3KSIA

Structure of frmsr of staphylococcus aureus (complex with 2-propanol)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
TINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILGPFQGHPACVHIPIGKGVCGTAVSERRTQVVADVHQFKGHIACDANSKSEIVVPIFKDDKIIGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title structure of fRMsr of Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
total genus 46
structure length 152
sequence length 152
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ksiA00
3D3OA 3ZQ5A 5LBRA 4R6LA 2W3DA 2K31A 2HGVA 2XROA 4ZRRA 4BWIA 2M7UA 4MMNA 5DFYA 5HSQA 3IBJA 3DBAA 4G3VA 3MQ0A 2VEAA 3NOTC 4R70A 2Y8HA 3HCYA 2O9AA 4G3WA 2G7UA 5HPFA 3VV4A 4DN0A 2ZMFA 1YSPA 2W3HA 3G6OA 4EUVA 1TD5A 2VJWA 2W3EA 3IBRA 5I5LA 3O5YA 4Q0HA 3KO6A 2W1RA 2LB9A 3E0YA 3KSIA 3EEAA 2M7VA 3S7PA 1YKDA 4IJGA 3S7OA 3KSHA 5AJGA 4O8GA 2IA2A 1TF1A 4FOFA 3OBFA 3BJNA 3E98A 4LRXC 5HL6A 3KSGA 2O9CA 1MKMA 4IUHA 4DMZA 4QPRA 3TRCA 2XSSA 4YOFA 1YSQA 5L8MA 2K2NA 3KSFA 4MDZA 2Y79A 5TJJA 4ETZA 2W3FA 2O9BA 4Q0JA 1VHMA 3NOUC 3NHQA 2O0YA 3OOVA 3C2WA 4O0PA 3NOPC 2W1TB 4MN7A 4Y2FA 2OOLA 3W2ZA 4YNRA 4IUKA 5C5KA 4ETXA 4EU0A 4Z1WA 4MCWA 4Y3IA 1STZA 3LFVA 4RQ9A 3RFBA 2QYBA 3CITA 1ZTUA 4LRZE 2VKSA 3K2NA 4ME4A 4CQHA 2O99A 2XRNA 4O01A 5DFXA 3S7NA 3S7QA 5K5BA 4LRYC 2VZWA 2GX5A 1MC0A 2KLIA 2W3GA 3R4KA 4G3KA 4GLQA 4Y5FA 4E04A 4GW9A 5HPIA 2LB5A 4PAUA 4Q0IA 3CI6A 1F5MA 2W1TA 3MF0A 2B18A 2KOIA 3MMHA
chains in the Genus database with same CATH superfamily
3QP1A 3UE6A 1T19A 2Y2GA 4JF6A 3WRZA 1L0GA 3M6HA 1TEMA 3ZVWA 1FSYA 4G3VA 2X71A 1XGJA 3HLBA 2OSUA 5FI2A 3SOIA 4LV2A 5FL3A 2V0UA 3H82A 3IXGA 4R4SA 3O5YA 2QJ7A 2M7VA 5KIZA 4ID4A 4EESA 4F3LB 4N9LA 3MZFA 4X53A 4MNRA 4EBLA 3ZG7B 3BEBA 4LRXC 4X55A 2PYPA 1YLWA 4HIAA 5DKLA 3UDXA 4GCZA 1ZKJA 3HLGA 3N7WA 1OT9A 2L1MA 1XJ4A 4YOFA 1YSQA 2OLUA 3ZVTA 3GMWA 3QP5A 5FSRA 4JKTA 2Y91A 5GLBA 5C5KA 3ZFZA 1W63Q 5EM1A 5EVIC 4DRTA 3G30A 4R38A 1I2SA 2WYXA 4JXVA 2UV0E 3PYPA 4L9GA 3S7NA 5JYPA 4LRYC 1TS7A 1IYQA 3HUNA 4LPZA 4XT2B 2HDUA 4KENB 3BY8A 2B18A 1PI4A 3W4PA 4YWZA 2EX2A 3D3OA 3MZEA 4U0TA 1GA0A 4GKUA 5CECA 4B88A 5GHZA 5F1GA 3NDGA 1G6OA 3H7WB 2JE5A 2G7UA 3MSHA 5HPFA 4R3JA 1D7EA 1GSWA 1YLTA 1ONGA 5HAIA 2JKGA 1FR6A 2PAVP 3IBRA 2WGIA 3T4SA 1ES4A 4OLDA 4OKPA 5FASA 5HDDA 1N9BA 3IHAA 3ULFA 1F98A 5D3OA 3BQ8A 2YKHA 4Y7PA 5HAQA 3E98A 1S6RA 4CLCE 3MXSA 4WZ5A 3DW0A 1ERQA 2JKRI 3VFFA 2XFTA 2C5WB 3UE1A 4GN2A 2V0WA 1VM1A 1LSXA 1AWIA 4DDYA 2K2NA 1IYSA 3HLWA 3PBNA 5HARA 1LT0A 3LR5A 2V9AA 3R7WB 5TGFA 4IHQA 4N1XA 5M18A 1DJAA 4CJNA 3VP1A 1NXYA 2VV6A 3T1QB 2Y2MA 3M6BA 4WL9A 4DE1A 2ZC4B 3V3SA 5HAPA 2KLIA 1VETB 4KZ9A 4FSFA 4OH0A 4PM9A 3MMHA 4UQIS 2IWCA 3OCLA 2XR0A 2Z2LB 3A3IA 3HJIA 5M1AA 1FR1A 3VSLA 1TS8A 2VA0A 4XXRA 1T18A 3GTCA 1K6RA 2J7VA 2V1ZA 3KYZA 4KUOA 5DF7A 3Q7VA 1FQGA 5EV0A 4DJ2A 3WS0A 2JKTM 5HD5A 2BASA 3AGDA 3T4QA 4JBFA 4QHCA 2BLSA 1NY0A 4E6XA 1SKOA 4Q0HA 1MPLA 4E3JA 3FYZA 1YPRA 2WKQA 4X6TA 3G2YA 3S7OA 4ARZB 4JXWA 1MBLA 5EUAA 3BWLA 4BBVA 3BW6A 1BYWA 4UQIM 4E3KA 3P09A 1FCNA 1WYBA 1P9RA 3CMZA 2DMWA 2ZL1B 3D72A 3E4PA 2OV5A 5EOEA 1KDWA 4OPYA 3LY4A 3ZDJA 4N9KA 2Y2JA 1T1AA 4OQ0A 4S2LA 4I3AA 4OVDA 4XUZA 3QP6A 3LIEA 4BL3A 2V20A 1MY8A 3DTKA 3HL9A 4IUKA 1KE4A 1YAXA 1XGIA 1N4OA 2EX8A 4MCWA 4YFMA 1SKFA 3ISGA 1BULA 3A3DA 3RFBA 3W4OA 3UB5P 4IBRA 5DJUA 4PPRA 5F5YA 3PBRA 3VMAA 4GJ4A 4UAAA 2QMIA 3VOLA 1OT6A 1AXBA 2WZZA 3IX8A 2JC7A 3C7UA 3CI6A 5FI6A 3CJMA 3GECA 5FQQA 1ACFA 1FIKA 4ZRRA 4BWIA 1N9LA 4CLCD 4HHDA 4NK3A 4KZ8A 4UA7A 3LR3A 2VEAA 2WZXA 3HCYA 2WKHA 4Y0UA 3LO7A 2ZJ9A 1M40A 1W79A 4L9EA 4NG2A 4KQDA 1TS6A 1VB6A 5I5LA 2P04A 1NRFA 2PR6A 1SKOB 3S7PA 4IJGA 4WN5A 1KVMA 3CLOA 1XFNA 3MZDA 5CGSA 3OBFA 4WEJA 1YLPA 3OPRA 2PBYA 3KSGA 4BL2A 3IWQA 1BT5A 4HBTA 5CRFA 2ZMVA 1H3QA 3NBLA 3U4LP 1W63M 3KYEA 3UO9A 2XSSA 1OTBA 5EVID 4P85A 3NI9A 3A0SA 2EX9A 1ALQA 2ZD8A 1I5QA 1M6KA 4GHIA 1UWNX 2EXAA 3RXXA 2VGLS 2W1TB 4OQIA 5KSCA 4YNRA 1K4EA 4OONA 3MFDA 2H28A 5IT5A 4JGPA 5A8BA 3CITA 2W27A 4DXBA 1O07A 4O01A 1H8YA 1LL8A 3S22A 3QP8A 4ARZA 4HP9A 4PAUA 5E2FA 1PW1A 2WKRA 2BTFP 3PTEA 3V67A 2Q9NA 3IX4A 3D9YA 4EWFA 2HGVA 4MLLA 2XH9A 2Z6CA 1U60A 5A92A 1LL9A 2EWVA 2Y55A 4ESPA 3NIAA 3BFDA 1G5UA 3GVBA 4JGRA 3PBSA 4Y15A 2A49A 3B33A 4DN0A 2P9VB 4FTXA 3ICYA 2VGLM 5BOHA 5EVIB 3G6OA 3MS6A 2VJWA 1GSXA 3FPVA 2PU4A 3NC8A 3PBOA 1E3UD 1Q2PA 3Q81A 4ZBEA 4NXGA 2Y59A 1JWVA 4R4RA 4C75A 3E2KA 2PYRA 4HESA 3UB8A 1JNUA 4HQAA 1BSGA 2CMNA 4S2NA 1VHMA 3VP0A 4DKIA 5F6AA 2WKPA 4KQRA 4EETB 1KE3A 2EFUA 2E8JA 4LCLA 3W2ZA 3F1PA 5A91A 2ZQAA 4BBTA 4Y3IA 2XF3A 2ZC5B 3GR2A 1PNEA 4BENA 3N6IA 4EW7A 1XX2A 2OLVA 3MFXA 2FH5A 5E2GA 3LR4A 3S7QA 3T4KA 1FCOA 4GDBA 3IX3A 3UB9A 4E3OA 3R4KA 1DP8A 3UNWA 4GW9A 3LIDA 4Q0IA 3O3VA 1F5MA 1HVBA 1I2WA 1CQAA 1O7EA 3T4LA 3WS5A 3HLEA 3OC2A 3A0VA 2J3TD 4U0XA 4ZJ2A 1ONHA 1UGUA 4NXBA 3WS2A 2R9XA 3FPWA 4HNBA 1NJ4A 2ZMFA 1ZC2A 2Z2MB 2W3HA 1PZPA 2UWXA 2Y2OA 1W5DA 3FKVA 5AQ7A 2Y2NA 5CEDA 3DTEA 2A3UA 1T1CA 1K56D 4JF4A 5DF9A 3H82B 1IOUA 1K54A 4FD8A 3H7WA 4OQGA 4S2PA 4FOFA 2PD7A 2E8IA 5A93A 3P01A 1ZG4A 3BY9A 1E3UA 1DRMA 5AQAA 5G4YA 2MJ6A 1KGFA 3BECA 1JTDA 3V5MA 1BLPA 2VLGA 3EEHA 4K0WA 1YMXA 3G4PA 2XK1A 1H0MA 2WGVA 1S1ZA 5GHXA 2H5SA 1RGYA 2HJEA 4WBGA 4Y2FA 2VX8A 2PD8A 1NYYA 1MWTA 4NEED 4KG6A 5KZHA 1H8ZA 4WZ5C 1MKIA 4EBNA 5IS1A 4ZDXA 1OJ5A 2Y2HA 1PWCA 2W3GA 4G3KA 5CHUA 4FH2A 3CWFA 3O87A 5DTSA 1W8YA 1N9NA 3OPHA 5CEBA 4E3IA 2ACGA 2ZC6B 2HP9A 1K25A 3PHYA 4IEDA 4LV1A 5DKKA 1CJFA 5J4EA 1QMFA 2EWWA 1PZOA 4KZ6A 5JYOA 1K57A 1PWDA 3SH8A 1MZUA 4ZAMA 1IELA 3MR0A 3IH9A 1W8QA 1NRJA 1TD5A 2B95A 4MN5A 3KO6A 5HL1A 1NLZA 1H8MA 2WAEA 1DJBA 1OTDA 2FFYA 4WMCD 3UDFA 2OWJA 1XA7A 3FWLA 2O9CA 5L07A 3WS4A 4KZ7A 2VV8A 2ZM2A 3SZTA 4Y0OA 3V39A 3KX0X 3MXRA 1IKIA 3A3JA 1DY6A 1LLBA 2J9PA 2EX6A 5FDSA 4EEPA 1MWRA 1ES3A 1T1BA 4I39A 3VP4A 4O0PA 2OOLA 5DVAA 1CI9A 3P7NA 1OJGA 2Y4AA 4CLCB 5MC7A 4EERA 5KMWA 4S2NC 4WYYA 1HD8A 4LRZE 3MJQA 1NZUA 1SZVA 3IH8A 2O99A 2H0TA 3Q1FA 4QJGA 1TDGA 4R0QA 3AGEA 1EWZA 2LB5A 4X25A 2Y2PA 4GS9B 5M19A 2V8FA 3LIAA 4XUXA 3DTMA 2QZ6A 4MMNA 3BLMA 2KDKA 1XKZA 3IQAA 4FUWA 3EGXC 5AVEA 1FOFA 2OAQ1 4GB7A 1S0WA 3ZGAB 3EOIA 2XD5A 3LEQA 4MBFA 3LIFA 4UA9A 1OTIA 3T4JA 4S2OA 1BLCA 3UB6A 2W3EA 3BFFA 4R23A 4S2IA 5F83A 4D60A 3E0YA 1GCEA 2WGWB 4L0LA 4E3MA 3BRMA 4B4XA 3GSGA 1Y28A 1TS0A 2PHYA 2CC1A 3N8SA 4JGQA 3TRCA 4H8RA 3T1SA 2QHKA 5L8MA 5FQIA 1SCWA 1Y54A 2JHEA 4QWOA 1EI5A 3ITAA 1GSVA 2ZL1A 2X02A 1OPXA 3PAEA 1A0KA 3C2WA 2L4RA 2ZM8A 4OLGA 3CAXA 4PM6A 4RX2A 4RQ9A 2QYBA 1D1JA 1WE4A 4GD6A 3LYXA 1ZTUA 4GDNA 2AVXA 1FCMA 4ME4A 1MXOA 3CHWP 1Z6FA 5FQMA 5L10A 4EQ1A 1ES2A 1YLJA 2NUTC 2XEPA 2HPBA 4IBXA 3PR6A 3N8RA 4EQIA 1PIOA 4KZ4A 4RX3A 3WWXA 3LI8A 4K0XA 4K91A 2M7UA 3OPPA 3T1RA 1J9MA 2VV7A 3F1NA 3CPTA 3UN7A 4UEYA 3O88A 5IU1A 3TE8A 3G31A 4X56A 2ZOHA 3BFGA 1RP5A 3IS2B 4JPMA 1KGEA 3IF6C 4EUVA 4AFIA 3S4XA 3WRTA 2ZC7A 4BQMA 5J8XA 4OPQA 1K57C 3LEZA 1K55C 1Z09A 2G2UA 2J8YA 1TF1A 2C6WB 2ZQ9A 3DTIA 1MKMA 4OP8A 2XDMA 5FEGA 5CTMA 5EM0A 3T4TA 3PAGA 3IWOA 3KSFA 3VSKA 2WK0A 3M2KA 3NOUC 3NHQA 1NZOA 1G28A 2HDQA 3NOPC 1V9ZA 3TJZC 3LFVA 1YLZA 2QPNA 1F2KA 3EGDC 4BMWA 4E3NA 3LIBA 4HBUA 5IHVA 4HJ4A 2J80A 3GRJA 4KQOA 4CQHA 1TDLA 1XJ6A 5DFXA 4WMCA 3PBTA 1MC0A 2XGNA 1LI9A 5CGWA 3CZDA 1NWZA 3E2LA 5FI7A 4R6LA 3RXWA 3DWKA 4S2JA 4GNUA 5TR7A 4S2MA 2Z6DA 1ZG6A 5HZHA 4KZ5A 3MQ0A 5F69A 3A3FA 2DRWA 5FQKA 3EQUA 3HUMA 4WELA 3UDIA 3Q07A 2O9AA 5FAPA 3UPOA 2P08A 2PDRA 4RA7A 3GDIA 4PM8A 3D4FA 3LICA 5FDHA 4QB8A 1S67L 1XJ2A 3ZNYA 3LI9A 1IEMA 5TBMB 3T1XA 4O8GA 1K54C 1SDNA 3LR0A 5HL6A 2P7JA 3DAVA 2M1CA 1OTAA 3UMEA 2FZ0A 4I38A 5FEFA 1KE0A 4QPRA 4IVKA 4MDZA 4O7DA 4B93A 5EECA 3B42A 5DTTA 5FAOA 1BLSA 1X0OA 2L0WA 2RCXA 2V1BA 3HJKA 3OPLA 2IWBA 3OOVA 1XA1A 3E4QA 5AQBA 1XP4A 4M4XA 4LV3A 4WEKA 4DE0A 3RJUA 1ERMA 1NLYA 5CGXA 3SS5A 3NECA 4D2OA 4U3TA 1ODVA 1LSWA 1TVFA 4UA6A 1EW0A 3NDEA 3HVFA 5GHYA 3QHYA 1DJCA 3V50A 4NXFA 1K6SA 1LL5A 1PW8A 4BJPA 4NETA 5LBRA 5EFWA 1IFQA 2XFSA 2HP5A 2J3TC 4JXGA 2ZM0A 3JVVA 5DFYA 3IBJA 3DBAA 4E6WA 4R70A 1BLHA 2Y8HA 3EQVA 3ZCZA 4I3JA 3IXBA 4Z9QA 3SH9A 5HD3A 3FZCA 5E2EA 1FILA 3UE3A 3F1OA 1YLYA 2R9WA 2IWDA 4II7A 4KZ3A 1SHVA 1D06A 2LB9A 4OP5A 2WKIA 3Q82A 5AJGA 3AGFA 1L0DA 1PWGA 4EXOA 3DWZA 3UE0A 1F9IA 2X01A 4L9FA 1K56A 5GLCA 4K08A 1P9WA 4X69A 2HV1A 4R3AA 2W3FA 2O9BA 3K3DA 3FV7A 2OAP1 4P6ZS 1KOUA 5FQ9A 1PI5A 4EV4A 3E4OA 4OOMA 4QU3A 4DF6A 2VGJA 2XQZA 2ZMAA 2XA7M 5HDSA 2H10A 3BM6A 3RTYA 5CHMA 4JLFA 2V2FF 1K38A 5J7EA 4P6BA 2GZAA 4HP4A 3ZG5A 2VZWA 3SS3A 1KGGA 5EVIA 4KZBA 4GZBA 3VE4A 5HW3A 3T12B 1IKGA 3BYDA 4UHUA 2WAFA 2ZLYA 3A0RA 2QKPA 2EFXA 2R78A 2K31A 4HJ3A 4PMAA 3HREA 5HWVA 5AVFA 1IYPA 2INWA 4OQHA 1ES5A 1VETA 2ZC3B 1YQSA 5I94A 2Y2KA 3VFHA 2Y2IA 3VV4A 3TW8A 2JBFA 3LUQA 4X68A 4HOIA 2QJ5A 2J9OA 2VK3A 3QNBA 3O86A 5F1FA 3KYQA 5EE8A 3EEAA 3JVUA 1S4RA 4PM7A 1W7FA 5F68A 3BJNA 5DJTA 2P74A 2I9VA 1MWUA 1BUEA 3PBQA 4PKYG 1HZOA 4Q8IA 5CTNA 4DMZA 4E3LA 4H6JA 2V8CA 2V1AA 2HF6A 2EA9A 4C6YA 4KUKA 1NYMA 5U47A 1E4DA 4BD1A 2XD1A 4ETXA 3HLDA 4EU0A 3ITBA 1STZA 3GV9A 1G68A 2PR5A 3UMDA 4FCFA 4HY8A 3IS2A 2FFFB 2ZQ8A 5CERA 3IHBA 4GLQA 3QNCA 4OOLA 3P98A 4NXEA 4GHIB 2A24A 5TFQA 3BQAA 3ZQ5A 3HUOA 1EROA 1XPBA 3NJAA 5KSHA 1BTLA 4Y17A 1OTEA 4JGOA 5L2FA 1ZHHB 4X1MA 4G3WA 4HI4A 3W8KA 5G18A 5J3WA 3SW1A 1YSPA 4BD0A 4XT2A 2I72A 3MBZA 4Y0TA 2W1RA 5HFOA 2HDRA 3KSIA 4KQQA 3C7VA 1YKDA 3HLCA 3Q7VB 1RGZA 1V9YA 1CI8A 2WADA 3PXPA 4X1LA 4OPRA 5A90A 4ZJ3A 3UPPA 3NY4A 3JYIA 1K4FA 4FH4A 3LY3A 2H0YA 2GJ3A 4N1HA 4ETZA 4PKYA 5EOOA 1E25A 5HDCA 3SH7A 5E2HA 3UY6A 5CX7A 3RH8B 4F94A 1VEUB 1DP6A 1K55A 4I5SA 4R3BA 3IF6B 4BLMA 3BFEA 3JPUA 1L0FA 4RYEA 4P87A 3C4OA 4BBUA 2WKEA 1FSWA 4PHTA 4E04A 4OPZA 4CLCA 2WGWA 3R7WA 1YMSA 1GA9A 3L9KA 3ZG8B 1N9OA 4WF0A 3BFCA 3ZNTA 2ZQCA 2W3DA 1S4SA 3VE3A 1PRQA 2KX6A 2A24B 3G32A 4LLOB 3K3CA 4WUJA 5HWWA 2PT7A 4ZTKA 1UWPX 4MBKA 4I3IA 4QD4A 4N92A 4GS9A 3TOIA 2PU2A 1SDEA 4EEUA 1LSVA 5EVEA 1K0KA 1P97A 1L0EA 3TG9A 1HTZA 4CLCC 4KZAA 3OCNA 4IVIA 3WS1A 3B47A 1XJ3A 4LV0A 4JF5A 4WM9A 1XFQA 3L7HA 2IA2A 4HH3A 2W0NA 4DDSA 3VOYA 3G2ZA 4H6JB 3VP2A 5HX9A 4LCMA 2ZQDA 2A2LA 3QP4A 5TJJA 2DCFA 3NCKA 3MQQA 1BZAA 2D01A 5TBMA 1KDSA 1Y4OA 2ZQ7A 1ESIA 3CG5A 3C4PA 1JVJA 3LCEA 4DXCA 3BLSA 1VQQA 5FA7A 4P0MA 3EWKA 3N8LA 4P6ZM 4KG5A 3V3RA 2XRNA 5EVLA 5K5BA 2D02A 5GLAA 4Y5FA 1LI0A 2GX5A 2RL3A 1H5XA 5HPIA 3C38A 2W1TA 5GLDA 4Y13A 3MKEA 1S1YA 3MXQA 3W4QA 4WLAA 4LGWA 2P9VA 1QMEA 1ESUA 4GOGA 1G6AA 3C5AA 3NOTC 2QWSA 1YT4A 3Q7ZA 4EBPA 2NUPC 1OMEA 5FAQA 1PFLA 3NULA 2HZ5A 4HH2A 4C3QA 3IT9A 4A5RA 4HEFA 4HJ6A 2JN7A 1GHIA 3KSHA 5CXWA 3VOZA 1HLUP 5DF8A 3IXDA 4YINA 3IF6A 1JWPA 4OOYA 3UB7A 2HJ9C 4B9OA 4QY5A 3ZG0A 4EUZA 2G2WA 3GQZA 4ZJ1A 3FG8A 4R1GA 2VGKA 4NKPA 2O0YA 5CHJA 1DP9A 2ZOIA 2J3WA 4MN7A 3CUEC 2Q0OA 3CUEA 1JTGA 2GDNA 2VKSA 3K2NA 4DE3A 2HDSA 4F3LA 4DE2A 3S1YA 4MBHA 4LENA 1GHPA 4KG2A 2XA7S 4WZ4A 2Q9MA 4S2KA 3G34A 3F1NB 4CPKA 3F1OB 5FQJA 2XLNA 3U2AA 3IF5A 3MF0A 1CEFA 1IYOA 3F1PB 2KOIA 2GNXA 3OZHA 1S66L 5FATA 4PM5A 3T50A 3T4OA 1MWSA 2XROA 1C3BA 2Y2LA 3OLOA 4B4ZA 1P0ZA 3B3XA 5EPHA 5HSQA 2WUQA 4GD8A 1KVLA 2JKTI 1JWZA 5L09A 2Y2QA 5G4ZA 1L2SA 4MN6A 3FC7A 3I7JA 3TSGA 3VP3A 1WA9A 1CF0A 5AQ9A 1XXMA 4DJ3A 3G35A 3M2JA 4IUHA 3LGOA 2BG1A 3HBRA 3A3EA 5DTKA 3N4IA 3HLFA 2ZBBA 2PRFA 5HWTA 2K7SA 5E43A 4LFUA 4QY6A 2Y79A 1CEGA 2EXBA 5F82A 2HP6A 4Q0JA 1J3WA 1LHYA 1Q2QA 3FKWA 3C30A 3ZG9B 1CK3A 3IXHA 3C8CA 2OWHA 2YKFA 3MQOA 4Z1WA 1L3LA 2JKRM 2JKFA 2DNSA 2B5RA 1PYYA 3ZYTA 3H9WA 3IWIA 3UPNA 1GHMA 4M3KA 3QP2A 1WYCA 3SS4A 3ZHHA 1VEUA 3MKFA 1RCJA 2JCHA 1YM1A 2B02A 4RVAA 5GL9A 2PBDP 4JXSA 4MEZA 3CPTB
chains in the Genus database with same CATH topology
3BQAA 3ZQ5A 3UE6A 3V67A 3LI8A 2HGVA 2M7UA 2Z6CA 3NJAA 1T19A 5KSHA 2VV7A 3F1NA 2EWVA 1OTEA 4G3VA 4JGOA 1ZHHB 4UEYA 5IU1A 4G3WA 4HI4A 3TE8A 4JGRA 3PBSA 2ZOHA 5J3WA 3B33A 4DN0A 3SW1A 3ICYA 2VGLM 1YSPA 3IS2B 4XT2A 5FL3A 2V0UA 3H82A 3G6OA 4EUVA 2VJWA 1GSXA 3FPVA 4AFIA 3O5YA 3PBOA 2W1RA 2QJ7A 3KSIA 2M7VA 5KIZA 4EESA 4F3LB 1YKDA 1TF1A 4NXGA 1V9YA 4LRXC 3PXPA 2PYPA 1MKMA 4HIAA 5DKLA 4GCZA 1OT9A 2L1MA 1XJ4A 4YOFA 1YSQA 3T4TA 3KSFA 2PYRA 2GJ3A 4ETZA 4PKYA 3UB8A 1JNUA 4HQAA 2CMNA 1VHMA 3NOUC 5F6AA 3NHQA 5HDCA 2WKPA 4EETB 1G28A 5CX7A 3RH8B 3NOPC 1V9ZA 3W2ZA 3F1PA 5C5KA 1DP6A 4BBTA 4I5SA 4Y3IA 3TJZC 3LFVA 1W63Q 3EGDC 4BMWA 4EW7A 4R38A 3LIBA 3MFXA 2FH5A 4HJ4A 3LR4A 2J80A 4KQOA 4CQHA 3PYPA 1XJ6A 4L9GA 5DFXA 3S7NA 3S7QA 4BBUA 3PBTA 3T4KA 4LRYC 4PHTA 1TS7A 3UB9A 1MC0A 3R4KA 1DP8A 4E04A 4CLCA 4GW9A 3LIDA 4LPZA 4XT2B 4Q0IA 3R7WA 1F5MA 3BY8A 2B18A 1N9OA 4WF0A 1NWZA 4YWZA 3D3OA 4R6LA 3T4LA 2W3DA 1S4SA 3VE3A 2KX6A 2A24B 3OC2A 4LLOB 3K3CA 4WUJA 5HWWA 3A0VA 2PT7A 2Z6DA 2J3TD 5HZHA 1UWPX 3MQ0A 1UGUA 4NXBA 5F69A 4I3IA 3FPWA 3EQUA 1G6OA 4GS9A 4HNBA 4WELA 3H7WB 2O9AA 2G7UA 4EEUA 5HPFA 1LSVA 2P08A 2PDRA 1D7EA 1GSWA 1P97A 2ZMFA 3GDIA 2W3HA 4CLCC 3OCNA 3LICA 3IBRA 1T1CA 3T4SA 1S67L 1XJ2A 3B47A 5DF9A 5HDDA 3H82B 1XJ3A 3LI9A 1IOUA 3ULFA 5TBMB 3H7WA 1F98A 1XFQA 3BQ8A 4O8GA 2IA2A 2YKHA 3E98A 4FOFA 3LR0A 2PD7A 5HL6A 4CLCE 4HH3A 2W0NA 2P7JA 3P01A 2JKRI 2M1CA 1OTAA 3UMEA 3BY9A 4H6JB 2FZ0A 4I38A 1DRMA 5G4YA 2MJ6A 2V0WA 1LSXA 4QPRA 2VLGA 3EEHA 2A2LA 5TJJA 2K2NA 4MDZA 4B93A 1S1ZA 3B42A 3PBNA 3MQQA 2D01A 1LT0A 5TBMA 3LR5A 1X0OA 2V9AA 3R7WB 2L0WA 2V1BA 3HJKA 4IHQA 3OOVA 2HJEA 4Y2FA 3E4QA 2VX8A 4M4XA 2PD8A 4NEED 4WEKA 1NLYA 2VV6A 3EWKA 4P6ZM 5IS1A 1ODVA 1LSWA 1OJ5A 4WL9A 2XRNA 5K5BA 1EW0A 2D02A 2W3GA 2GX5A 2KLIA 4G3KA 4Y5FA 4NXFA 5HPIA 3C38A 4FSFA 3CWFA 2W1TA 1N9NA 4BJPA 3MMHA 4UQIS 1S1YA 3MXQA 3OCLA 5EFWA 5LBRA 1IFQA 3HJIA 4WLAA 3PHYA 1TS8A 2J3TC 5DKKA 2VA0A 3JVVA 5DFYA 5J4EA 2EWWA 1T18A 4KUOA 3KYZA 3IBJA 3DBAA 3NOTC 4R70A 2Y8HA 3EQVA 4DJ2A 4I3JA 2QWSA 2JKTM 5HD5A 2BASA 2NUPC 1MZUA 5HD3A 3T4QA 3MR0A 3UE3A 3F1OA 4II7A 1NRJA 1TD5A 4MN5A 4Q0HA 4HH2A 1D06A 3KO6A 2LB9A 1NLZA 2WKQA 1H8MA 4HJ6A 2JN7A 3S7OA 4ARZB 3KSHA 1OTDA 5AJGA 3BWLA 4EXOA 4BBVA 3BW6A 1BYWA 4UQIM 2OWJA 2O9CA 1F9IA 3UB7A 2HJ9C 1P9RA 4B9OA 2DMWA 3D72A 4L9FA 2VV8A 4K08A 3E4PA 1P9WA 3FG8A 3KX0X 2HV1A 4R3AA 2W3FA 1T1AA 2O9BA 3K3DA 4P6ZS 2OAP1 4I3AA 1KOUA 3LIEA 4EEPA 4NKPA 1T1BA 2O0YA 3E4OA 1DP9A 4I39A 4OOMA 2ZOIA 2J3WA 4O0PA 4MN7A 2OOLA 4IUKA 1YAXA 3P7NA 2XA7M 3CUEC 4MCWA 1OJGA 5HDSA 4CLCB 3CUEA 3RFBA 4EERA 5MC7A 3RTYA 5DJUA 4LRZE 3MJQA 2VKSA 3K2NA 5J7EA 5F5YA 4F3LA 2O99A 3PBRA 2GZAA 4HP4A 4GJ4A 3VOLA 2XA7S 1OT6A 2VZWA 3F1NB 3F1OB 2LB5A 3U2AA 3CI6A 3VE4A 4GS9B 3MF0A 3F1PB 3A0RA 2KOIA 2GNXA 3LIAA 2QKPA 1S66L 3GECA 2R78A 2K31A 4HJ3A 3T50A 3T4OA 2XROA 4ZRRA 4BWIA 1N9LA 3OLOA 5HWVA 4MMNA 5AVFA 1P0ZA 4CLCD 2INWA 2KDKA 4HHDA 3EGXC 5HSQA 5AVEA 3LR3A 2VEAA 2JKTI 2OAQ1 3HCYA 3EOIA 3VV4A 3TW8A 3LUQA 5G4ZA 3LIFA 4L9EA 3T4JA 1OTIA 4HOIA 2QJ5A 4KQDA 4MN6A 3FC7A 3UB6A 1TS6A 2W3EA 1VB6A 5I5LA 2P04A 3KYQA 3E0YA 2PR6A 3EEAA 3JVUA 3S7PA 4L0LA 1S4RA 1WA9A 4IJGA 4WN5A 5F68A 3CLOA 1XFNA 1Y28A 3BJNA 3OBFA 4WEJA 5DJTA 2I9VA 1TS0A 4DJ3A 3KSGA 2PHYA 4IUHA 3PBQA 4PKYG 2ZMVA 1H3QA 4DMZA 4JGQA 1W63M 4H6JA 2ZBBA 5HWTA 3TRCA 2XSSA 2K7SA 2QHKA 5L8MA 1OTBA 2V1AA 2Y79A 2HF6A 2EA9A 3A0SA 2JHEA 4Q0JA 4KUKA 1GSVA 1OPXA 3C30A 4GHIA 3C8CA 3C2WA 1UWNX 2OWHA 2L4RA 2VGLS 2W1TB 2YKFA 4YNRA 4ETXA 3MQOA 4EU0A 4Z1WA 2JKRM 3CAXA 1STZA 4RQ9A 2H28A 2PR5A 5IT5A 2QYBA 4JGPA 3UMDA 5A8BA 3CITA 3ZYTA 3LYXA 1ZTUA 2W27A 3H9WA 4ME4A 4O01A 4EQ1A 4HY8A 1LL8A 3IS2A 4GLQA 4ARZA 4OOLA 2B02A 4NXEA 4HP9A 2NUTC 4PAUA 2WKRA 4GHIB 2A24A 3PR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3O A;  3ZQ5 A;  5LBR A;  4R6L A;  2W3D A;  2K31 A;  2HGV A;  2XRO A;  4ZRR A;  4BWI A;  2M7U A;  4MMN A;  5DFY A;  5HSQ A;  3IBJ A;  3DBA A;  4G3V A;  3MQ0 A;  2VEA A;  3NOT C;  4R70 A;  2Y8H A;  3HCY A;  2O9A A;  4G3W A;  2G7U A;  5HPF A;  3VV4 A;  4DN0 A;  2ZMF A;  1YSP A;  2W3H A;  3G6O A;  4EUV A;  1TD5 A;  2VJW A;  2W3E A;  3IBR A;  5I5L A;  3O5Y A;  4Q0H A;  3KO6 A;  2W1R A;  2LB9 A;  3E0Y A;  3KSI A;  3EEA A;  2M7V A;  3S7P A;  1YKD A;  4IJG A;  3S7O A;  3KSH A;  5AJG A;  4O8G A;  2IA2 A;  1TF1 A;  4FOF A;  3OBF A;  3BJN A;  3E98 A;  4LRX C;  5HL6 A;  3KSG A;  2O9C A;  1MKM A;  4IUH A;  4DMZ A;  4QPR A;  3TRC A;  2XSS A;  4YOF A;  1YSQ A;  5L8M A;  2K2N A;  3KSF A;  4MDZ A;  2Y79 A;  5TJJ A;  4ETZ A;  2W3F A;  2O9B A;  4Q0J A;  1VHM A;  3NOU C;  3NHQ A;  2O0Y A;  3OOV A;  3C2W A;  4O0P A;  3NOP C;  2W1T B;  4MN7 A;  4Y2F A;  2OOL A;  3W2Z A;  4YNR A;  4IUK A;  5C5K A;  4ETX A;  4EU0 A;  4Z1W A;  4MCW A;  4Y3I A;  1STZ A;  3LFV A;  4RQ9 A;  3RFB A;  2QYB A;  3CIT A;  1ZTU A;  4LRZ E;  2VKS A;  3K2N A;  4ME4 A;  4CQH A;  2O99 A;  2XRN A;  4O01 A;  5DFX A;  3S7N A;  3S7Q A;  5K5B A;  4LRY C;  2VZW A;  2GX5 A;  1MC0 A;  2KLI A;  2W3G A;  3R4K A;  4G3K A;  4GLQ A;  4Y5F A;  4E04 A;  4GW9 A;  5HPI A;  2LB5 A;  4PAU A;  4Q0I A;  3CI6 A;  1F5M A;  2W1T A;  3MF0 A;  2B18 A;  2KOI A;  3MMH A; 
#chains in the Genus database with same CATH topology
 3QP1 A;  3UE6 A;  1T19 A;  2Y2G A;  4JF6 A;  3WRZ A;  1L0G A;  3M6H A;  1TEM A;  3ZVW A;  1FSY A;  4G3V A;  2X71 A;  1XGJ A;  3HLB A;  2OSU A;  5FI2 A;  3SOI A;  4LV2 A;  5FL3 A;  2V0U A;  3H82 A;  3IXG A;  4R4S A;  3O5Y A;  2QJ7 A;  2M7V A;  5KIZ A;  4ID4 A;  4EES A;  4F3L B;  4N9L A;  3MZF A;  4X53 A;  4MNR A;  4EBL A;  3ZG7 B;  3BEB A;  4LRX C;  4X55 A;  2PYP A;  1YLW A;  4HIA A;  5DKL A;  3UDX A;  4GCZ A;  1ZKJ A;  3HLG A;  3N7W A;  1OT9 A;  2L1M A;  1XJ4 A;  4YOF A;  1YSQ A;  2OLU A;  3ZVT A;  3GMW A;  3QP5 A;  5FSR A;  4JKT A;  2Y91 A;  5GLB A;  5C5K A;  3ZFZ A;  1W63 Q;  5EM1 A;  5EVI C;  4DRT A;  3G30 A;  4R38 A;  1I2S A;  2WYX A;  4JXV A;  2UV0 E;  3PYP A;  4L9G A;  3S7N A;  5JYP A;  4LRY C;  1TS7 A;  1IYQ A;  3HUN A;  4LPZ A;  4XT2 B;  2HDU A;  4KEN B;  3BY8 A;  2B18 A;  1PI4 A;  3W4P A;  4YWZ A;  2EX2 A;  3D3O A;  3MZE A;  4U0T A;  1GA0 A;  4GKU A;  5CEC A;  4B88 A;  5GHZ A;  5F1G A;  3NDG A;  1G6O A;  3H7W B;  2JE5 A;  2G7U A;  3MSH A;  5HPF A;  4R3J A;  1D7E A;  1GSW A;  1YLT A;  1ONG A;  5HAI A;  2JKG A;  1FR6 A;  2PAV P;  3IBR A;  2WGI A;  3T4S A;  1ES4 A;  4OLD A;  4OKP A;  5FAS A;  5HDD A;  1N9B A;  3IHA A;  3ULF A;  1F98 A;  5D3O A;  3BQ8 A;  2YKH A;  4Y7P A;  5HAQ A;  3E98 A;  1S6R A;  4CLC E;  3MXS A;  4WZ5 A;  3DW0 A;  1ERQ A;  2JKR I;  3VFF A;  2XFT A;  2C5W B;  3UE1 A;  4GN2 A;  2V0W A;  1VM1 A;  1LSX A;  1AWI A;  4DDY A;  2K2N A;  1IYS A;  3HLW A;  3PBN A;  5HAR A;  1LT0 A;  3LR5 A;  2V9A A;  3R7W B;  5TGF A;  4IHQ A;  4N1X A;  5M18 A;  1DJA A;  4CJN A;  3VP1 A;  1NXY A;  2VV6 A;  3T1Q B;  2Y2M A;  3M6B A;  4WL9 A;  4DE1 A;  2ZC4 B;  3V3S A;  5HAP A;  2KLI A;  1VET B;  4KZ9 A;  4FSF A;  4OH0 A;  4PM9 A;  3MMH A;  4UQI S;  2IWC A;  3OCL A;  2XR0 A;  2Z2L B;  3A3I A;  3HJI A;  5M1A A;  1FR1 A;  3VSL A;  1TS8 A;  2VA0 A;  4XXR A;  1T18 A;  3GTC A;  1K6R A;  2J7V A;  2V1Z A;  3KYZ A;  4KUO A;  5DF7 A;  3Q7V A;  1FQG A;  5EV0 A;  4DJ2 A;  3WS0 A;  2JKT M;  5HD5 A;  2BAS A;  3AGD A;  3T4Q A;  4JBF A;  4QHC A;  2BLS A;  1NY0 A;  4E6X A;  1SKO A;  4Q0H A;  1MPL A;  4E3J A;  3FYZ A;  1YPR A;  2WKQ A;  4X6T A;  3G2Y A;  3S7O A;  4ARZ B;  4JXW A;  1MBL A;  5EUA A;  3BWL A;  4BBV A;  3BW6 A;  1BYW A;  4UQI M;  4E3K A;  3P09 A;  1FCN A;  1WYB A;  1P9R A;  3CMZ A;  2DMW A;  2ZL1 B;  3D72 A;  3E4P A;  2OV5 A;  5EOE A;  1KDW A;  4OPY A;  3LY4 A;  3ZDJ A;  4N9K A;  2Y2J A;  1T1A A;  4OQ0 A;  4S2L A;  4I3A A;  4OVD A;  4XUZ A;  3QP6 A;  3LIE A;  4BL3 A;  2V20 A;  1MY8 A;  3DTK A;  3HL9 A;  4IUK A;  1KE4 A;  1YAX A;  1XGI A;  1N4O A;  2EX8 A;  4MCW A;  4YFM A;  1SKF A;  3ISG A;  1BUL A;  3A3D A;  3RFB A;  3W4O A;  3UB5 P;  4IBR A;  5DJU A;  4PPR A;  5F5Y A;  3PBR A;  3VMA A;  4GJ4 A;  4UAA A;  2QMI A;  3VOL A;  1OT6 A;  1AXB A;  2WZZ A;  3IX8 A;  2JC7 A;  3C7U A;  3CI6 A;  5FI6 A;  3CJM A;  3GEC A;  5FQQ A;  1ACF A;  1FIK A;  4ZRR A;  4BWI A;  1N9L A;  4CLC D;  4HHD A;  4NK3 A;  4KZ8 A;  4UA7 A;  3LR3 A;  2VEA A;  2WZX A;  3HCY A;  2WKH A;  4Y0U A;  3LO7 A;  2ZJ9 A;  1M40 A;  1W79 A;  4L9E A;  4NG2 A;  4KQD A;  1TS6 A;  1VB6 A;  5I5L A;  2P04 A;  1NRF A;  2PR6 A;  1SKO B;  3S7P A;  4IJG A;  4WN5 A;  1KVM A;  3CLO A;  1XFN A;  3MZD A;  5CGS A;  3OBF A;  4WEJ A;  1YLP A;  3OPR A;  2PBY A;  3KSG A;  4BL2 A;  3IWQ A;  1BT5 A;  4HBT A;  5CRF A;  2ZMV A;  1H3Q A;  3NBL A;  3U4L P;  1W63 M;  3KYE A;  3UO9 A;  2XSS A;  1OTB A;  5EVI D;  4P85 A;  3NI9 A;  3A0S A;  2EX9 A;  1ALQ A;  2ZD8 A;  1I5Q A;  1M6K A;  4GHI A;  1UWN X;  2EXA A;  3RXX A;  2VGL S;  2W1T B;  4OQI A;  5KSC A;  4YNR A;  1K4E A;  4OON A;  3MFD A;  2H28 A;  5IT5 A;  4JGP A;  5A8B A;  3CIT A;  2W27 A;  4DXB A;  1O07 A;  4O01 A;  1H8Y A;  1LL8 A;  3S22 A;  3QP8 A;  4ARZ A;  4HP9 A;  4PAU A;  5E2F A;  1PW1 A;  2WKR A;  2BTF P;  3PTE A;  3V67 A;  2Q9N A;  3IX4 A;  3D9Y A;  4EWF A;  2HGV A;  4MLL A;  2XH9 A;  2Z6C A;  1U60 A;  5A92 A;  1LL9 A;  2EWV A;  2Y55 A;  4ESP A;  3NIA A;  3BFD A;  1G5U A;  3GVB A;  4JGR A;  3PBS A;  4Y15 A;  2A49 A;  3B33 A;  4DN0 A;  2P9V B;  4FTX A;  3ICY A;  2VGL M;  5BOH A;  5EVI B;  3G6O A;  3MS6 A;  2VJW A;  1GSX A;  3FPV A;  2PU4 A;  3NC8 A;  3PBO A;  1E3U D;  1Q2P A;  3Q81 A;  4ZBE A;  4NXG A;  2Y59 A;  1JWV A;  4R4R A;  4C75 A;  3E2K A;  2PYR A;  4HES A;  3UB8 A;  1JNU A;  4HQA A;  1BSG A;  2CMN A;  4S2N A;  1VHM A;  3VP0 A;  4DKI A;  5F6A A;  2WKP A;  4KQR A;  4EET B;  1KE3 A;  2EFU A;  2E8J A;  4LCL A;  3W2Z A;  3F1P A;  5A91 A;  2ZQA A;  4BBT A;  4Y3I A;  2XF3 A;  2ZC5 B;  3GR2 A;  1PNE A;  4BEN A;  3N6I A;  4EW7 A;  1XX2 A;  2OLV A;  3MFX A;  2FH5 A;  5E2G A;  3LR4 A;  3S7Q A;  3T4K A;  1FCO A;  4GDB A;  3IX3 A;  3UB9 A;  4E3O A;  3R4K A;  1DP8 A;  3UNW A;  4GW9 A;  3LID A;  4Q0I A;  3O3V A;  1F5M A;  1HVB A;  1I2W A;  1CQA A;  1O7E A;  3T4L A;  3WS5 A;  3HLE A;  3OC2 A;  3A0V A;  2J3T D;  4U0X A;  4ZJ2 A;  1ONH A;  1UGU A;  4NXB A;  3WS2 A;  2R9X A;  3FPW A;  4HNB A;  1NJ4 A;  2ZMF A;  1ZC2 A;  2Z2M B;  2W3H A;  1PZP A;  2UWX A;  2Y2O A;  1W5D A;  3FKV A;  5AQ7 A;  2Y2N A;  5CED A;  3DTE A;  2A3U A;  1T1C A;  1K56 D;  4JF4 A;  5DF9 A;  3H82 B;  1IOU A;  1K54 A;  4FD8 A;  3H7W A;  4OQG A;  4S2P A;  4FOF A;  2PD7 A;  2E8I A;  5A93 A;  3P01 A;  1ZG4 A;  3BY9 A;  1E3U A;  1DRM A;  5AQA A;  5G4Y A;  2MJ6 A;  1KGF A;  3BEC A;  1JTD A;  3V5M A;  1BLP A;  2VLG A;  3EEH A;  4K0W A;  1YMX A;  3G4P A;  2XK1 A;  1H0M A;  2WGV A;  1S1Z A;  5GHX A;  2H5S A;  1RGY A;  2HJE A;  4WBG A;  4Y2F A;  2VX8 A;  2PD8 A;  1NYY A;  1MWT A;  4NEE D;  4KG6 A;  5KZH A;  1H8Z A;  4WZ5 C;  1MKI A;  4EBN A;  5IS1 A;  4ZDX A;  1OJ5 A;  2Y2H A;  1PWC A;  2W3G A;  4G3K A;  5CHU A;  4FH2 A;  3CWF A;  3O87 A;  5DTS A;  1W8Y A;  1N9N A;  3OPH A;  5CEB A;  4E3I A;  2ACG A;  2ZC6 B;  2HP9 A;  1K25 A;  3PHY A;  4IED A;  4LV1 A;  5DKK A;  1CJF A;  5J4E A;  1QMF A;  2EWW A;  1PZO A;  4KZ6 A;  5JYO A;  1K57 A;  1PWD A;  3SH8 A;  1MZU A;  4ZAM A;  1IEL A;  3MR0 A;  3IH9 A;  1W8Q A;  1NRJ A;  1TD5 A;  2B95 A;  4MN5 A;  3KO6 A;  5HL1 A;  1NLZ A;  1H8M A;  2WAE A;  1DJB A;  1OTD A;  2FFY A;  4WMC D;  3UDF A;  2OWJ A;  1XA7 A;  3FWL A;  2O9C A;  5L07 A;  3WS4 A;  4KZ7 A;  2VV8 A;  2ZM2 A;  3SZT A;  4Y0O A;  3V39 A;  3KX0 X;  3MXR A;  1IKI A;  3A3J A;  1DY6 A;  1LLB A;  2J9P A;  2EX6 A;  5FDS A;  4EEP A;  1MWR A;  1ES3 A;  1T1B A;  4I39 A;  3VP4 A;  4O0P A;  2OOL A;  5DVA A;  1CI9 A;  3P7N A;  1OJG A;  2Y4A A;  4CLC B;  5MC7 A;  4EER A;  5KMW A;  4S2N C;  4WYY A;  1HD8 A;  4LRZ E;  3MJQ A;  1NZU A;  1SZV A;  3IH8 A;  2O99 A;  2H0T A;  3Q1F A;  4QJG A;  1TDG A;  4R0Q A;  3AGE A;  1EWZ A;  2LB5 A;  4X25 A;  2Y2P A;  4GS9 B;  5M19 A;  2V8F A;  3LIA A;  4XUX A;  3DTM A;  2QZ6 A;  4MMN A;  3BLM A;  2KDK A;  1XKZ A;  3IQA A;  4FUW A;  3EGX C;  5AVE A;  1FOF A;  2OAQ 1;  4GB7 A;  1S0W A;  3ZGA B;  3EOI A;  2XD5 A;  3LEQ A;  4MBF A;  3LIF A;  4UA9 A;  1OTI A;  3T4J A;  4S2O A;  1BLC A;  3UB6 A;  2W3E A;  3BFF A;  4R23 A;  4S2I A;  5F83 A;  4D60 A;  3E0Y A;  1GCE A;  2WGW B;  4L0L A;  4E3M A;  3BRM A;  4B4X A;  3GSG A;  1Y28 A;  1TS0 A;  2PHY A;  2CC1 A;  3N8S A;  4JGQ A;  3TRC A;  4H8R A;  3T1S A;  2QHK A;  5L8M A;  5FQI A;  1SCW A;  1Y54 A;  2JHE A;  4QWO A;  1EI5 A;  3ITA A;  1GSV A;  2ZL1 A;  2X02 A;  1OPX A;  3PAE A;  1A0K A;  3C2W A;  2L4R A;  2ZM8 A;  4OLG A;  3CAX A;  4PM6 A;  4RX2 A;  4RQ9 A;  2QYB A;  1D1J A;  1WE4 A;  4GD6 A;  3LYX A;  1ZTU A;  4GDN A;  2AVX A;  1FCM A;  4ME4 A;  1MXO A;  3CHW P;  1Z6F A;  5FQM A;  5L10 A;  4EQ1 A;  1ES2 A;  1YLJ A;  2NUT C;  2XEP A;  2HPB A;  4IBX A;  3PR6 A;  3N8R A;  4EQI A;  1PIO A;  4KZ4 A;  4RX3 A;  3WWX A;  3LI8 A;  4K0X A;  4K91 A;  2M7U A;  3OPP A;  3T1R A;  1J9M A;  2VV7 A;  3F1N A;  3CPT A;  3UN7 A;  4UEY A;  3O88 A;  5IU1 A;  3TE8 A;  3G31 A;  4X56 A;  2ZOH A;  3BFG A;  1RP5 A;  3IS2 B;  4JPM A;  1KGE A;  3IF6 C;  4EUV A;  4AFI A;  3S4X A;  3WRT A;  2ZC7 A;  4BQM A;  5J8X A;  4OPQ A;  1K57 C;  3LEZ A;  1K55 C;  1Z09 A;  2G2U A;  2J8Y A;  1TF1 A;  2C6W B;  2ZQ9 A;  3DTI A;  1MKM A;  4OP8 A;  2XDM A;  5FEG A;  5CTM A;  5EM0 A;  3T4T A;  3PAG A;  3IWO A;  3KSF A;  3VSK A;  2WK0 A;  3M2K A;  3NOU C;  3NHQ A;  1NZO A;  1G28 A;  2HDQ A;  3NOP C;  1V9Z A;  3TJZ C;  3LFV A;  1YLZ A;  2QPN A;  1F2K A;  3EGD C;  4BMW A;  4E3N A;  3LIB A;  4HBU A;  5IHV A;  4HJ4 A;  2J80 A;  3GRJ A;  4KQO A;  4CQH A;  1TDL A;  1XJ6 A;  5DFX A;  4WMC A;  3PBT A;  1MC0 A;  2XGN A;  1LI9 A;  5CGW A;  3CZD A;  1NWZ A;  3E2L A;  5FI7 A;  4R6L A;  3RXW A;  3DWK A;  4S2J A;  4GNU A;  5TR7 A;  4S2M A;  2Z6D A;  1ZG6 A;  5HZH A;  4KZ5 A;  3MQ0 A;  5F69 A;  3A3F A;  2DRW A;  5FQK A;  3EQU A;  3HUM A;  4WEL A;  3UDI A;  3Q07 A;  2O9A A;  5FAP A;  3UPO A;  2P08 A;  2PDR A;  4RA7 A;  3GDI A;  4PM8 A;  3D4F A;  3LIC A;  5FDH A;  4QB8 A;  1S67 L;  1XJ2 A;  3ZNY A;  3LI9 A;  1IEM A;  5TBM B;  3T1X A;  4O8G A;  1K54 C;  1SDN A;  3LR0 A;  5HL6 A;  2P7J A;  3DAV A;  2M1C A;  1OTA A;  3UME A;  2FZ0 A;  4I38 A;  5FEF A;  1KE0 A;  4QPR A;  4IVK A;  4MDZ A;  4O7D A;  4B93 A;  5EEC A;  3B42 A;  5DTT A;  5FAO A;  1BLS A;  1X0O A;  2L0W A;  2RCX A;  2V1B A;  3HJK A;  3OPL A;  2IWB A;  3OOV A;  1XA1 A;  3E4Q A;  5AQB A;  1XP4 A;  4M4X A;  4LV3 A;  4WEK A;  4DE0 A;  3RJU A;  1ERM A;  1NLY A;  5CGX A;  3SS5 A;  3NEC A;  4D2O A;  4U3T A;  1ODV A;  1LSW A;  1TVF A;  4UA6 A;  1EW0 A;  3NDE A;  3HVF A;  5GHY A;  3QHY A;  1DJC A;  3V50 A;  4NXF A;  1K6S A;  1LL5 A;  1PW8 A;  4BJP A;  4NET A;  5LBR A;  5EFW A;  1IFQ A;  2XFS A;  2HP5 A;  2J3T C;  4JXG A;  2ZM0 A;  3JVV A;  5DFY A;  3IBJ A;  3DBA A;  4E6W A;  4R70 A;  1BLH A;  2Y8H A;  3EQV A;  3ZCZ A;  4I3J A;  3IXB A;  4Z9Q A;  3SH9 A;  5HD3 A;  3FZC A;  5E2E A;  1FIL A;  3UE3 A;  3F1O A;  1YLY A;  2R9W A;  2IWD A;  4II7 A;  4KZ3 A;  1SHV A;  1D06 A;  2LB9 A;  4OP5 A;  2WKI A;  3Q82 A;  5AJG A;  3AGF A;  1L0D A;  1PWG A;  4EXO A;  3DWZ A;  3UE0 A;  1F9I A;  2X01 A;  4L9F A;  1K56 A;  5GLC A;  4K08 A;  1P9W A;  4X69 A;  2HV1 A;  4R3A A;  2W3F A;  2O9B A;  3K3D A;  3FV7 A;  2OAP 1;  4P6Z S;  1KOU A;  5FQ9 A;  1PI5 A;  4EV4 A;  3E4O A;  4OOM A;  4QU3 A;  4DF6 A;  2VGJ A;  2XQZ A;  2ZMA A;  2XA7 M;  5HDS A;  2H10 A;  3BM6 A;  3RTY A;  5CHM A;  4JLF A;  2V2F F;  1K38 A;  5J7E A;  4P6B A;  2GZA A;  4HP4 A;  3ZG5 A;  2VZW A;  3SS3 A;  1KGG A;  5EVI A;  4KZB A;  4GZB A;  3VE4 A;  5HW3 A;  3T12 B;  1IKG A;  3BYD A;  4UHU A;  2WAF A;  2ZLY A;  3A0R A;  2QKP A;  2EFX A;  2R78 A;  2K31 A;  4HJ3 A;  4PMA A;  3HRE A;  5HWV A;  5AVF A;  1IYP A;  2INW A;  4OQH A;  1ES5 A;  1VET A;  2ZC3 B;  1YQS A;  5I94 A;  2Y2K A;  3VFH A;  2Y2I A;  3VV4 A;  3TW8 A;  2JBF A;  3LUQ A;  4X68 A;  4HOI A;  2QJ5 A;  2J9O A;  2VK3 A;  3QNB A;  3O86 A;  5F1F A;  3KYQ A;  5EE8 A;  3EEA A;  3JVU A;  1S4R A;  4PM7 A;  1W7F A;  5F68 A;  3BJN A;  5DJT A;  2P74 A;  2I9V A;  1MWU A;  1BUE A;  3PBQ A;  4PKY G;  1HZO A;  4Q8I A;  5CTN A;  4DMZ A;  4E3L A;  4H6J A;  2V8C A;  2V1A A;  2HF6 A;  2EA9 A;  4C6Y A;  4KUK A;  1NYM A;  5U47 A;  1E4D A;  4BD1 A;  2XD1 A;  4ETX A;  3HLD A;  4EU0 A;  3ITB A;  1STZ A;  3GV9 A;  1G68 A;  2PR5 A;  3UMD A;  4FCF A;  4HY8 A;  3IS2 A;  2FFF B;  2ZQ8 A;  5CER A;  3IHB A;  4GLQ A;  3QNC A;  4OOL A;  3P98 A;  4NXE A;  4GHI B;  2A24 A;  5TFQ A;  3BQA A;  3ZQ5 A;  3HUO A;  1ERO A;  1XPB A;  3NJA A;  5KSH A;  1BTL A;  4Y17 A;  1OTE A;  4JGO A;  5L2F A;  1ZHH B;  4X1M A;  4G3W A;  4HI4 A;  3W8K A;  5G18 A;  5J3W A;  3SW1 A;  1YSP A;  4BD0 A;  4XT2 A;  2I72 A;  3MBZ A;  4Y0T A;  2W1R A;  5HFO A;  2HDR A;  3KSI A;  4KQQ A;  3C7V A;  1YKD A;  3HLC A;  3Q7V B;  1RGZ A;  1V9Y A;  1CI8 A;  2WAD A;  3PXP A;  4X1L A;  4OPR A;  5A90 A;  4ZJ3 A;  3UPP A;  3NY4 A;  3JYI A;  1K4F A;  4FH4 A;  3LY3 A;  2H0Y A;  2GJ3 A;  4N1H A;  4ETZ A;  4PKY A;  5EOO A;  1E25 A;  5HDC A;  3SH7 A;  5E2H A;  3UY6 A;  5CX7 A;  3RH8 B;  4F94 A;  1VEU B;  1DP6 A;  1K55 A;  4I5S A;  4R3B A;  3IF6 B;  4BLM A;  3BFE A;  3JPU A;  1L0F A;  4RYE A;  4P87 A;  3C4O A;  4BBU A;  2WKE A;  1FSW A;  4PHT A;  4E04 A;  4OPZ A;  4CLC A;  2WGW A;  3R7W A;  1YMS A;  1GA9 A;  3L9K A;  3ZG8 B;  1N9O A;  4WF0 A;  3BFC A;  3ZNT A;  2ZQC A;  2W3D A;  1S4S A;  3VE3 A;  1PRQ A;  2KX6 A;  2A24 B;  3G32 A;  4LLO B;  3K3C A;  4WUJ A;  5HWW A;  2PT7 A;  4ZTK A;  1UWP X;  4MBK A;  4I3I A;  4QD4 A;  4N92 A;  4GS9 A;  3TOI A;  2PU2 A;  1SDE A;  4EEU A;  1LSV A;  5EVE A;  1K0K A;  1P97 A;  1L0E A;  3TG9 A;  1HTZ A;  4CLC C;  4KZA A;  3OCN A;  4IVI A;  3WS1 A;  3B47 A;  1XJ3 A;  4LV0 A;  4JF5 A;  4WM9 A;  1XFQ A;  3L7H A;  2IA2 A;  4HH3 A;  2W0N A;  4DDS A;  3VOY A;  3G2Z A;  4H6J B;  3VP2 A;  5HX9 A;  4LCM A;  2ZQD A;  2A2L A;  3QP4 A;  5TJJ A;  2DCF A;  3NCK A;  3MQQ A;  1BZA A;  2D01 A;  5TBM A;  1KDS A;  1Y4O A;  2ZQ7 A;  1ESI A;  3CG5 A;  3C4P A;  1JVJ A;  3LCE A;  4DXC A;  3BLS A;  1VQQ A;  5FA7 A;  4P0M A;  3EWK A;  3N8L A;  4P6Z M;  4KG5 A;  3V3R A;  2XRN A;  5EVL A;  5K5B A;  2D02 A;  5GLA A;  4Y5F A;  1LI0 A;  2GX5 A;  2RL3 A;  1H5X A;  5HPI A;  3C38 A;  2W1T A;  5GLD A;  4Y13 A;  3MKE A;  1S1Y A;  3MXQ A;  3W4Q A;  4WLA A;  4LGW A;  2P9V A;  1QME A;  1ESU A;  4GOG A;  1G6A A;  3C5A A;  3NOT C;  2QWS A;  1YT4 A;  3Q7Z A;  4EBP A;  2NUP C;  1OME A;  5FAQ A;  1PFL A;  3NUL A;  2HZ5 A;  4HH2 A;  4C3Q A;  3IT9 A;  4A5R A;  4HEF A;  4HJ6 A;  2JN7 A;  1GHI A;  3KSH A;  5CXW A;  3VOZ A;  1HLU P;  5DF8 A;  3IXD A;  4YIN A;  3IF6 A;  1JWP A;  4OOY A;  3UB7 A;  2HJ9 C;  4B9O A;  4QY5 A;  3ZG0 A;  4EUZ A;  2G2W A;  3GQZ A;  4ZJ1 A;  3FG8 A;  4R1G A;  2VGK A;  4NKP A;  2O0Y A;  5CHJ A;  1DP9 A;  2ZOI A;  2J3W A;  4MN7 A;  3CUE C;  2Q0O A;  3CUE A;  1JTG A;  2GDN A;  2VKS A;  3K2N A;  4DE3 A;  2HDS A;  4F3L A;  4DE2 A;  3S1Y A;  4MBH A;  4LEN A;  1GHP A;  4KG2 A;  2XA7 S;  4WZ4 A;  2Q9M A;  4S2K A;  3G34 A;  3F1N B;  4CPK A;  3F1O B;  5FQJ A;  2XLN A;  3U2A A;  3IF5 A;  3MF0 A;  1CEF A;  1IYO A;  3F1P B;  2KOI A;  2GNX A;  3OZH A;  1S66 L;  5FAT A;  4PM5 A;  3T50 A;  3T4O A;  1MWS A;  2XRO A;  1C3B A;  2Y2L A;  3OLO A;  4B4Z A;  1P0Z A;  3B3X A;  5EPH A;  5HSQ A;  2WUQ A;  4GD8 A;  1KVL A;  2JKT I;  1JWZ A;  5L09 A;  2Y2Q A;  5G4Z A;  1L2S A;  4MN6 A;  3FC7 A;  3I7J A;  3TSG A;  3VP3 A;  1WA9 A;  1CF0 A;  5AQ9 A;  1XXM A;  4DJ3 A;  3G35 A;  3M2J A;  4IUH A;  3LGO A;  2BG1 A;  3HBR A;  3A3E A;  5DTK A;  3N4I A;  3HLF A;  2ZBB A;  2PRF A;  5HWT A;  2K7S A;  5E43 A;  4LFU A;  4QY6 A;  2Y79 A;  1CEG A;  2EXB A;  5F82 A;  2HP6 A;  4Q0J A;  1J3W A;  1LHY A;  1Q2Q A;  3FKW A;  3C30 A;  3ZG9 B;  1CK3 A;  3IXH A;  3C8C A;  2OWH A;  2YKF A;  3MQO A;  4Z1W A;  1L3L A;  2JKR M;  2JKF A;  2DNS A;  2B5R A;  1PYY A;  3ZYT A;  3H9W A;  3IWI A;  3UPN A;  1GHM A;  4M3K A;  3QP2 A;  1WYC A;  3SS4 A;  3ZHH A;  1VEU A;  3MKF A;  1RCJ A;  2JCH A;  1YM1 A;  2B02 A;  4RVA A;  5GL9 A;  2PBD P;  4JXS A;  4MEZ A;  3CPT B; 
#chains in the Genus database with same CATH homology
 3BQA A;  3ZQ5 A;  3UE6 A;  3V67 A;  3LI8 A;  2HGV A;  2M7U A;  2Z6C A;  3NJA A;  1T19 A;  5KSH A;  2VV7 A;  3F1N A;  2EWV A;  1OTE A;  4G3V A;  4JGO A;  1ZHH B;  4UEY A;  5IU1 A;  4G3W A;  4HI4 A;  3TE8 A;  4JGR A;  3PBS A;  2ZOH A;  5J3W A;  3B33 A;  4DN0 A;  3SW1 A;  3ICY A;  2VGL M;  1YSP A;  3IS2 B;  4XT2 A;  5FL3 A;  2V0U A;  3H82 A;  3G6O A;  4EUV A;  2VJW A;  1GSX A;  3FPV A;  4AFI A;  3O5Y A;  3PBO A;  2W1R A;  2QJ7 A;  3KSI A;  2M7V A;  5KIZ A;  4EES A;  4F3L B;  1YKD A;  1TF1 A;  4NXG A;  1V9Y A;  4LRX C;  3PXP A;  2PYP A;  1MKM A;  4HIA A;  5DKL A;  4GCZ A;  1OT9 A;  2L1M A;  1XJ4 A;  4YOF A;  1YSQ A;  3T4T A;  3KSF A;  2PYR A;  2GJ3 A;  4ETZ A;  4PKY A;  3UB8 A;  1JNU A;  4HQA A;  2CMN A;  1VHM A;  3NOU C;  5F6A A;  3NHQ A;  5HDC A;  2WKP A;  4EET B;  1G28 A;  5CX7 A;  3RH8 B;  3NOP C;  1V9Z A;  3W2Z A;  3F1P A;  5C5K A;  1DP6 A;  4BBT A;  4I5S A;  4Y3I A;  3TJZ C;  3LFV A;  1W63 Q;  3EGD C;  4BMW A;  4EW7 A;  4R38 A;  3LIB A;  3MFX A;  2FH5 A;  4HJ4 A;  3LR4 A;  2J80 A;  4KQO A;  4CQH A;  3PYP A;  1XJ6 A;  4L9G A;  5DFX A;  3S7N A;  3S7Q A;  4BBU A;  3PBT A;  3T4K A;  4LRY C;  4PHT A;  1TS7 A;  3UB9 A;  1MC0 A;  3R4K A;  1DP8 A;  4E04 A;  4CLC A;  4GW9 A;  3LID A;  4LPZ A;  4XT2 B;  4Q0I A;  3R7W A;  1F5M A;  3BY8 A;  2B18 A;  1N9O A;  4WF0 A;  1NWZ A;  4YWZ A;  3D3O A;  4R6L A;  3T4L A;  2W3D A;  1S4S A;  3VE3 A;  2KX6 A;  2A24 B;  3OC2 A;  4LLO B;  3K3C A;  4WUJ A;  5HWW A;  3A0V A;  2PT7 A;  2Z6D A;  2J3T D;  5HZH A;  1UWP X;  3MQ0 A;  1UGU A;  4NXB A;  5F69 A;  4I3I A;  3FPW A;  3EQU A;  1G6O A;  4GS9 A;  4HNB A;  4WEL A;  3H7W B;  2O9A A;  2G7U A;  4EEU A;  5HPF A;  1LSV A;  2P08 A;  2PDR A;  1D7E A;  1GSW A;  1P97 A;  2ZMF A;  3GDI A;  2W3H A;  4CLC C;  3OCN A;  3LIC A;  3IBR A;  1T1C A;  3T4S A;  1S67 L;  1XJ2 A;  3B47 A;  5DF9 A;  5HDD A;  3H82 B;  1XJ3 A;  3LI9 A;  1IOU A;  3ULF A;  5TBM B;  3H7W A;  1F98 A;  1XFQ A;  3BQ8 A;  4O8G A;  2IA2 A;  2YKH A;  3E98 A;  4FOF A;  3LR0 A;  2PD7 A;  5HL6 A;  4CLC E;  4HH3 A;  2W0N A;  2P7J A;  3P01 A;  2JKR I;  2M1C A;  1OTA A;  3UME A;  3BY9 A;  4H6J B;  2FZ0 A;  4I38 A;  1DRM A;  5G4Y A;  2MJ6 A;  2V0W A;  1LSX A;  4QPR A;  2VLG A;  3EEH A;  2A2L A;  5TJJ A;  2K2N A;  4MDZ A;  4B93 A;  1S1Z A;  3B42 A;  3PBN A;  3MQQ A;  2D01 A;  1LT0 A;  5TBM A;  3LR5 A;  1X0O A;  2V9A A;  3R7W B;  2L0W A;  2V1B A;  3HJK A;  4IHQ A;  3OOV A;  2HJE A;  4Y2F A;  3E4Q A;  2VX8 A;  4M4X A;  2PD8 A;  4NEE D;  4WEK A;  1NLY A;  2VV6 A;  3EWK A;  4P6Z M;  5IS1 A;  1ODV A;  1LSW A;  1OJ5 A;  4WL9 A;  2XRN A;  5K5B A;  1EW0 A;  2D02 A;  2W3G A;  2GX5 A;  2KLI A;  4G3K A;  4Y5F A;  4NXF A;  5HPI A;  3C38 A;  4FSF A;  3CWF A;  2W1T A;  1N9N A;  4BJP A;  3MMH A;  4UQI S;  1S1Y A;  3MXQ A;  3OCL A;  5EFW A;  5LBR A;  1IFQ A;  3HJI A;  4WLA A;  3PHY A;  1TS8 A;  2J3T C;  5DKK A;  2VA0 A;  3JVV A;  5DFY A;  5J4E A;  2EWW A;  1T18 A;  4KUO A;  3KYZ A;  3IBJ A;  3DBA A;  3NOT C;  4R70 A;  2Y8H A;  3EQV A;  4DJ2 A;  4I3J A;  2QWS A;  2JKT M;  5HD5 A;  2BAS A;  2NUP C;  1MZU A;  5HD3 A;  3T4Q A;  3MR0 A;  3UE3 A;  3F1O A;  4II7 A;  1NRJ A;  1TD5 A;  4MN5 A;  4Q0H A;  4HH2 A;  1D06 A;  3KO6 A;  2LB9 A;  1NLZ A;  2WKQ A;  1H8M A;  4HJ6 A;  2JN7 A;  3S7O A;  4ARZ B;  3KSH A;  1OTD A;  5AJG A;  3BWL A;  4EXO A;  4BBV A;  3BW6 A;  1BYW A;  4UQI M;  2OWJ A;  2O9C A;  1F9I A;  3UB7 A;  2HJ9 C;  1P9R A;  4B9O A;  2DMW A;  3D72 A;  4L9F A;  2VV8 A;  4K08 A;  3E4P A;  1P9W A;  3FG8 A;  3KX0 X;  2HV1 A;  4R3A A;  2W3F A;  1T1A A;  2O9B A;  3K3D A;  4P6Z S;  2OAP 1;  4I3A A;  1KOU A;  3LIE A;  4EEP A;  4NKP A;  1T1B A;  2O0Y A;  3E4O A;  1DP9 A;  4I39 A;  4OOM A;  2ZOI A;  2J3W A;  4O0P A;  4MN7 A;  2OOL A;  4IUK A;  1YAX A;  3P7N A;  2XA7 M;  3CUE C;  4MCW A;  1OJG A;  5HDS A;  4CLC B;  3CUE A;  3RFB A;  4EER A;  5MC7 A;  3RTY A;  5DJU A;  4LRZ E;  3MJQ A;  2VKS A;  3K2N A;  5J7E A;  5F5Y A;  4F3L A;  2O99 A;  3PBR A;  2GZA A;  4HP4 A;  4GJ4 A;  3VOL A;  2XA7 S;  1OT6 A;  2VZW A;  3F1N B;  3F1O B;  2LB5 A;  3U2A A;  3CI6 A;  3VE4 A;  4GS9 B;  3MF0 A;  3F1P B;  3A0R A;  2KOI A;  2GNX A;  3LIA A;  2QKP A;  1S66 L;  3GEC A;  2R78 A;  2K31 A;  4HJ3 A;  3T50 A;  3T4O A;  2XRO A;  4ZRR A;  4BWI A;  1N9L A;  3OLO A;  5HWV A;  4MMN A;  5AVF A;  1P0Z A;  4CLC D;  2INW A;  2KDK A;  4HHD A;  3EGX C;  5HSQ A;  5AVE A;  3LR3 A;  2VEA A;  2JKT I;  2OAQ 1;  3HCY A;  3EOI A;  3VV4 A;  3TW8 A;  3LUQ A;  5G4Z A;  3LIF A;  4L9E A;  3T4J A;  1OTI A;  4HOI A;  2QJ5 A;  4KQD A;  4MN6 A;  3FC7 A;  3UB6 A;  1TS6 A;  2W3E A;  1VB6 A;  5I5L A;  2P04 A;  3KYQ A;  3E0Y A;  2PR6 A;  3EEA A;  3JVU A;  3S7P A;  4L0L A;  1S4R A;  1WA9 A;  4IJG A;  4WN5 A;  5F68 A;  3CLO A;  1XFN A;  1Y28 A;  3BJN A;  3OBF A;  4WEJ A;  5DJT A;  2I9V A;  1TS0 A;  4DJ3 A;  3KSG A;  2PHY A;  4IUH A;  3PBQ A;  4PKY G;  2ZMV A;  1H3Q A;  4DMZ A;  4JGQ A;  1W63 M;  4H6J A;  2ZBB A;  5HWT A;  3TRC A;  2XSS A;  2K7S A;  2QHK A;  5L8M A;  1OTB A;  2V1A A;  2Y79 A;  2HF6 A;  2EA9 A;  3A0S A;  2JHE A;  4Q0J A;  4KUK A;  1GSV A;  1OPX A;  3C30 A;  4GHI A;  3C8C A;  3C2W A;  1UWN X;  2OWH A;  2L4R A;  2VGL S;  2W1T B;  2YKF A;  4YNR A;  4ETX A;  3MQO A;  4EU0 A;  4Z1W A;  2JKR M;  3CAX A;  1STZ A;  4RQ9 A;  2H28 A;  2PR5 A;  5IT5 A;  2QYB A;  4JGP A;  3UMD A;  5A8B A;  3CIT A;  3ZYT A;  3LYX A;  1ZTU A;  2W27 A;  3H9W A;  4ME4 A;  4O01 A;  4EQ1 A;  4HY8 A;  1LL8 A;  3IS2 A;  4GLQ A;  4ARZ A;  4OOL A;  2B02 A;  4NXE A;  4HP9 A;  2NUT C;  4PAU A;  2WKR A;  4GHI B;  2A24 A;  3PR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...