3KSIA

Structure of frmsr of staphylococcus aureus (complex with 2-propanol)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
TINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILGPFQGHPACVHIPIGKGVCGTAVSERRTQVVADVHQFKGHIACDANSKSEIVVPIFKDDKIIGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
publication title structure of fRMsr of Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
total genus 46
structure length 152
sequence length 152
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ksiA00
2XRNA 3MQ0A 2O9AA 3S7OA 4Y2FA 1VHMA 2LB5A 2LB9A 4IUKA 4MCWA 3ZQ5A 3KO6A 2IA2A 2Y8HA 3RFBA 2O9CA 3C2WA 3LFVA 4CQHA 3KSGA 4MDZA 4DN0A 5L8MA 3R4KA 2O0YA 4O8GA 1YKDA 3IBJA 3MF0A 4G3KA 4E04A 4ETXA 4ME4A 4RQ9A 3DBAA 4GLQA 5HPIA 1TF1A 4G3VA 3KSIA 4G3WA 4IUHA 4EU0A 4Z1WA 1TD5A 3KSHA 4LRYC 1YSPA 4GW9A 1STZA 5LBRA 4YNRA 2GX5A 2B18A 4R6LA 2XROA 4Q0HA 3O5YA 5I5LA 2W1TB 3S7QA 3NOTC 2W1RA 4LRZE 4ETZA 4PAUA 2W3HA 2VKSA 3D3OA 2OOLA 2W3GA 5HL6A 5DFXA 3G6OA 5DFYA 5HPFA 4QPRA 4DMZA 1ZTUA 5K5BA 2VEAA 2KLIA 2G7UA 3NHQA 2QYBA 3EEAA 1MC0A 3NOUC 3TRCA 3CITA 5C5KA 1MKMA 4MN7A 3VV4A 4IJGA 4Y3IA 4O0PA 4O01A 3W2ZA 2O9BA 2KOIA 4MMNA 4Q0JA 2XSSA 4ZRRA 2M7VA 2W3EA 3HCYA 2K31A 4YOFA 2O99A 3S7NA 2Y79A 1YSQA 3IBRA 2VZWA 3KSFA 4LRXC 3MMHA 4R70A 4Y5FA 3K2NA 5TJJA 2HGVA 4FOFA 4BWIA 3OOVA 3OBFA 3CI6A 2M7UA 3BJNA 3NOPC 2VJWA 4Q0IA 2W1TA 3S7PA 3E98A 5AJGA 3E0YA 2W3FA 2W3DA 2K2NA 2ZMFA 5HSQA 4EUVA 1F5MA
chains in the Genus database with same CATH superfamily
2Z2MB 2V20A 3UE0A 1DJCA 3Q7ZA 1JVJA 4JXVA 3PBOA 1D06A 2Y2PA 5GHZA 3IBJA 1FILA 3MFDA 4QWOA 1M40A 4OQ0A 1NZUA 3FWLA 3VSKA 3DAVA 2P7JA 5CGSA 3N4IA 2A49A 4GKUA 2BLSA 5HX9A 2D01A 1XJ3A 3W4PA 1MBLA 5E2EA 4OPYA 2P9VA 3T1XA 2ZOIA 2OAQ1 3VOYA 4IBXA 2ZL1A 3P7NA 1GSWA 3P09A 3D3OA 2ZBBA 4ZJ3A 1N9LA 1KDWA 1O07A 3G34A 5HL6A 5J8XA 2Q9NA 5FI2A 3C7UA 1KOUA 5AQ9A 5M1AA 3RXWA 2VGJA 4BD1A 1XGIA 2ZC5B 4OVDA 2QYBA 2WAEA 4CJNA 5TBMB 4JF5A 3R7WA 3UB6A 2HF6A 2JN7A 4Q8IA 2EXAA 1H8MA 4FD8A 4EBLA 1MZUA 5FL3A 3MR0A 4OH0A 5TJJA 3K2NA 2YKHA 2H0YA 2VV6A 4LENA 4P85A 5DTTA 1Q2QA 4QU3A 4X56A 3EWKA 5AJGA 3FKWA 5HSQA 2QJ5A 2O9AA 1F2KA 3NC8A 3S7OA 4JF4A 3T50A 2Y55A 2PYRA 2V1ZA 3C4OA 1SKFA 5CRFA 3A3EA 3UE6A 3KYEA 4O8GA 3SS4A 3BFEA 5HD5A 3T4JA 1YAXA 4XXRA 5DF7A 3LIBA 3DBAA 1PZPA 3T4KA 4Y0OA 1H0MA 2PYPA 1OT9A 3G32A 3VE3A 1TS8A 4I5SA 3HLFA 2X02A 4X53A 3G35A 3FV7A 4NKPA 1VM1A 3QP1A 2J3TC 3UO9A 3A3JA 4JGQA 3TOIA 2WK0A 3IH8A 2W3GA 3MFXA 1Y4OA 3FC7A 2WKEA 4ZBEA 1SDEA 4UAAA 1ES3A 1HTZA 4BMWA 2VLGA 3T1RA 2ZQDA 2V0UA 2WAFA 1ESUA 4ZDXA 3S22A 4KG6A 1CQAA 3VV4A 3PXPA 1TDLA 1W63M 1EWZA 1D1JA 3C38A 4FUWA 1ALQA 3E4QA 4GNUA 3KSFA 5DJUA 4WBGA 1P0ZA 3OOVA 1OPXA 3MQOA 2VK3A 2WADA 2VJWA 1O7EA 2VV8A 1ZHHB 5EECA 2Y2HA 2XRNA 5EUAA 2ZQ7A 1K25A 3ULFA 3QHYA 3Q07A 4FH4A 1YLYA 2FFFB 4OKPA 3SS5A 5HZHA 4WZ4A 3HBRA 4Y0TA 2EFXA 4S2NC 3UB7A 5F83A 2L4RA 4EW7A 3LI9A 1XFQA 5TBMA 1CF0A 4LV3A 5DKKA 1LI0A 2OAP1 3UPPA 1S1YA 1PI4A 5DVAA 3LUQA 1OTBA 2RCXA 1IYOA 3QNBA 1HD8A 3O5YA 2IWDA 3LIFA 3SH7A 3D9YA 5GLCA 1LSVA 3S7QA 1K56A 3V3SA 3G2ZA 2WKPA 4LRZE 4GOGA 4DE1A 1L0EA 3CUEC 3EGDC 4JXSA 2OSUA 3P01A 1K55C 1ZTUA 4IVKA 3CG5A 3JYIA 4HNBA 1ZKJA 4NXEA 4Y17A 3L7HA 1Y28A 5CEBA 3DTMA 3ISGA 1TEMA 3CPTB 2CMNA 3C30A 1XA7A 3GVBA 1QMFA 4MLLA 3VFFA 4MBKA 3UE1A 1WYBA 2WZXA 3F1PB 4WL9A 1OT6A 1OJGA 3A0RA 1YLPA 1KE4A 3UB9A 2ZJ9A 1LHYA 2G2UA 1VHMA 1E25A 4WM9A 1YLWA 1HZOA 4YFMA 1SDNA 3CLOA 2O0YA 5FDSA 4G3KA 5IHVA 2HZ5A 1DJBA 2QMIA 3BW6A 2H28A 1F98A 1T19A 3H82B 2EX9A 3MXSA 3MXRA 2WKQA 3LR5A 5IU1A 3NOTC 4DKIA 3CWFA 1HVBA 4E6XA 4EWFA 5EVIC 3A0VA 1F9IA 1KGGA 2XEPA 4IBRA 5FASA 3G6OA 4MN5A 2HDQA 2JHEA 2HDRA 2V9AA 4KZ6A 3NOUC 2Y2OA 5CEDA 1XJ2A 3IHBA 4BQMA 1H8ZA 4JXWA 4GZBA 3CAXA 2L1MA 5FQIA 3Q82A 3DW0A 1K4EA 2O99A 3LR3A 2JE5A 3GSGA 3UNWA 1A0KA 1EROA 3B3XA 3ITBA 3TE8A 5DTSA 2XK1A 1RGZA 5JYPA 1FCNA 3IS2B 1K0KA 4R0QA 1VQQA 1JTDA 4E3KA 2JBFA 5G18A 2J3WA 3PBSA 3PBRA 2V2FF 2W3FA 5KSCA 1EI5A 1K57A 1N9BA 3CHWP 2PBYA 4S2IA 5HDDA 3VSLA 4IUKA 5HDSA 2Y8HA 2Y2MA 3EOIA 3LFVA 1ES2A 1IOUA 2R9WA 3R4KA 3SH9A 1YKDA 1L0GA 4E04A 4ME4A 4RX2A 5FAQA 4P6ZS 3CPTA 3VOZA 3T4LA 3ZFZA 3NDGA 4GW9A 5AQAA 2ZC4B 3ZVTA 3ZHHA 2DNSA 4ID4A 4HH2A 3A0SA 4PM7A 4EESA 5L09A 3F1PA 1UGUA 3LEQA 4PAUA 2UV0E 2XQZA 3F1NB 1NZOA 4S2LA 4EV4A 3IXHA 3E2LA 5I94A 5KZHA 1PW1A 3OLOA 5E43A 1JNUA 4EETB 2JCHA 1PIOA 3BFDA 1UWNX 3NHQA 4II7A 2HV1A 2ZD8A 1FSWA 2VV7A 3ZCZA 5L2FA 1T1BA 2EXBA 4MN7A 3WWXA 3IX4A 4FCFA 4IJGA 4NK3A 3BQ8A 4N9LA 5HWWA 5AQ7A 3QP2A 5JYOA 2V8FA 2W3EA 1TDGA 3PBTA 2XDMA 2HDUA 4BBUA 4I39A 3LIDA 1ERQA 2OWJA 2A3UA 1J9MA 2ZOHA 3H82A 4EQ1A 5EVLA 5IT5A 2QJ7A 3NOPC 3Q7VB 1YLZA 4EXOA 3ZGAB 4EUVA 5FAOA 1N4OA 1IELA 5F1FA 3HLBA 2JKTM 3GMWA 2PU2A 4QY6A 2I9VA 2GDNA 3IF6B 3BFFA 4G3WA 3BQAA 3LYXA 5HAPA 4WLAA 1TS7A 2XGNA 1XPBA 2NUTC 4CLCA 4K08A 5EE8A 3LGOA 3L9KA 4BJPA 4C75A 3IS2A 4D60A 4I38A 4HOIA 3IH9A 3O86A 4P6ZM 3LEZA 3FPWA 2WGWB 5AVFA 2Y2GA 2I72A 2JKFA 5HPFA 4LV2A 2KX6A 5FSRA 3OPPA 2XR0A 2J3TD 2KLIA 5MC7A 2HP6A 5IS1A 3EEAA 1L0DA 3IX8A 1V9YA 5HARA 3LO7A 5C5KA 3SH8A 4HI4A 2KOIA 3RTYA 4Q0JA 2PDRA 2EX6A 3M2JA 2W0NA 2OLUA 4LLOB 1S4RA 2PU4A 3LY4A 3T4TA 1MPLA 2PR6A 1UWPX 3B47A 1KVLA 5J7EA 3MMHA 1XX2A 3KX0X 4PKYG 4DDSA 1ONGA 1N9NA 1G5UA 4WEKA 4KQDA 3PR6A 3CJMA 5FQKA 4EQIA 3F1NA 4GJ4A 4S2OA 3TW8A 2CC1A 2DMWA 2D02A 2V8CA 2UWXA 3BEBA 3WRTA 2DRWA 2OWHA 4CQHA 3PBNA 5L8MA 4BD0A 1RCJA 4LCMA 3B42A 4OOLA 3HUNA 4G3VA 3FZCA 1W8YA 2B18A 1P9WA 4RA7A 4FH2A 2J9PA 3OZHA 4N1XA 2ZLYA 2Y2LA 1NRJA 3NY4A 2GNXA 3Q7VA 3UDXA 2L0WA 1GA0A 3WS0A 1OTAA 3A3IA 3G2YA 1K6SA 1KDSA 3N6IA 5J4EA 3LCEA 1KGEA 3B33A 4DRTA 1MC0A 3JPUA 2J9OA 3CITA 1Y54A 1E3UD 4NXGA 4MN6A 2BTFP 2H0TA 4QY5A 5CGWA 2M7VA 3UE3A 3O88A 2Y79A 3JVUA 3IF6A 3QP5A 1SKOB 2JKRM 4EUZA 4KZ8A 3C5AA 4PM6A 2V1BA 5HW3A 1ES4A 4OLDA 4YWZA 3WRZA 3UPOA 2XH9A 3C4PA 3V5MA 3HREA 2WGWA 3RH8B 1K57C 1S67L 3GRJA 4WZ5C 3GR2A 5AVEA 3VE4A 3N8LA 1CEGA 2ZMVA 4LPZA 4QJGA 1H5XA 2PBDP 3HLEA 2HJEA 4ARZB 4HJ6A 4GS9B 2EX2A 1PWGA 1GA9A 2X71A 1TD5A 3BLMA 1IFQA 1STZA 3M2KA 4HH3A 5A8BA 1JWZA 1PI5A 2GZAA 3AGDA 1VETB 1KGFA 4CPKA 2ZC6B 1M6KA 2W27A 4KZ5A 2EFUA 1W79A 3N8SA 1W7FA 1PNEA 3U4LP 5DF9A 1AXBA 4QPRA 1W63Q 3VP0A 4R38A 4XT2B 2GJ3A 3HLGA 4LV1A 3W8KA 3JVVA 5EVID 4KZBA 1DJAA 3G30A 1P97A 1L2SA 4Y3IA 4B4XA 4X68A 5HFOA 3VP1A 2XSSA 2K31A 1JWPA 4P6BA 4GCZA 3MBZA 5E2GA 3ZG0A 5BOHA 4KZ4A 4Y5FA 1BULA 4UA9A 1H8YA 4PPRA 2A24B 4E3LA 4Q0IA 4UQIS 4GHIB 4U0XA 5FQMA 5DKLA 2Y91A 3OPLA 3H7WB 2PT7A 2VGKA 1KE0A 2IA2A 3HLDA 4QB8A 4M4XA 5E2FA 4DN0A 2C5WB 3UB5P 3T12B 5TR7A 4OQGA 3OPRA 5HWVA 3OC2A 4L9FA 1ONHA 2VGLS 5HPIA 4K0XA 5FEFA 2ZQ9A 4KG2A 3KSHA 1YSPA 2EWWA 1BT5A 5EVEA 1BLHA 1SKOA 5DJTA 2ZC3B 3E4OA 4E3MA 2YKFA 4KENB 3FYZA 4CLCC 2W1RA 5FQQA 4ETZA 1WE4A 1ES5A 2W3HA 1KVMA 3EQUA 4NG2A 3M6HA 4YINA 1YMSA 3DTIA 2BG1A 4JPMA 5EOEA 3U2AA 2JKRI 3ICYA 1DP8A 3T4SA 2ZQCA 3LIEA 4R4SA 4K91A 3UDIA 2QWSA 1K38A 1T1CA 4OP8A 1D7EA 1SHVA 3QNCA 4UHUA 2Y2NA 1FQGA 1LI9A 3O3VA 5L10A 4ARZA 3K3DA 3ITAA 1NYMA 1I2WA 3NCKA 3IBRA 2VZWA 4HIAA 3MQQA 4XUZA 3N8RA 4HBTA 1QMEA 3LI8A 4IEDA 1LL5A 1I5QA 1VETA 2P74A 2IWBA 1I2SA 4JBFA 1V9ZA 4S2KA 4PM9A 4X1LA 3S7PA 2J7VA 2W3DA 1F5MA 4CLCE 1PWCA 1CJFA 2XFTA 3W4QA 3IXBA 3E4PA 2LB9A 2ZM8A 1W8QA 4GN2A 4KQOA 3IT9A 2FZ0A 3A3DA 4MDZA 4HP4A 1ODVA 1MWTA 4XT2A 4O7DA 2ZMAA 4UQIM 2A2LA 2Y2KA 1H3QA 3Q81A 3T4QA 3UN7A 1YM1A 2QKPA 4BBVA 5HD3A 4Q0HA 4D2OA 3I7JA 1DRMA 3PTEA 4UA6A 2VGLM 1XXMA 1OJ5A 1T18A 2A24A 4GD6A 4GHIA 4ZJ1A 5DFXA 5L07A 1P9RA 3ZNTA 5F82A 5K5BA 1YPRA 2V0WA 3MXQA 5EVIB 4MBHA 4ZTKA 1NYYA 1S0WA 2VA0A 4BENA 5G4YA 3BY8A 3HCYA 3QP6A 1DP6A 3S7NA 2WKRA 3HLCA 1BZAA 1S1ZA 1Q2PA 4DF6A 1XJ4A 1MWSA 4OOMA 3OBFA 2B95A 4DE0A 5FA7A 1FR6A 3VP4A 4WMCD 2INWA 3E0YA 4H6JB 4OQIA 2O9BA 3PYPA 3K3CA 3ZG7B 3WS1A 1G28A 3E2KA 5FI6A 4EBNA 3ZG9B 3C2WA 4NEED 1S4SA 4KQQA 4E3NA 3CUEA 4I3AA 4R23A 5F1GA 3IWOA 5FATA 1IKGA 1K55A 3MSHA 4DJ3A 1MXOA 5A90A 5EPHA 4EEPA 3KSIA 5EOOA 1BYWA 2K7SA 2GX5A 5A91A 3O87A 2DCFA 4KQRA 3ZDJA 1E4DA 5DTKA 2HP5A 4Y7PA 3DTEA 3KYZA 4DJ2A 2JC7A 4OONA 3C8CA 3LR0A 1SZVA 5DFYA 4P87A 1LT0A 4DMZA 2PAVP 3TJZC 3ZNYA 1Z09A 3BY9A 3LR4A 4P0MA 4NXBA 5TFQA 4L9EA 1T1AA 2R9XA 1ESIA 2VX8A 5AQBA 1YLJA 3V39A 2ZQAA 4O0PA 4O01A 1ACFA 5FEGA 3HL9A 4DDYA 2FFYA 3QP4A 4KUKA 4KUOA 3VP2A 2Z2LB 4BBTA 4R70A 2HGVA 4BWIA 4OPZA 2WKHA 1MKIA 1GHIA 2QZ6A 2X01A 2BASA 3E98A 3D72A 2HP9A 1LLBA 3GV9A 4Y2FA 3V67A 3QP8A 3H9WA 4HP9A 3SZTA 5GL9A 3SOIA 2O9CA 1SCWA 3EQVA 4LCLA 4HY8A 2ZM2A 2HPBA 5EVIA 4H8RA 2Q0OA 1FOFA 3NULA 4RYEA 3D4FA 4S2MA 5KIZA 2HDSA 1TF1A 3PHYA 4PM5A 2J80A 5CX7A 1FCMA 5LBRA 3NJAA 4I3JA 4C6YA 4E3IA 5A92A 1BUEA 1DY6A 4HJ4A 3UMEA 4X69A 4WELA 2XF3A 2WKIA 3BM6A 1K4FA 4N9KA 4KZ3A 5HL1A 4N1HA 2OOLA 3ZG5A 1C3BA 2E8JA 2Y2IA 2OLVA 4H6JA 1WYCA 3OCLA 3PAGA 3S4XA 4KZ7A 1NJ4A 3MS6A 2V1AA 5EM0A 1J3WA 1YT4A 5F69A 3IHAA 2XFSA 4MBFA 1MKMA 5M19A 1NXYA 2ZM0A 2XD1A 1PWDA 1WA9A 4S2PA 2AVXA 3C7VA 3NI9A 2Z6CA 3G4PA 3FKVA 5DF8A 5EFWA 4E3JA 1OTEA 1K54A 4E3OA 4WN5A 3UY6A 3T4OA 3IXGA 3NBLA 1XGJA 3IX3A 4MCWA 3N7WA 5TGFA 3CMZA 4PHTA 4OP5A 3KSGA 4OOYA 1G68A 2JKTI 3V50A 2Q9MA 4HQAA 4ETXA 3VOLA 2PRFA 2Y59A 4AFIA 3AGFA 1XP4A 2H5SA 5GHYA 4Z1WA 3M6BA 4YNRA 4MEZA 3P98A 1G6AA 2B5RA 3RXXA 1YQSA 2VKSA 1BSGA 3DWKA 4FSFA 2M1CA 4B4ZA 4JKTA 1JWVA 4CLCD 1FCOA 2H10A 5FI7A 5A93A 4U0TA 1BLCA 4WYYA 4A5RA 3GDIA 3KYQA 4PMAA 3CZDA 2JKGA 1ZG4A 2PHYA 4B88A 5GHXA 1FIKA 4MMNA 5CERA 3EGXC 4ZRRA 4ZJ2A 4JGOA 3PAEA 2B02A 4EEUA 3IXDA 4PKYA 1OTIA 4GDNA 2M7UA 3Q1FA 5EM1A 5KMWA 5CGXA 1BTLA 1NLYA 2WGIA 1JTGA 4EERA 1FR1A 2QHKA 3UB8A 2LB5A 4C3QA 3SS3A 1RP5A 3KO6A 4MNRA 4R3AA 4R4RA 1XJ6A 3GECA 5HWTA 4OQHA 4DXBA 1TS0A 4L0LA 2EWVA 1VB6A 2WYXA 4XUXA 3ZVWA 1NY0A 3IF5A 2XA7S 5FQJA 1L3LA 4EU0A 1NRFA 4IUHA 4GD8A 3BYDA 1LL9A 4HHDA 3GQZA 4UA7A 4X6TA 1IYSA 3TG9A 2W1TB 3F1OB 1HLUP 3ZYTA 3VFHA 4JF6A 5HDCA 3NDEA 4Y0UA 4WMCA 2NUPC 3AGEA 3MKFA 1S66L 4B9OA 3BRMA 5CXWA 2WUQA 2G7UA 4WEJA 4BLMA 4HBUA 1YLTA 4OPRA 4X1MA 2E8IA 3V3RA 4B93A 4BL2A 4ZAMA 3A3FA 1XKZA 2WGVA 3HJIA 1L0FA 3TSGA 5E2HA 1ERMA 2R78A 1TS6A 4FOFA 2ZQ8A 4RVAA 1S6RA 3CI6A 3IWQA 3MZFA 4F94A 4GB7A 2MJ6A 2ZMFA 2KDKA 3MQ0A 2EX8A 4F3LB 2PD8A 4R3JA 2RL3A 4GS9A 2XLNA 1PYYA 3RFBA 2Y2QA 1VEUB 2IWCA 5CHJA 1W5DA 3LY3A 5FAPA 3FG8A 4HESA 4RQ9A 4DXCA 3HUOA 4GLQA 4QD4A 2WZZA 3HLWA 3BWLA 1CI9A 4HEFA 4LRYC 3S1YA 3T1QB 1OTDA 5F68A 4KZ9A 3MZEA 4NXFA 3DTKA 2XROA 4Y15A 5I5LA 4L9GA 4GDBA 4R3BA 5CTNA 4X25A 3WS5A 3UMDA 4LGWA 1MWUA 3GTCA 2XA7M 1EW0A 4DE2A 4I3IA 3SW1A 4DE3A 1DP9A 5D3OA 3PBQA 1PW8A 4U3TA 3RJUA 1ZG6A 3MZDA 4WF0A 4CLCB 1ZC2A 5CECA 1PRQA 1AWIA 1X0OA 3BECA 4LV0A 3TRCA 2J8YA 1XFNA 1BLSA 5U47A 1IKIA 5CTMA 4WZ5A 5GLBA 1KE3A 5CHMA 2P08A 4NETA 4Z9QA 4HJ3A 1RGYA 1YSQA 3H7WA 2P9VB 5GLDA 4LRXC 1K56D 2ZC7A 4ESPA 3NECA 1YMXA 2ZL1B 4X55A 3UDFA 1GSVA 4S2JA 2FH5A 4JGPA 4WUJA 3VP3A 2W1TA 3F1OA 1K54C 1MWRA 2K2NA 2Z6DA 1OMEA 3WS2A 1CI8A 2HJ9C 3MKEA 1IYPA 4KZAA 1N9OA 3HUMA 2XD5A 1Z6FA 4E6WA 1TVFA 3WS4A 5F6AA 3ZQ5A 1MY8A 1FSYA 4S2NA 3IF6C 1NWZA 1BLPA 3R7WB 5GLAA 3MF0A 3ZG8B 4KG5A 5J3WA 5CHUA 3IQAA 3VMAA 3W4OA 2C6WB 5FDHA 3LICA 3UPNA 3OCNA 4EBPA 4OPQA 4JXGA 4JLFA 1GHMA 3MJQA 4IVIA 2OV5A 4JGRA 4R6LA 3T1SA 3DWZA 1LSXA 1XA1A 5FQ9A 3NIAA 1LL8A 1CK3A 3EEHA 1CEFA 5G4ZA 4IHQA 4M3KA 1LSWA 3LIAA 3FPVA 4OLGA 3G31A 2Y4AA 3BFGA 3BFCA 1E3UA 5M18A 4RX3A 4F3LA 4K0WA 4R1GA 4Y13A 2VEAA 5EV0A 1NLZA 5HAIA 2Y2JA 1IEMA 2QPNA 2EA9A 4QHCA 2PD7A 5F5YA 2PR5A 1U60A 1VEUA 3BLSA 2G2WA 2ACGA 4N92A 3W2ZA 5HAQA 4UEYA 3OPHA 4YOFA 3IWIA 2P04A 1GSXA 1PFLA 1G6OA 1K6RA 4FTXA 4BL3A 4LFUA 1GCEA 5KSHA 1PZOA 1GHPA 3BJNA 3HJKA 1IYQA 3HVFA 4PM8A
chains in the Genus database with same CATH topology
3H7WB 2PT7A 5HDDA 4IUKA 4MCWA 5HDSA 2IA2A 2Y8HA 4M4XA 3PBOA 3EOIA 3LFVA 4PHTA 1D06A 3KSGA 1IOUA 4DN0A 3R4KA 1YKDA 2JKTI 3IBJA 4HQAA 4E04A 4ETXA 4ME4A 3VOLA 5HWVA 3OC2A 4L9FA 2P7JA 2VGLS 4AFIA 4P6ZS 5HPIA 3T4LA 4Z1WA 3KSHA 1YSPA 4GW9A 2EWWA 4YNRA 2D01A 1XJ3A 4HH2A 5DJTA 3A0SA 3E4OA 2YKFA 2ZOIA 4EESA 2OAQ1 3F1PA 4CLCC 1UGUA 2W1RA 4ETZA 4PAUA 3P7NA 2W3HA 3EQUA 1GSWA 3F1NB 2VKSA 3D3OA 4FSFA 2ZBBA 2M1CA 1N9LA 5HL6A 3U2AA 1KOUA 3OLOA 4CLCD 1JNUA 2JKRI 4EETB 3ICYA 1DP8A 1UWNX 3T4SA 3LIEA 3NHQA 2QYBA 4II7A 2HV1A 2QWSA 3GDIA 2VV7A 1T1CA 5TBMB 1T1BA 3KYQA 4MN7A 4IJGA 3R7WA 1D7EA 2PHYA 3BQ8A 5HWWA 3UB6A 2HF6A 2JN7A 4MMNA 1H8MA 3EGXC 4ZRRA 2W3EA 3PBTA 4ARZA 4JGOA 3K3DA 1MZUA 4BBUA 4I39A 5FL3A 3MR0A 3LIDA 2B02A 3IBRA 2OWJA 2VZWA 4EEUA 5TJJA 3K2NA 4HIAA 2ZOHA 3MQQA 2YKHA 3H82A 4EQ1A 2VV6A 4PKYA 1OTIA 3LI8A 5IT5A 2M7UA 2QJ7A 3NOPC 1V9ZA 3EWKA 3S7PA 5AJGA 1NLYA 2W3DA 4EXOA 5HSQA 4EUVA 1F5MA 4CLCE 2QJ5A 2O9AA 4EERA 3S7OA 3T50A 2QHKA 3E4PA 3UB8A 2LB5A 2LB9A 2PYRA 3KO6A 4R3AA 4KQOA 1XJ6A 2FZ0A 3GECA 4MDZA 3UE6A 4HP4A 1ODVA 5HWTA 4XT2A 4O8GA 2JKTM 5HD5A 4UQIM 2A2LA 1TS0A 4L0LA 2EWVA 1VB6A 3T4JA 1YAXA 2I9VA 3LIBA 3DBAA 2XA7S 1H3QA 3T4KA 4G3WA 2PYPA 1OT9A 4IUHA 3T4QA 4EU0A 3BQAA 3LYXA 3VE3A 4WLAA 1TS8A 4I5SA 4HHDA 1TS7A 2QKPA 4BBVA 5HD3A 2NUTC 4Q0HA 4CLCA 4K08A 2W1TB 3F1OB 4BJPA 4NKPA 3IS2A 3ZYTA 1DRMA 4I38A 2VGLM 4HOIA 2J3TC 4P6ZM 1OJ5A 3FPWA 5HDCA 1T18A 4JGQA 2A24A 5AVFA 2W3GA 4GHIA 3MFXA 5DFXA 3FC7A 5HPFA 2NUPC 1P9RA 1S66L 2KX6A 5K5BA 4B9OA 2J3TD 2V0WA 4BMWA 2KLIA 2VLGA 3MXQA 5MC7A 2V0UA 5IS1A 2G7UA 4WEJA 3EEAA 1V9YA 2VA0A 5C5KA 3VV4A 3PXPA 4HI4A 2KOIA 5G4YA 3BY8A 4Q0JA 2PDRA 3RTYA 4B93A 2W0NA 1W63M 4LLOB 3HCYA 1DP6A 1S4RA 3S7NA 2WKRA 3C38A 3T4TA 3E4QA 3HJIA 2PR6A 1S1ZA 1UWPX 2R78A 3B47A 1TS6A 3KSFA 5J7EA 3MMHA 1XJ4A 3KX0X 5DJUA 4FOFA 4PKYG 4OOMA 1P0ZA 3OOVA 1OPXA 3OBFA 3CI6A 3MQOA 1N9NA 4WEKA 2VJWA 4KQDA 2MJ6A 2INWA 3E0YA 2VV8A 4H6JB 1ZHHB 3PR6A 2ZMFA 2O9BA 2KDKA 2XRNA 3MQ0A 4F3LB 3PYPA 3F1NA 3K3CA 2PD8A 4GJ4A 3ULFA 4GS9A 3TW8A 2DMWA 2D02A 1G28A 3RFBA 5HZHA 3C2WA 4NEED 2OWHA 1S4SA 4CQHA 3PBNA 5L8MA 3CUEA 4I3AA 3UB7A 3FG8A 4RQ9A 2L4RA 4EW7A 3B42A 4OOLA 3LI9A 4DJ3A 4GLQA 1XFQA 5TBMA 3BWLA 4EEPA 4G3VA 3KSIA 5DKKA 2OAP1 4LRYC 1OTDA 1S1YA 1BYWA 2K7SA 5F68A 2GX5A 2B18A 1OTBA 3LUQA 4NXFA 1P9WA 2XROA 3O5YA 5I5LA 4L9GA 3LIFA 1LSVA 3S7QA 3UMDA 2WKPA 4LRZE 2XA7M 3CUEC 1NRJA 1EW0A 2GNXA 4I3IA 3SW1A 3KYZA 4DJ2A 3EGDC 2L0WA 1DP9A 3P01A 3C8CA 3PBQA 3LR0A 5DFYA 1OTAA 4WF0A 4CLCB 1LT0A 4DMZA 1ZTUA 4HNBA 4NXEA 3TJZC 3BY9A 3LR4A 5J4EA 3B33A 1X0OA 1Y28A 4NXBA 1MC0A 3TRCA 4L9EA 1T1AA 2VX8A 3CITA 1XFNA 4O0PA 4O01A 2CMNA 3C30A 4NXGA 4MN6A 2M7VA 3UE3A 2P08A 2Y79A 3JVUA 4HJ3A 4KUKA 4KUOA 1YSQA 3H7WA 2JKRM 4BBTA 4LRXC 4R70A 2HGVA 3F1PB 4WL9A 4BWIA 1GSVA 2FH5A 4JGPA 2V1BA 4WUJA 1OT6A 1OJGA 3A0RA 2W1TA 3F1OA 4YWZA 2BASA 3E98A 3D72A 2K2NA 2Z6DA 3UB9A 2HJ9C 1N9OA 4Y2FA 1VHMA 3RH8B 3V67A 1S67L 3H9WA 4HP9A 5F6AA 5AVEA 3VE4A 3ZQ5A 2O9CA 2ZMVA 4LPZA 3EQVA 1NWZA 4HY8A 3CLOA 2O0YA 3R7WB 3MF0A 4G3KA 5J3WA 2HJEA 4ARZB 4HJ6A 4GS9B 5KIZA 3LICA 1TF1A 3BW6A 3OCNA 3PHYA 1TD5A 2H28A 2J80A 1IFQA 1STZA 5CX7A 4HH3A 1F98A 3MJQA 1T19A 5A8BA 3H82B 5LBRA 3NJAA 4JGRA 4I3JA 4R6LA 2GZAA 2WKQA 3LR5A 4HJ4A 3UMEA 1LSXA 4WELA 5IU1A 3NOTC 2W27A 3CWFA 1LL8A 3EEHA 2OOLA 5G4ZA 4IHQA 3A0VA 1F9IA 1LSWA 4H6JA 3LIAA 3FPVA 3G6OA 5DF9A 4MN5A 4QPRA 2JHEA 4F3LA 2VEAA 1W63Q 3OCLA 4R38A 2GJ3A 4XT2B 2V9AA 1NLZA 3JVVA 2V1AA 5F69A 2EA9A 3NOUC 2PD7A 5F5YA 2PR5A 1XJ2A 1P97A 1MKMA 4Y3IA 3CAXA 3W2ZA 2L1MA 4UEYA 2XSSA 2K31A 1WA9A 2O99A 4YOFA 2P04A 1GSXA 3LR3A 4GCZA 1G6OA 3TE8A 2Z6CA 4Y5FA 3IS2B 5KSHA 5EFWA 1OTEA 4WN5A 3BJNA 3HJKA 3T4OA 2A24B 2J3WA 4Q0IA 3PBSA 4UQIS 3PBRA 4GHIB 2W3FA 5DKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRN A;  3MQ0 A;  2O9A A;  3S7O A;  4Y2F A;  1VHM A;  2LB5 A;  2LB9 A;  4IUK A;  4MCW A;  3ZQ5 A;  3KO6 A;  2IA2 A;  2Y8H A;  3RFB A;  2O9C A;  3C2W A;  3LFV A;  4CQH A;  3KSG A;  4MDZ A;  4DN0 A;  5L8M A;  3R4K A;  2O0Y A;  4O8G A;  1YKD A;  3IBJ A;  3MF0 A;  4G3K A;  4E04 A;  4ETX A;  4ME4 A;  4RQ9 A;  3DBA A;  4GLQ A;  5HPI A;  1TF1 A;  4G3V A;  3KSI A;  4G3W A;  4IUH A;  4EU0 A;  4Z1W A;  1TD5 A;  3KSH A;  4LRY C;  1YSP A;  4GW9 A;  1STZ A;  5LBR A;  4YNR A;  2GX5 A;  2B18 A;  4R6L A;  2XRO A;  4Q0H A;  3O5Y A;  5I5L A;  2W1T B;  3S7Q A;  3NOT C;  2W1R A;  4LRZ E;  4ETZ A;  4PAU A;  2W3H A;  2VKS A;  3D3O A;  2OOL A;  2W3G A;  5HL6 A;  5DFX A;  3G6O A;  5DFY A;  5HPF A;  4QPR A;  4DMZ A;  1ZTU A;  5K5B A;  2VEA A;  2KLI A;  2G7U A;  3NHQ A;  2QYB A;  3EEA A;  1MC0 A;  3NOU C;  3TRC A;  3CIT A;  5C5K A;  1MKM A;  4MN7 A;  3VV4 A;  4IJG A;  4Y3I A;  4O0P A;  4O01 A;  3W2Z A;  2O9B A;  2KOI A;  4MMN A;  4Q0J A;  2XSS A;  4ZRR A;  2M7V A;  2W3E A;  3HCY A;  2K31 A;  4YOF A;  2O99 A;  3S7N A;  2Y79 A;  1YSQ A;  3IBR A;  2VZW A;  3KSF A;  4LRX C;  3MMH A;  4R70 A;  4Y5F A;  3K2N A;  5TJJ A;  2HGV A;  4FOF A;  4BWI A;  3OOV A;  3OBF A;  3CI6 A;  2M7U A;  3BJN A;  3NOP C;  2VJW A;  4Q0I A;  2W1T A;  3S7P A;  3E98 A;  5AJG A;  3E0Y A;  2W3F A;  2W3D A;  2K2N A;  2ZMF A;  5HSQ A;  4EUV A;  1F5M A; 
#chains in the Genus database with same CATH topology
 2Z2M B;  2V20 A;  3UE0 A;  1DJC A;  3Q7Z A;  1JVJ A;  4JXV A;  3PBO A;  1D06 A;  2Y2P A;  5GHZ A;  3IBJ A;  1FIL A;  3MFD A;  4QWO A;  1M40 A;  4OQ0 A;  1NZU A;  3FWL A;  3VSK A;  3DAV A;  2P7J A;  5CGS A;  3N4I A;  2A49 A;  4GKU A;  2BLS A;  5HX9 A;  2D01 A;  1XJ3 A;  3W4P A;  1MBL A;  5E2E A;  4OPY A;  2P9V A;  3T1X A;  2ZOI A;  2OAQ 1;  3VOY A;  4IBX A;  2ZL1 A;  3P7N A;  1GSW A;  3P09 A;  3D3O A;  2ZBB A;  4ZJ3 A;  1N9L A;  1KDW A;  1O07 A;  3G34 A;  5HL6 A;  5J8X A;  2Q9N A;  5FI2 A;  3C7U A;  1KOU A;  5AQ9 A;  5M1A A;  3RXW A;  2VGJ A;  4BD1 A;  1XGI A;  2ZC5 B;  4OVD A;  2QYB A;  2WAE A;  4CJN A;  5TBM B;  4JF5 A;  3R7W A;  3UB6 A;  2HF6 A;  2JN7 A;  4Q8I A;  2EXA A;  1H8M A;  4FD8 A;  4EBL A;  1MZU A;  5FL3 A;  3MR0 A;  4OH0 A;  5TJJ A;  3K2N A;  2YKH A;  2H0Y A;  2VV6 A;  4LEN A;  4P85 A;  5DTT A;  1Q2Q A;  4QU3 A;  4X56 A;  3EWK A;  5AJG A;  3FKW A;  5HSQ A;  2QJ5 A;  2O9A A;  1F2K A;  3NC8 A;  3S7O A;  4JF4 A;  3T50 A;  2Y55 A;  2PYR A;  2V1Z A;  3C4O A;  1SKF A;  5CRF A;  3A3E A;  3UE6 A;  3KYE A;  4O8G A;  3SS4 A;  3BFE A;  5HD5 A;  3T4J A;  1YAX A;  4XXR A;  5DF7 A;  3LIB A;  3DBA A;  1PZP A;  3T4K A;  4Y0O A;  1H0M A;  2PYP A;  1OT9 A;  3G32 A;  3VE3 A;  1TS8 A;  4I5S A;  3HLF A;  2X02 A;  4X53 A;  3G35 A;  3FV7 A;  4NKP A;  1VM1 A;  3QP1 A;  2J3T C;  3UO9 A;  3A3J A;  4JGQ A;  3TOI A;  2WK0 A;  3IH8 A;  2W3G A;  3MFX A;  1Y4O A;  3FC7 A;  2WKE A;  4ZBE A;  1SDE A;  4UAA A;  1ES3 A;  1HTZ A;  4BMW A;  2VLG A;  3T1R A;  2ZQD A;  2V0U A;  2WAF A;  1ESU A;  4ZDX A;  3S22 A;  4KG6 A;  1CQA A;  3VV4 A;  3PXP A;  1TDL A;  1W63 M;  1EWZ A;  1D1J A;  3C38 A;  4FUW A;  1ALQ A;  3E4Q A;  4GNU A;  3KSF A;  5DJU A;  4WBG A;  1P0Z A;  3OOV A;  1OPX A;  3MQO A;  2VK3 A;  2WAD A;  2VJW A;  1O7E A;  2VV8 A;  1ZHH B;  5EEC A;  2Y2H A;  2XRN A;  5EUA A;  2ZQ7 A;  1K25 A;  3ULF A;  3QHY A;  3Q07 A;  4FH4 A;  1YLY A;  2FFF B;  4OKP A;  3SS5 A;  5HZH A;  4WZ4 A;  3HBR A;  4Y0T A;  2EFX A;  4S2N C;  3UB7 A;  5F83 A;  2L4R A;  4EW7 A;  3LI9 A;  1XFQ A;  5TBM A;  1CF0 A;  4LV3 A;  5DKK A;  1LI0 A;  2OAP 1;  3UPP A;  1S1Y A;  1PI4 A;  5DVA A;  3LUQ A;  1OTB A;  2RCX A;  1IYO A;  3QNB A;  1HD8 A;  3O5Y A;  2IWD A;  3LIF A;  3SH7 A;  3D9Y A;  5GLC A;  1LSV A;  3S7Q A;  1K56 A;  3V3S A;  3G2Z A;  2WKP A;  4LRZ E;  4GOG A;  4DE1 A;  1L0E A;  3CUE C;  3EGD C;  4JXS A;  2OSU A;  3P01 A;  1K55 C;  1ZTU A;  4IVK A;  3CG5 A;  3JYI A;  4HNB A;  1ZKJ A;  4NXE A;  4Y17 A;  3L7H A;  1Y28 A;  5CEB A;  3DTM A;  3ISG A;  1TEM A;  3CPT B;  2CMN A;  3C30 A;  1XA7 A;  3GVB A;  1QMF A;  4MLL A;  3VFF A;  4MBK A;  3UE1 A;  1WYB A;  2WZX A;  3F1P B;  4WL9 A;  1OT6 A;  1OJG A;  3A0R A;  1YLP A;  1KE4 A;  3UB9 A;  2ZJ9 A;  1LHY A;  2G2U A;  1VHM A;  1E25 A;  4WM9 A;  1YLW A;  1HZO A;  4YFM A;  1SDN A;  3CLO A;  2O0Y A;  5FDS A;  4G3K A;  5IHV A;  2HZ5 A;  1DJB A;  2QMI A;  3BW6 A;  2H28 A;  1F98 A;  1T19 A;  3H82 B;  2EX9 A;  3MXS A;  3MXR A;  2WKQ A;  3LR5 A;  5IU1 A;  3NOT C;  4DKI A;  3CWF A;  1HVB A;  4E6X A;  4EWF A;  5EVI C;  3A0V A;  1F9I A;  1KGG A;  2XEP A;  4IBR A;  5FAS A;  3G6O A;  4MN5 A;  2HDQ A;  2JHE A;  2HDR A;  2V9A A;  4KZ6 A;  3NOU C;  2Y2O A;  5CED A;  1XJ2 A;  3IHB A;  4BQM A;  1H8Z A;  4JXW A;  4GZB A;  3CAX A;  2L1M A;  5FQI A;  3Q82 A;  3DW0 A;  1K4E A;  2O99 A;  3LR3 A;  2JE5 A;  3GSG A;  3UNW A;  1A0K A;  1ERO A;  3B3X A;  3ITB A;  3TE8 A;  5DTS A;  2XK1 A;  1RGZ A;  5JYP A;  1FCN A;  3IS2 B;  1K0K A;  4R0Q A;  1VQQ A;  1JTD A;  4E3K A;  2JBF A;  5G18 A;  2J3W A;  3PBS A;  3PBR A;  2V2F F;  2W3F A;  5KSC A;  1EI5 A;  1K57 A;  1N9B A;  3CHW P;  2PBY A;  4S2I A;  5HDD A;  3VSL A;  4IUK A;  5HDS A;  2Y8H A;  2Y2M A;  3EOI A;  3LFV A;  1ES2 A;  1IOU A;  2R9W A;  3R4K A;  3SH9 A;  1YKD A;  1L0G A;  4E04 A;  4ME4 A;  4RX2 A;  5FAQ A;  4P6Z S;  3CPT A;  3VOZ A;  3T4L A;  3ZFZ A;  3NDG A;  4GW9 A;  5AQA A;  2ZC4 B;  3ZVT A;  3ZHH A;  2DNS A;  4ID4 A;  4HH2 A;  3A0S A;  4PM7 A;  4EES A;  5L09 A;  3F1P A;  1UGU A;  3LEQ A;  4PAU A;  2UV0 E;  2XQZ A;  3F1N B;  1NZO A;  4S2L A;  4EV4 A;  3IXH A;  3E2L A;  5I94 A;  5KZH A;  1PW1 A;  3OLO A;  5E43 A;  1JNU A;  4EET B;  2JCH A;  1PIO A;  3BFD A;  1UWN X;  3NHQ A;  4II7 A;  2HV1 A;  2ZD8 A;  1FSW A;  2VV7 A;  3ZCZ A;  5L2F A;  1T1B A;  2EXB A;  4MN7 A;  3WWX A;  3IX4 A;  4FCF A;  4IJG A;  4NK3 A;  3BQ8 A;  4N9L A;  5HWW A;  5AQ7 A;  3QP2 A;  5JYO A;  2V8F A;  2W3E A;  1TDG A;  3PBT A;  2XDM A;  2HDU A;  4BBU A;  4I39 A;  3LID A;  1ERQ A;  2OWJ A;  2A3U A;  1J9M A;  2ZOH A;  3H82 A;  4EQ1 A;  5EVL A;  5IT5 A;  2QJ7 A;  3NOP C;  3Q7V B;  1YLZ A;  4EXO A;  3ZGA B;  4EUV A;  5FAO A;  1N4O A;  1IEL A;  5F1F A;  3HLB A;  2JKT M;  3GMW A;  2PU2 A;  4QY6 A;  2I9V A;  2GDN A;  3IF6 B;  3BFF A;  4G3W A;  3BQA A;  3LYX A;  5HAP A;  4WLA A;  1TS7 A;  2XGN A;  1XPB A;  2NUT C;  4CLC A;  4K08 A;  5EE8 A;  3LGO A;  3L9K A;  4BJP A;  4C75 A;  3IS2 A;  4D60 A;  4I38 A;  4HOI A;  3IH9 A;  3O86 A;  4P6Z M;  3LEZ A;  3FPW A;  2WGW B;  5AVF A;  2Y2G A;  2I72 A;  2JKF A;  5HPF A;  4LV2 A;  2KX6 A;  5FSR A;  3OPP A;  2XR0 A;  2J3T D;  2KLI A;  5MC7 A;  2HP6 A;  5IS1 A;  3EEA A;  1L0D A;  3IX8 A;  1V9Y A;  5HAR A;  3LO7 A;  5C5K A;  3SH8 A;  4HI4 A;  2KOI A;  3RTY A;  4Q0J A;  2PDR A;  2EX6 A;  3M2J A;  2W0N A;  2OLU A;  4LLO B;  1S4R A;  2PU4 A;  3LY4 A;  3T4T A;  1MPL A;  2PR6 A;  1UWP X;  3B47 A;  1KVL A;  5J7E A;  3MMH A;  1XX2 A;  3KX0 X;  4PKY G;  4DDS A;  1ONG A;  1N9N A;  1G5U A;  4WEK A;  4KQD A;  3PR6 A;  3CJM A;  5FQK A;  4EQI A;  3F1N A;  4GJ4 A;  4S2O A;  3TW8 A;  2CC1 A;  2DMW A;  2D02 A;  2V8C A;  2UWX A;  3BEB A;  3WRT A;  2DRW A;  2OWH A;  4CQH A;  3PBN A;  5L8M A;  4BD0 A;  1RCJ A;  4LCM A;  3B42 A;  4OOL A;  3HUN A;  4G3V A;  3FZC A;  1W8Y A;  2B18 A;  1P9W A;  4RA7 A;  4FH2 A;  2J9P A;  3OZH A;  4N1X A;  2ZLY A;  2Y2L A;  1NRJ A;  3NY4 A;  2GNX A;  3Q7V A;  3UDX A;  2L0W A;  1GA0 A;  3WS0 A;  1OTA A;  3A3I A;  3G2Y A;  1K6S A;  1KDS A;  3N6I A;  5J4E A;  3LCE A;  1KGE A;  3B33 A;  4DRT A;  1MC0 A;  3JPU A;  2J9O A;  3CIT A;  1Y54 A;  1E3U D;  4NXG A;  4MN6 A;  2BTF P;  2H0T A;  4QY5 A;  5CGW A;  2M7V A;  3UE3 A;  3O88 A;  2Y79 A;  3JVU A;  3IF6 A;  3QP5 A;  1SKO B;  2JKR M;  4EUZ A;  4KZ8 A;  3C5A A;  4PM6 A;  2V1B A;  5HW3 A;  1ES4 A;  4OLD A;  4YWZ A;  3WRZ A;  3UPO A;  2XH9 A;  3C4P A;  3V5M A;  3HRE A;  2WGW A;  3RH8 B;  1K57 C;  1S67 L;  3GRJ A;  4WZ5 C;  3GR2 A;  5AVE A;  3VE4 A;  3N8L A;  1CEG A;  2ZMV A;  4LPZ A;  4QJG A;  1H5X A;  2PBD P;  3HLE A;  2HJE A;  4ARZ B;  4HJ6 A;  4GS9 B;  2EX2 A;  1PWG A;  1GA9 A;  2X71 A;  1TD5 A;  3BLM A;  1IFQ A;  1STZ A;  3M2K A;  4HH3 A;  5A8B A;  1JWZ A;  1PI5 A;  2GZA A;  3AGD A;  1VET B;  1KGF A;  4CPK A;  2ZC6 B;  1M6K A;  2W27 A;  4KZ5 A;  2EFU A;  1W79 A;  3N8S A;  1W7F A;  1PNE A;  3U4L P;  5DF9 A;  1AXB A;  4QPR A;  1W63 Q;  3VP0 A;  4R38 A;  4XT2 B;  2GJ3 A;  3HLG A;  4LV1 A;  3W8K A;  3JVV A;  5EVI D;  4KZB A;  1DJA A;  3G30 A;  1P97 A;  1L2S A;  4Y3I A;  4B4X A;  4X68 A;  5HFO A;  3VP1 A;  2XSS A;  2K31 A;  1JWP A;  4P6B A;  4GCZ A;  3MBZ A;  5E2G A;  3ZG0 A;  5BOH A;  4KZ4 A;  4Y5F A;  1BUL A;  4UA9 A;  1H8Y A;  4PPR A;  2A24 B;  4E3L A;  4Q0I A;  4UQI S;  4GHI B;  4U0X A;  5FQM A;  5DKL A;  2Y91 A;  3OPL A;  3H7W B;  2PT7 A;  2VGK A;  1KE0 A;  2IA2 A;  3HLD A;  4QB8 A;  4M4X A;  5E2F A;  4DN0 A;  2C5W B;  3UB5 P;  3T12 B;  5TR7 A;  4OQG A;  3OPR A;  5HWV A;  3OC2 A;  4L9F A;  1ONH A;  2VGL S;  5HPI A;  4K0X A;  5FEF A;  2ZQ9 A;  4KG2 A;  3KSH A;  1YSP A;  2EWW A;  1BT5 A;  5EVE A;  1BLH A;  1SKO A;  5DJT A;  2ZC3 B;  3E4O A;  4E3M A;  2YKF A;  4KEN B;  3FYZ A;  4CLC C;  2W1R A;  5FQQ A;  4ETZ A;  1WE4 A;  1ES5 A;  2W3H A;  1KVM A;  3EQU A;  4NG2 A;  3M6H A;  4YIN A;  1YMS A;  3DTI A;  2BG1 A;  4JPM A;  5EOE A;  3U2A A;  2JKR I;  3ICY A;  1DP8 A;  3T4S A;  2ZQC A;  3LIE A;  4R4S A;  4K91 A;  3UDI A;  2QWS A;  1K38 A;  1T1C A;  4OP8 A;  1D7E A;  1SHV A;  3QNC A;  4UHU A;  2Y2N A;  1FQG A;  1LI9 A;  3O3V A;  5L10 A;  4ARZ A;  3K3D A;  3ITA A;  1NYM A;  1I2W A;  3NCK A;  3IBR A;  2VZW A;  4HIA A;  3MQQ A;  4XUZ A;  3N8R A;  4HBT A;  1QME A;  3LI8 A;  4IED A;  1LL5 A;  1I5Q A;  1VET A;  2P74 A;  2IWB A;  1I2S A;  4JBF A;  1V9Z A;  4S2K A;  4PM9 A;  4X1L A;  3S7P A;  2J7V A;  2W3D A;  1F5M A;  4CLC E;  1PWC A;  1CJF A;  2XFT A;  3W4Q A;  3IXB A;  3E4P A;  2LB9 A;  2ZM8 A;  1W8Q A;  4GN2 A;  4KQO A;  3IT9 A;  2FZ0 A;  3A3D A;  4MDZ A;  4HP4 A;  1ODV A;  1MWT A;  4XT2 A;  4O7D A;  2ZMA A;  4UQI M;  2A2L A;  2Y2K A;  1H3Q A;  3Q81 A;  3T4Q A;  3UN7 A;  1YM1 A;  2QKP A;  4BBV A;  5HD3 A;  4Q0H A;  4D2O A;  3I7J A;  1DRM A;  3PTE A;  4UA6 A;  2VGL M;  1XXM A;  1OJ5 A;  1T18 A;  2A24 A;  4GD6 A;  4GHI A;  4ZJ1 A;  5DFX A;  5L07 A;  1P9R A;  3ZNT A;  5F82 A;  5K5B A;  1YPR A;  2V0W A;  3MXQ A;  5EVI B;  4MBH A;  4ZTK A;  1NYY A;  1S0W A;  2VA0 A;  4BEN A;  5G4Y A;  3BY8 A;  3HCY A;  3QP6 A;  1DP6 A;  3S7N A;  2WKR A;  3HLC A;  1BZA A;  1S1Z A;  1Q2P A;  4DF6 A;  1XJ4 A;  1MWS A;  4OOM A;  3OBF A;  2B95 A;  4DE0 A;  5FA7 A;  1FR6 A;  3VP4 A;  4WMC D;  2INW A;  3E0Y A;  4H6J B;  4OQI A;  2O9B A;  3PYP A;  3K3C A;  3ZG7 B;  3WS1 A;  1G28 A;  3E2K A;  5FI6 A;  4EBN A;  3ZG9 B;  3C2W A;  4NEE D;  1S4S A;  4KQQ A;  4E3N A;  3CUE A;  4I3A A;  4R23 A;  5F1G A;  3IWO A;  5FAT A;  1IKG A;  1K55 A;  3MSH A;  4DJ3 A;  1MXO A;  5A90 A;  5EPH A;  4EEP A;  3KSI A;  5EOO A;  1BYW A;  2K7S A;  2GX5 A;  5A91 A;  3O87 A;  2DCF A;  4KQR A;  3ZDJ A;  1E4D A;  5DTK A;  2HP5 A;  4Y7P A;  3DTE A;  3KYZ A;  4DJ2 A;  2JC7 A;  4OON A;  3C8C A;  3LR0 A;  1SZV A;  5DFY A;  4P87 A;  1LT0 A;  4DMZ A;  2PAV P;  3TJZ C;  3ZNY A;  1Z09 A;  3BY9 A;  3LR4 A;  4P0M A;  4NXB A;  5TFQ A;  4L9E A;  1T1A A;  2R9X A;  1ESI A;  2VX8 A;  5AQB A;  1YLJ A;  3V39 A;  2ZQA A;  4O0P A;  4O01 A;  1ACF A;  5FEG A;  3HL9 A;  4DDY A;  2FFY A;  3QP4 A;  4KUK A;  4KUO A;  3VP2 A;  2Z2L B;  4BBT A;  4R70 A;  2HGV A;  4BWI A;  4OPZ A;  2WKH A;  1MKI A;  1GHI A;  2QZ6 A;  2X01 A;  2BAS A;  3E98 A;  3D72 A;  2HP9 A;  1LLB A;  3GV9 A;  4Y2F A;  3V67 A;  3QP8 A;  3H9W A;  4HP9 A;  3SZT A;  5GL9 A;  3SOI A;  2O9C A;  1SCW A;  3EQV A;  4LCL A;  4HY8 A;  2ZM2 A;  2HPB A;  5EVI A;  4H8R A;  2Q0O A;  1FOF A;  3NUL A;  4RYE A;  3D4F A;  4S2M A;  5KIZ A;  2HDS A;  1TF1 A;  3PHY A;  4PM5 A;  2J80 A;  5CX7 A;  1FCM A;  5LBR A;  3NJA A;  4I3J A;  4C6Y A;  4E3I A;  5A92 A;  1BUE A;  1DY6 A;  4HJ4 A;  3UME A;  4X69 A;  4WEL A;  2XF3 A;  2WKI A;  3BM6 A;  1K4F A;  4N9K A;  4KZ3 A;  5HL1 A;  4N1H A;  2OOL A;  3ZG5 A;  1C3B A;  2E8J A;  2Y2I A;  2OLV A;  4H6J A;  1WYC A;  3OCL A;  3PAG A;  3S4X A;  4KZ7 A;  1NJ4 A;  3MS6 A;  2V1A A;  5EM0 A;  1J3W A;  1YT4 A;  5F69 A;  3IHA A;  2XFS A;  4MBF A;  1MKM A;  5M19 A;  1NXY A;  2ZM0 A;  2XD1 A;  1PWD A;  1WA9 A;  4S2P A;  2AVX A;  3C7V A;  3NI9 A;  2Z6C A;  3G4P A;  3FKV A;  5DF8 A;  5EFW A;  4E3J A;  1OTE A;  1K54 A;  4E3O A;  4WN5 A;  3UY6 A;  3T4O A;  3IXG A;  3NBL A;  1XGJ A;  3IX3 A;  4MCW A;  3N7W A;  5TGF A;  3CMZ A;  4PHT A;  4OP5 A;  3KSG A;  4OOY A;  1G68 A;  2JKT I;  3V50 A;  2Q9M A;  4HQA A;  4ETX A;  3VOL A;  2PRF A;  2Y59 A;  4AFI A;  3AGF A;  1XP4 A;  2H5S A;  5GHY A;  4Z1W A;  3M6B A;  4YNR A;  4MEZ A;  3P98 A;  1G6A A;  2B5R A;  3RXX A;  1YQS A;  2VKS A;  1BSG A;  3DWK A;  4FSF A;  2M1C A;  4B4Z A;  4JKT A;  1JWV A;  4CLC D;  1FCO A;  2H10 A;  5FI7 A;  5A93 A;  4U0T A;  1BLC A;  4WYY A;  4A5R A;  3GDI A;  3KYQ A;  4PMA A;  3CZD A;  2JKG A;  1ZG4 A;  2PHY A;  4B88 A;  5GHX A;  1FIK A;  4MMN A;  5CER A;  3EGX C;  4ZRR A;  4ZJ2 A;  4JGO A;  3PAE A;  2B02 A;  4EEU A;  3IXD A;  4PKY A;  1OTI A;  4GDN A;  2M7U A;  3Q1F A;  5EM1 A;  5KMW A;  5CGX A;  1BTL A;  1NLY A;  2WGI A;  1JTG A;  4EER A;  1FR1 A;  2QHK A;  3UB8 A;  2LB5 A;  4C3Q A;  3SS3 A;  1RP5 A;  3KO6 A;  4MNR A;  4R3A A;  4R4R A;  1XJ6 A;  3GEC A;  5HWT A;  4OQH A;  4DXB A;  1TS0 A;  4L0L A;  2EWV A;  1VB6 A;  2WYX A;  4XUX A;  3ZVW A;  1NY0 A;  3IF5 A;  2XA7 S;  5FQJ A;  1L3L A;  4EU0 A;  1NRF A;  4IUH A;  4GD8 A;  3BYD A;  1LL9 A;  4HHD A;  3GQZ A;  4UA7 A;  4X6T A;  1IYS A;  3TG9 A;  2W1T B;  3F1O B;  1HLU P;  3ZYT A;  3VFH A;  4JF6 A;  5HDC A;  3NDE A;  4Y0U A;  4WMC A;  2NUP C;  3AGE A;  3MKF A;  1S66 L;  4B9O A;  3BRM A;  5CXW A;  2WUQ A;  2G7U A;  4WEJ A;  4BLM A;  4HBU A;  1YLT A;  4OPR A;  4X1M A;  2E8I A;  3V3R A;  4B93 A;  4BL2 A;  4ZAM A;  3A3F A;  1XKZ A;  2WGV A;  3HJI A;  1L0F A;  3TSG A;  5E2H A;  1ERM A;  2R78 A;  1TS6 A;  4FOF A;  2ZQ8 A;  4RVA A;  1S6R A;  3CI6 A;  3IWQ A;  3MZF A;  4F94 A;  4GB7 A;  2MJ6 A;  2ZMF A;  2KDK A;  3MQ0 A;  2EX8 A;  4F3L B;  2PD8 A;  4R3J A;  2RL3 A;  4GS9 A;  2XLN A;  1PYY A;  3RFB A;  2Y2Q A;  1VEU B;  2IWC A;  5CHJ A;  1W5D A;  3LY3 A;  5FAP A;  3FG8 A;  4HES A;  4RQ9 A;  4DXC A;  3HUO A;  4GLQ A;  4QD4 A;  2WZZ A;  3HLW A;  3BWL A;  1CI9 A;  4HEF A;  4LRY C;  3S1Y A;  3T1Q B;  1OTD A;  5F68 A;  4KZ9 A;  3MZE A;  4NXF A;  3DTK A;  2XRO A;  4Y15 A;  5I5L A;  4L9G A;  4GDB A;  4R3B A;  5CTN A;  4X25 A;  3WS5 A;  3UMD A;  4LGW A;  1MWU A;  3GTC A;  2XA7 M;  1EW0 A;  4DE2 A;  4I3I A;  3SW1 A;  4DE3 A;  1DP9 A;  5D3O A;  3PBQ A;  1PW8 A;  4U3T A;  3RJU A;  1ZG6 A;  3MZD A;  4WF0 A;  4CLC B;  1ZC2 A;  5CEC A;  1PRQ A;  1AWI A;  1X0O A;  3BEC A;  4LV0 A;  3TRC A;  2J8Y A;  1XFN A;  1BLS A;  5U47 A;  1IKI A;  5CTM A;  4WZ5 A;  5GLB A;  1KE3 A;  5CHM A;  2P08 A;  4NET A;  4Z9Q A;  4HJ3 A;  1RGY A;  1YSQ A;  3H7W A;  2P9V B;  5GLD A;  4LRX C;  1K56 D;  2ZC7 A;  4ESP A;  3NEC A;  1YMX A;  2ZL1 B;  4X55 A;  3UDF A;  1GSV A;  4S2J A;  2FH5 A;  4JGP A;  4WUJ A;  3VP3 A;  2W1T A;  3F1O A;  1K54 C;  1MWR A;  2K2N A;  2Z6D A;  1OME A;  3WS2 A;  1CI8 A;  2HJ9 C;  3MKE A;  1IYP A;  4KZA A;  1N9O A;  3HUM A;  2XD5 A;  1Z6F A;  4E6W A;  1TVF A;  3WS4 A;  5F6A A;  3ZQ5 A;  1MY8 A;  1FSY A;  4S2N A;  3IF6 C;  1NWZ A;  1BLP A;  3R7W B;  5GLA A;  3MF0 A;  3ZG8 B;  4KG5 A;  5J3W A;  5CHU A;  3IQA A;  3VMA A;  3W4O A;  2C6W B;  5FDH A;  3LIC A;  3UPN A;  3OCN A;  4EBP A;  4OPQ A;  4JXG A;  4JLF A;  1GHM A;  3MJQ A;  4IVI A;  2OV5 A;  4JGR A;  4R6L A;  3T1S A;  3DWZ A;  1LSX A;  1XA1 A;  5FQ9 A;  3NIA A;  1LL8 A;  1CK3 A;  3EEH A;  1CEF A;  5G4Z A;  4IHQ A;  4M3K A;  1LSW A;  3LIA A;  3FPV A;  4OLG A;  3G31 A;  2Y4A A;  3BFG A;  3BFC A;  1E3U A;  5M18 A;  4RX3 A;  4F3L A;  4K0W A;  4R1G A;  4Y13 A;  2VEA A;  5EV0 A;  1NLZ A;  5HAI A;  2Y2J A;  1IEM A;  2QPN A;  2EA9 A;  4QHC A;  2PD7 A;  5F5Y A;  2PR5 A;  1U60 A;  1VEU A;  3BLS A;  2G2W A;  2ACG A;  4N92 A;  3W2Z A;  5HAQ A;  4UEY A;  3OPH A;  4YOF A;  3IWI A;  2P04 A;  1GSX A;  1PFL A;  1G6O A;  1K6R A;  4FTX A;  4BL3 A;  4LFU A;  1GCE A;  5KSH A;  1PZO A;  1GHP A;  3BJN A;  3HJK A;  1IYQ A;  3HVF A;  4PM8 A; 
#chains in the Genus database with same CATH homology
 3H7W B;  2PT7 A;  5HDD A;  4IUK A;  4MCW A;  5HDS A;  2IA2 A;  2Y8H A;  4M4X A;  3PBO A;  3EOI A;  3LFV A;  4PHT A;  1D06 A;  3KSG A;  1IOU A;  4DN0 A;  3R4K A;  1YKD A;  2JKT I;  3IBJ A;  4HQA A;  4E04 A;  4ETX A;  4ME4 A;  3VOL A;  5HWV A;  3OC2 A;  4L9F A;  2P7J A;  2VGL S;  4AFI A;  4P6Z S;  5HPI A;  3T4L A;  4Z1W A;  3KSH A;  1YSP A;  4GW9 A;  2EWW A;  4YNR A;  2D01 A;  1XJ3 A;  4HH2 A;  5DJT A;  3A0S A;  3E4O A;  2YKF A;  2ZOI A;  4EES A;  2OAQ 1;  3F1P A;  4CLC C;  1UGU A;  2W1R A;  4ETZ A;  4PAU A;  3P7N A;  2W3H A;  3EQU A;  1GSW A;  3F1N B;  2VKS A;  3D3O A;  4FSF A;  2ZBB A;  2M1C A;  1N9L A;  5HL6 A;  3U2A A;  1KOU A;  3OLO A;  4CLC D;  1JNU A;  2JKR I;  4EET B;  3ICY A;  1DP8 A;  1UWN X;  3T4S A;  3LIE A;  3NHQ A;  2QYB A;  4II7 A;  2HV1 A;  2QWS A;  3GDI A;  2VV7 A;  1T1C A;  5TBM B;  1T1B A;  3KYQ A;  4MN7 A;  4IJG A;  3R7W A;  1D7E A;  2PHY A;  3BQ8 A;  5HWW A;  3UB6 A;  2HF6 A;  2JN7 A;  4MMN A;  1H8M A;  3EGX C;  4ZRR A;  2W3E A;  3PBT A;  4ARZ A;  4JGO A;  3K3D A;  1MZU A;  4BBU A;  4I39 A;  5FL3 A;  3MR0 A;  3LID A;  2B02 A;  3IBR A;  2OWJ A;  2VZW A;  4EEU A;  5TJJ A;  3K2N A;  4HIA A;  2ZOH A;  3MQQ A;  2YKH A;  3H82 A;  4EQ1 A;  2VV6 A;  4PKY A;  1OTI A;  3LI8 A;  5IT5 A;  2M7U A;  2QJ7 A;  3NOP C;  1V9Z A;  3EWK A;  3S7P A;  5AJG A;  1NLY A;  2W3D A;  4EXO A;  5HSQ A;  4EUV A;  1F5M A;  4CLC E;  2QJ5 A;  2O9A A;  4EER A;  3S7O A;  3T50 A;  2QHK A;  3E4P A;  3UB8 A;  2LB5 A;  2LB9 A;  2PYR A;  3KO6 A;  4R3A A;  4KQO A;  1XJ6 A;  2FZ0 A;  3GEC A;  4MDZ A;  3UE6 A;  4HP4 A;  1ODV A;  5HWT A;  4XT2 A;  4O8G A;  2JKT M;  5HD5 A;  4UQI M;  2A2L A;  1TS0 A;  4L0L A;  2EWV A;  1VB6 A;  3T4J A;  1YAX A;  2I9V A;  3LIB A;  3DBA A;  2XA7 S;  1H3Q A;  3T4K A;  4G3W A;  2PYP A;  1OT9 A;  4IUH A;  3T4Q A;  4EU0 A;  3BQA A;  3LYX A;  3VE3 A;  4WLA A;  1TS8 A;  4I5S A;  4HHD A;  1TS7 A;  2QKP A;  4BBV A;  5HD3 A;  2NUT C;  4Q0H A;  4CLC A;  4K08 A;  2W1T B;  3F1O B;  4BJP A;  4NKP A;  3IS2 A;  3ZYT A;  1DRM A;  4I38 A;  2VGL M;  4HOI A;  2J3T C;  4P6Z M;  1OJ5 A;  3FPW A;  5HDC A;  1T18 A;  4JGQ A;  2A24 A;  5AVF A;  2W3G A;  4GHI A;  3MFX A;  5DFX A;  3FC7 A;  5HPF A;  2NUP C;  1P9R A;  1S66 L;  2KX6 A;  5K5B A;  4B9O A;  2J3T D;  2V0W A;  4BMW A;  2KLI A;  2VLG A;  3MXQ A;  5MC7 A;  2V0U A;  5IS1 A;  2G7U A;  4WEJ A;  3EEA A;  1V9Y A;  2VA0 A;  5C5K A;  3VV4 A;  3PXP A;  4HI4 A;  2KOI A;  5G4Y A;  3BY8 A;  4Q0J A;  2PDR A;  3RTY A;  4B93 A;  2W0N A;  1W63 M;  4LLO B;  3HCY A;  1DP6 A;  1S4R A;  3S7N A;  2WKR A;  3C38 A;  3T4T A;  3E4Q A;  3HJI A;  2PR6 A;  1S1Z A;  1UWP X;  2R78 A;  3B47 A;  1TS6 A;  3KSF A;  5J7E A;  3MMH A;  1XJ4 A;  3KX0 X;  5DJU A;  4FOF A;  4PKY G;  4OOM A;  1P0Z A;  3OOV A;  1OPX A;  3OBF A;  3CI6 A;  3MQO A;  1N9N A;  4WEK A;  2VJW A;  4KQD A;  2MJ6 A;  2INW A;  3E0Y A;  2VV8 A;  4H6J B;  1ZHH B;  3PR6 A;  2ZMF A;  2O9B A;  2KDK A;  2XRN A;  3MQ0 A;  4F3L B;  3PYP A;  3F1N A;  3K3C A;  2PD8 A;  4GJ4 A;  3ULF A;  4GS9 A;  3TW8 A;  2DMW A;  2D02 A;  1G28 A;  3RFB A;  5HZH A;  3C2W A;  4NEE D;  2OWH A;  1S4S A;  4CQH A;  3PBN A;  5L8M A;  3CUE A;  4I3A A;  3UB7 A;  3FG8 A;  4RQ9 A;  2L4R A;  4EW7 A;  3B42 A;  4OOL A;  3LI9 A;  4DJ3 A;  4GLQ A;  1XFQ A;  5TBM A;  3BWL A;  4EEP A;  4G3V A;  3KSI A;  5DKK A;  2OAP 1;  4LRY C;  1OTD A;  1S1Y A;  1BYW A;  2K7S A;  5F68 A;  2GX5 A;  2B18 A;  1OTB A;  3LUQ A;  4NXF A;  1P9W A;  2XRO A;  3O5Y A;  5I5L A;  4L9G A;  3LIF A;  1LSV A;  3S7Q A;  3UMD A;  2WKP A;  4LRZ E;  2XA7 M;  3CUE C;  1NRJ A;  1EW0 A;  2GNX A;  4I3I A;  3SW1 A;  3KYZ A;  4DJ2 A;  3EGD C;  2L0W A;  1DP9 A;  3P01 A;  3C8C A;  3PBQ A;  3LR0 A;  5DFY A;  1OTA A;  4WF0 A;  4CLC B;  1LT0 A;  4DMZ A;  1ZTU A;  4HNB A;  4NXE A;  3TJZ C;  3BY9 A;  3LR4 A;  5J4E A;  3B33 A;  1X0O A;  1Y28 A;  4NXB A;  1MC0 A;  3TRC A;  4L9E A;  1T1A A;  2VX8 A;  3CIT A;  1XFN A;  4O0P A;  4O01 A;  2CMN A;  3C30 A;  4NXG A;  4MN6 A;  2M7V A;  3UE3 A;  2P08 A;  2Y79 A;  3JVU A;  4HJ3 A;  4KUK A;  4KUO A;  1YSQ A;  3H7W A;  2JKR M;  4BBT A;  4LRX C;  4R70 A;  2HGV A;  3F1P B;  4WL9 A;  4BWI A;  1GSV A;  2FH5 A;  4JGP A;  2V1B A;  4WUJ A;  1OT6 A;  1OJG A;  3A0R A;  2W1T A;  3F1O A;  4YWZ A;  2BAS A;  3E98 A;  3D72 A;  2K2N A;  2Z6D A;  3UB9 A;  2HJ9 C;  1N9O A;  4Y2F A;  1VHM A;  3RH8 B;  3V67 A;  1S67 L;  3H9W A;  4HP9 A;  5F6A A;  5AVE A;  3VE4 A;  3ZQ5 A;  2O9C A;  2ZMV A;  4LPZ A;  3EQV A;  1NWZ A;  4HY8 A;  3CLO A;  2O0Y A;  3R7W B;  3MF0 A;  4G3K A;  5J3W A;  2HJE A;  4ARZ B;  4HJ6 A;  4GS9 B;  5KIZ A;  3LIC A;  1TF1 A;  3BW6 A;  3OCN A;  3PHY A;  1TD5 A;  2H28 A;  2J80 A;  1IFQ A;  1STZ A;  5CX7 A;  4HH3 A;  1F98 A;  3MJQ A;  1T19 A;  5A8B A;  3H82 B;  5LBR A;  3NJA A;  4JGR A;  4I3J A;  4R6L A;  2GZA A;  2WKQ A;  3LR5 A;  4HJ4 A;  3UME A;  1LSX A;  4WEL A;  5IU1 A;  3NOT C;  2W27 A;  3CWF A;  1LL8 A;  3EEH A;  2OOL A;  5G4Z A;  4IHQ A;  3A0V A;  1F9I A;  1LSW A;  4H6J A;  3LIA A;  3FPV A;  3G6O A;  5DF9 A;  4MN5 A;  4QPR A;  2JHE A;  4F3L A;  2VEA A;  1W63 Q;  3OCL A;  4R38 A;  2GJ3 A;  4XT2 B;  2V9A A;  1NLZ A;  3JVV A;  2V1A A;  5F69 A;  2EA9 A;  3NOU C;  2PD7 A;  5F5Y A;  2PR5 A;  1XJ2 A;  1P97 A;  1MKM A;  4Y3I A;  3CAX A;  3W2Z A;  2L1M A;  4UEY A;  2XSS A;  2K31 A;  1WA9 A;  2O99 A;  4YOF A;  2P04 A;  1GSX A;  3LR3 A;  4GCZ A;  1G6O A;  3TE8 A;  2Z6C A;  4Y5F A;  3IS2 B;  5KSH A;  5EFW A;  1OTE A;  4WN5 A;  3BJN A;  3HJK A;  3T4O A;  2A24 B;  2J3W A;  4Q0I A;  3PBS A;  4UQI S;  3PBR A;  4GHI B;  2W3F A;  5DKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...