1ODVA

Photoactive yellow protein 1-25 deletion mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
100
structure length
100
Chain Sequence
LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pas Domains.Common Structure and Common Flexibility
pubmed doi rcsb
source organism Ectothiorhodospira halophila
molecule tags Signalling
molecule keywords PHOTOACTIVE YELLOW PROTEIN
total genus 29
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1odvA00
1XJ6A 3LIEA 3VOLA 2KX6A 4F3LA 1S4RA 2OWHA 5J4EA 5AVFA 1P97A 4LRZE 2JN7A 5G4YA 3IBRA 1S66L 5F6AA 5HWTA 1WA9A 5EFWA 1F9IA 2VV8A 4GHIA 5DKKA 3NOUC 5F5YA 1T1AA 3F1PB 3G6OA 1DP6A 1DP8A 2OWJA 3UB6A 1D7EA 1GSWA 2B02A 3LIBA 3H7WA 2V1BA 3CAXA 1LSXA 2I9VA 1BYWA 1S4SA 2KDKA 2QJ7A 3LUQA 3H82B 3NHQA 4I3AA 4LLOB 4EETB 3LYXA 1XFNA 4EEPA 2R78A 3PHYA 4K08A 1OJ5A 3CLOA 4GW9A 4WF0A 3ZQ5A 3H9WA 5HDDA 4EQ1A 4EESA 3LI9A 2J80A 4LPZA 1TS8A 3FG8A 4I39A 3HJIA 5DJUA 2QKPA 4RQ9A 2VEAA 4JGQA 1T19A 4XT2B 5F69A 1F98A 3C2WA 3SW1A 1LSVA 1LT0A 4PKYA 3A0VA 5HWWA 2D01A 3H7WB 4PKYG 2V1AA 4WUJA 3F1OB 3KX0X 2M1CA 5I5LA 1UGUA 3F1NB 4GS9A 1MZUA 4HJ6A 1DRMA 1OT6A 2H28A 2ZBBA 4HI4A 4GS9B 4EXOA 4HIAA 4HY8A 5G4ZA 1TS6A 4L9EA 4BBTA 2Z6CA 2GJ3A 4HJ3A 5J7EA 1NWZA 3EWKA 1LSWA 2L0WA 4HJ4A 4F3LB 5TBMB 3BY8A 1XJ4A 3F1NA 3PYPA 4JGOA 4I38A 3UB8A 2W0NA 3EEHA 2PD7A 2VV6A 4H6JB 1S67L 1OTAA 1V9YA 4JGRA 4KQDA 4M4XA 3ULFA 2V0WA 1XJ2A 5KIZA 3BWLA 3K3CA 3IS2A 1T1CA 3MQQA 4LRYC 5DKLA 5A8BA 3UB9A 1TS0A 4HOIA 3IS2B 4EEUA 2INWA 3GDIA 3LIFA 5HWVA 3LIDA 4DJ2A 3T50A 3MJQA 3NOTC 4L9GA 3H82A 4GCZA 3MFXA 4B9OA 4EW7A 4NXGA 3FC7A 4E04A 4WL9A 4WLAA 4JGPA 5AVEA 2W27A 2A24B 5IS1A 1ODVA 4HQAA 4BBUA 5HSQA 4NXEA 4R3AA 1X0OA 2P7JA 3UE6A 2WKQA 4R6LA 5J3WA 3VE4A 2PYRA 3LIAA 4R70A 1V9ZA 1VB6A 4NXBA 2PYPA 1TS7A 3ICYA 3K3DA 4I3JA 1D06A 3A0RA 3D72A 4GHIB 1OJGA 4DJ3A 2VV7A 1G28A 1T1BA 1KOUA 2PD8A 3OLOA 2QJ5A 3F1OA 5IU1A 3B33A 1N9LA 4HNBA 1Y28A 4I3IA 2L4RA 4WN5A 2V0UA 3A0SA 1XFQA 3LICA 4KUKA 1OTEA 3CWFA 3C8CA 3NOPC 4EERA 3MXQA 2PR6A 4HHDA 3MR0A 3VE3A 1LL8A 1T18A 1OTIA 2D02A 4H6JA 1GSXA 1S1ZA 2JHEA 3P7NA 3MQOA 4HP9A 1OT9A 4L9FA 3NJAA 4MN6A 5F68A 1DP9A 2CMNA 4R38A 2EA9A 1JNUA 1GSVA 1OTBA 4HP4A 4KUOA 4LRXC 3E4PA 1UWPX 3F1PA 2V9AA 2ZOIA 3HJKA 3LI8A 4HH2A 5HDCA 5TBMA 5HZHA 2WKPA 5HDSA 3RTYA 2VLGA 2ZOHA 1P0ZA 3UMDA 2WKRA 1N9OA 2PDRA 2QWSA 3E4OA 3GECA 1EW0A 4XT2A 1S1YA 2OOLA 2YKFA 2A24A 3UMEA 2QHKA 1N9NA 3RH8B 2YKHA 2K7SA 2PR5A 2Z6DA 5DJTA 2PHYA 1OTDA 1XJ3A 2HV1A 4MN5A 3UB7A 2L1MA 3E4QA 1UWNX 5HD3A 5HD5A 4BBVA 3BY9A 2BASA 4I5SA 4YWZA 4HH3A 4NXFA
chains in the Genus database with same CATH superfamily
2JKTM 4F3LA 5G4YA 1S66L 3SS4A 5JYOA 5GHXA 4NKPA 3WS1A 4GHIA 4JF6A 4QPRA 5EV0A 5IHVA 3NY4A 5A92A 1LSXA 5EE8A 3ZVWA 3WRTA 1FOFA 4KG6A 2HPBA 3CMZA 3IXGA 5CTNA 3FYZA 2R9WA 2E8JA 2X01A 3HL9A 1TS6A 4EUVA 4KZ3A 4KQOA 3GR2A 5M19A 4WEJA 2VV6A 4OONA 4IEDA 1ES5A 1TVFA 1Y54A 1K6SA 5FQ9A 4Q0HA 2P9VB 2PYRA 5J8XA 1CEGA 3A0RA 5FAQA 4Z9QA 3ZNTA 4MEZA 3BFFA 4WN5A 3A0SA 3LICA 3TE8A 5FEFA 4A5RA 4DE0A 3I7JA 4B4ZA 3R7WA 3SH7A 2QZ6A 2V9AA 4QY5A 4E3MA 3RTYA 1ESUA 2HJ9C 2WKRA 5I94A 1N9BA 1S6RA 3CG5A 2JCHA 4X69A 1IELA 2XDMA 1E25A 1WYCA 4CJNA 3ZGAB 4LGWA 1A0KA 2ZMVA 4NXFA 3IX3A 2PT7A 3LR3A 3BFCA 3CUEC 2JN7A 3MS6A 2DNSA 2WAEA 3HLCA 3G6OA 4E3LA 2OWJA 4X53A 4ETXA 2V1BA 2Y2QA 1S4SA 1G5UA 3HUMA 4Y0UA 4BD0A 4GJ4A 3Q82A 2R78A 3E2LA 3PHYA 2ZQCA 3V3RA 4D60A 3H9WA 3NULA 3PBTA 5FAPA 1KGFA 3SH9A 1S0WA 1MKMA 2EX2A 5CHMA 3ZNYA 2Y2GA 3Q7VB 3BM6A 3CJMA 4E6XA 3HLDA 4BL3A 1GCEA 2WGIA 2OV5A 3IS2A 3IF5A 3T4SA 4OVDA 4S2MA 3DTKA 3MXRA 3DTMA 4S2KA 3T1SA 4FH4A 3E2KA 3UDFA 4P85A 2M7VA 2Y2PA 2QJ5A 4GLQA 4R3JA 2LB9A 4I3IA 2L4RA 2B18A 3A3EA 4M3KA 2JE5A 3VMAA 2ZQ8A 4MMNA 2D02A 4MN6A 4BENA 2XA7M 3LFVA 5HAQA 1MWUA 3F1PA 3HJKA 1N4OA 2P04A 2QPNA 2H0YA 4WZ4A 3N6IA 4QJGA 2JKRM 1PIOA 4JBFA 3HVFA 5DTKA 2PR5A 3A3FA 1FSYA 2Y2NA 5TR7A 3NECA 3BY9A 2BASA 2XR0A 5HSQA 2PU4A 4O01A 4OLGA 3VSKA 3B47A 1ZHHB 4OP5A 4OLDA 3UO9A 2P08A 2JC7A 2ZM2A 3S7PA 5HL1A 4EV4A 1D7EA 3UPNA 2G2UA 3P09A 3NHQA 4K08A 2G7UA 2WKEA 5F69A 1KGGA 2XH9A 1YMXA 3A0VA 4PKYA 4R0QA 2M1CA 3T4KA 1DRMA 2ZBBA 5G4ZA 3DTEA 3CHWP 4HJ3A 4C75A 2EFXA 3MZFA 3ULFA 1LI9A 4N92A 5DKLA 1LL5A 3VP1A 4B9OA 1NLYA 5CGXA 4RA7A 3IQAA 4R6LA 4R70A 1VB6A 4U0TA 3K3DA 4I3JA 3T12B 4R1GA 1PW8A 1IKIA 3ZHHA 1HTZA 4HNBA 4BJPA 5U47A 3GVBA 3MR0A 1NYYA 4X56A 5FQJA 3IXDA 3MZDA 4LV1A 5KSHA 1ZC2A 3D3OA 3TSGA 3HLFA 2ZQ7A 1FCMA 2VGJA 3N8SA 5HX9A 4CLCD 3V5MA 4HESA 4PMAA 2A3UA 4C3QA 4GDBA 4MN5A 5HPFA 4P6BA 3W4PA 2XA7S 5AJGA 4OOMA 3BQ8A 3Q7VA 3E0YA 2BG1A 4Y13A 1F9IA 5F83A 2PAVP 1H8MA 1IYQA 1NLZA 5FDHA 3TRCA 4ZRRA 3DWKA 5HDDA 3KYEA 3FG8A 4G3WA 2Y79A 2VEAA 2M7UA 4F94A 1AWIA 2NUPC 1FR6A 1E3UD 3F1NB 3LEQA 3MBZA 4HI4A 4JXWA 1NRJA 2ACGA 1NWZA 4BL2A 1TD5A 2PD7A 4KQDA 1VETB 3TW8A 1CI8A 2VGKA 3IWQA 3PBOA 4QHCA 4UAAA 2O9CA 1K55C 3G32A 3QP2A 3S1YA 2P7JA 2WUQA 2W3DA 3LIAA 3U4LP 4ESPA 1L0GA 4G3VA 1JTGA 3T1XA 1L3LA 3ZYTA 1STZA 3FWLA 4R4RA 1TEMA 4ARZA 1K4EA 1XFQA 4KQRA 1I5QA 4YWZA 1XGIA 2FFYA 1JWZA 4R38A 2VA0A 4K91A 1G68A 2O9BA 2ZOHA 2PDRA 3GECA 2Z2MB 1PNEA 1DJBA 5EVEA 4R3BA 2Q0OA 3UB7A 4GKUA 3A3DA 1FILA 3BFDA 4I5SA 3GSGA 2Y2IA 3PBSA 5DF8A 1JTDA 2XEPA 4QY6A 4WZ5A 1WA9A 2PBYA 4LV2A 5CGWA 1PI4A 2AVXA 1RGZA 4LLOB 4X1MA 4OQIA 1XFNA 5FSRA 3BFGA 2J9PA 3B42A 1KGEA 2HP9A 2WYXA 4KZ6A 1T19A 4NEED 3RJUA 3IX4A 4FCFA 1LT0A 2D01A 5CEBA 4BMWA 2HZ5A 1PYYA 1W63M 3VP0A 3UE1A 3LO7A 3BECA 4H6JB 4Q0JA 3T4JA 2Y2HA 4MBFA 2Y8HA 1YAXA 3MJQA 3KSHA 4E04A 1H5XA 2W27A 1I2SA 4QWOA 4Y15A 1U60A 3LR0A 2J7VA 3UE0A 3O3VA 2VGLS 3VE3A 4H6JA 1OTIA 3MQOA 5F68A 3NJAA 2Y2JA 3E4PA 1UWPX 5CHJA 2Z2LB 1BT5A 5TBMA 3T1QB 5CRFA 3OZHA 3ZG8B 3G2YA 4MCWA 1S1YA 2QHKA 2YKHA 2Z6DA 3NIAA 5M18A 2PHYA 3N8RA 3HUOA 2ZQ9A 4O0PA 2JBFA 2PRFA 2J3WA 2DMWA 2W1TB 4GOGA 3C7UA 3G31A 1BUEA 3EGXC 3NDEA 1CJFA 4P6ZM 5F6AA 1WE4A 1SKOA 1LHYA 3IH9A 3LUQA 1HZOA 2RCXA 3UDIA 3VP4A 3CLOA 3O88A 5GHZA 3DAVA 5TGFA 3OC2A 5FQMA 4E3KA 3D9YA 4HJ6A 5CTMA 4EBNA 3IWIA 4PHTA 3QP8A 1QMEA 1ONHA 2W3GA 2MJ6A 3F1NA 3SS3A 1ES4A 1FR1A 2V0WA 4IVIA 4OOYA 4G3KA 4DXCA 2INWA 1K55A 5HWVA 4DJ2A 2ZC5B 3H82A 2ZL1A 2ZLYA 3C5AA 4JGPA 1KDSA 3LEZA 4OPRA 5DF9A 1L0FA 2Y59A 5DF7A 4B93A 5A91A 4R23A 3ZFZA 3MFDA 4KENB 3BYDA 3KSGA 4ZBEA 1KDWA 2W1TA 3FKWA 3MKEA 4DN0A 3WS5A 4X25A 5L2FA 4UA9A 2XGNA 1GA0A 3UB5P 1H8ZA 2A2LA 4CPKA 1K6RA 4BD1A 3AGFA 3HBRA 3IXHA 2EA9A 3R4KA 1G6OA 5DTSA 4MBKA 2XSSA 2J9OA 5HDSA 4ZDXA 4BWIA 4XUZA 4E3IA 4YNRA 4FTXA 3IHBA 1DJCA 2L1MA 3E4QA 4QD4A 3HLWA 5HD5A 4BBVA 2EX9A 3LIEA 3VOLA 1K0KA 4Y0TA 1RCJA 4KG2A 3VFFA 3PAEA 5F5YA 4E6WA 3MXSA 2P9VA 3M6BA 4DE1A 3EQUA 4HP4A 3CAXA 2HGVA 2KDKA 3PTEA 5EM1A 4CQHA 3DW0A 5LBRA 2QKPA 2WGVA 4ARZB 3UE3A 1LLBA 2VX8A 4X1LA 3C30A 3H7WB 2V1AA 4WUJA 3T4LA 4EUZA 4BBTA 3V67A 4IUHA 4WM9A 5GL9A 3MQQA 2XFTA 3M2JA 5E43A 4S2LA 4B88A 3PR6A 3JVVA 4OPYA 4PAUA 5KMWA 1YSQA 3V50A 4NXEA 3FKVA 3UE6A 3OBFA 2XFSA 3IX8A 4X55A 2H5SA 2VV7A 3EOIA 2PBDP 1FCNA 1XX2A 4D2OA 1N9LA 3HREA 3K2NA 4LCLA 3UY6A 1YLWA 4IHQA 2Y55A 5FQQA 1OT9A 5KZHA 5FATA 1DP9A 1HD8A 1IFQA 4WELA 2JKFA 2XLNA 4PM7A 4DXBA 3OPHA 4WYYA 2QWSA 5EOEA 4GNUA 1JWPA 1YLJA 3BLSA 3SZTA 3QP1A 1K57A 3LR4A 1Q2QA 3OPLA 2LB5A 5DKKA 5GLCA 1DP6A 1DP8A 3N7WA 3O86A 2QJ7A 5FA7A 2DCFA 1SZVA 2ZL1B 4EETB 1SDEA 4PM8A 4OQ0A 2KOIA 5L10A 3VV4A 4OH0A 4S2OA 3FV7A 1BLPA 1FIKA 1BZAA 2VK3A 4GS9A 4XUXA 5EVID 4OQHA 1YPRA 3T4OA 4GS9B 4P87A 3JVUA 3ZCZA 3TJZC 1E3UA 2Z6CA 1C3BA 1LSWA 1NRFA 1XJ2A 4IJGA 4HOIA 1ES2A 4MN7A 1BLHA 3IH8A 3FZCA 3G35A 4DRTA 1BTLA 1OJGA 1T1BA 2ZC6B 4KQQA 3ZVTA 5AQAA 3MXQA 4BBUA 3BEBA 1E4DA 1GSVA 1PFLA 4Y2FA 3E4OA 1LI0A 3SH8A 2WAFA 4JKTA 2FH5A 4GZBA 2GX5A 2H10A 4LRZE 4FOFA 3IBRA 5HWTA 4HBUA 5JYPA 2B02A 3LIBA 1BYWA 4UEYA 2RL3A 3PBQA 2EX8A 2Y2OA 5AQBA 4EESA 1EWZA 2Y2KA 1W63Q 2HF6A 3RXXA 3B3XA 1F98A 4ZTKA 3QP4A 1LSVA 4UQIS 1O7EA 4O7DA 2XROA 4GD8A 3QHYA 3BW6A 5GLAA 4I38A 2W0NA 3C4OA 3EEHA 4LENA 1OTAA 5A90A 1MXOA 4KZBA 1TS0A 2Q9MA 3NOTC 2KLIA 5CX7A 1Q2PA 4NXGA 3FC7A 1L2SA 2V8FA 4HQAA 4EU0A 5FI6A 3O5YA 3SS5A 4BLMA 1DJAA 2IWBA 2WGWB 2XQZA 1W5DA 1IEMA 4GHIB 4L0LA 1G6AA 3BQAA 5HAPA 1MWRA 2O9AA 1ERMA 3M6HA 3UNWA 3Q81A 4GB7A 5CHUA 2JHEA 4H8RA 2XF3A 4WEKA 1ERQA 5F1GA 3CUEA 3LI8A 4JF5A 2IWCA 3UMDA 1VM1A 2OOLA 2V1ZA 2A24A 2YKFA 1YMSA 5FDSA 3EEAA 2K7SA 3BRMA 4ZAMA 3DBAA 4PM6A 2B95A 4PPRA 2OWHA 1TDLA 5FAOA 1K25A 4B4XA 5EECA 1HLUP 5K5BA 1GA9A 1KE3A 3H82B 1HVBA 3OPRA 2OSUA 3FPWA 3HLEA 3L9KA 1YLYA 4WMCD 2V20A 1VEUA 3ZG9B 3EGDC 5HPIA 1PWGA 5HWWA 3VSLA 4EBLA 3DWZA 3NI9A 4RX3A 4L9EA 4JPMA 4Y17A 3KYZA 2B5RA 3BWLA 3A3JA 2EWVA 4ZJ3A 3LIFA 3GDIA 3LIDA 3LCEA 4EW7A 4XXRA 1ESIA 1XGJA 2WGWA 4IUKA 4NETA 3VE4A 4DKIA 2XRNA 1SCWA 3DTIA 3NC8A 2HDSA 1G28A 1K57C 1W79A 3O87A 3ZG5A 5MC7A 1W8YA 4DF6A 2BLSA 4EERA 4HHDA 4S2NC 5AQ7A 3P7NA 1J9MA 1CF0A 1L0DA 4JF4A 2WZXA 1GHMA 4Y7PA 5L8MA 5HFOA 3BLMA 2JKTI 4DDYA 2VLGA 2X02A 2G2WA 1N9OA 3S7OA 3FPVA 1K56D 1MC0A 3KYQA 3WS2A 4KZ8A 3LR5A 1Z6FA 1JVJA 3T4TA 1MKIA 3W4QA 3KO6A 2ZQAA 3UN7A 3QP5A 5CERA 2ZD8A 1ZG6A 5DFXA 1OMEA 1XA7A 2KX6A 1P97A 5KSCA 2K31A 3NOUC 4FD8A 3F1PB 1JWVA 4Q8IA 3W8KA 4S2IA 3WRZA 3ZDJA 3GQZA 1GSWA 4I3AA 5FQIA 3CZDA 1TF1A 3MZEA 2EX6A 1YLTA 3ZQ5A 4N9KA 3LI9A 1TS8A 3BJNA 4RQ9A 2Y2LA 2ZC3B 1IYSA 3KX0X 4MBHA 4N1HA 2K2NA 5EVIB 3D4FA 3IF6A 2L0WA 4O8GA 1K38A 1V9YA 2J8YA 4NK3A 2C6WB 3NBLA 3OPPA 3IS2B 4UHUA 3T50A 4QU3A 1ACFA 4E3JA 1CEFA 2A24B 1X0OA 1FQGA 1K56A 5AQ9A 5HAIA 3UPPA 4NXBA 3C7VA 3PBRA 3R7WB 1D06A 4K0XA 1KOUA 1XKZA 5IU1A 4OP8A 3CWFA 3NOPC 2WZZA 2PR6A 5BOHA 1K54A 1OTBA 4Q0IA 5FI7A 2WKPA 2ZMFA 1P0ZA 1YKDA 2VJWA 4EQIA 5E2FA 1XJ3A 1PWCA 1ONGA 4ME4A 5HL6A 4WBGA 1IKGA 3PAGA 2EFUA 1H8YA 4X68A 3JYIA 3C4PA 2HDRA 5M1AA 1ZKJA 3OCNA 4E3OA 4HBTA 3TG9A 1MBLA 4KZ4A 1AXBA 4GW9A 3VP2A 1P9RA 3KSIA 5DJUA 4YOFA 4JGQA 2ZMAA 4EWFA 4EXOA 2QMIA 4JXVA 4EBPA 1NYMA 4P0MA 5TBMB 3BY8A 3PYPA 5KIZA 4IBXA 3NDGA 5A8BA 1BSGA 1J3WA 5TFQA 1NZOA 2PU2A 4DE3A 2O0YA 3WWXA 1BLCA 1SKOB 1V9ZA 4GN2A 1GHIA 3F1OA 4E3NA 2WKIA 1OTEA 2VKSA 4UQIM 2I72A 3U2AA 1VQQA 4MLLA 4CLCC 1MPLA 1MWSA 5GLBA 2CMNA 3WS4A 5CGSA 3ZG7B 2W3FA 2BTFP 5EVIC 1EW0A 4XT2A 3UMEA 3QNBA 3KSFA 1W7FA 2UWXA 2Y2MA 1O07A 1YLZA 1S4RA 5AVFA 5EFWA 5EOOA 4MNRA 3Q7ZA 3MSHA 4GD6A 3UB6A 3T1RA 2UV0E 4II7A 4RX2A 1VEUB 3BFEA 2J80A 4YFMA 1MWTA 4P6ZS 3S4XA 4OPQA 1XP4A 2DRWA 4C6YA 4LFUA 1FSWA 1OT6A 1QMFA 4LV0A 4F3LB 3HUNA 2HP5A 4GDNA 1PI5A 1XXMA 3IXBA 4X6TA 3UB9A 1F5MA 4ID4A 3AGDA 4L9GA 1MY8A 2GZAA 4PM9A 5AVEA 2VZWA 3Q07A 1H3QA 4RYEA 2EWWA 4R3AA 5EPHA 3PXPA 4WZ5C 2PYPA 3GTCA 3ICYA 4OPZA 5DTTA 1CI9A 1KVLA 1EI5A 4Y5FA 3D72A 2JKRI 3OLOA 3M2KA 2OLVA 3B33A 5E2GA 1KE0A 2VGLM 3V39A 1SKFA 2HJEA 4Z1WA 3LY3A 3CITA 3EQVA 1S1ZA 2ZQDA 4HP9A 5EM0A 1YT4A 4FSFA 4KUOA 1KE4A 5HARA 3RXWA 2ZOIA 1F2KA 1DY6A 5HZHA 4KG5A 4ETZA 3OCLA 3RH8B 4N1XA 3HCYA 3A3IA 4CLCA 1Z09A 2H0TA 3AGEA 5HD3A 3V3SA 2X71A 4HH3A 1XJ6A 4K0WA 2C5WB 3ZG0A 4U0XA 4LV3A 1YLPA 3H7WA 2I9VA 3UPOA 5EVIA 3LYXA 1IYOA 5TJJA 1PZPA 2A49A 1ALQA 3JPUA 1ZG4A 3F1OB 4BQMA 1MZUA 3LY4A 2J3TC 1XPBA 2H28A 4HY8A 5DFYA 1YQSA 2EXAA 1XJ4A 1NXYA 1S67L 2W3HA 4JGRA 4M4XA 3K3CA 1T1CA 4RVAA 4R4SA 4EEUA 3L7HA 5IT5A 1RGYA 3MFXA 4GCZA 2W3EA 2FFFB 5FEGA 4WL9A 1YSPA 4WLAA 5C5KA 5IS1A 3S7QA 5J3WA 1M40A 1P9WA 3CI6A 2P74A 2QYBA 2NUTC 4DJ3A 2PD8A 4JXSA 1KVMA 5G18A 3GRJA 1Y28A 2ZC4B 4S2PA 4DMZA 1IOUA 1T18A 3MQ0A 3VP3A 5D3OA 1ES3A 1BULA 3HLGA 5CEDA 4HH2A 3P01A 2HDUA 5EVLA 1OTDA 1K54C 3G2ZA 3G30A 3N8LA 5EUAA 1UWNX 2ZM0A 1D1JA 1GHPA 2HP6A 5J4EA 4JXGA 3GMWA 4Y3IA 2VV8A 1T1AA 3VOZA 3MKFA 2E8IA 2ZJ9A 5E2EA 4OKPA 1NZUA 4U3TA 1OJ5A 4NG2A 4WF0A 1PW1A 4CLCB 4LPZA 2JKGA 4I39A 3N4IA 1NY0A 2OLUA 3C2WA 3IWOA 3SW1A 4YINA 1UGUA 5E2HA 5FASA 4HIAA 3IF6B 4IVKA 2GJ3A 5J7EA 1Y4OA 3CPTA 4JGOA 2V2FF 1K4FA 4FH2A 4LRYC 4DDSA 1FCOA 3Q1FA 1BLSA 4HEFA 2IWDA 2R9XA 5L09A 1ODVA 3IBJA 3ITAA 5CECA 3C38A 2CC1A 1TDGA 1TS7A 1VHMA 2GDNA 2XK1A 3VOYA 3IF6C 4KZ9A 4Y0OA 1PZOA 1M6KA 2GNXA 4UA6A 2V0UA 1CK3A 3C8CA 2XD5A 1LL8A 3W2ZA 1GSXA 5I5LA 4MDZA 4DE2A 1VETA 3G34A 1JNUA 3IHAA 2XD1A 4OQGA 2WADA 1PWDA 3P98A 3PBNA 3MF0A 3GV9A 1NJ4A 1CQAA 2V8CA 3WS0A 1L0EA 2J3TD 5F1FA 5DVAA 4QB8A 2WK0A 3OOVA 2Q9NA 3IT9A 1PRQA 3CPTB 2Y4AA 4LCMA 1EROA 1SDNA 3S22A 4KZ7A 5GHYA 5GLDA 3ITBA 3NCKA 4WMCA 5FI2A 4EEPA 5FQKA 4EQ1A 2IA2A 3LGOA 3HJIA 3SOIA 4XT2B 4ZJ1A 4KZ5A 4S2NA 4PM5A 1H0MA 4PKYG 3T4QA 2ZC7A 3TOIA 3HLBA 2EXBA 3EWKA 4HJ4A 3W4OA 3G4PA 3UB8A 3VFHA 4CLCE 3UDXA 5FL3A 4S2JA 1IYPA 1SHVA 3MMHA 2W1RA 2ZM8A 2FZ0A 1LL9A 3QNCA 3E98A 4ZJ2A 1W8QA 1WYBA 3S7NA 2Y91A 4KZAA 2WKQA 4UA7A 2OAP1 1OPXA 4JLFA 1RP5A 4N9LA 4AFIA 3QP6A 5L07A 4OOLA 1YM1A 5A93A 4KUKA 4IBRA 1XA1A 4FUWA 5CXWA 4L9FA 2HDQA 4LRXC 1I2WA 2OAQ1 1ZTUA 2WKHA 3RFBA 5HDCA 1N9NA 2O99A 5DJTA 2HV1A 3ISGA 5HW3A 5F82A
chains in the Genus database with same CATH topology
2JKTM 2GX5A 3PBSA 4F3LA 1S4RA 5AVFA 4LRZE 5G4YA 4FOFA 3IBRA 1S66L 5HWTA 1WA9A 4NKPA 5EFWA 4GHIA 4QPRA 3UB6A 2B02A 3LIBA 1LSXA 1BYWA 4LLOB 4UEYA 3PBQA 1XFNA 4II7A 4EESA 2J80A 3B42A 1W63Q 2HF6A 4P6ZS 1T19A 4NEED 1F98A 1LSVA 1LT0A 2D01A 4UQIS 4BMWA 1OT6A 2XROA 3BW6A 1TS6A 1W63M 4EUVA 4KQOA 4F3LB 4WEJA 4I38A 2W0NA 3EEHA 2VV6A 4H6JB 1OTAA 4Q0JA 3T4JA 3UB9A 1TS0A 1F5MA 2Y8HA 1YAXA 3MJQA 3KSHA 3NOTC 4L9GA 2KLIA 5CX7A 4NXGA 2GZAA 4Q0HA 3FC7A 4E04A 5AVEA 2VZWA 2W27A 1H3QA 4HQAA 2EWWA 4R3AA 4EU0A 2PYRA 3O5YA 3PXPA 2PYPA 3ICYA 3A0RA 3D72A 4GHIB 4L0LA 4Y5FA 3BQAA 3LR0A 2JKRI 3OLOA 3B33A 2O9AA 4WN5A 3A0SA 2VGLM 3LICA 3TE8A 2HJEA 4Z1WA 2VGLS 3CITA 3EQVA 3VE3A 4H6JA 1OTIA 1S1ZA 2JHEA 4HP9A 3MQOA 5F68A 3NJAA 3R7WA 4FSFA 4WEKA 4KUOA 3E4PA 1UWPX 2V9AA 2ZOIA 3CUEA 3LI8A 5TBMA 5HZHA 3RTYA 3UMDA 2HJ9C 4ETZA 2WKRA 4MCWA 1S1YA 2OOLA 2YKFA 2A24A 3OCLA 3EEAA 2QHKA 3RH8B 2YKHA 2K7SA 2Z6DA 3HCYA 2PHYA 4CLCA 3DBAA 4O0PA 5HD3A 2J3WA 2ZMVA 4HH3A 4NXFA 2DMWA 1XJ6A 2W1TB 2OWHA 2PT7A 3LR3A 3CUEC 2JN7A 3G6OA 2OWJA 3EGXC 4P6ZM 5K5BA 4ETXA 5F6AA 3H7WA 2V1BA 2I9VA 1S4SA 3LUQA 3H82B 3LYXA 4GJ4A 5TJJA 2R78A 3FPWA 3PHYA 3CLOA 3H9WA 3PBTA 3EGDC 5HPIA 3OC2A 5HWWA 3F1OB 4HJ6A 1MZUA 2J3TC 2H28A 1MKMA 4HY8A 4PHTA 5DFYA 4L9EA 2W3GA 2MJ6A 1XJ4A 3F1NA 1S67L 2W3HA 4JGRA 4M4XA 2V0WA 3KYZA 3BWLA 2EWVA 3K3CA 3IS2A 1T1CA 4G3KA 3T4SA 4EEUA 2INWA 3GDIA 3LIFA 5HWVA 3LIDA 4DJ2A 5IT5A 3H82A 4GCZA 3MFXA 4EW7A 2W3EA 4WL9A 1YSPA 4JGPA 4WLAA 5C5KA 5IS1A 3S7QA 4IUKA 5J3WA 3VE4A 5DF9A 1P9WA 2XRNA 3CI6A 4B93A 2QYBA 2NUTC 4DJ3A 2M7VA 3KSGA 1G28A 2W1TA 2PD8A 2QJ5A 4GLQA 2LB9A 4DN0A 1Y28A 4I3IA 2L4RA 5MC7A 2B18A 4DMZA 4EERA 4HHDA 4MMNA 1IOUA 2A2LA 1T18A 3MQ0A 2D02A 3P7NA 4MN6A 2XA7M 3LFVA 2EA9A 3R4KA 5L8MA 1G6OA 3F1PA 3HJKA 4HH2A 2P04A 2XSSA 3P01A 5HDSA 2JKTI 2VLGA 1N9OA 4BWIA 3S7OA 3FPVA 2JKRM 1MC0A 3KYQA 3LR5A 2PR5A 1OTDA 3T4TA 4YNRA 2L1MA 3E4QA 1UWNX 5HD5A 4BBVA 3BY9A 2BASA 3KO6A 5HSQA 5DFXA 4O01A 3LIEA 3VOLA 2KX6A 3B47A 1ZHHB 5J4EA 1P97A 2P08A 4Y3IA 3S7PA 2K31A 2VV8A 5F5YA 3NOUC 1T1AA 3F1PB 1D7EA 1GSWA 3EQUA 4HP4A 3CAXA 2HGVA 2KDKA 4I3AA 3NHQA 1TF1A 4K08A 1OJ5A 4WF0A 3ZQ5A 4CLCB 3LI9A 4LPZA 4CQHA 1TS8A 2G7UA 3BJNA 4I39A 5LBRA 2QKPA 4RQ9A 4ARZB 5F69A 3UE3A 3C2WA 2VX8A 3SW1A 4PKYA 3A0VA 3C30A 3H7WB 2V1AA 4WUJA 3KX0X 2M1CA 3T4KA 1UGUA 2K2NA 1DRMA 2ZBBA 4HIAA 5G4ZA 3T4LA 4BBTA 4HJ3A 2GJ3A 5J7EA 3V67A 2L0WA 4IUHA 4O8GA 4JGOA 1V9YA 3ULFA 4LRYC 3MQQA 5DKLA 3IS2B 3T50A 4B9OA 3PR6A 3JVVA 1NLYA 4PAUA 2A24B 1YSQA 1ODVA 3IBJA 4NXEA 1X0OA 3UE6A 4R6LA 3C38A 4R70A 3OBFA 1VB6A 4NXBA 1TS7A 1VHMA 3K3DA 3PBRA 4I3JA 3R7WB 1D06A 2VV7A 1KOUA 3EOIA 5IU1A 1N9LA 4HNBA 2GNXA 3K2NA 4BJPA 2V0UA 3CWFA 3C8CA 3NOPC 2PR6A 3MR0A 1LL8A 3W2ZA 4IHQA 1GSXA 5I5LA 1OT9A 4MDZA 1DP9A 1IFQA 1JNUA 1OTBA 4WELA 5KSHA 4Q0IA 3D3OA 2WKPA 2ZMFA 1P0ZA 3PBNA 3MF0A 1YKDA 2QWSA 2VJWA 4CLCD 1XJ3A 4MN5A 2J3TD 5HPFA 3OOVA 4ME4A 5HL6A 2XA7S 5AJGA 4OOMA 3BQ8A 3E0YA 3LR4A 3OCNA 2LB5A 1F9IA 5DKKA 1DP6A 1DP8A 1H8MA 1NLZA 2QJ7A 4EETB 4EEPA 3TRCA 4ZRRA 4GW9A 4EQ1A 5HDDA 1P9RA 2KOIA 2IA2A 3VV4A 3FG8A 4G3WA 3HJIA 3KSIA 5DJUA 2Y79A 2VEAA 4YOFA 4JGQA 4XT2B 2M7UA 2NUPC 4PKYG 3T4QA 3F1NB 4GS9A 4EXOA 4HI4A 4GS9B 3T4OA 3JVUA 1NRJA 3TJZC 2Z6CA 1NWZA 3EWKA 1LSWA 4HJ4A 5TBMB 3BY8A 3PYPA 3UB8A 4CLCE 1TD5A 2PD7A 4KQDA 5FL3A 3TW8A 1XJ2A 4IJGA 5KIZA 3MMHA 2W1RA 5A8BA 4HOIA 2FZ0A 4MN7A 3PBOA 3E98A 2O9CA 3S7NA 2P7JA 2O0YA 2WKQA 2W3DA 3LIAA 2OAP1 1OPXA 1V9ZA 4G3VA 4AFIA 1OJGA 1T1BA 3ZYTA 4OOLA 1STZA 3F1OA 4ARZA 1XFQA 4KUKA 1OTEA 2VKSA 4UQIM 3MXQA 3U2AA 4BBUA 4CLCC 4YWZA 4L9FA 4R38A 2CMNA 1GSVA 4LRXC 2VA0A 2W3FA 2OAQ1 1ZTUA 3RFBA 5HDCA 2O9BA 2ZOHA 4Y2FA 3E4OA 3GECA 2PDRA 1EW0A 4XT2A 3UMEA 1N9NA 2O99A 5DJTA 2HV1A 3KSFA 3UB7A 2FH5A 4I5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ6 A;  3LIE A;  3VOL A;  2KX6 A;  4F3L A;  1S4R A;  2OWH A;  5J4E A;  5AVF A;  1P97 A;  4LRZ E;  2JN7 A;  5G4Y A;  3IBR A;  1S66 L;  5F6A A;  5HWT A;  1WA9 A;  5EFW A;  1F9I A;  2VV8 A;  4GHI A;  5DKK A;  3NOU C;  5F5Y A;  1T1A A;  3F1P B;  3G6O A;  1DP6 A;  1DP8 A;  2OWJ A;  3UB6 A;  1D7E A;  1GSW A;  2B02 A;  3LIB A;  3H7W A;  2V1B A;  3CAX A;  1LSX A;  2I9V A;  1BYW A;  1S4S A;  2KDK A;  2QJ7 A;  3LUQ A;  3H82 B;  3NHQ A;  4I3A A;  4LLO B;  4EET B;  3LYX A;  1XFN A;  4EEP A;  2R78 A;  3PHY A;  4K08 A;  1OJ5 A;  3CLO A;  4GW9 A;  4WF0 A;  3ZQ5 A;  3H9W A;  5HDD A;  4EQ1 A;  4EES A;  3LI9 A;  2J80 A;  4LPZ A;  1TS8 A;  3FG8 A;  4I39 A;  3HJI A;  5DJU A;  2QKP A;  4RQ9 A;  2VEA A;  4JGQ A;  1T19 A;  4XT2 B;  5F69 A;  1F98 A;  3C2W A;  3SW1 A;  1LSV A;  1LT0 A;  4PKY A;  3A0V A;  5HWW A;  2D01 A;  3H7W B;  4PKY G;  2V1A A;  4WUJ A;  3F1O B;  3KX0 X;  2M1C A;  5I5L A;  1UGU A;  3F1N B;  4GS9 A;  1MZU A;  4HJ6 A;  1DRM A;  1OT6 A;  2H28 A;  2ZBB A;  4HI4 A;  4GS9 B;  4EXO A;  4HIA A;  4HY8 A;  5G4Z A;  1TS6 A;  4L9E A;  4BBT A;  2Z6C A;  2GJ3 A;  4HJ3 A;  5J7E A;  1NWZ A;  3EWK A;  1LSW A;  2L0W A;  4HJ4 A;  4F3L B;  5TBM B;  3BY8 A;  1XJ4 A;  3F1N A;  3PYP A;  4JGO A;  4I38 A;  3UB8 A;  2W0N A;  3EEH A;  2PD7 A;  2VV6 A;  4H6J B;  1S67 L;  1OTA A;  1V9Y A;  4JGR A;  4KQD A;  4M4X A;  3ULF A;  2V0W A;  1XJ2 A;  5KIZ A;  3BWL A;  3K3C A;  3IS2 A;  1T1C A;  3MQQ A;  4LRY C;  5DKL A;  5A8B A;  3UB9 A;  1TS0 A;  4HOI A;  3IS2 B;  4EEU A;  2INW A;  3GDI A;  3LIF A;  5HWV A;  3LID A;  4DJ2 A;  3T50 A;  3MJQ A;  3NOT C;  4L9G A;  3H82 A;  4GCZ A;  3MFX A;  4B9O A;  4EW7 A;  4NXG A;  3FC7 A;  4E04 A;  4WL9 A;  4WLA A;  4JGP A;  5AVE A;  2W27 A;  2A24 B;  5IS1 A;  1ODV A;  4HQA A;  4BBU A;  5HSQ A;  4NXE A;  4R3A A;  1X0O A;  2P7J A;  3UE6 A;  2WKQ A;  4R6L A;  5J3W A;  3VE4 A;  2PYR A;  3LIA A;  4R70 A;  1V9Z A;  1VB6 A;  4NXB A;  2PYP A;  1TS7 A;  3ICY A;  3K3D A;  4I3J A;  1D06 A;  3A0R A;  3D72 A;  4GHI B;  1OJG A;  4DJ3 A;  2VV7 A;  1G28 A;  1T1B A;  1KOU A;  2PD8 A;  3OLO A;  2QJ5 A;  3F1O A;  5IU1 A;  3B33 A;  1N9L A;  4HNB A;  1Y28 A;  4I3I A;  2L4R A;  4WN5 A;  2V0U A;  3A0S A;  1XFQ A;  3LIC A;  4KUK A;  1OTE A;  3CWF A;  3C8C A;  3NOP C;  4EER A;  3MXQ A;  2PR6 A;  4HHD A;  3MR0 A;  3VE3 A;  1LL8 A;  1T18 A;  1OTI A;  2D02 A;  4H6J A;  1GSX A;  1S1Z A;  2JHE A;  3P7N A;  3MQO A;  4HP9 A;  1OT9 A;  4L9F A;  3NJA A;  4MN6 A;  5F68 A;  1DP9 A;  2CMN A;  4R38 A;  2EA9 A;  1JNU A;  1GSV A;  1OTB A;  4HP4 A;  4KUO A;  4LRX C;  3E4P A;  1UWP X;  3F1P A;  2V9A A;  2ZOI A;  3HJK A;  3LI8 A;  4HH2 A;  5HDC A;  5TBM A;  5HZH A;  2WKP A;  5HDS A;  3RTY A;  2VLG A;  2ZOH A;  1P0Z A;  3UMD A;  2WKR A;  1N9O A;  2PDR A;  2QWS A;  3E4O A;  3GEC A;  1EW0 A;  4XT2 A;  1S1Y A;  2OOL A;  2YKF A;  2A24 A;  3UME A;  2QHK A;  1N9N A;  3RH8 B;  2YKH A;  2K7S A;  2PR5 A;  2Z6D A;  5DJT A;  2PHY A;  1OTD A;  1XJ3 A;  2HV1 A;  4MN5 A;  3UB7 A;  2L1M A;  3E4Q A;  1UWN X;  5HD3 A;  5HD5 A;  4BBV A;  3BY9 A;  2BAS A;  4I5S A;  4YWZ A;  4HH3 A;  4NXF A; 
#chains in the Genus database with same CATH topology
 2JKT M;  4F3L A;  5G4Y A;  1S66 L;  3SS4 A;  5JYO A;  5GHX A;  4NKP A;  3WS1 A;  4GHI A;  4JF6 A;  4QPR A;  5EV0 A;  5IHV A;  3NY4 A;  5A92 A;  1LSX A;  5EE8 A;  3ZVW A;  3WRT A;  1FOF A;  4KG6 A;  2HPB A;  3CMZ A;  3IXG A;  5CTN A;  3FYZ A;  2R9W A;  2E8J A;  2X01 A;  3HL9 A;  1TS6 A;  4EUV A;  4KZ3 A;  4KQO A;  3GR2 A;  5M19 A;  4WEJ A;  2VV6 A;  4OON A;  4IED A;  1ES5 A;  1TVF A;  1Y54 A;  1K6S A;  5FQ9 A;  4Q0H A;  2P9V B;  2PYR A;  5J8X A;  1CEG A;  3A0R A;  5FAQ A;  4Z9Q A;  3ZNT A;  4MEZ A;  3BFF A;  4WN5 A;  3A0S A;  3LIC A;  3TE8 A;  5FEF A;  4A5R A;  4DE0 A;  3I7J A;  4B4Z A;  3R7W A;  3SH7 A;  2QZ6 A;  2V9A A;  4QY5 A;  4E3M A;  3RTY A;  1ESU A;  2HJ9 C;  2WKR A;  5I94 A;  1N9B A;  1S6R A;  3CG5 A;  2JCH A;  4X69 A;  1IEL A;  2XDM A;  1E25 A;  1WYC A;  4CJN A;  3ZGA B;  4LGW A;  1A0K A;  2ZMV A;  4NXF A;  3IX3 A;  2PT7 A;  3LR3 A;  3BFC A;  3CUE C;  2JN7 A;  3MS6 A;  2DNS A;  2WAE A;  3HLC A;  3G6O A;  4E3L A;  2OWJ A;  4X53 A;  4ETX A;  2V1B A;  2Y2Q A;  1S4S A;  1G5U A;  3HUM A;  4Y0U A;  4BD0 A;  4GJ4 A;  3Q82 A;  2R78 A;  3E2L A;  3PHY A;  2ZQC A;  3V3R A;  4D60 A;  3H9W A;  3NUL A;  3PBT A;  5FAP A;  1KGF A;  3SH9 A;  1S0W A;  1MKM A;  2EX2 A;  5CHM A;  3ZNY A;  2Y2G A;  3Q7V B;  3BM6 A;  3CJM A;  4E6X A;  3HLD A;  4BL3 A;  1GCE A;  2WGI A;  2OV5 A;  3IS2 A;  3IF5 A;  3T4S A;  4OVD A;  4S2M A;  3DTK A;  3MXR A;  3DTM A;  4S2K A;  3T1S A;  4FH4 A;  3E2K A;  3UDF A;  4P85 A;  2M7V A;  2Y2P A;  2QJ5 A;  4GLQ A;  4R3J A;  2LB9 A;  4I3I A;  2L4R A;  2B18 A;  3A3E A;  4M3K A;  2JE5 A;  3VMA A;  2ZQ8 A;  4MMN A;  2D02 A;  4MN6 A;  4BEN A;  2XA7 M;  3LFV A;  5HAQ A;  1MWU A;  3F1P A;  3HJK A;  1N4O A;  2P04 A;  2QPN A;  2H0Y A;  4WZ4 A;  3N6I A;  4QJG A;  2JKR M;  1PIO A;  4JBF A;  3HVF A;  5DTK A;  2PR5 A;  3A3F A;  1FSY A;  2Y2N A;  5TR7 A;  3NEC A;  3BY9 A;  2BAS A;  2XR0 A;  5HSQ A;  2PU4 A;  4O01 A;  4OLG A;  3VSK A;  3B47 A;  1ZHH B;  4OP5 A;  4OLD A;  3UO9 A;  2P08 A;  2JC7 A;  2ZM2 A;  3S7P A;  5HL1 A;  4EV4 A;  1D7E A;  3UPN A;  2G2U A;  3P09 A;  3NHQ A;  4K08 A;  2G7U A;  2WKE A;  5F69 A;  1KGG A;  2XH9 A;  1YMX A;  3A0V A;  4PKY A;  4R0Q A;  2M1C A;  3T4K A;  1DRM A;  2ZBB A;  5G4Z A;  3DTE A;  3CHW P;  4HJ3 A;  4C75 A;  2EFX A;  3MZF A;  3ULF A;  1LI9 A;  4N92 A;  5DKL A;  1LL5 A;  3VP1 A;  4B9O A;  1NLY A;  5CGX A;  4RA7 A;  3IQA A;  4R6L A;  4R70 A;  1VB6 A;  4U0T A;  3K3D A;  4I3J A;  3T12 B;  4R1G A;  1PW8 A;  1IKI A;  3ZHH A;  1HTZ A;  4HNB A;  4BJP A;  5U47 A;  3GVB A;  3MR0 A;  1NYY A;  4X56 A;  5FQJ A;  3IXD A;  3MZD A;  4LV1 A;  5KSH A;  1ZC2 A;  3D3O A;  3TSG A;  3HLF A;  2ZQ7 A;  1FCM A;  2VGJ A;  3N8S A;  5HX9 A;  4CLC D;  3V5M A;  4HES A;  4PMA A;  2A3U A;  4C3Q A;  4GDB A;  4MN5 A;  5HPF A;  4P6B A;  3W4P A;  2XA7 S;  5AJG A;  4OOM A;  3BQ8 A;  3Q7V A;  3E0Y A;  2BG1 A;  4Y13 A;  1F9I A;  5F83 A;  2PAV P;  1H8M A;  1IYQ A;  1NLZ A;  5FDH A;  3TRC A;  4ZRR A;  3DWK A;  5HDD A;  3KYE A;  3FG8 A;  4G3W A;  2Y79 A;  2VEA A;  2M7U A;  4F94 A;  1AWI A;  2NUP C;  1FR6 A;  1E3U D;  3F1N B;  3LEQ A;  3MBZ A;  4HI4 A;  4JXW A;  1NRJ A;  2ACG A;  1NWZ A;  4BL2 A;  1TD5 A;  2PD7 A;  4KQD A;  1VET B;  3TW8 A;  1CI8 A;  2VGK A;  3IWQ A;  3PBO A;  4QHC A;  4UAA A;  2O9C A;  1K55 C;  3G32 A;  3QP2 A;  3S1Y A;  2P7J A;  2WUQ A;  2W3D A;  3LIA A;  3U4L P;  4ESP A;  1L0G A;  4G3V A;  1JTG A;  3T1X A;  1L3L A;  3ZYT A;  1STZ A;  3FWL A;  4R4R A;  1TEM A;  4ARZ A;  1K4E A;  1XFQ A;  4KQR A;  1I5Q A;  4YWZ A;  1XGI A;  2FFY A;  1JWZ A;  4R38 A;  2VA0 A;  4K91 A;  1G68 A;  2O9B A;  2ZOH A;  2PDR A;  3GEC A;  2Z2M B;  1PNE A;  1DJB A;  5EVE A;  4R3B A;  2Q0O A;  3UB7 A;  4GKU A;  3A3D A;  1FIL A;  3BFD A;  4I5S A;  3GSG A;  2Y2I A;  3PBS A;  5DF8 A;  1JTD A;  2XEP A;  4QY6 A;  4WZ5 A;  1WA9 A;  2PBY A;  4LV2 A;  5CGW A;  1PI4 A;  2AVX A;  1RGZ A;  4LLO B;  4X1M A;  4OQI A;  1XFN A;  5FSR A;  3BFG A;  2J9P A;  3B42 A;  1KGE A;  2HP9 A;  2WYX A;  4KZ6 A;  1T19 A;  4NEE D;  3RJU A;  3IX4 A;  4FCF A;  1LT0 A;  2D01 A;  5CEB A;  4BMW A;  2HZ5 A;  1PYY A;  1W63 M;  3VP0 A;  3UE1 A;  3LO7 A;  3BEC A;  4H6J B;  4Q0J A;  3T4J A;  2Y2H A;  4MBF A;  2Y8H A;  1YAX A;  3MJQ A;  3KSH A;  4E04 A;  1H5X A;  2W27 A;  1I2S A;  4QWO A;  4Y15 A;  1U60 A;  3LR0 A;  2J7V A;  3UE0 A;  3O3V A;  2VGL S;  3VE3 A;  4H6J A;  1OTI A;  3MQO A;  5F68 A;  3NJA A;  2Y2J A;  3E4P A;  1UWP X;  5CHJ A;  2Z2L B;  1BT5 A;  5TBM A;  3T1Q B;  5CRF A;  3OZH A;  3ZG8 B;  3G2Y A;  4MCW A;  1S1Y A;  2QHK A;  2YKH A;  2Z6D A;  3NIA A;  5M18 A;  2PHY A;  3N8R A;  3HUO A;  2ZQ9 A;  4O0P A;  2JBF A;  2PRF A;  2J3W A;  2DMW A;  2W1T B;  4GOG A;  3C7U A;  3G31 A;  1BUE A;  3EGX C;  3NDE A;  1CJF A;  4P6Z M;  5F6A A;  1WE4 A;  1SKO A;  1LHY A;  3IH9 A;  3LUQ A;  1HZO A;  2RCX A;  3UDI A;  3VP4 A;  3CLO A;  3O88 A;  5GHZ A;  3DAV A;  5TGF A;  3OC2 A;  5FQM A;  4E3K A;  3D9Y A;  4HJ6 A;  5CTM A;  4EBN A;  3IWI A;  4PHT A;  3QP8 A;  1QME A;  1ONH A;  2W3G A;  2MJ6 A;  3F1N A;  3SS3 A;  1ES4 A;  1FR1 A;  2V0W A;  4IVI A;  4OOY A;  4G3K A;  4DXC A;  2INW A;  1K55 A;  5HWV A;  4DJ2 A;  2ZC5 B;  3H82 A;  2ZL1 A;  2ZLY A;  3C5A A;  4JGP A;  1KDS A;  3LEZ A;  4OPR A;  5DF9 A;  1L0F A;  2Y59 A;  5DF7 A;  4B93 A;  5A91 A;  4R23 A;  3ZFZ A;  3MFD A;  4KEN B;  3BYD A;  3KSG A;  4ZBE A;  1KDW A;  2W1T A;  3FKW A;  3MKE A;  4DN0 A;  3WS5 A;  4X25 A;  5L2F A;  4UA9 A;  2XGN A;  1GA0 A;  3UB5 P;  1H8Z A;  2A2L A;  4CPK A;  1K6R A;  4BD1 A;  3AGF A;  3HBR A;  3IXH A;  2EA9 A;  3R4K A;  1G6O A;  5DTS A;  4MBK A;  2XSS A;  2J9O A;  5HDS A;  4ZDX A;  4BWI A;  4XUZ A;  4E3I A;  4YNR A;  4FTX A;  3IHB A;  1DJC A;  2L1M A;  3E4Q A;  4QD4 A;  3HLW A;  5HD5 A;  4BBV A;  2EX9 A;  3LIE A;  3VOL A;  1K0K A;  4Y0T A;  1RCJ A;  4KG2 A;  3VFF A;  3PAE A;  5F5Y A;  4E6W A;  3MXS A;  2P9V A;  3M6B A;  4DE1 A;  3EQU A;  4HP4 A;  3CAX A;  2HGV A;  2KDK A;  3PTE A;  5EM1 A;  4CQH A;  3DW0 A;  5LBR A;  2QKP A;  2WGV A;  4ARZ B;  3UE3 A;  1LLB A;  2VX8 A;  4X1L A;  3C30 A;  3H7W B;  2V1A A;  4WUJ A;  3T4L A;  4EUZ A;  4BBT A;  3V67 A;  4IUH A;  4WM9 A;  5GL9 A;  3MQQ A;  2XFT A;  3M2J A;  5E43 A;  4S2L A;  4B88 A;  3PR6 A;  3JVV A;  4OPY A;  4PAU A;  5KMW A;  1YSQ A;  3V50 A;  4NXE A;  3FKV A;  3UE6 A;  3OBF A;  2XFS A;  3IX8 A;  4X55 A;  2H5S A;  2VV7 A;  3EOI A;  2PBD P;  1FCN A;  1XX2 A;  4D2O A;  1N9L A;  3HRE A;  3K2N A;  4LCL A;  3UY6 A;  1YLW A;  4IHQ A;  2Y55 A;  5FQQ A;  1OT9 A;  5KZH A;  5FAT A;  1DP9 A;  1HD8 A;  1IFQ A;  4WEL A;  2JKF A;  2XLN A;  4PM7 A;  4DXB A;  3OPH A;  4WYY A;  2QWS A;  5EOE A;  4GNU A;  1JWP A;  1YLJ A;  3BLS A;  3SZT A;  3QP1 A;  1K57 A;  3LR4 A;  1Q2Q A;  3OPL A;  2LB5 A;  5DKK A;  5GLC A;  1DP6 A;  1DP8 A;  3N7W A;  3O86 A;  2QJ7 A;  5FA7 A;  2DCF A;  1SZV A;  2ZL1 B;  4EET B;  1SDE A;  4PM8 A;  4OQ0 A;  2KOI A;  5L10 A;  3VV4 A;  4OH0 A;  4S2O A;  3FV7 A;  1BLP A;  1FIK A;  1BZA A;  2VK3 A;  4GS9 A;  4XUX A;  5EVI D;  4OQH A;  1YPR A;  3T4O A;  4GS9 B;  4P87 A;  3JVU A;  3ZCZ A;  3TJZ C;  1E3U A;  2Z6C A;  1C3B A;  1LSW A;  1NRF A;  1XJ2 A;  4IJG A;  4HOI A;  1ES2 A;  4MN7 A;  1BLH A;  3IH8 A;  3FZC A;  3G35 A;  4DRT A;  1BTL A;  1OJG A;  1T1B A;  2ZC6 B;  4KQQ A;  3ZVT A;  5AQA A;  3MXQ A;  4BBU A;  3BEB A;  1E4D A;  1GSV A;  1PFL A;  4Y2F A;  3E4O A;  1LI0 A;  3SH8 A;  2WAF A;  4JKT A;  2FH5 A;  4GZB A;  2GX5 A;  2H10 A;  4LRZ E;  4FOF A;  3IBR A;  5HWT A;  4HBU A;  5JYP A;  2B02 A;  3LIB A;  1BYW A;  4UEY A;  2RL3 A;  3PBQ A;  2EX8 A;  2Y2O A;  5AQB A;  4EES A;  1EWZ A;  2Y2K A;  1W63 Q;  2HF6 A;  3RXX A;  3B3X A;  1F98 A;  4ZTK A;  3QP4 A;  1LSV A;  4UQI S;  1O7E A;  4O7D A;  2XRO A;  4GD8 A;  3QHY A;  3BW6 A;  5GLA A;  4I38 A;  2W0N A;  3C4O A;  3EEH A;  4LEN A;  1OTA A;  5A90 A;  1MXO A;  4KZB A;  1TS0 A;  2Q9M A;  3NOT C;  2KLI A;  5CX7 A;  1Q2P A;  4NXG A;  3FC7 A;  1L2S A;  2V8F A;  4HQA A;  4EU0 A;  5FI6 A;  3O5Y A;  3SS5 A;  4BLM A;  1DJA A;  2IWB A;  2WGW B;  2XQZ A;  1W5D A;  1IEM A;  4GHI B;  4L0L A;  1G6A A;  3BQA A;  5HAP A;  1MWR A;  2O9A A;  1ERM A;  3M6H A;  3UNW A;  3Q81 A;  4GB7 A;  5CHU A;  2JHE A;  4H8R A;  2XF3 A;  4WEK A;  1ERQ A;  5F1G A;  3CUE A;  3LI8 A;  4JF5 A;  2IWC A;  3UMD A;  1VM1 A;  2OOL A;  2V1Z A;  2A24 A;  2YKF A;  1YMS A;  5FDS A;  3EEA A;  2K7S A;  3BRM A;  4ZAM A;  3DBA A;  4PM6 A;  2B95 A;  4PPR A;  2OWH A;  1TDL A;  5FAO A;  1K25 A;  4B4X A;  5EEC A;  1HLU P;  5K5B A;  1GA9 A;  1KE3 A;  3H82 B;  1HVB A;  3OPR A;  2OSU A;  3FPW A;  3HLE A;  3L9K A;  1YLY A;  4WMC D;  2V20 A;  1VEU A;  3ZG9 B;  3EGD C;  5HPI A;  1PWG A;  5HWW A;  3VSL A;  4EBL A;  3DWZ A;  3NI9 A;  4RX3 A;  4L9E A;  4JPM A;  4Y17 A;  3KYZ A;  2B5R A;  3BWL A;  3A3J A;  2EWV A;  4ZJ3 A;  3LIF A;  3GDI A;  3LID A;  3LCE A;  4EW7 A;  4XXR A;  1ESI A;  1XGJ A;  2WGW A;  4IUK A;  4NET A;  3VE4 A;  4DKI A;  2XRN A;  1SCW A;  3DTI A;  3NC8 A;  2HDS A;  1G28 A;  1K57 C;  1W79 A;  3O87 A;  3ZG5 A;  5MC7 A;  1W8Y A;  4DF6 A;  2BLS A;  4EER A;  4HHD A;  4S2N C;  5AQ7 A;  3P7N A;  1J9M A;  1CF0 A;  1L0D A;  4JF4 A;  2WZX A;  1GHM A;  4Y7P A;  5L8M A;  5HFO A;  3BLM A;  2JKT I;  4DDY A;  2VLG A;  2X02 A;  2G2W A;  1N9O A;  3S7O A;  3FPV A;  1K56 D;  1MC0 A;  3KYQ A;  3WS2 A;  4KZ8 A;  3LR5 A;  1Z6F A;  1JVJ A;  3T4T A;  1MKI A;  3W4Q A;  3KO6 A;  2ZQA A;  3UN7 A;  3QP5 A;  5CER A;  2ZD8 A;  1ZG6 A;  5DFX A;  1OME A;  1XA7 A;  2KX6 A;  1P97 A;  5KSC A;  2K31 A;  3NOU C;  4FD8 A;  3F1P B;  1JWV A;  4Q8I A;  3W8K A;  4S2I A;  3WRZ A;  3ZDJ A;  3GQZ A;  1GSW A;  4I3A A;  5FQI A;  3CZD A;  1TF1 A;  3MZE A;  2EX6 A;  1YLT A;  3ZQ5 A;  4N9K A;  3LI9 A;  1TS8 A;  3BJN A;  4RQ9 A;  2Y2L A;  2ZC3 B;  1IYS A;  3KX0 X;  4MBH A;  4N1H A;  2K2N A;  5EVI B;  3D4F A;  3IF6 A;  2L0W A;  4O8G A;  1K38 A;  1V9Y A;  2J8Y A;  4NK3 A;  2C6W B;  3NBL A;  3OPP A;  3IS2 B;  4UHU A;  3T50 A;  4QU3 A;  1ACF A;  4E3J A;  1CEF A;  2A24 B;  1X0O A;  1FQG A;  1K56 A;  5AQ9 A;  5HAI A;  3UPP A;  4NXB A;  3C7V A;  3PBR A;  3R7W B;  1D06 A;  4K0X A;  1KOU A;  1XKZ A;  5IU1 A;  4OP8 A;  3CWF A;  3NOP C;  2WZZ A;  2PR6 A;  5BOH A;  1K54 A;  1OTB A;  4Q0I A;  5FI7 A;  2WKP A;  2ZMF A;  1P0Z A;  1YKD A;  2VJW A;  4EQI A;  5E2F A;  1XJ3 A;  1PWC A;  1ONG A;  4ME4 A;  5HL6 A;  4WBG A;  1IKG A;  3PAG A;  2EFU A;  1H8Y A;  4X68 A;  3JYI A;  3C4P A;  2HDR A;  5M1A A;  1ZKJ A;  3OCN A;  4E3O A;  4HBT A;  3TG9 A;  1MBL A;  4KZ4 A;  1AXB A;  4GW9 A;  3VP2 A;  1P9R A;  3KSI A;  5DJU A;  4YOF A;  4JGQ A;  2ZMA A;  4EWF A;  4EXO A;  2QMI A;  4JXV A;  4EBP A;  1NYM A;  4P0M A;  5TBM B;  3BY8 A;  3PYP A;  5KIZ A;  4IBX A;  3NDG A;  5A8B A;  1BSG A;  1J3W A;  5TFQ A;  1NZO A;  2PU2 A;  4DE3 A;  2O0Y A;  3WWX A;  1BLC A;  1SKO B;  1V9Z A;  4GN2 A;  1GHI A;  3F1O A;  4E3N A;  2WKI A;  1OTE A;  2VKS A;  4UQI M;  2I72 A;  3U2A A;  1VQQ A;  4MLL A;  4CLC C;  1MPL A;  1MWS A;  5GLB A;  2CMN A;  3WS4 A;  5CGS A;  3ZG7 B;  2W3F A;  2BTF P;  5EVI C;  1EW0 A;  4XT2 A;  3UME A;  3QNB A;  3KSF A;  1W7F A;  2UWX A;  2Y2M A;  1O07 A;  1YLZ A;  1S4R A;  5AVF A;  5EFW A;  5EOO A;  4MNR A;  3Q7Z A;  3MSH A;  4GD6 A;  3UB6 A;  3T1R A;  2UV0 E;  4II7 A;  4RX2 A;  1VEU B;  3BFE A;  2J80 A;  4YFM A;  1MWT A;  4P6Z S;  3S4X A;  4OPQ A;  1XP4 A;  2DRW A;  4C6Y A;  4LFU A;  1FSW A;  1OT6 A;  1QMF A;  4LV0 A;  4F3L B;  3HUN A;  2HP5 A;  4GDN A;  1PI5 A;  1XXM A;  3IXB A;  4X6T A;  3UB9 A;  1F5M A;  4ID4 A;  3AGD A;  4L9G A;  1MY8 A;  2GZA A;  4PM9 A;  5AVE A;  2VZW A;  3Q07 A;  1H3Q A;  4RYE A;  2EWW A;  4R3A A;  5EPH A;  3PXP A;  4WZ5 C;  2PYP A;  3GTC A;  3ICY A;  4OPZ A;  5DTT A;  1CI9 A;  1KVL A;  1EI5 A;  4Y5F A;  3D72 A;  2JKR I;  3OLO A;  3M2K A;  2OLV A;  3B33 A;  5E2G A;  1KE0 A;  2VGL M;  3V39 A;  1SKF A;  2HJE A;  4Z1W A;  3LY3 A;  3CIT A;  3EQV A;  1S1Z A;  2ZQD A;  4HP9 A;  5EM0 A;  1YT4 A;  4FSF A;  4KUO A;  1KE4 A;  5HAR A;  3RXW A;  2ZOI A;  1F2K A;  1DY6 A;  5HZH A;  4KG5 A;  4ETZ A;  3OCL A;  3RH8 B;  4N1X A;  3HCY A;  3A3I A;  4CLC A;  1Z09 A;  2H0T A;  3AGE A;  5HD3 A;  3V3S A;  2X71 A;  4HH3 A;  1XJ6 A;  4K0W A;  2C5W B;  3ZG0 A;  4U0X A;  4LV3 A;  1YLP A;  3H7W A;  2I9V A;  3UPO A;  5EVI A;  3LYX A;  1IYO A;  5TJJ A;  1PZP A;  2A49 A;  1ALQ A;  3JPU A;  1ZG4 A;  3F1O B;  4BQM A;  1MZU A;  3LY4 A;  2J3T C;  1XPB A;  2H28 A;  4HY8 A;  5DFY A;  1YQS A;  2EXA A;  1XJ4 A;  1NXY A;  1S67 L;  2W3H A;  4JGR A;  4M4X A;  3K3C A;  1T1C A;  4RVA A;  4R4S A;  4EEU A;  3L7H A;  5IT5 A;  1RGY A;  3MFX A;  4GCZ A;  2W3E A;  2FFF B;  5FEG A;  4WL9 A;  1YSP A;  4WLA A;  5C5K A;  5IS1 A;  3S7Q A;  5J3W A;  1M40 A;  1P9W A;  3CI6 A;  2P74 A;  2QYB A;  2NUT C;  4DJ3 A;  2PD8 A;  4JXS A;  1KVM A;  5G18 A;  3GRJ A;  1Y28 A;  2ZC4 B;  4S2P A;  4DMZ A;  1IOU A;  1T18 A;  3MQ0 A;  3VP3 A;  5D3O A;  1ES3 A;  1BUL A;  3HLG A;  5CED A;  4HH2 A;  3P01 A;  2HDU A;  5EVL A;  1OTD A;  1K54 C;  3G2Z A;  3G30 A;  3N8L A;  5EUA A;  1UWN X;  2ZM0 A;  1D1J A;  1GHP A;  2HP6 A;  5J4E A;  4JXG A;  3GMW A;  4Y3I A;  2VV8 A;  1T1A A;  3VOZ A;  3MKF A;  2E8I A;  2ZJ9 A;  5E2E A;  4OKP A;  1NZU A;  4U3T A;  1OJ5 A;  4NG2 A;  4WF0 A;  1PW1 A;  4CLC B;  4LPZ A;  2JKG A;  4I39 A;  3N4I A;  1NY0 A;  2OLU A;  3C2W A;  3IWO A;  3SW1 A;  4YIN A;  1UGU A;  5E2H A;  5FAS A;  4HIA A;  3IF6 B;  4IVK A;  2GJ3 A;  5J7E A;  1Y4O A;  3CPT A;  4JGO A;  2V2F F;  1K4F A;  4FH2 A;  4LRY C;  4DDS A;  1FCO A;  3Q1F A;  1BLS A;  4HEF A;  2IWD A;  2R9X A;  5L09 A;  1ODV A;  3IBJ A;  3ITA A;  5CEC A;  3C38 A;  2CC1 A;  1TDG A;  1TS7 A;  1VHM A;  2GDN A;  2XK1 A;  3VOY A;  3IF6 C;  4KZ9 A;  4Y0O A;  1PZO A;  1M6K A;  2GNX A;  4UA6 A;  2V0U A;  1CK3 A;  3C8C A;  2XD5 A;  1LL8 A;  3W2Z A;  1GSX A;  5I5L A;  4MDZ A;  4DE2 A;  1VET A;  3G34 A;  1JNU A;  3IHA A;  2XD1 A;  4OQG A;  2WAD A;  1PWD A;  3P98 A;  3PBN A;  3MF0 A;  3GV9 A;  1NJ4 A;  1CQA A;  2V8C A;  3WS0 A;  1L0E A;  2J3T D;  5F1F A;  5DVA A;  4QB8 A;  2WK0 A;  3OOV A;  2Q9N A;  3IT9 A;  1PRQ A;  3CPT B;  2Y4A A;  4LCM A;  1ERO A;  1SDN A;  3S22 A;  4KZ7 A;  5GHY A;  5GLD A;  3ITB A;  3NCK A;  4WMC A;  5FI2 A;  4EEP A;  5FQK A;  4EQ1 A;  2IA2 A;  3LGO A;  3HJI A;  3SOI A;  4XT2 B;  4ZJ1 A;  4KZ5 A;  4S2N A;  4PM5 A;  1H0M A;  4PKY G;  3T4Q A;  2ZC7 A;  3TOI A;  3HLB A;  2EXB A;  3EWK A;  4HJ4 A;  3W4O A;  3G4P A;  3UB8 A;  3VFH A;  4CLC E;  3UDX A;  5FL3 A;  4S2J A;  1IYP A;  1SHV A;  3MMH A;  2W1R A;  2ZM8 A;  2FZ0 A;  1LL9 A;  3QNC A;  3E98 A;  4ZJ2 A;  1W8Q A;  1WYB A;  3S7N A;  2Y91 A;  4KZA A;  2WKQ A;  4UA7 A;  2OAP 1;  1OPX A;  4JLF A;  1RP5 A;  4N9L A;  4AFI A;  3QP6 A;  5L07 A;  4OOL A;  1YM1 A;  5A93 A;  4KUK A;  4IBR A;  1XA1 A;  4FUW A;  5CXW A;  4L9F A;  2HDQ A;  4LRX C;  1I2W A;  2OAQ 1;  1ZTU A;  2WKH A;  3RFB A;  5HDC A;  1N9N A;  2O99 A;  5DJT A;  2HV1 A;  3ISG A;  5HW3 A;  5F82 A; 
#chains in the Genus database with same CATH homology
 2JKT M;  2GX5 A;  3PBS A;  4F3L A;  1S4R A;  5AVF A;  4LRZ E;  5G4Y A;  4FOF A;  3IBR A;  1S66 L;  5HWT A;  1WA9 A;  4NKP A;  5EFW A;  4GHI A;  4QPR A;  3UB6 A;  2B02 A;  3LIB A;  1LSX A;  1BYW A;  4LLO B;  4UEY A;  3PBQ A;  1XFN A;  4II7 A;  4EES A;  2J80 A;  3B42 A;  1W63 Q;  2HF6 A;  4P6Z S;  1T19 A;  4NEE D;  1F98 A;  1LSV A;  1LT0 A;  2D01 A;  4UQI S;  4BMW A;  1OT6 A;  2XRO A;  3BW6 A;  1TS6 A;  1W63 M;  4EUV A;  4KQO A;  4F3L B;  4WEJ A;  4I38 A;  2W0N A;  3EEH A;  2VV6 A;  4H6J B;  1OTA A;  4Q0J A;  3T4J A;  3UB9 A;  1TS0 A;  1F5M A;  2Y8H A;  1YAX A;  3MJQ A;  3KSH A;  3NOT C;  4L9G A;  2KLI A;  5CX7 A;  4NXG A;  2GZA A;  4Q0H A;  3FC7 A;  4E04 A;  5AVE A;  2VZW A;  2W27 A;  1H3Q A;  4HQA A;  2EWW A;  4R3A A;  4EU0 A;  2PYR A;  3O5Y A;  3PXP A;  2PYP A;  3ICY A;  3A0R A;  3D72 A;  4GHI B;  4L0L A;  4Y5F A;  3BQA A;  3LR0 A;  2JKR I;  3OLO A;  3B33 A;  2O9A A;  4WN5 A;  3A0S A;  2VGL M;  3LIC A;  3TE8 A;  2HJE A;  4Z1W A;  2VGL S;  3CIT A;  3EQV A;  3VE3 A;  4H6J A;  1OTI A;  1S1Z A;  2JHE A;  4HP9 A;  3MQO A;  5F68 A;  3NJA A;  3R7W A;  4FSF A;  4WEK A;  4KUO A;  3E4P A;  1UWP X;  2V9A A;  2ZOI A;  3CUE A;  3LI8 A;  5TBM A;  5HZH A;  3RTY A;  3UMD A;  2HJ9 C;  4ETZ A;  2WKR A;  4MCW A;  1S1Y A;  2OOL A;  2YKF A;  2A24 A;  3OCL A;  3EEA A;  2QHK A;  3RH8 B;  2YKH A;  2K7S A;  2Z6D A;  3HCY A;  2PHY A;  4CLC A;  3DBA A;  4O0P A;  5HD3 A;  2J3W A;  2ZMV A;  4HH3 A;  4NXF A;  2DMW A;  1XJ6 A;  2W1T B;  2OWH A;  2PT7 A;  3LR3 A;  3CUE C;  2JN7 A;  3G6O A;  2OWJ A;  3EGX C;  4P6Z M;  5K5B A;  4ETX A;  5F6A A;  3H7W A;  2V1B A;  2I9V A;  1S4S A;  3LUQ A;  3H82 B;  3LYX A;  4GJ4 A;  5TJJ A;  2R78 A;  3FPW A;  3PHY A;  3CLO A;  3H9W A;  3PBT A;  3EGD C;  5HPI A;  3OC2 A;  5HWW A;  3F1O B;  4HJ6 A;  1MZU A;  2J3T C;  2H28 A;  1MKM A;  4HY8 A;  4PHT A;  5DFY A;  4L9E A;  2W3G A;  2MJ6 A;  1XJ4 A;  3F1N A;  1S67 L;  2W3H A;  4JGR A;  4M4X A;  2V0W A;  3KYZ A;  3BWL A;  2EWV A;  3K3C A;  3IS2 A;  1T1C A;  4G3K A;  3T4S A;  4EEU A;  2INW A;  3GDI A;  3LIF A;  5HWV A;  3LID A;  4DJ2 A;  5IT5 A;  3H82 A;  4GCZ A;  3MFX A;  4EW7 A;  2W3E A;  4WL9 A;  1YSP A;  4JGP A;  4WLA A;  5C5K A;  5IS1 A;  3S7Q A;  4IUK A;  5J3W A;  3VE4 A;  5DF9 A;  1P9W A;  2XRN A;  3CI6 A;  4B93 A;  2QYB A;  2NUT C;  4DJ3 A;  2M7V A;  3KSG A;  1G28 A;  2W1T A;  2PD8 A;  2QJ5 A;  4GLQ A;  2LB9 A;  4DN0 A;  1Y28 A;  4I3I A;  2L4R A;  5MC7 A;  2B18 A;  4DMZ A;  4EER A;  4HHD A;  4MMN A;  1IOU A;  2A2L A;  1T18 A;  3MQ0 A;  2D02 A;  3P7N A;  4MN6 A;  2XA7 M;  3LFV A;  2EA9 A;  3R4K A;  5L8M A;  1G6O A;  3F1P A;  3HJK A;  4HH2 A;  2P04 A;  2XSS A;  3P01 A;  5HDS A;  2JKT I;  2VLG A;  1N9O A;  4BWI A;  3S7O A;  3FPV A;  2JKR M;  1MC0 A;  3KYQ A;  3LR5 A;  2PR5 A;  1OTD A;  3T4T A;  4YNR A;  2L1M A;  3E4Q A;  1UWN X;  5HD5 A;  4BBV A;  3BY9 A;  2BAS A;  3KO6 A;  5HSQ A;  5DFX A;  4O01 A;  3LIE A;  3VOL A;  2KX6 A;  3B47 A;  1ZHH B;  5J4E A;  1P97 A;  2P08 A;  4Y3I A;  3S7P A;  2K31 A;  2VV8 A;  5F5Y A;  3NOU C;  1T1A A;  3F1P B;  1D7E A;  1GSW A;  3EQU A;  4HP4 A;  3CAX A;  2HGV A;  2KDK A;  4I3A A;  3NHQ A;  1TF1 A;  4K08 A;  1OJ5 A;  4WF0 A;  3ZQ5 A;  4CLC B;  3LI9 A;  4LPZ A;  4CQH A;  1TS8 A;  2G7U A;  3BJN A;  4I39 A;  5LBR A;  2QKP A;  4RQ9 A;  4ARZ B;  5F69 A;  3UE3 A;  3C2W A;  2VX8 A;  3SW1 A;  4PKY A;  3A0V A;  3C30 A;  3H7W B;  2V1A A;  4WUJ A;  3KX0 X;  2M1C A;  3T4K A;  1UGU A;  2K2N A;  1DRM A;  2ZBB A;  4HIA A;  5G4Z A;  3T4L A;  4BBT A;  4HJ3 A;  2GJ3 A;  5J7E A;  3V67 A;  2L0W A;  4IUH A;  4O8G A;  4JGO A;  1V9Y A;  3ULF A;  4LRY C;  3MQQ A;  5DKL A;  3IS2 B;  3T50 A;  4B9O A;  3PR6 A;  3JVV A;  1NLY A;  4PAU A;  2A24 B;  1YSQ A;  1ODV A;  3IBJ A;  4NXE A;  1X0O A;  3UE6 A;  4R6L A;  3C38 A;  4R70 A;  3OBF A;  1VB6 A;  4NXB A;  1TS7 A;  1VHM A;  3K3D A;  3PBR A;  4I3J A;  3R7W B;  1D06 A;  2VV7 A;  1KOU A;  3EOI A;  5IU1 A;  1N9L A;  4HNB A;  2GNX A;  3K2N A;  4BJP A;  2V0U A;  3CWF A;  3C8C A;  3NOP C;  2PR6 A;  3MR0 A;  1LL8 A;  3W2Z A;  4IHQ A;  1GSX A;  5I5L A;  1OT9 A;  4MDZ A;  1DP9 A;  1IFQ A;  1JNU A;  1OTB A;  4WEL A;  5KSH A;  4Q0I A;  3D3O A;  2WKP A;  2ZMF A;  1P0Z A;  3PBN A;  3MF0 A;  1YKD A;  2QWS A;  2VJW A;  4CLC D;  1XJ3 A;  4MN5 A;  2J3T D;  5HPF A;  3OOV A;  4ME4 A;  5HL6 A;  2XA7 S;  5AJG A;  4OOM A;  3BQ8 A;  3E0Y A;  3LR4 A;  3OCN A;  2LB5 A;  1F9I A;  5DKK A;  1DP6 A;  1DP8 A;  1H8M A;  1NLZ A;  2QJ7 A;  4EET B;  4EEP A;  3TRC A;  4ZRR A;  4GW9 A;  4EQ1 A;  5HDD A;  1P9R A;  2KOI A;  2IA2 A;  3VV4 A;  3FG8 A;  4G3W A;  3HJI A;  3KSI A;  5DJU A;  2Y79 A;  2VEA A;  4YOF A;  4JGQ A;  4XT2 B;  2M7U A;  2NUP C;  4PKY G;  3T4Q A;  3F1N B;  4GS9 A;  4EXO A;  4HI4 A;  4GS9 B;  3T4O A;  3JVU A;  1NRJ A;  3TJZ C;  2Z6C A;  1NWZ A;  3EWK A;  1LSW A;  4HJ4 A;  5TBM B;  3BY8 A;  3PYP A;  3UB8 A;  4CLC E;  1TD5 A;  2PD7 A;  4KQD A;  5FL3 A;  3TW8 A;  1XJ2 A;  4IJG A;  5KIZ A;  3MMH A;  2W1R A;  5A8B A;  4HOI A;  2FZ0 A;  4MN7 A;  3PBO A;  3E98 A;  2O9C A;  3S7N A;  2P7J A;  2O0Y A;  2WKQ A;  2W3D A;  3LIA A;  2OAP 1;  1OPX A;  1V9Z A;  4G3V A;  4AFI A;  1OJG A;  1T1B A;  3ZYT A;  4OOL A;  1STZ A;  3F1O A;  4ARZ A;  1XFQ A;  4KUK A;  1OTE A;  2VKS A;  4UQI M;  3MXQ A;  3U2A A;  4BBU A;  4CLC C;  4YWZ A;  4L9F A;  4R38 A;  2CMN A;  1GSV A;  4LRX C;  2VA0 A;  2W3F A;  2OAQ 1;  1ZTU A;  3RFB A;  5HDC A;  2O9B A;  2ZOH A;  4Y2F A;  3E4O A;  3GEC A;  2PDR A;  1EW0 A;  4XT2 A;  3UME A;  1N9N A;  2O99 A;  5DJT A;  2HV1 A;  3KSF A;  3UB7 A;  2FH5 A;  4I5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...