3A0SA

Pas domain of histidine kinase thka (tm1359)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
METAIITLSKDGRITEWNKKAEQLFGLKKENVLGRRLKDLPDFEEIGSVAESVFENKEPVFLNFYKFGERYFNIRFSPFRNAKTQLLEGVIITIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Sensor protein
total genus 27
structure length 96
sequence length 96
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3a0sA00
2PYPA 3H7WA 1XJ4A 2VV6A 2V9AA 1OJGA 3A0SA 4GHIB 4GHIA 1P0ZA 4R70A 4WLAA 5DJTA 2P7JA 3FG8A 5HDCA 3E4PA 2W0NA 4LLOB 1XFQA 3VE4A 2OOLA 3B33A 3LIEA 2WKRA 4F3LA 5IS1A 1UGUA 2QHKA 3MQQA 4GS9A 4HJ4A 4MN5A 5AVEA 1NWZA 3H9WA 1MZUA 1S1ZA 3H82B 1OJ5A 4LRYC 3PYPA 3UB6A 5I5LA 1OTEA 5J3WA 2R78A 3A0VA 1S67L 2A24A 2H28A 2PYRA 3CAXA 4HNBA 3RTYA 3F1PB 3LUQA 1LL8A 4WL9A 1Y28A 1XJ3A 3EEHA 5HWWA 4WN5A 3UMDA 2J80A 3NOUC 3P7NA 4WF0A 4NXGA 4WUJA 3PHYA 4EESA 1GSXA 1KOUA 1ODVA 1TS0A 2GJ3A 3F1PA 2L4RA 3NOTC 4HI4A 4LPZA 1UWNX 3HJKA 4HIAA 4EQ1A 3GECA 1V9YA 1G28A 4LRZE 4NXEA 4KUOA 2PD7A 1OTBA 2V1AA 3C2WA 2HV1A 2WKPA 3LIBA 4HH3A 5DJUA 4HP9A 3UB8A 2WKQA 4GS9B 1D7EA 4HJ3A 5HWVA 3MFXA 1XJ6A 5HSQA 4GCZA 2K7SA 4L9EA 4XT2A 3IS2A 4JGPA 5HD3A 4EW7A 3UMEA 3MR0A 3H7WB 4PKYA 2B02A 2BASA 5F69A 4BBUA 1OT9A 4EEUA 1XFNA 1TS8A 3MXQA 4HP4A 1LSXA 4L9FA 3VOLA 3G6OA 3C8CA 1OTAA 3UE6A 3KX0X 1DP6A 4HOIA 2PHYA 5F68A 4PKYG 2OWHA 1N9NA 5HZHA 2Z6CA 4H6JA 3NOPC 4L9GA 4MN6A 4M4XA 1F9IA 2OWJA 4EEPA 1LSVA 4KUKA 3OLOA 1T18A 3LIDA 4HY8A 1GSVA 1S4RA 3GDIA 4I5SA 5AVFA 2W27A 5TBMA 2KX6A 4EERA 2M1CA 4LRXC 5HDDA 1TS6A 1N9OA 3RH8B 3MJQA 2D01A 2JHEA 1X0OA 2ZBBA 5EFWA 3UB9A 4BBTA 5A8BA 1LSWA 1T1AA 3K3CA 1F98A 1T1BA 4JGRA 2QWSA 2VV8A 2I9VA 4HQAA 4I39A 4DJ3A 2L1MA 1OTDA 2VLGA 3A0RA 3LI8A 2QJ7A 3BY9A 1D06A 3F1NB 4NXFA 2INWA 3BWLA 3ZQ5A 2CMNA 2PDRA 3NHQA 4RQ9A 3F1OB 4K08A 1JNUA 3BY8A 2V1BA 3LIAA 4I3JA 3ICYA 5HWTA 3ULFA 5J7EA 3IS2B 2PR6A 4H6JB 2YKFA 4DJ2A 4BBVA 4I3AA 5F5YA 3LYXA 2Z6DA 3K3DA 4KQDA 5DKKA 1DP9A 1OTIA 1P97A 4JGQA 2V0WA 2PD8A 2D02A 4EXOA 4HHDA 2YKHA 2ZOHA 3SW1A 1GSWA 2KDKA 2VV7A 3CWFA 3LICA 3VE3A 4XT2B 3F1NA 5KIZA 3UB7A 1VB6A 4I3IA 3D72A 3T50A 3E4OA 1DRMA 4R6LA 4E04A 5G4ZA 4YWZA 1TS7A 3F1OA 1EW0A 5HD5A 3CLOA 2JN7A 1V9ZA 2A24B 2V0UA 3HJIA 3IBRA 4JGOA 1S1YA 4R3AA 2ZOIA 5J4EA 1S4SA 2EA9A 3FC7A 4EETB 2VEAA 3H82A 4GW9A 2QJ5A 5G4YA 3MQOA 4HJ6A 4NXBA 4R38A 3LI9A 3NJAA 1S66L 5IU1A 3E4QA 1OT6A 1T19A 5HDSA 1XJ2A 1UWPX 5F6AA 4HH2A 3EWKA 1T1CA 1N9LA 2PR5A 3LIFA 4B9OA 1BYWA 5DKLA 1WA9A 1DP8A 1LT0A 4I38A 5TBMB 4F3LB 2L0WA 2QKPA
chains in the Genus database with same CATH superfamily
4E3MA 3IX3A 2OOLA 3B33A 4CQHA 4GS9A 5AVEA 5EV0A 3H9WA 1XP4A 2XRNA 2XDMA 3R7WA 3ZNYA 5I5LA 5CX7A 3HLBA 1L0DA 2XD1A 3MZDA 4QD4A 2ZQDA 2EFUA 2J80A 3NOUC 3P7NA 4WF0A 4WUJA 3T4KA 1IOUA 4GZBA 1K4FA 3QP2A 3FKWA 4JXGA 2V1ZA 2V1AA 2XK1A 4CPKA 5EVID 1Q2PA 4N9KA 4Y7PA 5A93A 4X6TA 1FIKA 3Q7ZA 2B02A 4LV2A 2Y2NA 1BLHA 1K56D 1VEUA 5HZHA 4MN6A 3GDIA 2HP6A 3ZYTA 3HBRA 2UWXA 4B4XA 3C5AA 1OTDA 4K91A 4WYYA 3S7QA 1D06A 3UNWA 4PM7A 3SOIA 3UPPA 4RQ9A 1KE0A 3V67A 3PBNA 4ME4A 4DF6A 3OPLA 4G3VA 4OLGA 2PR6A 2PT7A 3BFDA 1AWIA 3ZDJA 4R3JA 1H3QA 1I2SA 4EV4A 4R23A 5M18A 1P97A 4MNRA 2Q0OA 2KDKA 1KE3A 4WEJA 1SZVA 4OQIA 1IKGA 4K0XA 4IVIA 5EECA 2WGVA 4BL3A 3ZFZA 4HJ6A 4DDYA 5CTMA 4GD8A 2XD5A 5FAPA 1XJ2A 4Y15A 1ESUA 4JBFA 3HCYA 4DE3A 4YNRA 1XJ4A 5AJGA 2WYXA 2NUTC 4S2KA 2Y2QA 3EOIA 1PW8A 3LFVA 5TR7A 2QMIA 5CHUA 1CK3A 3QP4A 3A0VA 1E25A 2H28A 3Q7VA 4ESPA 1YLPA 4EESA 1ODVA 1ZG6A 3GECA 3FYZA 2ZLYA 5HX9A 5AQ7A 3BLSA 3O88A 4E3JA 4Q0HA 4GCZA 3T1QB 1FCNA 4GN2A 1VETB 2OAQ1 4HP4A 3OPHA 1Z09A 2Y79A 1KVMA 1SCWA 2Z6CA 2KOIA 3FZCA 1T18A 2DRWA 2ZC3B 5AVFA 1FCMA 3C4OA 3LY3A 2ZBBA 3OZHA 2WAEA 4Y2FA 4WZ5A 3GVBA 4GJ4A 3N6IA 2PAVP 3T12B 4Z1WA 2FFYA 5FQJA 2XROA 4KQDA 2EX9A 2CC1A 3GR2A 3VFFA 4JXWA 1GSWA 1IELA 4XT2B 1SKOA 2IWCA 4S2NC 3H82A 4GW9A 1W8QA 4LFUA 1G6OA 1KE4A 5G4YA 3LI9A 4IUKA 4IVKA 5IU1A 4ETZA 3HUOA 3IX4A 3PBRA 1T1CA 2WUQA 4KZ4A 5L10A 3MF0A 2GZAA 3D9YA 2PYPA 4QWOA 2BLSA 2VV6A 3NBLA 1NWZA 1OJ5A 3PYPA 1KDWA 1OTEA 3MKFA 2EFXA 1S67L 2PYRA 4N1HA 4BWIA 1YSQA 1YQSA 4YINA 4NXGA 1KOUA 2OLUA 2L4RA 4EQ1A 3UY6A 2Y55A 4NXEA 4HJ3A 1TDGA 2Y2PA 1PW1A 3IF5A 4ARZA 1YMSA 3N7WA 2W3DA 3MXQA 3EGXC 4MCWA 5CHMA 3VP1A 2EWWA 2H0TA 4HY8A 5BOHA 4FH2A 4FD8A 3KSIA 2W3HA 5HARA 1F5MA 1F98A 4KG6A 4PM8A 2HP5A 4JPMA 3HLDA 4NXFA 3W4PA 4E3KA 3LR3A 2HGVA 1MWSA 2P74A 3GQZA 5F5YA 2J9OA 5DKKA 4LGWA 4PM9A 3CWFA 4S2LA 1G6AA 4O7DA 3T4JA 3UB7A 1K4EA 3D72A 4R1GA 4MBHA 4JF4A 2XR0A 3MBZA 4DJ2A 2A24B 3T4SA 3HJIA 1S0WA 1S1YA 5J4EA 3GV9A 1GHIA 1ACFA 1CI9A 3DWKA 1ES3A 5FSRA 3SH8A 1N9LA 4C6YA 1DP8A 4OOYA 4I38A 3NDEA 4F3LB 5E2EA 5FEGA 1HVBA 1K55C 1IFQA 2Z2LB 3ZG0A 5HDCA 1XFQA 4DDSA 1H5XA 3PXPA 3H82B 2JKFA 3MS6A 1HLUP 5CERA 3EEHA 4D2OA 1BLCA 1TS0A 3Q81A 4Y3IA 1FSWA 2PD7A 4Q8IA 2IA2A 5HWVA 4QY6A 4FUWA 3TG9A 4DXCA 4X1LA 4PM5A 4PKYA 4S2OA 1FOFA 4AFIA 4UA6A 1OTAA 5CGXA 3CMZA 4WEKA 2AVXA 5F68A 2X02A 1K38A 1M40A 4M4XA 2OWJA 4UHUA 4P87A 1S4RA 2W27A 5TBMA 5L2FA 4RYEA 5HDDA 2GDNA 2D01A 2G2WA 4ZDXA 4BBTA 3MFDA 1KGFA 2L1MA 2O9AA 1SKOB 2V8CA 1PNEA 4K08A 5HWTA 4O01A 5GLDA 4E6XA 4GDNA 4P6ZS 4I3AA 5GLAA 1LI9A 1K54A 4PPRA 1XKZA 3S7OA 2HDUA 1ES2A 1RCJA 3JVVA 4GLQA 3IBRA 2G2UA 3TRCA 4EBPA 5CECA 4Y13A 1H8ZA 3BYDA 2RCXA 3GRJA 2WADA 2HJEA 3IWOA 1LT0A 1TVFA 2L0WA 5J7EA 5FI6A 3DTMA 5EVIB 2B18A 3UB8A 2P7JA 3QHYA 3SH7A 2QHKA 2ZD8A 4HJ4A 1S1ZA 1PYYA 3BM6A 1S6RA 2ZC5B 3TOIA 3O5YA 1P9RA 2P9VA 3LEQA 3RJUA 3LR5A 1JWVA 1K56A 5FEFA 1MC0A 2W3GA 3ZG9B 3CPTB 2LB5A 5HPFA 1YLZA 4EW7A 1BLPA 2IWDA 3N4IA 1XPBA 2E8IA 2R9WA 3LY4A 4BD0A 1WE4A 4I5SA 2Y59A 4UAAA 4CLCA 1A0KA 3MJQA 3D4FA 4E6WA 1ZC2A 2WAFA 4I39A 4EBNA 3S1YA 2INWA 5HFOA 1LL5A 3F1OB 4MLLA 3LIAA 1JVJA 4EU0A 1E3UD 5HW3A 2PD8A 1IYOA 1LL9A 1YLWA 5FQQA 4NKPA 3Q1FA 4E3LA 3EQUA 4Y0TA 3FC7A 3P09A 3C38A 3DAVA 1XX2A 2A49A 4X25A 5F6AA 4P85A 2WKHA 3HUNA 3P01A 5EE8A 4R4SA 2ZMAA 4R70A 3QP1A 2C5WB 2ZMFA 2Y4AA 4YFMA 3MQQA 2EXAA 1IKIA 4QU3A 3UB6A 2Y8HA 5J3WA 5I94A 2R78A 4HESA 4HNBA 4OOMA 2P04A 4IBRA 1GSXA 4U0XA 3UPOA 1J3WA 4KUOA 3QP8A 5GHYA 3VOLA 3E2KA 4QJGA 3Q07A 4A5RA 1DP6A 2WGWA 4Q0JA 4H6JA 1L0EA 1NRFA 1HD8A 3TW8A 2KX6A 4WM9A 3IHAA 2IWBA 4ETXA 1X0OA 3IHBA 1EWZA 5A8BA 3ZG7B 2OV5A 5K5BA 3NHQA 3UE0A 1WYBA 5FAQA 4ZJ3A 4HHDA 2ZOHA 3LICA 3FKVA 3VE3A 4X53A 2ZL1B 1VB6A 5D3OA 5AQ9A 1YAXA 1EW0A 4KZ9A 5FI2A 1NJ4A 3C30A 5CTNA 5CRFA 1FCOA 3ZG5A 4BL2A 1T19A 5F83A 5GLCA 1UWPX 4HH2A 4X55A 4B4ZA 2DNSA 2Y2KA 1STZA 2JKTM 4BLMA 4IHQA 5EOOA 5KMWA 4II7A 3FG8A 3MZEA 5IS1A 3LIEA 4OVDA 4ARZB 3VV4A 2J3TC 5JYPA 3GTCA 4BJPA 3ZGAB 2GJ3A 4OQ0A 3E98A 2WKPA 5DJUA 3VP4A 3DTIA 1MPLA 3HLFA 1JTDA 4L9EA 3D3OA 3T4OA 5EVIA 4X1MA 3BEBA 5F1FA 3DTKA 4S2IA 2K31A 4UQIS 3UDFA 1TEMA 1BLSA 4LRXC 1PI5A 3GMWA 1NYMA 2WZZA 1ONHA 2VGLS 3K3CA 2O0YA 4HQAA 5M19A 1NXYA 1TD5A 4IEDA 2XFSA 4HBTA 4OQHA 3M2JA 5HAIA 4IBXA 4LCLA 1CJFA 2Q9MA 3V5MA 3OCLA 4R6LA 5IHVA 5GHXA 3CLOA 5DF7A 3MXSA 4JGOA 2ZOIA 3MQ0A 4EETB 4HEFA 3NJAA 2OSUA 2W1TA 1KGGA 1ALQA 4FTXA 3EGDC 3OPPA 3M2KA 3RXXA 3LIFA 3HLCA 5DKLA 1ZTUA 3JYIA 5GHZA 4RX2A 1ZHHB 4NG2A 4GHIA 4ZTKA 1GA9A 2VJWA 4KG5A 3PBOA 3BFEA 4LRYC 1N4OA 2G7UA 1F2KA 3CPTA 1ERQA 1W79A 3IX8A 1JWZA 3F1PA 4LV1A 1UWNX 4LCMA 4EUZA 4WZ5C 2ZQ8A 4OP5A 4ZBEA 3TJZC 2WKQA 3OCNA 1LI0A 5GLBA 2V8FA 3G2ZA 4CLCD 4EEUA 1TS8A 3G6OA 3LO7A 4HOIA 4LV0A 2OWHA 1HZOA 1MKIA 3C4PA 3NOPC 4MEZA 2XGNA 4MBKA 1K0KA 3LGOA 2M1CA 2Z2MB 1L0GA 3TSGA 4CLCC 3IWIA 3P98A 1ESIA 1YSPA 4WMCA 2V2FF 3B47A 1T1BA 2QWSA 2W1TB 3T1XA 3WWXA 1ZKJA 3BY9A 2ZL1A 4ZJ1A 1IEMA 1RP5A 2ZQ7A 4H6JB 3R4KA 1CEFA 5EVEA 5HL1A 3L9KA 2WK0A 3UE1A 3HLEA 4G3KA 1MWUA 4KZ8A 3K2NA 1QMFA 3C7VA 5G4ZA 1FR1A 3O86A 2XF3A 2Y91A 1PI4A 3HREA 1V9ZA 2V0UA 3O3VA 4R38A 1HTZA 2PBDP 2EX8A 1NRJA 2GNXA 2PR5A 2PU4A 4KZ7A 4XXRA 3AGEA 3H7WA 1SHVA 4X69A 5DJTA 2W0NA 4LLOB 4F3LA 3E2LA 5CEBA 1O07A 3RTYA 3LUQA 1Y28A 3UMDA 2DMWA 2XLNA 1VHMA 1EROA 3T1SA 5E2GA 1OTBA 4HH3A 3S7PA 2VGJA 3G30A 5HSQA 5DTSA 3UMEA 5CHJA 5L07A 3VSKA 4R3BA 4JXSA 3MKEA 3NC8A 2OLVA 4ZAMA 1N9NA 1ZG4A 4KUKA 4L0LA 2WKIA 3NECA 5CGSA 3SZTA 3CITA 1TS6A 3KSFA 2ACGA 2B95A 2VV8A 5F82A 2HDSA 4PM6A 4RVAA 3BJNA 3ULFA 2HP9A 3ICYA 2J3TD 3JPUA 4H8RA 1MBLA 3PBSA 1KVLA 1Y54A 2JC7A 4QPRA 2J7VA 5J8XA 3SW1A 3NI9A 1W8YA 5EM0A 4UA9A 1BULA 3BFFA 3E4OA 2EXBA 4GKUA 2QYBA 1M6KA 3HL9A 4NXBA 1PFLA 5FQKA 2H5SA 1CEGA 2JKGA 1SKFA 4N1XA 1WYCA 4FH4A 2PRFA 4KZ3A 4GD6A 3LCEA 2OAP1 2XFTA 3A0SA 1YLTA 2QPNA 4DE0A 5AQBA 4S2MA 1KDSA 2XA7S 3WS5A 1UGUA 3A3FA 1JTGA 3VOZA 2HJ9C 2QZ6A 1YPRA 1SDNA 1PWDA 5EVLA 4WL9A 1E3UA 5HWWA 3I7JA 3M6BA 3HVFA 2Y2JA 1G28A 1G5UA 3IF6A 4KZ5A 1W63M 2ZM8A 3CUEA 2HZ5A 3G4PA 4DXBA 4JGPA 1TDLA 5C5KA 1EI5A 2ZM0A 4BBUA 3CZDA 3U4LP 2PBYA 5EOEA 3BFCA 4O0PA 1BTLA 5M1AA 4GDBA 1LSVA 1YM1A 2ZC7A 3LIDA 3MMHA 1BUEA 1JWPA 3OPRA 3CUEC 3IH9A 2JHEA 1PZPA 3UO9A 3NULA 3LI8A 2CMNA 1P9WA 1JNUA 3IT9A 3FV7A 2FFFB 5HL6A 3U2AA 4OQGA 5AQAA 3VSLA 4EXOA 2YKHA 3UDIA 2V20A 4S2JA 4I3IA 4E04A 5FQIA 5FI7A 3R7WB 3L7HA 3V50A 3W8KA 2HDQA 2JKTI 4E3IA 5EUAA 2JBFA 3CJMA 5A90A 1WA9A 1Z6FA 3HLWA 4E3OA 1I2WA 2RL3A 4K0WA 1NZUA 4WLAA 4Y17A 3IWQA 3SS3A 4WMCD 5LBRA 2WKRA 5DTKA 2Y2LA 4DE2A 1J9MA 1DJBA 3FPWA 4FSFA 5GL9A 2A24A 3FWLA 1NLYA 3NY4A 1XJ3A 1YT4A 3OOVA 1RGYA 4KENB 4HIAA 4HP9A 1LHYA 4GS9B 1DJCA 2VX8A 4ZRRA 3Q7VB 3KYQA 4ID4A 1XFNA 3UB5P 1LSXA 3IQAA 1DY6A 2W3EA 2XSSA 4L9GA 5DFXA 3ISGA 2VZWA 3QNCA 1PIOA 4WZ4A 3M6HA 3T1RA 1XGIA 2M7UA 3UN7A 1T1AA 3ZHHA 3B3XA 1C3BA 2I9VA 1K6SA 1OPXA 2VA0A 3WS1A 4Q0IA 4BD1A 5FA7A 4JF5A 2VGLM 4P6BA 4NETA 3K3DA 3B42A 2R9XA 3QNBA 4UQIM 2JKRI 4KQQA 3G34A 2A2LA 2Y2GA 3MZFA 3CG5A 1DJAA 5HD5A 2KLIA 4CJNA 3UDXA 1S66L 4M3KA 2B5RA 2EX6A 1VEUB 1U60A 2WZXA 2Y2IA 4OKPA 4OONA 1L3LA 3PTEA 1VM1A 2V9AA 2Y2HA 3PR6A 4GHIB 1P0ZA 4BQMA 3E4PA 1GA0A 4KZ6A 3VOYA 1LLBA 1BZAA 4BMWA 4P0MA 2JE5A 4GOGA 3BQAA 4XUXA 4C75A 4LRZE 2Y2OA 2K7SA 4XT2A 2ZJ9A 5HD3A 3BFGA 1XGJA 3H7WB 3ZNTA 3Q82A 3KYZA 3ZCZA 3BLMA 3PAEA 3FPVA 3RH8B 3NIAA 5EFWA 3BW6A 2QJ7A 2HPBA 3PAGA 3BWLA 5KZHA 3IF6C 2ZC4B 2A3UA 3HLGA 1QMEA 4GNUA 3G2YA 2JKRM 1XA1A 5MC7A 1PRQA 1CI8A 2D02A 5KSHA 1CQAA 1BT5A 5DF9A 2P9VB 1NYYA 3W4QA 3DWZA 2BG1A 4KQRA 2VEAA 3MQOA 3VP2A 4D60A 3E4QA 4O8GA 1K54C 4B9OA 4DRTA 3GSGA 3KO6A 4DN0A 1E4DA 2PU2A 1Y4OA 3VE4A 4FOFA 3T4TA 3AGDA 3IF6B 3ITAA 3CAXA 4RA7A 2VKSA 3F1PB 3QP5A 4C3QA 3CI6A 5HAQA 2UV0E 5FQ9A 1ERMA 4LPZA 4IUHA 5TFQA 3ZVTA 1FR6A 2J9PA 2FH5A 2LB9A 1NY0A 4X56A 3N8SA 4X68A 3IS2A 2Y2MA 5EPHA 5F69A 2BASA 4L9FA 2HDRA 2PHYA 3W4OA 4EEPA 3LR4A 4N92A 3SH9A 5A91A 1K57A 3A0RA 2VLGA 3IXHA 3S4XA 1O7EA 2O9BA 3DTEA 3BECA 3ZVWA 2YKFA 1NZOA 2FZ0A 4MBFA 2VK3A 1OTIA 3C7UA 2VV7A 4MN7A 5KIZA 1ES4A 3VFHA 3LEZA 3JVUA 4YWZA 2H0YA 4OLDA 4S2NA 2ZQCA 4R3AA 4HBUA 2QJ5A 5U47A 4JKTA 1FSYA 1PWGA 4G3WA 1OT6A 3RFBA 3WRTA 3EWKA 3A3IA 2O9CA 5TBMB 5CGWA 5HAPA 4Y0OA 3E0YA 1MXOA 4KG2A 3DBAA 5FL3A 1MZUA 1N9BA 2GX5A 1VQQA 1ONGA 4OP8A 1LL8A 2MJ6A 3SS4A 5TGFA 3PHYA 4IJGA 3NOTC 4MDZA 2HV1A 5CEDA 4OOLA 4Y5FA 2XH9A 4NK3A 4KZAA 3MFXA 1XJ6A 2I72A 3MR0A 2JCHA 3C8CA 1L0FA 4XUZA 1K6RA 5FDHA 4PKYG 5F1GA 5DFYA 5EM1A 2ZC6B 3S7NA 1Q2QA 3G32A 4F94A 4P6ZM 4EBLA 3UB9A 5FAOA 3T4LA 1SDEA 5FATA 3WS2A 5E2HA 3ZQ5A 2V1BA 4I3JA 1VETA 3IS2B 4BBVA 3LYXA 3UPNA 3NDGA 4JGQA 1H8YA 1RGZA 1GCEA 3VP0A 4LENA 2X01A 2BTFP 3F1NA 3G31A 1IYSA 2WGIA 2X71A 4NEED 4Y0UA 2P08A 3A3DA 2ZQ9A 2XQZA 2ZMVA 1MY8A 4JXVA 5FDSA 3EEAA 3RXWA 1BYWA 1KGEA 2WGWB 3PBQA 4CLCE 1G68A 4PHTA 3BQ8A 4KQOA 2Q9NA 3WS4A 3CHWP 4DKIA 2ZM2A 4RX3A 3V39A 4FCFA 4EWFA 4WN5A 1YLYA 3HJKA 4S2PA 3C2WA 4MMNA 4R0QA 1NLZA 3VMAA 1D7EA 3W2ZA 4JF6A 3TE8A 1MWTA 4QY5A 3KYEA 5CXWA 3UE3A 5TJJA 3DW0A 1OT9A 3PBTA 3BRMA 1MKMA 4EQIA 1BSGA 3KX0X 2HF6A 1YKDA 3OLOA 5E43A 2J3WA 4U0TA 1D1JA 4EERA 4EUVA 4GB7A 1K25A 3A3EA 5DTTA 3T4QA 1LSWA 3OBFA 2NUPC 5FQMA 4JGRA 5L09A 4DJ3A 3MSHA 5EVIC 4KZBA 3QP6A 4OH0A 4ZJ2A 1AXBA 3G35A 3KSHA 3BY8A 5DF8A 1H0MA 2XEPA 5E2FA 3ZG8B 1GHMA 3WS0A 4DMZA 3LR0A 3IBJA 3OC2A 1DRMA 1TS7A 3F1OA 3V3SA 1FQGA 3IXBA 1S4SA 2EA9A 1XXMA 5DVAA 2DCFA 3ITBA 1IYPA 4CLCB 5L8MA 4LV3A 1OJGA 3SS5A 1IYQA 4MN5A 4UEYA 3VP3A 1YMXA 2J8YA 2C6WB 4WBGA 2W3FA 1YLJA 4UA7A 4OPYA 4OPZA 2O99A 3IXDA 1PZOA 4DE1A 4HI4A 4WELA 1GHPA 1V9YA 3LIBA 3O87A 4JLFA 4OPRA 4B88A 5IT5A 4R4RA 4BENA 1XA7A 3UE6A 4U3TA 1K55A 1F9IA 5KSCA 4B93A 2WKEA 1ES5A 1GSVA 1I5QA 1MWRA 3HUMA 5JYOA 3MXRA 1N9OA 1K57C 2EWVA 2ZQAA 1PWCA 1W5DA 1OMEA 3AGFA 2K2NA 3N8RA 3V3RA 3F1NB 3EQVA 2PDRA 3NCKA 4QHCA 2VGKA 1FILA 3IH8A 4QB8A 2Z6DA 1DP9A 5FASA 2V0WA 1L2SA 4N9LA 3IXGA 3T50A 1W63Q 1H8MA 2XA7M 5HPIA 4PAUA 2EX2A 2JN7A 5G18A 3N8LA 3S22A 3A3JA 5A92A 4E3NA 1CF0A 2E8JA 2H10A 5HDSA 3WRZA 2W1RA 4YOFA 4OPQA 1TF1A 1W7FA 4PMAA 2M7VA 3KSGA 4Z9QA 2QKPA
chains in the Genus database with same CATH topology
4DN0A 3H7WA 2B18A 3UB8A 5DJTA 2P7JA 2W0NA 4LLOB 3VE4A 2OOLA 3B33A 4F3LA 4FOFA 4CQHA 3T4TA 2QHKA 4GS9A 5AVEA 4HJ4A 3H9WA 2XRNA 1S1ZA 3R7WA 5I5LA 5CX7A 3CAXA 3RTYA 2VKSA 3LUQA 3F1PB 3O5YA 1Y28A 1P9RA 3UMDA 2J80A 3CI6A 3LR5A 2DMWA 3NOUC 3P7NA 4WF0A 4WUJA 3T4KA 1VHMA 4LPZA 1IOUA 4IUHA 1MC0A 1OTBA 2V1AA 4HH3A 3S7PA 2W3GA 2FH5A 5HSQA 2LB9A 2LB5A 5HPFA 3IS2A 4EW7A 3UMEA 5F69A 2B02A 2BASA 4L9FA 2PHYA 1N9NA 5HZHA 4MN6A 4EEPA 3LR4A 4KUKA 4L0LA 3GDIA 4I5SA 3CITA 1TS6A 3ZYTA 4CLCA 3MJQA 3KSFA 2VV8A 4I39A 1OTDA 2VLGA 3A0RA 3S7QA 1D06A 2INWA 2O9BA 4RQ9A 3V67A 3PBNA 3BJNA 3F1OB 4ME4A 3ULFA 3LIAA 3ICYA 4G3VA 4EU0A 2PR6A 2PT7A 2J3TD 2YKFA 2FZ0A 1H3QA 3PBSA 1OTIA 1P97A 2PD8A 4QPRA 3SW1A 2KDKA 2VV7A 4WEJA 4MN7A 5KIZA 4NKPA 3E4OA 3JVUA 4YWZA 3EQUA 4R3AA 2QYBA 3FC7A 3C38A 2QJ5A 4HJ6A 4NXBA 4G3WA 1OT6A 3RFBA 1XJ2A 5F6AA 3EWKA 3HCYA 3P01A 2O9CA 5TBMB 2OAP1 4YNRA 1XJ4A 3E0YA 5AJGA 4R70A 3A0SA 2NUTC 2ZMFA 3DBAA 2XA7S 1UGUA 5FL3A 3MQQA 3EOIA 1MZUA 3LFVA 2HJ9C 2GX5A 2Y8HA 5J3WA 3UB6A 2R78A 3A0VA 2H28A 4HNBA 4OOMA 4WL9A 1LL8A 2MJ6A 2P04A 5HWWA 3PHYA 4IJGA 4EESA 1GSXA 1ODVA 3NOTC 4MDZA 3GECA 1G28A 4KUOA 1W63M 2HV1A 3CUEA 4OOLA 4Y5FA 4Q0HA 3MFXA 1XJ6A 4GCZA 4JGPA 5C5KA 3MR0A 4BBUA 2OAQ1 3VOLA 4HP4A 3C8CA 2Y79A 1DP6A 4Q0JA 4PKYG 4O0PA 2Z6CA 4H6JA 1LSVA 2KOIA 1T18A 3LIDA 3MMHA 5DFYA 5AVFA 3TW8A 3S7NA 2KX6A 4P6ZM 3CUEC 4ETXA 1X0OA 2JHEA 2ZBBA 3UB9A 5A8BA 3T4LA 3LI8A 4Y2FA 3ZQ5A 2CMNA 5K5BA 3NHQA 4GJ4A 1P9WA 1JNUA 5J7EA 2V1BA 4I3JA 4Z1WA 3IS2B 4BBVA 5HL6A 2XROA 3U2AA 3LYXA 4KQDA 4JGQA 4EXOA 4HHDA 2YKHA 2ZOHA 1GSWA 3LICA 3VE3A 4XT2B 3F1NA 1VB6A 4I3IA 4E04A 1YAXA 1EW0A 4NEED 3C30A 2P08A 3R7WB 3H82A 4GW9A 5G4YA 1G6OA 2ZMVA 3LI9A 4IUKA 5IU1A 4ETZA 1T19A 3PBRA 2JKTI 1UWPX 3EEAA 4HH2A 1T1CA 1BYWA 1STZA 3PBQA 1WA9A 2JKTM 4CLCE 4IHQA 3MF0A 2GZAA 2PYPA 2VV6A 4WLAA 4II7A 3FG8A 4PHTA 5IS1A 3BQ8A 3LIEA 2WKRA 5LBRA 4KQOA 1NWZA 1OJ5A 3PYPA 3FPWA 1OTEA 4ARZB 4FSFA 1S67L 2A24A 2PYRA 4BWIA 1YSQA 3VV4A 1NLYA 1XJ3A 2J3TC 4WN5A 4NXGA 4BJPA 3OOVA 1KOUA 2GJ3A 2L4RA 4EQ1A 3HJKA 4HIAA 3E98A 4NXEA 3C2WA 2WKPA 5DJUA 4MMNA 4HP9A 1NLZA 4GS9B 1D7EA 4HJ3A 3TE8A 3W2ZA 4L9EA 3D3OA 2VX8A 4ZRRA 3T4OA 3KYQA 3UE3A 4ARZA 5TJJA 1OT9A 1XFNA 2W3DA 3MXQA 3PBTA 1LSXA 1MKMA 3KX0X 3EGXC 2HF6A 4MCWA 2W3EA 2XSSA 1YKDA 4L9GA 5DFXA 2EWWA 3OLOA 2K31A 2VZWA 4UQIS 4HY8A 2J3WA 4EERA 4EUVA 4LRXC 3KSIA 2W3HA 1F5MA 2M7UA 3T4QA 1LSWA 2VGLS 1T1AA 3K3CA 1F98A 2O0YA 3OBFA 4JGRA 2NUPC 2I9VA 4HQAA 4DJ3A 1OPXA 2VA0A 4NXFA 1TD5A 4Q0IA 3KSHA 2VGLM 3BY8A 3LR3A 2HGVA 5F5YA 3K3DA 3B42A 5DKKA 4UQIM 4DMZA 2JKRI 3LR0A 3IBJA 3OC2A 3CWFA 2A2LA 3T4JA 3UB7A 3D72A 1DRMA 3OCLA 4R6LA 1TS7A 3F1OA 5HD5A 3CLOA 2A24B 2KLIA 3HJIA 3T4SA 4DJ2A 4JGOA 1S1YA 5J4EA 2ZOIA 1S4SA 2EA9A 3MQ0A 4EETB 3NJAA 1S66L 2W1TA 3EGDC 1N9LA 4CLCB 3LIFA 5DKLA 1ZTUA 5L8MA 1DP8A 4I38A 4F3LB 1ZHHB 4GHIA 2V9AA 1OJGA 3PR6A 1IFQA 4GHIB 1P0ZA 5HDCA 2VJWA 3E4PA 1XFQA 3PBOA 4MN5A 4UEYA 3PXPA 3H82B 4LRYC 2W3FA 4BMWA 2G7UA 2O99A 3BQAA 3EEHA 3F1PA 1TS0A 4HI4A 4WELA 4Y3IA 1UWNX 1V9YA 4LRZE 2PD7A 3LIBA 3TJZC 2WKQA 3OCNA 2IA2A 5HWVA 5IT5A 2K7SA 4XT2A 5HD3A 4PKYA 3H7WB 4CLCD 4EEUA 1TS8A 4AFIA 3G6OA 1OTAA 3UE6A 4WEKA 3KYZA 4HOIA 5F68A 2OWHA 3NOPC 4M4XA 1F9IA 2OWJA 4B93A 1GSVA 1S4RA 2W27A 5TBMA 3FPVA 2M1CA 5HDDA 1N9OA 2EWVA 3RH8B 4CLCC 1YSPA 2D01A 5EFWA 4BBTA 3B47A 1T1BA 2QWSA 3BW6A 2W1TB 2K2NA 2L1MA 2QJ7A 2O9AA 3BY9A 3F1NB 3EQVA 3BWLA 2PDRA 4K08A 5HWTA 4O01A 4H6JB 3R4KA 4P6ZS 4I3AA 2JKRM 2Z6DA 5MC7A 1DP9A 2V0WA 2D02A 5KSHA 3S7OA 5DF9A 4G3KA 3K2NA 3T50A 5G4ZA 1W63Q 1H8MA 2XA7M 3JVVA 5HPIA 1V9ZA 2JN7A 2V0UA 4GLQA 4PAUA 3IBRA 2VEAA 3TRCA 3MQOA 4R38A 3E4QA 1NRJA 4O8GA 5HDSA 2W1RA 4YOFA 2GNXA 4B9OA 2PR5A 1TF1A 2HJEA 2M7VA 1LT0A 3KSGA 2L0WA 3KO6A 2QKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYP A;  3H7W A;  1XJ4 A;  2VV6 A;  2V9A A;  1OJG A;  3A0S A;  4GHI B;  4GHI A;  1P0Z A;  4R70 A;  4WLA A;  5DJT A;  2P7J A;  3FG8 A;  5HDC A;  3E4P A;  2W0N A;  4LLO B;  1XFQ A;  3VE4 A;  2OOL A;  3B33 A;  3LIE A;  2WKR A;  4F3L A;  5IS1 A;  1UGU A;  2QHK A;  3MQQ A;  4GS9 A;  4HJ4 A;  4MN5 A;  5AVE A;  1NWZ A;  3H9W A;  1MZU A;  1S1Z A;  3H82 B;  1OJ5 A;  4LRY C;  3PYP A;  3UB6 A;  5I5L A;  1OTE A;  5J3W A;  2R78 A;  3A0V A;  1S67 L;  2A24 A;  2H28 A;  2PYR A;  3CAX A;  4HNB A;  3RTY A;  3F1P B;  3LUQ A;  1LL8 A;  4WL9 A;  1Y28 A;  1XJ3 A;  3EEH A;  5HWW A;  4WN5 A;  3UMD A;  2J80 A;  3NOU C;  3P7N A;  4WF0 A;  4NXG A;  4WUJ A;  3PHY A;  4EES A;  1GSX A;  1KOU A;  1ODV A;  1TS0 A;  2GJ3 A;  3F1P A;  2L4R A;  3NOT C;  4HI4 A;  4LPZ A;  1UWN X;  3HJK A;  4HIA A;  4EQ1 A;  3GEC A;  1V9Y A;  1G28 A;  4LRZ E;  4NXE A;  4KUO A;  2PD7 A;  1OTB A;  2V1A A;  3C2W A;  2HV1 A;  2WKP A;  3LIB A;  4HH3 A;  5DJU A;  4HP9 A;  3UB8 A;  2WKQ A;  4GS9 B;  1D7E A;  4HJ3 A;  5HWV A;  3MFX A;  1XJ6 A;  5HSQ A;  4GCZ A;  2K7S A;  4L9E A;  4XT2 A;  3IS2 A;  4JGP A;  5HD3 A;  4EW7 A;  3UME A;  3MR0 A;  3H7W B;  4PKY A;  2B02 A;  2BAS A;  5F69 A;  4BBU A;  1OT9 A;  4EEU A;  1XFN A;  1TS8 A;  3MXQ A;  4HP4 A;  1LSX A;  4L9F A;  3VOL A;  3G6O A;  3C8C A;  1OTA A;  3UE6 A;  3KX0 X;  1DP6 A;  4HOI A;  2PHY A;  5F68 A;  4PKY G;  2OWH A;  1N9N A;  5HZH A;  2Z6C A;  4H6J A;  3NOP C;  4L9G A;  4MN6 A;  4M4X A;  1F9I A;  2OWJ A;  4EEP A;  1LSV A;  4KUK A;  3OLO A;  1T18 A;  3LID A;  4HY8 A;  1GSV A;  1S4R A;  3GDI A;  4I5S A;  5AVF A;  2W27 A;  5TBM A;  2KX6 A;  4EER A;  2M1C A;  4LRX C;  5HDD A;  1TS6 A;  1N9O A;  3RH8 B;  3MJQ A;  2D01 A;  2JHE A;  1X0O A;  2ZBB A;  5EFW A;  3UB9 A;  4BBT A;  5A8B A;  1LSW A;  1T1A A;  3K3C A;  1F98 A;  1T1B A;  4JGR A;  2QWS A;  2VV8 A;  2I9V A;  4HQA A;  4I39 A;  4DJ3 A;  2L1M A;  1OTD A;  2VLG A;  3A0R A;  3LI8 A;  2QJ7 A;  3BY9 A;  1D06 A;  3F1N B;  4NXF A;  2INW A;  3BWL A;  3ZQ5 A;  2CMN A;  2PDR A;  3NHQ A;  4RQ9 A;  3F1O B;  4K08 A;  1JNU A;  3BY8 A;  2V1B A;  3LIA A;  4I3J A;  3ICY A;  5HWT A;  3ULF A;  5J7E A;  3IS2 B;  2PR6 A;  4H6J B;  2YKF A;  4DJ2 A;  4BBV A;  4I3A A;  5F5Y A;  3LYX A;  2Z6D A;  3K3D A;  4KQD A;  5DKK A;  1DP9 A;  1OTI A;  1P97 A;  4JGQ A;  2V0W A;  2PD8 A;  2D02 A;  4EXO A;  4HHD A;  2YKH A;  2ZOH A;  3SW1 A;  1GSW A;  2KDK A;  2VV7 A;  3CWF A;  3LIC A;  3VE3 A;  4XT2 B;  3F1N A;  5KIZ A;  3UB7 A;  1VB6 A;  4I3I A;  3D72 A;  3T50 A;  3E4O A;  1DRM A;  4R6L A;  4E04 A;  5G4Z A;  4YWZ A;  1TS7 A;  3F1O A;  1EW0 A;  5HD5 A;  3CLO A;  2JN7 A;  1V9Z A;  2A24 B;  2V0U A;  3HJI A;  3IBR A;  4JGO A;  1S1Y A;  4R3A A;  2ZOI A;  5J4E A;  1S4S A;  2EA9 A;  3FC7 A;  4EET B;  2VEA A;  3H82 A;  4GW9 A;  2QJ5 A;  5G4Y A;  3MQO A;  4HJ6 A;  4NXB A;  4R38 A;  3LI9 A;  3NJA A;  1S66 L;  5IU1 A;  3E4Q A;  1OT6 A;  1T19 A;  5HDS A;  1XJ2 A;  1UWP X;  5F6A A;  4HH2 A;  3EWK A;  1T1C A;  1N9L A;  2PR5 A;  3LIF A;  4B9O A;  1BYW A;  5DKL A;  1WA9 A;  1DP8 A;  1LT0 A;  4I38 A;  5TBM B;  4F3L B;  2L0W A;  2QKP A; 
#chains in the Genus database with same CATH topology
 4E3M A;  3IX3 A;  2OOL A;  3B33 A;  4CQH A;  4GS9 A;  5AVE A;  5EV0 A;  3H9W A;  1XP4 A;  2XRN A;  2XDM A;  3R7W A;  3ZNY A;  5I5L A;  5CX7 A;  3HLB A;  1L0D A;  2XD1 A;  3MZD A;  4QD4 A;  2ZQD A;  2EFU A;  2J80 A;  3NOU C;  3P7N A;  4WF0 A;  4WUJ A;  3T4K A;  1IOU A;  4GZB A;  1K4F A;  3QP2 A;  3FKW A;  4JXG A;  2V1Z A;  2V1A A;  2XK1 A;  4CPK A;  5EVI D;  1Q2P A;  4N9K A;  4Y7P A;  5A93 A;  4X6T A;  1FIK A;  3Q7Z A;  2B02 A;  4LV2 A;  2Y2N A;  1BLH A;  1K56 D;  1VEU A;  5HZH A;  4MN6 A;  3GDI A;  2HP6 A;  3ZYT A;  3HBR A;  2UWX A;  4B4X A;  3C5A A;  1OTD A;  4K91 A;  4WYY A;  3S7Q A;  1D06 A;  3UNW A;  4PM7 A;  3SOI A;  3UPP A;  4RQ9 A;  1KE0 A;  3V67 A;  3PBN A;  4ME4 A;  4DF6 A;  3OPL A;  4G3V A;  4OLG A;  2PR6 A;  2PT7 A;  3BFD A;  1AWI A;  3ZDJ A;  4R3J A;  1H3Q A;  1I2S A;  4EV4 A;  4R23 A;  5M18 A;  1P97 A;  4MNR A;  2Q0O A;  2KDK A;  1KE3 A;  4WEJ A;  1SZV A;  4OQI A;  1IKG A;  4K0X A;  4IVI A;  5EEC A;  2WGV A;  4BL3 A;  3ZFZ A;  4HJ6 A;  4DDY A;  5CTM A;  4GD8 A;  2XD5 A;  5FAP A;  1XJ2 A;  4Y15 A;  1ESU A;  4JBF A;  3HCY A;  4DE3 A;  4YNR A;  1XJ4 A;  5AJG A;  2WYX A;  2NUT C;  4S2K A;  2Y2Q A;  3EOI A;  1PW8 A;  3LFV A;  5TR7 A;  2QMI A;  5CHU A;  1CK3 A;  3QP4 A;  3A0V A;  1E25 A;  2H28 A;  3Q7V A;  4ESP A;  1YLP A;  4EES A;  1ODV A;  1ZG6 A;  3GEC A;  3FYZ A;  2ZLY A;  5HX9 A;  5AQ7 A;  3BLS A;  3O88 A;  4E3J A;  4Q0H A;  4GCZ A;  3T1Q B;  1FCN A;  4GN2 A;  1VET B;  2OAQ 1;  4HP4 A;  3OPH A;  1Z09 A;  2Y79 A;  1KVM A;  1SCW A;  2Z6C A;  2KOI A;  3FZC A;  1T18 A;  2DRW A;  2ZC3 B;  5AVF A;  1FCM A;  3C4O A;  3LY3 A;  2ZBB A;  3OZH A;  2WAE A;  4Y2F A;  4WZ5 A;  3GVB A;  4GJ4 A;  3N6I A;  2PAV P;  3T12 B;  4Z1W A;  2FFY A;  5FQJ A;  2XRO A;  4KQD A;  2EX9 A;  2CC1 A;  3GR2 A;  3VFF A;  4JXW A;  1GSW A;  1IEL A;  4XT2 B;  1SKO A;  2IWC A;  4S2N C;  3H82 A;  4GW9 A;  1W8Q A;  4LFU A;  1G6O A;  1KE4 A;  5G4Y A;  3LI9 A;  4IUK A;  4IVK A;  5IU1 A;  4ETZ A;  3HUO A;  3IX4 A;  3PBR A;  1T1C A;  2WUQ A;  4KZ4 A;  5L10 A;  3MF0 A;  2GZA A;  3D9Y A;  2PYP A;  4QWO A;  2BLS A;  2VV6 A;  3NBL A;  1NWZ A;  1OJ5 A;  3PYP A;  1KDW A;  1OTE A;  3MKF A;  2EFX A;  1S67 L;  2PYR A;  4N1H A;  4BWI A;  1YSQ A;  1YQS A;  4YIN A;  4NXG A;  1KOU A;  2OLU A;  2L4R A;  4EQ1 A;  3UY6 A;  2Y55 A;  4NXE A;  4HJ3 A;  1TDG A;  2Y2P A;  1PW1 A;  3IF5 A;  4ARZ A;  1YMS A;  3N7W A;  2W3D A;  3MXQ A;  3EGX C;  4MCW A;  5CHM A;  3VP1 A;  2EWW A;  2H0T A;  4HY8 A;  5BOH A;  4FH2 A;  4FD8 A;  3KSI A;  2W3H A;  5HAR A;  1F5M A;  1F98 A;  4KG6 A;  4PM8 A;  2HP5 A;  4JPM A;  3HLD A;  4NXF A;  3W4P A;  4E3K A;  3LR3 A;  2HGV A;  1MWS A;  2P74 A;  3GQZ A;  5F5Y A;  2J9O A;  5DKK A;  4LGW A;  4PM9 A;  3CWF A;  4S2L A;  1G6A A;  4O7D A;  3T4J A;  3UB7 A;  1K4E A;  3D72 A;  4R1G A;  4MBH A;  4JF4 A;  2XR0 A;  3MBZ A;  4DJ2 A;  2A24 B;  3T4S A;  3HJI A;  1S0W A;  1S1Y A;  5J4E A;  3GV9 A;  1GHI A;  1ACF A;  1CI9 A;  3DWK A;  1ES3 A;  5FSR A;  3SH8 A;  1N9L A;  4C6Y A;  1DP8 A;  4OOY A;  4I38 A;  3NDE A;  4F3L B;  5E2E A;  5FEG A;  1HVB A;  1K55 C;  1IFQ A;  2Z2L B;  3ZG0 A;  5HDC A;  1XFQ A;  4DDS A;  1H5X A;  3PXP A;  3H82 B;  2JKF A;  3MS6 A;  1HLU P;  5CER A;  3EEH A;  4D2O A;  1BLC A;  1TS0 A;  3Q81 A;  4Y3I A;  1FSW A;  2PD7 A;  4Q8I A;  2IA2 A;  5HWV A;  4QY6 A;  4FUW A;  3TG9 A;  4DXC A;  4X1L A;  4PM5 A;  4PKY A;  4S2O A;  1FOF A;  4AFI A;  4UA6 A;  1OTA A;  5CGX A;  3CMZ A;  4WEK A;  2AVX A;  5F68 A;  2X02 A;  1K38 A;  1M40 A;  4M4X A;  2OWJ A;  4UHU A;  4P87 A;  1S4R A;  2W27 A;  5TBM A;  5L2F A;  4RYE A;  5HDD A;  2GDN A;  2D01 A;  2G2W A;  4ZDX A;  4BBT A;  3MFD A;  1KGF A;  2L1M A;  2O9A A;  1SKO B;  2V8C A;  1PNE A;  4K08 A;  5HWT A;  4O01 A;  5GLD A;  4E6X A;  4GDN A;  4P6Z S;  4I3A A;  5GLA A;  1LI9 A;  1K54 A;  4PPR A;  1XKZ A;  3S7O A;  2HDU A;  1ES2 A;  1RCJ A;  3JVV A;  4GLQ A;  3IBR A;  2G2U A;  3TRC A;  4EBP A;  5CEC A;  4Y13 A;  1H8Z A;  3BYD A;  2RCX A;  3GRJ A;  2WAD A;  2HJE A;  3IWO A;  1LT0 A;  1TVF A;  2L0W A;  5J7E A;  5FI6 A;  3DTM A;  5EVI B;  2B18 A;  3UB8 A;  2P7J A;  3QHY A;  3SH7 A;  2QHK A;  2ZD8 A;  4HJ4 A;  1S1Z A;  1PYY A;  3BM6 A;  1S6R A;  2ZC5 B;  3TOI A;  3O5Y A;  1P9R A;  2P9V A;  3LEQ A;  3RJU A;  3LR5 A;  1JWV A;  1K56 A;  5FEF A;  1MC0 A;  2W3G A;  3ZG9 B;  3CPT B;  2LB5 A;  5HPF A;  1YLZ A;  4EW7 A;  1BLP A;  2IWD A;  3N4I A;  1XPB A;  2E8I A;  2R9W A;  3LY4 A;  4BD0 A;  1WE4 A;  4I5S A;  2Y59 A;  4UAA A;  4CLC A;  1A0K A;  3MJQ A;  3D4F A;  4E6W A;  1ZC2 A;  2WAF A;  4I39 A;  4EBN A;  3S1Y A;  2INW A;  5HFO A;  1LL5 A;  3F1O B;  4MLL A;  3LIA A;  1JVJ A;  4EU0 A;  1E3U D;  5HW3 A;  2PD8 A;  1IYO A;  1LL9 A;  1YLW A;  5FQQ A;  4NKP A;  3Q1F A;  4E3L A;  3EQU A;  4Y0T A;  3FC7 A;  3P09 A;  3C38 A;  3DAV A;  1XX2 A;  2A49 A;  4X25 A;  5F6A A;  4P85 A;  2WKH A;  3HUN A;  3P01 A;  5EE8 A;  4R4S A;  2ZMA A;  4R70 A;  3QP1 A;  2C5W B;  2ZMF A;  2Y4A A;  4YFM A;  3MQQ A;  2EXA A;  1IKI A;  4QU3 A;  3UB6 A;  2Y8H A;  5J3W A;  5I94 A;  2R78 A;  4HES A;  4HNB A;  4OOM A;  2P04 A;  4IBR A;  1GSX A;  4U0X A;  3UPO A;  1J3W A;  4KUO A;  3QP8 A;  5GHY A;  3VOL A;  3E2K A;  4QJG A;  3Q07 A;  4A5R A;  1DP6 A;  2WGW A;  4Q0J A;  4H6J A;  1L0E A;  1NRF A;  1HD8 A;  3TW8 A;  2KX6 A;  4WM9 A;  3IHA A;  2IWB A;  4ETX A;  1X0O A;  3IHB A;  1EWZ A;  5A8B A;  3ZG7 B;  2OV5 A;  5K5B A;  3NHQ A;  3UE0 A;  1WYB A;  5FAQ A;  4ZJ3 A;  4HHD A;  2ZOH A;  3LIC A;  3FKV A;  3VE3 A;  4X53 A;  2ZL1 B;  1VB6 A;  5D3O A;  5AQ9 A;  1YAX A;  1EW0 A;  4KZ9 A;  5FI2 A;  1NJ4 A;  3C30 A;  5CTN A;  5CRF A;  1FCO A;  3ZG5 A;  4BL2 A;  1T19 A;  5F83 A;  5GLC A;  1UWP X;  4HH2 A;  4X55 A;  4B4Z A;  2DNS A;  2Y2K A;  1STZ A;  2JKT M;  4BLM A;  4IHQ A;  5EOO A;  5KMW A;  4II7 A;  3FG8 A;  3MZE A;  5IS1 A;  3LIE A;  4OVD A;  4ARZ B;  3VV4 A;  2J3T C;  5JYP A;  3GTC A;  4BJP A;  3ZGA B;  2GJ3 A;  4OQ0 A;  3E98 A;  2WKP A;  5DJU A;  3VP4 A;  3DTI A;  1MPL A;  3HLF A;  1JTD A;  4L9E A;  3D3O A;  3T4O A;  5EVI A;  4X1M A;  3BEB A;  5F1F A;  3DTK A;  4S2I A;  2K31 A;  4UQI S;  3UDF A;  1TEM A;  1BLS A;  4LRX C;  1PI5 A;  3GMW A;  1NYM A;  2WZZ A;  1ONH A;  2VGL S;  3K3C A;  2O0Y A;  4HQA A;  5M19 A;  1NXY A;  1TD5 A;  4IED A;  2XFS A;  4HBT A;  4OQH A;  3M2J A;  5HAI A;  4IBX A;  4LCL A;  1CJF A;  2Q9M A;  3V5M A;  3OCL A;  4R6L A;  5IHV A;  5GHX A;  3CLO A;  5DF7 A;  3MXS A;  4JGO A;  2ZOI A;  3MQ0 A;  4EET B;  4HEF A;  3NJA A;  2OSU A;  2W1T A;  1KGG A;  1ALQ A;  4FTX A;  3EGD C;  3OPP A;  3M2K A;  3RXX A;  3LIF A;  3HLC A;  5DKL A;  1ZTU A;  3JYI A;  5GHZ A;  4RX2 A;  1ZHH B;  4NG2 A;  4GHI A;  4ZTK A;  1GA9 A;  2VJW A;  4KG5 A;  3PBO A;  3BFE A;  4LRY C;  1N4O A;  2G7U A;  1F2K A;  3CPT A;  1ERQ A;  1W79 A;  3IX8 A;  1JWZ A;  3F1P A;  4LV1 A;  1UWN X;  4LCM A;  4EUZ A;  4WZ5 C;  2ZQ8 A;  4OP5 A;  4ZBE A;  3TJZ C;  2WKQ A;  3OCN A;  1LI0 A;  5GLB A;  2V8F A;  3G2Z A;  4CLC D;  4EEU A;  1TS8 A;  3G6O A;  3LO7 A;  4HOI A;  4LV0 A;  2OWH A;  1HZO A;  1MKI A;  3C4P A;  3NOP C;  4MEZ A;  2XGN A;  4MBK A;  1K0K A;  3LGO A;  2M1C A;  2Z2M B;  1L0G A;  3TSG A;  4CLC C;  3IWI A;  3P98 A;  1ESI A;  1YSP A;  4WMC A;  2V2F F;  3B47 A;  1T1B A;  2QWS A;  2W1T B;  3T1X A;  3WWX A;  1ZKJ A;  3BY9 A;  2ZL1 A;  4ZJ1 A;  1IEM A;  1RP5 A;  2ZQ7 A;  4H6J B;  3R4K A;  1CEF A;  5EVE A;  5HL1 A;  3L9K A;  2WK0 A;  3UE1 A;  3HLE A;  4G3K A;  1MWU A;  4KZ8 A;  3K2N A;  1QMF A;  3C7V A;  5G4Z A;  1FR1 A;  3O86 A;  2XF3 A;  2Y91 A;  1PI4 A;  3HRE A;  1V9Z A;  2V0U A;  3O3V A;  4R38 A;  1HTZ A;  2PBD P;  2EX8 A;  1NRJ A;  2GNX A;  2PR5 A;  2PU4 A;  4KZ7 A;  4XXR A;  3AGE A;  3H7W A;  1SHV A;  4X69 A;  5DJT A;  2W0N A;  4LLO B;  4F3L A;  3E2L A;  5CEB A;  1O07 A;  3RTY A;  3LUQ A;  1Y28 A;  3UMD A;  2DMW A;  2XLN A;  1VHM A;  1ERO A;  3T1S A;  5E2G A;  1OTB A;  4HH3 A;  3S7P A;  2VGJ A;  3G30 A;  5HSQ A;  5DTS A;  3UME A;  5CHJ A;  5L07 A;  3VSK A;  4R3B A;  4JXS A;  3MKE A;  3NC8 A;  2OLV A;  4ZAM A;  1N9N A;  1ZG4 A;  4KUK A;  4L0L A;  2WKI A;  3NEC A;  5CGS A;  3SZT A;  3CIT A;  1TS6 A;  3KSF A;  2ACG A;  2B95 A;  2VV8 A;  5F82 A;  2HDS A;  4PM6 A;  4RVA A;  3BJN A;  3ULF A;  2HP9 A;  3ICY A;  2J3T D;  3JPU A;  4H8R A;  1MBL A;  3PBS A;  1KVL A;  1Y54 A;  2JC7 A;  4QPR A;  2J7V A;  5J8X A;  3SW1 A;  3NI9 A;  1W8Y A;  5EM0 A;  4UA9 A;  1BUL A;  3BFF A;  3E4O A;  2EXB A;  4GKU A;  2QYB A;  1M6K A;  3HL9 A;  4NXB A;  1PFL A;  5FQK A;  2H5S A;  1CEG A;  2JKG A;  1SKF A;  4N1X A;  1WYC A;  4FH4 A;  2PRF A;  4KZ3 A;  4GD6 A;  3LCE A;  2OAP 1;  2XFT A;  3A0S A;  1YLT A;  2QPN A;  4DE0 A;  5AQB A;  4S2M A;  1KDS A;  2XA7 S;  3WS5 A;  1UGU A;  3A3F A;  1JTG A;  3VOZ A;  2HJ9 C;  2QZ6 A;  1YPR A;  1SDN A;  1PWD A;  5EVL A;  4WL9 A;  1E3U A;  5HWW A;  3I7J A;  3M6B A;  3HVF A;  2Y2J A;  1G28 A;  1G5U A;  3IF6 A;  4KZ5 A;  1W63 M;  2ZM8 A;  3CUE A;  2HZ5 A;  3G4P A;  4DXB A;  4JGP A;  1TDL A;  5C5K A;  1EI5 A;  2ZM0 A;  4BBU A;  3CZD A;  3U4L P;  2PBY A;  5EOE A;  3BFC A;  4O0P A;  1BTL A;  5M1A A;  4GDB A;  1LSV A;  1YM1 A;  2ZC7 A;  3LID A;  3MMH A;  1BUE A;  1JWP A;  3OPR A;  3CUE C;  3IH9 A;  2JHE A;  1PZP A;  3UO9 A;  3NUL A;  3LI8 A;  2CMN A;  1P9W A;  1JNU A;  3IT9 A;  3FV7 A;  2FFF B;  5HL6 A;  3U2A A;  4OQG A;  5AQA A;  3VSL A;  4EXO A;  2YKH A;  3UDI A;  2V20 A;  4S2J A;  4I3I A;  4E04 A;  5FQI A;  5FI7 A;  3R7W B;  3L7H A;  3V50 A;  3W8K A;  2HDQ A;  2JKT I;  4E3I A;  5EUA A;  2JBF A;  3CJM A;  5A90 A;  1WA9 A;  1Z6F A;  3HLW A;  4E3O A;  1I2W A;  2RL3 A;  4K0W A;  1NZU A;  4WLA A;  4Y17 A;  3IWQ A;  3SS3 A;  4WMC D;  5LBR A;  2WKR A;  5DTK A;  2Y2L A;  4DE2 A;  1J9M A;  1DJB A;  3FPW A;  4FSF A;  5GL9 A;  2A24 A;  3FWL A;  1NLY A;  3NY4 A;  1XJ3 A;  1YT4 A;  3OOV A;  1RGY A;  4KEN B;  4HIA A;  4HP9 A;  1LHY A;  4GS9 B;  1DJC A;  2VX8 A;  4ZRR A;  3Q7V B;  3KYQ A;  4ID4 A;  1XFN A;  3UB5 P;  1LSX A;  3IQA A;  1DY6 A;  2W3E A;  2XSS A;  4L9G A;  5DFX A;  3ISG A;  2VZW A;  3QNC A;  1PIO A;  4WZ4 A;  3M6H A;  3T1R A;  1XGI A;  2M7U A;  3UN7 A;  1T1A A;  3ZHH A;  3B3X A;  1C3B A;  2I9V A;  1K6S A;  1OPX A;  2VA0 A;  3WS1 A;  4Q0I A;  4BD1 A;  5FA7 A;  4JF5 A;  2VGL M;  4P6B A;  4NET A;  3K3D A;  3B42 A;  2R9X A;  3QNB A;  4UQI M;  2JKR I;  4KQQ A;  3G34 A;  2A2L A;  2Y2G A;  3MZF A;  3CG5 A;  1DJA A;  5HD5 A;  2KLI A;  4CJN A;  3UDX A;  1S66 L;  4M3K A;  2B5R A;  2EX6 A;  1VEU B;  1U60 A;  2WZX A;  2Y2I A;  4OKP A;  4OON A;  1L3L A;  3PTE A;  1VM1 A;  2V9A A;  2Y2H A;  3PR6 A;  4GHI B;  1P0Z A;  4BQM A;  3E4P A;  1GA0 A;  4KZ6 A;  3VOY A;  1LLB A;  1BZA A;  4BMW A;  4P0M A;  2JE5 A;  4GOG A;  3BQA A;  4XUX A;  4C75 A;  4LRZ E;  2Y2O A;  2K7S A;  4XT2 A;  2ZJ9 A;  5HD3 A;  3BFG A;  1XGJ A;  3H7W B;  3ZNT A;  3Q82 A;  3KYZ A;  3ZCZ A;  3BLM A;  3PAE A;  3FPV A;  3RH8 B;  3NIA A;  5EFW A;  3BW6 A;  2QJ7 A;  2HPB A;  3PAG A;  3BWL A;  5KZH A;  3IF6 C;  2ZC4 B;  2A3U A;  3HLG A;  1QME A;  4GNU A;  3G2Y A;  2JKR M;  1XA1 A;  5MC7 A;  1PRQ A;  1CI8 A;  2D02 A;  5KSH A;  1CQA A;  1BT5 A;  5DF9 A;  2P9V B;  1NYY A;  3W4Q A;  3DWZ A;  2BG1 A;  4KQR A;  2VEA A;  3MQO A;  3VP2 A;  4D60 A;  3E4Q A;  4O8G A;  1K54 C;  4B9O A;  4DRT A;  3GSG A;  3KO6 A;  4DN0 A;  1E4D A;  2PU2 A;  1Y4O A;  3VE4 A;  4FOF A;  3T4T A;  3AGD A;  3IF6 B;  3ITA A;  3CAX A;  4RA7 A;  2VKS A;  3F1P B;  3QP5 A;  4C3Q A;  3CI6 A;  5HAQ A;  2UV0 E;  5FQ9 A;  1ERM A;  4LPZ A;  4IUH A;  5TFQ A;  3ZVT A;  1FR6 A;  2J9P A;  2FH5 A;  2LB9 A;  1NY0 A;  4X56 A;  3N8S A;  4X68 A;  3IS2 A;  2Y2M A;  5EPH A;  5F69 A;  2BAS A;  4L9F A;  2HDR A;  2PHY A;  3W4O A;  4EEP A;  3LR4 A;  4N92 A;  3SH9 A;  5A91 A;  1K57 A;  3A0R A;  2VLG A;  3IXH A;  3S4X A;  1O7E A;  2O9B A;  3DTE A;  3BEC A;  3ZVW A;  2YKF A;  1NZO A;  2FZ0 A;  4MBF A;  2VK3 A;  1OTI A;  3C7U A;  2VV7 A;  4MN7 A;  5KIZ A;  1ES4 A;  3VFH A;  3LEZ A;  3JVU A;  4YWZ A;  2H0Y A;  4OLD A;  4S2N A;  2ZQC A;  4R3A A;  4HBU A;  2QJ5 A;  5U47 A;  4JKT A;  1FSY A;  1PWG A;  4G3W A;  1OT6 A;  3RFB A;  3WRT A;  3EWK A;  3A3I A;  2O9C A;  5TBM B;  5CGW A;  5HAP A;  4Y0O A;  3E0Y A;  1MXO A;  4KG2 A;  3DBA A;  5FL3 A;  1MZU A;  1N9B A;  2GX5 A;  1VQQ A;  1ONG A;  4OP8 A;  1LL8 A;  2MJ6 A;  3SS4 A;  5TGF A;  3PHY A;  4IJG A;  3NOT C;  4MDZ A;  2HV1 A;  5CED A;  4OOL A;  4Y5F A;  2XH9 A;  4NK3 A;  4KZA A;  3MFX A;  1XJ6 A;  2I72 A;  3MR0 A;  2JCH A;  3C8C A;  1L0F A;  4XUZ A;  1K6R A;  5FDH A;  4PKY G;  5F1G A;  5DFY A;  5EM1 A;  2ZC6 B;  3S7N A;  1Q2Q A;  3G32 A;  4F94 A;  4P6Z M;  4EBL A;  3UB9 A;  5FAO A;  3T4L A;  1SDE A;  5FAT A;  3WS2 A;  5E2H A;  3ZQ5 A;  2V1B A;  4I3J A;  1VET A;  3IS2 B;  4BBV A;  3LYX A;  3UPN A;  3NDG A;  4JGQ A;  1H8Y A;  1RGZ A;  1GCE A;  3VP0 A;  4LEN A;  2X01 A;  2BTF P;  3F1N A;  3G31 A;  1IYS A;  2WGI A;  2X71 A;  4NEE D;  4Y0U A;  2P08 A;  3A3D A;  2ZQ9 A;  2XQZ A;  2ZMV A;  1MY8 A;  4JXV A;  5FDS A;  3EEA A;  3RXW A;  1BYW A;  1KGE A;  2WGW B;  3PBQ A;  4CLC E;  1G68 A;  4PHT A;  3BQ8 A;  4KQO A;  2Q9N A;  3WS4 A;  3CHW P;  4DKI A;  2ZM2 A;  4RX3 A;  3V39 A;  4FCF A;  4EWF A;  4WN5 A;  1YLY A;  3HJK A;  4S2P A;  3C2W A;  4MMN A;  4R0Q A;  1NLZ A;  3VMA A;  1D7E A;  3W2Z A;  4JF6 A;  3TE8 A;  1MWT A;  4QY5 A;  3KYE A;  5CXW A;  3UE3 A;  5TJJ A;  3DW0 A;  1OT9 A;  3PBT A;  3BRM A;  1MKM A;  4EQI A;  1BSG A;  3KX0 X;  2HF6 A;  1YKD A;  3OLO A;  5E43 A;  2J3W A;  4U0T A;  1D1J A;  4EER A;  4EUV A;  4GB7 A;  1K25 A;  3A3E A;  5DTT A;  3T4Q A;  1LSW A;  3OBF A;  2NUP C;  5FQM A;  4JGR A;  5L09 A;  4DJ3 A;  3MSH A;  5EVI C;  4KZB A;  3QP6 A;  4OH0 A;  4ZJ2 A;  1AXB A;  3G35 A;  3KSH A;  3BY8 A;  5DF8 A;  1H0M A;  2XEP A;  5E2F A;  3ZG8 B;  1GHM A;  3WS0 A;  4DMZ A;  3LR0 A;  3IBJ A;  3OC2 A;  1DRM A;  1TS7 A;  3F1O A;  3V3S A;  1FQG A;  3IXB A;  1S4S A;  2EA9 A;  1XXM A;  5DVA A;  2DCF A;  3ITB A;  1IYP A;  4CLC B;  5L8M A;  4LV3 A;  1OJG A;  3SS5 A;  1IYQ A;  4MN5 A;  4UEY A;  3VP3 A;  1YMX A;  2J8Y A;  2C6W B;  4WBG A;  2W3F A;  1YLJ A;  4UA7 A;  4OPY A;  4OPZ A;  2O99 A;  3IXD A;  1PZO A;  4DE1 A;  4HI4 A;  4WEL A;  1GHP A;  1V9Y A;  3LIB A;  3O87 A;  4JLF A;  4OPR A;  4B88 A;  5IT5 A;  4R4R A;  4BEN A;  1XA7 A;  3UE6 A;  4U3T A;  1K55 A;  1F9I A;  5KSC A;  4B93 A;  2WKE A;  1ES5 A;  1GSV A;  1I5Q A;  1MWR A;  3HUM A;  5JYO A;  3MXR A;  1N9O A;  1K57 C;  2EWV A;  2ZQA A;  1PWC A;  1W5D A;  1OME A;  3AGF A;  2K2N A;  3N8R A;  3V3R A;  3F1N B;  3EQV A;  2PDR A;  3NCK A;  4QHC A;  2VGK A;  1FIL A;  3IH8 A;  4QB8 A;  2Z6D A;  1DP9 A;  5FAS A;  2V0W A;  1L2S A;  4N9L A;  3IXG A;  3T50 A;  1W63 Q;  1H8M A;  2XA7 M;  5HPI A;  4PAU A;  2EX2 A;  2JN7 A;  5G18 A;  3N8L A;  3S22 A;  3A3J A;  5A92 A;  4E3N A;  1CF0 A;  2E8J A;  2H10 A;  5HDS A;  3WRZ A;  2W1R A;  4YOF A;  4OPQ A;  1TF1 A;  1W7F A;  4PMA A;  2M7V A;  3KSG A;  4Z9Q A;  2QKP A; 
#chains in the Genus database with same CATH homology
 4DN0 A;  3H7W A;  2B18 A;  3UB8 A;  5DJT A;  2P7J A;  2W0N A;  4LLO B;  3VE4 A;  2OOL A;  3B33 A;  4F3L A;  4FOF A;  4CQH A;  3T4T A;  2QHK A;  4GS9 A;  5AVE A;  4HJ4 A;  3H9W A;  2XRN A;  1S1Z A;  3R7W A;  5I5L A;  5CX7 A;  3CAX A;  3RTY A;  2VKS A;  3LUQ A;  3F1P B;  3O5Y A;  1Y28 A;  1P9R A;  3UMD A;  2J80 A;  3CI6 A;  3LR5 A;  2DMW A;  3NOU C;  3P7N A;  4WF0 A;  4WUJ A;  3T4K A;  1VHM A;  4LPZ A;  1IOU A;  4IUH A;  1MC0 A;  1OTB A;  2V1A A;  4HH3 A;  3S7P A;  2W3G A;  2FH5 A;  5HSQ A;  2LB9 A;  2LB5 A;  5HPF A;  3IS2 A;  4EW7 A;  3UME A;  5F69 A;  2B02 A;  2BAS A;  4L9F A;  2PHY A;  1N9N A;  5HZH A;  4MN6 A;  4EEP A;  3LR4 A;  4KUK A;  4L0L A;  3GDI A;  4I5S A;  3CIT A;  1TS6 A;  3ZYT A;  4CLC A;  3MJQ A;  3KSF A;  2VV8 A;  4I39 A;  1OTD A;  2VLG A;  3A0R A;  3S7Q A;  1D06 A;  2INW A;  2O9B A;  4RQ9 A;  3V67 A;  3PBN A;  3BJN A;  3F1O B;  4ME4 A;  3ULF A;  3LIA A;  3ICY A;  4G3V A;  4EU0 A;  2PR6 A;  2PT7 A;  2J3T D;  2YKF A;  2FZ0 A;  1H3Q A;  3PBS A;  1OTI A;  1P97 A;  2PD8 A;  4QPR A;  3SW1 A;  2KDK A;  2VV7 A;  4WEJ A;  4MN7 A;  5KIZ A;  4NKP A;  3E4O A;  3JVU A;  4YWZ A;  3EQU A;  4R3A A;  2QYB A;  3FC7 A;  3C38 A;  2QJ5 A;  4HJ6 A;  4NXB A;  4G3W A;  1OT6 A;  3RFB A;  1XJ2 A;  5F6A A;  3EWK A;  3HCY A;  3P01 A;  2O9C A;  5TBM B;  2OAP 1;  4YNR A;  1XJ4 A;  3E0Y A;  5AJG A;  4R70 A;  3A0S A;  2NUT C;  2ZMF A;  3DBA A;  2XA7 S;  1UGU A;  5FL3 A;  3MQQ A;  3EOI A;  1MZU A;  3LFV A;  2HJ9 C;  2GX5 A;  2Y8H A;  5J3W A;  3UB6 A;  2R78 A;  3A0V A;  2H28 A;  4HNB A;  4OOM A;  4WL9 A;  1LL8 A;  2MJ6 A;  2P04 A;  5HWW A;  3PHY A;  4IJG A;  4EES A;  1GSX A;  1ODV A;  3NOT C;  4MDZ A;  3GEC A;  1G28 A;  4KUO A;  1W63 M;  2HV1 A;  3CUE A;  4OOL A;  4Y5F A;  4Q0H A;  3MFX A;  1XJ6 A;  4GCZ A;  4JGP A;  5C5K A;  3MR0 A;  4BBU A;  2OAQ 1;  3VOL A;  4HP4 A;  3C8C A;  2Y79 A;  1DP6 A;  4Q0J A;  4PKY G;  4O0P A;  2Z6C A;  4H6J A;  1LSV A;  2KOI A;  1T18 A;  3LID A;  3MMH A;  5DFY A;  5AVF A;  3TW8 A;  3S7N A;  2KX6 A;  4P6Z M;  3CUE C;  4ETX A;  1X0O A;  2JHE A;  2ZBB A;  3UB9 A;  5A8B A;  3T4L A;  3LI8 A;  4Y2F A;  3ZQ5 A;  2CMN A;  5K5B A;  3NHQ A;  4GJ4 A;  1P9W A;  1JNU A;  5J7E A;  2V1B A;  4I3J A;  4Z1W A;  3IS2 B;  4BBV A;  5HL6 A;  2XRO A;  3U2A A;  3LYX A;  4KQD A;  4JGQ A;  4EXO A;  4HHD A;  2YKH A;  2ZOH A;  1GSW A;  3LIC A;  3VE3 A;  4XT2 B;  3F1N A;  1VB6 A;  4I3I A;  4E04 A;  1YAX A;  1EW0 A;  4NEE D;  3C30 A;  2P08 A;  3R7W B;  3H82 A;  4GW9 A;  5G4Y A;  1G6O A;  2ZMV A;  3LI9 A;  4IUK A;  5IU1 A;  4ETZ A;  1T19 A;  3PBR A;  2JKT I;  1UWP X;  3EEA A;  4HH2 A;  1T1C A;  1BYW A;  1STZ A;  3PBQ A;  1WA9 A;  2JKT M;  4CLC E;  4IHQ A;  3MF0 A;  2GZA A;  2PYP A;  2VV6 A;  4WLA A;  4II7 A;  3FG8 A;  4PHT A;  5IS1 A;  3BQ8 A;  3LIE A;  2WKR A;  5LBR A;  4KQO A;  1NWZ A;  1OJ5 A;  3PYP A;  3FPW A;  1OTE A;  4ARZ B;  4FSF A;  1S67 L;  2A24 A;  2PYR A;  4BWI A;  1YSQ A;  3VV4 A;  1NLY A;  1XJ3 A;  2J3T C;  4WN5 A;  4NXG A;  4BJP A;  3OOV A;  1KOU A;  2GJ3 A;  2L4R A;  4EQ1 A;  3HJK A;  4HIA A;  3E98 A;  4NXE A;  3C2W A;  2WKP A;  5DJU A;  4MMN A;  4HP9 A;  1NLZ A;  4GS9 B;  1D7E A;  4HJ3 A;  3TE8 A;  3W2Z A;  4L9E A;  3D3O A;  2VX8 A;  4ZRR A;  3T4O A;  3KYQ A;  3UE3 A;  4ARZ A;  5TJJ A;  1OT9 A;  1XFN A;  2W3D A;  3MXQ A;  3PBT A;  1LSX A;  1MKM A;  3KX0 X;  3EGX C;  2HF6 A;  4MCW A;  2W3E A;  2XSS A;  1YKD A;  4L9G A;  5DFX A;  2EWW A;  3OLO A;  2K31 A;  2VZW A;  4UQI S;  4HY8 A;  2J3W A;  4EER A;  4EUV A;  4LRX C;  3KSI A;  2W3H A;  1F5M A;  2M7U A;  3T4Q A;  1LSW A;  2VGL S;  1T1A A;  3K3C A;  1F98 A;  2O0Y A;  3OBF A;  4JGR A;  2NUP C;  2I9V A;  4HQA A;  4DJ3 A;  1OPX A;  2VA0 A;  4NXF A;  1TD5 A;  4Q0I A;  3KSH A;  2VGL M;  3BY8 A;  3LR3 A;  2HGV A;  5F5Y A;  3K3D A;  3B42 A;  5DKK A;  4UQI M;  4DMZ A;  2JKR I;  3LR0 A;  3IBJ A;  3OC2 A;  3CWF A;  2A2L A;  3T4J A;  3UB7 A;  3D72 A;  1DRM A;  3OCL A;  4R6L A;  1TS7 A;  3F1O A;  5HD5 A;  3CLO A;  2A24 B;  2KLI A;  3HJI A;  3T4S A;  4DJ2 A;  4JGO A;  1S1Y A;  5J4E A;  2ZOI A;  1S4S A;  2EA9 A;  3MQ0 A;  4EET B;  3NJA A;  1S66 L;  2W1T A;  3EGD C;  1N9L A;  4CLC B;  3LIF A;  5DKL A;  1ZTU A;  5L8M A;  1DP8 A;  4I38 A;  4F3L B;  1ZHH B;  4GHI A;  2V9A A;  1OJG A;  3PR6 A;  1IFQ A;  4GHI B;  1P0Z A;  5HDC A;  2VJW A;  3E4P A;  1XFQ A;  3PBO A;  4MN5 A;  4UEY A;  3PXP A;  3H82 B;  4LRY C;  2W3F A;  4BMW A;  2G7U A;  2O99 A;  3BQA A;  3EEH A;  3F1P A;  1TS0 A;  4HI4 A;  4WEL A;  4Y3I A;  1UWN X;  1V9Y A;  4LRZ E;  2PD7 A;  3LIB A;  3TJZ C;  2WKQ A;  3OCN A;  2IA2 A;  5HWV A;  5IT5 A;  2K7S A;  4XT2 A;  5HD3 A;  4PKY A;  3H7W B;  4CLC D;  4EEU A;  1TS8 A;  4AFI A;  3G6O A;  1OTA A;  3UE6 A;  4WEK A;  3KYZ A;  4HOI A;  5F68 A;  2OWH A;  3NOP C;  4M4X A;  1F9I A;  2OWJ A;  4B93 A;  1GSV A;  1S4R A;  2W27 A;  5TBM A;  3FPV A;  2M1C A;  5HDD A;  1N9O A;  2EWV A;  3RH8 B;  4CLC C;  1YSP A;  2D01 A;  5EFW A;  4BBT A;  3B47 A;  1T1B A;  2QWS A;  3BW6 A;  2W1T B;  2K2N A;  2L1M A;  2QJ7 A;  2O9A A;  3BY9 A;  3F1N B;  3EQV A;  3BWL A;  2PDR A;  4K08 A;  5HWT A;  4O01 A;  4H6J B;  3R4K A;  4P6Z S;  4I3A A;  2JKR M;  2Z6D A;  5MC7 A;  1DP9 A;  2V0W A;  2D02 A;  5KSH A;  3S7O A;  5DF9 A;  4G3K A;  3K2N A;  3T50 A;  5G4Z A;  1W63 Q;  1H8M A;  2XA7 M;  3JVV A;  5HPI A;  1V9Z A;  2JN7 A;  2V0U A;  4GLQ A;  4PAU A;  3IBR A;  2VEA A;  3TRC A;  3MQO A;  4R38 A;  3E4Q A;  1NRJ A;  4O8G A;  5HDS A;  2W1R A;  4YOF A;  2GNX A;  4B9O A;  2PR5 A;  1TF1 A;  2HJE A;  2M7V A;  1LT0 A;  3KSG A;  2L0W A;  3KO6 A;  2QKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...