1ODVA

Photoactive yellow protein 1-25 deletion mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
100
structure length
100
Chain Sequence
LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Pas Domains.Common Structure and Common Flexibility
pubmed doi rcsb
source organism Ectothiorhodospira halophila
molecule tags Signalling
total genus 29
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1odvA00
2PYPA 2Z6CA 3NHQA 2L0WA 3UB7A 2K7SA 1F98A 3E4OA 2PR6A 3NOUC 2A24A 1UWNX 3F1OA 4L9EA 1N9NA 3F1NB 3HJKA 5DKKA 3PHYA 1VB6A 1XFQA 4I3AA 2B02A 1BYWA 1S66L 4B9OA 1T1CA 1DP6A 1S67L 2VV6A 2GJ3A 4NXFA 1N9OA 4LRZE 4HY8A 4HNBA 1LSXA 3VE3A 1XJ3A 5J7EA 3H9WA 1N9LA 2OWJA 5TBMB 4F3LA 3BY8A 5HWVA 2W27A 3FC7A 5A8BA 2VV7A 4HI4A 3F1PB 3LICA 3F1PA 1OJGA 1ODVA 4K08A 2ZOIA 3BWLA 5G4YA 4GS9A 3UE6A 3LI9A 5EFWA 1GSXA 3RH8B 1G28A 4H6JA 4I3JA 4HJ3A 1EW0A 5HWWA 5G4ZA 3GECA 2KX6A 3H82A 5HZHA 3MJQA 2D01A 3NOPC 2PHYA 5DJTA 3ICYA 3ULFA 2D02A 2INWA 2CMNA 2QWSA 4NXGA 3MXQA 3UB6A 1WA9A 2QJ5A 1DRMA 4GW9A 3MFXA 3UMEA 3H7WB 4XT2A 2BASA 5HDCA 2I9VA 3H7WA 4PKYA 4LRYC 1GSWA 2YKFA 5F68A 1TS7A 4HH2A 2JHEA 2PYRA 1OTDA 3IS2B 1F9IA 4I5SA 5HDSA 2ZBBA 4MN6A 4L9FA 3F1NA 1OT6A 4JGRA 4BBUA 4WN5A 2QJ7A 4EW7A 1Y28A 3G6OA 2WKRA 4E04A 3LIBA 5HWTA 3FG8A 2YKHA 3A0RA 4I39A 4JGOA 5DKLA 4HIAA 1S4SA 5I5LA 3LIFA 4R70A 3KX0X 1D7EA 3MQQA 1XFNA 3NJAA 4EESA 1UGUA 1OTAA 1LT0A 5J4EA 4L9GA 5F5YA 1X0OA 5TBMA 2V1AA 1GSVA 3P7NA 3IBRA 2VV8A 3RTYA 5IS1A 4MN5A 1MZUA 1OTBA 2V0UA 4HHDA 2PD8A 1UWPX 1S1YA 2P7JA 1D06A 1TS8A 2L1MA 3C8CA 3LIDA 3LUQA 3SW1A 2L4RA 1T18A 5AVFA 3VE4A 3UMDA 1XJ2A 1P0ZA 4KUKA 2V0WA 2V1BA 3A0VA 1V9YA 4R3AA 4JGQA 1LL8A 1OJ5A 3MR0A 2HV1A 4GHIB 3BY9A 2VEAA 4WLAA 3ZQ5A 5IU1A 4R38A 5HSQA 5KIZA 5HD5A 4HJ4A 2ZOHA 4EERA 4DJ2A 4BBTA 1LSVA 4WL9A 3T50A 4NXBA 3VOLA 3LYXA 1KOUA 3NOTC 3LI8A 4HOIA 3PYPA 4BBVA 5HDDA 4R6LA 3IS2A 4M4XA 3OLOA 3E4QA 1LSWA 3UB9A 2QHKA 4KUOA 5AVEA 1JNUA 2A24B 3F1OB 2PDRA 1NWZA 3K3CA 3E4PA 2OOLA 5DJUA 4HQAA 4EEUA 2EA9A 3CAXA 3LIAA 4LRXC 4LPZA 3EWKA 4I3IA 1S1ZA 3LIEA 1XJ4A 3CLOA 2H28A 3C2WA 1S4RA 4NXEA 4EQ1A 1DP8A 4RQ9A 4HP4A 4WUJA 3MQOA 1OT9A 4LLOB 2WKQA 4F3LB 1T19A 2V9AA 4HH3A 1OTIA 3K3DA 4EETB 1OTEA 4HP9A 3D72A 4HJ6A 1TS0A 1P97A 2J80A 2M1CA 4GCZA 1TS6A 5F6AA 2QKPA 4GS9B 4H6JB 3CWFA 4PKYG 1DP9A 5J3WA 4DJ3A 5F69A 4GHIA 3GDIA 1XJ6A 4EXOA 3H82B 1T1BA 4WF0A 3EEHA 2W0NA 2Z6DA 2R78A 3UB8A 1T1AA 4YWZA 2PD7A 3B33A 2KDKA 4JGPA 3A0SA 2OWHA 1V9ZA 5HD3A 2WKPA 3HJIA 2JN7A 2VLGA 4EEPA 2PR5A 4KQDA 4XT2B 4I38A
chains in the Genus database with same CATH superfamily
4OOYA 2EX6A 2L0WA 1KDSA 5GLAA 1W8QA 4DE1A 3C5AA 2PR6A 3KSHA 4RA7A 4MNRA 4L9EA 4M3KA 1N9NA 2J9PA 1EI5A 3VSKA 4Q0HA 3PHYA 3A3FA 4WZ5A 1SZVA 3LGOA 1N9BA 1PI4A 1VEUB 3TE8A 4OH0A 1S67L 3JVUA 4OOLA 4R23A 5L07A 1WE4A 5FQMA 5BOHA 4LRZE 3ZHHA 1XKZA 3CUEC 3UDIA 2PRFA 1VHMA 5C5KA 3ZG9B 3TW8A 3R7WB 2X01A 1OPXA 2XA7M 3MXRA 4DXCA 4XUZA 3PTEA 4LGWA 3ZG5A 1MXOA 2OWJA 3UY6A 1MY8A 2XLNA 4E3JA 4PPRA 3EQUA 5CRFA 4NEED 4LV3A 2ZM2A 4S2IA 4BLMA 5FI7A 1YLWA 3CUEA 5HWVA 2G2UA 4KQOA 4GD8A 1YLZA 4IVKA 4UA6A 3RJUA 1FILA 4HI4A 3IXHA 3F1PA 2Y55A 4L0LA 5HX9A 4E3IA 3PR6A 4O01A 2Q0OA 1NLYA 2VGKA 4DE3A 4GLQA 5EE8A 2X71A 4BL3A 4GS9A 3UB5P 2JE5A 5EFWA 2XK1A 1F2KA 5G4ZA 2Y2KA 5EOOA 4CQHA 2D01A 2O9AA 5FQ9A 1ZKJA 5HAPA 1LLBA 1WYCA 1KE0A 2NUPC 3ICYA 2O9BA 5FASA 2DRWA 2CMNA 5CHMA 3E98A 2WGVA 3BW6A 5LBRA 1W7FA 4CLCD 2B18A 4GW9A 5HAQA 3BYDA 4XT2A 3PBTA 5E2EA 3W8KA 2OV5A 1O7EA 1YSQA 5GLCA 3H7WA 3IF6B 4LV0A 2JHEA 2PYRA 1BUEA 5HDSA 5L2FA 3HLEA 4MN6A 1KGFA 2PAVP 1RP5A 4BBUA 1YLPA 3FKVA 4WN5A 4NG2A 3MF0A 3T4OA 3G6OA 3B42A 3AGFA 2WKRA 5F83A 1S0WA 5HWTA 2WKIA 2YKHA 5JYOA 1FOFA 3S22A 4HIAA 2HF6A 2J3WA 1VETB 4DE0A 1FIKA 3LIFA 4R70A 3N8RA 1K55C 3MQQA 1PWDA 3RXXA 3NJAA 4D60A 4H8RA 2ZC7A 3D4FA 1I5QA 5TFQA 1TEMA 1H0MA 2V1AA 3VV4A 4CLCB 3IBRA 2B95A 4HHDA 4ARZA 2I72A 1UWPX 3Q82A 4GDNA 3S7QA 5FAOA 3MZDA 1YMSA 2P7JA 5AJGA 4WEJA 4DRTA 3SH8A 4U3TA 5AQ9A 3B3XA 2C5WB 4BWIA 2J3TC 4EQIA 1P0ZA 2ZM8A 2V1BA 3IX4A 1L3LA 1CEGA 2M7VA 5FEFA 5J8XA 1NZUA 1CJFA 1K54C 2HV1A 1W8YA 3RXWA 1FCMA 3NBLA 3ZGAB 3MS6A 2W1TB 4R38A 5HSQA 5KIZA 1W63Q 4EBNA 3OZHA 3SS3A 2V8FA 2ZOHA 4DJ2A 4QHCA 3WRZA 1K54A 1LSVA 4WL9A 1PZOA 3IHBA 3ZG7B 2WGWA 4BBVA 5CHJA 3UB9A 3SS5A 1BLSA 5EVID 4R4RA 2ZJ9A 4MMNA 2IWBA 4JKTA 2EX9A 1JWVA 3N8SA 2GNXA 2EA9A 3NCKA 2O9CA 4FCFA 4I3IA 1LI0A 4YOFA 2ZQDA 1VQQA 3HCYA 1S4RA 5FAQA 4KZ3A 3OOVA 1G6AA 2G7UA 3VP0A 3HUMA 1FQGA 3CJMA 4ZDXA 4HP4A 1HZOA 2OAQ1 1S6RA 5CEBA 3HL9A 4LLOB 1GCEA 4WEKA 3HLFA 3HLGA 3ZFZA 5EV0A 2ZQ9A 4JF6A 3K3DA 3LR3A 4LCLA 5AQ7A 1TS0A 2EX8A 1KVLA 2WYXA 4GCZA 2EXAA 3OPPA 2JKFA 3PBNA 5FATA 4GS9B 2A2LA 3M6HA 4X53A 1ES5A 4QY6A 5F69A 3UDXA 4EXOA 1KE3A 4DE2A 4WF0A 5FDHA 4X25A 1TDGA 2W0NA 2Z6DA 4ZJ3A 5CTMA 5G18A 4GD6A 5CXWA 4DF6A 4QWOA 3MSHA 4X1LA 3B33A 4K91A 3LR0A 3A0SA 4DKIA 5MC7A 4WMCD 3EGXC 3RFBA 1QMEA 4KZ7A 4Y7PA 4OPYA 2ZL1A 1KGGA 3HREA 4XT2B 4K0WA 3ZNYA 5F1GA 2NUTC 1XX2A 1PRQA 2PYPA 4Q0JA 2WZXA 4GOGA 3IF5A 2Z6CA 3NHQA 2V2FF 2K7SA 1MBLA 1K4FA 2BTFP 3HJKA 2VJWA 5DKKA 3PAGA 1XFQA 3OCNA 2B02A 1BYWA 4B9OA 3E0YA 4Y13A 3BRMA 3G30A 2E8JA 3N4IA 2W1RA 2HDUA 2P08A 2Q9MA 3SH9A 2W3DA 5GL9A 4HY8A 4DDSA 1FCNA 3WS1A 4HNBA 1L0GA 5FI2A 3WS5A 3VE3A 4X6TA 5A92A 2GZAA 5HPFA 3IH9A 2VA0A 3PBSA 1N9LA 1NLZA 3NY4A 4Z9QA 4E6WA 2Y2NA 3Q07A 2Q9NA 5FL3A 3BFFA 4S2KA 5EPHA 2IWCA 4EU0A 1TD5A 5A8BA 3KSGA 4ARZB 2VV7A 4PM9A 4IUHA 2OSUA 3LICA 2JKRM 1NYYA 3G4PA 1ONHA 4MEZA 1H3QA 4NK3A 3BWLA 4P0MA 5G4YA 1BT5A 3KYEA 2A49A 4KZBA 1GSXA 3RH8B 1G28A 3VP1A 4H6JA 1EROA 4HJ3A 1EW0A 5HWWA 2WADA 3GR2A 1SKOB 3GECA 3N8LA 4Y2FA 4EBPA 3EGDC 4ZTKA 4KZ9A 4X69A 2HDSA 1MPLA 3EQVA 1GA9A 3NECA 5AQBA 3ULFA 2WKEA 3W4QA 1CK3A 2RL3A 4JBFA 4ETXA 4NXGA 4QD4A 2QJ5A 5M18A 3CHWP 1XA7A 1GHIA 2FFFB 1FSYA 4B4ZA 3MFXA 4QJGA 1H8ZA 2BASA 5HDCA 2A3UA 2I9VA 2WGWB 1TVFA 4LRYC 1GSWA 2YKFA 5IT5A 4JLFA 3FV7A 4G3KA 1HLUP 2ZMVA 1ES3A 1XPBA 3FPVA 1H8YA 2BG1A 3OCLA 3ISGA 1O07A 3IH8A 3TJZC 2GDNA 3FYZA 4Y3IA 4OP5A 1STZA 4KQQA 3MKFA 4B4XA 3OC2A 4JXSA 3A0RA 2XH9A 3V5MA 4IBRA 5D3OA 3MFDA 3WS0A 4EESA 5U47A 2XGNA 1YLTA 5J4EA 3BFEA 4L9GA 5EOEA 5TBMA 2Y2LA 3W2ZA 3DTEA 2IWDA 2Z2MB 3RTYA 2Y2JA 4JF5A 1MZUA 2O0YA 3MQ0A 4OPZA 2V0UA 2PD8A 4PM5A 3KSIA 4X56A 1K56A 2VKSA 1S1YA 3IWQA 1XGIA 5FQQA 1TS8A 5A93A 3C8CA 3DTKA 3LUQA 2V20A 3KO6A 1T18A 3VE4A 1ES4A 5DTKA 4R0QA 1K6RA 5TR7A 4II7A 2P74A 4C6YA 3NIAA 3A0VA 4JXVA 4RVAA 1V9YA 3L7HA 4MDZA 1LL8A 2K31A 1OJ5A 3MR0A 1NRJA 3BFCA 2EWVA 1ERMA 4Q8IA 4WLAA 5IU1A 4BL2A 2Y2IA 4R4SA 3VP2A 5HD5A 1IOUA 4OVDA 3V67A 5L10A 4MBKA 1YSPA 3K2NA 1SHVA 3W4OA 1CI9A 2ZMFA 3NOTC 3LCEA 1C3BA 5CX7A 3LI8A 5FEGA 5HDDA 4R6LA 3ZYTA 2PT7A 4KZ5A 1ZG6A 3V39A 2ZL1B 1RGZA 3JPUA 2WK0A 3IS2A 3BEBA 3OLOA 1ESUA 4KUOA 1Z6FA 1Q2QA 2WAEA 4PAUA 4GB7A 2Y59A 3E4PA 2KOIA 5DJUA 2FFYA 4HQAA 4WM9A 3DAVA 3CAXA 3LIAA 4GN2A 1Y4OA 1MWRA 3EWKA 1S1ZA 3LIEA 3ZVWA 1XJ4A 4YINA 3BJNA 3C2WA 3IXBA 2LB5A 3HUNA 1YT4A 4HBTA 3IWIA 4EQ1A 4FD8A 3U2AA 1K55A 3V3RA 4WZ4A 1IKGA 4Z1WA 5GHYA 1BLHA 4KZ6A 1I2WA 3T1XA 3WRTA 1T19A 4LV1A 2V9AA 1YLYA 4HH3A 4OOMA 1Q2PA 4PMAA 4BQMA 3M2JA 2UV0E 5KSHA 3L9KA 1P97A 2ZC5B 3N7WA 1TS6A 3O88A 3C7VA 5F6AA 5E2FA 1AXBA 4WBGA 2Z2LB 4Q0IA 1G6OA 3LR5A 2QKPA 3WWXA 3LR4A 4H6JB 1MC0A 4BD1A 1NZOA 5J3WA 4GHIA 4XUXA 2ZLYA 3A3IA 4E3KA 4KG2A 3CPTA 1MWUA 2VGJA 3D3OA 2DNSA 2EXBA 2R78A 3UB8A 4MBFA 2ZD8A 1YPRA 3S7PA 4YWZA 5DF7A 4JGPA 4O0PA 1BULA 1LHYA 1IYQA 1JWZA 2JN7A 4OP8A 3MMHA 2VLGA 1FR6A 1KGEA 3ZG0A 1F5MA 2K2NA 3N6IA 3HLWA 3SZTA 4MLLA 1K25A 1N4OA 3UB7A 4KG5A 5M1AA 1F98A 2HZ5A 1U60A 2A24A 4OONA 3T4SA 3F1OA 2ZQ8A 1HD8A 4EWFA 2ZQCA 1I2SA 4JF4A 3HBRA 1E3UA 1BSGA 3UE0A 2LB9A 3Q7ZA 4P6BA 1HTZA 2VV6A 1ZC2A 1CQAA 1MWSA 4C3QA 2JKTI 4RX2A 3QP1A 2HP5A 3CG5A 1SCWA 3LEQA 2GX5A 2PBYA 3QHYA 3UPPA 1H5XA 2PU4A 4S2PA 2VZWA 1W79A 5TBMB 1JWPA 3OBFA 1KE4A 1NY0A 3G31A 3BY8A 2XEPA 5FDSA 1NRFA 4PM6A 5CGXA 3A3DA 4BD0A 2H10A 4B93A 3TSGA 5CEDA 3HVFA 3F1PB 2VX8A 4PM7A 4N9LA 4K08A 2ZOIA 5L8MA 3LFVA 1XXMA 1DJAA 4FUWA 3UE6A 4LENA 1ZTUA 3TRCA 5HZHA 4NETA 3NOPC 2PHYA 4F94A 3ZG8B 3GSGA 5CECA 2D02A 2INWA 1MWTA 4U0XA 4ZRRA 3IF6C 2QWSA 3MKEA 3MXQA 3UB6A 4Y0TA 1M6KA 3BECA 3UMEA 3LY4A 1SDEA 3H7WB 2C6WB 1D1JA 1LI9A 4PKYA 2Y4AA 1TS7A 4HBUA 1CI8A 4HH2A 5DFYA 1ES2A 4OPQA 1OTDA 3IS2B 4I5SA 3QP6A 2HP6A 3UN7A 4LFUA 4X68A 3F1NA 1H8MA 1OT6A 5E2HA 4IUKA 4AFIA 2E8IA 4JGRA 4KG6A 3S7OA 2QJ7A 4EW7A 4HEFA 2H0TA 5KMWA 4E04A 2HDRA 4IJGA 3FG8A 3ZCZA 1WYBA 3BFDA 4GZBA 4I39A 5IHVA 4JGOA 5DKLA 2J3TD 3UPOA 4C75A 1EWZA 1S4SA 2EFXA 5I5LA 4CLCC 3KX0X 3NI9A 1XFNA 1UGUA 3IX8A 1PWCA 3SOIA 1LT0A 2Y2HA 3BLSA 4KZAA 3G34A 3LEZA 4HESA 3BLMA 4D2OA 5CGWA 3FPWA 1YLJA 3HLBA 5TGFA 3T12B 5HL6A 3DTIA 1MKIA 2CC1A 1OTBA 4EBLA 3G32A 3QP5A 3G2ZA 3IX3A 4P85A 4S2NC 3O5YA 3I7JA 5A90A 4A5RA 1D06A 3KYZA 2Y91A 3O86A 4QPRA 5GHZA 3SW1A 2B5RA 2L4RA 4Y17A 1P9RA 5TJJA 4XXRA 3UMDA 4Y5FA 4S2NA 2WAFA 4R3AA 3MZFA 1G68A 4UEYA 1PNEA 2ZM0A 4JXWA 1P9WA 4E3OA 3S7NA 4DDYA 3PXPA 4GHIB 3BY9A 2VEAA 1FSWA 1PWGA 5DFXA 2Y2QA 3B47A 3CPTB 3IQAA 3S1YA 5EECA 1ERQA 4OLDA 4HJ4A 1Y54A 4LCMA 1PW8A 3C38A 4EERA 4EUVA 3E2LA 4BBTA 2HJ9C 3D9YA 4IBXA 3ZNTA 3FKWA 1IFQA 2Y2GA 3JVVA 4NXBA 3T4TA 3VOLA 1ALQA 2J8YA 4NKPA 3ITBA 3PYPA 3BM6A 1NJ4A 2W3EA 4WZ5C 3E4QA 1LSWA 2FH5A 3BFGA 2DCFA 3GQZA 3T4QA 3T1SA 1IYPA 1JNUA 2A24B 3F1OB 2WZZA 3UE3A 1ESIA 4B88A 2Y2PA 2R9XA 5I94A 3BQ8A 2XSSA 4K0XA 4QU3A 4CPKA 3QNCA 4S2OA 1L0DA 4EUZA 4LRXC 2JKRI 2KLIA 4LPZA 2IA2A 3BQAA 4Y0UA 5GLDA 1G5UA 3Q7VA 2O99A 4ETZA 4NXEA 2G2WA 2OLVA 1DP8A 3WS4A 3VOZA 1GHPA 3KYQA 5HPIA 1TDLA 1NYMA 4WUJA 3MQOA 4BMWA 2WKQA 2QMIA 3FWLA 4DXBA 2HGVA 4GNUA 1BLCA 5E2GA 5EVIC 2V1ZA 1OTIA 3G35A 1PZPA 4EETB 1OTEA 1DJBA 3D72A 3EEAA 4BENA 2Y8HA 4S2LA 5EVIA 4EV4A 3IBJA 1IEMA 4PM8A 4KQRA 4FH4A 1YQSA 3IHAA 5EM1A 1M40A 2MJ6A 1PI5A 3UO9A 4DJ3A 2XD1A 3GDIA 1XJ6A 2JC7A 2EWWA 2AVXA 3MXSA 4UA7A 3EEHA 3UPNA 2HJEA 2RCXA 3NC8A 5M19A 1NXYA 2KDKA 2HDQA 2OWHA 1V9ZA 3C4PA 5HD3A 2X02A 5L09A 2QZ6A 3VP3A 5AQAA 1YAXA 3VOYA 2EX2A 3P09A 5FQIA 5CGSA 3NDEA 1Z09A 2PBDP 1OMEA 1J3WA 2W3HA 4FH2A 2PU2A 3E4OA 5HFOA 3NOUC 1UWNX 2JBFA 3F1NB 3T4JA 2FZ0A 1RGYA 5FSRA 1VB6A 1AWIA 2QYBA 3TG9A 2VK3A 4I3AA 4CJNA 1S66L 2XQZA 3QP8A 2H0YA 2OAP1 1T1CA 1DP6A 1IYSA 2GJ3A 2W3FA 3MBZA 4QY5A 1KDWA 2J9OA 1W63M 2VGLS 4E3LA 4NXFA 1N9OA 2XROA 3M6BA 2XF3A 3U4LP 1LSXA 3Q81A 5EUAA 1K4EA 3VMAA 1XJ3A 3DBAA 3GTCA 3M2KA 3IXDA 3LY3A 5J7EA 4OKPA 3H9WA 4E6XA 4O7DA 3ZVTA 3SH7A 4R3BA 4R1GA 4F3LA 2W27A 3FC7A 4WMCA 3HLCA 1BZAA 3LO7A 5EVEA 3GV9A 4X1MA 1OJGA 3UDFA 4FTXA 1ODVA 4S2MA 2VGLM 2JKTM 4GJ4A 4UQIS 3LI9A 1YM1A 3DWKA 2XFTA 4I3JA 3A3JA 2KX6A 3GRJA 3H82A 1SKOA 3JYIA 3MJQA 3OPRA 2ACGA 5DJTA 2XDMA 3PBQA 4X55A 5GLBA 1JVJA 4PHTA 2P04A 4LV2A 2HPBA 4P87A 4BJPA 3O87A 1K6SA 3AGDA 1WA9A 1DRMA 1PW1A 3NULA 3S4XA 3T4KA 2WKHA 2P9VA 5DTTA 1L0EA 1K56D 4G3WA 4FSFA 3V50A 4S2JA 5F68A 1KVMA 4MN7A 5K5BA 4UQIM 4UAAA 1F9IA 2ZBBA 1CEFA 4L9FA 4WYYA 1PIOA 4MCWA 4KENB 5GHXA 3QNBA 1TF1A 1MKMA 1DY6A 4OLGA 3T1RA 4QB8A 1GA0A 3NDGA 2ZC3B 1Y28A 4DN0A 5DF9A 1QMFA 1VEUA 3LIBA 3PBRA 3IXGA 4U0TA 3GVBA 3CZDA 3HLDA 4YFMA 3EOIA 1ZHHB 3QP4A 4E3MA 4GDBA 1IELA 3GMWA 1VM1A 2J7VA 3R7WA 1D7EA 1XA1A 1HVBA 3Q7VB 5DF8A 1OTAA 3SS4A 3P98A 1IYOA 5F5YA 3E2KA 1X0OA 4RX3A 1GSVA 3P7NA 4ZAMA 3AGEA 3WS2A 2VV8A 2WGIA 5IS1A 4MN5A 5FAPA 4E3NA 2Y2OA 4JXGA 1SDNA 1YMXA 5HAIA 5HW3A 2H5SA 3CI6A 3Q1FA 3ITAA 2M7UA 3IT9A 3UNWA 1W5DA 2L1MA 2UWXA 5CERA 3LIDA 1SKFA 2DMWA 4ZBEA 2XFSA 2XR0A 5AVFA 2Y79A 1BTLA 1XJ2A 5FI6A 2W3GA 5EVIB 1XGJA 1E25A 4KUKA 2V0WA 5EM0A 5EVLA 3OPHA 3DWZA 4JGQA 3FZCA 4JPMA 5HL1A 5FQJA 3ZDJA 3ZQ5A 3MZEA 4MBHA 1PYYA 4IVIA 5FQKA 3TOIA 3CMZA 3A3EA 4KZ8A 5HARA 3P01A 5CTNA 5A91A 1J9MA 2ZQ7A 3T50A 3C4OA 3VFFA 3LYXA 1KOUA 2ZQAA 4ME4A 5DVAA 4HOIA 5KZHA 3IF6A 1ONGA 4N9KA 3UE1A 3C30A 4M4XA 4ESPA 2QHKA 4N1XA 2EFUA 4O8GA 1IKIA 3IWOA 5AVEA 4N1HA 4Y15A 2ZC6B 1L2SA 3VFHA 5CHUA 2PDRA 4RYEA 1XP4A 3W4PA 1NWZA 3K3CA 4WELA 5F1FA 4FOFA 3QP2A 2OOLA 4OQHA 4IHQA 3CITA 4R3JA 4EEUA 2XD5A 1ZG4A 3DTMA 2ZC4B 2WUQA 1VETA 3PBOA 2R9WA 2V8CA 2BLSA 3CLOA 1CF0A 2H28A 1RCJA 2JKGA 4Y0OA 4N92A 5KSCA 3VSLA 4RQ9A 1FCOA 4OQIA 3PAEA 4CLCA 3C7UA 1OT9A 5JYPA 1A0KA 4F3LB 1K57C 4ZJ1A 4OPRA 2OLUA 4P6ZS 2HP9A 1DJCA 4ID4A 5F82A 1YKDA 1K38A 4HP9A 3G2YA 4HJ6A 4KZ4A 2J80A 1E3UD 3R4KA 3T1QB 2M1CA 4YNRA 1K57A 2ZMAA 5FA7A 2JCHA 4G3VA 3CWFA 4PKYG 1DP9A 3DW0A 4OQ0A 3H82B 1T1BA 4IEDA 2Y2MA 4ZJ2A 2W1TA 1K0KA 1ACFA 1LL9A 1PFLA 3V3SA 4UA9A 2XRNA 3HUOA 1LL5A 1T1AA 1E4DA 2PD7A 5DTSA 1L0FA 3OPLA 5E43A 4P6ZM 4GKUA 3VP4A 4CLCE 2WKPA 3KSFA 1GHMA 3HJIA 4UHUA 4EEPA 2PR5A 2P9VB 2XA7S 3O3VA 3T4LA 2QPNA 1BLPA 4KQDA 1JTGA 1JTDA 1FR1A 4DMZA 4I38A 4OQGA
chains in the Genus database with same CATH topology
1F5MA 2K2NA 2PYPA 4Q0JA 2Z6CA 3NHQA 2L0WA 3UB7A 2K7SA 2W3HA 1F98A 3E4OA 2PR6A 3NOUC 3KSHA 2A24A 3T4SA 1UWNX 3F1OA 4L9EA 1N9NA 3F1NB 3HJKA 3T4JA 2VJWA 2FZ0A 5DKKA 4Q0HA 3PHYA 1VB6A 2QYBA 1XFQA 3OCNA 4I3AA 2B02A 1BYWA 1S66L 4B9OA 2OAP1 3E0YA 2LB9A 3TE8A 1T1CA 1DP6A 1S67L 2VV6A 3JVUA 4OOLA 2GJ3A 2W1RA 2W3FA 1W63M 2VGLS 2P08A 4NXFA 1N9OA 2W3DA 4LRZE 2XROA 2JKTI 4HY8A 3CUEC 4HNBA 1LSXA 2GX5A 1VHMA 5C5KA 3VE3A 3TW8A 3R7WB 1XJ3A 3DBAA 1OPXA 2XA7M 2GZAA 5HPFA 5J7EA 2VA0A 3H9WA 3PBSA 2VZWA 1N9LA 2OWJA 1NLZA 5TBMB 3EQUA 4NEED 3OBFA 3CUEA 4F3LA 3BY8A 5FL3A 5HWVA 2W27A 4KQOA 3FC7A 4EU0A 1TD5A 4B93A 5A8BA 3KSGA 4ARZB 2VV7A 4HI4A 4IUHA 3F1PB 3LICA 2VX8A 2JKRM 3F1PA 4L0LA 1OJGA 3PR6A 4O01A 1ODVA 1NLYA 4K08A 2ZOIA 4GLQA 5L8MA 1H3QA 2VGLM 3LFVA 2JKTM 3BWLA 4GJ4A 5G4YA 4UQIS 4GS9A 3UE6A 3LI9A 5EFWA 1GSXA 3RH8B 1G28A 4H6JA 4I3JA 4HJ3A 1EW0A 5HWWA 5G4ZA 1ZTUA 3GECA 2KX6A 4Y2FA 3H82A 3TRCA 5HZHA 4CQHA 3MJQA 2D01A 2O9AA 3NOPC 2PHYA 5DJTA 3EGDC 3PBQA 2NUPC 3ICYA 2O9BA 4PHTA 2P04A 3EQVA 3ULFA 2D02A 2INWA 4ZRRA 2CMNA 4BJPA 3E98A 2QWSA 4ETXA 4NXGA 3MXQA 3BW6A 5LBRA 3UB6A 1WA9A 4CLCD 2QJ5A 2B18A 1DRMA 4GW9A 3MFXA 3T4KA 3UMEA 3H7WB 4XT2A 2BASA 3PBTA 5HDCA 4G3WA 2I9VA 4FSFA 1YSQA 3H7WA 4PKYA 4LRYC 1GSWA 2YKFA 5F68A 1TS7A 5IT5A 4MN7A 4HH2A 5DFYA 5K5BA 2JHEA 2PYRA 4G3KA 4UQIM 1OTDA 3IS2B 2ZMVA 1F9IA 4I5SA 5HDSA 3FPVA 2ZBBA 4MN6A 4L9FA 3F1NA 1H8MA 3OCLA 1OT6A 4IUKA 4MCWA 4AFIA 4JGRA 1TF1A 4BBUA 1MKMA 3S7OA 4WN5A 2QJ7A 4EW7A 3TJZC 3MF0A 3T4OA 1Y28A 3G6OA 3B42A 4DN0A 4Y3IA 5DF9A 2WKRA 4E04A 4IJGA 1STZA 3LIBA 3PBRA 5HWTA 3FG8A 3OC2A 2YKHA 3A0RA 4I39A 3EOIA 1ZHHB 4JGOA 5DKLA 2J3TD 4HIAA 2HF6A 2J3WA 1S4SA 5I5LA 3LIFA 4R70A 4CLCC 3R7WA 3KX0X 1D7EA 3MQQA 1XFNA 3NJAA 4EESA 1UGUA 1OTAA 1LT0A 5J4EA 4L9GA 5F5YA 1X0OA 5TBMA 2V1AA 3W2ZA 1GSVA 3P7NA 3VV4A 4CLCB 3FPWA 3IBRA 2VV8A 3RTYA 5IS1A 4MN5A 5HL6A 1MZUA 2O0YA 3MQ0A 1OTBA 2V0UA 4HHDA 4ARZA 2PD8A 1UWPX 3KSIA 3S7QA 3CI6A 3O5YA 2VKSA 1S1YA 2P7JA 5AJGA 2M7UA 1D06A 3KYZA 4WEJA 1TS8A 2L1MA 3C8CA 3LIDA 3LUQA 2DMWA 3SW1A 4QPRA 2L4RA 3KO6A 1P9RA 1T18A 2Y79A 5AVFA 5TJJA 3VE4A 4BWIA 3UMDA 1XJ2A 2J3TC 2W3GA 4Y5FA 4II7A 1P0ZA 4KUKA 2V0WA 2V1BA 3A0VA 1V9YA 4MDZA 4R3AA 4JGQA 4UEYA 1LL8A 2K31A 2M7VA 1OJ5A 1P9WA 1NRJA 3MR0A 2EWVA 2HV1A 3S7NA 3PXPA 4GHIB 3BY9A 2VEAA 4WLAA 5DFXA 3ZQ5A 5IU1A 3B47A 2W1TB 4R38A 5HSQA 5KIZA 5HD5A 1W63Q 1IOUA 3V67A 4HJ4A 2ZOHA 3C38A 1YSPA 4EERA 3K2NA 4DJ2A 4EUVA 3P01A 4BBTA 2HJ9C 1IFQA 1LSVA 4WL9A 3T50A 3JVVA 4NXBA 3T4TA 3VOLA 3LYXA 1KOUA 2ZMFA 3NOTC 4NKPA 5CX7A 4ME4A 3LI8A 4HOIA 3PYPA 4BBVA 5HDDA 4R6LA 3ZYTA 2PT7A 3C30A 2W3EA 3IS2A 4M4XA 3OLOA 3E4QA 1LSWA 2FH5A 3UB9A 2QHKA 4O8GA 3T4QA 4KUOA 5AVEA 1JNUA 4PAUA 2A24B 3F1OB 4MMNA 2PDRA 3UE3A 1NWZA 3K3CA 4WELA 3E4PA 4FOFA 2KOIA 2OOLA 3BQ8A 5DJUA 2XSSA 4IHQA 3CITA 4HQAA 4EEUA 2GNXA 2EA9A 3CAXA 3LIAA 4LRXC 2JKRI 2KLIA 4LPZA 2IA2A 3PBOA 2O9CA 3BQAA 3EWKA 4I3IA 1S1ZA 3LIEA 4YOFA 1XJ4A 3CLOA 3BJNA 2H28A 3HCYA 3C2WA 1S4RA 2LB5A 2O99A 3OOVA 4ETZA 4NXEA 2G7UA 4EQ1A 1DP8A 4RQ9A 4HP4A 3KYQA 5HPIA 3U2AA 2OAQ1 4WUJA 3MQOA 4CLCA 1OT9A 4LLOB 4BMWA 2WKQA 4Z1WA 4WEKA 4F3LB 2HGVA 1T19A 2V9AA 4HH3A 4OOMA 1OTIA 4P6ZS 3K3DA 3LR3A 4EETB 1YKDA 1OTEA 4HP9A 5KSHA 3D72A 3EEAA 4HJ6A 1TS0A 1P97A 2J80A 3R4KA 2M1CA 4GCZA 1TS6A 4YNRA 5F6AA 2Y8HA 3PBNA 3IBJA 4Q0IA 1G6OA 3LR5A 2QKPA 4GS9B 3LR4A 4G3VA 4H6JB 2A2LA 3CWFA 1MC0A 2MJ6A 4PKYG 1DP9A 5J3WA 4DJ3A 5F69A 4GHIA 3GDIA 1XJ6A 4EXOA 2EWWA 1T1BA 3H82B 4WF0A 3EEHA 2W1TA 3D3OA 2HJEA 2W0NA 2Z6DA 2R78A 3UB8A 2XRNA 1T1AA 3S7PA 4YWZA 2PD7A 3B33A 2KDKA 3LR0A 3A0SA 4JGPA 2OWHA 4O0PA 5MC7A 1V9ZA 5HD3A 3EGXC 4P6ZM 3RFBA 4CLCE 2WKPA 3KSFA 3HJIA 2JN7A 3MMHA 2VLGA 4EEPA 2PR5A 2XA7S 1YAXA 3T4LA 4KQDA 4XT2B 4DMZA 2NUTC 4I38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYP A;  2Z6C A;  3NHQ A;  2L0W A;  3UB7 A;  2K7S A;  1F98 A;  3E4O A;  2PR6 A;  3NOU C;  2A24 A;  1UWN X;  3F1O A;  4L9E A;  1N9N A;  3F1N B;  3HJK A;  5DKK A;  3PHY A;  1VB6 A;  1XFQ A;  4I3A A;  2B02 A;  1BYW A;  1S66 L;  4B9O A;  1T1C A;  1DP6 A;  1S67 L;  2VV6 A;  2GJ3 A;  4NXF A;  1N9O A;  4LRZ E;  4HY8 A;  4HNB A;  1LSX A;  3VE3 A;  1XJ3 A;  5J7E A;  3H9W A;  1N9L A;  2OWJ A;  5TBM B;  4F3L A;  3BY8 A;  5HWV A;  2W27 A;  3FC7 A;  5A8B A;  2VV7 A;  4HI4 A;  3F1P B;  3LIC A;  3F1P A;  1OJG A;  1ODV A;  4K08 A;  2ZOI A;  3BWL A;  5G4Y A;  4GS9 A;  3UE6 A;  3LI9 A;  5EFW A;  1GSX A;  3RH8 B;  1G28 A;  4H6J A;  4I3J A;  4HJ3 A;  1EW0 A;  5HWW A;  5G4Z A;  3GEC A;  2KX6 A;  3H82 A;  5HZH A;  3MJQ A;  2D01 A;  3NOP C;  2PHY A;  5DJT A;  3ICY A;  3ULF A;  2D02 A;  2INW A;  2CMN A;  2QWS A;  4NXG A;  3MXQ A;  3UB6 A;  1WA9 A;  2QJ5 A;  1DRM A;  4GW9 A;  3MFX A;  3UME A;  3H7W B;  4XT2 A;  2BAS A;  5HDC A;  2I9V A;  3H7W A;  4PKY A;  4LRY C;  1GSW A;  2YKF A;  5F68 A;  1TS7 A;  4HH2 A;  2JHE A;  2PYR A;  1OTD A;  3IS2 B;  1F9I A;  4I5S A;  5HDS A;  2ZBB A;  4MN6 A;  4L9F A;  3F1N A;  1OT6 A;  4JGR A;  4BBU A;  4WN5 A;  2QJ7 A;  4EW7 A;  1Y28 A;  3G6O A;  2WKR A;  4E04 A;  3LIB A;  5HWT A;  3FG8 A;  2YKH A;  3A0R A;  4I39 A;  4JGO A;  5DKL A;  4HIA A;  1S4S A;  5I5L A;  3LIF A;  4R70 A;  3KX0 X;  1D7E A;  3MQQ A;  1XFN A;  3NJA A;  4EES A;  1UGU A;  1OTA A;  1LT0 A;  5J4E A;  4L9G A;  5F5Y A;  1X0O A;  5TBM A;  2V1A A;  1GSV A;  3P7N A;  3IBR A;  2VV8 A;  3RTY A;  5IS1 A;  4MN5 A;  1MZU A;  1OTB A;  2V0U A;  4HHD A;  2PD8 A;  1UWP X;  1S1Y A;  2P7J A;  1D06 A;  1TS8 A;  2L1M A;  3C8C A;  3LID A;  3LUQ A;  3SW1 A;  2L4R A;  1T18 A;  5AVF A;  3VE4 A;  3UMD A;  1XJ2 A;  1P0Z A;  4KUK A;  2V0W A;  2V1B A;  3A0V A;  1V9Y A;  4R3A A;  4JGQ A;  1LL8 A;  1OJ5 A;  3MR0 A;  2HV1 A;  4GHI B;  3BY9 A;  2VEA A;  4WLA A;  3ZQ5 A;  5IU1 A;  4R38 A;  5HSQ A;  5KIZ A;  5HD5 A;  4HJ4 A;  2ZOH A;  4EER A;  4DJ2 A;  4BBT A;  1LSV A;  4WL9 A;  3T50 A;  4NXB A;  3VOL A;  3LYX A;  1KOU A;  3NOT C;  3LI8 A;  4HOI A;  3PYP A;  4BBV A;  5HDD A;  4R6L A;  3IS2 A;  4M4X A;  3OLO A;  3E4Q A;  1LSW A;  3UB9 A;  2QHK A;  4KUO A;  5AVE A;  1JNU A;  2A24 B;  3F1O B;  2PDR A;  1NWZ A;  3K3C A;  3E4P A;  2OOL A;  5DJU A;  4HQA A;  4EEU A;  2EA9 A;  3CAX A;  3LIA A;  4LRX C;  4LPZ A;  3EWK A;  4I3I A;  1S1Z A;  3LIE A;  1XJ4 A;  3CLO A;  2H28 A;  3C2W A;  1S4R A;  4NXE A;  4EQ1 A;  1DP8 A;  4RQ9 A;  4HP4 A;  4WUJ A;  3MQO A;  1OT9 A;  4LLO B;  2WKQ A;  4F3L B;  1T19 A;  2V9A A;  4HH3 A;  1OTI A;  3K3D A;  4EET B;  1OTE A;  4HP9 A;  3D72 A;  4HJ6 A;  1TS0 A;  1P97 A;  2J80 A;  2M1C A;  4GCZ A;  1TS6 A;  5F6A A;  2QKP A;  4GS9 B;  4H6J B;  3CWF A;  4PKY G;  1DP9 A;  5J3W A;  4DJ3 A;  5F69 A;  4GHI A;  3GDI A;  1XJ6 A;  4EXO A;  3H82 B;  1T1B A;  4WF0 A;  3EEH A;  2W0N A;  2Z6D A;  2R78 A;  3UB8 A;  1T1A A;  4YWZ A;  2PD7 A;  3B33 A;  2KDK A;  4JGP A;  3A0S A;  2OWH A;  1V9Z A;  5HD3 A;  2WKP A;  3HJI A;  2JN7 A;  2VLG A;  4EEP A;  2PR5 A;  4KQD A;  4XT2 B;  4I38 A; 
#chains in the Genus database with same CATH topology
 4OOY A;  2EX6 A;  2L0W A;  1KDS A;  5GLA A;  1W8Q A;  4DE1 A;  3C5A A;  2PR6 A;  3KSH A;  4RA7 A;  4MNR A;  4L9E A;  4M3K A;  1N9N A;  2J9P A;  1EI5 A;  3VSK A;  4Q0H A;  3PHY A;  3A3F A;  4WZ5 A;  1SZV A;  3LGO A;  1N9B A;  1PI4 A;  1VEU B;  3TE8 A;  4OH0 A;  1S67 L;  3JVU A;  4OOL A;  4R23 A;  5L07 A;  1WE4 A;  5FQM A;  5BOH A;  4LRZ E;  3ZHH A;  1XKZ A;  3CUE C;  3UDI A;  2PRF A;  1VHM A;  5C5K A;  3ZG9 B;  3TW8 A;  3R7W B;  2X01 A;  1OPX A;  2XA7 M;  3MXR A;  4DXC A;  4XUZ A;  3PTE A;  4LGW A;  3ZG5 A;  1MXO A;  2OWJ A;  3UY6 A;  1MY8 A;  2XLN A;  4E3J A;  4PPR A;  3EQU A;  5CRF A;  4NEE D;  4LV3 A;  2ZM2 A;  4S2I A;  4BLM A;  5FI7 A;  1YLW A;  3CUE A;  5HWV A;  2G2U A;  4KQO A;  4GD8 A;  1YLZ A;  4IVK A;  4UA6 A;  3RJU A;  1FIL A;  4HI4 A;  3IXH A;  3F1P A;  2Y55 A;  4L0L A;  5HX9 A;  4E3I A;  3PR6 A;  4O01 A;  2Q0O A;  1NLY A;  2VGK A;  4DE3 A;  4GLQ A;  5EE8 A;  2X71 A;  4BL3 A;  4GS9 A;  3UB5 P;  2JE5 A;  5EFW A;  2XK1 A;  1F2K A;  5G4Z A;  2Y2K A;  5EOO A;  4CQH A;  2D01 A;  2O9A A;  5FQ9 A;  1ZKJ A;  5HAP A;  1LLB A;  1WYC A;  1KE0 A;  2NUP C;  3ICY A;  2O9B A;  5FAS A;  2DRW A;  2CMN A;  5CHM A;  3E98 A;  2WGV A;  3BW6 A;  5LBR A;  1W7F A;  4CLC D;  2B18 A;  4GW9 A;  5HAQ A;  3BYD A;  4XT2 A;  3PBT A;  5E2E A;  3W8K A;  2OV5 A;  1O7E A;  1YSQ A;  5GLC A;  3H7W A;  3IF6 B;  4LV0 A;  2JHE A;  2PYR A;  1BUE A;  5HDS A;  5L2F A;  3HLE A;  4MN6 A;  1KGF A;  2PAV P;  1RP5 A;  4BBU A;  1YLP A;  3FKV A;  4WN5 A;  4NG2 A;  3MF0 A;  3T4O A;  3G6O A;  3B42 A;  3AGF A;  2WKR A;  5F83 A;  1S0W A;  5HWT A;  2WKI A;  2YKH A;  5JYO A;  1FOF A;  3S22 A;  4HIA A;  2HF6 A;  2J3W A;  1VET B;  4DE0 A;  1FIK A;  3LIF A;  4R70 A;  3N8R A;  1K55 C;  3MQQ A;  1PWD A;  3RXX A;  3NJA A;  4D60 A;  4H8R A;  2ZC7 A;  3D4F A;  1I5Q A;  5TFQ A;  1TEM A;  1H0M A;  2V1A A;  3VV4 A;  4CLC B;  3IBR A;  2B95 A;  4HHD A;  4ARZ A;  2I72 A;  1UWP X;  3Q82 A;  4GDN A;  3S7Q A;  5FAO A;  3MZD A;  1YMS A;  2P7J A;  5AJG A;  4WEJ A;  4DRT A;  3SH8 A;  4U3T A;  5AQ9 A;  3B3X A;  2C5W B;  4BWI A;  2J3T C;  4EQI A;  1P0Z A;  2ZM8 A;  2V1B A;  3IX4 A;  1L3L A;  1CEG A;  2M7V A;  5FEF A;  5J8X A;  1NZU A;  1CJF A;  1K54 C;  2HV1 A;  1W8Y A;  3RXW A;  1FCM A;  3NBL A;  3ZGA B;  3MS6 A;  2W1T B;  4R38 A;  5HSQ A;  5KIZ A;  1W63 Q;  4EBN A;  3OZH A;  3SS3 A;  2V8F A;  2ZOH A;  4DJ2 A;  4QHC A;  3WRZ A;  1K54 A;  1LSV A;  4WL9 A;  1PZO A;  3IHB A;  3ZG7 B;  2WGW A;  4BBV A;  5CHJ A;  3UB9 A;  3SS5 A;  1BLS A;  5EVI D;  4R4R A;  2ZJ9 A;  4MMN A;  2IWB A;  4JKT A;  2EX9 A;  1JWV A;  3N8S A;  2GNX A;  2EA9 A;  3NCK A;  2O9C A;  4FCF A;  4I3I A;  1LI0 A;  4YOF A;  2ZQD A;  1VQQ A;  3HCY A;  1S4R A;  5FAQ A;  4KZ3 A;  3OOV A;  1G6A A;  2G7U A;  3VP0 A;  3HUM A;  1FQG A;  3CJM A;  4ZDX A;  4HP4 A;  1HZO A;  2OAQ 1;  1S6R A;  5CEB A;  3HL9 A;  4LLO B;  1GCE A;  4WEK A;  3HLF A;  3HLG A;  3ZFZ A;  5EV0 A;  2ZQ9 A;  4JF6 A;  3K3D A;  3LR3 A;  4LCL A;  5AQ7 A;  1TS0 A;  2EX8 A;  1KVL A;  2WYX A;  4GCZ A;  2EXA A;  3OPP A;  2JKF A;  3PBN A;  5FAT A;  4GS9 B;  2A2L A;  3M6H A;  4X53 A;  1ES5 A;  4QY6 A;  5F69 A;  3UDX A;  4EXO A;  1KE3 A;  4DE2 A;  4WF0 A;  5FDH A;  4X25 A;  1TDG A;  2W0N A;  2Z6D A;  4ZJ3 A;  5CTM A;  5G18 A;  4GD6 A;  5CXW A;  4DF6 A;  4QWO A;  3MSH A;  4X1L A;  3B33 A;  4K91 A;  3LR0 A;  3A0S A;  4DKI A;  5MC7 A;  4WMC D;  3EGX C;  3RFB A;  1QME A;  4KZ7 A;  4Y7P A;  4OPY A;  2ZL1 A;  1KGG A;  3HRE A;  4XT2 B;  4K0W A;  3ZNY A;  5F1G A;  2NUT C;  1XX2 A;  1PRQ A;  2PYP A;  4Q0J A;  2WZX A;  4GOG A;  3IF5 A;  2Z6C A;  3NHQ A;  2V2F F;  2K7S A;  1MBL A;  1K4F A;  2BTF P;  3HJK A;  2VJW A;  5DKK A;  3PAG A;  1XFQ A;  3OCN A;  2B02 A;  1BYW A;  4B9O A;  3E0Y A;  4Y13 A;  3BRM A;  3G30 A;  2E8J A;  3N4I A;  2W1R A;  2HDU A;  2P08 A;  2Q9M A;  3SH9 A;  2W3D A;  5GL9 A;  4HY8 A;  4DDS A;  1FCN A;  3WS1 A;  4HNB A;  1L0G A;  5FI2 A;  3WS5 A;  3VE3 A;  4X6T A;  5A92 A;  2GZA A;  5HPF A;  3IH9 A;  2VA0 A;  3PBS A;  1N9L A;  1NLZ A;  3NY4 A;  4Z9Q A;  4E6W A;  2Y2N A;  3Q07 A;  2Q9N A;  5FL3 A;  3BFF A;  4S2K A;  5EPH A;  2IWC A;  4EU0 A;  1TD5 A;  5A8B A;  3KSG A;  4ARZ B;  2VV7 A;  4PM9 A;  4IUH A;  2OSU A;  3LIC A;  2JKR M;  1NYY A;  3G4P A;  1ONH A;  4MEZ A;  1H3Q A;  4NK3 A;  3BWL A;  4P0M A;  5G4Y A;  1BT5 A;  3KYE A;  2A49 A;  4KZB A;  1GSX A;  3RH8 B;  1G28 A;  3VP1 A;  4H6J A;  1ERO A;  4HJ3 A;  1EW0 A;  5HWW A;  2WAD A;  3GR2 A;  1SKO B;  3GEC A;  3N8L A;  4Y2F A;  4EBP A;  3EGD C;  4ZTK A;  4KZ9 A;  4X69 A;  2HDS A;  1MPL A;  3EQV A;  1GA9 A;  3NEC A;  5AQB A;  3ULF A;  2WKE A;  3W4Q A;  1CK3 A;  2RL3 A;  4JBF A;  4ETX A;  4NXG A;  4QD4 A;  2QJ5 A;  5M18 A;  3CHW P;  1XA7 A;  1GHI A;  2FFF B;  1FSY A;  4B4Z A;  3MFX A;  4QJG A;  1H8Z A;  2BAS A;  5HDC A;  2A3U A;  2I9V A;  2WGW B;  1TVF A;  4LRY C;  1GSW A;  2YKF A;  5IT5 A;  4JLF A;  3FV7 A;  4G3K A;  1HLU P;  2ZMV A;  1ES3 A;  1XPB A;  3FPV A;  1H8Y A;  2BG1 A;  3OCL A;  3ISG A;  1O07 A;  3IH8 A;  3TJZ C;  2GDN A;  3FYZ A;  4Y3I A;  4OP5 A;  1STZ A;  4KQQ A;  3MKF A;  4B4X A;  3OC2 A;  4JXS A;  3A0R A;  2XH9 A;  3V5M A;  4IBR A;  5D3O A;  3MFD A;  3WS0 A;  4EES A;  5U47 A;  2XGN A;  1YLT A;  5J4E A;  3BFE A;  4L9G A;  5EOE A;  5TBM A;  2Y2L A;  3W2Z A;  3DTE A;  2IWD A;  2Z2M B;  3RTY A;  2Y2J A;  4JF5 A;  1MZU A;  2O0Y A;  3MQ0 A;  4OPZ A;  2V0U A;  2PD8 A;  4PM5 A;  3KSI A;  4X56 A;  1K56 A;  2VKS A;  1S1Y A;  3IWQ A;  1XGI A;  5FQQ A;  1TS8 A;  5A93 A;  3C8C A;  3DTK A;  3LUQ A;  2V20 A;  3KO6 A;  1T18 A;  3VE4 A;  1ES4 A;  5DTK A;  4R0Q A;  1K6R A;  5TR7 A;  4II7 A;  2P74 A;  4C6Y A;  3NIA A;  3A0V A;  4JXV A;  4RVA A;  1V9Y A;  3L7H A;  4MDZ A;  1LL8 A;  2K31 A;  1OJ5 A;  3MR0 A;  1NRJ A;  3BFC A;  2EWV A;  1ERM A;  4Q8I A;  4WLA A;  5IU1 A;  4BL2 A;  2Y2I A;  4R4S A;  3VP2 A;  5HD5 A;  1IOU A;  4OVD A;  3V67 A;  5L10 A;  4MBK A;  1YSP A;  3K2N A;  1SHV A;  3W4O A;  1CI9 A;  2ZMF A;  3NOT C;  3LCE A;  1C3B A;  5CX7 A;  3LI8 A;  5FEG A;  5HDD A;  4R6L A;  3ZYT A;  2PT7 A;  4KZ5 A;  1ZG6 A;  3V39 A;  2ZL1 B;  1RGZ A;  3JPU A;  2WK0 A;  3IS2 A;  3BEB A;  3OLO A;  1ESU A;  4KUO A;  1Z6F A;  1Q2Q A;  2WAE A;  4PAU A;  4GB7 A;  2Y59 A;  3E4P A;  2KOI A;  5DJU A;  2FFY A;  4HQA A;  4WM9 A;  3DAV A;  3CAX A;  3LIA A;  4GN2 A;  1Y4O A;  1MWR A;  3EWK A;  1S1Z A;  3LIE A;  3ZVW A;  1XJ4 A;  4YIN A;  3BJN A;  3C2W A;  3IXB A;  2LB5 A;  3HUN A;  1YT4 A;  4HBT A;  3IWI A;  4EQ1 A;  4FD8 A;  3U2A A;  1K55 A;  3V3R A;  4WZ4 A;  1IKG A;  4Z1W A;  5GHY A;  1BLH A;  4KZ6 A;  1I2W A;  3T1X A;  3WRT A;  1T19 A;  4LV1 A;  2V9A A;  1YLY A;  4HH3 A;  4OOM A;  1Q2P A;  4PMA A;  4BQM A;  3M2J A;  2UV0 E;  5KSH A;  3L9K A;  1P97 A;  2ZC5 B;  3N7W A;  1TS6 A;  3O88 A;  3C7V A;  5F6A A;  5E2F A;  1AXB A;  4WBG A;  2Z2L B;  4Q0I A;  1G6O A;  3LR5 A;  2QKP A;  3WWX A;  3LR4 A;  4H6J B;  1MC0 A;  4BD1 A;  1NZO A;  5J3W A;  4GHI A;  4XUX A;  2ZLY A;  3A3I A;  4E3K A;  4KG2 A;  3CPT A;  1MWU A;  2VGJ A;  3D3O A;  2DNS A;  2EXB A;  2R78 A;  3UB8 A;  4MBF A;  2ZD8 A;  1YPR A;  3S7P A;  4YWZ A;  5DF7 A;  4JGP A;  4O0P A;  1BUL A;  1LHY A;  1IYQ A;  1JWZ A;  2JN7 A;  4OP8 A;  3MMH A;  2VLG A;  1FR6 A;  1KGE A;  3ZG0 A;  1F5M A;  2K2N A;  3N6I A;  3HLW A;  3SZT A;  4MLL A;  1K25 A;  1N4O A;  3UB7 A;  4KG5 A;  5M1A A;  1F98 A;  2HZ5 A;  1U60 A;  2A24 A;  4OON A;  3T4S A;  3F1O A;  2ZQ8 A;  1HD8 A;  4EWF A;  2ZQC A;  1I2S A;  4JF4 A;  3HBR A;  1E3U A;  1BSG A;  3UE0 A;  2LB9 A;  3Q7Z A;  4P6B A;  1HTZ A;  2VV6 A;  1ZC2 A;  1CQA A;  1MWS A;  4C3Q A;  2JKT I;  4RX2 A;  3QP1 A;  2HP5 A;  3CG5 A;  1SCW A;  3LEQ A;  2GX5 A;  2PBY A;  3QHY A;  3UPP A;  1H5X A;  2PU4 A;  4S2P A;  2VZW A;  1W79 A;  5TBM B;  1JWP A;  3OBF A;  1KE4 A;  1NY0 A;  3G31 A;  3BY8 A;  2XEP A;  5FDS A;  1NRF A;  4PM6 A;  5CGX A;  3A3D A;  4BD0 A;  2H10 A;  4B93 A;  3TSG A;  5CED A;  3HVF A;  3F1P B;  2VX8 A;  4PM7 A;  4N9L A;  4K08 A;  2ZOI A;  5L8M A;  3LFV A;  1XXM A;  1DJA A;  4FUW A;  3UE6 A;  4LEN A;  1ZTU A;  3TRC A;  5HZH A;  4NET A;  3NOP C;  2PHY A;  4F94 A;  3ZG8 B;  3GSG A;  5CEC A;  2D02 A;  2INW A;  1MWT A;  4U0X A;  4ZRR A;  3IF6 C;  2QWS A;  3MKE A;  3MXQ A;  3UB6 A;  4Y0T A;  1M6K A;  3BEC A;  3UME A;  3LY4 A;  1SDE A;  3H7W B;  2C6W B;  1D1J A;  1LI9 A;  4PKY A;  2Y4A A;  1TS7 A;  4HBU A;  1CI8 A;  4HH2 A;  5DFY A;  1ES2 A;  4OPQ A;  1OTD A;  3IS2 B;  4I5S A;  3QP6 A;  2HP6 A;  3UN7 A;  4LFU A;  4X68 A;  3F1N A;  1H8M A;  1OT6 A;  5E2H A;  4IUK A;  4AFI A;  2E8I A;  4JGR A;  4KG6 A;  3S7O A;  2QJ7 A;  4EW7 A;  4HEF A;  2H0T A;  5KMW A;  4E04 A;  2HDR A;  4IJG A;  3FG8 A;  3ZCZ A;  1WYB A;  3BFD A;  4GZB A;  4I39 A;  5IHV A;  4JGO A;  5DKL A;  2J3T D;  3UPO A;  4C75 A;  1EWZ A;  1S4S A;  2EFX A;  5I5L A;  4CLC C;  3KX0 X;  3NI9 A;  1XFN A;  1UGU A;  3IX8 A;  1PWC A;  3SOI A;  1LT0 A;  2Y2H A;  3BLS A;  4KZA A;  3G34 A;  3LEZ A;  4HES A;  3BLM A;  4D2O A;  5CGW A;  3FPW A;  1YLJ A;  3HLB A;  5TGF A;  3T12 B;  5HL6 A;  3DTI A;  1MKI A;  2CC1 A;  1OTB A;  4EBL A;  3G32 A;  3QP5 A;  3G2Z A;  3IX3 A;  4P85 A;  4S2N C;  3O5Y A;  3I7J A;  5A90 A;  4A5R A;  1D06 A;  3KYZ A;  2Y91 A;  3O86 A;  4QPR A;  5GHZ A;  3SW1 A;  2B5R A;  2L4R A;  4Y17 A;  1P9R A;  5TJJ A;  4XXR A;  3UMD A;  4Y5F A;  4S2N A;  2WAF A;  4R3A A;  3MZF A;  1G68 A;  4UEY A;  1PNE A;  2ZM0 A;  4JXW A;  1P9W A;  4E3O A;  3S7N A;  4DDY A;  3PXP A;  4GHI B;  3BY9 A;  2VEA A;  1FSW A;  1PWG A;  5DFX A;  2Y2Q A;  3B47 A;  3CPT B;  3IQA A;  3S1Y A;  5EEC A;  1ERQ A;  4OLD A;  4HJ4 A;  1Y54 A;  4LCM A;  1PW8 A;  3C38 A;  4EER A;  4EUV A;  3E2L A;  4BBT A;  2HJ9 C;  3D9Y A;  4IBX A;  3ZNT A;  3FKW A;  1IFQ A;  2Y2G A;  3JVV A;  4NXB A;  3T4T A;  3VOL A;  1ALQ A;  2J8Y A;  4NKP A;  3ITB A;  3PYP A;  3BM6 A;  1NJ4 A;  2W3E A;  4WZ5 C;  3E4Q A;  1LSW A;  2FH5 A;  3BFG A;  2DCF A;  3GQZ A;  3T4Q A;  3T1S A;  1IYP A;  1JNU A;  2A24 B;  3F1O B;  2WZZ A;  3UE3 A;  1ESI A;  4B88 A;  2Y2P A;  2R9X A;  5I94 A;  3BQ8 A;  2XSS A;  4K0X A;  4QU3 A;  4CPK A;  3QNC A;  4S2O A;  1L0D A;  4EUZ A;  4LRX C;  2JKR I;  2KLI A;  4LPZ A;  2IA2 A;  3BQA A;  4Y0U A;  5GLD A;  1G5U A;  3Q7V A;  2O99 A;  4ETZ A;  4NXE A;  2G2W A;  2OLV A;  1DP8 A;  3WS4 A;  3VOZ A;  1GHP A;  3KYQ A;  5HPI A;  1TDL A;  1NYM A;  4WUJ A;  3MQO A;  4BMW A;  2WKQ A;  2QMI A;  3FWL A;  4DXB A;  2HGV A;  4GNU A;  1BLC A;  5E2G A;  5EVI C;  2V1Z A;  1OTI A;  3G35 A;  1PZP A;  4EET B;  1OTE A;  1DJB A;  3D72 A;  3EEA A;  4BEN A;  2Y8H A;  4S2L A;  5EVI A;  4EV4 A;  3IBJ A;  1IEM A;  4PM8 A;  4KQR A;  4FH4 A;  1YQS A;  3IHA A;  5EM1 A;  1M40 A;  2MJ6 A;  1PI5 A;  3UO9 A;  4DJ3 A;  2XD1 A;  3GDI A;  1XJ6 A;  2JC7 A;  2EWW A;  2AVX A;  3MXS A;  4UA7 A;  3EEH A;  3UPN A;  2HJE A;  2RCX A;  3NC8 A;  5M19 A;  1NXY A;  2KDK A;  2HDQ A;  2OWH A;  1V9Z A;  3C4P A;  5HD3 A;  2X02 A;  5L09 A;  2QZ6 A;  3VP3 A;  5AQA A;  1YAX A;  3VOY A;  2EX2 A;  3P09 A;  5FQI A;  5CGS A;  3NDE A;  1Z09 A;  2PBD P;  1OME A;  1J3W A;  2W3H A;  4FH2 A;  2PU2 A;  3E4O A;  5HFO A;  3NOU C;  1UWN X;  2JBF A;  3F1N B;  3T4J A;  2FZ0 A;  1RGY A;  5FSR A;  1VB6 A;  1AWI A;  2QYB A;  3TG9 A;  2VK3 A;  4I3A A;  4CJN A;  1S66 L;  2XQZ A;  3QP8 A;  2H0Y A;  2OAP 1;  1T1C A;  1DP6 A;  1IYS A;  2GJ3 A;  2W3F A;  3MBZ A;  4QY5 A;  1KDW A;  2J9O A;  1W63 M;  2VGL S;  4E3L A;  4NXF A;  1N9O A;  2XRO A;  3M6B A;  2XF3 A;  3U4L P;  1LSX A;  3Q81 A;  5EUA A;  1K4E A;  3VMA A;  1XJ3 A;  3DBA A;  3GTC A;  3M2K A;  3IXD A;  3LY3 A;  5J7E A;  4OKP A;  3H9W A;  4E6X A;  4O7D A;  3ZVT A;  3SH7 A;  4R3B A;  4R1G A;  4F3L A;  2W27 A;  3FC7 A;  4WMC A;  3HLC A;  1BZA A;  3LO7 A;  5EVE A;  3GV9 A;  4X1M A;  1OJG A;  3UDF A;  4FTX A;  1ODV A;  4S2M A;  2VGL M;  2JKT M;  4GJ4 A;  4UQI S;  3LI9 A;  1YM1 A;  3DWK A;  2XFT A;  4I3J A;  3A3J A;  2KX6 A;  3GRJ A;  3H82 A;  1SKO A;  3JYI A;  3MJQ A;  3OPR A;  2ACG A;  5DJT A;  2XDM A;  3PBQ A;  4X55 A;  5GLB A;  1JVJ A;  4PHT A;  2P04 A;  4LV2 A;  2HPB A;  4P87 A;  4BJP A;  3O87 A;  1K6S A;  3AGD A;  1WA9 A;  1DRM A;  1PW1 A;  3NUL A;  3S4X A;  3T4K A;  2WKH A;  2P9V A;  5DTT A;  1L0E A;  1K56 D;  4G3W A;  4FSF A;  3V50 A;  4S2J A;  5F68 A;  1KVM A;  4MN7 A;  5K5B A;  4UQI M;  4UAA A;  1F9I A;  2ZBB A;  1CEF A;  4L9F A;  4WYY A;  1PIO A;  4MCW A;  4KEN B;  5GHX A;  3QNB A;  1TF1 A;  1MKM A;  1DY6 A;  4OLG A;  3T1R A;  4QB8 A;  1GA0 A;  3NDG A;  2ZC3 B;  1Y28 A;  4DN0 A;  5DF9 A;  1QMF A;  1VEU A;  3LIB A;  3PBR A;  3IXG A;  4U0T A;  3GVB A;  3CZD A;  3HLD A;  4YFM A;  3EOI A;  1ZHH B;  3QP4 A;  4E3M A;  4GDB A;  1IEL A;  3GMW A;  1VM1 A;  2J7V A;  3R7W A;  1D7E A;  1XA1 A;  1HVB A;  3Q7V B;  5DF8 A;  1OTA A;  3SS4 A;  3P98 A;  1IYO A;  5F5Y A;  3E2K A;  1X0O A;  4RX3 A;  1GSV A;  3P7N A;  4ZAM A;  3AGE A;  3WS2 A;  2VV8 A;  2WGI A;  5IS1 A;  4MN5 A;  5FAP A;  4E3N A;  2Y2O A;  4JXG A;  1SDN A;  1YMX A;  5HAI A;  5HW3 A;  2H5S A;  3CI6 A;  3Q1F A;  3ITA A;  2M7U A;  3IT9 A;  3UNW A;  1W5D A;  2L1M A;  2UWX A;  5CER A;  3LID A;  1SKF A;  2DMW A;  4ZBE A;  2XFS A;  2XR0 A;  5AVF A;  2Y79 A;  1BTL A;  1XJ2 A;  5FI6 A;  2W3G A;  5EVI B;  1XGJ A;  1E25 A;  4KUK A;  2V0W A;  5EM0 A;  5EVL A;  3OPH A;  3DWZ A;  4JGQ A;  3FZC A;  4JPM A;  5HL1 A;  5FQJ A;  3ZDJ A;  3ZQ5 A;  3MZE A;  4MBH A;  1PYY A;  4IVI A;  5FQK A;  3TOI A;  3CMZ A;  3A3E A;  4KZ8 A;  5HAR A;  3P01 A;  5CTN A;  5A91 A;  1J9M A;  2ZQ7 A;  3T50 A;  3C4O A;  3VFF A;  3LYX A;  1KOU A;  2ZQA A;  4ME4 A;  5DVA A;  4HOI A;  5KZH A;  3IF6 A;  1ONG A;  4N9K A;  3UE1 A;  3C30 A;  4M4X A;  4ESP A;  2QHK A;  4N1X A;  2EFU A;  4O8G A;  1IKI A;  3IWO A;  5AVE A;  4N1H A;  4Y15 A;  2ZC6 B;  1L2S A;  3VFH A;  5CHU A;  2PDR A;  4RYE A;  1XP4 A;  3W4P A;  1NWZ A;  3K3C A;  4WEL A;  5F1F A;  4FOF A;  3QP2 A;  2OOL A;  4OQH A;  4IHQ A;  3CIT A;  4R3J A;  4EEU A;  2XD5 A;  1ZG4 A;  3DTM A;  2ZC4 B;  2WUQ A;  1VET A;  3PBO A;  2R9W A;  2V8C A;  2BLS A;  3CLO A;  1CF0 A;  2H28 A;  1RCJ A;  2JKG A;  4Y0O A;  4N92 A;  5KSC A;  3VSL A;  4RQ9 A;  1FCO A;  4OQI A;  3PAE A;  4CLC A;  3C7U A;  1OT9 A;  5JYP A;  1A0K A;  4F3L B;  1K57 C;  4ZJ1 A;  4OPR A;  2OLU A;  4P6Z S;  2HP9 A;  1DJC A;  4ID4 A;  5F82 A;  1YKD A;  1K38 A;  4HP9 A;  3G2Y A;  4HJ6 A;  4KZ4 A;  2J80 A;  1E3U D;  3R4K A;  3T1Q B;  2M1C A;  4YNR A;  1K57 A;  2ZMA A;  5FA7 A;  2JCH A;  4G3V A;  3CWF A;  4PKY G;  1DP9 A;  3DW0 A;  4OQ0 A;  3H82 B;  1T1B A;  4IED A;  2Y2M A;  4ZJ2 A;  2W1T A;  1K0K A;  1ACF A;  1LL9 A;  1PFL A;  3V3S A;  4UA9 A;  2XRN A;  3HUO A;  1LL5 A;  1T1A A;  1E4D A;  2PD7 A;  5DTS A;  1L0F A;  3OPL A;  5E43 A;  4P6Z M;  4GKU A;  3VP4 A;  4CLC E;  2WKP A;  3KSF A;  1GHM A;  3HJI A;  4UHU A;  4EEP A;  2PR5 A;  2P9V B;  2XA7 S;  3O3V A;  3T4L A;  2QPN A;  1BLP A;  4KQD A;  1JTG A;  1JTD A;  1FR1 A;  4DMZ A;  4I38 A;  4OQG A; 
#chains in the Genus database with same CATH homology
 1F5M A;  2K2N A;  2PYP A;  4Q0J A;  2Z6C A;  3NHQ A;  2L0W A;  3UB7 A;  2K7S A;  2W3H A;  1F98 A;  3E4O A;  2PR6 A;  3NOU C;  3KSH A;  2A24 A;  3T4S A;  1UWN X;  3F1O A;  4L9E A;  1N9N A;  3F1N B;  3HJK A;  3T4J A;  2VJW A;  2FZ0 A;  5DKK A;  4Q0H A;  3PHY A;  1VB6 A;  2QYB A;  1XFQ A;  3OCN A;  4I3A A;  2B02 A;  1BYW A;  1S66 L;  4B9O A;  2OAP 1;  3E0Y A;  2LB9 A;  3TE8 A;  1T1C A;  1DP6 A;  1S67 L;  2VV6 A;  3JVU A;  4OOL A;  2GJ3 A;  2W1R A;  2W3F A;  1W63 M;  2VGL S;  2P08 A;  4NXF A;  1N9O A;  2W3D A;  4LRZ E;  2XRO A;  2JKT I;  4HY8 A;  3CUE C;  4HNB A;  1LSX A;  2GX5 A;  1VHM A;  5C5K A;  3VE3 A;  3TW8 A;  3R7W B;  1XJ3 A;  3DBA A;  1OPX A;  2XA7 M;  2GZA A;  5HPF A;  5J7E A;  2VA0 A;  3H9W A;  3PBS A;  2VZW A;  1N9L A;  2OWJ A;  1NLZ A;  5TBM B;  3EQU A;  4NEE D;  3OBF A;  3CUE A;  4F3L A;  3BY8 A;  5FL3 A;  5HWV A;  2W27 A;  4KQO A;  3FC7 A;  4EU0 A;  1TD5 A;  4B93 A;  5A8B A;  3KSG A;  4ARZ B;  2VV7 A;  4HI4 A;  4IUH A;  3F1P B;  3LIC A;  2VX8 A;  2JKR M;  3F1P A;  4L0L A;  1OJG A;  3PR6 A;  4O01 A;  1ODV A;  1NLY A;  4K08 A;  2ZOI A;  4GLQ A;  5L8M A;  1H3Q A;  2VGL M;  3LFV A;  2JKT M;  3BWL A;  4GJ4 A;  5G4Y A;  4UQI S;  4GS9 A;  3UE6 A;  3LI9 A;  5EFW A;  1GSX A;  3RH8 B;  1G28 A;  4H6J A;  4I3J A;  4HJ3 A;  1EW0 A;  5HWW A;  5G4Z A;  1ZTU A;  3GEC A;  2KX6 A;  4Y2F A;  3H82 A;  3TRC A;  5HZH A;  4CQH A;  3MJQ A;  2D01 A;  2O9A A;  3NOP C;  2PHY A;  5DJT A;  3EGD C;  3PBQ A;  2NUP C;  3ICY A;  2O9B A;  4PHT A;  2P04 A;  3EQV A;  3ULF A;  2D02 A;  2INW A;  4ZRR A;  2CMN A;  4BJP A;  3E98 A;  2QWS A;  4ETX A;  4NXG A;  3MXQ A;  3BW6 A;  5LBR A;  3UB6 A;  1WA9 A;  4CLC D;  2QJ5 A;  2B18 A;  1DRM A;  4GW9 A;  3MFX A;  3T4K A;  3UME A;  3H7W B;  4XT2 A;  2BAS A;  3PBT A;  5HDC A;  4G3W A;  2I9V A;  4FSF A;  1YSQ A;  3H7W A;  4PKY A;  4LRY C;  1GSW A;  2YKF A;  5F68 A;  1TS7 A;  5IT5 A;  4MN7 A;  4HH2 A;  5DFY A;  5K5B A;  2JHE A;  2PYR A;  4G3K A;  4UQI M;  1OTD A;  3IS2 B;  2ZMV A;  1F9I A;  4I5S A;  5HDS A;  3FPV A;  2ZBB A;  4MN6 A;  4L9F A;  3F1N A;  1H8M A;  3OCL A;  1OT6 A;  4IUK A;  4MCW A;  4AFI A;  4JGR A;  1TF1 A;  4BBU A;  1MKM A;  3S7O A;  4WN5 A;  2QJ7 A;  4EW7 A;  3TJZ C;  3MF0 A;  3T4O A;  1Y28 A;  3G6O A;  3B42 A;  4DN0 A;  4Y3I A;  5DF9 A;  2WKR A;  4E04 A;  4IJG A;  1STZ A;  3LIB A;  3PBR A;  5HWT A;  3FG8 A;  3OC2 A;  2YKH A;  3A0R A;  4I39 A;  3EOI A;  1ZHH B;  4JGO A;  5DKL A;  2J3T D;  4HIA A;  2HF6 A;  2J3W A;  1S4S A;  5I5L A;  3LIF A;  4R70 A;  4CLC C;  3R7W A;  3KX0 X;  1D7E A;  3MQQ A;  1XFN A;  3NJA A;  4EES A;  1UGU A;  1OTA A;  1LT0 A;  5J4E A;  4L9G A;  5F5Y A;  1X0O A;  5TBM A;  2V1A A;  3W2Z A;  1GSV A;  3P7N A;  3VV4 A;  4CLC B;  3FPW A;  3IBR A;  2VV8 A;  3RTY A;  5IS1 A;  4MN5 A;  5HL6 A;  1MZU A;  2O0Y A;  3MQ0 A;  1OTB A;  2V0U A;  4HHD A;  4ARZ A;  2PD8 A;  1UWP X;  3KSI A;  3S7Q A;  3CI6 A;  3O5Y A;  2VKS A;  1S1Y A;  2P7J A;  5AJG A;  2M7U A;  1D06 A;  3KYZ A;  4WEJ A;  1TS8 A;  2L1M A;  3C8C A;  3LID A;  3LUQ A;  2DMW A;  3SW1 A;  4QPR A;  2L4R A;  3KO6 A;  1P9R A;  1T18 A;  2Y79 A;  5AVF A;  5TJJ A;  3VE4 A;  4BWI A;  3UMD A;  1XJ2 A;  2J3T C;  2W3G A;  4Y5F A;  4II7 A;  1P0Z A;  4KUK A;  2V0W A;  2V1B A;  3A0V A;  1V9Y A;  4MDZ A;  4R3A A;  4JGQ A;  4UEY A;  1LL8 A;  2K31 A;  2M7V A;  1OJ5 A;  1P9W A;  1NRJ A;  3MR0 A;  2EWV A;  2HV1 A;  3S7N A;  3PXP A;  4GHI B;  3BY9 A;  2VEA A;  4WLA A;  5DFX A;  3ZQ5 A;  5IU1 A;  3B47 A;  2W1T B;  4R38 A;  5HSQ A;  5KIZ A;  5HD5 A;  1W63 Q;  1IOU A;  3V67 A;  4HJ4 A;  2ZOH A;  3C38 A;  1YSP A;  4EER A;  3K2N A;  4DJ2 A;  4EUV A;  3P01 A;  4BBT A;  2HJ9 C;  1IFQ A;  1LSV A;  4WL9 A;  3T50 A;  3JVV A;  4NXB A;  3T4T A;  3VOL A;  3LYX A;  1KOU A;  2ZMF A;  3NOT C;  4NKP A;  5CX7 A;  4ME4 A;  3LI8 A;  4HOI A;  3PYP A;  4BBV A;  5HDD A;  4R6L A;  3ZYT A;  2PT7 A;  3C30 A;  2W3E A;  3IS2 A;  4M4X A;  3OLO A;  3E4Q A;  1LSW A;  2FH5 A;  3UB9 A;  2QHK A;  4O8G A;  3T4Q A;  4KUO A;  5AVE A;  1JNU A;  4PAU A;  2A24 B;  3F1O B;  4MMN A;  2PDR A;  3UE3 A;  1NWZ A;  3K3C A;  4WEL A;  3E4P A;  4FOF A;  2KOI A;  2OOL A;  3BQ8 A;  5DJU A;  2XSS A;  4IHQ A;  3CIT A;  4HQA A;  4EEU A;  2GNX A;  2EA9 A;  3CAX A;  3LIA A;  4LRX C;  2JKR I;  2KLI A;  4LPZ A;  2IA2 A;  3PBO A;  2O9C A;  3BQA A;  3EWK A;  4I3I A;  1S1Z A;  3LIE A;  4YOF A;  1XJ4 A;  3CLO A;  3BJN A;  2H28 A;  3HCY A;  3C2W A;  1S4R A;  2LB5 A;  2O99 A;  3OOV A;  4ETZ A;  4NXE A;  2G7U A;  4EQ1 A;  1DP8 A;  4RQ9 A;  4HP4 A;  3KYQ A;  5HPI A;  3U2A A;  2OAQ 1;  4WUJ A;  3MQO A;  4CLC A;  1OT9 A;  4LLO B;  4BMW A;  2WKQ A;  4Z1W A;  4WEK A;  4F3L B;  2HGV A;  1T19 A;  2V9A A;  4HH3 A;  4OOM A;  1OTI A;  4P6Z S;  3K3D A;  3LR3 A;  4EET B;  1YKD A;  1OTE A;  4HP9 A;  5KSH A;  3D72 A;  3EEA A;  4HJ6 A;  1TS0 A;  1P97 A;  2J80 A;  3R4K A;  2M1C A;  4GCZ A;  1TS6 A;  4YNR A;  5F6A A;  2Y8H A;  3PBN A;  3IBJ A;  4Q0I A;  1G6O A;  3LR5 A;  2QKP A;  4GS9 B;  3LR4 A;  4G3V A;  4H6J B;  2A2L A;  3CWF A;  1MC0 A;  2MJ6 A;  4PKY G;  1DP9 A;  5J3W A;  4DJ3 A;  5F69 A;  4GHI A;  3GDI A;  1XJ6 A;  4EXO A;  2EWW A;  1T1B A;  3H82 B;  4WF0 A;  3EEH A;  2W1T A;  3D3O A;  2HJE A;  2W0N A;  2Z6D A;  2R78 A;  3UB8 A;  2XRN A;  1T1A A;  3S7P A;  4YWZ A;  2PD7 A;  3B33 A;  2KDK A;  3LR0 A;  3A0S A;  4JGP A;  2OWH A;  4O0P A;  5MC7 A;  1V9Z A;  5HD3 A;  3EGX C;  4P6Z M;  3RFB A;  4CLC E;  2WKP A;  3KSF A;  3HJI A;  2JN7 A;  3MMH A;  2VLG A;  4EEP A;  2PR5 A;  2XA7 S;  1YAX A;  3T4L A;  4KQD A;  4XT2 B;  4DMZ A;  2NUT C;  4I38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...