1ODVA

Photoactive yellow protein 1-25 deletion mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
100
structure length
100
Chain Sequence
LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Pas Domains.Common Structure and Common Flexibility
pubmed doi rcsb
source organism Ectothiorhodospira halophila
molecule tags Signalling
total genus 29
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1odvA00
3VOLA 4I39A 2VV8A 4EESA 4HNBA 2WKQA 3D72A 2M1CA 1Y28A 1MZUA 4I5SA 4HI4A 1OJGA 1OTEA 2R78A 3BY9A 5TBMA 4BBVA 2W0NA 5DKLA 3IS2B 4EEUA 5AVEA 3NOTC 1TS7A 2VV7A 4LLOB 4I3JA 5KIZA 1DP8A 2CMNA 1DRMA 4GHIA 2B02A 3E4PA 3UE6A 3A0VA 1T18A 4PKYG 5HD5A 2WKRA 4DJ2A 1GSVA 4HJ4A 2OOLA 3LIEA 1OTAA 3RH8B 3H7WA 1KOUA 2KX6A 3B33A 3UB9A 4HY8A 2QHKA 1XFQA 1TS6A 2H28A 4EW7A 3F1NB 4HP9A 5I5LA 3MJQA 5HWVA 4HP4A 4GCZA 3ZQ5A 4H6JB 2EA9A 2L0WA 1EW0A 5IS1A 4I3IA 4GS9B 4WL9A 3EWKA 2PD8A 3FG8A 4KUKA 5HD3A 4WUJA 4HJ3A 3UMDA 1LT0A 2WKPA 4MN5A 2QJ7A 3BWLA 4I38A 2D02A 4R70A 3IS2A 2L1MA 5HZHA 4NXGA 2PD7A 1NWZA 2V0UA 4B9OA 4LRYC 5HWWA 3LIDA 5DJTA 3CAXA 3ICYA 5F68A 4WLAA 4DJ3A 3LIBA 2KDKA 4EETB 4BBUA 3HJKA 1XJ3A 2PYRA 3MFXA 1N9OA 2PDRA 3UB8A 3LI9A 1OTIA 1LSXA 2VEAA 3MQOA 3F1OB 3PHYA 3NJAA 3F1NA 2V1AA 5HSQA 3LYXA 3UMEA 1XFNA 3IBRA 2ZBBA 4H6JA 2Z6DA 4EXOA 4GS9A 1XJ6A 1TS8A 2JN7A 1S1ZA 3F1PB 1JNUA 3A0RA 1OJ5A 5HDCA 2PHYA 3VE3A 1DP6A 3EEHA 1OT6A 2Z6CA 4K08A 3LIFA 2ZOIA 1UGUA 2PR5A 1G28A 3A0SA 5A8BA 4LRXC 3H82A 2I9VA 4GW9A 2V1BA 1UWNX 4XT2B 3LICA 4PKYA 3GDIA 2BASA 5AVFA 3NOUC 1S4SA 3UB7A 5TBMB 3GECA 1LSVA 5F5YA 2OWHA 4F3LB 1LL8A 3BY8A 2QWSA 2W27A 4R3AA 3F1OA 4WN5A 5J3WA 4JGOA 1T1BA 1UWPX 2OWJA 4NXBA 4MN6A 1D06A 4HJ6A 5IU1A 2P7JA 4GHIB 3RTYA 5F6AA 4EEPA 4EQ1A 1V9YA 4HQAA 4E04A 3G6OA 1N9NA 4HIAA 1F9IA 2ZOHA 5G4YA 1OTDA 3PYPA 4NXEA 3T50A 1S67L 1GSXA 4LPZA 3OLOA 1OTBA 1T19A 4KUOA 1S1YA 2A24B 1D7EA 2J80A 4L9EA 4XT2A 2V9AA 2QKPA 4HH2A 5F69A 3VE4A 3H9WA 3HJIA 1XJ2A 2PYPA 3C2WA 5J7EA 2VLGA 2D01A 1S66L 3CLOA 4F3LA 3K3CA 3MR0A 1N9LA 4BBTA 4R38A 1BYWA 1TS0A 3NOPC 3K3DA 3LIAA 4L9GA 4JGPA 3KX0X 1P97A 3E4OA 1S4RA 3MQQA 4R6LA 2V0WA 5G4ZA 1OT9A 2JHEA 5EFWA 4RQ9A 4L9FA 4HHDA 3SW1A 3MXQA 3ULFA 4HOIA 5J4EA 1VB6A 5HDDA 3E4QA 4KQDA 3LUQA 4M4XA 5HDSA 2YKFA 3UB6A 1DP9A 3C8CA 4LRZE 1P0ZA 3FC7A 3LI8A 5DJUA 2L4RA 2K7SA 1LSWA 4EERA 2A24A 3CWFA 2VV6A 1T1AA 2YKHA 4I3AA 1ODVA 1V9ZA 2GJ3A 1F98A 4HH3A 1T1CA 3F1PA 2HV1A 4NXFA 1WA9A 1GSWA 3H7WB 3NHQA 4JGQA 4JGRA 1X0OA 4YWZA 2INWA 2PR6A 3P7NA 2QJ5A 1XJ4A 5DKKA 3H82B 4WF0A 5HWTA
chains in the Genus database with same CATH superfamily
4EBNA 3KSIA 2GNXA 4DRTA 3TSGA 3PXPA 3O5YA 2RCXA 4I5SA 3A3DA 3BRMA 3NULA 3UDXA 4JF6A 4NETA 5FASA 5EOOA 3VP2A 3V5MA 1NLZA 5CX7A 4MDZA 5AVEA 2XH9A 4DE0A 3DTEA 1GA0A 4E3MA 2ZM0A 1CK3A 2Y2NA 3LCEA 4DMZA 1DY6A 4LLOB 5DVAA 5E2EA 1J3WA 4S2LA 2ZMFA 4YNRA 3ITBA 1E4DA 4DXCA 4OOYA 3A0VA 4X53A 1K38A 5HL6A 1ES3A 2WKRA 3N8SA 3IXBA 2C5WB 4EUZA 1YSPA 2OOLA 1BSGA 4GJ4A 4RVAA 4Y13A 5L07A 2G2UA 4S2OA 4WEKA 3HLDA 3B42A 4JLFA 3S1YA 4HP9A 1ACFA 1ESIA 3VFHA 3HLWA 3IHAA 4GOGA 3OBFA 1Y4OA 4PM9A 2X01A 2L0WA 4M3KA 5IS1A 3IWIA 4WL9A 3EWKA 1HVBA 1MKIA 5A90A 1LLBA 4R4RA 1W63M 4MCWA 4HJ3A 4G3VA 2WKPA 2QJ7A 2P08A 1U60A 4O7DA 4QU3A 4OP5A 4S2KA 4OP8A 4LV1A 3NCKA 4KG2A 4D60A 1L0FA 5EVIC 5HWWA 4MBFA 1YLYA 4CLCD 1BT5A 3BLSA 3BFEA 5GLDA 2O9BA 3UDIA 3ICYA 2ZL1A 1ESUA 2QZ6A 4ZDXA 3T1XA 5CECA 4WLAA 4FOFA 4EWFA 1JWPA 3HJKA 1XJ3A 1KVLA 1XXMA 4LCLA 3GMWA 3BEBA 2VGLM 4BD1A 1W8QA 3O86A 3VP3A 3MQOA 3F1OB 4Y2FA 3PAGA 3F1NA 3QP1A 3LYXA 2OLVA 2JKFA 1XFNA 2P04A 2QMIA 4S2JA 3PBRA 4XXRA 1YM1A 5DTTA 3C4OA 2OLUA 1JWVA 3TW8A 4HBTA 1I2WA 2PHYA 2PBYA 4RX2A 1G5UA 1BLSA 5FQKA 1BLCA 2NUPC 1Z09A 2PR5A 3A0SA 4E6WA 3NC8A 3M2KA 1L0DA 3G2YA 3H82A 1RP5A 2JKRM 1ES5A 2V1BA 5DFYA 1UWNX 3D3OA 2WAFA 4OKPA 1YLZA 1JVJA 4FTXA 3T4JA 3FWLA 4E6XA 3UB7A 3BW6A 5TBMB 4DF6A 1N4OA 1XKZA 4Y7PA 2OWHA 2J9PA 4F3LB 3IWOA 1VETA 5AQ7A 4K0WA 1M6KA 1MBLA 1YMSA 1UWPX 2HDSA 4JKTA 1NRFA 3UDFA 2XR0A 1BLHA 5F6AA 1L0GA 4EEPA 4EQ1A 4HQAA 3NIAA 4BWIA 1ZTUA 2Y2MA 1N9NA 1SKOB 4X68A 1F9IA 4Y0UA 1PI4A 1MKMA 5EUAA 1RGYA 4U3TA 3QNBA 1FCNA 4YINA 1OMEA 3PYPA 4Y5FA 3T50A 3WS2A 1CI9A 3MZFA 3MQ0A 3L7HA 3LGOA 4KUOA 2A24B 1ALQA 1D7EA 2J80A 2ZQ9A 4L9EA 3T1RA 3ZVTA 5TR7A 4DXBA 2EFXA 1VEUB 3TRCA 2H5SA 1A0KA 3RJUA 2V8CA 3FPWA 4KZAA 2D01A 4P6ZM 3CLOA 3WRZA 3K3CA 3MR0A 1PWCA 4KG6A 1MPLA 3HCYA 1K57A 1TS0A 2HDRA 1ZC2A 2HF6A 1F5MA 3DAVA 4FUWA 3K3DA 5FEFA 4L9GA 1S0WA 4DE1A 3HUMA 3MMHA 2JHEA 1RCJA 5M19A 4RQ9A 4EU0A 1H0MA 4HHDA 3BFCA 3MXQA 4G3KA 3ULFA 2ZC7A 3PBOA 5J4EA 3V39A 5HDDA 2ACGA 4KQDA 3LUQA 5AQBA 3T4SA 3EQVA 5KSHA 1MWRA 3SS3A 2L4RA 3O88A 3IXHA 2K7SA 3DTKA 3S7NA 4JF4A 4O01A 4XUXA 2H0YA 2M7VA 1FIKA 4QD4A 4MBKA 4DE3A 1LL5A 4UA9A 4KZ3A 3DBAA 1KGGA 3FKVA 4B4ZA 4EV4A 1H8MA 1GHIA 1K56D 3F1PA 3C38A 1LI9A 4B88A 3H7WB 3TOIA 4PM8A 3MS6A 1K0KA 2PR6A 3QP2A 3P7NA 1HZOA 2DRWA 3UE1A 3FKWA 3C7VA 3BWLA 5HWTA 3CUEA 4P85A 3G31A 3IQAA 2VV8A 3VOLA 4HNBA 2WKQA 3D72A 4F94A 5FSRA 4G3WA 3BFDA 1Y28A 2JKTM 3C5AA 3IHBA 4QHCA 1OTEA 4N9LA 3A3JA 1TEMA 2XFTA 4HESA 5FQQA 4LGWA 4BBVA 2W0NA 1ERQA 4EEUA 3LY3A 4Q0JA 4IBRA 1TS7A 1NRJA 4KG5A 2VV7A 3A3IA 1L0EA 4ZBEA 4S2PA 4OQ0A 1TVFA 2HPBA 4I3JA 5KIZA 1DP8A 1K57C 4PAUA 3ZG9B 4GHIA 4WYYA 2DNSA 2EWWA 3CHWP 3EOIA 4CQHA 3E4PA 3E2LA 4GNUA 2HJ9C 3R7WA 5AQ9A 5FDHA 1GHPA 1GHMA 4KZBA 3BFFA 2V8FA 4ZJ1A 1BULA 2XF3A 4UQIS 2RL3A 5HAQA 3DTIA 3UB9A 2QHKA 2JE5A 4II7A 2IWDA 4UEYA 5I5LA 2DCFA 1I2SA 3ZQ5A 4E3LA 3LEQA 3IX4A 4KQQA 3QP5A 2EA9A 5F1FA 4I3IA 4PM6A 1PW8A 1NY0A 5E2FA 1ONGA 3KSGA 5HD3A 4WUJA 4OVDA 2EX9A 1LT0A 3M2JA 3HUOA 3JYIA 2D02A 3O87A 4ME4A 4N92A 5L09A 1MWTA 2L1MA 4PM5A 4DN0A 1XPBA 5EPHA 2V0UA 4MMNA 1QMEA 4B9OA 5F82A 4MBHA 4OOLA 2V1ZA 4ARZB 5DJTA 3MKFA 3WS1A 4E3OA 3NDGA 4UA6A 4NK3A 4KZ4A 4U0TA 4Y17A 5FQMA 3Q82A 4DJ3A 3LIBA 3UPOA 2KDKA 3CUEC 1NJ4A 2PYRA 2QYBA 3VFFA 5CERA 1N9OA 2H0TA 2VX8A 3CPTB 4UHUA 4RX3A 2PDRA 3T4LA 3WS5A 1IELA 3HLGA 1YAXA 4A5RA 3NJAA 2V1AA 4KZ6A 5HL1A 2FFFB 3LR3A 2O0YA 5FAQA 1ZHHB 3E98A 2ZBBA 2Z6DA 4PPRA 4RA7A 2ZMVA 5EVEA 4GLQA 4B4XA 2HDQA 4MEZA 4Y0TA 3MXSA 1Q2PA 2OSUA 2JKGA 3Q7VB 1JNUA 3N7WA 3U4LP 5JYOA 1HTZA 1DP6A 4OPZA 3EEHA 1MC0A 2EFUA 2Z6CA 2IWBA 3GQZA 3WS4A 4NEED 2JKTI 4DDYA 3IXGA 4R1GA 1UGUA 3G35A 4QB8A 5EE8A 4WZ4A 5DTSA 2Y79A 3C7UA 5KSCA 2FZ0A 1W7FA 4LRXC 5AQAA 2I9VA 1DJBA 2XK1A 2VZWA 1STZA 2R9WA 3IF6B 5DTKA 4OOMA 4XT2B 3UE3A 2WADA 2WZZA 2Z2LB 5HFOA 2HDUA 3SOIA 4D2OA 3D9YA 3BY8A 5LBRA 3N8RA 2FFYA 4R3AA 3F1OA 5A93A 4WN5A 1XGIA 4JF5A 3OCLA 1T1BA 3AGFA 3K2NA 2Y8HA 4Y3IA 1FILA 5L10A 2XLNA 3KYZA 2X02A 3FPVA 3SZTA 2PU2A 1V9YA 2ZMAA 2WAEA 1HLUP 4O8GA 2J3TC 3NDEA 3PR6A 3Q07A 4KQOA 4WBGA 1W8YA 3SS5A 3G2ZA 3DWKA 4WZ5A 3UPPA 4LPZA 4ETZA 1BLPA 1YMXA 1G6OA 5EV0A 4HH2A 2E8IA 5CTMA 1KGEA 4KZ9A 3PBSA 3S7OA 3ZHHA 4NKPA 1E25A 2KOIA 3UB5P 4KQRA 2PAVP 3I7JA 4F3LA 1BTLA 2HZ5A 4GKUA 1M40A 1N9LA 2ZC3B 4BBTA 4R38A 1BYWA 4ZRRA 3NOPC 2EXBA 2ZL1B 5FQ9A 3CI6A 1S4RA 2XA7S 1ES4A 2XROA 1PWDA 2ZQ8A 5DF9A 1GCEA 2GX5A 1TDGA 3MKEA 4LFUA 4R6LA 1IFQA 3BQ8A 2V0WA 4AFIA 1FSYA 3G30A 4BQMA 5EFWA 3IX3A 2UWXA 1SKOA 3Q7ZA 2XQZA 4HOIA 3E0YA 3E4QA 4CLCA 5CRFA 3A3EA 4ZJ2A 3ZDJA 2Y2JA 1DP9A 3UB6A 3FC7A 2MJ6A 1VM1A 4N1HA 1K6SA 2A24A 4IUHA 4OLDA 2B18A 3OPRA 1YQSA 2V20A 4I3AA 1NZOA 1V9ZA 2WYXA 1O07A 1VEUA 3VOYA 3VP0A 2PT7A 4HH3A 2GDNA 5GHYA 2WKHA 4RYEA 4GN2A 3ISGA 3HLCA 2HV1A 4X69A 1PRQA 4JGRA 1X0OA 1FQGA 4YWZA 4S2NA 5FI6A 5E43A 2ZQAA 3IBJA 5DKKA 5FQJA 2B95A 4LV2A 5FEGA 3H82B 4EUVA 1FOFA 1YLWA 4I39A 5U47A 3RFBA 3QP6A 3B3XA 4IVIA 2M1CA 2Y2GA 4PMAA 4OLGA 5KMWA 1MZUA 3M6HA 4HI4A 4Q0HA 1OJGA 4WMCD 2R78A 3BY9A 1IYPA 4FD8A 4GZBA 2O9AA 4CPKA 3OPPA 3IS2B 4DKIA 3QP4A 1WYCA 3C4PA 1IYOA 3EEAA 3HBRA 4MN7A 5A92A 5CHJA 5AJGA 1PYYA 3BFGA 5HPIA 2JC7A 1GA9A 3KYQA 4N9KA 1YT4A 5FAOA 2CMNA 1KGFA 4BJPA 2K2NA 4L0LA 4ZTKA 2JBFA 3VSLA 1T18A 4Y0OA 4H8RA 1FCOA 4DJ2A 1GSVA 2P9VA 4BL3A 4GDNA 4HJ4A 1E3UD 3LIEA 4JBFA 4DE2A 4X25A 3H7WA 4P87A 1KOUA 2KX6A 3VP1A 4JXGA 2C6WB 3B33A 1PNEA 3G34A 3QNCA 3V3SA 3OC2A 3N6IA 1XA1A 4CLCC 4P0MA 4X6TA 1XFQA 2H28A 2O9CA 4EW7A 4R3JA 5HWVA 4HP4A 3CZDA 4GCZA 4YFMA 2E8JA 1CF0A 4H6JB 5D3OA 3ZGAB 3Q81A 1C3BA 1EW0A 4GS9B 2PD8A 3FG8A 1YKDA 4EBPA 3GVBA 3ZVWA 1MXOA 1MY8A 4WM9A 3UMDA 5CHMA 4Q0IA 2EWVA 1TDLA 3ZG8B 5GHXA 5HZHA 3BLMA 4K91A 3HUNA 4NXGA 2JKRI 2PD7A 4HEFA 1NWZA 4FH4A 5J8XA 2W3EA 3BQAA 4LRYC 1L3LA 1NZUA 1JTGA 4GDBA 2A3UA 1FSWA 1KDWA 2ZJ9A 3CAXA 2ZLYA 5F68A 4S2NC 3JVVA 3IX8A 3L9KA 4X56A 2EX2A 5KZHA 4QY5A 4EETB 4BBUA 3MBZA 1IKGA 3MFXA 5FDSA 2JCHA 2ZM2A 4E3JA 1WYBA 1G68A 3DWZA 1ZKJA 3W2ZA 3LI9A 3FZCA 2VEAA 4KZ8A 3IXDA 2HGVA 5HARA 2XRNA 3N8LA 5FI7A 3ZFZA 4Z9QA 5EVID 3IBRA 1YSQA 4OQHA 1JWZA 2Z2MB 4BL2A 2W3HA 2J3WA 4EXOA 3AGDA 1NLYA 1TS8A 3PAEA 1S1ZA 5TGFA 1SCWA 3F1PB 4MNRA 1LL9A 3A0RA 4S2IA 3S4XA 3N4IA 1CEGA 5HDCA 3P09A 3VE3A 1VHMA 5CGSA 4FSFA 3LFVA 4JPMA 1LHYA 4X1MA 5I94A 2WGWB 1G28A 3OPHA 1D1JA 4ARZA 4GD6A 1K4EA 5E2HA 1ZG6A 1K56A 4OPYA 1AWIA 5FA7A 2FH5A 3NECA 3T4TA 4UQIM 2EX6A 4PKYA 2IWCA 3CPTA 5CGXA 3NOUC 5FL3A 3S7PA 3GECA 1LSVA 5F5YA 1LL8A 5HPFA 2XD1A 1SHVA 2OAP1 4HBUA 1PW1A 1BZAA 4NXBA 4MN6A 1D06A 5CXWA 2VGJA 3MFDA 2P7JA 2Y2LA 4GHIB 3RTYA 5M18A 2W1TB 2WZXA 4KZ5A 4KZ7A 1K55A 3R7WB 4FH2A 5EECA 4E04A 3MF0A 4PM7A 2W3DA 3Q7VA 3G6OA 4OPQA 1PZOA 4LCMA 3LR5A 2Q9MA 4HIAA 1W79A 3T4KA 1G6AA 4Z1WA 1H3QA 5TFQA 2VK3A 2WKEA 5G4YA 1TF1A 3OOVA 1S67L 3NBLA 3T1QB 5CEDA 1XP4A 1CJFA 4ETXA 2LB9A 3IF6A 1W63Q 5JYPA 2V9AA 2QKPA 4XT2A 5F69A 1DJCA 3T4OA 4BMWA 3H9WA 2PRFA 3ITAA 2HJEA 3HJIA 4MLLA 4JXSA 2PYPA 3C2WA 1K25A 4R0QA 3JPUA 2VLGA 3G4PA 4UA7A 5GHZA 3RXWA 3CMZA 2ZC4B 3KO6A 3UN7A 5EVIB 4R4SA 2BG1A 1FR6A 2ZC6B 1PIOA 4KENB 4JGPA 5HAIA 4E3NA 4QJGA 3HL9A 3E4OA 3DW0A 2VKSA 5G4ZA 1NXYA 3SH8A 3VP4A 5DFXA 4L9FA 2Y2HA 2P74A 3SW1A 3CITA 3MZDA 3LEZA 2XEPA 2XDMA 3EGDC 4UAAA 2G2WA 1KE0A 5F83A 3UO9A 3V50A 4PHTA 3R4KA 2Y55A 3GSGA 1AXBA 1P0ZA 3FV7A 3MSHA 5IT5A 3W4QA 4LV0A 1LSWA 4C6YA 4OQIA 3VV4A 2VV6A 2YKHA 1S6RA 3Q1FA 5K5BA 4EBLA 1SKFA 1ERMA 1KE4A 2PBDP 2GJ3A 3SS4A 3ZNYA 5L8MA 2EX8A 3VOZA 1RGZA 1SDEA 1T1CA 3BECA 1CEFA 4E3KA 4JXVA 3AGEA 3LO7A 1IYSA 2ZM8A 1JTDA 3ZNTA 1LI0A 1K55C 2BLSA 2HP6A 4NXFA 1GSWA 4JGQA 2VGKA 1IKIA 3BJNA 2INWA 5E2GA 3LR0A 5IHVA 1XJ4A 4IEDA 3IH8A 4BD0A 4WF0A 5GL9A 2VGLS 2H10A 1QMFA 2W3GA 2J7VA 4Y15A 4EESA 3S7QA 3W4OA 5FQIA 3PBTA 1EROA 3HREA 4EQIA 5EM1A 3IF6C 3T1SA 5GLBA 3HLFA 2HP9A 3E2KA 3T4QA 5TBMA 2ZQCA 3VMAA 4K0XA 5FI2A 5C5KA 5EM0A 5DKLA 3UNWA 3NOTC 5GLAA 4QPRA 1FCMA 3SH7A 2Y2QA 1K4FA 3U2AA 5HX9A 2KLIA 4LV3A 2Q0OA 4U0XA 4IJGA 2M7UA 1NYYA 1DRMA 2B02A 1XX2A 2OV5A 3UE6A 3IT9A 2Y2IA 3KSHA 4PKYG 5HD5A 1PI5A 4O0PA 1K6RA 3TG9A 5FAPA 1YLTA 3QP8A 1OTAA 3RH8B 2W3FA 2XA7M 2V2FF 3JVUA 3BYDA 4HY8A 1Y54A 1YPRA 2DMWA 2IA2A 1TS6A 1HD8A 3F1NB 3MJQA 3CG5A 3GRJA 2J8YA 3OCNA 3OZHA 3D4FA 3LR4A 4P6BA 1K54A 1ZG4A 3P98A 5MC7A 3FYZA 4KUKA 1EWZA 4S2MA 3V67A 1SZVA 4GB7A 1XA7A 4MN5A 4I38A 4R70A 3IS2A 2X71A 1MWSA 2UV0E 1IEMA 4R3BA 2AVXA 3ZG7B 3A3FA 3ZG0A 1L2SA 3LIDA 2CC1A 1CQAA 3SH9A 4CJNA 3CJMA 2A2LA 3DTMA 2G7UA 4WZ5C 3W4PA 4FCFA 4CLCB 4QY6A 2OAQ1 4X55A 1SDNA 1FR1A 3UB8A 5G18A 4IBXA 4BENA 1J9MA 2Y59A 1OTIA 3MZEA 2W1RA 1OPXA 1LSXA 2WUQA 4IVKA 3P01A 1H8ZA 1VETB 3PHYA 5CEBA 2J9OA 1H8YA 4OPRA 5EVLA 4BLMA 5HSQA 2GZAA 2HP5A 4P6ZS 1Q2QA 3UMEA 3GTCA 5FATA 4B93A 4E3IA 4H6JA 5EOEA 3GV9A 4WEJA 1KVMA 4GS9A 1XJ6A 2XFSA 2JN7A 4XUZA 3V3RA 3W8KA 4YOFA 1OJ5A 4C75A 2XD5A 1F2KA 2PU4A 2NUTC 3KSFA 1OT6A 4K08A 3LIFA 4Q8IA 2ZOIA 1W5DA 1KE3A 1PZPA 3ZG5A 2ZQ7A 3QHYA 2Y2PA 5A8BA 4OQGA 4QWOA 2VA0A 4GW9A 4IUKA 4C3QA 2WGVA 3LICA 3UPNA 3GDIA 2BASA 3WWXA 5AVFA 1S4SA 1K54C 2Y2OA 4R23A 5CHUA 1PWGA 3EGXC 3C30A 3M6BA 2QWSA 2W27A 3NI9A 2EXAA 5J3WA 3EQUA 4JGOA 3T12B 2OWJA 1PFLA 5DF7A 4WMCA 3IF5A 4HJ6A 5IU1A 3TJZC 1DJAA 4N1XA 3ZYTA 3VSKA 1N9BA 1P9WA 1P9RA 2P9VB 1VQQA 2VJWA 4IHQA 3ZCZA 2ZQDA 1YLPA 1NYMA 1XGJA 3NY4A 3UE0A 4JXWA 2ZOHA 2I72A 5BOHA 1OTDA 2WGWA 4LENA 4NXEA 1ONHA 1GSXA 3B47A 3OLOA 1OTBA 1T19A 1S1YA 3KYEA 1E3UA 5CGWA 3TE8A 5HAPA 1I5QA 2LB5A 3VE4A 3LY4A 4WELA 3WRTA 3HVFA 2Q9NA 1XJ2A 2BTFP 5J7EA 1MWUA 1S66L 4DDSA 3HLEA 2J3TD 2WKIA 4CLCE 2QPNA 2ZC5B 4X1LA 1CI8A 1TD5A 1YLJA 1EI5A 3LIAA 2XSSA 3KX0X 1P97A 3MQQA 2W1TA 5M1AA 3WS0A 2O99A 3HLBA 3GR2A 1OT9A 2R9XA 1KDSA 1H5XA 3G32A 4ESPA 1ES2A 1VB6A 5TJJA 4M4XA 3BM6A 2K31A 3UY6A 5HDSA 1BUEA 3S22A 2YKFA 4NG2A 3IH9A 3C8CA 4LRZE 4OH0A 3RXXA 1IOUA 3LI8A 5DJUA 4ZAMA 2A49A 3PBQA 1Z6FA 2WGIA 4EERA 3CWFA 1WE4A 1T1AA 3PTEA 3IWQA 4ZJ3A 1ODVA 2XGNA 5DF8A 5A91A 1F98A 2WK0A 3OPLA 5F1GA 5L2FA 3O3VA 1IYQA 4GD8A 2ZD8A 5GLCA 1WA9A 5EVIA 3MXRA 4OONA 1O7EA 4ID4A 2Y91A 3NHQA 3PBNA 2B5RA 5HW3A 5CTNA 2QJ5A 2Y2KA 2Y4AA
chains in the Genus database with same CATH topology
3VOLA 2W3GA 4I39A 2VV8A 3KSIA 2GNXA 3RFBA 4EESA 3PXPA 3S7QA 4HNBA 2WKQA 3D72A 3O5YA 2M1CA 4G3WA 1Y28A 3PBTA 2JKTM 1MZUA 4I5SA 4HI4A 4Q0HA 1OJGA 1OTEA 2R78A 3BY9A 3T4QA 5TBMA 4BBVA 1NLZA 2W0NA 2O9AA 5CX7A 4MDZA 5C5KA 5DKLA 3IS2B 4EEUA 5AVEA 3NOTC 4QPRA 4Q0JA 1TS7A 1NRJA 3EEAA 2VV7A 3U2AA 4MN7A 2KLIA 5AJGA 4DMZA 4LLOB 4I3JA 5HPIA 5KIZA 1DP8A 2M7UA 3KYQA 4IJGA 4PAUA 2CMNA 2ZMFA 1DRMA 4YNRA 4GHIA 2B02A 4BJPA 2EWWA 3EOIA 2K2NA 4L0LA 3E4PA 4CQHA 3UE6A 3A0VA 2HJ9C 3R7WA 1T18A 5HL6A 5HWTA 3KSHA 4PKYG 5HD5A 2WKRA 4O0PA 4DJ2A 1GSVA 4HJ4A 1YSPA 2OOLA 3LIEA 1OTAA 3RH8B 2W3FA 3H7WA 2XA7M 1KOUA 2KX6A 4GJ4A 3JVUA 4UQIS 3B33A 3UB9A 4HY8A 2QHKA 3OC2A 4WEKA 3B42A 4CLCC 2DMWA 2IA2A 1XFQA 1TS6A 2H28A 2O9CA 4II7A 4EW7A 4UEYA 3F1NB 4HP9A 5I5LA 3MJQA 5HWVA 4HP4A 3OCNA 4GCZA 3LR4A 3ZQ5A 4H6JB 3OBFA 2EA9A 2L0WA 1EW0A 5IS1A 4I3IA 4GS9B 4WL9A 5MC7A 3EWKA 2PD8A 3FG8A 1YKDA 4KUKA 3KSGA 5HD3A 4WUJA 1W63M 4MCWA 4HJ3A 4G3VA 3UMDA 1LT0A 3V67A 2WKPA 4MN5A 2QJ7A 4I38A 4Q0IA 2D02A 2EWVA 4R70A 2P08A 3IS2A 4ME4A 2L1MA 5HZHA 4NXGA 4DN0A 2JKRI 2PD7A 1NWZA 2V0UA 2W3EA 3BQAA 4MMNA 4B9OA 4LRYC 5HWWA 4OOLA 4CLCD 3LIDA 4ARZB 5DJTA 2O9BA 3CAXA 3ICYA 5F68A 3JVVA 4WLAA 4FOFA 4DJ3A 3LIBA 2KDKA 4EETB 4BBUA 3CUEC 2A2LA 3HJKA 1XJ3A 2PYRA 2QYBA 2G7UA 3MFXA 1N9OA 4CLCB 2VX8A 2OAQ1 2PDRA 3T4LA 2VGLM 3UB8A 3W2ZA 3LI9A 1OTIA 2W1RA 1OPXA 1LSXA 2VEAA 3MQOA 3P01A 3F1OB 3PHYA 1YAXA 3NJAA 4Y2FA 2HGVA 3F1NA 2V1AA 2XRNA 5HSQA 3LYXA 3LR3A 2GZAA 2O0YA 4P6ZS 3UMEA 1ZHHB 1XFNA 3E98A 3IBRA 2ZBBA 1YSQA 2P04A 4B93A 4H6JA 2Z6DA 4WEJA 2W3HA 2ZMVA 2J3WA 4GLQA 4EXOA 3PBRA 4EUVA 4GS9A 1XJ6A 1NLYA 1TS8A 2JN7A 1S1ZA 3F1PB 1JNUA 3A0RA 4YOFA 1OJ5A 3TW8A 5HDCA 2PHYA 3VE3A 1VHMA 1DP6A 2NUTC 3EEHA 3KSFA 1MC0A 1OT6A 2Z6CA 3LIFA 4FSFA 4K08A 3LFVA 4NEED 2JKTI 2ZOIA 1UGUA 2NUPC 2PR5A 1G28A 3A0SA 2Y79A 4ARZA 5A8BA 2FZ0A 2VA0A 4LRXC 3H82A 2I9VA 4GW9A 4IUKA 2VZWA 1STZA 2FH5A 2JKRM 4OOMA 3T4TA 2V1BA 5DFYA 1UWNX 3D3OA 4UQIM 4XT2B 3LICA 4PKYA 3GDIA 2BASA 3T4JA 5AVFA 3NOUC 5FL3A 3UE3A 1S4SA 3S7PA 3UB7A 3BW6A 5TBMB 3GECA 1LSVA 5F5YA 2OWHA 4F3LB 1LL8A 3BY8A 5LBRA 3EGXC 3C30A 5HPFA 2QWSA 2W27A 4R3AA 3F1OA 2OAP1 4WN5A 5J3WA 3EQUA 3OCLA 4JGOA 1T1BA 1UWPX 3K2NA 2OWJA 2Y8HA 4NXBA 4MN6A 1D06A 4HJ6A 5IU1A 2P7JA 3TJZC 4Y3IA 4GHIB 3RTYA 2W1TB 5F6AA 3KYZA 3ZYTA 3FPVA 4EEPA 4EQ1A 1V9YA 3R7WB 4HQAA 1P9WA 4E04A 3MF0A 4BWIA 1P9RA 2W3DA 1ZTUA 3G6OA 2VJWA 3LR5A 4IHQA 4O8GA 1N9NA 2J3TC 4HIAA 1F9IA 3PR6A 1MKMA 3T4KA 4Z1WA 4KQOA 1H3QA 2ZOHA 5G4YA 1OTDA 3PYPA 1TF1A 4Y5FA 3OOVA 4NXEA 1S67L 3T50A 1GSXA 4LPZA 4ETZA 3B47A 3OLOA 3MQ0A 1OTBA 4ETXA 1T19A 4KUOA 1S1YA 2LB9A 2A24B 1D7EA 2J80A 1W63Q 1G6OA 3TE8A 4L9EA 2V9AA 2QKPA 4HH2A 4XT2A 5F69A 2LB5A 3TRCA 4WELA 3VE4A 3T4OA 4BMWA 3H9WA 3PBSA 3S7OA 2HJEA 3FPWA 3HJIA 4NKPA 1XJ2A 2KOIA 2PYPA 3C2WA 5J7EA 2VLGA 2D01A 1S66L 4P6ZM 3CLOA 4F3LA 2J3TD 3K3CA 3KO6A 3MR0A 4CLCE 1N9LA 4BBTA 4R38A 1BYWA 4ZRRA 3HCYA 1TS0A 3NOPC 1TD5A 1F5MA 2HF6A 3K3DA 3LIAA 2XSSA 4L9GA 4JGPA 3KX0X 1P97A 3CI6A 3E4OA 1S4RA 2W1TA 3MQQA 2XA7S 2XROA 3MMHA 5DF9A 2GX5A 4R6LA 2O99A 1IFQA 3BQ8A 2VKSA 2V0WA 5G4ZA 4AFIA 1OT9A 2JHEA 5EFWA 4RQ9A 4EU0A 5DFXA 4L9FA 4HHDA 3SW1A 3CITA 3MXQA 4G3KA 3ULFA 4HOIA 3PBOA 5J4EA 1VB6A 5HDDA 3E0YA 5TJJA 3EGDC 3E4QA 4KQDA 3LUQA 4M4XA 4CLCA 3T4SA 2K31A 5HDSA 3EQVA 5KSHA 4PHTA 3R4KA 2YKFA 3UB6A 1DP9A 3C8CA 4LRZE 1P0ZA 3FC7A 2MJ6A 1IOUA 3LI8A 5DJUA 2L4RA 5IT5A 2K7SA 3PBQA 1LSWA 4EERA 3VV4A 2A24A 3S7NA 3CWFA 2VV6A 1T1AA 2YKHA 2B18A 4IUHA 4O01A 5K5BA 4I3AA 2M7VA 1ODVA 1V9ZA 2GJ3A 5L8MA 3DBAA 1F98A 2PT7A 4HH3A 1T1CA 1H8MA 3F1PA 3C38A 2HV1A 4NXFA 1WA9A 1GSWA 3H7WB 3NHQA 4JGQA 4JGRA 1X0OA 4YWZA 3BJNA 3PBNA 2INWA 2PR6A 3LR0A 3P7NA 2QJ5A 3IBJA 1XJ4A 5DKKA 3H82B 4WF0A 3BWLA 3CUEA 2VGLS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VOL A;  4I39 A;  2VV8 A;  4EES A;  4HNB A;  2WKQ A;  3D72 A;  2M1C A;  1Y28 A;  1MZU A;  4I5S A;  4HI4 A;  1OJG A;  1OTE A;  2R78 A;  3BY9 A;  5TBM A;  4BBV A;  2W0N A;  5DKL A;  3IS2 B;  4EEU A;  5AVE A;  3NOT C;  1TS7 A;  2VV7 A;  4LLO B;  4I3J A;  5KIZ A;  1DP8 A;  2CMN A;  1DRM A;  4GHI A;  2B02 A;  3E4P A;  3UE6 A;  3A0V A;  1T18 A;  4PKY G;  5HD5 A;  2WKR A;  4DJ2 A;  1GSV A;  4HJ4 A;  2OOL A;  3LIE A;  1OTA A;  3RH8 B;  3H7W A;  1KOU A;  2KX6 A;  3B33 A;  3UB9 A;  4HY8 A;  2QHK A;  1XFQ A;  1TS6 A;  2H28 A;  4EW7 A;  3F1N B;  4HP9 A;  5I5L A;  3MJQ A;  5HWV A;  4HP4 A;  4GCZ A;  3ZQ5 A;  4H6J B;  2EA9 A;  2L0W A;  1EW0 A;  5IS1 A;  4I3I A;  4GS9 B;  4WL9 A;  3EWK A;  2PD8 A;  3FG8 A;  4KUK A;  5HD3 A;  4WUJ A;  4HJ3 A;  3UMD A;  1LT0 A;  2WKP A;  4MN5 A;  2QJ7 A;  3BWL A;  4I38 A;  2D02 A;  4R70 A;  3IS2 A;  2L1M A;  5HZH A;  4NXG A;  2PD7 A;  1NWZ A;  2V0U A;  4B9O A;  4LRY C;  5HWW A;  3LID A;  5DJT A;  3CAX A;  3ICY A;  5F68 A;  4WLA A;  4DJ3 A;  3LIB A;  2KDK A;  4EET B;  4BBU A;  3HJK A;  1XJ3 A;  2PYR A;  3MFX A;  1N9O A;  2PDR A;  3UB8 A;  3LI9 A;  1OTI A;  1LSX A;  2VEA A;  3MQO A;  3F1O B;  3PHY A;  3NJA A;  3F1N A;  2V1A A;  5HSQ A;  3LYX A;  3UME A;  1XFN A;  3IBR A;  2ZBB A;  4H6J A;  2Z6D A;  4EXO A;  4GS9 A;  1XJ6 A;  1TS8 A;  2JN7 A;  1S1Z A;  3F1P B;  1JNU A;  3A0R A;  1OJ5 A;  5HDC A;  2PHY A;  3VE3 A;  1DP6 A;  3EEH A;  1OT6 A;  2Z6C A;  4K08 A;  3LIF A;  2ZOI A;  1UGU A;  2PR5 A;  1G28 A;  3A0S A;  5A8B A;  4LRX C;  3H82 A;  2I9V A;  4GW9 A;  2V1B A;  1UWN X;  4XT2 B;  3LIC A;  4PKY A;  3GDI A;  2BAS A;  5AVF A;  3NOU C;  1S4S A;  3UB7 A;  5TBM B;  3GEC A;  1LSV A;  5F5Y A;  2OWH A;  4F3L B;  1LL8 A;  3BY8 A;  2QWS A;  2W27 A;  4R3A A;  3F1O A;  4WN5 A;  5J3W A;  4JGO A;  1T1B A;  1UWP X;  2OWJ A;  4NXB A;  4MN6 A;  1D06 A;  4HJ6 A;  5IU1 A;  2P7J A;  4GHI B;  3RTY A;  5F6A A;  4EEP A;  4EQ1 A;  1V9Y A;  4HQA A;  4E04 A;  3G6O A;  1N9N A;  4HIA A;  1F9I A;  2ZOH A;  5G4Y A;  1OTD A;  3PYP A;  4NXE A;  3T50 A;  1S67 L;  1GSX A;  4LPZ A;  3OLO A;  1OTB A;  1T19 A;  4KUO A;  1S1Y A;  2A24 B;  1D7E A;  2J80 A;  4L9E A;  4XT2 A;  2V9A A;  2QKP A;  4HH2 A;  5F69 A;  3VE4 A;  3H9W A;  3HJI A;  1XJ2 A;  2PYP A;  3C2W A;  5J7E A;  2VLG A;  2D01 A;  1S66 L;  3CLO A;  4F3L A;  3K3C A;  3MR0 A;  1N9L A;  4BBT A;  4R38 A;  1BYW A;  1TS0 A;  3NOP C;  3K3D A;  3LIA A;  4L9G A;  4JGP A;  3KX0 X;  1P97 A;  3E4O A;  1S4R A;  3MQQ A;  4R6L A;  2V0W A;  5G4Z A;  1OT9 A;  2JHE A;  5EFW A;  4RQ9 A;  4L9F A;  4HHD A;  3SW1 A;  3MXQ A;  3ULF A;  4HOI A;  5J4E A;  1VB6 A;  5HDD A;  3E4Q A;  4KQD A;  3LUQ A;  4M4X A;  5HDS A;  2YKF A;  3UB6 A;  1DP9 A;  3C8C A;  4LRZ E;  1P0Z A;  3FC7 A;  3LI8 A;  5DJU A;  2L4R A;  2K7S A;  1LSW A;  4EER A;  2A24 A;  3CWF A;  2VV6 A;  1T1A A;  2YKH A;  4I3A A;  1ODV A;  1V9Z A;  2GJ3 A;  1F98 A;  4HH3 A;  1T1C A;  3F1P A;  2HV1 A;  4NXF A;  1WA9 A;  1GSW A;  3H7W B;  3NHQ A;  4JGQ A;  4JGR A;  1X0O A;  4YWZ A;  2INW A;  2PR6 A;  3P7N A;  2QJ5 A;  1XJ4 A;  5DKK A;  3H82 B;  4WF0 A;  5HWT A; 
#chains in the Genus database with same CATH topology
 4EBN A;  3KSI A;  2GNX A;  4DRT A;  3TSG A;  3PXP A;  3O5Y A;  2RCX A;  4I5S A;  3A3D A;  3BRM A;  3NUL A;  3UDX A;  4JF6 A;  4NET A;  5FAS A;  5EOO A;  3VP2 A;  3V5M A;  1NLZ A;  5CX7 A;  4MDZ A;  5AVE A;  2XH9 A;  4DE0 A;  3DTE A;  1GA0 A;  4E3M A;  2ZM0 A;  1CK3 A;  2Y2N A;  3LCE A;  4DMZ A;  1DY6 A;  4LLO B;  5DVA A;  5E2E A;  1J3W A;  4S2L A;  2ZMF A;  4YNR A;  3ITB A;  1E4D A;  4DXC A;  4OOY A;  3A0V A;  4X53 A;  1K38 A;  5HL6 A;  1ES3 A;  2WKR A;  3N8S A;  3IXB A;  2C5W B;  4EUZ A;  1YSP A;  2OOL A;  1BSG A;  4GJ4 A;  4RVA A;  4Y13 A;  5L07 A;  2G2U A;  4S2O A;  4WEK A;  3HLD A;  3B42 A;  4JLF A;  3S1Y A;  4HP9 A;  1ACF A;  1ESI A;  3VFH A;  3HLW A;  3IHA A;  4GOG A;  3OBF A;  1Y4O A;  4PM9 A;  2X01 A;  2L0W A;  4M3K A;  5IS1 A;  3IWI A;  4WL9 A;  3EWK A;  1HVB A;  1MKI A;  5A90 A;  1LLB A;  4R4R A;  1W63 M;  4MCW A;  4HJ3 A;  4G3V A;  2WKP A;  2QJ7 A;  2P08 A;  1U60 A;  4O7D A;  4QU3 A;  4OP5 A;  4S2K A;  4OP8 A;  4LV1 A;  3NCK A;  4KG2 A;  4D60 A;  1L0F A;  5EVI C;  5HWW A;  4MBF A;  1YLY A;  4CLC D;  1BT5 A;  3BLS A;  3BFE A;  5GLD A;  2O9B A;  3UDI A;  3ICY A;  2ZL1 A;  1ESU A;  2QZ6 A;  4ZDX A;  3T1X A;  5CEC A;  4WLA A;  4FOF A;  4EWF A;  1JWP A;  3HJK A;  1XJ3 A;  1KVL A;  1XXM A;  4LCL A;  3GMW A;  3BEB A;  2VGL M;  4BD1 A;  1W8Q A;  3O86 A;  3VP3 A;  3MQO A;  3F1O B;  4Y2F A;  3PAG A;  3F1N A;  3QP1 A;  3LYX A;  2OLV A;  2JKF A;  1XFN A;  2P04 A;  2QMI A;  4S2J A;  3PBR A;  4XXR A;  1YM1 A;  5DTT A;  3C4O A;  2OLU A;  1JWV A;  3TW8 A;  4HBT A;  1I2W A;  2PHY A;  2PBY A;  4RX2 A;  1G5U A;  1BLS A;  5FQK A;  1BLC A;  2NUP C;  1Z09 A;  2PR5 A;  3A0S A;  4E6W A;  3NC8 A;  3M2K A;  1L0D A;  3G2Y A;  3H82 A;  1RP5 A;  2JKR M;  1ES5 A;  2V1B A;  5DFY A;  1UWN X;  3D3O A;  2WAF A;  4OKP A;  1YLZ A;  1JVJ A;  4FTX A;  3T4J A;  3FWL A;  4E6X A;  3UB7 A;  3BW6 A;  5TBM B;  4DF6 A;  1N4O A;  1XKZ A;  4Y7P A;  2OWH A;  2J9P A;  4F3L B;  3IWO A;  1VET A;  5AQ7 A;  4K0W A;  1M6K A;  1MBL A;  1YMS A;  1UWP X;  2HDS A;  4JKT A;  1NRF A;  3UDF A;  2XR0 A;  1BLH A;  5F6A A;  1L0G A;  4EEP A;  4EQ1 A;  4HQA A;  3NIA A;  4BWI A;  1ZTU A;  2Y2M A;  1N9N A;  1SKO B;  4X68 A;  1F9I A;  4Y0U A;  1PI4 A;  1MKM A;  5EUA A;  1RGY A;  4U3T A;  3QNB A;  1FCN A;  4YIN A;  1OME A;  3PYP A;  4Y5F A;  3T50 A;  3WS2 A;  1CI9 A;  3MZF A;  3MQ0 A;  3L7H A;  3LGO A;  4KUO A;  2A24 B;  1ALQ A;  1D7E A;  2J80 A;  2ZQ9 A;  4L9E A;  3T1R A;  3ZVT A;  5TR7 A;  4DXB A;  2EFX A;  1VEU B;  3TRC A;  2H5S A;  1A0K A;  3RJU A;  2V8C A;  3FPW A;  4KZA A;  2D01 A;  4P6Z M;  3CLO A;  3WRZ A;  3K3C A;  3MR0 A;  1PWC A;  4KG6 A;  1MPL A;  3HCY A;  1K57 A;  1TS0 A;  2HDR A;  1ZC2 A;  2HF6 A;  1F5M A;  3DAV A;  4FUW A;  3K3D A;  5FEF A;  4L9G A;  1S0W A;  4DE1 A;  3HUM A;  3MMH A;  2JHE A;  1RCJ A;  5M19 A;  4RQ9 A;  4EU0 A;  1H0M A;  4HHD A;  3BFC A;  3MXQ A;  4G3K A;  3ULF A;  2ZC7 A;  3PBO A;  5J4E A;  3V39 A;  5HDD A;  2ACG A;  4KQD A;  3LUQ A;  5AQB A;  3T4S A;  3EQV A;  5KSH A;  1MWR A;  3SS3 A;  2L4R A;  3O88 A;  3IXH A;  2K7S A;  3DTK A;  3S7N A;  4JF4 A;  4O01 A;  4XUX A;  2H0Y A;  2M7V A;  1FIK A;  4QD4 A;  4MBK A;  4DE3 A;  1LL5 A;  4UA9 A;  4KZ3 A;  3DBA A;  1KGG A;  3FKV A;  4B4Z A;  4EV4 A;  1H8M A;  1GHI A;  1K56 D;  3F1P A;  3C38 A;  1LI9 A;  4B88 A;  3H7W B;  3TOI A;  4PM8 A;  3MS6 A;  1K0K A;  2PR6 A;  3QP2 A;  3P7N A;  1HZO A;  2DRW A;  3UE1 A;  3FKW A;  3C7V A;  3BWL A;  5HWT A;  3CUE A;  4P85 A;  3G31 A;  3IQA A;  2VV8 A;  3VOL A;  4HNB A;  2WKQ A;  3D72 A;  4F94 A;  5FSR A;  4G3W A;  3BFD A;  1Y28 A;  2JKT M;  3C5A A;  3IHB A;  4QHC A;  1OTE A;  4N9L A;  3A3J A;  1TEM A;  2XFT A;  4HES A;  5FQQ A;  4LGW A;  4BBV A;  2W0N A;  1ERQ A;  4EEU A;  3LY3 A;  4Q0J A;  4IBR A;  1TS7 A;  1NRJ A;  4KG5 A;  2VV7 A;  3A3I A;  1L0E A;  4ZBE A;  4S2P A;  4OQ0 A;  1TVF A;  2HPB A;  4I3J A;  5KIZ A;  1DP8 A;  1K57 C;  4PAU A;  3ZG9 B;  4GHI A;  4WYY A;  2DNS A;  2EWW A;  3CHW P;  3EOI A;  4CQH A;  3E4P A;  3E2L A;  4GNU A;  2HJ9 C;  3R7W A;  5AQ9 A;  5FDH A;  1GHP A;  1GHM A;  4KZB A;  3BFF A;  2V8F A;  4ZJ1 A;  1BUL A;  2XF3 A;  4UQI S;  2RL3 A;  5HAQ A;  3DTI A;  3UB9 A;  2QHK A;  2JE5 A;  4II7 A;  2IWD A;  4UEY A;  5I5L A;  2DCF A;  1I2S A;  3ZQ5 A;  4E3L A;  3LEQ A;  3IX4 A;  4KQQ A;  3QP5 A;  2EA9 A;  5F1F A;  4I3I A;  4PM6 A;  1PW8 A;  1NY0 A;  5E2F A;  1ONG A;  3KSG A;  5HD3 A;  4WUJ A;  4OVD A;  2EX9 A;  1LT0 A;  3M2J A;  3HUO A;  3JYI A;  2D02 A;  3O87 A;  4ME4 A;  4N92 A;  5L09 A;  1MWT A;  2L1M A;  4PM5 A;  4DN0 A;  1XPB A;  5EPH A;  2V0U A;  4MMN A;  1QME A;  4B9O A;  5F82 A;  4MBH A;  4OOL A;  2V1Z A;  4ARZ B;  5DJT A;  3MKF A;  3WS1 A;  4E3O A;  3NDG A;  4UA6 A;  4NK3 A;  4KZ4 A;  4U0T A;  4Y17 A;  5FQM A;  3Q82 A;  4DJ3 A;  3LIB A;  3UPO A;  2KDK A;  3CUE C;  1NJ4 A;  2PYR A;  2QYB A;  3VFF A;  5CER A;  1N9O A;  2H0T A;  2VX8 A;  3CPT B;  4UHU A;  4RX3 A;  2PDR A;  3T4L A;  3WS5 A;  1IEL A;  3HLG A;  1YAX A;  4A5R A;  3NJA A;  2V1A A;  4KZ6 A;  5HL1 A;  2FFF B;  3LR3 A;  2O0Y A;  5FAQ A;  1ZHH B;  3E98 A;  2ZBB A;  2Z6D A;  4PPR A;  4RA7 A;  2ZMV A;  5EVE A;  4GLQ A;  4B4X A;  2HDQ A;  4MEZ A;  4Y0T A;  3MXS A;  1Q2P A;  2OSU A;  2JKG A;  3Q7V B;  1JNU A;  3N7W A;  3U4L P;  5JYO A;  1HTZ A;  1DP6 A;  4OPZ A;  3EEH A;  1MC0 A;  2EFU A;  2Z6C A;  2IWB A;  3GQZ A;  3WS4 A;  4NEE D;  2JKT I;  4DDY A;  3IXG A;  4R1G A;  1UGU A;  3G35 A;  4QB8 A;  5EE8 A;  4WZ4 A;  5DTS A;  2Y79 A;  3C7U A;  5KSC A;  2FZ0 A;  1W7F A;  4LRX C;  5AQA A;  2I9V A;  1DJB A;  2XK1 A;  2VZW A;  1STZ A;  2R9W A;  3IF6 B;  5DTK A;  4OOM A;  4XT2 B;  3UE3 A;  2WAD A;  2WZZ A;  2Z2L B;  5HFO A;  2HDU A;  3SOI A;  4D2O A;  3D9Y A;  3BY8 A;  5LBR A;  3N8R A;  2FFY A;  4R3A A;  3F1O A;  5A93 A;  4WN5 A;  1XGI A;  4JF5 A;  3OCL A;  1T1B A;  3AGF A;  3K2N A;  2Y8H A;  4Y3I A;  1FIL A;  5L10 A;  2XLN A;  3KYZ A;  2X02 A;  3FPV A;  3SZT A;  2PU2 A;  1V9Y A;  2ZMA A;  2WAE A;  1HLU P;  4O8G A;  2J3T C;  3NDE A;  3PR6 A;  3Q07 A;  4KQO A;  4WBG A;  1W8Y A;  3SS5 A;  3G2Z A;  3DWK A;  4WZ5 A;  3UPP A;  4LPZ A;  4ETZ A;  1BLP A;  1YMX A;  1G6O A;  5EV0 A;  4HH2 A;  2E8I A;  5CTM A;  1KGE A;  4KZ9 A;  3PBS A;  3S7O A;  3ZHH A;  4NKP A;  1E25 A;  2KOI A;  3UB5 P;  4KQR A;  2PAV P;  3I7J A;  4F3L A;  1BTL A;  2HZ5 A;  4GKU A;  1M40 A;  1N9L A;  2ZC3 B;  4BBT A;  4R38 A;  1BYW A;  4ZRR A;  3NOP C;  2EXB A;  2ZL1 B;  5FQ9 A;  3CI6 A;  1S4R A;  2XA7 S;  1ES4 A;  2XRO A;  1PWD A;  2ZQ8 A;  5DF9 A;  1GCE A;  2GX5 A;  1TDG A;  3MKE A;  4LFU A;  4R6L A;  1IFQ A;  3BQ8 A;  2V0W A;  4AFI A;  1FSY A;  3G30 A;  4BQM A;  5EFW A;  3IX3 A;  2UWX A;  1SKO A;  3Q7Z A;  2XQZ A;  4HOI A;  3E0Y A;  3E4Q A;  4CLC A;  5CRF A;  3A3E A;  4ZJ2 A;  3ZDJ A;  2Y2J A;  1DP9 A;  3UB6 A;  3FC7 A;  2MJ6 A;  1VM1 A;  4N1H A;  1K6S A;  2A24 A;  4IUH A;  4OLD A;  2B18 A;  3OPR A;  1YQS A;  2V20 A;  4I3A A;  1NZO A;  1V9Z A;  2WYX A;  1O07 A;  1VEU A;  3VOY A;  3VP0 A;  2PT7 A;  4HH3 A;  2GDN A;  5GHY A;  2WKH A;  4RYE A;  4GN2 A;  3ISG A;  3HLC A;  2HV1 A;  4X69 A;  1PRQ A;  4JGR A;  1X0O A;  1FQG A;  4YWZ A;  4S2N A;  5FI6 A;  5E43 A;  2ZQA A;  3IBJ A;  5DKK A;  5FQJ A;  2B95 A;  4LV2 A;  5FEG A;  3H82 B;  4EUV A;  1FOF A;  1YLW A;  4I39 A;  5U47 A;  3RFB A;  3QP6 A;  3B3X A;  4IVI A;  2M1C A;  2Y2G A;  4PMA A;  4OLG A;  5KMW A;  1MZU A;  3M6H A;  4HI4 A;  4Q0H A;  1OJG A;  4WMC D;  2R78 A;  3BY9 A;  1IYP A;  4FD8 A;  4GZB A;  2O9A A;  4CPK A;  3OPP A;  3IS2 B;  4DKI A;  3QP4 A;  1WYC A;  3C4P A;  1IYO A;  3EEA A;  3HBR A;  4MN7 A;  5A92 A;  5CHJ A;  5AJG A;  1PYY A;  3BFG A;  5HPI A;  2JC7 A;  1GA9 A;  3KYQ A;  4N9K A;  1YT4 A;  5FAO A;  2CMN A;  1KGF A;  4BJP A;  2K2N A;  4L0L A;  4ZTK A;  2JBF A;  3VSL A;  1T18 A;  4Y0O A;  4H8R A;  1FCO A;  4DJ2 A;  1GSV A;  2P9V A;  4BL3 A;  4GDN A;  4HJ4 A;  1E3U D;  3LIE A;  4JBF A;  4DE2 A;  4X25 A;  3H7W A;  4P87 A;  1KOU A;  2KX6 A;  3VP1 A;  4JXG A;  2C6W B;  3B33 A;  1PNE A;  3G34 A;  3QNC A;  3V3S A;  3OC2 A;  3N6I A;  1XA1 A;  4CLC C;  4P0M A;  4X6T A;  1XFQ A;  2H28 A;  2O9C A;  4EW7 A;  4R3J A;  5HWV A;  4HP4 A;  3CZD A;  4GCZ A;  4YFM A;  2E8J A;  1CF0 A;  4H6J B;  5D3O A;  3ZGA B;  3Q81 A;  1C3B A;  1EW0 A;  4GS9 B;  2PD8 A;  3FG8 A;  1YKD A;  4EBP A;  3GVB A;  3ZVW A;  1MXO A;  1MY8 A;  4WM9 A;  3UMD A;  5CHM A;  4Q0I A;  2EWV A;  1TDL A;  3ZG8 B;  5GHX A;  5HZH A;  3BLM A;  4K91 A;  3HUN A;  4NXG A;  2JKR I;  2PD7 A;  4HEF A;  1NWZ A;  4FH4 A;  5J8X A;  2W3E A;  3BQA A;  4LRY C;  1L3L A;  1NZU A;  1JTG A;  4GDB A;  2A3U A;  1FSW A;  1KDW A;  2ZJ9 A;  3CAX A;  2ZLY A;  5F68 A;  4S2N C;  3JVV A;  3IX8 A;  3L9K A;  4X56 A;  2EX2 A;  5KZH A;  4QY5 A;  4EET B;  4BBU A;  3MBZ A;  1IKG A;  3MFX A;  5FDS A;  2JCH A;  2ZM2 A;  4E3J A;  1WYB A;  1G68 A;  3DWZ A;  1ZKJ A;  3W2Z A;  3LI9 A;  3FZC A;  2VEA A;  4KZ8 A;  3IXD A;  2HGV A;  5HAR A;  2XRN A;  3N8L A;  5FI7 A;  3ZFZ A;  4Z9Q A;  5EVI D;  3IBR A;  1YSQ A;  4OQH A;  1JWZ A;  2Z2M B;  4BL2 A;  2W3H A;  2J3W A;  4EXO A;  3AGD A;  1NLY A;  1TS8 A;  3PAE A;  1S1Z A;  5TGF A;  1SCW A;  3F1P B;  4MNR A;  1LL9 A;  3A0R A;  4S2I A;  3S4X A;  3N4I A;  1CEG A;  5HDC A;  3P09 A;  3VE3 A;  1VHM A;  5CGS A;  4FSF A;  3LFV A;  4JPM A;  1LHY A;  4X1M A;  5I94 A;  2WGW B;  1G28 A;  3OPH A;  1D1J A;  4ARZ A;  4GD6 A;  1K4E A;  5E2H A;  1ZG6 A;  1K56 A;  4OPY A;  1AWI A;  5FA7 A;  2FH5 A;  3NEC A;  3T4T A;  4UQI M;  2EX6 A;  4PKY A;  2IWC A;  3CPT A;  5CGX A;  3NOU C;  5FL3 A;  3S7P A;  3GEC A;  1LSV A;  5F5Y A;  1LL8 A;  5HPF A;  2XD1 A;  1SHV A;  2OAP 1;  4HBU A;  1PW1 A;  1BZA A;  4NXB A;  4MN6 A;  1D06 A;  5CXW A;  2VGJ A;  3MFD A;  2P7J A;  2Y2L A;  4GHI B;  3RTY A;  5M18 A;  2W1T B;  2WZX A;  4KZ5 A;  4KZ7 A;  1K55 A;  3R7W B;  4FH2 A;  5EEC A;  4E04 A;  3MF0 A;  4PM7 A;  2W3D A;  3Q7V A;  3G6O A;  4OPQ A;  1PZO A;  4LCM A;  3LR5 A;  2Q9M A;  4HIA A;  1W79 A;  3T4K A;  1G6A A;  4Z1W A;  1H3Q A;  5TFQ A;  2VK3 A;  2WKE A;  5G4Y A;  1TF1 A;  3OOV A;  1S67 L;  3NBL A;  3T1Q B;  5CED A;  1XP4 A;  1CJF A;  4ETX A;  2LB9 A;  3IF6 A;  1W63 Q;  5JYP A;  2V9A A;  2QKP A;  4XT2 A;  5F69 A;  1DJC A;  3T4O A;  4BMW A;  3H9W A;  2PRF A;  3ITA A;  2HJE A;  3HJI A;  4MLL A;  4JXS A;  2PYP A;  3C2W A;  1K25 A;  4R0Q A;  3JPU A;  2VLG A;  3G4P A;  4UA7 A;  5GHZ A;  3RXW A;  3CMZ A;  2ZC4 B;  3KO6 A;  3UN7 A;  5EVI B;  4R4S A;  2BG1 A;  1FR6 A;  2ZC6 B;  1PIO A;  4KEN B;  4JGP A;  5HAI A;  4E3N A;  4QJG A;  3HL9 A;  3E4O A;  3DW0 A;  2VKS A;  5G4Z A;  1NXY A;  3SH8 A;  3VP4 A;  5DFX A;  4L9F A;  2Y2H A;  2P74 A;  3SW1 A;  3CIT A;  3MZD A;  3LEZ A;  2XEP A;  2XDM A;  3EGD C;  4UAA A;  2G2W A;  1KE0 A;  5F83 A;  3UO9 A;  3V50 A;  4PHT A;  3R4K A;  2Y55 A;  3GSG A;  1AXB A;  1P0Z A;  3FV7 A;  3MSH A;  5IT5 A;  3W4Q A;  4LV0 A;  1LSW A;  4C6Y A;  4OQI A;  3VV4 A;  2VV6 A;  2YKH A;  1S6R A;  3Q1F A;  5K5B A;  4EBL A;  1SKF A;  1ERM A;  1KE4 A;  2PBD P;  2GJ3 A;  3SS4 A;  3ZNY A;  5L8M A;  2EX8 A;  3VOZ A;  1RGZ A;  1SDE A;  1T1C A;  3BEC A;  1CEF A;  4E3K A;  4JXV A;  3AGE A;  3LO7 A;  1IYS A;  2ZM8 A;  1JTD A;  3ZNT A;  1LI0 A;  1K55 C;  2BLS A;  2HP6 A;  4NXF A;  1GSW A;  4JGQ A;  2VGK A;  1IKI A;  3BJN A;  2INW A;  5E2G A;  3LR0 A;  5IHV A;  1XJ4 A;  4IED A;  3IH8 A;  4BD0 A;  4WF0 A;  5GL9 A;  2VGL S;  2H10 A;  1QMF A;  2W3G A;  2J7V A;  4Y15 A;  4EES A;  3S7Q A;  3W4O A;  5FQI A;  3PBT A;  1ERO A;  3HRE A;  4EQI A;  5EM1 A;  3IF6 C;  3T1S A;  5GLB A;  3HLF A;  2HP9 A;  3E2K A;  3T4Q A;  5TBM A;  2ZQC A;  3VMA A;  4K0X A;  5FI2 A;  5C5K A;  5EM0 A;  5DKL A;  3UNW A;  3NOT C;  5GLA A;  4QPR A;  1FCM A;  3SH7 A;  2Y2Q A;  1K4F A;  3U2A A;  5HX9 A;  2KLI A;  4LV3 A;  2Q0O A;  4U0X A;  4IJG A;  2M7U A;  1NYY A;  1DRM A;  2B02 A;  1XX2 A;  2OV5 A;  3UE6 A;  3IT9 A;  2Y2I A;  3KSH A;  4PKY G;  5HD5 A;  1PI5 A;  4O0P A;  1K6R A;  3TG9 A;  5FAP A;  1YLT A;  3QP8 A;  1OTA A;  3RH8 B;  2W3F A;  2XA7 M;  2V2F F;  3JVU A;  3BYD A;  4HY8 A;  1Y54 A;  1YPR A;  2DMW A;  2IA2 A;  1TS6 A;  1HD8 A;  3F1N B;  3MJQ A;  3CG5 A;  3GRJ A;  2J8Y A;  3OCN A;  3OZH A;  3D4F A;  3LR4 A;  4P6B A;  1K54 A;  1ZG4 A;  3P98 A;  5MC7 A;  3FYZ A;  4KUK A;  1EWZ A;  4S2M A;  3V67 A;  1SZV A;  4GB7 A;  1XA7 A;  4MN5 A;  4I38 A;  4R70 A;  3IS2 A;  2X71 A;  1MWS A;  2UV0 E;  1IEM A;  4R3B A;  2AVX A;  3ZG7 B;  3A3F A;  3ZG0 A;  1L2S A;  3LID A;  2CC1 A;  1CQA A;  3SH9 A;  4CJN A;  3CJM A;  2A2L A;  3DTM A;  2G7U A;  4WZ5 C;  3W4P A;  4FCF A;  4CLC B;  4QY6 A;  2OAQ 1;  4X55 A;  1SDN A;  1FR1 A;  3UB8 A;  5G18 A;  4IBX A;  4BEN A;  1J9M A;  2Y59 A;  1OTI A;  3MZE A;  2W1R A;  1OPX A;  1LSX A;  2WUQ A;  4IVK A;  3P01 A;  1H8Z A;  1VET B;  3PHY A;  5CEB A;  2J9O A;  1H8Y A;  4OPR A;  5EVL A;  4BLM A;  5HSQ A;  2GZA A;  2HP5 A;  4P6Z S;  1Q2Q A;  3UME A;  3GTC A;  5FAT A;  4B93 A;  4E3I A;  4H6J A;  5EOE A;  3GV9 A;  4WEJ A;  1KVM A;  4GS9 A;  1XJ6 A;  2XFS A;  2JN7 A;  4XUZ A;  3V3R A;  3W8K A;  4YOF A;  1OJ5 A;  4C75 A;  2XD5 A;  1F2K A;  2PU4 A;  2NUT C;  3KSF A;  1OT6 A;  4K08 A;  3LIF A;  4Q8I A;  2ZOI A;  1W5D A;  1KE3 A;  1PZP A;  3ZG5 A;  2ZQ7 A;  3QHY A;  2Y2P A;  5A8B A;  4OQG A;  4QWO A;  2VA0 A;  4GW9 A;  4IUK A;  4C3Q A;  2WGV A;  3LIC A;  3UPN A;  3GDI A;  2BAS A;  3WWX A;  5AVF A;  1S4S A;  1K54 C;  2Y2O A;  4R23 A;  5CHU A;  1PWG A;  3EGX C;  3C30 A;  3M6B A;  2QWS A;  2W27 A;  3NI9 A;  2EXA A;  5J3W A;  3EQU A;  4JGO A;  3T12 B;  2OWJ A;  1PFL A;  5DF7 A;  4WMC A;  3IF5 A;  4HJ6 A;  5IU1 A;  3TJZ C;  1DJA A;  4N1X A;  3ZYT A;  3VSK A;  1N9B A;  1P9W A;  1P9R A;  2P9V B;  1VQQ A;  2VJW A;  4IHQ A;  3ZCZ A;  2ZQD A;  1YLP A;  1NYM A;  1XGJ A;  3NY4 A;  3UE0 A;  4JXW A;  2ZOH A;  2I72 A;  5BOH A;  1OTD A;  2WGW A;  4LEN A;  4NXE A;  1ONH A;  1GSX A;  3B47 A;  3OLO A;  1OTB A;  1T19 A;  1S1Y A;  3KYE A;  1E3U A;  5CGW A;  3TE8 A;  5HAP A;  1I5Q A;  2LB5 A;  3VE4 A;  3LY4 A;  4WEL A;  3WRT A;  3HVF A;  2Q9N A;  1XJ2 A;  2BTF P;  5J7E A;  1MWU A;  1S66 L;  4DDS A;  3HLE A;  2J3T D;  2WKI A;  4CLC E;  2QPN A;  2ZC5 B;  4X1L A;  1CI8 A;  1TD5 A;  1YLJ A;  1EI5 A;  3LIA A;  2XSS A;  3KX0 X;  1P97 A;  3MQQ A;  2W1T A;  5M1A A;  3WS0 A;  2O99 A;  3HLB A;  3GR2 A;  1OT9 A;  2R9X A;  1KDS A;  1H5X A;  3G32 A;  4ESP A;  1ES2 A;  1VB6 A;  5TJJ A;  4M4X A;  3BM6 A;  2K31 A;  3UY6 A;  5HDS A;  1BUE A;  3S22 A;  2YKF A;  4NG2 A;  3IH9 A;  3C8C A;  4LRZ E;  4OH0 A;  3RXX A;  1IOU A;  3LI8 A;  5DJU A;  4ZAM A;  2A49 A;  3PBQ A;  1Z6F A;  2WGI A;  4EER A;  3CWF A;  1WE4 A;  1T1A A;  3PTE A;  3IWQ A;  4ZJ3 A;  1ODV A;  2XGN A;  5DF8 A;  5A91 A;  1F98 A;  2WK0 A;  3OPL A;  5F1G A;  5L2F A;  3O3V A;  1IYQ A;  4GD8 A;  2ZD8 A;  5GLC A;  1WA9 A;  5EVI A;  3MXR A;  4OON A;  1O7E A;  4ID4 A;  2Y91 A;  3NHQ A;  3PBN A;  2B5R A;  5HW3 A;  5CTN A;  2QJ5 A;  2Y2K A;  2Y4A A; 
#chains in the Genus database with same CATH homology
 3VOL A;  2W3G A;  4I39 A;  2VV8 A;  3KSI A;  2GNX A;  3RFB A;  4EES A;  3PXP A;  3S7Q A;  4HNB A;  2WKQ A;  3D72 A;  3O5Y A;  2M1C A;  4G3W A;  1Y28 A;  3PBT A;  2JKT M;  1MZU A;  4I5S A;  4HI4 A;  4Q0H A;  1OJG A;  1OTE A;  2R78 A;  3BY9 A;  3T4Q A;  5TBM A;  4BBV A;  1NLZ A;  2W0N A;  2O9A A;  5CX7 A;  4MDZ A;  5C5K A;  5DKL A;  3IS2 B;  4EEU A;  5AVE A;  3NOT C;  4QPR A;  4Q0J A;  1TS7 A;  1NRJ A;  3EEA A;  2VV7 A;  3U2A A;  4MN7 A;  2KLI A;  5AJG A;  4DMZ A;  4LLO B;  4I3J A;  5HPI A;  5KIZ A;  1DP8 A;  2M7U A;  3KYQ A;  4IJG A;  4PAU A;  2CMN A;  2ZMF A;  1DRM A;  4YNR A;  4GHI A;  2B02 A;  4BJP A;  2EWW A;  3EOI A;  2K2N A;  4L0L A;  3E4P A;  4CQH A;  3UE6 A;  3A0V A;  2HJ9 C;  3R7W A;  1T18 A;  5HL6 A;  5HWT A;  3KSH A;  4PKY G;  5HD5 A;  2WKR A;  4O0P A;  4DJ2 A;  1GSV A;  4HJ4 A;  1YSP A;  2OOL A;  3LIE A;  1OTA A;  3RH8 B;  2W3F A;  3H7W A;  2XA7 M;  1KOU A;  2KX6 A;  4GJ4 A;  3JVU A;  4UQI S;  3B33 A;  3UB9 A;  4HY8 A;  2QHK A;  3OC2 A;  4WEK A;  3B42 A;  4CLC C;  2DMW A;  2IA2 A;  1XFQ A;  1TS6 A;  2H28 A;  2O9C A;  4II7 A;  4EW7 A;  4UEY A;  3F1N B;  4HP9 A;  5I5L A;  3MJQ A;  5HWV A;  4HP4 A;  3OCN A;  4GCZ A;  3LR4 A;  3ZQ5 A;  4H6J B;  3OBF A;  2EA9 A;  2L0W A;  1EW0 A;  5IS1 A;  4I3I A;  4GS9 B;  4WL9 A;  5MC7 A;  3EWK A;  2PD8 A;  3FG8 A;  1YKD A;  4KUK A;  3KSG A;  5HD3 A;  4WUJ A;  1W63 M;  4MCW A;  4HJ3 A;  4G3V A;  3UMD A;  1LT0 A;  3V67 A;  2WKP A;  4MN5 A;  2QJ7 A;  4I38 A;  4Q0I A;  2D02 A;  2EWV A;  4R70 A;  2P08 A;  3IS2 A;  4ME4 A;  2L1M A;  5HZH A;  4NXG A;  4DN0 A;  2JKR I;  2PD7 A;  1NWZ A;  2V0U A;  2W3E A;  3BQA A;  4MMN A;  4B9O A;  4LRY C;  5HWW A;  4OOL A;  4CLC D;  3LID A;  4ARZ B;  5DJT A;  2O9B A;  3CAX A;  3ICY A;  5F68 A;  3JVV A;  4WLA A;  4FOF A;  4DJ3 A;  3LIB A;  2KDK A;  4EET B;  4BBU A;  3CUE C;  2A2L A;  3HJK A;  1XJ3 A;  2PYR A;  2QYB A;  2G7U A;  3MFX A;  1N9O A;  4CLC B;  2VX8 A;  2OAQ 1;  2PDR A;  3T4L A;  2VGL M;  3UB8 A;  3W2Z A;  3LI9 A;  1OTI A;  2W1R A;  1OPX A;  1LSX A;  2VEA A;  3MQO A;  3P01 A;  3F1O B;  3PHY A;  1YAX A;  3NJA A;  4Y2F A;  2HGV A;  3F1N A;  2V1A A;  2XRN A;  5HSQ A;  3LYX A;  3LR3 A;  2GZA A;  2O0Y A;  4P6Z S;  3UME A;  1ZHH B;  1XFN A;  3E98 A;  3IBR A;  2ZBB A;  1YSQ A;  2P04 A;  4B93 A;  4H6J A;  2Z6D A;  4WEJ A;  2W3H A;  2ZMV A;  2J3W A;  4GLQ A;  4EXO A;  3PBR A;  4EUV A;  4GS9 A;  1XJ6 A;  1NLY A;  1TS8 A;  2JN7 A;  1S1Z A;  3F1P B;  1JNU A;  3A0R A;  4YOF A;  1OJ5 A;  3TW8 A;  5HDC A;  2PHY A;  3VE3 A;  1VHM A;  1DP6 A;  2NUT C;  3EEH A;  3KSF A;  1MC0 A;  1OT6 A;  2Z6C A;  3LIF A;  4FSF A;  4K08 A;  3LFV A;  4NEE D;  2JKT I;  2ZOI A;  1UGU A;  2NUP C;  2PR5 A;  1G28 A;  3A0S A;  2Y79 A;  4ARZ A;  5A8B A;  2FZ0 A;  2VA0 A;  4LRX C;  3H82 A;  2I9V A;  4GW9 A;  4IUK A;  2VZW A;  1STZ A;  2FH5 A;  2JKR M;  4OOM A;  3T4T A;  2V1B A;  5DFY A;  1UWN X;  3D3O A;  4UQI M;  4XT2 B;  3LIC A;  4PKY A;  3GDI A;  2BAS A;  3T4J A;  5AVF A;  3NOU C;  5FL3 A;  3UE3 A;  1S4S A;  3S7P A;  3UB7 A;  3BW6 A;  5TBM B;  3GEC A;  1LSV A;  5F5Y A;  2OWH A;  4F3L B;  1LL8 A;  3BY8 A;  5LBR A;  3EGX C;  3C30 A;  5HPF A;  2QWS A;  2W27 A;  4R3A A;  3F1O A;  2OAP 1;  4WN5 A;  5J3W A;  3EQU A;  3OCL A;  4JGO A;  1T1B A;  1UWP X;  3K2N A;  2OWJ A;  2Y8H A;  4NXB A;  4MN6 A;  1D06 A;  4HJ6 A;  5IU1 A;  2P7J A;  3TJZ C;  4Y3I A;  4GHI B;  3RTY A;  2W1T B;  5F6A A;  3KYZ A;  3ZYT A;  3FPV A;  4EEP A;  4EQ1 A;  1V9Y A;  3R7W B;  4HQA A;  1P9W A;  4E04 A;  3MF0 A;  4BWI A;  1P9R A;  2W3D A;  1ZTU A;  3G6O A;  2VJW A;  3LR5 A;  4IHQ A;  4O8G A;  1N9N A;  2J3T C;  4HIA A;  1F9I A;  3PR6 A;  1MKM A;  3T4K A;  4Z1W A;  4KQO A;  1H3Q A;  2ZOH A;  5G4Y A;  1OTD A;  3PYP A;  1TF1 A;  4Y5F A;  3OOV A;  4NXE A;  1S67 L;  3T50 A;  1GSX A;  4LPZ A;  4ETZ A;  3B47 A;  3OLO A;  3MQ0 A;  1OTB A;  4ETX A;  1T19 A;  4KUO A;  1S1Y A;  2LB9 A;  2A24 B;  1D7E A;  2J80 A;  1W63 Q;  1G6O A;  3TE8 A;  4L9E A;  2V9A A;  2QKP A;  4HH2 A;  4XT2 A;  5F69 A;  2LB5 A;  3TRC A;  4WEL A;  3VE4 A;  3T4O A;  4BMW A;  3H9W A;  3PBS A;  3S7O A;  2HJE A;  3FPW A;  3HJI A;  4NKP A;  1XJ2 A;  2KOI A;  2PYP A;  3C2W A;  5J7E A;  2VLG A;  2D01 A;  1S66 L;  4P6Z M;  3CLO A;  4F3L A;  2J3T D;  3K3C A;  3KO6 A;  3MR0 A;  4CLC E;  1N9L A;  4BBT A;  4R38 A;  1BYW A;  4ZRR A;  3HCY A;  1TS0 A;  3NOP C;  1TD5 A;  1F5M A;  2HF6 A;  3K3D A;  3LIA A;  2XSS A;  4L9G A;  4JGP A;  3KX0 X;  1P97 A;  3CI6 A;  3E4O A;  1S4R A;  2W1T A;  3MQQ A;  2XA7 S;  2XRO A;  3MMH A;  5DF9 A;  2GX5 A;  4R6L A;  2O99 A;  1IFQ A;  3BQ8 A;  2VKS A;  2V0W A;  5G4Z A;  4AFI A;  1OT9 A;  2JHE A;  5EFW A;  4RQ9 A;  4EU0 A;  5DFX A;  4L9F A;  4HHD A;  3SW1 A;  3CIT A;  3MXQ A;  4G3K A;  3ULF A;  4HOI A;  3PBO A;  5J4E A;  1VB6 A;  5HDD A;  3E0Y A;  5TJJ A;  3EGD C;  3E4Q A;  4KQD A;  3LUQ A;  4M4X A;  4CLC A;  3T4S A;  2K31 A;  5HDS A;  3EQV A;  5KSH A;  4PHT A;  3R4K A;  2YKF A;  3UB6 A;  1DP9 A;  3C8C A;  4LRZ E;  1P0Z A;  3FC7 A;  2MJ6 A;  1IOU A;  3LI8 A;  5DJU A;  2L4R A;  5IT5 A;  2K7S A;  3PBQ A;  1LSW A;  4EER A;  3VV4 A;  2A24 A;  3S7N A;  3CWF A;  2VV6 A;  1T1A A;  2YKH A;  2B18 A;  4IUH A;  4O01 A;  5K5B A;  4I3A A;  2M7V A;  1ODV A;  1V9Z A;  2GJ3 A;  5L8M A;  3DBA A;  1F98 A;  2PT7 A;  4HH3 A;  1T1C A;  1H8M A;  3F1P A;  3C38 A;  2HV1 A;  4NXF A;  1WA9 A;  1GSW A;  3H7W B;  3NHQ A;  4JGQ A;  4JGR A;  1X0O A;  4YWZ A;  3BJN A;  3PBN A;  2INW A;  2PR6 A;  3LR0 A;  3P7N A;  2QJ5 A;  3IBJ A;  1XJ4 A;  5DKK A;  3H82 B;  4WF0 A;  3BWL A;  3CUE A;  2VGL S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...