1YM1A

X-ray crystallographic structure of ctx-m-9 beta-lactamase complexed with a boronic acid inhibitor (sm2)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Function, and Inhibition along the Reaction Coordinate of CTX-M beta-Lactamases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords beta-lactamase CTX-M-9a
total genus 97
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ym1A00
4K0XA 4ZJ3A 1NZUA 2QMIA 2R9XA 1L2SA 3OZHA 1L0FA 3GQZA 1BLCA 2ZD8A 4R3BA 2ZC3B 4E3OA 4NETA 5A91A 5E2HA 5E2GA 4IEDA 3MXSA 5FQIA 4FD8A 5HX9A 5FAOA 1E25A 1ZG6A 3MZEA 4OPZA 3N8SA 2XD5A 1RP5A 1K56D 2XFTA 4IVKA 4JXGA 5FQJA 5G18A 4X69A 5EVIC 2XDMA 3IWQA 3IF6C 4QHCA 4R23A 3V50A 4GNUA 3O3VA 3Q81A 1WYCA 2Y2HA 4WYYA 4KZ8A 1CEGA 4OOYA 4OP8A 3D4FA 1KGFA 1MKIA 3HLCA 4XUXA 5HW3A 1K25A 5CTNA 3ZG7B 4EBPA 5J8XA 5KZHA 1NY0A 4MEZA 4P87A 1KDSA 3HBRA 1NYMA 5TFQA 4Q8IA 3RXXA 3UDXA 3CJMA 5TR7A 2WZXA 4OOLA 1K55C 1I2SA 1ES4A 5L2FA 4KZBA 3G34A 5FQ9A 3OPHA 1BLPA 1FCNA 2V1ZA 1LL5A 4U0XA 2ZMAA 1YM1A 4PM5A 1ES3A 1IYSA 3MXRA 3MZFA 4HEFA 1EI5A 5AQAA 4L0LA 1FCMA 4WELA 1RGYA 4KZAA 4S2LA 5DTTA 3PBTA 3FKWA 1IELA 4KZ5A 5CHMA 1N4OA 1ESIA 1TVFA 5FQMA 5KMWA 1SCWA 2WKEA 3GVBA 5U47A 5EECA 5EE8A 5D3OA 3MBZA 4K91A 2WKIA 4E3JA 1AXBA 4WMCD 3Q7ZA 1JWVA 3UPNA 1GA0A 5AQBA 3BLSA 4GKUA 3OPRA 1H5XA 4QY5A 3UDIA 1IKGA 4PM7A 3BFGA 3BFCA 3ZFZA 1PWCA 2QZ6A 2PU2A 1YT4A 2DCFA 4WZ5C 3LEZA 5EVLA 1GA9A 4LV3A 1BTLA 3AGFA 2XD1A 2Y55A 4MBFA 3WRTA 1H8ZA 1BLHA 3LY4A 4U3TA 3ZG0A 1ZG4A 1NYYA 3BECA 4E3IA 2ZQ9A 4OONA 3MKEA 1SDEA 1DY6A 1I2WA 1EWZA 4R0QA 4M3KA 2Y2GA 5EPHA 3QNCA 2V2FF 3G2YA 3BEBA 4S2NA 1FCOA 1ZKJA 1TDGA 1U60A 3FYZA 3ZDJA 2G2WA 1E3UD 3ZGAB 5FSRA 5HAPA 4BENA 5DTKA 4KG6A 1E4DA 1YLPA 4RA7A 1SHVA 4DXCA 4B4XA 1NZOA 5EUAA 3IWIA 1DJBA 3CZDA 4RX3A 1KE4A 1S6RA 4S2PA 3SH7A 4EBLA 1XKZA 5EVID 4DE2A 3HREA 2WGIA 4GD6A 4KZ9A 3GTCA 4WZ4A 4ZAMA 3RXWA 5EOEA 3BFDA 1QMEA 3TSGA 5CGXA 1PI5A 4EV4A 5DTSA 1JTDA 3DTMA 1FSWA 1Y54A 3ZG9B 3C7UA 4XUZA 5CERA 2HDUA 4QD4A 3GSGA 4BQMA 3G30A 3C5AA 4OKPA 1LI0A 5GLDA 5KSCA 4BD0A 2XH9A 2OSUA 4FCFA 5A90A 1ERMA 2ZM0A 5A92A 1JWPA 1TEMA 3DW0A 4DE0A 1PZPA 4JXSA 3SS3A 2EX9A 3M2KA 2UWXA 3A3JA 2IWBA 3VFHA 2HP6A 5FA7A 2A49A 5GHYA 4Y7PA 5CTMA 3SH8A 4O7DA 4OPYA 5FI2A 1FOFA 4WEKA 3FWLA 4IBRA 4Y0OA 4OOMA 2FFYA 3MKFA 4S2NC 3BLMA 2PBYA 2WAFA 1L0EA 1YQSA 5F1GA 4RYEA 3BFEA 4JF6A 3IWOA 4R1GA 1PWDA 1XP4A 3G4PA 4JF5A 4R4SA 2Y59A 4P0MA 1BZAA 4PM8A 4PMAA 4ZJ1A 1ESUA 3CMZA 4YFMA 1O07A 4LV0A 4H8RA 3P09A 3UPOA 1NXYA 4OQ0A 1MWRA 4LV2A 3OC2A 1SKFA 5JYPA 3IHAA 4DDSA 4A5RA 1RCJA 3HLEA 3NCKA 4HESA 1ES2A 4OQGA 1K38A 4MLLA 3BYDA 1W8QA 4EQIA 4OH0A 4ZBEA 1HZOA 1YLTA 3IXHA 4E3KA 1M40A 3LY3A 2Y2JA 1VM1A 2Y2OA 3O87A 4IVIA 1G6AA 2Y2NA 4KQRA 4N1XA 3VOZA 2I72A 1W5DA 4HBUA 4QY6A 3O86A 4S2KA 5M19A 1K56A 5FDHA 3NI9A 4B88A 5EVIB 2HDQA 3ZVWA 1WE4A 3W8KA 3HLDA 3HUMA 4JBFA 3GV9A 5FQQA 3IT9A 3AGEA 3S4XA 1IEMA 4BL3A 4KZ7A 5I94A 1KGEA 4DRTA 4U0TA 3JYIA 4F94A 3NDEA 4JXWA 4EBNA 2B5RA 3HLBA 1LHYA 4YINA 4E3NA 2ZQ7A 1XA7A 3N8RA 4C3QA 2C5WB 2H0YA 1FR6A 1LLBA 1IYPA 1OMEA 2ZC7A 3SS4A 3IF5A 3HVFA 3DWZA 2HDRA 1KE3A 1DJAA 3G32A 4MBHA 3IH9A 4MBKA 2VGJA 5CECA 3IF6B 5F83A 2ZLYA 4GD8A 3V3SA 3W4PA 4ZTKA 4DE3A 2VGKA 1Z6FA 2WK0A 3FV7A 5FASA 2ZC4B 3FZCA 1BT5A 3ISGA 5AQ7A 3WS1A 3PAEA 3VP1A 5CEBA 2RL3A 1L0DA 3C4OA 3SH9A 3HUNA 1GHIA 3IXDA 1QMFA 4RVAA 1W7FA 3VOYA 3SOIA 2EX6A 3UPPA 1YMXA 3MZDA 1MWUA 3M6BA 2CC1A 2J9PA 3OCLA 4WBGA 1VQQA 2Y2KA 3HL9A 4GZBA 2IWCA 4WMCA 4R4RA 1YMSA 3N7WA 4OQHA 2IWDA 4PPRA 4OPRA 4BD1A 4EUZA 3IQAA 5CGSA 4DDYA 3ZNTA 3UO9A 4ZJ2A 2EX2A 2XF3A 3PBRA 3C4PA 1JWZA 1IYOA 5GLCA 2ZQCA 4UA6A 1YLJA 1PIOA 2WZZA 2ZC5B 5BOHA 4N9LA 4X6TA 3BRMA 3GRJA 4RX2A 2Y2LA 1K57A 3HUOA 1MWTA 4BJPA 1K4EA 3G35A 2PU4A 1PW1A 3N4IA 2H10A 3LO7A 3WRZA 4PM9A 3MFDA 2X71A 4JPMA 1BSGA 3UE3A 2H0TA 2HP9A 4R3JA 5F82A 2JE5A 1E3UA 1GHMA 3VP0A 1YLYA 4OVDA 5GHZA 1BUEA 4CPKA 3HLFA 3UDFA 3NIAA 4Y0TA 5CRFA 3A3EA 4Z9QA 3IF6A 3IH8A 1JTGA 5EVIA 1BLSA 3AGDA 4KENB 5FAPA 3PTEA 3I7JA 1G68A 1PI4A 2XR0A 4KZ3A 4OLGA 1MPLA 5GLAA 4K0WA 4E6WA 1CK3A 2J9OA 3OPLA 3TOIA 1W8YA 2WUQA 3GMWA 1NJ4A 1Q2QA 2OLUA 5HAQA 1ZC2A 4GDBA 4OP5A 1EROA 5FI6A 3V3RA 3NDGA 2QPNA 5CXWA 3QHYA 2ZM2A 2R9WA 4MNRA 1ONGA 5TGFA 4GB7A 3PBNA 4N92A 3E2KA 1KVMA 1Q2PA 2WGWB 4N1HA 5F1FA 1O7EA 5E43A 3ITBA 4GN2A 1PW8A 1L0GA 4XXRA 2ZQDA 5HARA 2EXAA 3N6IA 1MBLA 2XGNA 1LI9A 1S0WA 2J8YA 4ID4A 1SDNA 2A3UA 4QU3A 4E3MA 2Q9NA 3GR2A 4E6XA 4FH2A 3WS0A 2Y2MA 4X55A 4GOGA 5DVAA 3V5MA 4DF6A 2HDSA 3A3IA 5KSHA 5DF9A 2FFFB 4KG2A 2JCHA 2WAEA 5FATA 4BLMA 5CHUA 4IBXA 5FQKA 3S1YA 2BG1A 3B3XA 3UN7A 4WEJA 3ITAA 4CJNA 1FR1A 4NK3A 2OV5A 2Z2MB 4P6BA 4UA7A 3BFFA 4S2IA 1KE0A 5E2FA 1XXMA 2JBFA 4UA9A 1I5QA 5CHJA 2WGVA 3ZNYA 5FI7A 4P85A 3ZG8B 2ZQ8A 2Y2IA 4LENA 5DF7A 2C6WB 2P9VA 1W79A 2WKHA 4C6YA 3VSLA 1LL9A 2X02A 4X68A 1FSYA 3VP3A 1K57C 1JVJA 1PZOA 1N9BA 3Q7VA 3IXGA 1TDLA 5HAIA 1GHPA 4X53A 3UE0A 3PBOA 2EFXA 3Q82A 2ZQAA 4E3LA 3G31A 4S2OA 1HD8A 4C75A 2Y2QA 3BM6A 4LV1A 3Q1FA 3C7VA 3W4QA 2EX8A 4JKTA 3M6HA 5M18A 1XA1A 3A3DA 3EQVA 2H5SA 1GCEA 1ES5A 1WYBA 3WS4A 4KQOA 4PM6A 2Z2LB 3ZVTA 4DXBA 5E2EA 4JLFA 1CI8A 4GDNA 2V20A 4KZ6A 2P74A 3M2JA 4OPQA 4ZDXA 3SS5A 1HTZA 4QB8A 2E8IA 5CEDA 2BLSA 2ZC6B 1H8YA 2DNSA 1ONHA 1NRFA 4LCLA 2X01A 3WS5A 1KDWA 1ALQA 5DF8A 3ZG5A 3RJUA 2JC7A 1K4FA 1MWSA 1XX2A 3PAGA 1XGIA 4EWFA 2XFSA 2XQZA 2EXBA 4JXVA 2DRWA 3CG5A 1IYQA 1K55A 3PBSA 1K6RA 4UHUA 4BL2A 3ZCZA 2GDNA 3NY4A 1YLWA 4S2JA 3VP4A 3DWKA 4KQQA 4X56A 3P98A 3Q7VB 4LCMA 4UAAA 2WYXA 1XPBA 3HLGA 4D2OA 2ZJ9A 4Y0UA 3WWXA 4KG5A 5GHXA 2HP5A 1K54A 1M6KA 3A3FA 1YLZA 3OCNA 5IHVA 3UNWA 3WS2A 2WADA 2XLNA 3PBQA 2XEPA 1FQGA 1DJCA 5AQ9A 2Q9MA 3V39A 2P9VB 1RGZA 3OPPA 1CEFA 5GL9A 2OLVA 2WGWA 1PWGA 2HPBA 4WM9A 3VFFA 4B4ZA 2Y91A 3O88A 3HLWA 3QNBA 3E2LA 3N8LA 3ZHHA 5CGWA 3VP2A 3VSKA 4S2MA 1K54C 5FAQA 5HL1A 3S22A 2J7VA 3TG9A 3Q07A 3G2ZA 1KVLA 3IXBA 4QJGA 1C3BA 1BULA 2Y2PA 1CI9A 2RCXA 3EQUA 1J9MA 3FKVA 4FSFA 1ERQA 4N9KA 4HBTA 1MXOA 5HFOA 1IKIA 4JF4A 3UY6A 3NC8A 5JYOA 5GLBA 2XK1A 2G2UA 4KZ4A 5M1AA 1KGGA 3UE1A 3LCEA 2ZM8A 3NBLA 1HVBA 2EFUA 4OQIA 1MY8A 4OLDA 4DE1A 5A93A 4FH4A 4WZ5A 3IHBA 4DKIA 3W4OA 5EOOA 1PYYA 1K6SA 3VMAA 2Y4AA 1XGJA
chains in the Genus database with same CATH superfamily
1NZUA 1L0FA 3GQZA 1BLCA 3A0RA 4F3LA 3MXSA 4GJ4A 1FILA 1E25A 3ZQ5A 3PYPA 5L09A 2XFTA 5G18A 4X69A 5EVIC 2XDMA 3V50A 4GNUA 4WYYA 4KZ8A 1KGFA 1MKIA 2HJEA 5J8XA 3BW6A 4PKYA 2L4RA 4MEZA 3KSIA 4P87A 2VA0A 1N9LA 3RXXA 1K55C 1I2SA 4IJGA 5J4EA 2VKSA 3DTEA 4WLAA 3G34A 4I3JA 1FCNA 1N9OA 4U0XA 3JVUA 1ES3A 4WELA 2DMWA 4S2LA 3K2NA 4KZ5A 1ESIA 3F1NB 5FQMA 4G3VA 3S7QA 5EE8A 4K91A 1AXBA 3OPRA 1H5XA 1IKGA 4Y5FA 3BFGA 4EXOA 2DCFA 4LV3A 2Y55A 4MBFA 1VB6A 3WRTA 2PRFA 3ZG0A 3MJQA 4E3IA 2ZQ9A 4IUKA 3MKEA 5DKKA 1DY6A 1OT9A 3QNCA 2J3TD 1TDGA 1U60A 5DTKA 1YLPA 3LR4A 2GZAA 3SH7A 5C5KA 4KZ9A 4WZ4A 3RXWA 3BFDA 3NOPC 2UV0E 1PI5A 2BTFP 3DTMA 3ZG9B 2HDUA 2GJ3A 3G30A 4OKPA 4BD0A 1TEMA 1PZPA 2WKRA 2UWXA 2IWBA 3VFHA 2A49A 5HSQA 1BYWA 4O7DA 1OJ5A 4WEKA 3FWLA 4IBRA 1XJ6A 2YKHA 5F1GA 3IWOA 4R1GA 2W0NA 3G4PA 2OAQ1 1UGUA 4Q0HA 1TF1A 2A24A 2Y59A 4PM8A 4E04A 4ZJ1A 5HPFA 1ESUA 4L9FA 1O07A 3S7PA 3UPOA 4DJ2A 1SKFA 4K08A 3IHAA 4DDSA 2JKTM 3NCKA 4HESA 2ZOHA 2CMNA 3T4KA 4OQGA 3KSFA 2PYPA 4YNRA 4HP4A 4E3KA 5MC7A 4IVIA 1G6AA 3QP1A 1V9ZA 1W5DA 4L9EA 3O86A 1LL8A 4S2KA 5FDHA 3F1OB 2ZOIA 3ZVWA 3W8KA 1PFLA 1WA9A 3HLDA 3HUMA 4JBFA 5FQQA 3AGEA 3EEHA 4NEED 1NLYA 1KGEA 4F94A 3NDEA 4JXWA 5HZHA 4E3NA 1OTIA 2ZQ7A 3SS4A 3IF5A 2HDRA 4WUJA 1KE3A 1DJAA 3G32A 4MBHA 3IH9A 5CECA 4H6JA 1A0KA 5F83A 2ZLYA 3V3SA 4ZTKA 4CLCE 4DE3A 2W3DA 1VETA 4NXFA 2ZC4B 3ISGA 5AQ7A 5CEBA 2LB9A 1L0DA 3SH9A 3S7NA 3IXDA 2QHKA 1QMFA 3P01A 2EX6A 3TE8A 3MZDA 3MS6A 2CC1A 2J9PA 4WBGA 2JHEA 3HL9A 3N7WA 1W63M 3MMHA 2IWDA 4PPRA 4Y13A 3ZNTA 3PBRA 4Q0IA 3C4PA 1PIOA 2WZZA 2ZC5B 3BRMA 4RX2A 4G3WA 1PW1A 2H10A 3FG8A 1TS6A 3FPWA 4PAUA 1GHMA 3LGOA 3VP0A 1X0OA 4LLOB 4OVDA 4KUOA 4IHQA 5GLAA 4E6WA 1MPLA 3OPLA 1W8YA 3GMWA 1NJ4A 3O5YA 3QHYA 3W2ZA 2W27A 2HZ5A 2E8JA 4GB7A 3PBNA 3IS2A 4N1HA 1L0GA 1LI9A 1F9IA 3GR2A 4FH2A 3WS0A 3V5MA 3IBJA 2FFFB 4G3KA 2WAEA 5FATA 4IUHA 4IBXA 3B3XA 3IBRA 3ITAA 2OV5A 3UB8A 4UA7A 2W3EA 5E2FA 2JBFA 1I5QA 3ZNYA 4P85A 2Y2IA 3NECA 5DF7A 3E0YA 1TS7A 1K57C 3CWFA 1N9BA 3NHQA 1XFNA 5FDSA 4X53A 3RTYA 3PBOA 4S2OA 1HD8A 3RH8B 3UMDA 3C7VA 4EQ1A 3M6HA 1GCEA 4PM6A 4DXBA 1KOUA 2OWHA 4KZ6A 4ZDXA 3SS5A 5AVFA 2E8IA 3OLOA 3WS5A 1YAXA 4Y2FA 5DF8A 3U4LP 2KX6A 2XQZA 3UE6A 2EXBA 1YLWA 3BY8A 4KQQA 2QJ7A 4X56A 1XPBA 4HOIA 2ZJ9A 3WWXA 1HLUP 1OJGA 1K54A 3OCNA 1W63Q 2WADA 2XLNA 1OTBA 3MXQA 4WN5A 1RGZA 3OPPA 2OLVA 3BQ8A 1PWGA 4B4ZA 3O88A 3ZHHA 4HH3A 4NG2A 3Q07A 3IXBA 2Y2PA 1J9MA 1SKOB 1ERQA 5HFOA 3UY6A 3BQAA 2XK1A 2G2UA 4KZ4A 1KGGA 1CQAA 3L9KA 4OLDA 3KSGA 4DKIA 4LPZA 4PHTA 3VMAA 3IXHA 4K0XA 3PXPA 2ZD8A 3IX3A 2ZC3B 1OTDA 3T4JA 4E3OA 1EW0A 3H82A 5E2HA 4IEDA 3BWLA 5TBMB 1ZG6A 3MZEA 5IU1A 4OPZA 2V0UA 3N8SA 1RP5A 5DJUA 5FQJA 3IWQA 4QHCA 3O3VA 2Y2HA 2M7UA 3UB5P 5DKLA 2H28A 3K3DA 3HLCA 4XUXA 5KIZA 1K25A 3NOUC 3ZG7B 3E4QA 4EBPA 3T12B 3HBRA 3CJMA 2WZXA 2KDKA 1ZTUA 4X1LA 1ES4A 1DP9A 2Y8HA 4KZBA 1BLPA 3NOTC 1F5MA 4PM5A 3MZFA 5AQAA 3T50A 2Y79A 1S66L 1FCMA 3EOIA 1RGYA 3H82B 3FKWA 1IELA 3MQQA 1N4OA 3L7HA 1PRQA 3GVBA 5U47A 2WKIA 4WMCD 3Q7ZA 1JWVA 4EW7A 3UDIA 3ZFZA 1PWCA 3CHWP 3A0SA 1YT4A 3LIDA 4WZ5C 3LEZA 5CX7A 4X25A 1BTLA 1H8ZA 1BLHA 4U3TA 4BMWA 3JPUA 1OPXA 1ZG4A 4UQIM 3BECA 1I2WA 1EWZA 3KYZA 4M3KA 2V2FF 3LR5A 4R38A 3BEBA 4S2NA 2G2WA 2VV6A 2M7VA 3CAXA 4RA7A 4DXCA 1DJBA 2XA7M 1KE4A 4S2PA 1P9RA 4EBLA 1XKZA 5EVID 5HD3A 4DE2A 3HREA 4GD6A 1QMEA 3TSGA 4EV4A 1Y28A 2HF6A 5DTSA 1JTDA 1FSWA 3GSGA 5KSCA 3C5AA 2OSUA 4FCFA 4DE0A 4JXSA 3SS3A 1VHMA 3A3JA 2HP6A 4FUWA 5FA7A 1S4RA 4CQHA 5L07A 4Y0OA 2K2NA 4S2NC 3BLMA 4EESA 3KO6A 1YQSA 3BFEA 4JF6A 4NXGA 1PWDA 3GDIA 4JF5A 1YSPA 4PMAA 4LRYC 4H8RA 4OQ0A 4A5RA 3HLEA 1V9YA 1ES2A 2VV8A 5FL3A 1K38A 4EQIA 1YLTA 3JVVA 2Y2JA 2Y2NA 4N1XA 3VOZA 4LRZE 4B88A 5EVIB 5HD5A 3CITA 4MN5A 3H7WA 5HDCA 5IS1A 3S4XA 4RQ9A 4JGOA 3JYIA 4ME4A 4R6LA 2H0YA 1LLBA 1OMEA 3HVFA 3DWZA 4XT2A 5TJJA 4MBKA 2VGJA 1NWZA 4GD8A 1F2KA 1XFQA 4Y15A 4EUVA 3FZCA 3WS1A 3CLOA 3PAEA 2RL3A 1GHIA 4LGWA 4EEPA 2V9AA 3BJNA 3UPPA 4BWIA 3OCLA 4QWOA 1VQQA 4WMCA 1UWNX 4OQHA 2JKRM 4JGRA 4D60A 1DRMA 5CGSA 4DDYA 2EX2A 4H6JB 2ZQCA 4UA6A 3CI6A 5BOHA 2HGVA 5HL6A 3G35A 3LO7A 3WRZA 2X71A 2K31A 4JPMA 5F82A 3EGDC 1YLYA 3LFVA 2Q0OA 3P7NA 2VGLS 3IH8A 5EVIA 1G68A 1CK3A 2OLUA 2XA7S 4OP5A 2QPNA 5CXWA 4I3AA 2R9WA 1ONGA 5TGFA 4N92A 3E2KA 1KVMA 4ZRRA 4HI4A 1O7EA 5F1FA 3ITBA 3NJAA 1VEUA 2ZQDA 1MBLA 5HDSA 4CLCB 3R4KA 1D06A 2A3UA 4QU3A 4E3MA 2PT7A 4E6XA 2BASA 4ARZA 4DF6A 3CPTB 3A3IA 5KSHA 2JCHA 3VV4A 5CHUA 3S1YA 5AJGA 4CJNA 4NK3A 4GHIA 4P6BA 4S2IA 1KE0A 2WGVA 4LENA 2C6WB 2P9VA 1W79A 2WKHA 4C6YA 4R70A 2OWJA 3ULFA 2X02A 1FSYA 3VP3A 1JVJA 4JGQA 2V0WA 4BBVA 3IXGA 1TDLA 5HAIA 3UE0A 2EFXA 3Q82A 3G31A 2Y2QA 3QP6A 4LV1A 4GCZA 4ESPA 4JKTA 1XA1A 1LSVA 3A3DA 2H5SA 3VE3A 4KQOA 4GDNA 4MCWA 5J7EA 2P74A 1HTZA 5CEDA 2QJ5A 3TW8A 1TS8A 2ZC6B 1H8YA 2DNSA 4GLQA 1NRFA 3RJUA 1MWSA 1XX2A 3PAGA 2OAP1 2DRWA 1CF0A 2GDNA 2J80A 4LCMA 4UAAA 3V67A 4ARZB 2VGLM 4KG5A 2HP5A 1M6KA 3A3FA 1FQGA 1S4SA 1T18A 2WGWA 3T1QB 4WM9A 3QNBA 3VSKA 1T1AA 4S2MA 2B02A 1CJFA 1K0KA 5HL1A 3CUEA 4UEYA 4QJGA 1C3BA 4II7A 2RCXA 3EQUA 3FKVA 2PAVP 1MXOA 4MMNA 5JYOA 3NC8A 5GLBA 3UE1A 3LCEA 4DE1A 1K6SA 2Y4AA 3FPVA 4ZJ3A 3UB9A 2D02A 2QMIA 2R9XA 3QP2A 1L2SA 3OZHA 5HWTA 3T1XA 4NETA 5A91A 3D9YA 5FQIA 5FAOA 4JGPA 4GS9A 2JN7A 4JXGA 1K56D 4R23A 2G7UA 3TRCA 4EETB 3LR3A 5HW3A 5CTNA 4MDZA 3HCYA 2Z6CA 2Z6DA 3R7WB 2XSSA 4Q8IA 2P04A 5TR7A 4OOLA 2B95A 4FOFA 5L2FA 2D01A 3OPHA 1YM1A 1IYSA 3MXRA 1EI5A 1DP6A 2INWA 2L1MA 2XRNA 5DTTA 3PBTA 1SCWA 2WKEA 2VV7A 3QP8A 5D3OA 3MSHA 4E3JA 1GA0A 3BLSA 4QY5A 4YWZA 4F3LB 4B9OA 1G28A 2QZ6A 1LSWA 2PU2A 2VZWA 1GA9A 5DFXA 1NYYA 1SDEA 1P0ZA 2Y2GA 4HH2A 3ZDJA 3ZGAB 5HAPA 5FSRA 4KG6A 3NULA 1SHVA 4B4XA 1NZOA 5EUAA 3PR6A 4RX3A 4ZAMA 2KLIA 2PYRA 3F1OA 2PHYA 2PD8A 4BQMA 3QP5A 5GLDA 4NXEA 5A90A 3E4OA 1JWPA 4LRXC 3M2KA 3HJKA 5F68A 4Y7PA 3SH8A 3VE4A 3DTKA 1FOFA 4OOMA 2PBYA 2XROA 4RYEA 3DTIA 1D7EA 1XP4A 4R4SA 3LICA 4P0MA 5HDDA 3CMZA 4YFMA 3P09A 1MWRA 4LV2A 3OC2A 5EVEA 5JYPA 3DAVA 1RCJA 3A0VA 3MR0A 4MLLA 3BYDA 5HPIA 2VX8A 1HZOA 3B47A 3LY3A 1VM1A 2Y2OA 1YKDA 2I72A 4HBUA 2WKQA 4QY6A 4O8GA 2FH5A 1F98A 1K56A 3NI9A 4MN6A 3GV9A 5FEFA 1IEMA 3HJIA 4BL3A 4KZ7A 5I94A 1OTAA 5L8MA 4U0TA 2NUPC 2B5RA 3EEAA 3HLBA 3UB7A 4KUKA 2HV1A 3QP4A 4YINA 1XA7A 1IOUA 1FR6A 4HJ4A 2ZC7A 1VEUB 2ZMVA 4LFUA 1Z09A 1G5UA 4KQDA 4O01A 3BY9A 5AVEA 3C4OA 3LIEA 3HUNA 3LI8A 2R78A 1W7FA 3VOYA 1YMXA 3M6BA 5HWWA 4R4RA 1YMSA 4OPRA 4EUZA 2IA2A 2V8FA 4ZJ2A 1NRJA 1YLJA 3C2WA 3HUOA 1MWTA 4BJPA 3N4IA 4I38A 3MFDA 2H0TA 4R3JA 2JE5A 5GHZA 1BUEA 4CPKA 4EERA 3HLFA 3UDFA 4WF0A 3A3EA 5G4ZA 5CRFA 3IF6A 4Z9QA 3D3OA 1JTGA 4HIAA 2XR0A 1PI4A 4OLGA 3IX4A 5HAQA 1Q2QA 2V8CA 2QYBA 5EM0A 5F69A 1EROA 2VJWA 3NDGA 4HJ3A 4MNRA 4ETZA 2WGWB 4GN2A 1PW8A 3H9WA 1FIKA 4ID4A 1S0WA 2J8YA 1SDNA 4O0PA 2Y2MA 3KSHA 5DVAA 3LIAA 2HDSA 1DP8A 4XT2B 5I5LA 4AFIA 3T4TA 4WEJA 2Z2MB 4HJ6A 3BFFA 1TD5A 5CHJA 2A24B 4EU0A 3U2AA 3VSLA 3UMEA 1LL9A 4GS9B 3D72A 2P7JA 3CPTA 3Q7VA 1GHPA 4BBTA 3G6OA 2O9BA 4C75A 3BM6A 4HP9A 1L3LA 4Y17A 3W4QA 2EX8A 1ES5A 1WYBA 3S7OA 2Z2LB 3TJZC 4JLFA 1CI8A 4OPQA 2BLSA 1ALQA 2PR6A 1GSVA 2XFSA 1ODVA 2AVXA 3CG5A 1YSQA 4UHUA 3NY4A 4S2JA 3VP4A 3B42A 1TS0A 3P98A 3Q7VB 2WYXA 3HLGA 4WL9A 1YLZA 2FZ0A 3UNWA 3WS2A 4ETXA 5GL9A 2V1BA 2HPBA 2Y91A 1N9NA 3N8LA 5CGWA 5FAQA 3R7WA 4GW9A 2J7VA 3G2ZA 3C30A 4HBTA 1IKIA 4I3IA 1ACFA 1HVBA 1MY8A 2L0WA 4HY8A 5A93A 4WZ5A 3IHBA 3W4OA 1H8MA 1PYYA 2LB5A 3B33A 4R3BA 2W3FA 3T1SA 5E2GA 2MJ6A 4FD8A 1LSXA 5HX9A 2JKRI 5F6AA 2K7SA 2XD5A 4IVKA 1VETB 3IF6C 3Q81A 1WYCA 1CEGA 4OOYA 1SZVA 4OP8A 3D4FA 3FC7A 3KX0X 3IS2B 4FTXA 1NLZA 1T1BA 5KZHA 5A8BA 2ZBBA 1NY0A 1KDSA 1NYMA 5TFQA 3UDXA 2M1CA 1P9WA 1ZHHB 5FQ9A 2V1ZA 3E98A 2ACGA 1LL5A 3LUQA 2ZMAA 3H7WB 4HEFA 4L0LA 3GECA 4KZAA 4P6ZM 1SKOA 5CHMA 1TVFA 5KMWA 1AWIA 5EECA 3MBZA 2HJ9C 3UPNA 2EWWA 5AQBA 4GKUA 2W1TA 4P6ZS 4PM7A 3BFCA 1IFQA 3DBAA 5EVLA 5DFYA 3AGFA 2XD1A 3LY4A 5TBMA 4OONA 4HNBA 3EGXC 4R0QA 5EPHA 3G2YA 2KOIA 1FCOA 1ZKJA 2ZL1B 3FYZA 1E3UD 4NXBA 4BENA 2GX5A 1E4DA 4YOFA 3LYXA 3IWIA 3CZDA 1S6RA 4I5SA 2WGIA 3MFXA 3GTCA 5EOEA 1STZA 2VLGA 4BBUA 2I9VA 3T4SA 1T19A 5CGXA 2ZL1A 1Y54A 3C7UA 4XUZA 4Y3IA 5CERA 4QD4A 1LI0A 2XH9A 1GSWA 1ERMA 2W3GA 2ZM0A 5A92A 3DW0A 2EX9A 1OTEA 5GHYA 5CTMA 2O99A 4OPYA 5FI2A 3MQOA 2FFYA 3MKFA 1UWPX 1L0EA 2WAFA 3ZYTA 4PKYG 2A2LA 4DN0A 3C8CA 2O9CA 2PBDP 1BZAA 3PHYA 4LV0A 1NXYA 3LI9A 4GHIB 5G4YA 1W8QA 2JKTI 4OH0A 4ZBEA 3F1PA 1M40A 3O87A 4L9GA 4KQRA 1Y4OA 3KYQA 5M19A 2HDQA 4DMZA 1WE4A 5HWVA 3UB6A 3IT9A 4DRTA 4MN7A 5L10A 4EBNA 5EFWA 1LHYA 1H3QA 3N8RA 4C3QA 2C5WB 2PR5A 1IYPA 1JNUA 3IF6B 3W4PA 2VGKA 1Z6FA 2WK0A 2O0YA 3FV7A 5FASA 1BT5A 3VP1A 5EV0A 4RVAA 5DJTA 1OT6A 2W3HA 3SOIA 1H0MA 1MWUA 2ZMFA 2JKFA 1MZUA 2W1TB 5J3WA 2Y2KA 4GZBA 2IWCA 3CUEC 1P97A 4M4XA 5K5BA 2P08A 1LT0A 4BD1A 4CLCA 3IQAA 3T1RA 3C38A 5EM1A 3UO9A 4UQIS 2XF3A 1IYOA 1JWZA 5GLCA 2PD7A 1S1YA 4N9LA 4X6TA 1T1CA 3GRJA 1YPRA 2Y2LA 4NKPA 1K57A 1K4EA 2PU4A 4PM9A 1BSGA 3UE3A 2HP9A 1E3UA 5LBRA 1GSXA 3NIAA 4Y0TA 1BLSA 3AGDA 5FAPA 4KENB 3PTEA 3I7JA 4KZ3A 2PDRA 2J3TC 4K0WA 2J9OA 3TOIA 3IX8A 2WUQA 4I39A 1ZC2A 1D1JA 4GDBA 4Z1WA 5FI6A 3V3RA 2QWSA 3F1NA 2O9AA 2ZM2A 1G6OA 3EWKA 1Q2PA 2YKFA 5E43A 4XXRA 5HARA 2OOLA 2EXAA 3N6IA 2B18A 2XGNA 4HHDA 2V1AA 2Q9NA 4B93A 4X55A 3T4QA 4GOGA 5DF9A 4HQAA 2EA9A 2WKPA 3LIFA 4KG2A 4BLMA 3E4PA 5FQKA 1MKMA 2BG1A 3UN7A 4QPRA 1FR1A 3LIBA 2EWVA 1XXMA 4UA9A 5FI7A 3ZG8B 2ZQ8A 2GNXA 3F1PB 3OOVA 4X68A 2NUTC 1PZOA 1XJ4A 3MF0A 2ZQAA 4R3AA 4E3LA 2VEAA 1S1ZA 3Q1FA 4Q0JA 1MC0A 3RFBA 5M18A 2J3WA 3EQVA 5F5YA 3WS4A 3ZVTA 5E2EA 5IT5A 2V20A 3M2JA 4QB8A 3LR0A 3T4LA 1ONHA 4DJ3A 2X01A 1KDWA 3ZG5A 3LEQA 2JC7A 1K4FA 1XJ3A 3K3CA 3VOLA 1XGIA 4EWFA 3KYEA 4JXVA 4X1MA 1IYQA 1K55A 3PBSA 1K6RA 4BL2A 2JKGA 3ZCZA 3T4OA 3DWKA 3ICYA 3OBFA 4D2OA 1XJ2A 4Y0UA 5GHXA 1J3WA 5IHVA 4CLCD 3PBQA 2XEPA 5AQ9A 1DJCA 2Q9MA 3V39A 2P9VB 1CEFA 1PNEA 3VFFA 2QKPA 3HLWA 4CLCC 3E2LA 3VP2A 1K54C 4EEUA 3MQ0A 3S22A 3TG9A 5FEGA 2W1RA 1KVLA 1BULA 1CI9A 4FSFA 4N9KA 4JF4A 5M1AA 2ZM8A 3NBLA 3SW1A 3SZTA 2EFUA 4OQIA 1S67L 4FH4A 5EOOA 2VK3A 4LCLA 1XGJA
chains in the Genus database with same CATH topology
4K0XA 4ZJ3A 1NZUA 2QMIA 2R9XA 1L2SA 3OZHA 1L0FA 3GQZA 1BLCA 2ZD8A 4R3BA 2ZC3B 4E3OA 4NETA 5A91A 5E2HA 5E2GA 4IEDA 3MXSA 5FQIA 4FD8A 5HX9A 5FAOA 1E25A 1ZG6A 3MZEA 4OPZA 3N8SA 2XD5A 1RP5A 1K56D 2XFTA 4IVKA 4JXGA 5FQJA 5G18A 4X69A 5EVIC 2XDMA 3IWQA 3IF6C 4QHCA 4R23A 3V50A 4GNUA 3O3VA 3Q81A 1WYCA 2Y2HA 4WYYA 4KZ8A 1CEGA 4OOYA 4OP8A 3D4FA 1KGFA 1MKIA 3HLCA 4XUXA 5HW3A 1K25A 5CTNA 3ZG7B 4EBPA 5J8XA 5KZHA 1NY0A 4MEZA 4P87A 1KDSA 3HBRA 1NYMA 5TFQA 4Q8IA 3RXXA 3UDXA 3CJMA 5TR7A 2WZXA 4OOLA 1K55C 1I2SA 1ES4A 5L2FA 4KZBA 3G34A 5FQ9A 3OPHA 1BLPA 1FCNA 2V1ZA 1LL5A 4U0XA 2ZMAA 1YM1A 4PM5A 1ES3A 1IYSA 3MXRA 3MZFA 4HEFA 1EI5A 5AQAA 4L0LA 1FCMA 4WELA 1RGYA 4KZAA 4S2LA 5DTTA 3PBTA 3FKWA 1IELA 4KZ5A 5CHMA 1N4OA 1ESIA 1TVFA 5FQMA 5KMWA 1SCWA 2WKEA 3GVBA 5U47A 5EECA 5EE8A 5D3OA 3MBZA 4K91A 2WKIA 4E3JA 1AXBA 4WMCD 3Q7ZA 1JWVA 3UPNA 1GA0A 5AQBA 3BLSA 4GKUA 3OPRA 1H5XA 4QY5A 3UDIA 1IKGA 4PM7A 3BFGA 3BFCA 3ZFZA 1PWCA 2QZ6A 2PU2A 1YT4A 2DCFA 4WZ5C 3LEZA 5EVLA 1GA9A 4LV3A 1BTLA 3AGFA 2XD1A 2Y55A 4MBFA 3WRTA 1H8ZA 1BLHA 3LY4A 4U3TA 3ZG0A 1ZG4A 1NYYA 3BECA 4E3IA 2ZQ9A 4OONA 3MKEA 1SDEA 1DY6A 1I2WA 1EWZA 4R0QA 4M3KA 2Y2GA 5EPHA 3QNCA 2V2FF 3G2YA 3BEBA 4S2NA 1FCOA 1ZKJA 1TDGA 1U60A 3FYZA 3ZDJA 2G2WA 1E3UD 3ZGAB 5FSRA 5HAPA 4BENA 5DTKA 4KG6A 1E4DA 1YLPA 4RA7A 1SHVA 4DXCA 4B4XA 1NZOA 5EUAA 3IWIA 1DJBA 3CZDA 4RX3A 1KE4A 1S6RA 4S2PA 3SH7A 4EBLA 1XKZA 5EVID 4DE2A 3HREA 2WGIA 4GD6A 4KZ9A 3GTCA 4WZ4A 4ZAMA 3RXWA 5EOEA 3BFDA 1QMEA 3TSGA 5CGXA 1PI5A 4EV4A 5DTSA 1JTDA 3DTMA 1FSWA 1Y54A 3ZG9B 3C7UA 4XUZA 5CERA 2HDUA 4QD4A 3GSGA 4BQMA 3G30A 3C5AA 4OKPA 1LI0A 5GLDA 5KSCA 4BD0A 2XH9A 2OSUA 4FCFA 5A90A 1ERMA 2ZM0A 5A92A 1JWPA 1TEMA 3DW0A 4DE0A 1PZPA 4JXSA 3SS3A 2EX9A 3M2KA 2UWXA 3A3JA 2IWBA 3VFHA 2HP6A 5FA7A 2A49A 5GHYA 4Y7PA 5CTMA 3SH8A 4O7DA 4OPYA 5FI2A 1FOFA 4WEKA 3FWLA 4IBRA 4Y0OA 4OOMA 2FFYA 3MKFA 4S2NC 3BLMA 2PBYA 2WAFA 1L0EA 1YQSA 5F1GA 4RYEA 3BFEA 4JF6A 3IWOA 4R1GA 1PWDA 1XP4A 3G4PA 4JF5A 4R4SA 2Y59A 4P0MA 1BZAA 4PM8A 4PMAA 4ZJ1A 1ESUA 3CMZA 4YFMA 1O07A 4LV0A 4H8RA 3P09A 3UPOA 1NXYA 4OQ0A 1MWRA 4LV2A 3OC2A 1SKFA 5JYPA 3IHAA 4DDSA 4A5RA 1RCJA 3HLEA 3NCKA 4HESA 1ES2A 4OQGA 1K38A 4MLLA 3BYDA 1W8QA 4EQIA 4OH0A 4ZBEA 1HZOA 1YLTA 3IXHA 4E3KA 1M40A 3LY3A 2Y2JA 1VM1A 2Y2OA 3O87A 4IVIA 1G6AA 2Y2NA 4KQRA 4N1XA 3VOZA 2I72A 1W5DA 4HBUA 4QY6A 3O86A 4S2KA 5M19A 1K56A 5FDHA 3NI9A 4B88A 5EVIB 2HDQA 3ZVWA 1WE4A 3W8KA 3HLDA 3HUMA 4JBFA 3GV9A 5FQQA 3IT9A 3AGEA 3S4XA 1IEMA 4BL3A 4KZ7A 5I94A 1KGEA 4DRTA 4U0TA 3JYIA 4F94A 3NDEA 4JXWA 4EBNA 2B5RA 3HLBA 1LHYA 4YINA 4E3NA 2ZQ7A 1XA7A 3N8RA 4C3QA 2C5WB 2H0YA 1FR6A 1LLBA 1IYPA 1OMEA 2ZC7A 3SS4A 3IF5A 3HVFA 3DWZA 2HDRA 1KE3A 1DJAA 3G32A 4MBHA 3IH9A 4MBKA 2VGJA 5CECA 3IF6B 5F83A 2ZLYA 4GD8A 3V3SA 3W4PA 4ZTKA 4DE3A 2VGKA 1Z6FA 2WK0A 3FV7A 5FASA 2ZC4B 3FZCA 1BT5A 3ISGA 5AQ7A 3WS1A 3PAEA 3VP1A 5CEBA 2RL3A 1L0DA 3C4OA 3SH9A 3HUNA 1GHIA 3IXDA 1QMFA 4RVAA 1W7FA 3VOYA 3SOIA 2EX6A 3UPPA 1YMXA 3MZDA 1MWUA 3M6BA 2CC1A 2J9PA 3OCLA 4WBGA 1VQQA 2Y2KA 3HL9A 4GZBA 2IWCA 4WMCA 4R4RA 1YMSA 3N7WA 4OQHA 2IWDA 4PPRA 4OPRA 4BD1A 4EUZA 3IQAA 5CGSA 4DDYA 3ZNTA 3UO9A 4ZJ2A 2EX2A 2XF3A 3PBRA 3C4PA 1JWZA 1IYOA 5GLCA 2ZQCA 4UA6A 1YLJA 1PIOA 2WZZA 2ZC5B 5BOHA 4N9LA 4X6TA 3BRMA 3GRJA 4RX2A 2Y2LA 1K57A 3HUOA 1MWTA 4BJPA 1K4EA 3G35A 2PU4A 1PW1A 3N4IA 2H10A 3LO7A 3WRZA 4PM9A 3MFDA 2X71A 4JPMA 1BSGA 3UE3A 2H0TA 2HP9A 4R3JA 5F82A 2JE5A 1E3UA 1GHMA 3VP0A 1YLYA 4OVDA 5GHZA 1BUEA 4CPKA 3HLFA 3UDFA 3NIAA 4Y0TA 5CRFA 3A3EA 4Z9QA 3IF6A 3IH8A 1JTGA 5EVIA 1BLSA 3AGDA 4KENB 5FAPA 3PTEA 3I7JA 1G68A 1PI4A 2XR0A 4KZ3A 4OLGA 1MPLA 5GLAA 4K0WA 4E6WA 1CK3A 2J9OA 3OPLA 3TOIA 1W8YA 2WUQA 3GMWA 1NJ4A 1Q2QA 2OLUA 5HAQA 1ZC2A 4GDBA 4OP5A 1EROA 5FI6A 3V3RA 3NDGA 2QPNA 5CXWA 3QHYA 2ZM2A 2R9WA 4MNRA 1ONGA 5TGFA 4GB7A 3PBNA 4N92A 3E2KA 1KVMA 1Q2PA 2WGWB 4N1HA 5F1FA 1O7EA 5E43A 3ITBA 4GN2A 1PW8A 1L0GA 4XXRA 2ZQDA 5HARA 2EXAA 3N6IA 1MBLA 2XGNA 1LI9A 1S0WA 2J8YA 4ID4A 1SDNA 2A3UA 4QU3A 4E3MA 2Q9NA 3GR2A 4E6XA 4FH2A 3WS0A 2Y2MA 4X55A 4GOGA 5DVAA 3V5MA 4DF6A 2HDSA 3A3IA 5KSHA 5DF9A 2FFFB 4KG2A 2JCHA 2WAEA 5FATA 4BLMA 5CHUA 4IBXA 5FQKA 3S1YA 2BG1A 3B3XA 3UN7A 4WEJA 3ITAA 4CJNA 1FR1A 4NK3A 2OV5A 2Z2MB 4P6BA 4UA7A 3BFFA 4S2IA 1KE0A 5E2FA 1XXMA 2JBFA 4UA9A 1I5QA 5CHJA 2WGVA 3ZNYA 5FI7A 4P85A 3ZG8B 2ZQ8A 2Y2IA 4LENA 5DF7A 2C6WB 2P9VA 1W79A 2WKHA 4C6YA 3VSLA 1LL9A 2X02A 4X68A 1FSYA 3VP3A 1K57C 1JVJA 1PZOA 1N9BA 3Q7VA 3IXGA 1TDLA 5HAIA 1GHPA 4X53A 3UE0A 3PBOA 2EFXA 3Q82A 2ZQAA 4E3LA 3G31A 4S2OA 1HD8A 4C75A 2Y2QA 3BM6A 4LV1A 3Q1FA 3C7VA 3W4QA 2EX8A 4JKTA 3M6HA 5M18A 1XA1A 3A3DA 3EQVA 2H5SA 1GCEA 1ES5A 1WYBA 3WS4A 4KQOA 4PM6A 2Z2LB 3ZVTA 4DXBA 5E2EA 4JLFA 1CI8A 4GDNA 2V20A 4KZ6A 2P74A 3M2JA 4OPQA 4ZDXA 3SS5A 1HTZA 4QB8A 2E8IA 5CEDA 2BLSA 2ZC6B 1H8YA 2DNSA 1ONHA 1NRFA 4LCLA 2X01A 3WS5A 1KDWA 1ALQA 5DF8A 3ZG5A 3RJUA 2JC7A 1K4FA 1MWSA 1XX2A 3PAGA 1XGIA 4EWFA 2XFSA 2XQZA 2EXBA 4JXVA 2DRWA 3CG5A 1IYQA 1K55A 3PBSA 1K6RA 4UHUA 4BL2A 3ZCZA 2GDNA 3NY4A 1YLWA 4S2JA 3VP4A 3DWKA 4KQQA 4X56A 3P98A 3Q7VB 4LCMA 4UAAA 2WYXA 1XPBA 3HLGA 4D2OA 2ZJ9A 4Y0UA 3WWXA 4KG5A 5GHXA 2HP5A 1K54A 1M6KA 3A3FA 1YLZA 3OCNA 5IHVA 3UNWA 3WS2A 2WADA 2XLNA 3PBQA 2XEPA 1FQGA 1DJCA 5AQ9A 2Q9MA 3V39A 2P9VB 1RGZA 3OPPA 1CEFA 5GL9A 2OLVA 2WGWA 1PWGA 2HPBA 4WM9A 3VFFA 4B4ZA 2Y91A 3O88A 3HLWA 3QNBA 3E2LA 3N8LA 3ZHHA 5CGWA 3VP2A 3VSKA 4S2MA 1K54C 5FAQA 5HL1A 3S22A 2J7VA 3TG9A 3Q07A 3G2ZA 1KVLA 3IXBA 4QJGA 1C3BA 1BULA 2Y2PA 1CI9A 2RCXA 3EQUA 1J9MA 3FKVA 4FSFA 1ERQA 4N9KA 4HBTA 1MXOA 5HFOA 1IKIA 4JF4A 3UY6A 3NC8A 5JYOA 5GLBA 2XK1A 2G2UA 4KZ4A 5M1AA 1KGGA 3UE1A 3LCEA 2ZM8A 3NBLA 1HVBA 2EFUA 4OQIA 1MY8A 4OLDA 4DE1A 5A93A 4FH4A 4WZ5A 3IHBA 4DKIA 3W4OA 5EOOA 1PYYA 1K6SA 3VMAA 2Y4AA 1XGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0X A;  4ZJ3 A;  1NZU A;  2QMI A;  2R9X A;  1L2S A;  3OZH A;  1L0F A;  3GQZ A;  1BLC A;  2ZD8 A;  4R3B A;  2ZC3 B;  4E3O A;  4NET A;  5A91 A;  5E2H A;  5E2G A;  4IED A;  3MXS A;  5FQI A;  4FD8 A;  5HX9 A;  5FAO A;  1E25 A;  1ZG6 A;  3MZE A;  4OPZ A;  3N8S A;  2XD5 A;  1RP5 A;  1K56 D;  2XFT A;  4IVK A;  4JXG A;  5FQJ A;  5G18 A;  4X69 A;  5EVI C;  2XDM A;  3IWQ A;  3IF6 C;  4QHC A;  4R23 A;  3V50 A;  4GNU A;  3O3V A;  3Q81 A;  1WYC A;  2Y2H A;  4WYY A;  4KZ8 A;  1CEG A;  4OOY A;  4OP8 A;  3D4F A;  1KGF A;  1MKI A;  3HLC A;  4XUX A;  5HW3 A;  1K25 A;  5CTN A;  3ZG7 B;  4EBP A;  5J8X A;  5KZH A;  1NY0 A;  4MEZ A;  4P87 A;  1KDS A;  3HBR A;  1NYM A;  5TFQ A;  4Q8I A;  3RXX A;  3UDX A;  3CJM A;  5TR7 A;  2WZX A;  4OOL A;  1K55 C;  1I2S A;  1ES4 A;  5L2F A;  4KZB A;  3G34 A;  5FQ9 A;  3OPH A;  1BLP A;  1FCN A;  2V1Z A;  1LL5 A;  4U0X A;  2ZMA A;  1YM1 A;  4PM5 A;  1ES3 A;  1IYS A;  3MXR A;  3MZF A;  4HEF A;  1EI5 A;  5AQA A;  4L0L A;  1FCM A;  4WEL A;  1RGY A;  4KZA A;  4S2L A;  5DTT A;  3PBT A;  3FKW A;  1IEL A;  4KZ5 A;  5CHM A;  1N4O A;  1ESI A;  1TVF A;  5FQM A;  5KMW A;  1SCW A;  2WKE A;  3GVB A;  5U47 A;  5EEC A;  5EE8 A;  5D3O A;  3MBZ A;  4K91 A;  2WKI A;  4E3J A;  1AXB A;  4WMC D;  3Q7Z A;  1JWV A;  3UPN A;  1GA0 A;  5AQB A;  3BLS A;  4GKU A;  3OPR A;  1H5X A;  4QY5 A;  3UDI A;  1IKG A;  4PM7 A;  3BFG A;  3BFC A;  3ZFZ A;  1PWC A;  2QZ6 A;  2PU2 A;  1YT4 A;  2DCF A;  4WZ5 C;  3LEZ A;  5EVL A;  1GA9 A;  4LV3 A;  1BTL A;  3AGF A;  2XD1 A;  2Y55 A;  4MBF A;  3WRT A;  1H8Z A;  1BLH A;  3LY4 A;  4U3T A;  3ZG0 A;  1ZG4 A;  1NYY A;  3BEC A;  4E3I A;  2ZQ9 A;  4OON A;  3MKE A;  1SDE A;  1DY6 A;  1I2W A;  1EWZ A;  4R0Q A;  4M3K A;  2Y2G A;  5EPH A;  3QNC A;  2V2F F;  3G2Y A;  3BEB A;  4S2N A;  1FCO A;  1ZKJ A;  1TDG A;  1U60 A;  3FYZ A;  3ZDJ A;  2G2W A;  1E3U D;  3ZGA B;  5FSR A;  5HAP A;  4BEN A;  5DTK A;  4KG6 A;  1E4D A;  1YLP A;  4RA7 A;  1SHV A;  4DXC A;  4B4X A;  1NZO A;  5EUA A;  3IWI A;  1DJB A;  3CZD A;  4RX3 A;  1KE4 A;  1S6R A;  4S2P A;  3SH7 A;  4EBL A;  1XKZ A;  5EVI D;  4DE2 A;  3HRE A;  2WGI A;  4GD6 A;  4KZ9 A;  3GTC A;  4WZ4 A;  4ZAM A;  3RXW A;  5EOE A;  3BFD A;  1QME A;  3TSG A;  5CGX A;  1PI5 A;  4EV4 A;  5DTS A;  1JTD A;  3DTM A;  1FSW A;  1Y54 A;  3ZG9 B;  3C7U A;  4XUZ A;  5CER A;  2HDU A;  4QD4 A;  3GSG A;  4BQM A;  3G30 A;  3C5A A;  4OKP A;  1LI0 A;  5GLD A;  5KSC A;  4BD0 A;  2XH9 A;  2OSU A;  4FCF A;  5A90 A;  1ERM A;  2ZM0 A;  5A92 A;  1JWP A;  1TEM A;  3DW0 A;  4DE0 A;  1PZP A;  4JXS A;  3SS3 A;  2EX9 A;  3M2K A;  2UWX A;  3A3J A;  2IWB A;  3VFH A;  2HP6 A;  5FA7 A;  2A49 A;  5GHY A;  4Y7P A;  5CTM A;  3SH8 A;  4O7D A;  4OPY A;  5FI2 A;  1FOF A;  4WEK A;  3FWL A;  4IBR A;  4Y0O A;  4OOM A;  2FFY A;  3MKF A;  4S2N C;  3BLM A;  2PBY A;  2WAF A;  1L0E A;  1YQS A;  5F1G A;  4RYE A;  3BFE A;  4JF6 A;  3IWO A;  4R1G A;  1PWD A;  1XP4 A;  3G4P A;  4JF5 A;  4R4S A;  2Y59 A;  4P0M A;  1BZA A;  4PM8 A;  4PMA A;  4ZJ1 A;  1ESU A;  3CMZ A;  4YFM A;  1O07 A;  4LV0 A;  4H8R A;  3P09 A;  3UPO A;  1NXY A;  4OQ0 A;  1MWR A;  4LV2 A;  3OC2 A;  1SKF A;  5JYP A;  3IHA A;  4DDS A;  4A5R A;  1RCJ A;  3HLE A;  3NCK A;  4HES A;  1ES2 A;  4OQG A;  1K38 A;  4MLL A;  3BYD A;  1W8Q A;  4EQI A;  4OH0 A;  4ZBE A;  1HZO A;  1YLT A;  3IXH A;  4E3K A;  1M40 A;  3LY3 A;  2Y2J A;  1VM1 A;  2Y2O A;  3O87 A;  4IVI A;  1G6A A;  2Y2N A;  4KQR A;  4N1X A;  3VOZ A;  2I72 A;  1W5D A;  4HBU A;  4QY6 A;  3O86 A;  4S2K A;  5M19 A;  1K56 A;  5FDH A;  3NI9 A;  4B88 A;  5EVI B;  2HDQ A;  3ZVW A;  1WE4 A;  3W8K A;  3HLD A;  3HUM A;  4JBF A;  3GV9 A;  5FQQ A;  3IT9 A;  3AGE A;  3S4X A;  1IEM A;  4BL3 A;  4KZ7 A;  5I94 A;  1KGE A;  4DRT A;  4U0T A;  3JYI A;  4F94 A;  3NDE A;  4JXW A;  4EBN A;  2B5R A;  3HLB A;  1LHY A;  4YIN A;  4E3N A;  2ZQ7 A;  1XA7 A;  3N8R A;  4C3Q A;  2C5W B;  2H0Y A;  1FR6 A;  1LLB A;  1IYP A;  1OME A;  2ZC7 A;  3SS4 A;  3IF5 A;  3HVF A;  3DWZ A;  2HDR A;  1KE3 A;  1DJA A;  3G32 A;  4MBH A;  3IH9 A;  4MBK A;  2VGJ A;  5CEC A;  3IF6 B;  5F83 A;  2ZLY A;  4GD8 A;  3V3S A;  3W4P A;  4ZTK A;  4DE3 A;  2VGK A;  1Z6F A;  2WK0 A;  3FV7 A;  5FAS A;  2ZC4 B;  3FZC A;  1BT5 A;  3ISG A;  5AQ7 A;  3WS1 A;  3PAE A;  3VP1 A;  5CEB A;  2RL3 A;  1L0D A;  3C4O A;  3SH9 A;  3HUN A;  1GHI A;  3IXD A;  1QMF A;  4RVA A;  1W7F A;  3VOY A;  3SOI A;  2EX6 A;  3UPP A;  1YMX A;  3MZD A;  1MWU A;  3M6B A;  2CC1 A;  2J9P A;  3OCL A;  4WBG A;  1VQQ A;  2Y2K A;  3HL9 A;  4GZB A;  2IWC A;  4WMC A;  4R4R A;  1YMS A;  3N7W A;  4OQH A;  2IWD A;  4PPR A;  4OPR A;  4BD1 A;  4EUZ A;  3IQA A;  5CGS A;  4DDY A;  3ZNT A;  3UO9 A;  4ZJ2 A;  2EX2 A;  2XF3 A;  3PBR A;  3C4P A;  1JWZ A;  1IYO A;  5GLC A;  2ZQC A;  4UA6 A;  1YLJ A;  1PIO A;  2WZZ A;  2ZC5 B;  5BOH A;  4N9L A;  4X6T A;  3BRM A;  3GRJ A;  4RX2 A;  2Y2L A;  1K57 A;  3HUO A;  1MWT A;  4BJP A;  1K4E A;  3G35 A;  2PU4 A;  1PW1 A;  3N4I A;  2H10 A;  3LO7 A;  3WRZ A;  4PM9 A;  3MFD A;  2X71 A;  4JPM A;  1BSG A;  3UE3 A;  2H0T A;  2HP9 A;  4R3J A;  5F82 A;  2JE5 A;  1E3U A;  1GHM A;  3VP0 A;  1YLY A;  4OVD A;  5GHZ A;  1BUE A;  4CPK A;  3HLF A;  3UDF A;  3NIA A;  4Y0T A;  5CRF A;  3A3E A;  4Z9Q A;  3IF6 A;  3IH8 A;  1JTG A;  5EVI A;  1BLS A;  3AGD A;  4KEN B;  5FAP A;  3PTE A;  3I7J A;  1G68 A;  1PI4 A;  2XR0 A;  4KZ3 A;  4OLG A;  1MPL A;  5GLA A;  4K0W A;  4E6W A;  1CK3 A;  2J9O A;  3OPL A;  3TOI A;  1W8Y A;  2WUQ A;  3GMW A;  1NJ4 A;  1Q2Q A;  2OLU A;  5HAQ A;  1ZC2 A;  4GDB A;  4OP5 A;  1ERO A;  5FI6 A;  3V3R A;  3NDG A;  2QPN A;  5CXW A;  3QHY A;  2ZM2 A;  2R9W A;  4MNR A;  1ONG A;  5TGF A;  4GB7 A;  3PBN A;  4N92 A;  3E2K A;  1KVM A;  1Q2P A;  2WGW B;  4N1H A;  5F1F A;  1O7E A;  5E43 A;  3ITB A;  4GN2 A;  1PW8 A;  1L0G A;  4XXR A;  2ZQD A;  5HAR A;  2EXA A;  3N6I A;  1MBL A;  2XGN A;  1LI9 A;  1S0W A;  2J8Y A;  4ID4 A;  1SDN A;  2A3U A;  4QU3 A;  4E3M A;  2Q9N A;  3GR2 A;  4E6X A;  4FH2 A;  3WS0 A;  2Y2M A;  4X55 A;  4GOG A;  5DVA A;  3V5M A;  4DF6 A;  2HDS A;  3A3I A;  5KSH A;  5DF9 A;  2FFF B;  4KG2 A;  2JCH A;  2WAE A;  5FAT A;  4BLM A;  5CHU A;  4IBX A;  5FQK A;  3S1Y A;  2BG1 A;  3B3X A;  3UN7 A;  4WEJ A;  3ITA A;  4CJN A;  1FR1 A;  4NK3 A;  2OV5 A;  2Z2M B;  4P6B A;  4UA7 A;  3BFF A;  4S2I A;  1KE0 A;  5E2F A;  1XXM A;  2JBF A;  4UA9 A;  1I5Q A;  5CHJ A;  2WGV A;  3ZNY A;  5FI7 A;  4P85 A;  3ZG8 B;  2ZQ8 A;  2Y2I A;  4LEN A;  5DF7 A;  2C6W B;  2P9V A;  1W79 A;  2WKH A;  4C6Y A;  3VSL A;  1LL9 A;  2X02 A;  4X68 A;  1FSY A;  3VP3 A;  1K57 C;  1JVJ A;  1PZO A;  1N9B A;  3Q7V A;  3IXG A;  1TDL A;  5HAI A;  1GHP A;  4X53 A;  3UE0 A;  3PBO A;  2EFX A;  3Q82 A;  2ZQA A;  4E3L A;  3G31 A;  4S2O A;  1HD8 A;  4C75 A;  2Y2Q A;  3BM6 A;  4LV1 A;  3Q1F A;  3C7V A;  3W4Q A;  2EX8 A;  4JKT A;  3M6H A;  5M18 A;  1XA1 A;  3A3D A;  3EQV A;  2H5S A;  1GCE A;  1ES5 A;  1WYB A;  3WS4 A;  4KQO A;  4PM6 A;  2Z2L B;  3ZVT A;  4DXB A;  5E2E A;  4JLF A;  1CI8 A;  4GDN A;  2V20 A;  4KZ6 A;  2P74 A;  3M2J A;  4OPQ A;  4ZDX A;  3SS5 A;  1HTZ A;  4QB8 A;  2E8I A;  5CED A;  2BLS A;  2ZC6 B;  1H8Y A;  2DNS A;  1ONH A;  1NRF A;  4LCL A;  2X01 A;  3WS5 A;  1KDW A;  1ALQ A;  5DF8 A;  3ZG5 A;  3RJU A;  2JC7 A;  1K4F A;  1MWS A;  1XX2 A;  3PAG A;  1XGI A;  4EWF A;  2XFS A;  2XQZ A;  2EXB A;  4JXV A;  2DRW A;  3CG5 A;  1IYQ A;  1K55 A;  3PBS A;  1K6R A;  4UHU A;  4BL2 A;  3ZCZ A;  2GDN A;  3NY4 A;  1YLW A;  4S2J A;  3VP4 A;  3DWK A;  4KQQ A;  4X56 A;  3P98 A;  3Q7V B;  4LCM A;  4UAA A;  2WYX A;  1XPB A;  3HLG A;  4D2O A;  2ZJ9 A;  4Y0U A;  3WWX A;  4KG5 A;  5GHX A;  2HP5 A;  1K54 A;  1M6K A;  3A3F A;  1YLZ A;  3OCN A;  5IHV A;  3UNW A;  3WS2 A;  2WAD A;  2XLN A;  3PBQ A;  2XEP A;  1FQG A;  1DJC A;  5AQ9 A;  2Q9M A;  3V39 A;  2P9V B;  1RGZ A;  3OPP A;  1CEF A;  5GL9 A;  2OLV A;  2WGW A;  1PWG A;  2HPB A;  4WM9 A;  3VFF A;  4B4Z A;  2Y91 A;  3O88 A;  3HLW A;  3QNB A;  3E2L A;  3N8L A;  3ZHH A;  5CGW A;  3VP2 A;  3VSK A;  4S2M A;  1K54 C;  5FAQ A;  5HL1 A;  3S22 A;  2J7V A;  3TG9 A;  3Q07 A;  3G2Z A;  1KVL A;  3IXB A;  4QJG A;  1C3B A;  1BUL A;  2Y2P A;  1CI9 A;  2RCX A;  3EQU A;  1J9M A;  3FKV A;  4FSF A;  1ERQ A;  4N9K A;  4HBT A;  1MXO A;  5HFO A;  1IKI A;  4JF4 A;  3UY6 A;  3NC8 A;  5JYO A;  5GLB A;  2XK1 A;  2G2U A;  4KZ4 A;  5M1A A;  1KGG A;  3UE1 A;  3LCE A;  2ZM8 A;  3NBL A;  1HVB A;  2EFU A;  4OQI A;  1MY8 A;  4OLD A;  4DE1 A;  5A93 A;  4FH4 A;  4WZ5 A;  3IHB A;  4DKI A;  3W4O A;  5EOO A;  1PYY A;  1K6S A;  3VMA A;  2Y4A A;  1XGJ A; 
#chains in the Genus database with same CATH topology
 1NZU A;  1L0F A;  3GQZ A;  1BLC A;  3A0R A;  4F3L A;  3MXS A;  4GJ4 A;  1FIL A;  1E25 A;  3ZQ5 A;  3PYP A;  5L09 A;  2XFT A;  5G18 A;  4X69 A;  5EVI C;  2XDM A;  3V50 A;  4GNU A;  4WYY A;  4KZ8 A;  1KGF A;  1MKI A;  2HJE A;  5J8X A;  3BW6 A;  4PKY A;  2L4R A;  4MEZ A;  3KSI A;  4P87 A;  2VA0 A;  1N9L A;  3RXX A;  1K55 C;  1I2S A;  4IJG A;  5J4E A;  2VKS A;  3DTE A;  4WLA A;  3G34 A;  4I3J A;  1FCN A;  1N9O A;  4U0X A;  3JVU A;  1ES3 A;  4WEL A;  2DMW A;  4S2L A;  3K2N A;  4KZ5 A;  1ESI A;  3F1N B;  5FQM A;  4G3V A;  3S7Q A;  5EE8 A;  4K91 A;  1AXB A;  3OPR A;  1H5X A;  1IKG A;  4Y5F A;  3BFG A;  4EXO A;  2DCF A;  4LV3 A;  2Y55 A;  4MBF A;  1VB6 A;  3WRT A;  2PRF A;  3ZG0 A;  3MJQ A;  4E3I A;  2ZQ9 A;  4IUK A;  3MKE A;  5DKK A;  1DY6 A;  1OT9 A;  3QNC A;  2J3T D;  1TDG A;  1U60 A;  5DTK A;  1YLP A;  3LR4 A;  2GZA A;  3SH7 A;  5C5K A;  4KZ9 A;  4WZ4 A;  3RXW A;  3BFD A;  3NOP C;  2UV0 E;  1PI5 A;  2BTF P;  3DTM A;  3ZG9 B;  2HDU A;  2GJ3 A;  3G30 A;  4OKP A;  4BD0 A;  1TEM A;  1PZP A;  2WKR A;  2UWX A;  2IWB A;  3VFH A;  2A49 A;  5HSQ A;  1BYW A;  4O7D A;  1OJ5 A;  4WEK A;  3FWL A;  4IBR A;  1XJ6 A;  2YKH A;  5F1G A;  3IWO A;  4R1G A;  2W0N A;  3G4P A;  2OAQ 1;  1UGU A;  4Q0H A;  1TF1 A;  2A24 A;  2Y59 A;  4PM8 A;  4E04 A;  4ZJ1 A;  5HPF A;  1ESU A;  4L9F A;  1O07 A;  3S7P A;  3UPO A;  4DJ2 A;  1SKF A;  4K08 A;  3IHA A;  4DDS A;  2JKT M;  3NCK A;  4HES A;  2ZOH A;  2CMN A;  3T4K A;  4OQG A;  3KSF A;  2PYP A;  4YNR A;  4HP4 A;  4E3K A;  5MC7 A;  4IVI A;  1G6A A;  3QP1 A;  1V9Z A;  1W5D A;  4L9E A;  3O86 A;  1LL8 A;  4S2K A;  5FDH A;  3F1O B;  2ZOI A;  3ZVW A;  3W8K A;  1PFL A;  1WA9 A;  3HLD A;  3HUM A;  4JBF A;  5FQQ A;  3AGE A;  3EEH A;  4NEE D;  1NLY A;  1KGE A;  4F94 A;  3NDE A;  4JXW A;  5HZH A;  4E3N A;  1OTI A;  2ZQ7 A;  3SS4 A;  3IF5 A;  2HDR A;  4WUJ A;  1KE3 A;  1DJA A;  3G32 A;  4MBH A;  3IH9 A;  5CEC A;  4H6J A;  1A0K A;  5F83 A;  2ZLY A;  3V3S A;  4ZTK A;  4CLC E;  4DE3 A;  2W3D A;  1VET A;  4NXF A;  2ZC4 B;  3ISG A;  5AQ7 A;  5CEB A;  2LB9 A;  1L0D A;  3SH9 A;  3S7N A;  3IXD A;  2QHK A;  1QMF A;  3P01 A;  2EX6 A;  3TE8 A;  3MZD A;  3MS6 A;  2CC1 A;  2J9P A;  4WBG A;  2JHE A;  3HL9 A;  3N7W A;  1W63 M;  3MMH A;  2IWD A;  4PPR A;  4Y13 A;  3ZNT A;  3PBR A;  4Q0I A;  3C4P A;  1PIO A;  2WZZ A;  2ZC5 B;  3BRM A;  4RX2 A;  4G3W A;  1PW1 A;  2H10 A;  3FG8 A;  1TS6 A;  3FPW A;  4PAU A;  1GHM A;  3LGO A;  3VP0 A;  1X0O A;  4LLO B;  4OVD A;  4KUO A;  4IHQ A;  5GLA A;  4E6W A;  1MPL A;  3OPL A;  1W8Y A;  3GMW A;  1NJ4 A;  3O5Y A;  3QHY A;  3W2Z A;  2W27 A;  2HZ5 A;  2E8J A;  4GB7 A;  3PBN A;  3IS2 A;  4N1H A;  1L0G A;  1LI9 A;  1F9I A;  3GR2 A;  4FH2 A;  3WS0 A;  3V5M A;  3IBJ A;  2FFF B;  4G3K A;  2WAE A;  5FAT A;  4IUH A;  4IBX A;  3B3X A;  3IBR A;  3ITA A;  2OV5 A;  3UB8 A;  4UA7 A;  2W3E A;  5E2F A;  2JBF A;  1I5Q A;  3ZNY A;  4P85 A;  2Y2I A;  3NEC A;  5DF7 A;  3E0Y A;  1TS7 A;  1K57 C;  3CWF A;  1N9B A;  3NHQ A;  1XFN A;  5FDS A;  4X53 A;  3RTY A;  3PBO A;  4S2O A;  1HD8 A;  3RH8 B;  3UMD A;  3C7V A;  4EQ1 A;  3M6H A;  1GCE A;  4PM6 A;  4DXB A;  1KOU A;  2OWH A;  4KZ6 A;  4ZDX A;  3SS5 A;  5AVF A;  2E8I A;  3OLO A;  3WS5 A;  1YAX A;  4Y2F A;  5DF8 A;  3U4L P;  2KX6 A;  2XQZ A;  3UE6 A;  2EXB A;  1YLW A;  3BY8 A;  4KQQ A;  2QJ7 A;  4X56 A;  1XPB A;  4HOI A;  2ZJ9 A;  3WWX A;  1HLU P;  1OJG A;  1K54 A;  3OCN A;  1W63 Q;  2WAD A;  2XLN A;  1OTB A;  3MXQ A;  4WN5 A;  1RGZ A;  3OPP A;  2OLV A;  3BQ8 A;  1PWG A;  4B4Z A;  3O88 A;  3ZHH A;  4HH3 A;  4NG2 A;  3Q07 A;  3IXB A;  2Y2P A;  1J9M A;  1SKO B;  1ERQ A;  5HFO A;  3UY6 A;  3BQA A;  2XK1 A;  2G2U A;  4KZ4 A;  1KGG A;  1CQA A;  3L9K A;  4OLD A;  3KSG A;  4DKI A;  4LPZ A;  4PHT A;  3VMA A;  3IXH A;  4K0X A;  3PXP A;  2ZD8 A;  3IX3 A;  2ZC3 B;  1OTD A;  3T4J A;  4E3O A;  1EW0 A;  3H82 A;  5E2H A;  4IED A;  3BWL A;  5TBM B;  1ZG6 A;  3MZE A;  5IU1 A;  4OPZ A;  2V0U A;  3N8S A;  1RP5 A;  5DJU A;  5FQJ A;  3IWQ A;  4QHC A;  3O3V A;  2Y2H A;  2M7U A;  3UB5 P;  5DKL A;  2H28 A;  3K3D A;  3HLC A;  4XUX A;  5KIZ A;  1K25 A;  3NOU C;  3ZG7 B;  3E4Q A;  4EBP A;  3T12 B;  3HBR A;  3CJM A;  2WZX A;  2KDK A;  1ZTU A;  4X1L A;  1ES4 A;  1DP9 A;  2Y8H A;  4KZB A;  1BLP A;  3NOT C;  1F5M A;  4PM5 A;  3MZF A;  5AQA A;  3T50 A;  2Y79 A;  1S66 L;  1FCM A;  3EOI A;  1RGY A;  3H82 B;  3FKW A;  1IEL A;  3MQQ A;  1N4O A;  3L7H A;  1PRQ A;  3GVB A;  5U47 A;  2WKI A;  4WMC D;  3Q7Z A;  1JWV A;  4EW7 A;  3UDI A;  3ZFZ A;  1PWC A;  3CHW P;  3A0S A;  1YT4 A;  3LID A;  4WZ5 C;  3LEZ A;  5CX7 A;  4X25 A;  1BTL A;  1H8Z A;  1BLH A;  4U3T A;  4BMW A;  3JPU A;  1OPX A;  1ZG4 A;  4UQI M;  3BEC A;  1I2W A;  1EWZ A;  3KYZ A;  4M3K A;  2V2F F;  3LR5 A;  4R38 A;  3BEB A;  4S2N A;  2G2W A;  2VV6 A;  2M7V A;  3CAX A;  4RA7 A;  4DXC A;  1DJB A;  2XA7 M;  1KE4 A;  4S2P A;  1P9R A;  4EBL A;  1XKZ A;  5EVI D;  5HD3 A;  4DE2 A;  3HRE A;  4GD6 A;  1QME A;  3TSG A;  4EV4 A;  1Y28 A;  2HF6 A;  5DTS A;  1JTD A;  1FSW A;  3GSG A;  5KSC A;  3C5A A;  2OSU A;  4FCF A;  4DE0 A;  4JXS A;  3SS3 A;  1VHM A;  3A3J A;  2HP6 A;  4FUW A;  5FA7 A;  1S4R A;  4CQH A;  5L07 A;  4Y0O A;  2K2N A;  4S2N C;  3BLM A;  4EES A;  3KO6 A;  1YQS A;  3BFE A;  4JF6 A;  4NXG A;  1PWD A;  3GDI A;  4JF5 A;  1YSP A;  4PMA A;  4LRY C;  4H8R A;  4OQ0 A;  4A5R A;  3HLE A;  1V9Y A;  1ES2 A;  2VV8 A;  5FL3 A;  1K38 A;  4EQI A;  1YLT A;  3JVV A;  2Y2J A;  2Y2N A;  4N1X A;  3VOZ A;  4LRZ E;  4B88 A;  5EVI B;  5HD5 A;  3CIT A;  4MN5 A;  3H7W A;  5HDC A;  5IS1 A;  3S4X A;  4RQ9 A;  4JGO A;  3JYI A;  4ME4 A;  4R6L A;  2H0Y A;  1LLB A;  1OME A;  3HVF A;  3DWZ A;  4XT2 A;  5TJJ A;  4MBK A;  2VGJ A;  1NWZ A;  4GD8 A;  1F2K A;  1XFQ A;  4Y15 A;  4EUV A;  3FZC A;  3WS1 A;  3CLO A;  3PAE A;  2RL3 A;  1GHI A;  4LGW A;  4EEP A;  2V9A A;  3BJN A;  3UPP A;  4BWI A;  3OCL A;  4QWO A;  1VQQ A;  4WMC A;  1UWN X;  4OQH A;  2JKR M;  4JGR A;  4D60 A;  1DRM A;  5CGS A;  4DDY A;  2EX2 A;  4H6J B;  2ZQC A;  4UA6 A;  3CI6 A;  5BOH A;  2HGV A;  5HL6 A;  3G35 A;  3LO7 A;  3WRZ A;  2X71 A;  2K31 A;  4JPM A;  5F82 A;  3EGD C;  1YLY A;  3LFV A;  2Q0O A;  3P7N A;  2VGL S;  3IH8 A;  5EVI A;  1G68 A;  1CK3 A;  2OLU A;  2XA7 S;  4OP5 A;  2QPN A;  5CXW A;  4I3A A;  2R9W A;  1ONG A;  5TGF A;  4N92 A;  3E2K A;  1KVM A;  4ZRR A;  4HI4 A;  1O7E A;  5F1F A;  3ITB A;  3NJA A;  1VEU A;  2ZQD A;  1MBL A;  5HDS A;  4CLC B;  3R4K A;  1D06 A;  2A3U A;  4QU3 A;  4E3M A;  2PT7 A;  4E6X A;  2BAS A;  4ARZ A;  4DF6 A;  3CPT B;  3A3I A;  5KSH A;  2JCH A;  3VV4 A;  5CHU A;  3S1Y A;  5AJG A;  4CJN A;  4NK3 A;  4GHI A;  4P6B A;  4S2I A;  1KE0 A;  2WGV A;  4LEN A;  2C6W B;  2P9V A;  1W79 A;  2WKH A;  4C6Y A;  4R70 A;  2OWJ A;  3ULF A;  2X02 A;  1FSY A;  3VP3 A;  1JVJ A;  4JGQ A;  2V0W A;  4BBV A;  3IXG A;  1TDL A;  5HAI A;  3UE0 A;  2EFX A;  3Q82 A;  3G31 A;  2Y2Q A;  3QP6 A;  4LV1 A;  4GCZ A;  4ESP A;  4JKT A;  1XA1 A;  1LSV A;  3A3D A;  2H5S A;  3VE3 A;  4KQO A;  4GDN A;  4MCW A;  5J7E A;  2P74 A;  1HTZ A;  5CED A;  2QJ5 A;  3TW8 A;  1TS8 A;  2ZC6 B;  1H8Y A;  2DNS A;  4GLQ A;  1NRF A;  3RJU A;  1MWS A;  1XX2 A;  3PAG A;  2OAP 1;  2DRW A;  1CF0 A;  2GDN A;  2J80 A;  4LCM A;  4UAA A;  3V67 A;  4ARZ B;  2VGL M;  4KG5 A;  2HP5 A;  1M6K A;  3A3F A;  1FQG A;  1S4S A;  1T18 A;  2WGW A;  3T1Q B;  4WM9 A;  3QNB A;  3VSK A;  1T1A A;  4S2M A;  2B02 A;  1CJF A;  1K0K A;  5HL1 A;  3CUE A;  4UEY A;  4QJG A;  1C3B A;  4II7 A;  2RCX A;  3EQU A;  3FKV A;  2PAV P;  1MXO A;  4MMN A;  5JYO A;  3NC8 A;  5GLB A;  3UE1 A;  3LCE A;  4DE1 A;  1K6S A;  2Y4A A;  3FPV A;  4ZJ3 A;  3UB9 A;  2D02 A;  2QMI A;  2R9X A;  3QP2 A;  1L2S A;  3OZH A;  5HWT A;  3T1X A;  4NET A;  5A91 A;  3D9Y A;  5FQI A;  5FAO A;  4JGP A;  4GS9 A;  2JN7 A;  4JXG A;  1K56 D;  4R23 A;  2G7U A;  3TRC A;  4EET B;  3LR3 A;  5HW3 A;  5CTN A;  4MDZ A;  3HCY A;  2Z6C A;  2Z6D A;  3R7W B;  2XSS A;  4Q8I A;  2P04 A;  5TR7 A;  4OOL A;  2B95 A;  4FOF A;  5L2F A;  2D01 A;  3OPH A;  1YM1 A;  1IYS A;  3MXR A;  1EI5 A;  1DP6 A;  2INW A;  2L1M A;  2XRN A;  5DTT A;  3PBT A;  1SCW A;  2WKE A;  2VV7 A;  3QP8 A;  5D3O A;  3MSH A;  4E3J A;  1GA0 A;  3BLS A;  4QY5 A;  4YWZ A;  4F3L B;  4B9O A;  1G28 A;  2QZ6 A;  1LSW A;  2PU2 A;  2VZW A;  1GA9 A;  5DFX A;  1NYY A;  1SDE A;  1P0Z A;  2Y2G A;  4HH2 A;  3ZDJ A;  3ZGA B;  5HAP A;  5FSR A;  4KG6 A;  3NUL A;  1SHV A;  4B4X A;  1NZO A;  5EUA A;  3PR6 A;  4RX3 A;  4ZAM A;  2KLI A;  2PYR A;  3F1O A;  2PHY A;  2PD8 A;  4BQM A;  3QP5 A;  5GLD A;  4NXE A;  5A90 A;  3E4O A;  1JWP A;  4LRX C;  3M2K A;  3HJK A;  5F68 A;  4Y7P A;  3SH8 A;  3VE4 A;  3DTK A;  1FOF A;  4OOM A;  2PBY A;  2XRO A;  4RYE A;  3DTI A;  1D7E A;  1XP4 A;  4R4S A;  3LIC A;  4P0M A;  5HDD A;  3CMZ A;  4YFM A;  3P09 A;  1MWR A;  4LV2 A;  3OC2 A;  5EVE A;  5JYP A;  3DAV A;  1RCJ A;  3A0V A;  3MR0 A;  4MLL A;  3BYD A;  5HPI A;  2VX8 A;  1HZO A;  3B47 A;  3LY3 A;  1VM1 A;  2Y2O A;  1YKD A;  2I72 A;  4HBU A;  2WKQ A;  4QY6 A;  4O8G A;  2FH5 A;  1F98 A;  1K56 A;  3NI9 A;  4MN6 A;  3GV9 A;  5FEF A;  1IEM A;  3HJI A;  4BL3 A;  4KZ7 A;  5I94 A;  1OTA A;  5L8M A;  4U0T A;  2NUP C;  2B5R A;  3EEA A;  3HLB A;  3UB7 A;  4KUK A;  2HV1 A;  3QP4 A;  4YIN A;  1XA7 A;  1IOU A;  1FR6 A;  4HJ4 A;  2ZC7 A;  1VEU B;  2ZMV A;  4LFU A;  1Z09 A;  1G5U A;  4KQD A;  4O01 A;  3BY9 A;  5AVE A;  3C4O A;  3LIE A;  3HUN A;  3LI8 A;  2R78 A;  1W7F A;  3VOY A;  1YMX A;  3M6B A;  5HWW A;  4R4R A;  1YMS A;  4OPR A;  4EUZ A;  2IA2 A;  2V8F A;  4ZJ2 A;  1NRJ A;  1YLJ A;  3C2W A;  3HUO A;  1MWT A;  4BJP A;  3N4I A;  4I38 A;  3MFD A;  2H0T A;  4R3J A;  2JE5 A;  5GHZ A;  1BUE A;  4CPK A;  4EER A;  3HLF A;  3UDF A;  4WF0 A;  3A3E A;  5G4Z A;  5CRF A;  3IF6 A;  4Z9Q A;  3D3O A;  1JTG A;  4HIA A;  2XR0 A;  1PI4 A;  4OLG A;  3IX4 A;  5HAQ A;  1Q2Q A;  2V8C A;  2QYB A;  5EM0 A;  5F69 A;  1ERO A;  2VJW A;  3NDG A;  4HJ3 A;  4MNR A;  4ETZ A;  2WGW B;  4GN2 A;  1PW8 A;  3H9W A;  1FIK A;  4ID4 A;  1S0W A;  2J8Y A;  1SDN A;  4O0P A;  2Y2M A;  3KSH A;  5DVA A;  3LIA A;  2HDS A;  1DP8 A;  4XT2 B;  5I5L A;  4AFI A;  3T4T A;  4WEJ A;  2Z2M B;  4HJ6 A;  3BFF A;  1TD5 A;  5CHJ A;  2A24 B;  4EU0 A;  3U2A A;  3VSL A;  3UME A;  1LL9 A;  4GS9 B;  3D72 A;  2P7J A;  3CPT A;  3Q7V A;  1GHP A;  4BBT A;  3G6O A;  2O9B A;  4C75 A;  3BM6 A;  4HP9 A;  1L3L A;  4Y17 A;  3W4Q A;  2EX8 A;  1ES5 A;  1WYB A;  3S7O A;  2Z2L B;  3TJZ C;  4JLF A;  1CI8 A;  4OPQ A;  2BLS A;  1ALQ A;  2PR6 A;  1GSV A;  2XFS A;  1ODV A;  2AVX A;  3CG5 A;  1YSQ A;  4UHU A;  3NY4 A;  4S2J A;  3VP4 A;  3B42 A;  1TS0 A;  3P98 A;  3Q7V B;  2WYX A;  3HLG A;  4WL9 A;  1YLZ A;  2FZ0 A;  3UNW A;  3WS2 A;  4ETX A;  5GL9 A;  2V1B A;  2HPB A;  2Y91 A;  1N9N A;  3N8L A;  5CGW A;  5FAQ A;  3R7W A;  4GW9 A;  2J7V A;  3G2Z A;  3C30 A;  4HBT A;  1IKI A;  4I3I A;  1ACF A;  1HVB A;  1MY8 A;  2L0W A;  4HY8 A;  5A93 A;  4WZ5 A;  3IHB A;  3W4O A;  1H8M A;  1PYY A;  2LB5 A;  3B33 A;  4R3B A;  2W3F A;  3T1S A;  5E2G A;  2MJ6 A;  4FD8 A;  1LSX A;  5HX9 A;  2JKR I;  5F6A A;  2K7S A;  2XD5 A;  4IVK A;  1VET B;  3IF6 C;  3Q81 A;  1WYC A;  1CEG A;  4OOY A;  1SZV A;  4OP8 A;  3D4F A;  3FC7 A;  3KX0 X;  3IS2 B;  4FTX A;  1NLZ A;  1T1B A;  5KZH A;  5A8B A;  2ZBB A;  1NY0 A;  1KDS A;  1NYM A;  5TFQ A;  3UDX A;  2M1C A;  1P9W A;  1ZHH B;  5FQ9 A;  2V1Z A;  3E98 A;  2ACG A;  1LL5 A;  3LUQ A;  2ZMA A;  3H7W B;  4HEF A;  4L0L A;  3GEC A;  4KZA A;  4P6Z M;  1SKO A;  5CHM A;  1TVF A;  5KMW A;  1AWI A;  5EEC A;  3MBZ A;  2HJ9 C;  3UPN A;  2EWW A;  5AQB A;  4GKU A;  2W1T A;  4P6Z S;  4PM7 A;  3BFC A;  1IFQ A;  3DBA A;  5EVL A;  5DFY A;  3AGF A;  2XD1 A;  3LY4 A;  5TBM A;  4OON A;  4HNB A;  3EGX C;  4R0Q A;  5EPH A;  3G2Y A;  2KOI A;  1FCO A;  1ZKJ A;  2ZL1 B;  3FYZ A;  1E3U D;  4NXB A;  4BEN A;  2GX5 A;  1E4D A;  4YOF A;  3LYX A;  3IWI A;  3CZD A;  1S6R A;  4I5S A;  2WGI A;  3MFX A;  3GTC A;  5EOE A;  1STZ A;  2VLG A;  4BBU A;  2I9V A;  3T4S A;  1T19 A;  5CGX A;  2ZL1 A;  1Y54 A;  3C7U A;  4XUZ A;  4Y3I A;  5CER A;  4QD4 A;  1LI0 A;  2XH9 A;  1GSW A;  1ERM A;  2W3G A;  2ZM0 A;  5A92 A;  3DW0 A;  2EX9 A;  1OTE A;  5GHY A;  5CTM A;  2O99 A;  4OPY A;  5FI2 A;  3MQO A;  2FFY A;  3MKF A;  1UWP X;  1L0E A;  2WAF A;  3ZYT A;  4PKY G;  2A2L A;  4DN0 A;  3C8C A;  2O9C A;  2PBD P;  1BZA A;  3PHY A;  4LV0 A;  1NXY A;  3LI9 A;  4GHI B;  5G4Y A;  1W8Q A;  2JKT I;  4OH0 A;  4ZBE A;  3F1P A;  1M40 A;  3O87 A;  4L9G A;  4KQR A;  1Y4O A;  3KYQ A;  5M19 A;  2HDQ A;  4DMZ A;  1WE4 A;  5HWV A;  3UB6 A;  3IT9 A;  4DRT A;  4MN7 A;  5L10 A;  4EBN A;  5EFW A;  1LHY A;  1H3Q A;  3N8R A;  4C3Q A;  2C5W B;  2PR5 A;  1IYP A;  1JNU A;  3IF6 B;  3W4P A;  2VGK A;  1Z6F A;  2WK0 A;  2O0Y A;  3FV7 A;  5FAS A;  1BT5 A;  3VP1 A;  5EV0 A;  4RVA A;  5DJT A;  1OT6 A;  2W3H A;  3SOI A;  1H0M A;  1MWU A;  2ZMF A;  2JKF A;  1MZU A;  2W1T B;  5J3W A;  2Y2K A;  4GZB A;  2IWC A;  3CUE C;  1P97 A;  4M4X A;  5K5B A;  2P08 A;  1LT0 A;  4BD1 A;  4CLC A;  3IQA A;  3T1R A;  3C38 A;  5EM1 A;  3UO9 A;  4UQI S;  2XF3 A;  1IYO A;  1JWZ A;  5GLC A;  2PD7 A;  1S1Y A;  4N9L A;  4X6T A;  1T1C A;  3GRJ A;  1YPR A;  2Y2L A;  4NKP A;  1K57 A;  1K4E A;  2PU4 A;  4PM9 A;  1BSG A;  3UE3 A;  2HP9 A;  1E3U A;  5LBR A;  1GSX A;  3NIA A;  4Y0T A;  1BLS A;  3AGD A;  5FAP A;  4KEN B;  3PTE A;  3I7J A;  4KZ3 A;  2PDR A;  2J3T C;  4K0W A;  2J9O A;  3TOI A;  3IX8 A;  2WUQ A;  4I39 A;  1ZC2 A;  1D1J A;  4GDB A;  4Z1W A;  5FI6 A;  3V3R A;  2QWS A;  3F1N A;  2O9A A;  2ZM2 A;  1G6O A;  3EWK A;  1Q2P A;  2YKF A;  5E43 A;  4XXR A;  5HAR A;  2OOL A;  2EXA A;  3N6I A;  2B18 A;  2XGN A;  4HHD A;  2V1A A;  2Q9N A;  4B93 A;  4X55 A;  3T4Q A;  4GOG A;  5DF9 A;  4HQA A;  2EA9 A;  2WKP A;  3LIF A;  4KG2 A;  4BLM A;  3E4P A;  5FQK A;  1MKM A;  2BG1 A;  3UN7 A;  4QPR A;  1FR1 A;  3LIB A;  2EWV A;  1XXM A;  4UA9 A;  5FI7 A;  3ZG8 B;  2ZQ8 A;  2GNX A;  3F1P B;  3OOV A;  4X68 A;  2NUT C;  1PZO A;  1XJ4 A;  3MF0 A;  2ZQA A;  4R3A A;  4E3L A;  2VEA A;  1S1Z A;  3Q1F A;  4Q0J A;  1MC0 A;  3RFB A;  5M18 A;  2J3W A;  3EQV A;  5F5Y A;  3WS4 A;  3ZVT A;  5E2E A;  5IT5 A;  2V20 A;  3M2J A;  4QB8 A;  3LR0 A;  3T4L A;  1ONH A;  4DJ3 A;  2X01 A;  1KDW A;  3ZG5 A;  3LEQ A;  2JC7 A;  1K4F A;  1XJ3 A;  3K3C A;  3VOL A;  1XGI A;  4EWF A;  3KYE A;  4JXV A;  4X1M A;  1IYQ A;  1K55 A;  3PBS A;  1K6R A;  4BL2 A;  2JKG A;  3ZCZ A;  3T4O A;  3DWK A;  3ICY A;  3OBF A;  4D2O A;  1XJ2 A;  4Y0U A;  5GHX A;  1J3W A;  5IHV A;  4CLC D;  3PBQ A;  2XEP A;  5AQ9 A;  1DJC A;  2Q9M A;  3V39 A;  2P9V B;  1CEF A;  1PNE A;  3VFF A;  2QKP A;  3HLW A;  4CLC C;  3E2L A;  3VP2 A;  1K54 C;  4EEU A;  3MQ0 A;  3S22 A;  3TG9 A;  5FEG A;  2W1R A;  1KVL A;  1BUL A;  1CI9 A;  4FSF A;  4N9K A;  4JF4 A;  5M1A A;  2ZM8 A;  3NBL A;  3SW1 A;  3SZT A;  2EFU A;  4OQI A;  1S67 L;  4FH4 A;  5EOO A;  2VK3 A;  4LCL A;  1XGJ A; 
#chains in the Genus database with same CATH homology
 4K0X A;  4ZJ3 A;  1NZU A;  2QMI A;  2R9X A;  1L2S A;  3OZH A;  1L0F A;  3GQZ A;  1BLC A;  2ZD8 A;  4R3B A;  2ZC3 B;  4E3O A;  4NET A;  5A91 A;  5E2H A;  5E2G A;  4IED A;  3MXS A;  5FQI A;  4FD8 A;  5HX9 A;  5FAO A;  1E25 A;  1ZG6 A;  3MZE A;  4OPZ A;  3N8S A;  2XD5 A;  1RP5 A;  1K56 D;  2XFT A;  4IVK A;  4JXG A;  5FQJ A;  5G18 A;  4X69 A;  5EVI C;  2XDM A;  3IWQ A;  3IF6 C;  4QHC A;  4R23 A;  3V50 A;  4GNU A;  3O3V A;  3Q81 A;  1WYC A;  2Y2H A;  4WYY A;  4KZ8 A;  1CEG A;  4OOY A;  4OP8 A;  3D4F A;  1KGF A;  1MKI A;  3HLC A;  4XUX A;  5HW3 A;  1K25 A;  5CTN A;  3ZG7 B;  4EBP A;  5J8X A;  5KZH A;  1NY0 A;  4MEZ A;  4P87 A;  1KDS A;  3HBR A;  1NYM A;  5TFQ A;  4Q8I A;  3RXX A;  3UDX A;  3CJM A;  5TR7 A;  2WZX A;  4OOL A;  1K55 C;  1I2S A;  1ES4 A;  5L2F A;  4KZB A;  3G34 A;  5FQ9 A;  3OPH A;  1BLP A;  1FCN A;  2V1Z A;  1LL5 A;  4U0X A;  2ZMA A;  1YM1 A;  4PM5 A;  1ES3 A;  1IYS A;  3MXR A;  3MZF A;  4HEF A;  1EI5 A;  5AQA A;  4L0L A;  1FCM A;  4WEL A;  1RGY A;  4KZA A;  4S2L A;  5DTT A;  3PBT A;  3FKW A;  1IEL A;  4KZ5 A;  5CHM A;  1N4O A;  1ESI A;  1TVF A;  5FQM A;  5KMW A;  1SCW A;  2WKE A;  3GVB A;  5U47 A;  5EEC A;  5EE8 A;  5D3O A;  3MBZ A;  4K91 A;  2WKI A;  4E3J A;  1AXB A;  4WMC D;  3Q7Z A;  1JWV A;  3UPN A;  1GA0 A;  5AQB A;  3BLS A;  4GKU A;  3OPR A;  1H5X A;  4QY5 A;  3UDI A;  1IKG A;  4PM7 A;  3BFG A;  3BFC A;  3ZFZ A;  1PWC A;  2QZ6 A;  2PU2 A;  1YT4 A;  2DCF A;  4WZ5 C;  3LEZ A;  5EVL A;  1GA9 A;  4LV3 A;  1BTL A;  3AGF A;  2XD1 A;  2Y55 A;  4MBF A;  3WRT A;  1H8Z A;  1BLH A;  3LY4 A;  4U3T A;  3ZG0 A;  1ZG4 A;  1NYY A;  3BEC A;  4E3I A;  2ZQ9 A;  4OON A;  3MKE A;  1SDE A;  1DY6 A;  1I2W A;  1EWZ A;  4R0Q A;  4M3K A;  2Y2G A;  5EPH A;  3QNC A;  2V2F F;  3G2Y A;  3BEB A;  4S2N A;  1FCO A;  1ZKJ A;  1TDG A;  1U60 A;  3FYZ A;  3ZDJ A;  2G2W A;  1E3U D;  3ZGA B;  5FSR A;  5HAP A;  4BEN A;  5DTK A;  4KG6 A;  1E4D A;  1YLP A;  4RA7 A;  1SHV A;  4DXC A;  4B4X A;  1NZO A;  5EUA A;  3IWI A;  1DJB A;  3CZD A;  4RX3 A;  1KE4 A;  1S6R A;  4S2P A;  3SH7 A;  4EBL A;  1XKZ A;  5EVI D;  4DE2 A;  3HRE A;  2WGI A;  4GD6 A;  4KZ9 A;  3GTC A;  4WZ4 A;  4ZAM A;  3RXW A;  5EOE A;  3BFD A;  1QME A;  3TSG A;  5CGX A;  1PI5 A;  4EV4 A;  5DTS A;  1JTD A;  3DTM A;  1FSW A;  1Y54 A;  3ZG9 B;  3C7U A;  4XUZ A;  5CER A;  2HDU A;  4QD4 A;  3GSG A;  4BQM A;  3G30 A;  3C5A A;  4OKP A;  1LI0 A;  5GLD A;  5KSC A;  4BD0 A;  2XH9 A;  2OSU A;  4FCF A;  5A90 A;  1ERM A;  2ZM0 A;  5A92 A;  1JWP A;  1TEM A;  3DW0 A;  4DE0 A;  1PZP A;  4JXS A;  3SS3 A;  2EX9 A;  3M2K A;  2UWX A;  3A3J A;  2IWB A;  3VFH A;  2HP6 A;  5FA7 A;  2A49 A;  5GHY A;  4Y7P A;  5CTM A;  3SH8 A;  4O7D A;  4OPY A;  5FI2 A;  1FOF A;  4WEK A;  3FWL A;  4IBR A;  4Y0O A;  4OOM A;  2FFY A;  3MKF A;  4S2N C;  3BLM A;  2PBY A;  2WAF A;  1L0E A;  1YQS A;  5F1G A;  4RYE A;  3BFE A;  4JF6 A;  3IWO A;  4R1G A;  1PWD A;  1XP4 A;  3G4P A;  4JF5 A;  4R4S A;  2Y59 A;  4P0M A;  1BZA A;  4PM8 A;  4PMA A;  4ZJ1 A;  1ESU A;  3CMZ A;  4YFM A;  1O07 A;  4LV0 A;  4H8R A;  3P09 A;  3UPO A;  1NXY A;  4OQ0 A;  1MWR A;  4LV2 A;  3OC2 A;  1SKF A;  5JYP A;  3IHA A;  4DDS A;  4A5R A;  1RCJ A;  3HLE A;  3NCK A;  4HES A;  1ES2 A;  4OQG A;  1K38 A;  4MLL A;  3BYD A;  1W8Q A;  4EQI A;  4OH0 A;  4ZBE A;  1HZO A;  1YLT A;  3IXH A;  4E3K A;  1M40 A;  3LY3 A;  2Y2J A;  1VM1 A;  2Y2O A;  3O87 A;  4IVI A;  1G6A A;  2Y2N A;  4KQR A;  4N1X A;  3VOZ A;  2I72 A;  1W5D A;  4HBU A;  4QY6 A;  3O86 A;  4S2K A;  5M19 A;  1K56 A;  5FDH A;  3NI9 A;  4B88 A;  5EVI B;  2HDQ A;  3ZVW A;  1WE4 A;  3W8K A;  3HLD A;  3HUM A;  4JBF A;  3GV9 A;  5FQQ A;  3IT9 A;  3AGE A;  3S4X A;  1IEM A;  4BL3 A;  4KZ7 A;  5I94 A;  1KGE A;  4DRT A;  4U0T A;  3JYI A;  4F94 A;  3NDE A;  4JXW A;  4EBN A;  2B5R A;  3HLB A;  1LHY A;  4YIN A;  4E3N A;  2ZQ7 A;  1XA7 A;  3N8R A;  4C3Q A;  2C5W B;  2H0Y A;  1FR6 A;  1LLB A;  1IYP A;  1OME A;  2ZC7 A;  3SS4 A;  3IF5 A;  3HVF A;  3DWZ A;  2HDR A;  1KE3 A;  1DJA A;  3G32 A;  4MBH A;  3IH9 A;  4MBK A;  2VGJ A;  5CEC A;  3IF6 B;  5F83 A;  2ZLY A;  4GD8 A;  3V3S A;  3W4P A;  4ZTK A;  4DE3 A;  2VGK A;  1Z6F A;  2WK0 A;  3FV7 A;  5FAS A;  2ZC4 B;  3FZC A;  1BT5 A;  3ISG A;  5AQ7 A;  3WS1 A;  3PAE A;  3VP1 A;  5CEB A;  2RL3 A;  1L0D A;  3C4O A;  3SH9 A;  3HUN A;  1GHI A;  3IXD A;  1QMF A;  4RVA A;  1W7F A;  3VOY A;  3SOI A;  2EX6 A;  3UPP A;  1YMX A;  3MZD A;  1MWU A;  3M6B A;  2CC1 A;  2J9P A;  3OCL A;  4WBG A;  1VQQ A;  2Y2K A;  3HL9 A;  4GZB A;  2IWC A;  4WMC A;  4R4R A;  1YMS A;  3N7W A;  4OQH A;  2IWD A;  4PPR A;  4OPR A;  4BD1 A;  4EUZ A;  3IQA A;  5CGS A;  4DDY A;  3ZNT A;  3UO9 A;  4ZJ2 A;  2EX2 A;  2XF3 A;  3PBR A;  3C4P A;  1JWZ A;  1IYO A;  5GLC A;  2ZQC A;  4UA6 A;  1YLJ A;  1PIO A;  2WZZ A;  2ZC5 B;  5BOH A;  4N9L A;  4X6T A;  3BRM A;  3GRJ A;  4RX2 A;  2Y2L A;  1K57 A;  3HUO A;  1MWT A;  4BJP A;  1K4E A;  3G35 A;  2PU4 A;  1PW1 A;  3N4I A;  2H10 A;  3LO7 A;  3WRZ A;  4PM9 A;  3MFD A;  2X71 A;  4JPM A;  1BSG A;  3UE3 A;  2H0T A;  2HP9 A;  4R3J A;  5F82 A;  2JE5 A;  1E3U A;  1GHM A;  3VP0 A;  1YLY A;  4OVD A;  5GHZ A;  1BUE A;  4CPK A;  3HLF A;  3UDF A;  3NIA A;  4Y0T A;  5CRF A;  3A3E A;  4Z9Q A;  3IF6 A;  3IH8 A;  1JTG A;  5EVI A;  1BLS A;  3AGD A;  4KEN B;  5FAP A;  3PTE A;  3I7J A;  1G68 A;  1PI4 A;  2XR0 A;  4KZ3 A;  4OLG A;  1MPL A;  5GLA A;  4K0W A;  4E6W A;  1CK3 A;  2J9O A;  3OPL A;  3TOI A;  1W8Y A;  2WUQ A;  3GMW A;  1NJ4 A;  1Q2Q A;  2OLU A;  5HAQ A;  1ZC2 A;  4GDB A;  4OP5 A;  1ERO A;  5FI6 A;  3V3R A;  3NDG A;  2QPN A;  5CXW A;  3QHY A;  2ZM2 A;  2R9W A;  4MNR A;  1ONG A;  5TGF A;  4GB7 A;  3PBN A;  4N92 A;  3E2K A;  1KVM A;  1Q2P A;  2WGW B;  4N1H A;  5F1F A;  1O7E A;  5E43 A;  3ITB A;  4GN2 A;  1PW8 A;  1L0G A;  4XXR A;  2ZQD A;  5HAR A;  2EXA A;  3N6I A;  1MBL A;  2XGN A;  1LI9 A;  1S0W A;  2J8Y A;  4ID4 A;  1SDN A;  2A3U A;  4QU3 A;  4E3M A;  2Q9N A;  3GR2 A;  4E6X A;  4FH2 A;  3WS0 A;  2Y2M A;  4X55 A;  4GOG A;  5DVA A;  3V5M A;  4DF6 A;  2HDS A;  3A3I A;  5KSH A;  5DF9 A;  2FFF B;  4KG2 A;  2JCH A;  2WAE A;  5FAT A;  4BLM A;  5CHU A;  4IBX A;  5FQK A;  3S1Y A;  2BG1 A;  3B3X A;  3UN7 A;  4WEJ A;  3ITA A;  4CJN A;  1FR1 A;  4NK3 A;  2OV5 A;  2Z2M B;  4P6B A;  4UA7 A;  3BFF A;  4S2I A;  1KE0 A;  5E2F A;  1XXM A;  2JBF A;  4UA9 A;  1I5Q A;  5CHJ A;  2WGV A;  3ZNY A;  5FI7 A;  4P85 A;  3ZG8 B;  2ZQ8 A;  2Y2I A;  4LEN A;  5DF7 A;  2C6W B;  2P9V A;  1W79 A;  2WKH A;  4C6Y A;  3VSL A;  1LL9 A;  2X02 A;  4X68 A;  1FSY A;  3VP3 A;  1K57 C;  1JVJ A;  1PZO A;  1N9B A;  3Q7V A;  3IXG A;  1TDL A;  5HAI A;  1GHP A;  4X53 A;  3UE0 A;  3PBO A;  2EFX A;  3Q82 A;  2ZQA A;  4E3L A;  3G31 A;  4S2O A;  1HD8 A;  4C75 A;  2Y2Q A;  3BM6 A;  4LV1 A;  3Q1F A;  3C7V A;  3W4Q A;  2EX8 A;  4JKT A;  3M6H A;  5M18 A;  1XA1 A;  3A3D A;  3EQV A;  2H5S A;  1GCE A;  1ES5 A;  1WYB A;  3WS4 A;  4KQO A;  4PM6 A;  2Z2L B;  3ZVT A;  4DXB A;  5E2E A;  4JLF A;  1CI8 A;  4GDN A;  2V20 A;  4KZ6 A;  2P74 A;  3M2J A;  4OPQ A;  4ZDX A;  3SS5 A;  1HTZ A;  4QB8 A;  2E8I A;  5CED A;  2BLS A;  2ZC6 B;  1H8Y A;  2DNS A;  1ONH A;  1NRF A;  4LCL A;  2X01 A;  3WS5 A;  1KDW A;  1ALQ A;  5DF8 A;  3ZG5 A;  3RJU A;  2JC7 A;  1K4F A;  1MWS A;  1XX2 A;  3PAG A;  1XGI A;  4EWF A;  2XFS A;  2XQZ A;  2EXB A;  4JXV A;  2DRW A;  3CG5 A;  1IYQ A;  1K55 A;  3PBS A;  1K6R A;  4UHU A;  4BL2 A;  3ZCZ A;  2GDN A;  3NY4 A;  1YLW A;  4S2J A;  3VP4 A;  3DWK A;  4KQQ A;  4X56 A;  3P98 A;  3Q7V B;  4LCM A;  4UAA A;  2WYX A;  1XPB A;  3HLG A;  4D2O A;  2ZJ9 A;  4Y0U A;  3WWX A;  4KG5 A;  5GHX A;  2HP5 A;  1K54 A;  1M6K A;  3A3F A;  1YLZ A;  3OCN A;  5IHV A;  3UNW A;  3WS2 A;  2WAD A;  2XLN A;  3PBQ A;  2XEP A;  1FQG A;  1DJC A;  5AQ9 A;  2Q9M A;  3V39 A;  2P9V B;  1RGZ A;  3OPP A;  1CEF A;  5GL9 A;  2OLV A;  2WGW A;  1PWG A;  2HPB A;  4WM9 A;  3VFF A;  4B4Z A;  2Y91 A;  3O88 A;  3HLW A;  3QNB A;  3E2L A;  3N8L A;  3ZHH A;  5CGW A;  3VP2 A;  3VSK A;  4S2M A;  1K54 C;  5FAQ A;  5HL1 A;  3S22 A;  2J7V A;  3TG9 A;  3Q07 A;  3G2Z A;  1KVL A;  3IXB A;  4QJG A;  1C3B A;  1BUL A;  2Y2P A;  1CI9 A;  2RCX A;  3EQU A;  1J9M A;  3FKV A;  4FSF A;  1ERQ A;  4N9K A;  4HBT A;  1MXO A;  5HFO A;  1IKI A;  4JF4 A;  3UY6 A;  3NC8 A;  5JYO A;  5GLB A;  2XK1 A;  2G2U A;  4KZ4 A;  5M1A A;  1KGG A;  3UE1 A;  3LCE A;  2ZM8 A;  3NBL A;  1HVB A;  2EFU A;  4OQI A;  1MY8 A;  4OLD A;  4DE1 A;  5A93 A;  4FH4 A;  4WZ5 A;  3IHB A;  4DKI A;  3W4O A;  5EOO A;  1PYY A;  1K6S A;  3VMA A;  2Y4A A;  1XGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...