAA 5AVFA 3UB9A 4EXOA 3LI9A 1OT9A 1P97A 4HJ6A 4JGQA 3UB8A 1XJ2A 5DKLA 4DJ2A 3NOUC 3MQQA 5HDDA 3LICA 2H28A 4EERA 1DRMA 1XJ4A 3C8CA 3LUQA 3B33A 2W0NA 4HQAA 1XJ6A 5KIZA 2WKRA 1OTAA 4MN6A 4HH2A 1NWZA 3F1OB 3LIEA 1GSXA 3H82A 3HJKA 4H6JA 2Z6CA 4RQ9A 2PYRA 4I3IA 1P0ZA 3LIFA 2PD8A 4EEPA 5HSQA 3FG8A 2L4RA 3UE6A 4L9GA 4WUJA 4GS9B 3HJIA 3CWFA 3CLOA 4KUOA 1MZUA 4E04A 3RH8B 4XT2A 3E4PA 3C2WA 4HY8A 4PKYG 3G6OA 4GCZA 3KX0X 4GW9A 1D7EA 3F1NB 2L1MA 1BYWA 4HJ4A 1N9NA 1TS0A 4JGOA 2P7JA 3D72A 3H7WB 4B9OA 5DKKA 4LRXC 3LIAA 3NHQA 3CAXA 1DP9A 4M4XA 3VOLA 3A0RA 3PHYA 4I3JA 2PR5A 3IBRA 1OTDA 1EW0A 3EWKA 4L9FA 5G4ZA 4HP9A 5HD5A 2J80A 2Z6DA 3MXQA 1XJ3A 4GHIA 3P7NA 4HI4A 1T19A 1S66L 4I3AA 2V9AA 2CMNA 3MJQA 3H82B 3UMEA 3PYPA 3BWLA 5HDSA 1G28A 3MQOA 2B02A 4HHDA 1JNUA 4NXGA 1S4SA 2OWHA 2VV8A 5I5LA 1Y28A 3A0SA 2QWSA 5J4EA 4KQDA 4EESA 1T1BA 5G4YA 2JN7A 4LRYC 1GSVA 2QJ7A 2V0WA 3T50A 3K3DA 3LI8A 4LPZA 2INWA 4BBTA 2WKQA 3NOPC 3BY8A 1S1YA 1UGUA 1XFNA 3GDIA 2V1AA 1TS8A 2PR6A 3IS2A 4R3AA 1UWNX 4HNBA 5HWTA 5HWVA 2ZOHA 4GHIB 5TBMB 3SW1A 4WL9A 4JGPA 3A0VA 5AVEA 1D06A 3BY9A 2PD7A 4NXEA 4MN5A 3VE3A 3H9WA 3MR0A 5HD3A 5HDCA 3MFXA 1LT0A 4K08A 2VV7A 4EW7A 2VEAA 1KOUA 4R6LA 2D01A 3E4QA 3LIDA 2HV1A 4BBVA 1OJGA 2M1CA 2PHYA 5HZHA 4I5SA 2V0UA 4HIAA 2VV6A 3F1PA 1ODVA 1X0OA 3K3CA 1V9ZA
chains in the Genus database with same CATH superfamily
1MWTA 3LYXA 2DMWA 4JBFA 1BLPA 3LR0A 3OCLA 4E3KA 1GHIA 4H6JB 5E2FA 3C7UA 2VLGA 1ES5A 1FQGA 4JGRA 1NZOA 1I2SA 2VK3A 3BFDA 2K2NA 2OAQ1 2OSUA 5F68A 5J3WA 5J7EA 2JBFA 4HJ3A 3ZNTA 3KSFA 4OQIA 1YT4A 4I39A 2VGKA 3ICYA 1E25A 5FI6A 4EQ1A 3OC2A 1XA1A 5TJJA 2V2FF 3T1XA 4ARZB 4B93A 1HTZA 1MWUA 1F9IA 4N1HA 4EBLA 1FOFA 4MBHA 5EE8A 2UV0E 3UB6A 3LR3A 3IHBA 5CHMA 4XUZA 4Y5FA 2WADA 4Z9QA 3Q7VA 4P6BA 5F82A 4N1XA 2EX6A 2C5WB 3IQAA 5F5YA 4LV2A 4ZTKA 5CEBA 1FR6A 2XF3A 2WGWB 3LFVA 2WK0A 1JWPA 3G2ZA 4KZ7A 4OONA 4WN5A 4K0WA 3L9KA 5FASA 3BFCA 3ITAA 4S2MA 2V1BA 2PBDP 1OTEA 2VA0A 3OPHA 3UB7A 3WS4A 4IUKA 1ACFA 1VB6A 2Y2HA 2O99A 2HF6A 2P9VB 1CQAA 2PDRA 1SHVA 3VOZA 2YKHA 5HWWA 2J8YA 3G32A 3MZEA 2WYXA 3UE1A 1K55A 1K0KA 3TG9A 5KSHA 4LV1A 2JKRM 3B47A 5HAQA 5AJGA 1IELA 1G68A 3C7VA 4YOFA 3ITBA 1E3UA 2HJEA 5DF8A 1JWVA 1TS6A 3VP4A 1L3LA 1OTIA 3C5AA 1T1CA 4R70A 3CZDA 3UDIA 1KE0A 1JVJA 3NC8A 2BASA 3QNCA 4LRZE 4QB8A 1YPRA 5A8BA 3BFEA 4R3JA 3LI9A 4OOMA 4HJ6A 2ZL1B 2Y2OA 3WS5A 2HGVA 1ESUA 5FAQA 2Y2KA 5L07A 3GMWA 1FILA 4Q0IA 1W63Q 3HLEA 3BJNA 1SKFA 2EWVA 5HDDA 1FR1A 1NYYA 4S2NC 4WEKA 4D60A 3RFBA 4U0TA 3SS5A 3LEQA 2XR0A 1XJ6A 4LENA 1CI8A 4U3TA 3PBRA 4BL2A 3IXHA 2OAP1 1MKMA 3BLMA 4RX2A 5HFOA 5C5KA 1NWZA 2R9WA 3GSGA 4GD6A 3DTKA 4LCLA 3MSHA 1L0DA 2PYRA 4R23A 4IVIA 5GLDA 3HVFA 3LIFA 2W3DA 3G35A 2LB5A 2QPNA 3UE6A 3U2AA 1ONHA 2W3FA 2XRNA 4KUOA 4E04A 3RH8B 4L0LA 4Y0TA 4CLCA 1DJCA 3C2WA 4PKYG 3A3DA 3NIAA 2Y2MA 3S4XA 3SZTA 4IVKA 2HZ5A 1D7EA 2BG1A 4ZDXA 4IBRA 4KQRA 5EV0A 4WZ4A 3U4LP 4DE1A 1BLCA 1TS0A 4JGOA 4ETXA 1IKIA 2HP9A 5DVAA 1ZTUA 5DKKA 4UHUA 2XSSA 3VMAA 5E2GA 3UPNA 2H5SA 2VZWA 3CPTA 3NBLA 3DTEA 2V20A 2HP6A 2ZQCA 1EW0A 5F83A 1XJ3A 3IF5A 1H8ZA 5AQAA 1N9BA 4I3AA 4WM9A 4Y2FA 2CMNA 3R7WA 3FV7A 5EECA 3UMEA 1PWCA 5EOOA 5FI7A 3CHWP 3OPLA 4XUXA 2B02A 1K54C 2PU4A 5HL6A 3B42A 1YMXA 4HHDA 3W8KA 1JNUA 3O86A 4NXGA 1D1JA 1W7FA 2OWHA 2VV8A 5I5LA 2J3TD 3V50A 3A0SA 4G3KA 3OPPA 4IUHA 2V1ZA 2HDSA 4QPRA 1T1BA 4LRYC 2GZAA 1LHYA 4UA7A 2ZQDA 1AWIA 4BD1A 3ZYTA 1XGJA 2JC7A 3T1SA 1XX2A 3VOYA 4LPZA 3DW0A 3DWKA 3VP0A 2Z2MB 4ZJ3A 2JE5A 3WRTA 2WKQA 4O7DA 4EUVA 3BY8A 4R4SA 4QD4A 2HJ9C 1FCMA 2Y2GA 3T4OA 3MZDA 1WE4A 1PFLA 4KZ4A 1ES2A 1UWNX 4MLLA 2E8IA 2OV5A 3SW1A 2WKHA 4ZJ2A 3A0VA 1XPBA 2HDUA 3Q07A 2Y59A 1D06A 2VGLM 1LL9A 1K6RA 2Y2NA 1JTGA 3BY9A 4DDYA 4KZ5A 1TDGA 4NXEA 4OP5A 4MN5A 3HLBA 3MR0A 1LI9A 5J8XA 4OQGA 2NUPC 1SDNA 2VV7A 4BLMA 1RGYA 5F1GA 4OPYA 3IWOA 1PZOA 1G6OA 3PBSA 2V8FA 2D01A 1MKIA 3UPPA 3PAEA 3LIDA 3WS2A 3FPVA 3MZFA 3S22A 1H3QA 5CHJA 5CHUA 2BTFP 2B5RA 3MMHA 3EGDC 4S2PA 4N9LA 3UDFA 1MBLA 3IWIA 5EVID 3RXWA 1V9ZA 4PM9A 1TEMA 1H8MA 2AVXA 4BBUA 1PRQA 1K38A 3ZVTA 4NKPA 1N9OA 2JHEA 2L0WA 4QY6A 3ZQ5A 2QJ5A 4HOIA 4CJNA 1K56A 3MS6A 3O5YA 2RCXA 2KOIA 3IS2B 4FUWA 4ID4A 3PBOA 4R4RA 3KSHA 3BEBA 2C6WB 2EXBA 3HCYA 3WS0A 1BTLA 1OTBA 3GVBA 3TJZC 4HP4A 1SZVA 3HUOA 2A24A 1GA9A 4OPQA 1QMEA 3VP3A 4OVDA 4XT2B 3SH8A 3F1NA 1LSVA 4GOGA 2OWJA 3GECA 3CG5A 1DP8A 1WYCA 2FZ0A 3EOIA 2LB9A 4KUKA 1PNEA 5EVLA 2DRWA 5DTSA 1GCEA 3KYQA 5IS1A 1DY6A 5HPFA 3JVUA 4E3LA 4HH3A 4UQIS 5FQ9A 1LL5A 3UN7A 4S2IA 1KDWA 2IWBA 3O88A 1IYSA 2ZM2A 4P0MA 3QP1A 1LSWA 4GNUA 1P9WA 3QHYA 2D02A 4GZBA 2YKFA 4EBPA 5CXWA 2OLUA 3QP6A 2GNXA 2R9XA 3UMDA 2J3TC 3FYZA 4RVAA 5M19A 2GDNA 4PKYA 2H0YA 4MDZA 2X02A 2HPBA 2XEPA 1T1AA 3M2KA 2JCHA 5D3OA 1K4EA 3Q81A 4ZAMA 4DRTA 4MBKA 3KYZA 4PPRA 4DF6A 1SKOA 2OOLA 2WKPA 2CC1A 4A5RA 2W27A 5CGSA 1HZOA 2QMIA 4UAAA 3Q7VB 4QJGA 3P98A 1IYOA 3C4PA 3TE8A 4S2OA 4BQMA 5DJUA 5FQMA 5TBMA 4O8GA 4GS9A 5JYOA 3ULFA 1NYMA 1BULA 3IX4A 2VJWA 4OQ0A 2XK1A 2HDQA 3EGXC 3IXDA 3NJAA 1KE4A 2ZQAA 1ZC2A 4UA6A 2JKRI 1IKGA 2HP5A 3LCEA 2XLNA 4JGQA 3LEZA 4KZ9A 3UB8A 1Q2PA 3NCKA 2ZM8A 4FSFA 4BJPA 1ZHHB 3NOUC 2KLIA 3N4IA 4N9KA 1YQSA 1XJ4A 1BUEA 2BLSA 1ZKJA 4HQAA 2WZZA 3B3XA 5KIZA 4RA7A 3N8LA 5EVIC 3BQAA 2XA7S 2EFXA 3E98A 1OTAA 4MN6A 2XQZA 1CEFA 1PZPA 3TRCA 1GSXA 2A3UA 5FAPA 3HJKA 4H6JA 4GD8A 4S2NA 3TW8A 2Z6CA 1HLUP 1F2KA 4RQ9A 5DF7A 4I3IA 4PAUA 3MKFA 3O3VA 1P0ZA 5EPHA 3OZHA 2PD8A 2WGIA 4L9GA 2QYBA 1C3BA 3CWFA 4X53A 1MZUA 3JVVA 5FA7A 4GLQA 3G6OA 5E43A 4ARZA 5HPIA 4GCZA 5DFYA 3KX0X 4QY5A 5FI2A 4DE0A 1MY8A 4E3MA 5HL1A 1N9NA 3BFGA 2WAFA 3H7WB 3IXGA 4B9OA 4HBTA 1L2SA 3CI6A 4WYYA 4WMCD 2DNSA 4LRXC 3LIAA 3NHQA 2FH5A 3CAXA 2VGLS 2PBYA 3VOLA 4HEFA 3A0RA 1VEUA 1ZG6A 3AGFA 3PHYA 3FPWA 4I3JA 2WGWA 4ME4A 4YNRA 5CRFA 3EWKA 3OBFA 2J80A 2Z6DA 3P7NA 4KG5A 3CJMA 5A90A 3W4QA 3WS1A 1FCOA 1IEMA 1KGEA 5L8MA 5G18A 2O9BA 3BRMA 4MEZA 5FL3A 2OLVA 1NLZA 2QZ6A 4CLCD 3VP1A 3C30A 5HARA 4OLDA 2ZLYA 4ETZA 3LO7A 1Y28A 4GDBA 2MJ6A 1ES4A 2P9VA 2QWSA 4BD0A 2G2UA 2NUTC 5LBRA 4CLCB 1XKZA 3VP2A 5M1AA 1RGZA 2JN7A 4Q0HA 1GSVA 4HESA 2EX8A 2V0WA 3Q82A 1K54A 1XP4A 3W4PA 4Z1WA 1BT5A 3T50A 2XDMA 5FSRA 5HW3A 3CUEC 1S1YA 1Y54A 4IHQA 1UGUA 4WZ5C 3G31A 3CPTB 2PRFA 4KG6A 4OLGA 4AFIA 2JKGA 2Y2JA 5HWTA 3E0YA 5GLBA 3V3RA 2ZOHA 4OP8A 5DF9A 4DXBA 4IEDA 4JGPA 4GDNA 3BECA 2WZXA 5E2HA 1RP5A 4Y7PA 3UY6A 4E6XA 5KMWA 4OQHA 4Y13A 4EW7A 2O9CA 3ZVWA 2V8CA 3TSGA 4FCFA 1DJBA 2VEAA 4R6LA 2ZQ9A 3VFFA 2G2WA 3S1YA 4MBFA 3E4QA 3T4TA 4DN0A 4IJGA 2EX2A 4LGWA 4BBVA 1OJGA 4X1LA 3W4OA 3MF0A 3VV4A 3S7NA 1PYYA 3UO9A 1ERMA 4C3QA 2WKIA 3DTIA 4F94A 4HIAA 1I2WA 3F1PA 5AQ9A 4JLFA 3HREA 3CITA 1X0OA 3K3CA 1NRJA 5TGFA 3HUMA 3UPOA 3KSGA 1T18A 3T1RA 2W3HA 3MBZA 2GJ3A 1KDSA 4Y15A 3FZCA 3T12B 2ACGA 1Y4OA 4O0PA 1S67L 1NLYA 3M6BA 3HLFA 4F3LA 3FKVA 1S4RA 5F6AA 4L9EA 3S7QA 3PXPA 1K25A 1PW1A 3ZCZA 4E3IA 1RCJA 1ESIA 3MKEA 2XH9A 3DAVA 3HLDA 2ZQ8A 4R3BA 1YLZA 3NY4A 3FC7A 3RJUA 1XFQA 2O0YA 4G3WA 1XA7A 4CPKA 3T4LA 1VETA 5K5BA 4UEYA 1S0WA 1LL8A 1YMSA 3ZDJA 1M40A 1AXBA 2KDKA 2IA2A 3NOTC 2X71A 1TVFA 3T1QB 1W79A 2ZBBA 1LI0A 4X6TA 1K6SA 1W5DA 1NXYA 2VKSA 1FSYA 2K31A 3BW6A 1XXMA 3P09A 1W8YA 1HD8A 2Y2IA 5FAOA 3UDXA 4R1GA 2EA9A 2ZC3B 2EWWA 1IOUA 5IU1A 3BLSA 5DFXA 4B4ZA 2ZJ9A 4JXVA 2Y8HA 2J3WA 1GSWA 3FWLA 4NXBA 2A24B 3IX8A 3IF6B 1JTDA 1P9RA 3K2NA 5FQJA 2WUQA 4QHCA 4U0XA 5DJTA 3WRZA 3RXXA 5U47A 4R38A 2G7UA 3IWQA 4WLAA 3F1OA 1W63M 2KX6A 3UE3A 4FH4A 1J3WA 4RX3A 3OLOA 4N92A 2P74A 3JPUA 4PM8A 3BFFA 4PMAA 4MCWA 2J7VA 1YLPA 2QKPA 1OJ5A 3R4KA 1YLYA 1BZAA 5EUAA 1DP6A 2R78A 1E4DA 1XGIA 4WEJA 4NG2A 1KVMA 1G6AA 4DMZA 1Z6FA 3UB9A 1IYQA 4EXOA 1OT9A 3V39A 1P97A 1BLSA 1XJ2A 3NDGA 2PAVP 3JYIA 4MN7A 5EM1A 3M6HA 3MQQA 3PAGA 3G34A 4JKTA 4JF6A 3ZG0A 4EERA 1DRMA 3C8CA 2H0TA 1EWZA 3PBTA 4K91A 5FQQA 3KYEA 2WKRA 2W1TA 1SKOB 4NEED 2Y55A 1ZG4A 4O01A 3LIEA 3H82A 3ZNYA 4KENB 3N8SA 3HL9A 3VSLA 1K57C 1H8YA 2X01A 4GN2A 5GLAA 1KVLA 5AQBA 5EVIA 5FDSA 3D4FA 4EEPA 2L4RA 2XFTA 3A3JA 3DBAA 4GS9B 3BM6A 1OMEA 2B95A 3HBRA 3NI9A 3HLWA 4XT2A 3E4PA 4HY8A 4C6YA 3IHAA 4Y17A 3PBQA 1EROA 2Y2PA 1BYWA 1PWGA 4HJ4A 1J9MA 3BYDA 2XROA 3D72A 5GHYA 5FQKA 4DDSA 1YSQA 1H5XA 1WYBA 1PIOA 1Q2QA 3LR5A 4M4XA 3VFHA 3TOIA 3IBRA 5GL9A 4ESPA 4IBXA 4L9FA 3NECA 2J9OA 3ZHHA 3MXQA 4GHIA 1VHMA 4HI4A 4BL3A 1MC0A 1S66L 4RYEA 3KO6A 3NULA 2V9AA 3MJQA 3LGOA 2Q9MA 3PYPA 4DE2A 1YKDA 1M6KA 4E3JA 5L2FA 3MQOA 2FFFB 2JKTM 2UWXA 5EOEA 1PWDA 1GHMA 1S4SA 5IHVA 4X25A 3L7HA 4X55A 4Y3IA 1YLWA 4MNRA 1H0MA 4EQIA 5CERA 1PI5A 4EU0A 5G4YA 2PT7A 3A3FA 4E3OA 2EFUA 1E3UD 3QP2A 4P85A 4ZJ1A 2P08A 3LI8A 2XD1A 2INWA 2ZMAA 4BBTA 4H8RA 2ZC4B 5I94A 3EEAA 1CF0A 1HVBA 2ZM0A 4PM6A 1VEUB 3LY3A 5EM0A 3C4OA 4R3AA 3LR4A 5HWVA 3E2KA 3GQZA 4WL9A 3Q7ZA 1DJAA 1FSWA 3S7PA 5A92A 3MFDA 2W1RA 2W3EA 1L0EA 3CUEA 1S6RA 4WZ5A 2J9PA 3SOIA 4KZ8A 1U60A 5HD3A 1STZA 3D3OA 5HDCA 3MFXA 1LT0A 1Z09A 2ZQ7A 1CEGA 2IWCA 4K08A 2VGJA 4M3KA 4MMNA 2PU2A 5CECA 4WBGA 5MC7A 3FKWA 3W2ZA 2HV1A 2ZD8A 4Q0JA 4X68A 2PHYA 1BSGA 3IXBA 4JF4A 3O87A 3E2LA 1ES3A 1FIKA 3GV9A 4K0XA 1A0KA 3LIBA 1QMFA 4GKUA 2PYPA 2VX8A 2Y79A 1YLJA 3VE4A 5TFQA 4ZRRA 4FD8A 1NRFA 5F1FA 4EBNA 3EEHA 4LLOB 3AGDA 2K7SA 4OOLA 1LLBA 3N7WA 2Y4AA 5DTKA 2Y2QA 2IWDA 1W8QA 2XGNA 3OCNA 4LCMA 3N6IA 4UQIM 4YWZA 5A91A 3G2YA 3H7WA 2XD5A 5AQ7A 4E3NA 5FEFA 3S7OA 1LSXA 1OT6A 3P01A 1MXOA 4PM7A 3ZG9B 4DE3A 4YFMA 4P6ZM 2HDRA 4WMCA 4S2KA 5CEDA 3SH7A 4X1MA 1ALQA 4EETB 3F1PB 1VM1A 2QHKA 3IH9A 4EUZA 3RTYA 4NXFA 2EXAA 5EVEA 3I7JA 1F98A 4R0QA 3IBJA 1YLTA 4G3VA 3R7WB 1SCWA 5KSCA 1KGFA 4OKPA 1CK3A 5CGWA 2ZL1A 5TR7A 3IX3A 4DKIA 3GRJA 1K55C 4F3LB 5CTNA 3T4SA 1UWPX 5F69A 1TF1A 2M7UA 1YM1A 1S1ZA 3MXSA 4WF0A 5GHZA 1ONGA 2ZOIA 4FH2A 4DJ3A 1MWRA 2A49A 3EQVA 4FOFA 3VSKA 4LV3A 1WA9A 1N4OA 4S2JA 1TDLA 2I9VA 3Q1FA 3E4OA 1GA0A 4LFUA 5FEGA 3PR6A 5EFWA 4OH0A 1EI5A 3V5MA 3NDEA 1VETB 1TS7A 4X69A 4JF5A 3HLCA 4QWOA 5FATA 4X56A 2WGVA 5DTTA 3G4PA 5HAPA 3ZGAB 1V9YA 4EEUA 3CMZA 5KZHA 3OPRA 4OPZA 3T4KA 4B4XA 3C38A 1MWSA 4XXRA 1N9LA 4BMWA 4EV4A 4CLCE 3V67A 1CJFA 4UA9A 2H10A 1NJ4A 4I38A 5AVFA 4Q8IA 2ZC6B 4CQHA 2XFSA 1YSPA 1SDEA 2XA7M 2Y91A 1KE3A 4Y0OA 4D2OA 5DKLA 4PM5A 4KQOA 5CX7A 4JXSA 4DJ2A 3OOVA 1KGGA 2JKFA 3LICA 2H28A 3DTMA 2O9AA 1YAXA 3QP8A 3KSIA 4QU3A 3LUQA 3B33A 3UB5P 2WAEA 3SH9A 2W0NA 4DXCA 2WKEA 5L09A 3DWZA 3IT9A 1L0FA 3SS4A 4HH2A 3T4QA 1K56D 4OPRA 4KZ3A 2ZMVA 4KQQA 1FCNA 3F1OB 5GHXA 4CLCC 3ISGA 2I72A 3PBNA 5GLCA 3UNWA 2Q0OA 3QP4A 1MPLA 5HSQA 3FG8A 3QP5A 1OPXA 4WUJA 4GB7A 5JYPA 3HJIA 3CLOA 3PTEA 4BWIA 3N8RA 5BOHA 3UE0A 1IFQA 4GW9A 2EX9A 1K57A 3ZFZA 3BQ8A 3F1NB 2L1MA 1ERQA 2P7JA 2ZC7A 5HX9A 4Y0UA 4E6WA 3EQUA 5CTMA 1DP9A 4KG2A 1F5MA 4PHTA 1O7EA 2GX5A 2PR5A 4S2LA 1OTDA 5G4ZA 4HP9A 5HD5A 1VQQA 2W1TB 1O07A 1T19A 2FFYA 1BLHA 1PI4A 3GTCA 3H82B 4FTXA 3AGEA 4WELA 1GHPA 3BWLA 5HDSA 3ZG7B 1G28A 1NZUA 1PW8A 2RL3A 5A93A 5EVIB 4HBUA 2DCFA 5HAIA 5E2EA 2ZC5B 3GR2A 3IF6A 5J4EA 3A3EA 4KQDA 4JPMA 1I5QA 2A2LA 4EESA 5IT5A 2P04A 1CI9A 3A3IA 3IH8A 2W3GA 3HLGA 2Z2LB 2QJ7A 5M18A 3D9YA 4JXGA 2E8JA 4P87A 4C75A 3K3DA 2M7VA 4NK3A 3LY4A 3G30A 3NOPC 4GJ4A 2JKTI 1G5UA 1XFNA 3GDIA 3MQ0A 2V1AA 1TS8A 2PR6A 3IS2A 4EWFA 4YINA 4JXWA 4HNBA 1NY0A 4NETA 4GHIB 5TBMB 5L10A 1K4FA 4KZ6A 5AVEA 3WWXA 3V3SA 1L0GA 3ZG5A 4OOYA 2PD7A 3VE3A 3ZG8B 4KZBA 3H9WA 2Y2LA 4P6ZS 1JWZA 5CGXA 2ZMFA 3MXRA 4B88A 1KOUA 2B18A 4BENA 3QNBA 3M2JA 5FQIA 2Q9NA 3T4JA 4KZAA 5FDHA 3SS3A 2M1CA 5HZHA 4I5SA 2V0UA 1IYPA 2VV6A 1TD5A 3HUNA 1ODVA 4II7A 4LV0A 3IF6C 4ZBEA
chains in the Genus database with same CATH topology
3KSGA 3LIBA 1T18A 3LYXA 2DMWA 2W3HA 2GJ3A 2PYPA 2VX8A 3LR0A 1H8MA 2Y79A 4BBUA 3OCLA 4H6JB 4NKPA 3VE4A 1N9OA 2JHEA 2L0WA 4O0PA 3ZQ5A 2QJ5A 4HOIA 1S67L 4ZRRA 1NLYA 2VLGA 3O5YA 4F3LA 2KOIA 3IS2B 3PBOA 4JGRA 3KSHA 2K2NA 2OAQ1 3HCYA 5F68A 5J3WA 5J7EA 1S4RA 1OTBA 4HJ3A 5F6AA 4L9EA 3S7QA 3PXPA 3KSFA 3TJZC 4HP4A 3EEHA 4LLOB 2K7SA 2A24A 4OOLA 4I39A 3ICYA 4EQ1A 3OC2A 5TJJA 4XT2B 3FC7A 3F1NA 4ARZB 1LSVA 1XFQA 4B93A 2OWJA 3OCNA 2O0YA 4G3WA 4UQIM 4YWZA 1F9IA 3T4LA 3GECA 3H7WA 5K5BA 1DP8A 4UEYA 1LL8A 2FZ0A 3UB6A 3EOIA 2LB9A 3LR3A 4KUKA 4Y5FA 3S7OA 1LSXA 1OT6A 3KYQA 3P01A 2KDKA 5F5YA 5IS1A 4P6ZM 2IA2A 3NOTC 3JVUA 5HPFA 3LFVA 2ZBBA 4HH3A 4UQIS 4WN5A 4EETB 3F1PB 2QHKA 2VKSA 3RTYA 4NXFA 2K31A 1LSWA 3BW6A 1F98A 1P9WA 2D02A 3IBJA 4G3VA 2YKFA 3R7WB 2V1BA 2GNXA 3UMDA 2J3TC 2EA9A 2EWWA 1OTEA 2VA0A 1IOUA 5IU1A 4F3LB 3T4SA 5DFXA 1UWPX 4PKYA 3UB7A 5F69A 1TF1A 2Y8HA 4IUKA 4MDZA 2J3WA 2M7UA 1GSWA 1VB6A 1S1ZA 4WF0A 1T1AA 2O99A 4NXBA 2ZOIA 4DJ3A 2HF6A 2A24B 2PDRA 3EQVA 1P9RA 4FOFA 3K2NA 2YKHA 1WA9A 5HWWA 2I9VA 3E4OA 3KYZA 3PR6A 5EFWA 5DJTA 5KSHA 2OOLA 2WKPA 2JKRM 3B47A 1TS7A 5AJGA 4R38A 2W27A 2G7UA 4WLAA 3F1OA 1W63M 2KX6A 4YOFA 3UE3A 1V9YA 4EEUA 3OLOA 2HJEA 1TS6A 3T4KA 1OTIA 4MCWA 3TE8A 5DJUA 3C38A 2QKPA 1T1CA 5TBMA 4R70A 1OJ5A 1N9LA 4O8GA 4GS9A 3R4KA 4BMWA 3ULFA 1DP6A 4CLCE 2BASA 2R78A 4LRZE 3V67A 4WEJA 2VJWA 3EGXC 4I38A 5A8BA 3NJAA 5AVFA 4CQHA 4DMZA 1YSPA 3UB9A 4EXOA 3LI9A 4OOMA 1OT9A 2JKRI 1P97A 2XA7M 4HJ6A 4JGQA 3UB8A 1XJ2A 2HGVA 5DKLA 4KQOA 5CX7A 4DJ2A 3OOVA 4FSFA 4BJPA 1ZHHB 4MN7A 3NOUC 1W63Q 4Q0IA 3BJNA 3MQQA 2KLIA 2EWVA 5HDDA 3LICA 2H28A 4EERA 1DRMA 1YAXA 2O9AA 4WEKA 1XJ4A 3C8CA 3RFBA 3KSIA 3LUQA 3B33A 3PBTA 2W0NA 4HQAA 1XJ6A 5KIZA 3BQAA 2XA7S 2WKRA 3E98A 1OTAA 2W1TA 3PBRA 4MN6A 4NEED 4HH2A 3T4QA 3TRCA 2OAP1 1MKMA 2ZMVA 5C5KA 1NWZA 4O01A 3F1OB 3LIEA 4CLCC 1GSXA 3H82A 3HJKA 4H6JA 3PBNA 2Z6CA 3TW8A 4RQ9A 2PYRA 4I3IA 4PAUA 1P0ZA 3LIFA 2PD8A 2W3DA 4EEPA 5HSQA 3FG8A 2LB5A 2L4RA 1OPXA 3UE6A 4L9GA 3DBAA 4WUJA 4GS9B 2QYBA 3U2AA 2W3FA 3HJIA 2XRNA 3CWFA 3CLOA 4KUOA 1MZUA 3JVVA 4E04A 4BWIA 3RH8B 4L0LA 4XT2A 4GLQA 3E4PA 4CLCA 3C2WA 4HY8A 4PKYG 3G6OA 5HPIA 4ARZA 4GCZA 5DFYA 3KX0X 1IFQA 4GW9A 3PBQA 1D7EA 3BQ8A 3F1NB 2L1MA 1BYWA 4HJ4A 1N9NA 1TS0A 4JGOA 2XROA 2P7JA 3D72A 4ETXA 3H7WB 4B9OA 1YSQA 3EQUA 1ZTUA 3CI6A 5DKKA 3LR5A 2XSSA 3LIAA 4LRXC 3NHQA 2FH5A 3CAXA 2VGLS 1DP9A 2VZWA 4M4XA 3VOLA 1F5MA 3A0RA 4PHTA 3PHYA 3FPWA 4I3JA 2GX5A 2PR5A 3IBRA 1OTDA 4ME4A 1EW0A 4YNRA 3EWKA 3OBFA 4L9FA 5G4ZA 4HP9A 5HD5A 2J80A 2Z6DA 3MXQA 2W1TB 1XJ3A 1VHMA 4GHIA 3P7NA 4HI4A 1T19A 1MC0A 1S66L 4I3AA 3KO6A 2V9AA 4Y2FA 2CMNA 3MJQA 3R7WA 3H82B 3UMEA 3PYPA 5L8MA 1YKDA 4WELA 2O9BA 3BWLA 5HDSA 1G28A 5FL3A 1NLZA 3MQOA 4CLCD 2B02A 2JKTM 5HL6A 3B42A 3C30A 4HHDA 4ETZA 1JNUA 4NXGA 1S4SA 2OWHA 2VV8A 5I5LA 1Y28A 2J3TD 2MJ6A 3A0SA 4G3KA 4Y3IA 4IUHA 2QWSA 5J4EA 2NUTC 4KQDA 4EESA 2A2LA 5IT5A 5LBRA 2P04A 4CLCB 4QPRA 4EU0A 1T1BA 5G4YA 2JN7A 2PT7A 4Q0HA 4LRYC 2GZAA 2W3GA 1GSVA 2QJ7A 2V0WA 4Z1WA 3ZYTA 2P08A 3T50A 3K3DA 3LI8A 2M7VA 4LPZA 2INWA 4BBTA 2WKQA 3NOPC 4EUVA 4GJ4A 2JKTI 3BY8A 3CUEC 1S1YA 2HJ9C 3T4OA 4IHQA 1UGUA 3EEAA 1XFNA 3GDIA 3MQ0A 2V1AA 4AFIA 1TS8A 2PR6A 3IS2A 4R3AA 3LR4A 1UWNX 4HNBA 5HWTA 3E0YA 5HWVA 2ZOHA 4GHIB 5TBMB 3SW1A 5DF9A 4WL9A 4JGPA 3A0VA 5AVEA 3S7PA 1D06A 2VGLM 2W1RA 2W3EA 3CUEA 3BY9A 2PD7A 4NXEA 4MN5A 3VE3A 3H9WA 3MR0A 5HD3A 1STZA 4P6ZS 3D3OA 5HDCA 3MFXA 1LT0A 2NUPC 4K08A 2ZMFA 2VV7A 4EW7A 2O9CA 2VEAA 1KOUA 4R6LA 4MMNA 1G6OA 3PBSA 2B18A 5MC7A 2D01A 3E4QA 3T4TA 3LIDA 4DN0A 3W2ZA 3FPVA 4IJGA 3T4JA 2HV1A 4BBVA 1H3QA 1OJGA 2M1CA 4Q0JA 3MF0A 2PHYA 3VV4A 4I5SA 3S7NA 5HZHA 2V0UA 3MMHA 3EGDC 4HIAA 2VV6A 1TD5A 3F1PA 1ODVA 4II7A 3CITA 1X0OA 3K3CA 1V9ZA 1NRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIB A;  1T18 A;  3LYX A;  2GJ3 A;  2PYP A;  4BBU A;  4H6J B;  3VE4 A;  1N9O A;  2JHE A;  2L0W A;  3ZQ5 A;  2QJ5 A;  4HOI A;  1S67 L;  2VLG A;  4F3L A;  3IS2 B;  4JGR A;  5F68 A;  5J3W A;  5J7E A;  1S4R A;  1OTB A;  4HJ3 A;  5F6A A;  4L9E A;  4HP4 A;  3EEH A;  4LLO B;  2K7S A;  2A24 A;  4I39 A;  3ICY A;  4EQ1 A;  4XT2 B;  3FC7 A;  3F1N A;  1LSV A;  1XFQ A;  2OWJ A;  4YWZ A;  1F9I A;  3GEC A;  3H7W A;  1DP8 A;  1LL8 A;  3UB6 A;  4KUK A;  1LSX A;  1OT6 A;  5F5Y A;  2KDK A;  5IS1 A;  3NOT C;  2ZBB A;  4HH3 A;  4WN5 A;  4EET B;  3F1P B;  2QHK A;  3RTY A;  4NXF A;  1LSW A;  1F98 A;  2D02 A;  2YKF A;  2V1B A;  3UMD A;  2EA9 A;  1OTE A;  5IU1 A;  4F3L B;  1UWP X;  3UB7 A;  4PKY A;  5F69 A;  1GSW A;  1VB6 A;  1S1Z A;  4WF0 A;  1T1A A;  4NXB A;  2ZOI A;  4DJ3 A;  2A24 B;  2PDR A;  2YKH A;  1WA9 A;  5HWW A;  2I9V A;  3E4O A;  5EFW A;  5DJT A;  2OOL A;  2WKP A;  1TS7 A;  4R38 A;  2W27 A;  4WLA A;  3F1O A;  2KX6 A;  1V9Y A;  4EEU A;  3OLO A;  1TS6 A;  1OTI A;  5DJU A;  2QKP A;  1T1C A;  5TBM A;  4R70 A;  1OJ5 A;  1N9L A;  4GS9 A;  3ULF A;  1DP6 A;  2BAS A;  2R78 A;  4LRZ E;  4I38 A;  5A8B A;  3NJA A;  5AVF A;  3UB9 A;  4EXO A;  3LI9 A;  1OT9 A;  1P97 A;  4HJ6 A;  4JGQ A;  3UB8 A;  1XJ2 A;  5DKL A;  4DJ2 A;  3NOU C;  3MQQ A;  5HDD A;  3LIC A;  2H28 A;  4EER A;  1DRM A;  1XJ4 A;  3C8C A;  3LUQ A;  3B33 A;  2W0N A;  4HQA A;  1XJ6 A;  5KIZ A;  2WKR A;  1OTA A;  4MN6 A;  4HH2 A;  1NWZ A;  3F1O B;  3LIE A;  1GSX A;  3H82 A;  3HJK A;  4H6J A;  2Z6C A;  4RQ9 A;  2PYR A;  4I3I A;  1P0Z A;  3LIF A;  2PD8 A;  4EEP A;  5HSQ A;  3FG8 A;  2L4R A;  3UE6 A;  4L9G A;  4WUJ A;  4GS9 B;  3HJI A;  3CWF A;  3CLO A;  4KUO A;  1MZU A;  4E04 A;  3RH8 B;  4XT2 A;  3E4P A;  3C2W A;  4HY8 A;  4PKY G;  3G6O A;  4GCZ A;  3KX0 X;  4GW9 A;  1D7E A;  3F1N B;  2L1M A;  1BYW A;  4HJ4 A;  1N9N A;  1TS0 A;  4JGO A;  2P7J A;  3D72 A;  3H7W B;  4B9O A;  5DKK A;  4LRX C;  3LIA A;  3NHQ A;  3CAX A;  1DP9 A;  4M4X A;  3VOL A;  3A0R A;  3PHY A;  4I3J A;  2PR5 A;  3IBR A;  1OTD A;  1EW0 A;  3EWK A;  4L9F A;  5G4Z A;  4HP9 A;  5HD5 A;  2J80 A;  2Z6D A;  3MXQ A;  1XJ3 A;  4GHI A;  3P7N A;  4HI4 A;  1T19 A;  1S66 L;  4I3A A;  2V9A A;  2CMN A;  3MJQ A;  3H82 B;  3UME A;  3PYP A;  3BWL A;  5HDS A;  1G28 A;  3MQO A;  2B02 A;  4HHD A;  1JNU A;  4NXG A;  1S4S A;  2OWH A;  2VV8 A;  5I5L A;  1Y28 A;  3A0S A;  2QWS A;  5J4E A;  4KQD A;  4EES A;  1T1B A;  5G4Y A;  2JN7 A;  4LRY C;  1GSV A;  2QJ7 A;  2V0W A;  3T50 A;  3K3D A;  3LI8 A;  4LPZ A;  2INW A;  4BBT A;  2WKQ A;  3NOP C;  3BY8 A;  1S1Y A;  1UGU A;  1XFN A;  3GDI A;  2V1A A;  1TS8 A;  2PR6 A;  3IS2 A;  4R3A A;  1UWN X;  4HNB A;  5HWT A;  5HWV A;  2ZOH A;  4GHI B;  5TBM B;  3SW1 A;  4WL9 A;  4JGP A;  3A0V A;  5AVE A;  1D06 A;  3BY9 A;  2PD7 A;  4NXE A;  4MN5 A;  3VE3 A;  3H9W A;  3MR0 A;  5HD3 A;  5HDC A;  3MFX A;  1LT0 A;  4K08 A;  2VV7 A;  4EW7 A;  2VEA A;  1KOU A;  4R6L A;  2D01 A;  3E4Q A;  3LID A;  2HV1 A;  4BBV A;  1OJG A;  2M1C A;  2PHY A;  5HZH A;  4I5S A;  2V0U A;  4HIA A;  2VV6 A;  3F1P A;  1ODV A;  1X0O A;  3K3C A;  1V9Z A; 
#chains in the Genus database with same CATH topology
 1MWT A;  3LYX A;  2DMW A;  4JBF A;  1BLP A;  3LR0 A;  3OCL A;  4E3K A;  1GHI A;  4H6J B;  5E2F A;  3C7U A;  2VLG A;  1ES5 A;  1FQG A;  4JGR A;  1NZO A;  1I2S A;  2VK3 A;  3BFD A;  2K2N A;  2OAQ 1;  2OSU A;  5F68 A;  5J3W A;  5J7E A;  2JBF A;  4HJ3 A;  3ZNT A;  3KSF A;  4OQI A;  1YT4 A;  4I39 A;  2VGK A;  3ICY A;  1E25 A;  5FI6 A;  4EQ1 A;  3OC2 A;  1XA1 A;  5TJJ A;  2V2F F;  3T1X A;  4ARZ B;  4B93 A;  1HTZ A;  1MWU A;  1F9I A;  4N1H A;  4EBL A;  1FOF A;  4MBH A;  5EE8 A;  2UV0 E;  3UB6 A;  3LR3 A;  3IHB A;  5CHM A;  4XUZ A;  4Y5F A;  2WAD A;  4Z9Q A;  3Q7V A;  4P6B A;  5F82 A;  4N1X A;  2EX6 A;  2C5W B;  3IQA A;  5F5Y A;  4LV2 A;  4ZTK A;  5CEB A;  1FR6 A;  2XF3 A;  2WGW B;  3LFV A;  2WK0 A;  1JWP A;  3G2Z A;  4KZ7 A;  4OON A;  4WN5 A;  4K0W A;  3L9K A;  5FAS A;  3BFC A;  3ITA A;  4S2M A;  2V1B A;  2PBD P;  1OTE A;  2VA0 A;  3OPH A;  3UB7 A;  3WS4 A;  4IUK A;  1ACF A;  1VB6 A;  2Y2H A;  2O99 A;  2HF6 A;  2P9V B;  1CQA A;  2PDR A;  1SHV A;  3VOZ A;  2YKH A;  5HWW A;  2J8Y A;  3G32 A;  3MZE A;  2WYX A;  3UE1 A;  1K55 A;  1K0K A;  3TG9 A;  5KSH A;  4LV1 A;  2JKR M;  3B47 A;  5HAQ A;  5AJG A;  1IEL A;  1G68 A;  3C7V A;  4YOF A;  3ITB A;  1E3U A;  2HJE A;  5DF8 A;  1JWV A;  1TS6 A;  3VP4 A;  1L3L A;  1OTI A;  3C5A A;  1T1C A;  4R70 A;  3CZD A;  3UDI A;  1KE0 A;  1JVJ A;  3NC8 A;  2BAS A;  3QNC A;  4LRZ E;  4QB8 A;  1YPR A;  5A8B A;  3BFE A;  4R3J A;  3LI9 A;  4OOM A;  4HJ6 A;  2ZL1 B;  2Y2O A;  3WS5 A;  2HGV A;  1ESU A;  5FAQ A;  2Y2K A;  5L07 A;  3GMW A;  1FIL A;  4Q0I A;  1W63 Q;  3HLE A;  3BJN A;  1SKF A;  2EWV A;  5HDD A;  1FR1 A;  1NYY A;  4S2N C;  4WEK A;  4D60 A;  3RFB A;  4U0T A;  3SS5 A;  3LEQ A;  2XR0 A;  1XJ6 A;  4LEN A;  1CI8 A;  4U3T A;  3PBR A;  4BL2 A;  3IXH A;  2OAP 1;  1MKM A;  3BLM A;  4RX2 A;  5HFO A;  5C5K A;  1NWZ A;  2R9W A;  3GSG A;  4GD6 A;  3DTK A;  4LCL A;  3MSH A;  1L0D A;  2PYR A;  4R23 A;  4IVI A;  5GLD A;  3HVF A;  3LIF A;  2W3D A;  3G35 A;  2LB5 A;  2QPN A;  3UE6 A;  3U2A A;  1ONH A;  2W3F A;  2XRN A;  4KUO A;  4E04 A;  3RH8 B;  4L0L A;  4Y0T A;  4CLC A;  1DJC A;  3C2W A;  4PKY G;  3A3D A;  3NIA A;  2Y2M A;  3S4X A;  3SZT A;  4IVK A;  2HZ5 A;  1D7E A;  2BG1 A;  4ZDX A;  4IBR A;  4KQR A;  5EV0 A;  4WZ4 A;  3U4L P;  4DE1 A;  1BLC A;  1TS0 A;  4JGO A;  4ETX A;  1IKI A;  2HP9 A;  5DVA A;  1ZTU A;  5DKK A;  4UHU A;  2XSS A;  3VMA A;  5E2G A;  3UPN A;  2H5S A;  2VZW A;  3CPT A;  3NBL A;  3DTE A;  2V20 A;  2HP6 A;  2ZQC A;  1EW0 A;  5F83 A;  1XJ3 A;  3IF5 A;  1H8Z A;  5AQA A;  1N9B A;  4I3A A;  4WM9 A;  4Y2F A;  2CMN A;  3R7W A;  3FV7 A;  5EEC A;  3UME A;  1PWC A;  5EOO A;  5FI7 A;  3CHW P;  3OPL A;  4XUX A;  2B02 A;  1K54 C;  2PU4 A;  5HL6 A;  3B42 A;  1YMX A;  4HHD A;  3W8K A;  1JNU A;  3O86 A;  4NXG A;  1D1J A;  1W7F A;  2OWH A;  2VV8 A;  5I5L A;  2J3T D;  3V50 A;  3A0S A;  4G3K A;  3OPP A;  4IUH A;  2V1Z A;  2HDS A;  4QPR A;  1T1B A;  4LRY C;  2GZA A;  1LHY A;  4UA7 A;  2ZQD A;  1AWI A;  4BD1 A;  3ZYT A;  1XGJ A;  2JC7 A;  3T1S A;  1XX2 A;  3VOY A;  4LPZ A;  3DW0 A;  3DWK A;  3VP0 A;  2Z2M B;  4ZJ3 A;  2JE5 A;  3WRT A;  2WKQ A;  4O7D A;  4EUV A;  3BY8 A;  4R4S A;  4QD4 A;  2HJ9 C;  1FCM A;  2Y2G A;  3T4O A;  3MZD A;  1WE4 A;  1PFL A;  4KZ4 A;  1ES2 A;  1UWN X;  4MLL A;  2E8I A;  2OV5 A;  3SW1 A;  2WKH A;  4ZJ2 A;  3A0V A;  1XPB A;  2HDU A;  3Q07 A;  2Y59 A;  1D06 A;  2VGL M;  1LL9 A;  1K6R A;  2Y2N A;  1JTG A;  3BY9 A;  4DDY A;  4KZ5 A;  1TDG A;  4NXE A;  4OP5 A;  4MN5 A;  3HLB A;  3MR0 A;  1LI9 A;  5J8X A;  4OQG A;  2NUP C;  1SDN A;  2VV7 A;  4BLM A;  1RGY A;  5F1G A;  4OPY A;  3IWO A;  1PZO A;  1G6O A;  3PBS A;  2V8F A;  2D01 A;  1MKI A;  3UPP A;  3PAE A;  3LID A;  3WS2 A;  3FPV A;  3MZF A;  3S22 A;  1H3Q A;  5CHJ A;  5CHU A;  2BTF P;  2B5R A;  3MMH A;  3EGD C;  4S2P A;  4N9L A;  3UDF A;  1MBL A;  3IWI A;  5EVI D;  3RXW A;  1V9Z A;  4PM9 A;  1TEM A;  1H8M A;  2AVX A;  4BBU A;  1PRQ A;  1K38 A;  3ZVT A;  4NKP A;  1N9O A;  2JHE A;  2L0W A;  4QY6 A;  3ZQ5 A;  2QJ5 A;  4HOI A;  4CJN A;  1K56 A;  3MS6 A;  3O5Y A;  2RCX A;  2KOI A;  3IS2 B;  4FUW A;  4ID4 A;  3PBO A;  4R4R A;  3KSH A;  3BEB A;  2C6W B;  2EXB A;  3HCY A;  3WS0 A;  1BTL A;  1OTB A;  3GVB A;  3TJZ C;  4HP4 A;  1SZV A;  3HUO A;  2A24 A;  1GA9 A;  4OPQ A;  1QME A;  3VP3 A;  4OVD A;  4XT2 B;  3SH8 A;  3F1N A;  1LSV A;  4GOG A;  2OWJ A;  3GEC A;  3CG5 A;  1DP8 A;  1WYC A;  2FZ0 A;  3EOI A;  2LB9 A;  4KUK A;  1PNE A;  5EVL A;  2DRW A;  5DTS A;  1GCE A;  3KYQ A;  5IS1 A;  1DY6 A;  5HPF A;  3JVU A;  4E3L A;  4HH3 A;  4UQI S;  5FQ9 A;  1LL5 A;  3UN7 A;  4S2I A;  1KDW A;  2IWB A;  3O88 A;  1IYS A;  2ZM2 A;  4P0M A;  3QP1 A;  1LSW A;  4GNU A;  1P9W A;  3QHY A;  2D02 A;  4GZB A;  2YKF A;  4EBP A;  5CXW A;  2OLU A;  3QP6 A;  2GNX A;  2R9X A;  3UMD A;  2J3T C;  3FYZ A;  4RVA A;  5M19 A;  2GDN A;  4PKY A;  2H0Y A;  4MDZ A;  2X02 A;  2HPB A;  2XEP A;  1T1A A;  3M2K A;  2JCH A;  5D3O A;  1K4E A;  3Q81 A;  4ZAM A;  4DRT A;  4MBK A;  3KYZ A;  4PPR A;  4DF6 A;  1SKO A;  2OOL A;  2WKP A;  2CC1 A;  4A5R A;  2W27 A;  5CGS A;  1HZO A;  2QMI A;  4UAA A;  3Q7V B;  4QJG A;  3P98 A;  1IYO A;  3C4P A;  3TE8 A;  4S2O A;  4BQM A;  5DJU A;  5FQM A;  5TBM A;  4O8G A;  4GS9 A;  5JYO A;  3ULF A;  1NYM A;  1BUL A;  3IX4 A;  2VJW A;  4OQ0 A;  2XK1 A;  2HDQ A;  3EGX C;  3IXD A;  3NJA A;  1KE4 A;  2ZQA A;  1ZC2 A;  4UA6 A;  2JKR I;  1IKG A;  2HP5 A;  3LCE A;  2XLN A;  4JGQ A;  3LEZ A;  4KZ9 A;  3UB8 A;  1Q2P A;  3NCK A;  2ZM8 A;  4FSF A;  4BJP A;  1ZHH B;  3NOU C;  2KLI A;  3N4I A;  4N9K A;  1YQS A;  1XJ4 A;  1BUE A;  2BLS A;  1ZKJ A;  4HQA A;  2WZZ A;  3B3X A;  5KIZ A;  4RA7 A;  3N8L A;  5EVI C;  3BQA A;  2XA7 S;  2EFX A;  3E98 A;  1OTA A;  4MN6 A;  2XQZ A;  1CEF A;  1PZP A;  3TRC A;  1GSX A;  2A3U A;  5FAP A;  3HJK A;  4H6J A;  4GD8 A;  4S2N A;  3TW8 A;  2Z6C A;  1HLU P;  1F2K A;  4RQ9 A;  5DF7 A;  4I3I A;  4PAU A;  3MKF A;  3O3V A;  1P0Z A;  5EPH A;  3OZH A;  2PD8 A;  2WGI A;  4L9G A;  2QYB A;  1C3B A;  3CWF A;  4X53 A;  1MZU A;  3JVV A;  5FA7 A;  4GLQ A;  3G6O A;  5E43 A;  4ARZ A;  5HPI A;  4GCZ A;  5DFY A;  3KX0 X;  4QY5 A;  5FI2 A;  4DE0 A;  1MY8 A;  4E3M A;  5HL1 A;  1N9N A;  3BFG A;  2WAF A;  3H7W B;  3IXG A;  4B9O A;  4HBT A;  1L2S A;  3CI6 A;  4WYY A;  4WMC D;  2DNS A;  4LRX C;  3LIA A;  3NHQ A;  2FH5 A;  3CAX A;  2VGL S;  2PBY A;  3VOL A;  4HEF A;  3A0R A;  1VEU A;  1ZG6 A;  3AGF A;  3PHY A;  3FPW A;  4I3J A;  2WGW A;  4ME4 A;  4YNR A;  5CRF A;  3EWK A;  3OBF A;  2J80 A;  2Z6D A;  3P7N A;  4KG5 A;  3CJM A;  5A90 A;  3W4Q A;  3WS1 A;  1FCO A;  1IEM A;  1KGE A;  5L8M A;  5G18 A;  2O9B A;  3BRM A;  4MEZ A;  5FL3 A;  2OLV A;  1NLZ A;  2QZ6 A;  4CLC D;  3VP1 A;  3C30 A;  5HAR A;  4OLD A;  2ZLY A;  4ETZ A;  3LO7 A;  1Y28 A;  4GDB A;  2MJ6 A;  1ES4 A;  2P9V A;  2QWS A;  4BD0 A;  2G2U A;  2NUT C;  5LBR A;  4CLC B;  1XKZ A;  3VP2 A;  5M1A A;  1RGZ A;  2JN7 A;  4Q0H A;  1GSV A;  4HES A;  2EX8 A;  2V0W A;  3Q82 A;  1K54 A;  1XP4 A;  3W4P A;  4Z1W A;  1BT5 A;  3T50 A;  2XDM A;  5FSR A;  5HW3 A;  3CUE C;  1S1Y A;  1Y54 A;  4IHQ A;  1UGU A;  4WZ5 C;  3G31 A;  3CPT B;  2PRF A;  4KG6 A;  4OLG A;  4AFI A;  2JKG A;  2Y2J A;  5HWT A;  3E0Y A;  5GLB A;  3V3R A;  2ZOH A;  4OP8 A;  5DF9 A;  4DXB A;  4IED A;  4JGP A;  4GDN A;  3BEC A;  2WZX A;  5E2H A;  1RP5 A;  4Y7P A;  3UY6 A;  4E6X A;  5KMW A;  4OQH A;  4Y13 A;  4EW7 A;  2O9C A;  3ZVW A;  2V8C A;  3TSG A;  4FCF A;  1DJB A;  2VEA A;  4R6L A;  2ZQ9 A;  3VFF A;  2G2W A;  3S1Y A;  4MBF A;  3E4Q A;  3T4T A;  4DN0 A;  4IJG A;  2EX2 A;  4LGW A;  4BBV A;  1OJG A;  4X1L A;  3W4O A;  3MF0 A;  3VV4 A;  3S7N A;  1PYY A;  3UO9 A;  1ERM A;  4C3Q A;  2WKI A;  3DTI A;  4F94 A;  4HIA A;  1I2W A;  3F1P A;  5AQ9 A;  4JLF A;  3HRE A;  3CIT A;  1X0O A;  3K3C A;  1NRJ A;  5TGF A;  3HUM A;  3UPO A;  3KSG A;  1T18 A;  3T1R A;  2W3H A;  3MBZ A;  2GJ3 A;  1KDS A;  4Y15 A;  3FZC A;  3T12 B;  2ACG A;  1Y4O A;  4O0P A;  1S67 L;  1NLY A;  3M6B A;  3HLF A;  4F3L A;  3FKV A;  1S4R A;  5F6A A;  4L9E A;  3S7Q A;  3PXP A;  1K25 A;  1PW1 A;  3ZCZ A;  4E3I A;  1RCJ A;  1ESI A;  3MKE A;  2XH9 A;  3DAV A;  3HLD A;  2ZQ8 A;  4R3B A;  1YLZ A;  3NY4 A;  3FC7 A;  3RJU A;  1XFQ A;  2O0Y A;  4G3W A;  1XA7 A;  4CPK A;  3T4L A;  1VET A;  5K5B A;  4UEY A;  1S0W A;  1LL8 A;  1YMS A;  3ZDJ A;  1M40 A;  1AXB A;  2KDK A;  2IA2 A;  3NOT C;  2X71 A;  1TVF A;  3T1Q B;  1W79 A;  2ZBB A;  1LI0 A;  4X6T A;  1K6S A;  1W5D A;  1NXY A;  2VKS A;  1FSY A;  2K31 A;  3BW6 A;  1XXM A;  3P09 A;  1W8Y A;  1HD8 A;  2Y2I A;  5FAO A;  3UDX A;  4R1G A;  2EA9 A;  2ZC3 B;  2EWW A;  1IOU A;  5IU1 A;  3BLS A;  5DFX A;  4B4Z A;  2ZJ9 A;  4JXV A;  2Y8H A;  2J3W A;  1GSW A;  3FWL A;  4NXB A;  2A24 B;  3IX8 A;  3IF6 B;  1JTD A;  1P9R A;  3K2N A;  5FQJ A;  2WUQ A;  4QHC A;  4U0X A;  5DJT A;  3WRZ A;  3RXX A;  5U47 A;  4R38 A;  2G7U A;  3IWQ A;  4WLA A;  3F1O A;  1W63 M;  2KX6 A;  3UE3 A;  4FH4 A;  1J3W A;  4RX3 A;  3OLO A;  4N92 A;  2P74 A;  3JPU A;  4PM8 A;  3BFF A;  4PMA A;  4MCW A;  2J7V A;  1YLP A;  2QKP A;  1OJ5 A;  3R4K A;  1YLY A;  1BZA A;  5EUA A;  1DP6 A;  2R78 A;  1E4D A;  1XGI A;  4WEJ A;  4NG2 A;  1KVM A;  1G6A A;  4DMZ A;  1Z6F A;  3UB9 A;  1IYQ A;  4EXO A;  1OT9 A;  3V39 A;  1P97 A;  1BLS A;  1XJ2 A;  3NDG A;  2PAV P;  3JYI A;  4MN7 A;  5EM1 A;  3M6H A;  3MQQ A;  3PAG A;  3G34 A;  4JKT A;  4JF6 A;  3ZG0 A;  4EER A;  1DRM A;  3C8C A;  2H0T A;  1EWZ A;  3PBT A;  4K91 A;  5FQQ A;  3KYE A;  2WKR A;  2W1T A;  1SKO B;  4NEE D;  2Y55 A;  1ZG4 A;  4O01 A;  3LIE A;  3H82 A;  3ZNY A;  4KEN B;  3N8S A;  3HL9 A;  3VSL A;  1K57 C;  1H8Y A;  2X01 A;  4GN2 A;  5GLA A;  1KVL A;  5AQB A;  5EVI A;  5FDS A;  3D4F A;  4EEP A;  2L4R A;  2XFT A;  3A3J A;  3DBA A;  4GS9 B;  3BM6 A;  1OME A;  2B95 A;  3HBR A;  3NI9 A;  3HLW A;  4XT2 A;  3E4P A;  4HY8 A;  4C6Y A;  3IHA A;  4Y17 A;  3PBQ A;  1ERO A;  2Y2P A;  1BYW A;  1PWG A;  4HJ4 A;  1J9M A;  3BYD A;  2XRO A;  3D72 A;  5GHY A;  5FQK A;  4DDS A;  1YSQ A;  1H5X A;  1WYB A;  1PIO A;  1Q2Q A;  3LR5 A;  4M4X A;  3VFH A;  3TOI A;  3IBR A;  5GL9 A;  4ESP A;  4IBX A;  4L9F A;  3NEC A;  2J9O A;  3ZHH A;  3MXQ A;  4GHI A;  1VHM A;  4HI4 A;  4BL3 A;  1MC0 A;  1S66 L;  4RYE A;  3KO6 A;  3NUL A;  2V9A A;  3MJQ A;  3LGO A;  2Q9M A;  3PYP A;  4DE2 A;  1YKD A;  1M6K A;  4E3J A;  5L2F A;  3MQO A;  2FFF B;  2JKT M;  2UWX A;  5EOE A;  1PWD A;  1GHM A;  1S4S A;  5IHV A;  4X25 A;  3L7H A;  4X55 A;  4Y3I A;  1YLW A;  4MNR A;  1H0M A;  4EQI A;  5CER A;  1PI5 A;  4EU0 A;  5G4Y A;  2PT7 A;  3A3F A;  4E3O A;  2EFU A;  1E3U D;  3QP2 A;  4P85 A;  4ZJ1 A;  2P08 A;  3LI8 A;  2XD1 A;  2INW A;  2ZMA A;  4BBT A;  4H8R A;  2ZC4 B;  5I94 A;  3EEA A;  1CF0 A;  1HVB A;  2ZM0 A;  4PM6 A;  1VEU B;  3LY3 A;  5EM0 A;  3C4O A;  4R3A A;  3LR4 A;  5HWV A;  3E2K A;  3GQZ A;  4WL9 A;  3Q7Z A;  1DJA A;  1FSW A;  3S7P A;  5A92 A;  3MFD A;  2W1R A;  2W3E A;  1L0E A;  3CUE A;  1S6R A;  4WZ5 A;  2J9P A;  3SOI A;  4KZ8 A;  1U60 A;  5HD3 A;  1STZ A;  3D3O A;  5HDC A;  3MFX A;  1LT0 A;  1Z09 A;  2ZQ7 A;  1CEG A;  2IWC A;  4K08 A;  2VGJ A;  4M3K A;  4MMN A;  2PU2 A;  5CEC A;  4WBG A;  5MC7 A;  3FKW A;  3W2Z A;  2HV1 A;  2ZD8 A;  4Q0J A;  4X68 A;  2PHY A;  1BSG A;  3IXB A;  4JF4 A;  3O87 A;  3E2L A;  1ES3 A;  1FIK A;  3GV9 A;  4K0X A;  1A0K A;  3LIB A;  1QMF A;  4GKU A;  2PYP A;  2VX8 A;  2Y79 A;  1YLJ A;  3VE4 A;  5TFQ A;  4ZRR A;  4FD8 A;  1NRF A;  5F1F A;  4EBN A;  3EEH A;  4LLO B;  3AGD A;  2K7S A;  4OOL A;  1LLB A;  3N7W A;  2Y4A A;  5DTK A;  2Y2Q A;  2IWD A;  1W8Q A;  2XGN A;  3OCN A;  4LCM A;  3N6I A;  4UQI M;  4YWZ A;  5A91 A;  3G2Y A;  3H7W A;  2XD5 A;  5AQ7 A;  4E3N A;  5FEF A;  3S7O A;  1LSX A;  1OT6 A;  3P01 A;  1MXO A;  4PM7 A;  3ZG9 B;  4DE3 A;  4YFM A;  4P6Z M;  2HDR A;  4WMC A;  4S2K A;  5CED A;  3SH7 A;  4X1M A;  1ALQ A;  4EET B;  3F1P B;  1VM1 A;  2QHK A;  3IH9 A;  4EUZ A;  3RTY A;  4NXF A;  2EXA A;  5EVE A;  3I7J A;  1F98 A;  4R0Q A;  3IBJ A;  1YLT A;  4G3V A;  3R7W B;  1SCW A;  5KSC A;  1KGF A;  4OKP A;  1CK3 A;  5CGW A;  2ZL1 A;  5TR7 A;  3IX3 A;  4DKI A;  3GRJ A;  1K55 C;  4F3L B;  5CTN A;  3T4S A;  1UWP X;  5F69 A;  1TF1 A;  2M7U A;  1YM1 A;  1S1Z A;  3MXS A;  4WF0 A;  5GHZ A;  1ONG A;  2ZOI A;  4FH2 A;  4DJ3 A;  1MWR A;  2A49 A;  3EQV A;  4FOF A;  3VSK A;  4LV3 A;  1WA9 A;  1N4O A;  4S2J A;  1TDL A;  2I9V A;  3Q1F A;  3E4O A;  1GA0 A;  4LFU A;  5FEG A;  3PR6 A;  5EFW A;  4OH0 A;  1EI5 A;  3V5M A;  3NDE A;  1VET B;  1TS7 A;  4X69 A;  4JF5 A;  3HLC A;  4QWO A;  5FAT A;  4X56 A;  2WGV A;  5DTT A;  3G4P A;  5HAP A;  3ZGA B;  1V9Y A;  4EEU A;  3CMZ A;  5KZH A;  3OPR A;  4OPZ A;  3T4K A;  4B4X A;  3C38 A;  1MWS A;  4XXR A;  1N9L A;  4BMW A;  4EV4 A;  4CLC E;  3V67 A;  1CJF A;  4UA9 A;  2H10 A;  1NJ4 A;  4I38 A;  5AVF A;  4Q8I A;  2ZC6 B;  4CQH A;  2XFS A;  1YSP A;  1SDE A;  2XA7 M;  2Y91 A;  1KE3 A;  4Y0O A;  4D2O A;  5DKL A;  4PM5 A;  4KQO A;  5CX7 A;  4JXS A;  4DJ2 A;  3OOV A;  1KGG A;  2JKF A;  3LIC A;  2H28 A;  3DTM A;  2O9A A;  1YAX A;  3QP8 A;  3KSI A;  4QU3 A;  3LUQ A;  3B33 A;  3UB5 P;  2WAE A;  3SH9 A;  2W0N A;  4DXC A;  2WKE A;  5L09 A;  3DWZ A;  3IT9 A;  1L0F A;  3SS4 A;  4HH2 A;  3T4Q A;  1K56 D;  4OPR A;  4KZ3 A;  2ZMV A;  4KQQ A;  1FCN A;  3F1O B;  5GHX A;  4CLC C;  3ISG A;  2I72 A;  3PBN A;  5GLC A;  3UNW A;  2Q0O A;  3QP4 A;  1MPL A;  5HSQ A;  3FG8 A;  3QP5 A;  1OPX A;  4WUJ A;  4GB7 A;  5JYP A;  3HJI A;  3CLO A;  3PTE A;  4BWI A;  3N8R A;  5BOH A;  3UE0 A;  1IFQ A;  4GW9 A;  2EX9 A;  1K57 A;  3ZFZ A;  3BQ8 A;  3F1N B;  2L1M A;  1ERQ A;  2P7J A;  2ZC7 A;  5HX9 A;  4Y0U A;  4E6W A;  3EQU A;  5CTM A;  1DP9 A;  4KG2 A;  1F5M A;  4PHT A;  1O7E A;  2GX5 A;  2PR5 A;  4S2L A;  1OTD A;  5G4Z A;  4HP9 A;  5HD5 A;  1VQQ A;  2W1T B;  1O07 A;  1T19 A;  2FFY A;  1BLH A;  1PI4 A;  3GTC A;  3H82 B;  4FTX A;  3AGE A;  4WEL A;  1GHP A;  3BWL A;  5HDS A;  3ZG7 B;  1G28 A;  1NZU A;  1PW8 A;  2RL3 A;  5A93 A;  5EVI B;  4HBU A;  2DCF A;  5HAI A;  5E2E A;  2ZC5 B;  3GR2 A;  3IF6 A;  5J4E A;  3A3E A;  4KQD A;  4JPM A;  1I5Q A;  2A2L A;  4EES A;  5IT5 A;  2P04 A;  1CI9 A;  3A3I A;  3IH8 A;  2W3G A;  3HLG A;  2Z2L B;  2QJ7 A;  5M18 A;  3D9Y A;  4JXG A;  2E8J A;  4P87 A;  4C75 A;  3K3D A;  2M7V A;  4NK3 A;  3LY4 A;  3G30 A;  3NOP C;  4GJ4 A;  2JKT I;  1G5U A;  1XFN A;  3GDI A;  3MQ0 A;  2V1A A;  1TS8 A;  2PR6 A;  3IS2 A;  4EWF A;  4YIN A;  4JXW A;  4HNB A;  1NY0 A;  4NET A;  4GHI B;  5TBM B;  5L10 A;  1K4F A;  4KZ6 A;  5AVE A;  3WWX A;  3V3S A;  1L0G A;  3ZG5 A;  4OOY A;  2PD7 A;  3VE3 A;  3ZG8 B;  4KZB A;  3H9W A;  2Y2L A;  4P6Z S;  1JWZ A;  5CGX A;  2ZMF A;  3MXR A;  4B88 A;  1KOU A;  2B18 A;  4BEN A;  3QNB A;  3M2J A;  5FQI A;  2Q9N A;  3T4J A;  4KZA A;  5FDH A;  3SS3 A;  2M1C A;  5HZH A;  4I5S A;  2V0U A;  1IYP A;  2VV6 A;  1TD5 A;  3HUN A;  1ODV A;  4II7 A;  4LV0 A;  3IF6 C;  4ZBE A; 
#chains in the Genus database with same CATH homology
 3KSG A;  3LIB A;  1T18 A;  3LYX A;  2DMW A;  2W3H A;  2GJ3 A;  2PYP A;  2VX8 A;  3LR0 A;  1H8M A;  2Y79 A;  4BBU A;  3OCL A;  4H6J B;  4NKP A;  3VE4 A;  1N9O A;  2JHE A;  2L0W A;  4O0P A;  3ZQ5 A;  2QJ5 A;  4HOI A;  1S67 L;  4ZRR A;  1NLY A;  2VLG A;  3O5Y A;  4F3L A;  2KOI A;  3IS2 B;  3PBO A;  4JGR A;  3KSH A;  2K2N A;  2OAQ 1;  3HCY A;  5F68 A;  5J3W A;  5J7E A;  1S4R A;  1OTB A;  4HJ3 A;  5F6A A;  4L9E A;  3S7Q A;  3PXP A;  3KSF A;  3TJZ C;  4HP4 A;  3EEH A;  4LLO B;  2K7S A;  2A24 A;  4OOL A;  4I39 A;  3ICY A;  4EQ1 A;  3OC2 A;  5TJJ A;  4XT2 B;  3FC7 A;  3F1N A;  4ARZ B;  1LSV A;  1XFQ A;  4B93 A;  2OWJ A;  3OCN A;  2O0Y A;  4G3W A;  4UQI M;  4YWZ A;  1F9I A;  3T4L A;  3GEC A;  3H7W A;  5K5B A;  1DP8 A;  4UEY A;  1LL8 A;  2FZ0 A;  3UB6 A;  3EOI A;  2LB9 A;  3LR3 A;  4KUK A;  4Y5F A;  3S7O A;  1LSX A;  1OT6 A;  3KYQ A;  3P01 A;  2KDK A;  5F5Y A;  5IS1 A;  4P6Z M;  2IA2 A;  3NOT C;  3JVU A;  5HPF A;  3LFV A;  2ZBB A;  4HH3 A;  4UQI S;  4WN5 A;  4EET B;  3F1P B;  2QHK A;  2VKS A;  3RTY A;  4NXF A;  2K31 A;  1LSW A;  3BW6 A;  1F98 A;  1P9W A;  2D02 A;  3IBJ A;  4G3V A;  2YKF A;  3R7W B;  2V1B A;  2GNX A;  3UMD A;  2J3T C;  2EA9 A;  2EWW A;  1OTE A;  2VA0 A;  1IOU A;  5IU1 A;  4F3L B;  3T4S A;  5DFX A;  1UWP X;  4PKY A;  3UB7 A;  5F69 A;  1TF1 A;  2Y8H A;  4IUK A;  4MDZ A;  2J3W A;  2M7U A;  1GSW A;  1VB6 A;  1S1Z A;  4WF0 A;  1T1A A;  2O99 A;  4NXB A;  2ZOI A;  4DJ3 A;  2HF6 A;  2A24 B;  2PDR A;  3EQV A;  1P9R A;  4FOF A;  3K2N A;  2YKH A;  1WA9 A;  5HWW A;  2I9V A;  3E4O A;  3KYZ A;  3PR6 A;  5EFW A;  5DJT A;  5KSH A;  2OOL A;  2WKP A;  2JKR M;  3B47 A;  1TS7 A;  5AJG A;  4R38 A;  2W27 A;  2G7U A;  4WLA A;  3F1O A;  1W63 M;  2KX6 A;  4YOF A;  3UE3 A;  1V9Y A;  4EEU A;  3OLO A;  2HJE A;  1TS6 A;  3T4K A;  1OTI A;  4MCW A;  3TE8 A;  5DJU A;  3C38 A;  2QKP A;  1T1C A;  5TBM A;  4R70 A;  1OJ5 A;  1N9L A;  4O8G A;  4GS9 A;  3R4K A;  4BMW A;  3ULF A;  1DP6 A;  4CLC E;  2BAS A;  2R78 A;  4LRZ E;  3V67 A;  4WEJ A;  2VJW A;  3EGX C;  4I38 A;  5A8B A;  3NJA A;  5AVF A;  4CQH A;  4DMZ A;  1YSP A;  3UB9 A;  4EXO A;  3LI9 A;  4OOM A;  1OT9 A;  2JKR I;  1P97 A;  2XA7 M;  4HJ6 A;  4JGQ A;  3UB8 A;  1XJ2 A;  2HGV A;  5DKL A;  4KQO A;  5CX7 A;  4DJ2 A;  3OOV A;  4FSF A;  4BJP A;  1ZHH B;  4MN7 A;  3NOU C;  1W63 Q;  4Q0I A;  3BJN A;  3MQQ A;  2KLI A;  2EWV A;  5HDD A;  3LIC A;  2H28 A;  4EER A;  1DRM A;  1YAX A;  2O9A A;  4WEK A;  1XJ4 A;  3C8C A;  3RFB A;  3KSI A;  3LUQ A;  3B33 A;  3PBT A;  2W0N A;  4HQA A;  1XJ6 A;  5KIZ A;  3BQA A;  2XA7 S;  2WKR A;  3E98 A;  1OTA A;  2W1T A;  3PBR A;  4MN6 A;  4NEE D;  4HH2 A;  3T4Q A;  3TRC A;  2OAP 1;  1MKM A;  2ZMV A;  5C5K A;  1NWZ A;  4O01 A;  3F1O B;  3LIE A;  4CLC C;  1GSX A;  3H82 A;  3HJK A;  4H6J A;  3PBN A;  2Z6C A;  3TW8 A;  4RQ9 A;  2PYR A;  4I3I A;  4PAU A;  1P0Z A;  3LIF A;  2PD8 A;  2W3D A;  4EEP A;  5HSQ A;  3FG8 A;  2LB5 A;  2L4R A;  1OPX A;  3UE6 A;  4L9G A;  3DBA A;  4WUJ A;  4GS9 B;  2QYB A;  3U2A A;  2W3F A;  3HJI A;  2XRN A;  3CWF A;  3CLO A;  4KUO A;  1MZU A;  3JVV A;  4E04 A;  4BWI A;  3RH8 B;  4L0L A;  4XT2 A;  4GLQ A;  3E4P A;  4CLC A;  3C2W A;  4HY8 A;  4PKY G;  3G6O A;  5HPI A;  4ARZ A;  4GCZ A;  5DFY A;  3KX0 X;  1IFQ A;  4GW9 A;  3PBQ A;  1D7E A;  3BQ8 A;  3F1N B;  2L1M A;  1BYW A;  4HJ4 A;  1N9N A;  1TS0 A;  4JGO A;  2XRO A;  2P7J A;  3D72 A;  4ETX A;  3H7W B;  4B9O A;  1YSQ A;  3EQU A;  1ZTU A;  3CI6 A;  5DKK A;  3LR5 A;  2XSS A;  3LIA A;  4LRX C;  3NHQ A;  2FH5 A;  3CAX A;  2VGL S;  1DP9 A;  2VZW A;  4M4X A;  3VOL A;  1F5M A;  3A0R A;  4PHT A;  3PHY A;  3FPW A;  4I3J A;  2GX5 A;  2PR5 A;  3IBR A;  1OTD A;  4ME4 A;  1EW0 A;  4YNR A;  3EWK A;  3OBF A;  4L9F A;  5G4Z A;  4HP9 A;  5HD5 A;  2J80 A;  2Z6D A;  3MXQ A;  2W1T B;  1XJ3 A;  1VHM A;  4GHI A;  3P7N A;  4HI4 A;  1T19 A;  1MC0 A;  1S66 L;  4I3A A;  3KO6 A;  2V9A A;  4Y2F A;  2CMN A;  3MJQ A;  3R7W A;  3H82 B;  3UME A;  3PYP A;  5L8M A;  1YKD A;  4WEL A;  2O9B A;  3BWL A;  5HDS A;  1G28 A;  5FL3 A;  1NLZ A;  3MQO A;  4CLC D;  2B02 A;  2JKT M;  5HL6 A;  3B42 A;  3C30 A;  4HHD A;  4ETZ A;  1JNU A;  4NXG A;  1S4S A;  2OWH A;  2VV8 A;  5I5L A;  1Y28 A;  2J3T D;  2MJ6 A;  3A0S A;  4G3K A;  4Y3I A;  4IUH A;  2QWS A;  5J4E A;  2NUT C;  4KQD A;  4EES A;  2A2L A;  5IT5 A;  5LBR A;  2P04 A;  4CLC B;  4QPR A;  4EU0 A;  1T1B A;  5G4Y A;  2JN7 A;  2PT7 A;  4Q0H A;  4LRY C;  2GZA A;  2W3G A;  1GSV A;  2QJ7 A;  2V0W A;  4Z1W A;  3ZYT A;  2P08 A;  3T50 A;  3K3D A;  3LI8 A;  2M7V A;  4LPZ A;  2INW A;  4BBT A;  2WKQ A;  3NOP C;  4EUV A;  4GJ4 A;  2JKT I;  3BY8 A;  3CUE C;  1S1Y A;  2HJ9 C;  3T4O A;  4IHQ A;  1UGU A;  3EEA A;  1XFN A;  3GDI A;  3MQ0 A;  2V1A A;  4AFI A;  1TS8 A;  2PR6 A;  3IS2 A;  4R3A A;  3LR4 A;  1UWN X;  4HNB A;  5HWT A;  3E0Y A;  5HWV A;  2ZOH A;  4GHI B;  5TBM B;  3SW1 A;  5DF9 A;  4WL9 A;  4JGP A;  3A0V A;  5AVE A;  3S7P A;  1D06 A;  2VGL M;  2W1R A;  2W3E A;  3CUE A;  3BY9 A;  2PD7 A;  4NXE A;  4MN5 A;  3VE3 A;  3H9W A;  3MR0 A;  5HD3 A;  1STZ A;  4P6Z S;  3D3O A;  5HDC A;  3MFX A;  1LT0 A;  2NUP C;  4K08 A;  2ZMF A;  2VV7 A;  4EW7 A;  2O9C A;  2VEA A;  1KOU A;  4R6L A;  4MMN A;  1G6O A;  3PBS A;  2B18 A;  5MC7 A;  2D01 A;  3E4Q A;  3T4T A;  3LID A;  4DN0 A;  3W2Z A;  3FPV A;  4IJG A;  3T4J A;  2HV1 A;  4BBV A;  1H3Q A;  1OJG A;  2M1C A;  4Q0J A;  3MF0 A;  2PHY A;  3VV4 A;  4I5S A;  3S7N A;  5HZH A;  2V0U A;  3MMH A;  3EGD C;  4HIA A;  2VV6 A;  1TD5 A;  3F1P A;  1ODV A;  4II7 A;  3CIT A;  1X0O A;  3K3C A;  1V9Z A;  1NRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...