1ODVA

Photoactive yellow protein 1-25 deletion mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
100
structure length
100
Chain Sequence
LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signalling
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Pas Domains.Common Structure and Common Flexibility
pubmed doi rcsb
source organism Ectothiorhodospira halophila
total genus 29
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1odvA00
4LLOB 3K3DA 3ZQ5A 3A0RA 3FC7A 2WKPA 4L9GA 4I38A 4MN6A 5F69A 3LIEA 1UGUA 4I3JA 2QJ5A 1S4RA 4HJ4A 2W27A 4HP4A 1S1ZA 4LRYC 1P97A 3LIAA 3RTYA 2D02A 3F1PA 2INWA 3CWFA 3UE6A 4KUKA 2PDRA 3MFXA 5TBMA 1T19A 3LIDA 3NJAA 2JN7A 1WA9A 3MQQA 2HV1A 3NOPC 2OOLA 5AVFA 1F9IA 3PYPA 3IS2A 3ULFA 1OTEA 4XT2B 4NXEA 1OTDA 5DJUA 3LYXA 1GSXA 3LI9A 1F98A 2YKHA 4R6LA 4HHDA 3E4QA 2V0WA 5I5LA 5HDCA 2R78A 1VB6A 3BY9A 2GJ3A 3LICA 2JHEA 1S4SA 3HJKA 1BYWA 2L1MA 3NHQA 1LSXA 2V0UA 3H82A 2ZOIA 3MR0A 3BY8A 4PKYG 1DRMA 2PD7A 3GECA 2VEAA 4HJ3A 1LSVA 2Z6CA 4JGQA 2WKQA 1D7EA 4EEUA 4WLAA 4WL9A 5HWVA 5HDSA 2QHKA 3LIFA 4WUJA 3CLOA 3F1PB 3PHYA 4DJ3A 4LPZA 3NOTC 4JGRA 4HY8A 4EEPA 1D06A 1V9YA 1OJ5A 2I9VA 4H6JA 4GHIB 1DP6A 3B33A 4I3AA 2PYPA 4F3LA 2K7SA 3IS2B 2WKRA 3MJQA 5HD5A 5G4ZA 2CMNA 1EW0A 2YKFA 3VE3A 1DP9A 4EERA 3G6OA 1G28A 1XFNA 4MN5A 1GSWA 1ODVA 1UWNX 3C2WA 3FG8A 2ZBBA 4HP9A 4HNBA 2V9AA 4NXGA 1OTAA 2PHYA 1NWZA 4JGOA 1UWPX 1N9LA 3H82B 5J7EA 5HWTA 1XFQA 4DJ2A 4GW9A 5G4YA 1TS6A 5KIZA 4YWZA 4M4XA 4R70A 3H9WA 3IBRA 1OTIA 4EETB 3P7NA 1XJ3A 3KX0X 1N9OA 1XJ2A 3A0SA 1JNUA 5J3WA 5DKKA 1OT6A 2PR6A 4GS9A 5A8BA 3VE4A 3F1NA 5J4EA 4PKYA 1S66L 1TS7A 3BWLA 2L0WA 1OT9A 1LT0A 4JGPA 1V9ZA 4KUOA 3SW1A 3H7WA 3EEHA 4NXBA 2VV6A 5F6AA 4H6JB 3T50A 2VLGA 4BBUA 1S67L 1DP8A 4L9FA 4HH2A 1XJ6A 5EFWA 2EA9A 2A24A 4KQDA 4F3LB 1T1AA 4EW7A 3ICYA 4WF0A 2H28A 5TBMB 3GDIA 2QJ7A 2PR5A 4K08A 2PD8A 2J80A 2M1CA 4R3AA 3UMDA 4HJ6A 4EESA 1X0OA 3LIBA 4EXOA 1MZUA 4GCZA 4BBTA 4I39A 4HOIA 2ZOHA 3F1OA 3NOUC 1S1YA 3UB6A 2PYRA 4B9OA 5HZHA 5AVEA 3RH8B 4E04A 2W0NA 1LL8A 3A0VA 4HI4A 1TS0A 1T18A 4EQ1A 3MQOA 1T1BA 3HJIA 3MXQA 5F5YA 4WN5A 2KX6A 4L9EA 5HD3A 2VV8A 2L4RA 4RQ9A 4BBVA 2VV7A 5HWWA 2BASA 3C8CA 5HSQA 5IU1A 4GHIA 2V1AA 5HDDA 4HIAA 3UB9A 4GS9B 3F1NB 2KDKA 3UB8A 1KOUA 5DJTA 1N9NA 3LI8A 5DKLA 3E4OA 3H7WB 2Z6DA 3CAXA 1XJ4A 2QWSA 1OTBA 5F68A 4I3IA 1T1CA 1LSWA 2A24B 3OLOA 2OWHA 4XT2A 1GSVA 3E4PA 3K3CA 3LUQA 2P7JA 2B02A 1TS8A 4HQAA 3UB7A 2V1BA 1P0ZA 2OWJA 3UMEA 2D01A 4R38A 1OJGA 5IS1A 1Y28A 3F1OB 4I5SA 4HH3A 3EWKA 3VOLA 3D72A 4LRZE 4LRXC 2QKPA 4NXFA
chains in the Genus database with same CATH superfamily
2XROA 3CJMA 4LLOB 3K3DA 1K57C 3ZQ5A 3KSHA 4A5RA 3N4IA 5FAOA 4KZ6A 5TGFA 3IX4A 4P6BA 5JYPA 1PIOA 4PM8A 4ESPA 1UGUA 4Q0IA 3SH7A 4S2PA 1SKFA 4K0WA 4B88A 3ZYTA 3JVVA 1IYOA 1S1ZA 1P97A 3KYQA 3TW8A 3VP1A 2D02A 2HZ5A 3UE6A 4R4SA 1LI0A 2V8FA 2WUQA 1XP4A 2G7UA 2PT7A 2B18A 2HDQA 3PAGA 4LRXC 4WEKA 1T19A 1K6RA 5EUAA 3NOPC 3ZG5A 5AVFA 2BTFP 5A92A 1PZPA 4EBNA 4ZRRA 1ES4A 3IS2A 1OTEA 1PRQA 1YQSA 3RJUA 4LGWA 5DJUA 3LYXA 1GSXA 1MKIA 1F98A 2YKHA 4HHDA 5CGXA 2ZC3B 1K55A 3VP3A 1K4FA 1BLCA 3Q81A 2JKTI 4LV1A 5HDCA 1L0DA 1RGYA 2G2WA 3NC8A 2OLUA 4O8GA 2JHEA 4CJNA 4GDBA 1K56A 4WMCD 3E2LA 3NHQA 1LSXA 3V5MA 4P0MA 3H82A 4UEYA 3EEAA 4IJGA 1BULA 1F2KA 1KGGA 2VEAA 4JGQA 2JKTM 3LEQA 3T4QA 4HBTA 2IWCA 4WLAA 5HDSA 5EPHA 1K54A 1ONHA 3W2ZA 4R3JA 5F1GA 4E3LA 4Z1WA 3KYZA 4OPQA 3QNCA 4IBRA 1ES5A 4LPZA 3ZHHA 5GLCA 1OMEA 2EFXA 1ZKJA 4HY8A 4JF6A 2W1TA 4EEPA 4RA7A 2O9CA 1JTDA 1FCMA 4GHIB 4JF4A 2BLSA 4Y0UA 2M7VA 3O86A 2XD1A 3VP2A 3BEBA 4I3AA 2PYPA 2K7SA 3AGDA 5FA7A 3IBJA 1H8YA 4S2JA 4S2MA 2IWBA 3VFHA 5CECA 5FL3A 2YKFA 4O01A 3WS0A 3VE3A 5L10A 3UE1A 3FV7A 1DP9A 2J9OA 3ZGAB 1RCJA 4WEJA 2NUTC 4P6ZS 1G28A 3IF5A 5D3OA 1GSWA 3BM6A 2P04A 3M2KA 3WS1A 2XFTA 3IWIA 1BT5A 1ZHHB 2PHYA 1UWPX 4FUWA 2H10A 1XPBA 4WYYA 1JWPA 1IYPA 4DJ2A 2WZZA 5AQ9A 2RL3A 1VQQA 5DTSA 3T1XA 4FCFA 2A2LA 4RX2A 1JWZA 1LL5A 1YM1A 1CK3A 1ACFA 5E2EA 4UA6A 3P7NA 1TD5A 1E4DA 3WRZA 1JNUA 2ZL1A 1TEMA 3PTEA 3UPOA 3F1NA 4UAAA 4FD8A 4PKYA 4WBGA 3BWLA 2L0WA 3WS4A 5FEFA 1OT9A 4B93A 2Y2LA 3A3IA 1VEUB 2XH9A 2ZC6B 4NXBA 1FSWA 4H6JB 2ZM2A 1HD8A 1S67L 2Y2HA 5EOEA 1XJ6A 4OQIA 2EA9A 2KOIA 3G31A 2ZQ7A 2A24A 4F3LB 3GR2A 3ZVWA 1YKDA 4WF0A 3GSGA 4C75A 2ZQCA 2JC7A 2O9BA 3GDIA 1E3UA 2PR5A 5JYOA 3Q1FA 1GA0A 4BJPA 4KZ7A 2PD8A 3UE3A 1HLUP 2M1CA 2Y2PA 1XGJA 3OPPA 3T4SA 5KZHA 4EESA 2W3HA 3LIBA 2JKFA 3CUEA 3UN7A 4I39A 4WM9A 3A3DA 5GLBA 1PW1A 3UB6A 3W4OA 3C4PA 5HZHA 3T4OA 5AVEA 1AWIA 2XGNA 3RH8B 4JF5A 5F1FA 4XXRA 1CEFA 2VGLS 3IH8A 5E43A 1LL8A 3MZFA 4NKPA 1IYQA 1T18A 4IBXA 3MXQA 3BLMA 2KX6A 3CPTA 2VV8A 4RQ9A 4LCMA 1L2SA 2ZM8A 3A3EA 1KVMA 3IXDA 2ZC5B 5DF9A 5IU1A 5GLAA 3TRCA 5AQ7A 1NYYA 3LY3A 2V1AA 5EVIB 3B47A 3N6IA 3UB9A 2KDKA 4BD0A 4NK3A 3ZG9B 1ZC2A 3A3FA 3BFEA 4LCLA 5DJTA 5HL6A 1M40A 1N9NA 1F5MA 3LI8A 5EVEA 3B3XA 1YSQA 4RVAA 1YMSA 1I5QA 2Z6DA 3GVBA 4GN2A 1FILA 4Y5FA 4KG2A 4S2NA 3O87A 2JBFA 2ZQAA 3BYDA 4OLGA 3FPVA 1YT4A 4U0XA 1BZAA 5EVID 4PM5A 4N1HA 1K4EA 2B02A 2PAVP 1W63M 1IYSA 3HVFA 5TR7A 2Y79A 3VP4A 3SS4A 1YPRA 4X1LA 3LR3A 3BQAA 5EM0A 2D01A 4R38A 4HH3A 1IOUA 5E2HA 1G5UA 4Y0OA 3IQAA 4Z9QA 3MS6A 4NXFA 3GMWA 1MKMA 3VOYA 1H5XA 3HCYA 3HUOA 2WKPA 2ZC7A 4L9GA 5TJJA 1PFLA 4I38A 2OSUA 3IXHA 5E2FA 2ZQ9A 3LIEA 1TDGA 2MJ6A 4I3JA 3ISGA 4CLCE 4FH4A 2DNSA 3I7JA 3MXSA 3G32A 4HJ4A 2P9VA 1ZG4A 4LRYC 3CZDA 5CEDA 1MPLA 3RTYA 2INWA 2Y2NA 2Y2MA 3CWFA 3ZG8B 1YLJA 4Y0TA 5HAIA 4KUKA 2PDRA 4EBLA 1RGZA 2EX8A 3HBRA 3UO9A 3LIDA 4UA7A 5HX9A 4R1GA 3NJAA 4MLLA 5DTTA 4E6WA 3BECA 2JN7A 1WA9A 3PBSA 2WAFA 3IXBA 2OOLA 1LLBA 1F9IA 3KSIA 3HREA 5EE8A 1OTDA 3UDXA 1P9RA 2FH5A 2E8IA 4UQIS 4PM9A 1DY6A 3HLCA 3E4QA 5I5LA 2QZ6A 5AJGA 3SH9A 5F82A 5EVIC 4KZ5A 3BY9A 4KZBA 1BUEA 2L1MA 3WS2A 2ZQDA 2V0UA 2VA0A 5TFQA 1H0MA 3BY8A 4PKYG 1YLWA 4ETXA 4X25A 3OPLA 3G34A 4AFIA 3PBOA 2PRFA 1QMFA 1SCWA 4DE0A 1MWSA 4C3QA 3MQ0A 3QP2A 4MDZA 4WL9A 5EM1A 1YMXA 4IVIA 1H3QA 4GB7A 3OCNA 4OOYA 5M19A 2HP9A 1HZOA 5EVLA 2CC1A 3OBFA 4II7A 4DJ3A 4IVKA 4IUHA 3QHYA 3HLDA 4JBFA 3VSKA 3CMZA 4EU0A 3ZFZA 1D06A 1OJ5A 4WZ5A 2W3EA 2Y2KA 4OQHA 3ZNYA 3B33A 3IHAA 4OPYA 5FSRA 3JYIA 1K25A 3IS2B 5FAQA 4UQIM 5G4ZA 2Y2QA 2CMNA 5EOOA 3SS3A 1QMEA 1PNEA 4XUZA 1G6AA 3UB5P 4ZJ2A 1ZTUA 1XFNA 3C2WA 3RFBA 1DJAA 1OTAA 4EV4A 4OP5A 1NWZA 4JGOA 3EQUA 5FEGA 2HPBA 1U60A 3H82B 3W4QA 1FQGA 4OOMA 1EI5A 5LBRA 4BWIA 1XFQA 2V1ZA 3NDEA 1MXOA 3GV9A 5G4YA 1W79A 1FSYA 4EUZA 1LHYA 5KIZA 1NJ4A 3Q7ZA 4M4XA 5DF7A 4DE3A 1ALQA 5HFOA 3W4PA 4UHUA 2DCFA 2B5RA 3PBNA 4EETB 5AQBA 3KX0X 5IT5A 4LV0A 3EGDC 5J3WA 1W7FA 3OOVA 1OT6A 1K56D 1IFQA 5A8BA 3DTIA 4LENA 1YSPA 5J4EA 1S66L 1YLTA 2UWXA 2ZM0A 4JGPA 1FR1A 3P98A 4JLFA 4ARZA 3SW1A 1NLZA 3L9KA 3IH9A 4QPRA 3A3JA 1PWDA 3EEHA 2VX8A 1EROA 4Y17A 1S6RA 4S2KA 1L0FA 5F6AA 1I2SA 3T50A 2H0TA 1DP8A 3C5AA 3D4FA 4H8RA 1NZOA 5CGWA 5L8MA 3MBZA 4X56A 3BQ8A 2H28A 3PBQA 5TBMB 5GHZA 4Q0HA 4ZAMA 4Y3IA 2C5WB 2VKSA 1KGEA 1IKGA 4ME4A 3KSFA 1TDLA 4QB8A 1ES2A 4EXOA 1MZUA 2R9XA 3N7WA 4G3KA 4O0PA 1S1YA 2WAEA 1K6SA 5FQMA 2GNXA 4B9OA 3NECA 1L0EA 4E04A 2W0NA 3BJNA 5AQAA 2V2FF 4OH0A 1TS0A 2VK3A 4EBPA 3IXGA 1GCEA 2ZMVA 1T1BA 3LEZA 3HJIA 4WN5A 4Y7PA 2Z2MB 4L9EA 5HD3A 2L4RA 2VV7A 4MEZA 4N9KA 5HWWA 2BASA 3C8CA 2ZL1B 4GHIA 1L3LA 3IF6A 4ZJ1A 2X71A 5J8XA 3F1NB 3GTCA 3UB8A 3OC2A 1KOUA 1K55C 4CLCA 1BLHA 3R7WA 1S0WA 3PBTA 2KLIA 1FCOA 3CAXA 4CLCD 4C6YA 2XD5A 4KQQA 4MBFA 1YLYA 4ZJ3A 1ONGA 2W1RA 3OCLA 4P87A 5FQQA 3IX8A 1I2WA 3Q82A 1G68A 2A24B 4LV3A 2OWHA 3CG5A 4XT2A 1XA7A 3C7VA 1WE4A 2XRNA 2JKGA 1GSVA 3T12B 2GDNA 3E4PA 3SOIA 4KG6A 2P7JA 4MN7A 5I94A 4ID4A 2OWJA 1GHMA 3MXRA 1K54C 4PHTA 4EQIA 4NEED 3S4XA 5HW3A 3DW0A 5GHYA 3T4TA 3E0YA 1VETA 3VOLA 3D72A 4PMAA 4LRZE 1XGIA 5HAQA 4DE2A 2EFUA 3Q7VB 3WRTA 2WGWA 3A0RA 4OPRA 3FC7A 1E3UD 3HLFA 3HLEA 3HLGA 4MN6A 4BLMA 5F69A 1N4OA 4BENA 4R4RA 3FKVA 4O7DA 3CPTB 1S4RA 4GJ4A 3S22A 4X69A 4CQHA 2R9WA 3MFDA 5E2GA 3LIAA 3F1PA 2V20A 3LO7A 2HJEA 3C38A 1LL9A 3LR5A 2Y2JA 3TSGA 3UY6A 2WADA 1P9WA 3KO6A 3MMHA 1G6OA 3MQQA 1VM1A 1HVBA 2HV1A 3N8LA 3UPPA 3P01A 3IF6C 3M6BA 2IA2A 5A91A 3NDGA 3U2AA 4X55A 3LI9A 4R6LA 1KGFA 1OPXA 2Y91A 2ZMAA 2WZXA 1J9MA 2R78A 2FZ0A 1O7EA 2GJ3A 1PYYA 3LICA 1XA1A 3W8KA 2LB9A 3T4KA 4EWFA 5HL1A 3BFGA 3P09A 3V39A 3BRMA 3IT9A 3MR0A 4JXWA 1PW8A 4LFUA 3T4JA 5CEBA 5K5BA 3LCEA 4GNUA 5F83A 2PD7A 4FH2A 3GECA 2P08A 1ES3A 4L0LA 4HJ3A 1LSVA 3PBRA 2Z6CA 1KE3A 2WKQA 2XDMA 4OPZA 4E3JA 1BTLA 1XXMA 1YLZA 4EEUA 4IEDA 2OV5A 2QHKA 3PXPA 5DFXA 3NI9A 4M3KA 3CLOA 2O9AA 5M18A 1N9BA 1CEGA 4X1MA 2ZQ8A 3CUEC 3V3RA 1SHVA 1K57A 1Q2PA 2ZJ9A 3SS5A 3UDFA 1V9YA 1NRJA 2I9VA 2QMIA 1ZG6A 1W8YA 4S2LA 3G35A 1DP6A 4JKTA 1H8ZA 1CI9A 2WKRA 5HD5A 2XQZA 1GHPA 3CI6A 1EW0A 5L2FA 2PU4A 1FIKA 2G2UA 2GX5A 4EERA 1K0KA 3G6OA 4KQOA 4MN5A 2HDSA 4S2OA 2PBYA 3GQZA 2Y2GA 4HP9A 1MWTA 4FTXA 3S7PA 5CHMA 1N9LA 4FOFA 4ZDXA 4DN0A 1Q2QA 1FR6A 3T4LA 2XR0A 4GW9A 3HL9A 2EX2A 4S2NC 3KYEA 2ZMFA 4RX3A 3H9WA 3IBRA 3QP5A 3U4LP 3UE0A 3DAVA 3OPHA 5CERA 1SKOA 4OONA 1XJ3A 2WKEA 1N9OA 1XJ2A 3A0SA 4DMZA 4D2OA 4R23A 1NYMA 5DTKA 5DKKA 2PR6A 4GS9A 2EWWA 1Z6FA 1TS7A 2NUPC 1ESUA 4GKUA 1V9ZA 2O0YA 4UA9A 1Y54A 3D9YA 4KUOA 4FSFA 3H7WA 1MBLA 4X53A 2J3TD 1VHMA 1CJFA 3NBLA 2VZWA 5CHJA 1D1JA 3SH8A 4L9FA 3NY4A 5HAPA 1J3WA 4HH2A 3E2KA 4YOFA 3MSHA 3VMAA 4E6XA 3UPNA 5GL9A 3ICYA 1O07A 4Q0JA 1KE4A 1NLYA 2H5SA 2EXAA 1PI4A 4K08A 2AVXA 4OVDA 2WYXA 3DWKA 4OQ0A 3UNWA 4KZAA 3QNBA 4HJ6A 3TOIA 5HPFA 1X0OA 3IX3A 4QY6A 4GD8A 4BBTA 4KZ8A 1DJCA 3F1OA 4GZBA 2JKRI 2HP5A 1PI5A 2W3DA 4HESA 3V67A 4Q8IA 3DWZA 4GOGA 3LR0A 3A0VA 5FQ9A 4DKIA 4HI4A 2JCHA 4U3TA 5FQKA 5U47A 3KSGA 5F5YA 1SZVA 3O3VA 4N9LA 2Y2IA 1CI8A 3LR4A 3T1QB 3JVUA 1KVLA 4BBVA 5A93A 1HTZA 1W63Q 2JKRM 5HSQA 3AGEA 2DMWA 5HDDA 4HIAA 1XKZA 4ETZA 4QU3A 5A90A 2W3GA 4QD4A 3MKEA 2I72A 3PR6A 2VGJA 2ZD8A 1KDWA 1MWRA 5FQIA 5CHUA 3E4OA 4ARZB 5FAPA 4Y13A 4ZTKA 2HP6A 3HUNA 1W5DA 3R4KA 1K38A 4WMCA 3ZG0A 2X01A 2XLNA 3G4PA 4I3IA 4IUKA 4QWOA 4Y15A 2J3TC 3S7NA 5CXWA 4QY5A 1JVJA 1FOFA 3K3CA 3LUQA 4D60A 2WKIA 2QYBA 1TS8A 2W1TB 3MZEA 1YLPA 2WGIA 2J7VA 2V1BA 2A49A 1P0ZA 1AXBA 1YAXA 3C4OA 4XUXA 2XFSA 3UMEA 4BD1A 1Y28A 4I5SA 5FI6A 1H8MA 3EWKA 2HJ9C 1ESIA 2J8YA 4BMWA 2Q0OA 4WZ5C 4E3OA 2UV0E 2WK0A 3EOIA 2ZC4B 4JXSA 2A3UA 3IWQA 4GLQA 3HLBA 4IHQA 3VFFA 2Q9MA 2QJ5A 5EECA 3QP1A 3FZCA 5DFYA 2Z2LB 1W8QA 5GHXA 2W27A 4HP4A 1NXYA 3T1RA 1STZA 2V8CA 3IF6B 3V3SA 3EGXC 2PU2A 1ERQA 4OLDA 5BOHA 3MFXA 4CLCB 5TBMA 2XK1A 3R7WB 2K2NA 4BL2A 3VOZA 3D3OA 5M1AA 2H0YA 1A0KA 3QP8A 2XEPA 4HEFA 2PBDP 2Y59A 1TVFA 5FDHA 3PYPA 3ULFA 5KSHA 3BFFA 2IWDA 4XT2B 4BL3A 3ITBA 2HF6A 4NXEA 3O5YA 2WKHA 2B95A 2LB5A 3SZTA 4LV2A 5HPIA 4DXCA 4CPKA 4K91A 2V0WA 5FQJA 1LI9A 2J9PA 2Y55A 4KENB 3MKFA 1VB6A 5FDSA 1S4SA 3HJKA 1KDSA 5L09A 1BYWA 3O88A 4JXGA 3G30A 3S7QA 1VETB 2Y4AA 3BFCA 3Q07A 4MCWA 3TE8A 2ZOIA 3FKWA 5CTMA 4R3BA 3T1SA 4HBUA 3E98A 2WGWB 1DRMA 3OPRA 4KZ9A 3G2ZA 4E3MA 4ZBEA 4B4ZA 3LY4A 4PM7A 1D7EA 2HDUA 4DDYA 1IEMA 5G18A 5MC7A 3VSLA 5HWVA 4X6TA 3LIFA 5DF8A 4WUJA 3F1PB 1RP5A 3PHYA 4N1XA 2J3WA 2OLVA 1WYBA 3C30A 3NULA 2C6WB 4MBKA 4DE1A 3NOTC 2BG1A 4JGRA 1VEUA 3V50A 2EWVA 4P6ZM 3NCKA 4WELA 3BLSA 4H6JA 2EXBA 2HDRA 5HARA 2Y8HA 1IELA 4DDSA 4PM6A 4OKPA 4F3LA 3M2JA 2XA7S 3ZVTA 3BFDA 2ACGA 3MJQA 4PPRA 3DTEA 3Q7VA 4OQGA 4DRTA 5KMWA 4P85A 3ZNTA 1ODVA 1UWNX 2ZLYA 3BW6A 3G2YA 3FG8A 2ZBBA 3B42A 4HNBA 2V9AA 4NXGA 5CGSA 4MNRA 5EV0A 4CLCC 2XSSA 3QP6A 3GRJA 5C5KA 5J7EA 2M7UA 3IWOA 5HWTA 2QPNA 2Y2OA 3PAEA 1TS6A 4YNRA 3ZDJA 4YWZA 1DJBA 2W3FA 1NZUA 3LFVA 4YFMA 3ZG7B 4R70A 3NIAA 1L0GA 1OTIA 3FYZA 4K0XA 3S7OA 4WZ4A 3TG9A 5EVIA 3FPWA 1NY0A 3M6HA 3CITA 3N8SA 4JPMA 3WS5A 2P74A 3VE4A 3RXWA 2OAP1 4R0QA 1Y4OA 2HGVA 4QHCA 4RYEA 1LT0A 4E3KA 3DTKA 1PWGA 1PZOA 3JPUA 3CHWP 2P9VB 2VV6A 5KSCA 1E25A 2K31A 2VLGA 4BBUA 4QJGA 1BSGA 1GA9A 5FATA 2XA7M 4NG2A 4MMNA 4B4XA 4G3VA 5EFWA 4EUVA 2E8JA 3C7UA 4G3WA 1T1AA 4KQDA 4EW7A 3AGFA 4E3IA 2VGLM 3L7HA 3RXXA 2QJ7A 2OAQ1 4E3NA 3K2NA 2GZAA 1C3BA 3HUMA 4YINA 2J80A 3HLWA 4U0TA 4R3AA 3UMDA 5CX7A 3IHBA 3WWXA 4GCZA 4S2IA 5FASA 2O99A 4HOIA 1MC0A 2ZOHA 1Z09A 4NETA 3NOUC 5L07A 4GD6A 4KQRA 2PYRA 5FI2A 1BLSA 5CTNA 4X68A 2DRWA 3DTMA 1EWZA 4Y2FA 3TJZC 3FWLA 4PAUA 3VV4A 4EQ1A 4OP8A 4KZ4A 3N8RA 2FFFB 3MQOA 1SDEA 1SDNA 4KG5A 2Q9NA 1FCNA 1KE0A 1CQAA 2EX6A 1SKOB 4N92A 3ZCZA 3MZDA 3VP0A 1JWVA 1MWUA 3EQVA 3ITAA 4JXVA 4DXBA 2WGVA 2FFYA 4GS9B 4KZ3A 1M6KA 2VJWA 2EX9A 1BLPA 1TF1A 1WYCA 3S1YA 3UDIA 5DKLA 3H7WB 4DF6A 1NRFA 1IKIA 1XJ4A 3LGOA 2QWSA 1OTBA 5CRFA 3MF0A 5F68A 1XX2A 1T1CA 1LSWA 3OLOA 2RCXA 2JE5A 4GDNA 1CF0A 4HQAA 3UB7A 4MBHA 3DBAA 3OZHA 5IHVA 4BQMA 5GLDA 4OOLA 1MY8A 1GHIA 1ERMA 2XF3A 1JTGA 1OJGA 5IS1A 3F1OB 4F94A 2X02A 1PWCA 2VGKA 5FI7A 3QP4A 5DVAA 2QKPA
chains in the Genus database with same CATH topology
2XROA 4LLOB 3K3DA 3ZQ5A 3A0RA 4BMWA 3KSHA 1MKMA 3HCYA 3FC7A 3EOIA 2WKPA 4L9GA 5TJJA 4I38A 4MN6A 4GLQA 5F69A 3LIEA 1UGUA 4Q0IA 4IHQA 2MJ6A 4I3JA 2QJ5A 4CLCE 5DFYA 1S4RA 4GJ4A 3ZYTA 3JVVA 4HJ4A 2W27A 4HP4A 1S1ZA 4LRYC 1P97A 4CQHA 3KYQA 3TW8A 3LIAA 1STZA 3RTYA 2D02A 3F1PA 2INWA 3CWFA 3UE6A 2HJEA 4KUKA 3C38A 3EGXC 2PDRA 2G7UA 2PT7A 3LR5A 3MFXA 2B18A 4CLCB 5TBMA 4WEKA 2K2NA 3R7WB 1T19A 3LIDA 3NJAA 3D3OA 1P9WA 3KO6A 3MMHA 2JN7A 1G6OA 1WA9A 3MQQA 2HV1A 3PBSA 3NOPC 2OOLA 5AVFA 1F9IA 3P01A 3PYPA 3KSIA 2IA2A 4ZRRA 3IS2A 3ULFA 5KSHA 1OTEA 4XT2B 2HF6A 4NXEA 3O5YA 1OTDA 5DJUA 3LYXA 1P9RA 1GSXA 3U2AA 2LB5A 1F98A 2YKHA 3LI9A 2FH5A 4UQIS 4R6LA 4HHDA 5HPIA 1OPXA 3E4QA 2V0WA 5I5LA 5AJGA 2JKTI 5HDCA 2R78A 1VB6A 2FZ0A 3BY9A 4O8GA 2GJ3A 3LICA 2JHEA 2LB9A 1S4SA 3T4KA 3HJKA 1BYWA 2L1MA 3NHQA 1LSXA 3S7QA 3TE8A 2V0UA 4MCWA 3H82A 2ZOIA 2VA0A 3MR0A 4UEYA 3BY8A 4PKYG 3T4JA 3E98A 3EEAA 4ETXA 1DRMA 4IJGA 5K5BA 4AFIA 3PBOA 2PD7A 3GECA 2VEAA 2P08A 4L0LA 4HJ3A 1LSVA 3PBRA 2Z6CA 4JGQA 2JKTM 2WKQA 1D7EA 3T4QA 4EEUA 4WLAA 5MC7A 3MQ0A 4MDZA 4WL9A 5HWVA 5HDSA 2QHKA 1H3QA 3PXPA 5DFXA 3LIFA 4WUJA 3W2ZA 3CLOA 2O9AA 3OCNA 3F1PB 4Z1WA 3KYZA 3PHYA 2J3WA 3C30A 4II7A 3OBFA 4DJ3A 4LPZA 3NOTC 4IUHA 3CUEC 4JGRA 2EWVA 4P6ZM 4HY8A 2W1TA 4EEPA 4WELA 4EU0A 1D06A 1V9YA 1NRJA 1OJ5A 2I9VA 4H6JA 2W3EA 2O9CA 4GHIB 1DP6A 2Y8HA 2M7VA 3B33A 4I3AA 2PYPA 4F3LA 2XA7S 2K7SA 3IBJA 3IS2B 2WKRA 3MJQA 4UQIM 5HD5A 5G4ZA 2CMNA 3CI6A 5FL3A 1EW0A 2YKFA 4O01A 3VE3A 2GX5A 1DP9A 4EERA 3G6OA 4WEJA 2NUTC 4P6ZS 1ZTUA 4KQOA 1G28A 1XFNA 4MN5A 1GSWA 1ODVA 1UWNX 2P04A 3BW6A 3C2WA 3FG8A 2ZBBA 3RFBA 3B42A 4HP9A 4HNBA 2V9AA 4NXGA 3S7PA 1OTAA 1ZHHB 2PHYA 1NWZA 4JGOA 3EQUA 1UWPX 4CLCC 1N9LA 4FOFA 4DN0A 2XSSA 3H82B 5C5KA 4OOMA 5J7EA 2M7UA 5LBRA 5HWTA 4BWIA 1XFQA 3T4LA 4DJ2A 4GW9A 5G4YA 1TS6A 4YNRA 5KIZA 4YWZA 2W3FA 2A2LA 4M4XA 2ZMFA 3LFVA 4R70A 3H9WA 3IBRA 1OTIA 4EETB 3PBNA 3P7NA 1XJ3A 1TD5A 3KX0X 3S7OA 5IT5A 1N9OA 1XJ2A 3A0SA 4DMZA 1JNUA 3EGDC 5J3WA 5DKKA 3OOVA 3FPWA 1OT6A 3CITA 2PR6A 1IFQA 4GS9A 5A8BA 3VE4A 3F1NA 1YSPA 2OAP1 5J4EA 4PKYA 1S66L 2EWWA 2NUPC 1TS7A 3BWLA 2L0WA 2HGVA 1OT9A 1LT0A 4JGPA 4B93A 1V9ZA 2O0YA 4ARZA 4KUOA 3SW1A 1NLZA 4FSFA 3H7WA 4QPRA 3EEHA 4NXBA 2J3TD 2VX8A 1VHMA 2VV6A 2VZWA 5F6AA 4H6JB 2K31A 3T50A 2VLGA 4BBUA 1S67L 1DP8A 4L9FA 2XA7M 4MMNA 4HH2A 5L8MA 1XJ6A 4YOFA 4G3VA 5EFWA 2EA9A 2KOIA 4EUVA 2A24A 4G3WA 4KQDA 1T1AA 4F3LB 4EW7A 3BQ8A 1YKDA 3ICYA 4WF0A 2H28A 3PBQA 2VGLM 5TBMB 4Q0JA 2O9BA 1NLYA 3GDIA 2QJ7A 4Q0HA 2PR5A 2OAQ1 4Y3IA 4K08A 3K2NA 2GZAA 2VKSA 4ME4A 4BJPA 3KSFA 2PD8A 3UE3A 2J80A 2M1CA 3T4SA 4R3AA 3UMDA 4HJ6A 5CX7A 4EESA 5HPFA 1X0OA 2W3HA 3LIBA 4EXOA 3CUEA 1MZUA 4GCZA 4BBTA 4I39A 2O99A 4HOIA 1MC0A 2ZOHA 3F1OA 4G3KA 3NOUC 4O0PA 1S1YA 3UB6A 2GNXA 2PYRA 4B9OA 5HZHA 3T4OA 5AVEA 2JKRI 3RH8B 2W3DA 3V67A 4E04A 2VGLS 2W0NA 3BJNA 4Y2FA 3TJZC 3LR0A 1LL8A 3A0VA 4NKPA 4HI4A 4PAUA 1TS0A 1T18A 3VV4A 4EQ1A 3MQOA 2ZMVA 1T1BA 3HJIA 3MXQA 3KSGA 5F5YA 4WN5A 2KX6A 4L9EA 5HD3A 2VV8A 2L4RA 3LR4A 4RQ9A 3JVUA 4BBVA 2VV7A 5HWWA 2BASA 3C8CA 1W63Q 5DF9A 2JKRM 5HSQA 5IU1A 3EQVA 3TRCA 4GHIA 2V1AA 2DMWA 5HDDA 4HIAA 3B47A 4ETZA 3UB9A 4GS9B 3F1NB 2KDKA 2W3GA 3UB8A 3OC2A 1KOUA 2VJWA 3PR6A 5HL6A 5DJTA 4CLCA 1TF1A 1N9NA 1F5MA 3LI8A 3R7WA 5DKLA 3PBTA 1YSQA 3E4OA 4ARZB 2KLIA 3H7WB 2Z6DA 3CAXA 4CLCD 1XJ4A 2QWSA 1OTBA 4Y5FA 2W1RA 3MF0A 3R4KA 3OCLA 5F68A 3FPVA 4I3IA 4IUKA 1T1CA 1LSWA 2A24B 3OLOA 2OWHA 4XT2A 3S7NA 2J3TC 2XRNA 1GSVA 3E4PA 3K3CA 3LUQA 2QYBA 2P7JA 2B02A 1W63M 1TS8A 4HQAA 2W1TB 3UB7A 3DBAA 4MN7A 2V1BA 2Y79A 4OOLA 1P0ZA 2OWJA 1YAXA 3LR3A 3UMEA 4PHTA 3BQAA 2D01A 4R38A 4NEED 1OJGA 5IS1A 1Y28A 3F1OB 4I5SA 4HH3A 1IOUA 3T4TA 3EWKA 1H8MA 2HJ9C 3E0YA 3VOLA 3D72A 4LRZE 4LRXC 2QKPA 4NXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LLO B;  3K3D A;  3ZQ5 A;  3A0R A;  3FC7 A;  2WKP A;  4L9G A;  4I38 A;  4MN6 A;  5F69 A;  3LIE A;  1UGU A;  4I3J A;  2QJ5 A;  1S4R A;  4HJ4 A;  2W27 A;  4HP4 A;  1S1Z A;  4LRY C;  1P97 A;  3LIA A;  3RTY A;  2D02 A;  3F1P A;  2INW A;  3CWF A;  3UE6 A;  4KUK A;  2PDR A;  3MFX A;  5TBM A;  1T19 A;  3LID A;  3NJA A;  2JN7 A;  1WA9 A;  3MQQ A;  2HV1 A;  3NOP C;  2OOL A;  5AVF A;  1F9I A;  3PYP A;  3IS2 A;  3ULF A;  1OTE A;  4XT2 B;  4NXE A;  1OTD A;  5DJU A;  3LYX A;  1GSX A;  3LI9 A;  1F98 A;  2YKH A;  4R6L A;  4HHD A;  3E4Q A;  2V0W A;  5I5L A;  5HDC A;  2R78 A;  1VB6 A;  3BY9 A;  2GJ3 A;  3LIC A;  2JHE A;  1S4S A;  3HJK A;  1BYW A;  2L1M A;  3NHQ A;  1LSX A;  2V0U A;  3H82 A;  2ZOI A;  3MR0 A;  3BY8 A;  4PKY G;  1DRM A;  2PD7 A;  3GEC A;  2VEA A;  4HJ3 A;  1LSV A;  2Z6C A;  4JGQ A;  2WKQ A;  1D7E A;  4EEU A;  4WLA A;  4WL9 A;  5HWV A;  5HDS A;  2QHK A;  3LIF A;  4WUJ A;  3CLO A;  3F1P B;  3PHY A;  4DJ3 A;  4LPZ A;  3NOT C;  4JGR A;  4HY8 A;  4EEP A;  1D06 A;  1V9Y A;  1OJ5 A;  2I9V A;  4H6J A;  4GHI B;  1DP6 A;  3B33 A;  4I3A A;  2PYP A;  4F3L A;  2K7S A;  3IS2 B;  2WKR A;  3MJQ A;  5HD5 A;  5G4Z A;  2CMN A;  1EW0 A;  2YKF A;  3VE3 A;  1DP9 A;  4EER A;  3G6O A;  1G28 A;  1XFN A;  4MN5 A;  1GSW A;  1ODV A;  1UWN X;  3C2W A;  3FG8 A;  2ZBB A;  4HP9 A;  4HNB A;  2V9A A;  4NXG A;  1OTA A;  2PHY A;  1NWZ A;  4JGO A;  1UWP X;  1N9L A;  3H82 B;  5J7E A;  5HWT A;  1XFQ A;  4DJ2 A;  4GW9 A;  5G4Y A;  1TS6 A;  5KIZ A;  4YWZ A;  4M4X A;  4R70 A;  3H9W A;  3IBR A;  1OTI A;  4EET B;  3P7N A;  1XJ3 A;  3KX0 X;  1N9O A;  1XJ2 A;  3A0S A;  1JNU A;  5J3W A;  5DKK A;  1OT6 A;  2PR6 A;  4GS9 A;  5A8B A;  3VE4 A;  3F1N A;  5J4E A;  4PKY A;  1S66 L;  1TS7 A;  3BWL A;  2L0W A;  1OT9 A;  1LT0 A;  4JGP A;  1V9Z A;  4KUO A;  3SW1 A;  3H7W A;  3EEH A;  4NXB A;  2VV6 A;  5F6A A;  4H6J B;  3T50 A;  2VLG A;  4BBU A;  1S67 L;  1DP8 A;  4L9F A;  4HH2 A;  1XJ6 A;  5EFW A;  2EA9 A;  2A24 A;  4KQD A;  4F3L B;  1T1A A;  4EW7 A;  3ICY A;  4WF0 A;  2H28 A;  5TBM B;  3GDI A;  2QJ7 A;  2PR5 A;  4K08 A;  2PD8 A;  2J80 A;  2M1C A;  4R3A A;  3UMD A;  4HJ6 A;  4EES A;  1X0O A;  3LIB A;  4EXO A;  1MZU A;  4GCZ A;  4BBT A;  4I39 A;  4HOI A;  2ZOH A;  3F1O A;  3NOU C;  1S1Y A;  3UB6 A;  2PYR A;  4B9O A;  5HZH A;  5AVE A;  3RH8 B;  4E04 A;  2W0N A;  1LL8 A;  3A0V A;  4HI4 A;  1TS0 A;  1T18 A;  4EQ1 A;  3MQO A;  1T1B A;  3HJI A;  3MXQ A;  5F5Y A;  4WN5 A;  2KX6 A;  4L9E A;  5HD3 A;  2VV8 A;  2L4R A;  4RQ9 A;  4BBV A;  2VV7 A;  5HWW A;  2BAS A;  3C8C A;  5HSQ A;  5IU1 A;  4GHI A;  2V1A A;  5HDD A;  4HIA A;  3UB9 A;  4GS9 B;  3F1N B;  2KDK A;  3UB8 A;  1KOU A;  5DJT A;  1N9N A;  3LI8 A;  5DKL A;  3E4O A;  3H7W B;  2Z6D A;  3CAX A;  1XJ4 A;  2QWS A;  1OTB A;  5F68 A;  4I3I A;  1T1C A;  1LSW A;  2A24 B;  3OLO A;  2OWH A;  4XT2 A;  1GSV A;  3E4P A;  3K3C A;  3LUQ A;  2P7J A;  2B02 A;  1TS8 A;  4HQA A;  3UB7 A;  2V1B A;  1P0Z A;  2OWJ A;  3UME A;  2D01 A;  4R38 A;  1OJG A;  5IS1 A;  1Y28 A;  3F1O B;  4I5S A;  4HH3 A;  3EWK A;  3VOL A;  3D72 A;  4LRZ E;  4LRX C;  2QKP A;  4NXF A; 
#chains in the Genus database with same CATH topology
 2XRO A;  3CJM A;  4LLO B;  3K3D A;  1K57 C;  3ZQ5 A;  3KSH A;  4A5R A;  3N4I A;  5FAO A;  4KZ6 A;  5TGF A;  3IX4 A;  4P6B A;  5JYP A;  1PIO A;  4PM8 A;  4ESP A;  1UGU A;  4Q0I A;  3SH7 A;  4S2P A;  1SKF A;  4K0W A;  4B88 A;  3ZYT A;  3JVV A;  1IYO A;  1S1Z A;  1P97 A;  3KYQ A;  3TW8 A;  3VP1 A;  2D02 A;  2HZ5 A;  3UE6 A;  4R4S A;  1LI0 A;  2V8F A;  2WUQ A;  1XP4 A;  2G7U A;  2PT7 A;  2B18 A;  2HDQ A;  3PAG A;  4LRX C;  4WEK A;  1T19 A;  1K6R A;  5EUA A;  3NOP C;  3ZG5 A;  5AVF A;  2BTF P;  5A92 A;  1PZP A;  4EBN A;  4ZRR A;  1ES4 A;  3IS2 A;  1OTE A;  1PRQ A;  1YQS A;  3RJU A;  4LGW A;  5DJU A;  3LYX A;  1GSX A;  1MKI A;  1F98 A;  2YKH A;  4HHD A;  5CGX A;  2ZC3 B;  1K55 A;  3VP3 A;  1K4F A;  1BLC A;  3Q81 A;  2JKT I;  4LV1 A;  5HDC A;  1L0D A;  1RGY A;  2G2W A;  3NC8 A;  2OLU A;  4O8G A;  2JHE A;  4CJN A;  4GDB A;  1K56 A;  4WMC D;  3E2L A;  3NHQ A;  1LSX A;  3V5M A;  4P0M A;  3H82 A;  4UEY A;  3EEA A;  4IJG A;  1BUL A;  1F2K A;  1KGG A;  2VEA A;  4JGQ A;  2JKT M;  3LEQ A;  3T4Q A;  4HBT A;  2IWC A;  4WLA A;  5HDS A;  5EPH A;  1K54 A;  1ONH A;  3W2Z A;  4R3J A;  5F1G A;  4E3L A;  4Z1W A;  3KYZ A;  4OPQ A;  3QNC A;  4IBR A;  1ES5 A;  4LPZ A;  3ZHH A;  5GLC A;  1OME A;  2EFX A;  1ZKJ A;  4HY8 A;  4JF6 A;  2W1T A;  4EEP A;  4RA7 A;  2O9C A;  1JTD A;  1FCM A;  4GHI B;  4JF4 A;  2BLS A;  4Y0U A;  2M7V A;  3O86 A;  2XD1 A;  3VP2 A;  3BEB A;  4I3A A;  2PYP A;  2K7S A;  3AGD A;  5FA7 A;  3IBJ A;  1H8Y A;  4S2J A;  4S2M A;  2IWB A;  3VFH A;  5CEC A;  5FL3 A;  2YKF A;  4O01 A;  3WS0 A;  3VE3 A;  5L10 A;  3UE1 A;  3FV7 A;  1DP9 A;  2J9O A;  3ZGA B;  1RCJ A;  4WEJ A;  2NUT C;  4P6Z S;  1G28 A;  3IF5 A;  5D3O A;  1GSW A;  3BM6 A;  2P04 A;  3M2K A;  3WS1 A;  2XFT A;  3IWI A;  1BT5 A;  1ZHH B;  2PHY A;  1UWP X;  4FUW A;  2H10 A;  1XPB A;  4WYY A;  1JWP A;  1IYP A;  4DJ2 A;  2WZZ A;  5AQ9 A;  2RL3 A;  1VQQ A;  5DTS A;  3T1X A;  4FCF A;  2A2L A;  4RX2 A;  1JWZ A;  1LL5 A;  1YM1 A;  1CK3 A;  1ACF A;  5E2E A;  4UA6 A;  3P7N A;  1TD5 A;  1E4D A;  3WRZ A;  1JNU A;  2ZL1 A;  1TEM A;  3PTE A;  3UPO A;  3F1N A;  4UAA A;  4FD8 A;  4PKY A;  4WBG A;  3BWL A;  2L0W A;  3WS4 A;  5FEF A;  1OT9 A;  4B93 A;  2Y2L A;  3A3I A;  1VEU B;  2XH9 A;  2ZC6 B;  4NXB A;  1FSW A;  4H6J B;  2ZM2 A;  1HD8 A;  1S67 L;  2Y2H A;  5EOE A;  1XJ6 A;  4OQI A;  2EA9 A;  2KOI A;  3G31 A;  2ZQ7 A;  2A24 A;  4F3L B;  3GR2 A;  3ZVW A;  1YKD A;  4WF0 A;  3GSG A;  4C75 A;  2ZQC A;  2JC7 A;  2O9B A;  3GDI A;  1E3U A;  2PR5 A;  5JYO A;  3Q1F A;  1GA0 A;  4BJP A;  4KZ7 A;  2PD8 A;  3UE3 A;  1HLU P;  2M1C A;  2Y2P A;  1XGJ A;  3OPP A;  3T4S A;  5KZH A;  4EES A;  2W3H A;  3LIB A;  2JKF A;  3CUE A;  3UN7 A;  4I39 A;  4WM9 A;  3A3D A;  5GLB A;  1PW1 A;  3UB6 A;  3W4O A;  3C4P A;  5HZH A;  3T4O A;  5AVE A;  1AWI A;  2XGN A;  3RH8 B;  4JF5 A;  5F1F A;  4XXR A;  1CEF A;  2VGL S;  3IH8 A;  5E43 A;  1LL8 A;  3MZF A;  4NKP A;  1IYQ A;  1T18 A;  4IBX A;  3MXQ A;  3BLM A;  2KX6 A;  3CPT A;  2VV8 A;  4RQ9 A;  4LCM A;  1L2S A;  2ZM8 A;  3A3E A;  1KVM A;  3IXD A;  2ZC5 B;  5DF9 A;  5IU1 A;  5GLA A;  3TRC A;  5AQ7 A;  1NYY A;  3LY3 A;  2V1A A;  5EVI B;  3B47 A;  3N6I A;  3UB9 A;  2KDK A;  4BD0 A;  4NK3 A;  3ZG9 B;  1ZC2 A;  3A3F A;  3BFE A;  4LCL A;  5DJT A;  5HL6 A;  1M40 A;  1N9N A;  1F5M A;  3LI8 A;  5EVE A;  3B3X A;  1YSQ A;  4RVA A;  1YMS A;  1I5Q A;  2Z6D A;  3GVB A;  4GN2 A;  1FIL A;  4Y5F A;  4KG2 A;  4S2N A;  3O87 A;  2JBF A;  2ZQA A;  3BYD A;  4OLG A;  3FPV A;  1YT4 A;  4U0X A;  1BZA A;  5EVI D;  4PM5 A;  4N1H A;  1K4E A;  2B02 A;  2PAV P;  1W63 M;  1IYS A;  3HVF A;  5TR7 A;  2Y79 A;  3VP4 A;  3SS4 A;  1YPR A;  4X1L A;  3LR3 A;  3BQA A;  5EM0 A;  2D01 A;  4R38 A;  4HH3 A;  1IOU A;  5E2H A;  1G5U A;  4Y0O A;  3IQA A;  4Z9Q A;  3MS6 A;  4NXF A;  3GMW A;  1MKM A;  3VOY A;  1H5X A;  3HCY A;  3HUO A;  2WKP A;  2ZC7 A;  4L9G A;  5TJJ A;  1PFL A;  4I38 A;  2OSU A;  3IXH A;  5E2F A;  2ZQ9 A;  3LIE A;  1TDG A;  2MJ6 A;  4I3J A;  3ISG A;  4CLC E;  4FH4 A;  2DNS A;  3I7J A;  3MXS A;  3G32 A;  4HJ4 A;  2P9V A;  1ZG4 A;  4LRY C;  3CZD A;  5CED A;  1MPL A;  3RTY A;  2INW A;  2Y2N A;  2Y2M A;  3CWF A;  3ZG8 B;  1YLJ A;  4Y0T A;  5HAI A;  4KUK A;  2PDR A;  4EBL A;  1RGZ A;  2EX8 A;  3HBR A;  3UO9 A;  3LID A;  4UA7 A;  5HX9 A;  4R1G A;  3NJA A;  4MLL A;  5DTT A;  4E6W A;  3BEC A;  2JN7 A;  1WA9 A;  3PBS A;  2WAF A;  3IXB A;  2OOL A;  1LLB A;  1F9I A;  3KSI A;  3HRE A;  5EE8 A;  1OTD A;  3UDX A;  1P9R A;  2FH5 A;  2E8I A;  4UQI S;  4PM9 A;  1DY6 A;  3HLC A;  3E4Q A;  5I5L A;  2QZ6 A;  5AJG A;  3SH9 A;  5F82 A;  5EVI C;  4KZ5 A;  3BY9 A;  4KZB A;  1BUE A;  2L1M A;  3WS2 A;  2ZQD A;  2V0U A;  2VA0 A;  5TFQ A;  1H0M A;  3BY8 A;  4PKY G;  1YLW A;  4ETX A;  4X25 A;  3OPL A;  3G34 A;  4AFI A;  3PBO A;  2PRF A;  1QMF A;  1SCW A;  4DE0 A;  1MWS A;  4C3Q A;  3MQ0 A;  3QP2 A;  4MDZ A;  4WL9 A;  5EM1 A;  1YMX A;  4IVI A;  1H3Q A;  4GB7 A;  3OCN A;  4OOY A;  5M19 A;  2HP9 A;  1HZO A;  5EVL A;  2CC1 A;  3OBF A;  4II7 A;  4DJ3 A;  4IVK A;  4IUH A;  3QHY A;  3HLD A;  4JBF A;  3VSK A;  3CMZ A;  4EU0 A;  3ZFZ A;  1D06 A;  1OJ5 A;  4WZ5 A;  2W3E A;  2Y2K A;  4OQH A;  3ZNY A;  3B33 A;  3IHA A;  4OPY A;  5FSR A;  3JYI A;  1K25 A;  3IS2 B;  5FAQ A;  4UQI M;  5G4Z A;  2Y2Q A;  2CMN A;  5EOO A;  3SS3 A;  1QME A;  1PNE A;  4XUZ A;  1G6A A;  3UB5 P;  4ZJ2 A;  1ZTU A;  1XFN A;  3C2W A;  3RFB A;  1DJA A;  1OTA A;  4EV4 A;  4OP5 A;  1NWZ A;  4JGO A;  3EQU A;  5FEG A;  2HPB A;  1U60 A;  3H82 B;  3W4Q A;  1FQG A;  4OOM A;  1EI5 A;  5LBR A;  4BWI A;  1XFQ A;  2V1Z A;  3NDE A;  1MXO A;  3GV9 A;  5G4Y A;  1W79 A;  1FSY A;  4EUZ A;  1LHY A;  5KIZ A;  1NJ4 A;  3Q7Z A;  4M4X A;  5DF7 A;  4DE3 A;  1ALQ A;  5HFO A;  3W4P A;  4UHU A;  2DCF A;  2B5R A;  3PBN A;  4EET B;  5AQB A;  3KX0 X;  5IT5 A;  4LV0 A;  3EGD C;  5J3W A;  1W7F A;  3OOV A;  1OT6 A;  1K56 D;  1IFQ A;  5A8B A;  3DTI A;  4LEN A;  1YSP A;  5J4E A;  1S66 L;  1YLT A;  2UWX A;  2ZM0 A;  4JGP A;  1FR1 A;  3P98 A;  4JLF A;  4ARZ A;  3SW1 A;  1NLZ A;  3L9K A;  3IH9 A;  4QPR A;  3A3J A;  1PWD A;  3EEH A;  2VX8 A;  1ERO A;  4Y17 A;  1S6R A;  4S2K A;  1L0F A;  5F6A A;  1I2S A;  3T50 A;  2H0T A;  1DP8 A;  3C5A A;  3D4F A;  4H8R A;  1NZO A;  5CGW A;  5L8M A;  3MBZ A;  4X56 A;  3BQ8 A;  2H28 A;  3PBQ A;  5TBM B;  5GHZ A;  4Q0H A;  4ZAM A;  4Y3I A;  2C5W B;  2VKS A;  1KGE A;  1IKG A;  4ME4 A;  3KSF A;  1TDL A;  4QB8 A;  1ES2 A;  4EXO A;  1MZU A;  2R9X A;  3N7W A;  4G3K A;  4O0P A;  1S1Y A;  2WAE A;  1K6S A;  5FQM A;  2GNX A;  4B9O A;  3NEC A;  1L0E A;  4E04 A;  2W0N A;  3BJN A;  5AQA A;  2V2F F;  4OH0 A;  1TS0 A;  2VK3 A;  4EBP A;  3IXG A;  1GCE A;  2ZMV A;  1T1B A;  3LEZ A;  3HJI A;  4WN5 A;  4Y7P A;  2Z2M B;  4L9E A;  5HD3 A;  2L4R A;  2VV7 A;  4MEZ A;  4N9K A;  5HWW A;  2BAS A;  3C8C A;  2ZL1 B;  4GHI A;  1L3L A;  3IF6 A;  4ZJ1 A;  2X71 A;  5J8X A;  3F1N B;  3GTC A;  3UB8 A;  3OC2 A;  1KOU A;  1K55 C;  4CLC A;  1BLH A;  3R7W A;  1S0W A;  3PBT A;  2KLI A;  1FCO A;  3CAX A;  4CLC D;  4C6Y A;  2XD5 A;  4KQQ A;  4MBF A;  1YLY A;  4ZJ3 A;  1ONG A;  2W1R A;  3OCL A;  4P87 A;  5FQQ A;  3IX8 A;  1I2W A;  3Q82 A;  1G68 A;  2A24 B;  4LV3 A;  2OWH A;  3CG5 A;  4XT2 A;  1XA7 A;  3C7V A;  1WE4 A;  2XRN A;  2JKG A;  1GSV A;  3T12 B;  2GDN A;  3E4P A;  3SOI A;  4KG6 A;  2P7J A;  4MN7 A;  5I94 A;  4ID4 A;  2OWJ A;  1GHM A;  3MXR A;  1K54 C;  4PHT A;  4EQI A;  4NEE D;  3S4X A;  5HW3 A;  3DW0 A;  5GHY A;  3T4T A;  3E0Y A;  1VET A;  3VOL A;  3D72 A;  4PMA A;  4LRZ E;  1XGI A;  5HAQ A;  4DE2 A;  2EFU A;  3Q7V B;  3WRT A;  2WGW A;  3A0R A;  4OPR A;  3FC7 A;  1E3U D;  3HLF A;  3HLE A;  3HLG A;  4MN6 A;  4BLM A;  5F69 A;  1N4O A;  4BEN A;  4R4R A;  3FKV A;  4O7D A;  3CPT B;  1S4R A;  4GJ4 A;  3S22 A;  4X69 A;  4CQH A;  2R9W A;  3MFD A;  5E2G A;  3LIA A;  3F1P A;  2V20 A;  3LO7 A;  2HJE A;  3C38 A;  1LL9 A;  3LR5 A;  2Y2J A;  3TSG A;  3UY6 A;  2WAD A;  1P9W A;  3KO6 A;  3MMH A;  1G6O A;  3MQQ A;  1VM1 A;  1HVB A;  2HV1 A;  3N8L A;  3UPP A;  3P01 A;  3IF6 C;  3M6B A;  2IA2 A;  5A91 A;  3NDG A;  3U2A A;  4X55 A;  3LI9 A;  4R6L A;  1KGF A;  1OPX A;  2Y91 A;  2ZMA A;  2WZX A;  1J9M A;  2R78 A;  2FZ0 A;  1O7E A;  2GJ3 A;  1PYY A;  3LIC A;  1XA1 A;  3W8K A;  2LB9 A;  3T4K A;  4EWF A;  5HL1 A;  3BFG A;  3P09 A;  3V39 A;  3BRM A;  3IT9 A;  3MR0 A;  4JXW A;  1PW8 A;  4LFU A;  3T4J A;  5CEB A;  5K5B A;  3LCE A;  4GNU A;  5F83 A;  2PD7 A;  4FH2 A;  3GEC A;  2P08 A;  1ES3 A;  4L0L A;  4HJ3 A;  1LSV A;  3PBR A;  2Z6C A;  1KE3 A;  2WKQ A;  2XDM A;  4OPZ A;  4E3J A;  1BTL A;  1XXM A;  1YLZ A;  4EEU A;  4IED A;  2OV5 A;  2QHK A;  3PXP A;  5DFX A;  3NI9 A;  4M3K A;  3CLO A;  2O9A A;  5M18 A;  1N9B A;  1CEG A;  4X1M A;  2ZQ8 A;  3CUE C;  3V3R A;  1SHV A;  1K57 A;  1Q2P A;  2ZJ9 A;  3SS5 A;  3UDF A;  1V9Y A;  1NRJ A;  2I9V A;  2QMI A;  1ZG6 A;  1W8Y A;  4S2L A;  3G35 A;  1DP6 A;  4JKT A;  1H8Z A;  1CI9 A;  2WKR A;  5HD5 A;  2XQZ A;  1GHP A;  3CI6 A;  1EW0 A;  5L2F A;  2PU4 A;  1FIK A;  2G2U A;  2GX5 A;  4EER A;  1K0K A;  3G6O A;  4KQO A;  4MN5 A;  2HDS A;  4S2O A;  2PBY A;  3GQZ A;  2Y2G A;  4HP9 A;  1MWT A;  4FTX A;  3S7P A;  5CHM A;  1N9L A;  4FOF A;  4ZDX A;  4DN0 A;  1Q2Q A;  1FR6 A;  3T4L A;  2XR0 A;  4GW9 A;  3HL9 A;  2EX2 A;  4S2N C;  3KYE A;  2ZMF A;  4RX3 A;  3H9W A;  3IBR A;  3QP5 A;  3U4L P;  3UE0 A;  3DAV A;  3OPH A;  5CER A;  1SKO A;  4OON A;  1XJ3 A;  2WKE A;  1N9O A;  1XJ2 A;  3A0S A;  4DMZ A;  4D2O A;  4R23 A;  1NYM A;  5DTK A;  5DKK A;  2PR6 A;  4GS9 A;  2EWW A;  1Z6F A;  1TS7 A;  2NUP C;  1ESU A;  4GKU A;  1V9Z A;  2O0Y A;  4UA9 A;  1Y54 A;  3D9Y A;  4KUO A;  4FSF A;  3H7W A;  1MBL A;  4X53 A;  2J3T D;  1VHM A;  1CJF A;  3NBL A;  2VZW A;  5CHJ A;  1D1J A;  3SH8 A;  4L9F A;  3NY4 A;  5HAP A;  1J3W A;  4HH2 A;  3E2K A;  4YOF A;  3MSH A;  3VMA A;  4E6X A;  3UPN A;  5GL9 A;  3ICY A;  1O07 A;  4Q0J A;  1KE4 A;  1NLY A;  2H5S A;  2EXA A;  1PI4 A;  4K08 A;  2AVX A;  4OVD A;  2WYX A;  3DWK A;  4OQ0 A;  3UNW A;  4KZA A;  3QNB A;  4HJ6 A;  3TOI A;  5HPF A;  1X0O A;  3IX3 A;  4QY6 A;  4GD8 A;  4BBT A;  4KZ8 A;  1DJC A;  3F1O A;  4GZB A;  2JKR I;  2HP5 A;  1PI5 A;  2W3D A;  4HES A;  3V67 A;  4Q8I A;  3DWZ A;  4GOG A;  3LR0 A;  3A0V A;  5FQ9 A;  4DKI A;  4HI4 A;  2JCH A;  4U3T A;  5FQK A;  5U47 A;  3KSG A;  5F5Y A;  1SZV A;  3O3V A;  4N9L A;  2Y2I A;  1CI8 A;  3LR4 A;  3T1Q B;  3JVU A;  1KVL A;  4BBV A;  5A93 A;  1HTZ A;  1W63 Q;  2JKR M;  5HSQ A;  3AGE A;  2DMW A;  5HDD A;  4HIA A;  1XKZ A;  4ETZ A;  4QU3 A;  5A90 A;  2W3G A;  4QD4 A;  3MKE A;  2I72 A;  3PR6 A;  2VGJ A;  2ZD8 A;  1KDW A;  1MWR A;  5FQI A;  5CHU A;  3E4O A;  4ARZ B;  5FAP A;  4Y13 A;  4ZTK A;  2HP6 A;  3HUN A;  1W5D A;  3R4K A;  1K38 A;  4WMC A;  3ZG0 A;  2X01 A;  2XLN A;  3G4P A;  4I3I A;  4IUK A;  4QWO A;  4Y15 A;  2J3T C;  3S7N A;  5CXW A;  4QY5 A;  1JVJ A;  1FOF A;  3K3C A;  3LUQ A;  4D60 A;  2WKI A;  2QYB A;  1TS8 A;  2W1T B;  3MZE A;  1YLP A;  2WGI A;  2J7V A;  2V1B A;  2A49 A;  1P0Z A;  1AXB A;  1YAX A;  3C4O A;  4XUX A;  2XFS A;  3UME A;  4BD1 A;  1Y28 A;  4I5S A;  5FI6 A;  1H8M A;  3EWK A;  2HJ9 C;  1ESI A;  2J8Y A;  4BMW A;  2Q0O A;  4WZ5 C;  4E3O A;  2UV0 E;  2WK0 A;  3EOI A;  2ZC4 B;  4JXS A;  2A3U A;  3IWQ A;  4GLQ A;  3HLB A;  4IHQ A;  3VFF A;  2Q9M A;  2QJ5 A;  5EEC A;  3QP1 A;  3FZC A;  5DFY A;  2Z2L B;  1W8Q A;  5GHX A;  2W27 A;  4HP4 A;  1NXY A;  3T1R A;  1STZ A;  2V8C A;  3IF6 B;  3V3S A;  3EGX C;  2PU2 A;  1ERQ A;  4OLD A;  5BOH A;  3MFX A;  4CLC B;  5TBM A;  2XK1 A;  3R7W B;  2K2N A;  4BL2 A;  3VOZ A;  3D3O A;  5M1A A;  2H0Y A;  1A0K A;  3QP8 A;  2XEP A;  4HEF A;  2PBD P;  2Y59 A;  1TVF A;  5FDH A;  3PYP A;  3ULF A;  5KSH A;  3BFF A;  2IWD A;  4XT2 B;  4BL3 A;  3ITB A;  2HF6 A;  4NXE A;  3O5Y A;  2WKH A;  2B95 A;  2LB5 A;  3SZT A;  4LV2 A;  5HPI A;  4DXC A;  4CPK A;  4K91 A;  2V0W A;  5FQJ A;  1LI9 A;  2J9P A;  2Y55 A;  4KEN B;  3MKF A;  1VB6 A;  5FDS A;  1S4S A;  3HJK A;  1KDS A;  5L09 A;  1BYW A;  3O88 A;  4JXG A;  3G30 A;  3S7Q A;  1VET B;  2Y4A A;  3BFC A;  3Q07 A;  4MCW A;  3TE8 A;  2ZOI A;  3FKW A;  5CTM A;  4R3B A;  3T1S A;  4HBU A;  3E98 A;  2WGW B;  1DRM A;  3OPR A;  4KZ9 A;  3G2Z A;  4E3M A;  4ZBE A;  4B4Z A;  3LY4 A;  4PM7 A;  1D7E A;  2HDU A;  4DDY A;  1IEM A;  5G18 A;  5MC7 A;  3VSL A;  5HWV A;  4X6T A;  3LIF A;  5DF8 A;  4WUJ A;  3F1P B;  1RP5 A;  3PHY A;  4N1X A;  2J3W A;  2OLV A;  1WYB A;  3C30 A;  3NUL A;  2C6W B;  4MBK A;  4DE1 A;  3NOT C;  2BG1 A;  4JGR A;  1VEU A;  3V50 A;  2EWV A;  4P6Z M;  3NCK A;  4WEL A;  3BLS A;  4H6J A;  2EXB A;  2HDR A;  5HAR A;  2Y8H A;  1IEL A;  4DDS A;  4PM6 A;  4OKP A;  4F3L A;  3M2J A;  2XA7 S;  3ZVT A;  3BFD A;  2ACG A;  3MJQ A;  4PPR A;  3DTE A;  3Q7V A;  4OQG A;  4DRT A;  5KMW A;  4P85 A;  3ZNT A;  1ODV A;  1UWN X;  2ZLY A;  3BW6 A;  3G2Y A;  3FG8 A;  2ZBB A;  3B42 A;  4HNB A;  2V9A A;  4NXG A;  5CGS A;  4MNR A;  5EV0 A;  4CLC C;  2XSS A;  3QP6 A;  3GRJ A;  5C5K A;  5J7E A;  2M7U A;  3IWO A;  5HWT A;  2QPN A;  2Y2O A;  3PAE A;  1TS6 A;  4YNR A;  3ZDJ A;  4YWZ A;  1DJB A;  2W3F A;  1NZU A;  3LFV A;  4YFM A;  3ZG7 B;  4R70 A;  3NIA A;  1L0G A;  1OTI A;  3FYZ A;  4K0X A;  3S7O A;  4WZ4 A;  3TG9 A;  5EVI A;  3FPW A;  1NY0 A;  3M6H A;  3CIT A;  3N8S A;  4JPM A;  3WS5 A;  2P74 A;  3VE4 A;  3RXW A;  2OAP 1;  4R0Q A;  1Y4O A;  2HGV A;  4QHC A;  4RYE A;  1LT0 A;  4E3K A;  3DTK A;  1PWG A;  1PZO A;  3JPU A;  3CHW P;  2P9V B;  2VV6 A;  5KSC A;  1E25 A;  2K31 A;  2VLG A;  4BBU A;  4QJG A;  1BSG A;  1GA9 A;  5FAT A;  2XA7 M;  4NG2 A;  4MMN A;  4B4X A;  4G3V A;  5EFW A;  4EUV A;  2E8J A;  3C7U A;  4G3W A;  1T1A A;  4KQD A;  4EW7 A;  3AGF A;  4E3I A;  2VGL M;  3L7H A;  3RXX A;  2QJ7 A;  2OAQ 1;  4E3N A;  3K2N A;  2GZA A;  1C3B A;  3HUM A;  4YIN A;  2J80 A;  3HLW A;  4U0T A;  4R3A A;  3UMD A;  5CX7 A;  3IHB A;  3WWX A;  4GCZ A;  4S2I A;  5FAS A;  2O99 A;  4HOI A;  1MC0 A;  2ZOH A;  1Z09 A;  4NET A;  3NOU C;  5L07 A;  4GD6 A;  4KQR A;  2PYR A;  5FI2 A;  1BLS A;  5CTN A;  4X68 A;  2DRW A;  3DTM A;  1EWZ A;  4Y2F A;  3TJZ C;  3FWL A;  4PAU A;  3VV4 A;  4EQ1 A;  4OP8 A;  4KZ4 A;  3N8R A;  2FFF B;  3MQO A;  1SDE A;  1SDN A;  4KG5 A;  2Q9N A;  1FCN A;  1KE0 A;  1CQA A;  2EX6 A;  1SKO B;  4N92 A;  3ZCZ A;  3MZD A;  3VP0 A;  1JWV A;  1MWU A;  3EQV A;  3ITA A;  4JXV A;  4DXB A;  2WGV A;  2FFY A;  4GS9 B;  4KZ3 A;  1M6K A;  2VJW A;  2EX9 A;  1BLP A;  1TF1 A;  1WYC A;  3S1Y A;  3UDI A;  5DKL A;  3H7W B;  4DF6 A;  1NRF A;  1IKI A;  1XJ4 A;  3LGO A;  2QWS A;  1OTB A;  5CRF A;  3MF0 A;  5F68 A;  1XX2 A;  1T1C A;  1LSW A;  3OLO A;  2RCX A;  2JE5 A;  4GDN A;  1CF0 A;  4HQA A;  3UB7 A;  4MBH A;  3DBA A;  3OZH A;  5IHV A;  4BQM A;  5GLD A;  4OOL A;  1MY8 A;  1GHI A;  1ERM A;  2XF3 A;  1JTG A;  1OJG A;  5IS1 A;  3F1O B;  4F94 A;  2X02 A;  1PWC A;  2VGK A;  5FI7 A;  3QP4 A;  5DVA A;  2QKP A; 
#chains in the Genus database with same CATH homology
 2XRO A;  4LLO B;  3K3D A;  3ZQ5 A;  3A0R A;  4BMW A;  3KSH A;  1MKM A;  3HCY A;  3FC7 A;  3EOI A;  2WKP A;  4L9G A;  5TJJ A;  4I38 A;  4MN6 A;  4GLQ A;  5F69 A;  3LIE A;  1UGU A;  4Q0I A;  4IHQ A;  2MJ6 A;  4I3J A;  2QJ5 A;  4CLC E;  5DFY A;  1S4R A;  4GJ4 A;  3ZYT A;  3JVV A;  4HJ4 A;  2W27 A;  4HP4 A;  1S1Z A;  4LRY C;  1P97 A;  4CQH A;  3KYQ A;  3TW8 A;  3LIA A;  1STZ A;  3RTY A;  2D02 A;  3F1P A;  2INW A;  3CWF A;  3UE6 A;  2HJE A;  4KUK A;  3C38 A;  3EGX C;  2PDR A;  2G7U A;  2PT7 A;  3LR5 A;  3MFX A;  2B18 A;  4CLC B;  5TBM A;  4WEK A;  2K2N A;  3R7W B;  1T19 A;  3LID A;  3NJA A;  3D3O A;  1P9W A;  3KO6 A;  3MMH A;  2JN7 A;  1G6O A;  1WA9 A;  3MQQ A;  2HV1 A;  3PBS A;  3NOP C;  2OOL A;  5AVF A;  1F9I A;  3P01 A;  3PYP A;  3KSI A;  2IA2 A;  4ZRR A;  3IS2 A;  3ULF A;  5KSH A;  1OTE A;  4XT2 B;  2HF6 A;  4NXE A;  3O5Y A;  1OTD A;  5DJU A;  3LYX A;  1P9R A;  1GSX A;  3U2A A;  2LB5 A;  1F98 A;  2YKH A;  3LI9 A;  2FH5 A;  4UQI S;  4R6L A;  4HHD A;  5HPI A;  1OPX A;  3E4Q A;  2V0W A;  5I5L A;  5AJG A;  2JKT I;  5HDC A;  2R78 A;  1VB6 A;  2FZ0 A;  3BY9 A;  4O8G A;  2GJ3 A;  3LIC A;  2JHE A;  2LB9 A;  1S4S A;  3T4K A;  3HJK A;  1BYW A;  2L1M A;  3NHQ A;  1LSX A;  3S7Q A;  3TE8 A;  2V0U A;  4MCW A;  3H82 A;  2ZOI A;  2VA0 A;  3MR0 A;  4UEY A;  3BY8 A;  4PKY G;  3T4J A;  3E98 A;  3EEA A;  4ETX A;  1DRM A;  4IJG A;  5K5B A;  4AFI A;  3PBO A;  2PD7 A;  3GEC A;  2VEA A;  2P08 A;  4L0L A;  4HJ3 A;  1LSV A;  3PBR A;  2Z6C A;  4JGQ A;  2JKT M;  2WKQ A;  1D7E A;  3T4Q A;  4EEU A;  4WLA A;  5MC7 A;  3MQ0 A;  4MDZ A;  4WL9 A;  5HWV A;  5HDS A;  2QHK A;  1H3Q A;  3PXP A;  5DFX A;  3LIF A;  4WUJ A;  3W2Z A;  3CLO A;  2O9A A;  3OCN A;  3F1P B;  4Z1W A;  3KYZ A;  3PHY A;  2J3W A;  3C30 A;  4II7 A;  3OBF A;  4DJ3 A;  4LPZ A;  3NOT C;  4IUH A;  3CUE C;  4JGR A;  2EWV A;  4P6Z M;  4HY8 A;  2W1T A;  4EEP A;  4WEL A;  4EU0 A;  1D06 A;  1V9Y A;  1NRJ A;  1OJ5 A;  2I9V A;  4H6J A;  2W3E A;  2O9C A;  4GHI B;  1DP6 A;  2Y8H A;  2M7V A;  3B33 A;  4I3A A;  2PYP A;  4F3L A;  2XA7 S;  2K7S A;  3IBJ A;  3IS2 B;  2WKR A;  3MJQ A;  4UQI M;  5HD5 A;  5G4Z A;  2CMN A;  3CI6 A;  5FL3 A;  1EW0 A;  2YKF A;  4O01 A;  3VE3 A;  2GX5 A;  1DP9 A;  4EER A;  3G6O A;  4WEJ A;  2NUT C;  4P6Z S;  1ZTU A;  4KQO A;  1G28 A;  1XFN A;  4MN5 A;  1GSW A;  1ODV A;  1UWN X;  2P04 A;  3BW6 A;  3C2W A;  3FG8 A;  2ZBB A;  3RFB A;  3B42 A;  4HP9 A;  4HNB A;  2V9A A;  4NXG A;  3S7P A;  1OTA A;  1ZHH B;  2PHY A;  1NWZ A;  4JGO A;  3EQU A;  1UWP X;  4CLC C;  1N9L A;  4FOF A;  4DN0 A;  2XSS A;  3H82 B;  5C5K A;  4OOM A;  5J7E A;  2M7U A;  5LBR A;  5HWT A;  4BWI A;  1XFQ A;  3T4L A;  4DJ2 A;  4GW9 A;  5G4Y A;  1TS6 A;  4YNR A;  5KIZ A;  4YWZ A;  2W3F A;  2A2L A;  4M4X A;  2ZMF A;  3LFV A;  4R70 A;  3H9W A;  3IBR A;  1OTI A;  4EET B;  3PBN A;  3P7N A;  1XJ3 A;  1TD5 A;  3KX0 X;  3S7O A;  5IT5 A;  1N9O A;  1XJ2 A;  3A0S A;  4DMZ A;  1JNU A;  3EGD C;  5J3W A;  5DKK A;  3OOV A;  3FPW A;  1OT6 A;  3CIT A;  2PR6 A;  1IFQ A;  4GS9 A;  5A8B A;  3VE4 A;  3F1N A;  1YSP A;  2OAP 1;  5J4E A;  4PKY A;  1S66 L;  2EWW A;  2NUP C;  1TS7 A;  3BWL A;  2L0W A;  2HGV A;  1OT9 A;  1LT0 A;  4JGP A;  4B93 A;  1V9Z A;  2O0Y A;  4ARZ A;  4KUO A;  3SW1 A;  1NLZ A;  4FSF A;  3H7W A;  4QPR A;  3EEH A;  4NXB A;  2J3T D;  2VX8 A;  1VHM A;  2VV6 A;  2VZW A;  5F6A A;  4H6J B;  2K31 A;  3T50 A;  2VLG A;  4BBU A;  1S67 L;  1DP8 A;  4L9F A;  2XA7 M;  4MMN A;  4HH2 A;  5L8M A;  1XJ6 A;  4YOF A;  4G3V A;  5EFW A;  2EA9 A;  2KOI A;  4EUV A;  2A24 A;  4G3W A;  4KQD A;  1T1A A;  4F3L B;  4EW7 A;  3BQ8 A;  1YKD A;  3ICY A;  4WF0 A;  2H28 A;  3PBQ A;  2VGL M;  5TBM B;  4Q0J A;  2O9B A;  1NLY A;  3GDI A;  2QJ7 A;  4Q0H A;  2PR5 A;  2OAQ 1;  4Y3I A;  4K08 A;  3K2N A;  2GZA A;  2VKS A;  4ME4 A;  4BJP A;  3KSF A;  2PD8 A;  3UE3 A;  2J80 A;  2M1C A;  3T4S A;  4R3A A;  3UMD A;  4HJ6 A;  5CX7 A;  4EES A;  5HPF A;  1X0O A;  2W3H A;  3LIB A;  4EXO A;  3CUE A;  1MZU A;  4GCZ A;  4BBT A;  4I39 A;  2O99 A;  4HOI A;  1MC0 A;  2ZOH A;  3F1O A;  4G3K A;  3NOU C;  4O0P A;  1S1Y A;  3UB6 A;  2GNX A;  2PYR A;  4B9O A;  5HZH A;  3T4O A;  5AVE A;  2JKR I;  3RH8 B;  2W3D A;  3V67 A;  4E04 A;  2VGL S;  2W0N A;  3BJN A;  4Y2F A;  3TJZ C;  3LR0 A;  1LL8 A;  3A0V A;  4NKP A;  4HI4 A;  4PAU A;  1TS0 A;  1T18 A;  3VV4 A;  4EQ1 A;  3MQO A;  2ZMV A;  1T1B A;  3HJI A;  3MXQ A;  3KSG A;  5F5Y A;  4WN5 A;  2KX6 A;  4L9E A;  5HD3 A;  2VV8 A;  2L4R A;  3LR4 A;  4RQ9 A;  3JVU A;  4BBV A;  2VV7 A;  5HWW A;  2BAS A;  3C8C A;  1W63 Q;  5DF9 A;  2JKR M;  5HSQ A;  5IU1 A;  3EQV A;  3TRC A;  4GHI A;  2V1A A;  2DMW A;  5HDD A;  4HIA A;  3B47 A;  4ETZ A;  3UB9 A;  4GS9 B;  3F1N B;  2KDK A;  2W3G A;  3UB8 A;  3OC2 A;  1KOU A;  2VJW A;  3PR6 A;  5HL6 A;  5DJT A;  4CLC A;  1TF1 A;  1N9N A;  1F5M A;  3LI8 A;  3R7W A;  5DKL A;  3PBT A;  1YSQ A;  3E4O A;  4ARZ B;  2KLI A;  3H7W B;  2Z6D A;  3CAX A;  4CLC D;  1XJ4 A;  2QWS A;  1OTB A;  4Y5F A;  2W1R A;  3MF0 A;  3R4K A;  3OCL A;  5F68 A;  3FPV A;  4I3I A;  4IUK A;  1T1C A;  1LSW A;  2A24 B;  3OLO A;  2OWH A;  4XT2 A;  3S7N A;  2J3T C;  2XRN A;  1GSV A;  3E4P A;  3K3C A;  3LUQ A;  2QYB A;  2P7J A;  2B02 A;  1W63 M;  1TS8 A;  4HQA A;  2W1T B;  3UB7 A;  3DBA A;  4MN7 A;  2V1B A;  2Y79 A;  4OOL A;  1P0Z A;  2OWJ A;  1YAX A;  3LR3 A;  3UME A;  4PHT A;  3BQA A;  2D01 A;  4R38 A;  4NEE D;  1OJG A;  5IS1 A;  1Y28 A;  3F1O B;  4I5S A;  4HH3 A;  1IOU A;  3T4T A;  3EWK A;  1H8M A;  2HJ9 C;  3E0Y A;  3VOL A;  3D72 A;  4LRZ E;  4LRX C;  2QKP A;  4NXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...