4CLCD

Crystal structure of ybr137w protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
172
structure length
172
Chain Sequence
b'MVVLDKKLLERLTSRKVPLEQLEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMAVSSLIAFANESL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0303 PROTEIN YBR137W
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 56
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcD00
4CLCB 4CLCA 2A2LA 5CX7A 4BMWA 4CLCC 4CLCD 4CLCE 4NKPA 3FPWA 3FPVA
chains in the Genus database with same CATH superfamily
4DE3A 2JHEA 2VKSA 2DRWA 4JLFA 2HPBA 5HSQA 1LHYA 4HY8A 3IX4A 4PM6A 3DW0A 3O88A 2KLIA 3H82A 3DAVA 4BD1A 5L07A 4R3AA 3GR2A 1LSXA 2FH5A 5FEFA 2O99A 1N4OA 2FZ0A 4JKTA 3JVVA 2EFUA 1MWSA 4MN6A 2BG1A 1KE4A 4L9FA 1ZKJA 2G2UA 4HHDA 1KOUA 4BJPA 3OPLA 4KZ7A 1GHIA 3P98A 1LLBA 3IF6C 5TFQA 5FAQA 4Z9QA 2QYBA 1STZA 3Q1FA 1YKDA 2K2NA 4QB8A 3QP6A 3AGEA 3G35A 3PBQA 1XPBA 3T1RA 2ZQ8A 3L9KA 3WRZA 1WE4A 3FC7A 4F3LA 2ZC7A 5GLDA 5IT5A 3N6IA 3MBZA 1IOUA 4DJ2A 2XQZA 3MFXA 3O3VA 3A0VA 4JGQA 3T50A 4YFMA 3ZDJA 2WK0A 3SW1A 4X53A 1C3BA 2FFFB 4UAAA 1K6RA 2R9WA 4ARZA 3BY8A 2QKPA 2KDKA 4P6BA 4HJ6A 1QMFA 4A5RA 1I2SA 5AQ7A 2Q9NA 2UWXA 4HJ4A 4IHQA 2GDNA 3MQOA 2V0WA 4OP8A 2V20A 4K08A 3MZDA 2HGVA 5DTKA 4EV4A 3MZFA 3G2ZA 4OQ0A 5EOOA 4PMAA 4GDBA 1VQQA 3HLEA 1NLZA 5DF7A 4X25A 1K0KA 1W7FA 4KZBA 3HJIA 4K0WA 2V1AA 4GB7A 3MZEA 3MR0A 3RJUA 2XRNA 5CGXA 1W63M 3UPPA 3DTEA 1LL9A 2Y2IA 2C5WB 3R4KA 3IXHA 1VEUB 3V50A 2J9OA 2QJ7A 3V5MA 4QY5A 4U0XA 1VB6A 3NDGA 3PXPA 4EBPA 1Y4OA 1JVJA 3TOIA 1GHPA 3DTIA 5C5KA 4FTXA 3N8SA 5DKLA 2EFXA 3LEZA 3H9WA 3G31A 4KZ6A 4JXVA 1P97A 5KSHA 1K56A 3IHBA 1L0DA 4HP9A 4BLMA 4HIAA 2J3WA 3B42A 2WKEA 3NOPC 5E43A 1Q2PA 1BLPA 1ZG6A 4JBFA 4YWZA 5FSRA 2Y2JA 3M2KA 1W5DA 4P6ZM 2V8FA 1MZUA 1IFQA 3MJQA 3S7QA 3BWLA 4L0LA 5G4ZA 2DNSA 2R78A 2Z6CA 2W1TB 2BLSA 3ZG0A 3V3RA 3KYZA 3HLGA 5FL3A 2RCXA 2O9AA 2W1RA 3BQAA 4MBFA 5TR7A 1DP8A 2V8CA 4ZJ3A 3ZHHA 4KQOA 2PRFA 2E8IA 1CJFA 3VMAA 2W3GA 5G4YA 3C2WA 3ZGAB 1T19A 5TBMB 2J3TD 3NHQA 5HAQA 1SDNA 3JPUA 3UE6A 1F2KA 4OPZA 1F9IA 1K4EA 5J8XA 2OOLA 3C30A 4LCLA 3IXGA 1Y54A 2O9CA 1G6OA 5HWTA 2PBDP 3NY4A 4CJNA 1K57C 4UQIM 3LI9A 1YT4A 3N8RA 3M6HA 3HLCA 2A24B 2GX5A 3Q81A 1P9WA 3OLOA 4LV0A 5AQAA 2ZOHA 1MPLA 1F98A 1ONGA 3KSIA 3MXSA 1KDSA 2P08A 2W27A 1TD5A 2M7VA 1K6SA 3T1XA 1NYYA 4NK3A 4BBUA 3IX8A 3SS3A 3F1PA 2I72A 1L0FA 1T1BA 1YQSA 2B02A 2KX6A 1TDGA 3B33A 2GJ3A 2WGVA 4ZAMA 4Y15A 3HREA 1SHVA 2IWBA 2JE5A 3N8LA 2VLGA 1PWDA 4O8GA 3HJKA 1O07A 4L9EA 4KUOA 3IXDA 3PBSA 2OSUA 2J7VA 4ZJ2A 4S2KA 4FH4A 1G68A 3CHWP 3QP4A 5BOHA 3C7VA 1YMXA 3UE1A 5HFOA 2Y79A 3K3DA 4IBXA 4DE0A 3V39A 1SKFA 5A90A 1IKGA 3LY4A 3OZHA 4MEZA 2ZL1A 2VZWA 4L9GA 3ZCZA 3F1NB 3ZG7B 2YKFA 2XH9A 3RFBA 4GS9B 5DJUA 4R0QA 2ZMFA 1OTAA 1JNUA 1S6RA 2VJWA 1S4SA 1JTGA 2PAVP 2PHYA 3GVBA 3CAXA 3RXXA 3MMHA 1TS8A 4CLCB 3BEBA 1JWVA 3OCLA 4Y17A 1VETA 2ZQ9A 3HLDA 1CEFA 2JBFA 3VP1A 5A91A 1BLHA 4S2NC 4PPRA 3ULFA 1OMEA 4EETB 3LIBA 4N1HA 3B3XA 3G6OA 2P74A 1OJ5A 3DTKA 1U60A 4R4SA 4C6YA 4LGWA 1FCNA 3VE4A 3QHYA 3ITBA 4R38A 4GNUA 4DF6A 1ERMA 1PNEA 1GA0A 3G2YA 4BBTA 4GCZA 5U47A 1XGIA 2Y2HA 1K55C 3M6BA 3WS0A 5F82A 1RGYA 1XFQA 3S1YA 5JYOA 3EGDC 1L0GA 3NC8A 1OTBA 3MS6A 1DJCA 1AWIA 3D3OA 3T1SA 4HBUA 2WADA 2ZM2A 3KSGA 4NXGA 3JYIA 4R3BA 3TSGA 1K54A 1PWCA 2Q9MA 4JXGA 2Y59A 4WN5A 3UDIA 4ETZA 4IVKA 5TJJA 3ZVWA 3KSHA 4MNRA 2Y91A 2EA9A 1XJ6A 1EI5A 5KIZA 4PM9A 3IS2B 4LFUA 4LLOB 5JYPA 3UE3A 1G5UA 4GLQA 4WLAA 4Q0IA 4X1LA 5HD3A 3LIEA 4R6LA 1YLYA 1D7EA 3GTCA 4MCWA 4D60A 2PD7A 3QP1A 5I94A 5CHMA 1GSXA 4GJ4A 1WA9A 2ZC4B 1GSWA 3S22A 4YNRA 1ES3A 2QJ5A 1N9BA 4QWOA 2V2FF 4E3NA 4XT2B 2QPNA 3QNBA 3S7PA 1BULA 3LR5A 2ZQDA 4H6JB 4DN0A 2G2WA 2X02A 1D06A 3UMEA 4GZBA 2EWVA 4QJGA 3UB7A 3Q7VA 3O87A 3VOZA 3EOIA 2VV8A 4XXRA 4E3KA 3EQVA 2V1ZA 3EEHA 4HJ3A 4C75A 2V0UA 1YLTA 3D9YA 5CHJA 3WS5A 4WF0A 1K55A 1XJ4A 2AVXA 4EESA 2WGWA 4E6WA 3ZFZA 2PYRA 4E3MA 4HESA 2Y2LA 5J7EA 1EW0A 4JGOA 5LBRA 1SZVA 5KZHA 2ZJ9A 1FSWA 1H3QA 3NOUC 1TS6A 2L4RA 2J8YA 3GSGA 4P85A 4B4ZA 1FIKA 2VGJA 5EM1A 2P9VA 2UV0E 4NXEA 4LPZA 3KYEA 4Q0HA 3NOTC 4G3WA 4GN2A 3KX0X 3VFHA 1NRJA 5EVLA 3F1OA 3CZDA 4MN5A 4NXFA 3JVUA 5TGFA 2WUQA 1XKZA 5L8MA 5DTSA 4ARZB 2ZOIA 3LR0A 5HAPA 3OBFA 5IHVA 1JTDA 3B47A 1IYQA 3SZTA 5CERA 3GMWA 2CMNA 3P01A 3UPOA 3ZNTA 5IU1A 4OQHA 4HI4A 1ESUA 2HP9A 2OWHA 1ESIA 2V9AA 5EUAA 2RL3A 3BLMA 2H0TA 4KZ9A 4BENA 2X71A 2Y55A 5HPIA 4DRTA 4UA7A 3K2NA 1HTZA 3O5YA 4KQRA 2XK1A 5FQJA 2Y2OA 3UY6A 5HWVA 1HZOA 5FQQA 4XUZA 1M6KA 3VOYA 2J80A 3SH9A 1IKIA 1XP4A 2VV6A 4BBVA 3WRTA 5L09A 4EW7A 5E2HA 4GKUA 3BM6A 4Y13A 2OV5A 1IEMA 2I9VA 3FPWA 1BLSA 3H7WA 3WWXA 3CUEC 3A3FA 5EVEA 1E3UD 3UO9A 2VGLS 2XLNA 4YINA 1OPXA 5CXWA 2XR0A 1N9OA 4O7DA 4E6XA 1IYSA 5EVID 5HL6A 1HD8A 5AVFA 3CG5A 5CRFA 4ME4A 4ETXA 2QMIA 4K0XA 4KZ3A 5E2EA 4WZ5C 3FG8A 1PYYA 1YLJA 4BWIA 4P87A 3LI8A 3ZG9B 2QWSA 4RVAA 2LB5A 1ZG4A 4GHIB 2HF6A 3WS1A 3HLFA 2OLVA 5M1AA 1JWPA 1FCMA 3LICA 2VA0A 2JCHA 3HUNA 5MC7A 5FDSA 4LRXC 4LENA 1JWZA 3IF6A 1H8YA 5AVEA 2HJEA 5EOEA 1DJBA 4HEFA 5F83A 1PW8A 1N9NA 1NYMA 2WKHA 4I3AA 3NCKA 4JXSA 3W8KA 1NZOA 2W3HA 3UB8A 5CX7A 1MWTA 3LFVA 4Y0TA 3DTMA 1BT5A 1D1JA 4LV3A 1Q2QA 4LV2A 1XA1A 3E0YA 2ACGA 5J3WA 1K38A 1FSYA 4I38A 4QU3A 3ZVTA 3PBTA 1YSQA 3IX3A 2WZZA 5GLBA 4KG2A 1BLCA 2ZQAA 3FKWA 2JKRM 4N9KA 1BZAA 4IEDA 2WKQA 1KGGA 1WYCA 1T18A 3NECA 5EVIB 1W63Q 3E98A 3EGXC 1LL8A 3W4OA 1PWGA 2W3DA 2X01A 1DJAA 4FOFA 5EE8A 3IBRA 1PZOA 1MWUA 4R3JA 3IH9A 3QP2A 2OAP1 4M3KA 4H8RA 4CLCD 1YM1A 2FFYA 3T1QB 3OPRA 4IBRA 2QZ6A 3IHAA 4B9OA 5FI6A 3VE3A 2ZL1B 2W3EA 2WYXA 2PD8A 4JF6A 4JF4A 1PIOA 3UE0A 3KSFA 2LB9A 4WM9A 4I39A 4WEKA 1O7EA 3PYPA 4HBTA 4MBKA 4X68A 1IELA 1MY8A 3GV9A 1PW1A 2HV1A 2W1TA 3KO6A 2H0YA 1VETB 3SH7A 3DWKA 3NBLA 5KSCA 2EXBA 2JKFA 3LIFA 2K7SA 5FQMA 3GECA 1CF0A 3ICYA 3BYDA 3WS2A 2INWA 3A3DA 1PI5A 1Y28A 1GSVA 2B95A 1NY0A 3CPTA 2J3TC 2G7UA 3T12B 1OTEA 4LV1A 4G3KA 4Y5FA 2WZXA 1YAXA 5CEDA 3T4TA 4HNBA 2PU4A 5CTNA 1MXOA 2Y2MA 3ZQ5A 5DKKA 3VV4A 2OLUA 4CLCC 5F1FA 1FOFA 2CC1A 1Z6FA 1DP6A 4CLCE 4I3IA 2VX8A 5DFXA 1YPRA 3BFEA 3ZYTA 1LI0A 1G28A 5CTMA 1BYWA 4DXCA 3ZNYA 3MQQA 1ZC2A 2IWDA 4GOGA 1SDEA 2QHKA 4KZAA 5FASA 2ZC3B 3ZG8B 4S2OA 5D3OA 4R4RA 4IUHA 2GNXA 2B18A 1ES4A 2EX8A 1K57A 2PDRA 3W4PA 1CEGA 1H8MA 2BTFP 5EM0A 3G4PA 1MWRA 2XA7S 1K25A 1G6AA 2XD1A 1KDWA 3AGFA 3SH8A 5A92A 4WMCD 1FCOA 2Y8HA 2Y2KA 4YOFA 2Z2LB 1BTLA 4FCFA 1OTIA 1BSGA 3RTYA 4WELA 3MXRA 4EUVA 3OPHA 1IYPA 4MDZA 3BJNA 4UHUA 4B93A 1KGFA 2ZQCA 5DF8A 5AJGA 4DXBA 3PTEA 3LYXA 3OPPA 4NXBA 3UPNA 4PKYA 2Y2GA 3V3SA 4X56A 1NJ4A 4II7A 2WAEA 4E04A 3G34A 3CI6A 3F1NA 3N4IA 1SKOA 4X55A 2JKGA 3Q7VB 3HL9A 4KUKA 3HBRA 2ZQ7A 5HW3A 2EXAA 5EFWA 2JKTI 5HDSA 4JF5A 4DE2A 2IWCA 5DF9A 5DTTA 4N1XA 2ZMVA 1CI8A 4UEYA 1EWZA 2NUTC 4DJ3A 3OCNA 4Z1WA 4LRYC 3R7WA 1ONHA 4PKYG 2WKRA 5HWWA 3SOIA 4ZDXA 1HLUP 2JN7A 3VP2A 4E3IA 4EBLA 4LRZE 5HZHA 2P9VB 4GD8A 3T4JA 4WYYA 1XA7A 4S2NA 1OJGA 5GL9A 5CECA 2A49A 4DMZA 2Y2QA 1Z09A 4S2IA 3F1OB 3HCYA 2O9BA 5FA7A 3H82B 1LSVA 2P7JA 2Z6DA 3FV7A 5GHXA 2PU2A 4JGPA 2Z2MB 4HQAA 5KMWA 4KENB 2W3FA 2HZ5A 5L10A 3K3CA 5EECA 3LR4A 3C8CA 3LGOA 1N9LA 2L0WA 4RX2A 3IS2A 3BW6A 1XX2A 3IQAA 3VSKA 4HOIA 1T1CA 3O86A 4PM7A 4QHCA 4WZ4A 3LY3A 3IXBA 1KE0A 3MSHA 3PBRA 1K56D 2D02A 4F3LB 4R1GA 2DCFA 1OT6A 2E8JA 2XGNA 3LIAA 4EQIA 4X1MA 5EPHA 3C4PA 4OLDA 4BL2A 4OKPA 1PRQA 3N7WA 2ZM0A 1CQAA 4DDSA 5HARA 3IF5A 3PHYA 3PBOA 2NUPC 2ZC6B 1E4DA 1ALQA 4OLGA 4Y3IA 1H0MA 1E25A 4H6JA 2K31A 4WMCA 4KZ8A 4O01A 2OAQ1 4OONA 4EEUA 3VP0A 1RCJA 3A0SA 3ISGA 1FILA 3UB5P 3TW8A 3Q07A 4QY6A 3H7WB 4U0TA 3UB9A 1L3LA 1UWPX 3BFDA 1P0ZA 3D4FA 5F5YA 3T4LA 1W79A 1P9RA 1DRMA 5M19A 3C5AA 2PR6A 2HP5A 4Q0JA 1LL5A 1X0OA 3OC2A 5HL1A 1LT0A 1I2WA 1KE3A 1RP5A 4WEJA 5E2FA 2EX9A 4E3OA 4KQQA 3TJZC 2C6WB 3BECA 3TE8A 2L1MA 1BUEA 4X6TA 1ZTUA 3WS4A 2XF3A 1ES2A 1GCEA 1TVFA 5GLCA 4PAUA 3VP3A 3IF6B 4JPMA 4WL9A 4MMNA 2ZLYA 4EERA 5E2GA 3BQ8A 4OVDA 2Y2NA 2Q0OA 4WUJA 2YKHA 1OT9A 3TG9A 1UWNX 3UDXA 3TRCA 3BFFA 5J4EA 2VGLM 4MBHA 4DDYA 2XFTA 4ID4A 3W2ZA 4RYEA 2DMWA 2WGIA 3IBJA 3PAEA 2J9PA 2ZBBA 4ZTKA 1YLPA 4OOYA 3HUMA 4KG5A 2XROA 3QP8A 3P09A 5AQ9A 5AQBA 3Q82A 3LCEA 1HVBA 3M2JA 3NI9A 4EEPA 1ZHHB 2JKTM 3MKFA 4ZBEA 3L7HA 1FQGA 2A3UA 3MKEA 1XGJA 3T4KA 3MFDA 3CWFA 3A3JA 1J9MA 4HH2A 4LCMA 2JC7A 4ZRRA 3SS5A 2B5RA 3UB6A 1TDLA 3S7OA 5CGSA 3C4OA 3CITA 4BL3A 4NKPA 5FEGA 5FAOA 1XFNA 4GW9A 1F5MA 3Q7ZA 3MQ0A 2H5SA 4CQHA 2VEAA 3GDIA 5FI7A 1W8YA 1UGUA 1H5XA 5CHUA 1OTDA 1S67L 2ZM8A 2XDMA 5EVIC 5FQKA 4OP5A 4P6ZS 3NDEA 4FH2A 4MN7A 4DE1A 4RQ9A 1MC0A 4OOLA 3U2AA 3F1PB 5EV0A 5HDCA 3CUEA 1K4FA 4I5SA 2WAFA 3A3EA 3A0RA 1H8ZA 1V9ZA 3E4PA 4GHIA 4OQGA 2XEPA 3AGDA 2VV7A 4WBGA 1QMEA 1VEUA 2ZMAA 5FAPA 1TEMA 3PBNA 3BFGA 4OOMA 5F6AA 1MKMA 3CPTB 2EWWA 1PI4A 3IWQA 4B4XA 3FZCA 4WZ5A 4Q8IA 4OQIA 2XD5A 2OWJA 1PFLA 3BLSA 4QD4A 1DP9A 1TS0A 2H28A 4UA9A 5DJTA 2HJ9C 1S1ZA 4M4XA 2VK3A 2KOIA 3D72A 4UQIS 3HVFA 3GRJA 1YLWA 3U4LP 4EWFA 3LEQA 2WKIA 5CEBA 4IJGA 2D01A 5HDDA 2HDSA 2XFSA 4B88A 2W0NA 2ZC5B 3NIAA 4Y7PA 3IH8A 5FQIA 3FKVA 2BASA 5FDHA 3RXWA 1W8QA 3E4QA 1T1AA 5HD5A 1E3UA 2PBYA 2P04A 4UA6A 5DFYA 4S2JA 1CK3A 1S0WA 4P0MA 3W4QA 1KGEA 5EVIA 1S66L 2XSSA 1GHMA 1YLZA 5TBMA 1S1YA 4NEED 4OPRA 1ES5A 3EWKA 3FPVA 4DKIA 4E3LA 1K54C 1L2SA 4FUWA 3T4OA 3LIDA 2IA2A 2Y2PA 2WKPA 1RGZA 3VOLA 4S2LA 4ZJ1A 4MLLA 3BRMA 4Y0UA 3HUOA 3VSLA 2A24A 1NXYA 5FI2A 2HDUA 1YMSA 3NULA 3BFCA 3MF0A 1SKOB 3VFFA 3DBAA 3E2KA 3CLOA 5DVAA 4Y2FA 1SCWA 3LO7A 3DWZA 2MJ6A 2XA7M 1FR6A 4AFIA 3IT9A 1ACFA 3I7JA 4C3QA 4I3JA 5G18A 5L2FA 3S7NA 5HPFA 3A3IA 1NLYA 2PR5A 3R7WB 3V67A 2Y4AA 3VP4A 4XUXA 2VGKA 1EROA 3OOVA 2ZD8A 1TF1A 2EX2A 1LI9A 2M7UA 3KYQA 1L0EA 1VHMA 5IS1A 4RX3A 1M40A 1XJ2A 4ESPA 4PM5A 4QPRA 4OPQA 2O0YA 5F68A 1MKIA 4F94A 5FATA 2PYPA 2EX6A 4GS9A 1GA9A 5CGWA 1AXBA 3T4SA 1PZPA 2A2LA 3P7NA 1ERQA 1TS7A 3QNCA 4JGRA 4NG2A 4CLCA 4N92A 1I5QA 1CI9A 4U3TA 3T4QA 5A8BA 2WGWB 2GZAA 4OPYA 2HDRA 3G30A 3FWLA 4R23A 4EBNA 4N9LA 1LSWA 1V9YA 3HLBA 5GHZA 1VM1A 1S4RA 3PR6A 2HP6A 2M1CA 3IWIA 1NWZA 4KZ5A 5A93A 3E4OA 3HLWA 3NJAA 3IWOA 3UDFA 4Y0OA 3BY9A 4BMWA 1IYOA 4R70A 2V1BA 4KG6A 4X69A 3SS4A 4EU0A 2R9XA 4IVIA 4E3JA 5M18A 5F69A 1A0KA 3E2LA 3CJMA 4GD6A 1FR1A 1WYBA 4S2PA 4K91A 1KVLA 3ITAA 4HP4A 3UMDA 3RH8B 4FD8A 4KZ4A 3EQUA 3QP5A 3UNWA 4GDNA 4BQMA 3GQZA 4EUZA 2HDQA 4NETA 4S2MA 3ZG5A 4PHTA 4EQ1A 5HAIA 4RA7A 1NZUA 3C38A 2JKRI 1KVMA 2PT7A 4PM8A 3G32A 3PAGA 4FSFA 5HX9A 3S4XA 3CMZA 3LR3A 3UN7A 5GHYA 4IUKA 4KQDA 3FYZA 1DY6A 4BD0A 3EEAA 1XJ3A 5I5LA 3LUQA 2H10A 1YSPA 4HH3A 4OH0A 3MXQA 4G3VA 1ODVA 5F1GA 1NRFA 4EXOA 4CPKA 4JXWA 1XXMA 1J3WA 3C7UA 4O0PA 4D2OA 5FQ9A 4XT2A 5GLAA 1MBLA 5K5BA
chains in the Genus database with same CATH topology
4ZRRA 2HV1A 3UB6A 2W1TA 3KO6A 2JHEA 2VKSA 4WN5A 5HSQA 3S7OA 3LIFA 4HY8A 5TJJA 4ETZA 2K7SA 3GECA 3ICYA 3KSHA 2KLIA 3H82A 2INWA 4R3AA 2EA9A 1XJ6A 3CITA 1LSXA 1Y28A 2FH5A 4NKPA 1GSVA 5KIZA 2O99A 3IS2B 4LLOB 1XFNA 2J3TC 2FZ0A 2G7UA 3UE3A 3JVVA 4GW9A 4MN6A 1OTEA 4GLQA 4G3KA 1F5MA 4Q0IA 4WLAA 3MQ0A 4Y5FA 3LIEA 4L9FA 5HD3A 4HHDA 1YAXA 1KOUA 4CQHA 4BJPA 2VEAA 3GDIA 4R6LA 3T4TA 1D7EA 1UGUA 4HNBA 4MCWA 1OTDA 1S67L 3ZQ5A 2PD7A 5DKKA 3VV4A 4CLCC 1GSXA 4GJ4A 1WA9A 1GSWA 2QYBA 1DP6A 1STZA 1YKDA 2K2NA 4CLCE 4I3IA 2VX8A 5DFXA 4P6ZS 4YNRA 3ZYTA 4MN7A 2QJ5A 1G28A 4XT2B 3PBQA 4RQ9A 1MC0A 4OOLA 3S7PA 1BYWA 3U2AA 3F1PB 3LR5A 3FC7A 3MQQA 4H6JB 5HDCA 3CUEA 4DN0A 4F3LA 4I5SA 5IT5A 3A0RA 2QHKA 1D06A 3UMEA 1IOUA 4DJ2A 1V9ZA 3MFXA 2EWVA 4IUHA 3A0VA 2GNXA 2B18A 4JGQA 3E4PA 3UB7A 3T50A 4GHIA 2PDRA 2VV7A 3EOIA 3SW1A 1H8MA 2VV8A 2XA7S 3EQVA 3PBNA 4OOMA 5F6AA 1MKMA 2EWWA 3EEHA 4HJ3A 2V0UA 4ARZA 4WF0A 2Y8HA 3BY8A 4YOFA 2QKPA 1XJ4A 2KDKA 4HJ6A 4EESA 1OTIA 3RTYA 4WELA 4HJ4A 4IHQA 3MQOA 2OWJA 2PYRA 4EUVA 2V0WA 1DP9A 5J7EA 1TS0A 1EW0A 3BJNA 2H28A 4K08A 4JGOA 4MDZA 5DJTA 2HJ9C 5LBRA 4B93A 1S1ZA 4M4XA 2KOIA 2HGVA 3D72A 4UQIS 5AJGA 1H3QA 3LYXA 3NOUC 1TS6A 2L4RA 4IJGA 4NXBA 1NLZA 4PKYA 2D01A 5HDDA 4NXEA 4II7A 4E04A 3HJIA 2V1AA 4LPZA 3MR0A 4Q0HA 2XRNA 3CI6A 3F1NA 2W0NA 3NOTC 1W63M 4G3WA 3KX0X 4KUKA 2BASA 1NRJA 3F1OA 3R4KA 4MN5A 4NXFA 3E4QA 5EFWA 1T1AA 2QJ7A 3JVUA 5HD5A 2JKTI 5HDSA 2P04A 5DF9A 1VB6A 5L8MA 5DFYA 3PXPA 4ARZB 2ZOIA 3LR0A 3OBFA 3B47A 2ZMVA 4UEYA 5C5KA 1S66L 2XSSA 2CMNA 5DKLA 5TBMA 3H9WA 3P01A 1S1YA 2NUTC 4NEED 4DJ3A 1P97A 5KSHA 3OCNA 5IU1A 4Z1WA 3EWKA 3FPVA 4HP9A 4HI4A 4LRYC 3R7WA 4HIAA 3T4OA 2J3WA 2OWHA 3B42A 4PKYG 3NOPC 3LIDA 2V9AA 2WKRA 5HWWA 2IA2A 2WKPA 4YWZA 2JN7A 3VOLA 4P6ZM 4LRZE 1MZUA 1IFQA 5HZHA 5HPIA 3MJQA 3S7QA 3T4JA 3BWLA 2A24A 4L0LA 5G4ZA 3K2NA 1OJGA 2R78A 2Z6CA 2W1TB 3MF0A 4DMZA 3O5YA 3KYZA 3DBAA 5FL3A 2O9AA 3CLOA 2W1RA 4Y2FA 3F1OB 3HCYA 2O9BA 3H82B 1LSVA 3BQAA 2P7JA 5HWVA 1DP8A 2MJ6A 2Z6DA 4KQOA 2XA7M 2W3GA 5G4YA 4AFIA 2J80A 3C2WA 2VV6A 1T19A 4BBVA 4JGPA 4EW7A 5TBMB 2J3TD 3NHQA 4I3JA 4HQAA 3S7NA 5HPFA 3UE6A 1NLYA 2I9VA 2PR5A 3FPWA 3H7WA 2W3FA 3R7WB 3V67A 1F9IA 3CUEC 3K3CA 3LR4A 2OOLA 3C8CA 3OOVA 3C30A 1TF1A 2VGLS 1N9LA 2O9CA 2L0WA 3IS2A 3BW6A 1G6OA 5HWTA 2M7UA 4HOIA 1OPXA 1N9OA 3KYQA 1T1CA 4UQIM 3LI9A 5HL6A 1VHMA 5AVFA 5IS1A 4ME4A 3PBRA 2A24B 4ETXA 2D02A 4F3LB 2GX5A 1XJ2A 1P9WA 4QPRA 1OT6A 3OLOA 2O0YA 3FG8A 4BWIA 5F68A 3LIAA 2ZOHA 3KSIA 1F98A 3LI8A 2P08A 2QWSA 2W27A 1TD5A 2PYPA 2LB5A 4GS9A 2M7VA 4GHIB 2HF6A 3PHYA 3PBOA 2NUPC 4BBUA 3T4SA 3P7NA 2A2LA 3LICA 3F1PA 4Y3IA 2VA0A 1TS7A 4JGRA 4H6JA 2K31A 1T1BA 5MC7A 4O01A 2OAQ1 2B02A 2KX6A 4LRXC 4CLCA 3B33A 2GJ3A 3T4QA 5AVEA 2HJEA 4EEUA 5A8BA 3A0SA 2GZAA 2VLGA 3TW8A 1N9NA 3UB9A 3H7WB 4O8GA 3HJKA 4I3AA 1UWPX 2W3HA 3UB8A 1LSWA 1V9YA 5CX7A 1P0ZA 4L9EA 4KUOA 3PBSA 5F5YA 3T4LA 1S4RA 3LFVA 3PR6A 2M1CA 1P9RA 1DRMA 1NWZA 2Y79A 3K3DA 2PR6A 4Q0JA 3E4OA 1X0OA 3OC2A 1LT0A 3NJAA 4WEJA 3BY9A 4BMWA 2VZWA 4L9GA 3E0YA 4R70A 3F1NB 5J3WA 2V1BA 3TJZC 2YKFA 4EU0A 3RFBA 4GS9B 4I38A 3PBTA 5DJUA 3TE8A 1YSQA 2L1MA 2ZMFA 1OTAA 1JNUA 1ZTUA 5F69A 2JKRM 2VJWA 1S4SA 2PHYA 3CAXA 4PAUA 3MMHA 4HP4A 1TS8A 4CLCB 3UMDA 2WKQA 4WL9A 4MMNA 1T18A 3OCLA 4EERA 3RH8B 3BQ8A 1W63Q 3E98A 3EGXC 1LL8A 3EQUA 2W3DA 4WUJA 4FOFA 3IBRA 2YKHA 1OT9A 3ULFA 1UWNX 4EETB 3TRCA 3LIBA 5J4EA 4PHTA 2OAP1 2VGLM 4EQ1A 3G6OA 4CLCD 3C38A 2JKRI 1OJ5A 2PT7A 4FSFA 3W2ZA 3LR3A 2DMWA 3IBJA 3VE4A 2ZBBA 4R38A 4IUKA 4B9OA 4KQDA 4BBTA 4GCZA 3VE3A 3EEAA 1XJ3A 5I5LA 2W3EA 3LUQA 2PD8A 2XROA 1YSPA 4HH3A 3MXQA 1XFQA 4G3VA 1ODVA 3KSFA 2LB9A 4EEPA 1ZHHB 2JKTM 4EXOA 3EGDC 1OTBA 4I39A 4WEKA 4O0PA 3T4KA 3D3OA 4XT2A 3CWFA 3PYPA 4HH2A 3KSGA 5K5BA 4NXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC B;  4CLC A;  2A2L A;  5CX7 A;  4BMW A;  4CLC C;  4CLC D;  4CLC E;  4NKP A;  3FPW A;  3FPV A; 
#chains in the Genus database with same CATH topology
 4DE3 A;  2JHE A;  2VKS A;  2DRW A;  4JLF A;  2HPB A;  5HSQ A;  1LHY A;  4HY8 A;  3IX4 A;  4PM6 A;  3DW0 A;  3O88 A;  2KLI A;  3H82 A;  3DAV A;  4BD1 A;  5L07 A;  4R3A A;  3GR2 A;  1LSX A;  2FH5 A;  5FEF A;  2O99 A;  1N4O A;  2FZ0 A;  4JKT A;  3JVV A;  2EFU A;  1MWS A;  4MN6 A;  2BG1 A;  1KE4 A;  4L9F A;  1ZKJ A;  2G2U A;  4HHD A;  1KOU A;  4BJP A;  3OPL A;  4KZ7 A;  1GHI A;  3P98 A;  1LLB A;  3IF6 C;  5TFQ A;  5FAQ A;  4Z9Q A;  2QYB A;  1STZ A;  3Q1F A;  1YKD A;  2K2N A;  4QB8 A;  3QP6 A;  3AGE A;  3G35 A;  3PBQ A;  1XPB A;  3T1R A;  2ZQ8 A;  3L9K A;  3WRZ A;  1WE4 A;  3FC7 A;  4F3L A;  2ZC7 A;  5GLD A;  5IT5 A;  3N6I A;  3MBZ A;  1IOU A;  4DJ2 A;  2XQZ A;  3MFX A;  3O3V A;  3A0V A;  4JGQ A;  3T50 A;  4YFM A;  3ZDJ A;  2WK0 A;  3SW1 A;  4X53 A;  1C3B A;  2FFF B;  4UAA A;  1K6R A;  2R9W A;  4ARZ A;  3BY8 A;  2QKP A;  2KDK A;  4P6B A;  4HJ6 A;  1QMF A;  4A5R A;  1I2S A;  5AQ7 A;  2Q9N A;  2UWX A;  4HJ4 A;  4IHQ A;  2GDN A;  3MQO A;  2V0W A;  4OP8 A;  2V20 A;  4K08 A;  3MZD A;  2HGV A;  5DTK A;  4EV4 A;  3MZF A;  3G2Z A;  4OQ0 A;  5EOO A;  4PMA A;  4GDB A;  1VQQ A;  3HLE A;  1NLZ A;  5DF7 A;  4X25 A;  1K0K A;  1W7F A;  4KZB A;  3HJI A;  4K0W A;  2V1A A;  4GB7 A;  3MZE A;  3MR0 A;  3RJU A;  2XRN A;  5CGX A;  1W63 M;  3UPP A;  3DTE A;  1LL9 A;  2Y2I A;  2C5W B;  3R4K A;  3IXH A;  1VEU B;  3V50 A;  2J9O A;  2QJ7 A;  3V5M A;  4QY5 A;  4U0X A;  1VB6 A;  3NDG A;  3PXP A;  4EBP A;  1Y4O A;  1JVJ A;  3TOI A;  1GHP A;  3DTI A;  5C5K A;  4FTX A;  3N8S A;  5DKL A;  2EFX A;  3LEZ A;  3H9W A;  3G31 A;  4KZ6 A;  4JXV A;  1P97 A;  5KSH A;  1K56 A;  3IHB A;  1L0D A;  4HP9 A;  4BLM A;  4HIA A;  2J3W A;  3B42 A;  2WKE A;  3NOP C;  5E43 A;  1Q2P A;  1BLP A;  1ZG6 A;  4JBF A;  4YWZ A;  5FSR A;  2Y2J A;  3M2K A;  1W5D A;  4P6Z M;  2V8F A;  1MZU A;  1IFQ A;  3MJQ A;  3S7Q A;  3BWL A;  4L0L A;  5G4Z A;  2DNS A;  2R78 A;  2Z6C A;  2W1T B;  2BLS A;  3ZG0 A;  3V3R A;  3KYZ A;  3HLG A;  5FL3 A;  2RCX A;  2O9A A;  2W1R A;  3BQA A;  4MBF A;  5TR7 A;  1DP8 A;  2V8C A;  4ZJ3 A;  3ZHH A;  4KQO A;  2PRF A;  2E8I A;  1CJF A;  3VMA A;  2W3G A;  5G4Y A;  3C2W A;  3ZGA B;  1T19 A;  5TBM B;  2J3T D;  3NHQ A;  5HAQ A;  1SDN A;  3JPU A;  3UE6 A;  1F2K A;  4OPZ A;  1F9I A;  1K4E A;  5J8X A;  2OOL A;  3C30 A;  4LCL A;  3IXG A;  1Y54 A;  2O9C A;  1G6O A;  5HWT A;  2PBD P;  3NY4 A;  4CJN A;  1K57 C;  4UQI M;  3LI9 A;  1YT4 A;  3N8R A;  3M6H A;  3HLC A;  2A24 B;  2GX5 A;  3Q81 A;  1P9W A;  3OLO A;  4LV0 A;  5AQA A;  2ZOH A;  1MPL A;  1F98 A;  1ONG A;  3KSI A;  3MXS A;  1KDS A;  2P08 A;  2W27 A;  1TD5 A;  2M7V A;  1K6S A;  3T1X A;  1NYY A;  4NK3 A;  4BBU A;  3IX8 A;  3SS3 A;  3F1P A;  2I72 A;  1L0F A;  1T1B A;  1YQS A;  2B02 A;  2KX6 A;  1TDG A;  3B33 A;  2GJ3 A;  2WGV A;  4ZAM A;  4Y15 A;  3HRE A;  1SHV A;  2IWB A;  2JE5 A;  3N8L A;  2VLG A;  1PWD A;  4O8G A;  3HJK A;  1O07 A;  4L9E A;  4KUO A;  3IXD A;  3PBS A;  2OSU A;  2J7V A;  4ZJ2 A;  4S2K A;  4FH4 A;  1G68 A;  3CHW P;  3QP4 A;  5BOH A;  3C7V A;  1YMX A;  3UE1 A;  5HFO A;  2Y79 A;  3K3D A;  4IBX A;  4DE0 A;  3V39 A;  1SKF A;  5A90 A;  1IKG A;  3LY4 A;  3OZH A;  4MEZ A;  2ZL1 A;  2VZW A;  4L9G A;  3ZCZ A;  3F1N B;  3ZG7 B;  2YKF A;  2XH9 A;  3RFB A;  4GS9 B;  5DJU A;  4R0Q A;  2ZMF A;  1OTA A;  1JNU A;  1S6R A;  2VJW A;  1S4S A;  1JTG A;  2PAV P;  2PHY A;  3GVB A;  3CAX A;  3RXX A;  3MMH A;  1TS8 A;  4CLC B;  3BEB A;  1JWV A;  3OCL A;  4Y17 A;  1VET A;  2ZQ9 A;  3HLD A;  1CEF A;  2JBF A;  3VP1 A;  5A91 A;  1BLH A;  4S2N C;  4PPR A;  3ULF A;  1OME A;  4EET B;  3LIB A;  4N1H A;  3B3X A;  3G6O A;  2P74 A;  1OJ5 A;  3DTK A;  1U60 A;  4R4S A;  4C6Y A;  4LGW A;  1FCN A;  3VE4 A;  3QHY A;  3ITB A;  4R38 A;  4GNU A;  4DF6 A;  1ERM A;  1PNE A;  1GA0 A;  3G2Y A;  4BBT A;  4GCZ A;  5U47 A;  1XGI A;  2Y2H A;  1K55 C;  3M6B A;  3WS0 A;  5F82 A;  1RGY A;  1XFQ A;  3S1Y A;  5JYO A;  3EGD C;  1L0G A;  3NC8 A;  1OTB A;  3MS6 A;  1DJC A;  1AWI A;  3D3O A;  3T1S A;  4HBU A;  2WAD A;  2ZM2 A;  3KSG A;  4NXG A;  3JYI A;  4R3B A;  3TSG A;  1K54 A;  1PWC A;  2Q9M A;  4JXG A;  2Y59 A;  4WN5 A;  3UDI A;  4ETZ A;  4IVK A;  5TJJ A;  3ZVW A;  3KSH A;  4MNR A;  2Y91 A;  2EA9 A;  1XJ6 A;  1EI5 A;  5KIZ A;  4PM9 A;  3IS2 B;  4LFU A;  4LLO B;  5JYP A;  3UE3 A;  1G5U A;  4GLQ A;  4WLA A;  4Q0I A;  4X1L A;  5HD3 A;  3LIE A;  4R6L A;  1YLY A;  1D7E A;  3GTC A;  4MCW A;  4D60 A;  2PD7 A;  3QP1 A;  5I94 A;  5CHM A;  1GSX A;  4GJ4 A;  1WA9 A;  2ZC4 B;  1GSW A;  3S22 A;  4YNR A;  1ES3 A;  2QJ5 A;  1N9B A;  4QWO A;  2V2F F;  4E3N A;  4XT2 B;  2QPN A;  3QNB A;  3S7P A;  1BUL A;  3LR5 A;  2ZQD A;  4H6J B;  4DN0 A;  2G2W A;  2X02 A;  1D06 A;  3UME A;  4GZB A;  2EWV A;  4QJG A;  3UB7 A;  3Q7V A;  3O87 A;  3VOZ A;  3EOI A;  2VV8 A;  4XXR A;  4E3K A;  3EQV A;  2V1Z A;  3EEH A;  4HJ3 A;  4C75 A;  2V0U A;  1YLT A;  3D9Y A;  5CHJ A;  3WS5 A;  4WF0 A;  1K55 A;  1XJ4 A;  2AVX A;  4EES A;  2WGW A;  4E6W A;  3ZFZ A;  2PYR A;  4E3M A;  4HES A;  2Y2L A;  5J7E A;  1EW0 A;  4JGO A;  5LBR A;  1SZV A;  5KZH A;  2ZJ9 A;  1FSW A;  1H3Q A;  3NOU C;  1TS6 A;  2L4R A;  2J8Y A;  3GSG A;  4P85 A;  4B4Z A;  1FIK A;  2VGJ A;  5EM1 A;  2P9V A;  2UV0 E;  4NXE A;  4LPZ A;  3KYE A;  4Q0H A;  3NOT C;  4G3W A;  4GN2 A;  3KX0 X;  3VFH A;  1NRJ A;  5EVL A;  3F1O A;  3CZD A;  4MN5 A;  4NXF A;  3JVU A;  5TGF A;  2WUQ A;  1XKZ A;  5L8M A;  5DTS A;  4ARZ B;  2ZOI A;  3LR0 A;  5HAP A;  3OBF A;  5IHV A;  1JTD A;  3B47 A;  1IYQ A;  3SZT A;  5CER A;  3GMW A;  2CMN A;  3P01 A;  3UPO A;  3ZNT A;  5IU1 A;  4OQH A;  4HI4 A;  1ESU A;  2HP9 A;  2OWH A;  1ESI A;  2V9A A;  5EUA A;  2RL3 A;  3BLM A;  2H0T A;  4KZ9 A;  4BEN A;  2X71 A;  2Y55 A;  5HPI A;  4DRT A;  4UA7 A;  3K2N A;  1HTZ A;  3O5Y A;  4KQR A;  2XK1 A;  5FQJ A;  2Y2O A;  3UY6 A;  5HWV A;  1HZO A;  5FQQ A;  4XUZ A;  1M6K A;  3VOY A;  2J80 A;  3SH9 A;  1IKI A;  1XP4 A;  2VV6 A;  4BBV A;  3WRT A;  5L09 A;  4EW7 A;  5E2H A;  4GKU A;  3BM6 A;  4Y13 A;  2OV5 A;  1IEM A;  2I9V A;  3FPW A;  1BLS A;  3H7W A;  3WWX A;  3CUE C;  3A3F A;  5EVE A;  1E3U D;  3UO9 A;  2VGL S;  2XLN A;  4YIN A;  1OPX A;  5CXW A;  2XR0 A;  1N9O A;  4O7D A;  4E6X A;  1IYS A;  5EVI D;  5HL6 A;  1HD8 A;  5AVF A;  3CG5 A;  5CRF A;  4ME4 A;  4ETX A;  2QMI A;  4K0X A;  4KZ3 A;  5E2E A;  4WZ5 C;  3FG8 A;  1PYY A;  1YLJ A;  4BWI A;  4P87 A;  3LI8 A;  3ZG9 B;  2QWS A;  4RVA A;  2LB5 A;  1ZG4 A;  4GHI B;  2HF6 A;  3WS1 A;  3HLF A;  2OLV A;  5M1A A;  1JWP A;  1FCM A;  3LIC A;  2VA0 A;  2JCH A;  3HUN A;  5MC7 A;  5FDS A;  4LRX C;  4LEN A;  1JWZ A;  3IF6 A;  1H8Y A;  5AVE A;  2HJE A;  5EOE A;  1DJB A;  4HEF A;  5F83 A;  1PW8 A;  1N9N A;  1NYM A;  2WKH A;  4I3A A;  3NCK A;  4JXS A;  3W8K A;  1NZO A;  2W3H A;  3UB8 A;  5CX7 A;  1MWT A;  3LFV A;  4Y0T A;  3DTM A;  1BT5 A;  1D1J A;  4LV3 A;  1Q2Q A;  4LV2 A;  1XA1 A;  3E0Y A;  2ACG A;  5J3W A;  1K38 A;  1FSY A;  4I38 A;  4QU3 A;  3ZVT A;  3PBT A;  1YSQ A;  3IX3 A;  2WZZ A;  5GLB A;  4KG2 A;  1BLC A;  2ZQA A;  3FKW A;  2JKR M;  4N9K A;  1BZA A;  4IED A;  2WKQ A;  1KGG A;  1WYC A;  1T18 A;  3NEC A;  5EVI B;  1W63 Q;  3E98 A;  3EGX C;  1LL8 A;  3W4O A;  1PWG A;  2W3D A;  2X01 A;  1DJA A;  4FOF A;  5EE8 A;  3IBR A;  1PZO A;  1MWU A;  4R3J A;  3IH9 A;  3QP2 A;  2OAP 1;  4M3K A;  4H8R A;  4CLC D;  1YM1 A;  2FFY A;  3T1Q B;  3OPR A;  4IBR A;  2QZ6 A;  3IHA A;  4B9O A;  5FI6 A;  3VE3 A;  2ZL1 B;  2W3E A;  2WYX A;  2PD8 A;  4JF6 A;  4JF4 A;  1PIO A;  3UE0 A;  3KSF A;  2LB9 A;  4WM9 A;  4I39 A;  4WEK A;  1O7E A;  3PYP A;  4HBT A;  4MBK A;  4X68 A;  1IEL A;  1MY8 A;  3GV9 A;  1PW1 A;  2HV1 A;  2W1T A;  3KO6 A;  2H0Y A;  1VET B;  3SH7 A;  3DWK A;  3NBL A;  5KSC A;  2EXB A;  2JKF A;  3LIF A;  2K7S A;  5FQM A;  3GEC A;  1CF0 A;  3ICY A;  3BYD A;  3WS2 A;  2INW A;  3A3D A;  1PI5 A;  1Y28 A;  1GSV A;  2B95 A;  1NY0 A;  3CPT A;  2J3T C;  2G7U A;  3T12 B;  1OTE A;  4LV1 A;  4G3K A;  4Y5F A;  2WZX A;  1YAX A;  5CED A;  3T4T A;  4HNB A;  2PU4 A;  5CTN A;  1MXO A;  2Y2M A;  3ZQ5 A;  5DKK A;  3VV4 A;  2OLU A;  4CLC C;  5F1F A;  1FOF A;  2CC1 A;  1Z6F A;  1DP6 A;  4CLC E;  4I3I A;  2VX8 A;  5DFX A;  1YPR A;  3BFE A;  3ZYT A;  1LI0 A;  1G28 A;  5CTM A;  1BYW A;  4DXC A;  3ZNY A;  3MQQ A;  1ZC2 A;  2IWD A;  4GOG A;  1SDE A;  2QHK A;  4KZA A;  5FAS A;  2ZC3 B;  3ZG8 B;  4S2O A;  5D3O A;  4R4R A;  4IUH A;  2GNX A;  2B18 A;  1ES4 A;  2EX8 A;  1K57 A;  2PDR A;  3W4P A;  1CEG A;  1H8M A;  2BTF P;  5EM0 A;  3G4P A;  1MWR A;  2XA7 S;  1K25 A;  1G6A A;  2XD1 A;  1KDW A;  3AGF A;  3SH8 A;  5A92 A;  4WMC D;  1FCO A;  2Y8H A;  2Y2K A;  4YOF A;  2Z2L B;  1BTL A;  4FCF A;  1OTI A;  1BSG A;  3RTY A;  4WEL A;  3MXR A;  4EUV A;  3OPH A;  1IYP A;  4MDZ A;  3BJN A;  4UHU A;  4B93 A;  1KGF A;  2ZQC A;  5DF8 A;  5AJG A;  4DXB A;  3PTE A;  3LYX A;  3OPP A;  4NXB A;  3UPN A;  4PKY A;  2Y2G A;  3V3S A;  4X56 A;  1NJ4 A;  4II7 A;  2WAE A;  4E04 A;  3G34 A;  3CI6 A;  3F1N A;  3N4I A;  1SKO A;  4X55 A;  2JKG A;  3Q7V B;  3HL9 A;  4KUK A;  3HBR A;  2ZQ7 A;  5HW3 A;  2EXA A;  5EFW A;  2JKT I;  5HDS A;  4JF5 A;  4DE2 A;  2IWC A;  5DF9 A;  5DTT A;  4N1X A;  2ZMV A;  1CI8 A;  4UEY A;  1EWZ A;  2NUT C;  4DJ3 A;  3OCN A;  4Z1W A;  4LRY C;  3R7W A;  1ONH A;  4PKY G;  2WKR A;  5HWW A;  3SOI A;  4ZDX A;  1HLU P;  2JN7 A;  3VP2 A;  4E3I A;  4EBL A;  4LRZ E;  5HZH A;  2P9V B;  4GD8 A;  3T4J A;  4WYY A;  1XA7 A;  4S2N A;  1OJG A;  5GL9 A;  5CEC A;  2A49 A;  4DMZ A;  2Y2Q A;  1Z09 A;  4S2I A;  3F1O B;  3HCY A;  2O9B A;  5FA7 A;  3H82 B;  1LSV A;  2P7J A;  2Z6D A;  3FV7 A;  5GHX A;  2PU2 A;  4JGP A;  2Z2M B;  4HQA A;  5KMW A;  4KEN B;  2W3F A;  2HZ5 A;  5L10 A;  3K3C A;  5EEC A;  3LR4 A;  3C8C A;  3LGO A;  1N9L A;  2L0W A;  4RX2 A;  3IS2 A;  3BW6 A;  1XX2 A;  3IQA A;  3VSK A;  4HOI A;  1T1C A;  3O86 A;  4PM7 A;  4QHC A;  4WZ4 A;  3LY3 A;  3IXB A;  1KE0 A;  3MSH A;  3PBR A;  1K56 D;  2D02 A;  4F3L B;  4R1G A;  2DCF A;  1OT6 A;  2E8J A;  2XGN A;  3LIA A;  4EQI A;  4X1M A;  5EPH A;  3C4P A;  4OLD A;  4BL2 A;  4OKP A;  1PRQ A;  3N7W A;  2ZM0 A;  1CQA A;  4DDS A;  5HAR A;  3IF5 A;  3PHY A;  3PBO A;  2NUP C;  2ZC6 B;  1E4D A;  1ALQ A;  4OLG A;  4Y3I A;  1H0M A;  1E25 A;  4H6J A;  2K31 A;  4WMC A;  4KZ8 A;  4O01 A;  2OAQ 1;  4OON A;  4EEU A;  3VP0 A;  1RCJ A;  3A0S A;  3ISG A;  1FIL A;  3UB5 P;  3TW8 A;  3Q07 A;  4QY6 A;  3H7W B;  4U0T A;  3UB9 A;  1L3L A;  1UWP X;  3BFD A;  1P0Z A;  3D4F A;  5F5Y A;  3T4L A;  1W79 A;  1P9R A;  1DRM A;  5M19 A;  3C5A A;  2PR6 A;  2HP5 A;  4Q0J A;  1LL5 A;  1X0O A;  3OC2 A;  5HL1 A;  1LT0 A;  1I2W A;  1KE3 A;  1RP5 A;  4WEJ A;  5E2F A;  2EX9 A;  4E3O A;  4KQQ A;  3TJZ C;  2C6W B;  3BEC A;  3TE8 A;  2L1M A;  1BUE A;  4X6T A;  1ZTU A;  3WS4 A;  2XF3 A;  1ES2 A;  1GCE A;  1TVF A;  5GLC A;  4PAU A;  3VP3 A;  3IF6 B;  4JPM A;  4WL9 A;  4MMN A;  2ZLY A;  4EER A;  5E2G A;  3BQ8 A;  4OVD A;  2Y2N A;  2Q0O A;  4WUJ A;  2YKH A;  1OT9 A;  3TG9 A;  1UWN X;  3UDX A;  3TRC A;  3BFF A;  5J4E A;  2VGL M;  4MBH A;  4DDY A;  2XFT A;  4ID4 A;  3W2Z A;  4RYE A;  2DMW A;  2WGI A;  3IBJ A;  3PAE A;  2J9P A;  2ZBB A;  4ZTK A;  1YLP A;  4OOY A;  3HUM A;  4KG5 A;  2XRO A;  3QP8 A;  3P09 A;  5AQ9 A;  5AQB A;  3Q82 A;  3LCE A;  1HVB A;  3M2J A;  3NI9 A;  4EEP A;  1ZHH B;  2JKT M;  3MKF A;  4ZBE A;  3L7H A;  1FQG A;  2A3U A;  3MKE A;  1XGJ A;  3T4K A;  3MFD A;  3CWF A;  3A3J A;  1J9M A;  4HH2 A;  4LCM A;  2JC7 A;  4ZRR A;  3SS5 A;  2B5R A;  3UB6 A;  1TDL A;  3S7O A;  5CGS A;  3C4O A;  3CIT A;  4BL3 A;  4NKP A;  5FEG A;  5FAO A;  1XFN A;  4GW9 A;  1F5M A;  3Q7Z A;  3MQ0 A;  2H5S A;  4CQH A;  2VEA A;  3GDI A;  5FI7 A;  1W8Y A;  1UGU A;  1H5X A;  5CHU A;  1OTD A;  1S67 L;  2ZM8 A;  2XDM A;  5EVI C;  5FQK A;  4OP5 A;  4P6Z S;  3NDE A;  4FH2 A;  4MN7 A;  4DE1 A;  4RQ9 A;  1MC0 A;  4OOL A;  3U2A A;  3F1P B;  5EV0 A;  5HDC A;  3CUE A;  1K4F A;  4I5S A;  2WAF A;  3A3E A;  3A0R A;  1H8Z A;  1V9Z A;  3E4P A;  4GHI A;  4OQG A;  2XEP A;  3AGD A;  2VV7 A;  4WBG A;  1QME A;  1VEU A;  2ZMA A;  5FAP A;  1TEM A;  3PBN A;  3BFG A;  4OOM A;  5F6A A;  1MKM A;  3CPT B;  2EWW A;  1PI4 A;  3IWQ A;  4B4X A;  3FZC A;  4WZ5 A;  4Q8I A;  4OQI A;  2XD5 A;  2OWJ A;  1PFL A;  3BLS A;  4QD4 A;  1DP9 A;  1TS0 A;  2H28 A;  4UA9 A;  5DJT A;  2HJ9 C;  1S1Z A;  4M4X A;  2VK3 A;  2KOI A;  3D72 A;  4UQI S;  3HVF A;  3GRJ A;  1YLW A;  3U4L P;  4EWF A;  3LEQ A;  2WKI A;  5CEB A;  4IJG A;  2D01 A;  5HDD A;  2HDS A;  2XFS A;  4B88 A;  2W0N A;  2ZC5 B;  3NIA A;  4Y7P A;  3IH8 A;  5FQI A;  3FKV A;  2BAS A;  5FDH A;  3RXW A;  1W8Q A;  3E4Q A;  1T1A A;  5HD5 A;  1E3U A;  2PBY A;  2P04 A;  4UA6 A;  5DFY A;  4S2J A;  1CK3 A;  1S0W A;  4P0M A;  3W4Q A;  1KGE A;  5EVI A;  1S66 L;  2XSS A;  1GHM A;  1YLZ A;  5TBM A;  1S1Y A;  4NEE D;  4OPR A;  1ES5 A;  3EWK A;  3FPV A;  4DKI A;  4E3L A;  1K54 C;  1L2S A;  4FUW A;  3T4O A;  3LID A;  2IA2 A;  2Y2P A;  2WKP A;  1RGZ A;  3VOL A;  4S2L A;  4ZJ1 A;  4MLL A;  3BRM A;  4Y0U A;  3HUO A;  3VSL A;  2A24 A;  1NXY A;  5FI2 A;  2HDU A;  1YMS A;  3NUL A;  3BFC A;  3MF0 A;  1SKO B;  3VFF A;  3DBA A;  3E2K A;  3CLO A;  5DVA A;  4Y2F A;  1SCW A;  3LO7 A;  3DWZ A;  2MJ6 A;  2XA7 M;  1FR6 A;  4AFI A;  3IT9 A;  1ACF A;  3I7J A;  4C3Q A;  4I3J A;  5G18 A;  5L2F A;  3S7N A;  5HPF A;  3A3I A;  1NLY A;  2PR5 A;  3R7W B;  3V67 A;  2Y4A A;  3VP4 A;  4XUX A;  2VGK A;  1ERO A;  3OOV A;  2ZD8 A;  1TF1 A;  2EX2 A;  1LI9 A;  2M7U A;  3KYQ A;  1L0E A;  1VHM A;  5IS1 A;  4RX3 A;  1M40 A;  1XJ2 A;  4ESP A;  4PM5 A;  4QPR A;  4OPQ A;  2O0Y A;  5F68 A;  1MKI A;  4F94 A;  5FAT A;  2PYP A;  2EX6 A;  4GS9 A;  1GA9 A;  5CGW A;  1AXB A;  3T4S A;  1PZP A;  2A2L A;  3P7N A;  1ERQ A;  1TS7 A;  3QNC A;  4JGR A;  4NG2 A;  4CLC A;  4N92 A;  1I5Q A;  1CI9 A;  4U3T A;  3T4Q A;  5A8B A;  2WGW B;  2GZA A;  4OPY A;  2HDR A;  3G30 A;  3FWL A;  4R23 A;  4EBN A;  4N9L A;  1LSW A;  1V9Y A;  3HLB A;  5GHZ A;  1VM1 A;  1S4R A;  3PR6 A;  2HP6 A;  2M1C A;  3IWI A;  1NWZ A;  4KZ5 A;  5A93 A;  3E4O A;  3HLW A;  3NJA A;  3IWO A;  3UDF A;  4Y0O A;  3BY9 A;  4BMW A;  1IYO A;  4R70 A;  2V1B A;  4KG6 A;  4X69 A;  3SS4 A;  4EU0 A;  2R9X A;  4IVI A;  4E3J A;  5M18 A;  5F69 A;  1A0K A;  3E2L A;  3CJM A;  4GD6 A;  1FR1 A;  1WYB A;  4S2P A;  4K91 A;  1KVL A;  3ITA A;  4HP4 A;  3UMD A;  3RH8 B;  4FD8 A;  4KZ4 A;  3EQU A;  3QP5 A;  3UNW A;  4GDN A;  4BQM A;  3GQZ A;  4EUZ A;  2HDQ A;  4NET A;  4S2M A;  3ZG5 A;  4PHT A;  4EQ1 A;  5HAI A;  4RA7 A;  1NZU A;  3C38 A;  2JKR I;  1KVM A;  2PT7 A;  4PM8 A;  3G32 A;  3PAG A;  4FSF A;  5HX9 A;  3S4X A;  3CMZ A;  3LR3 A;  3UN7 A;  5GHY A;  4IUK A;  4KQD A;  3FYZ A;  1DY6 A;  4BD0 A;  3EEA A;  1XJ3 A;  5I5L A;  3LUQ A;  2H10 A;  1YSP A;  4HH3 A;  4OH0 A;  3MXQ A;  4G3V A;  1ODV A;  5F1G A;  1NRF A;  4EXO A;  4CPK A;  4JXW A;  1XXM A;  1J3W A;  3C7U A;  4O0P A;  4D2O A;  5FQ9 A;  4XT2 A;  5GLA A;  1MBL A;  5K5B A; 
#chains in the Genus database with same CATH homology
 4ZRR A;  2HV1 A;  3UB6 A;  2W1T A;  3KO6 A;  2JHE A;  2VKS A;  4WN5 A;  5HSQ A;  3S7O A;  3LIF A;  4HY8 A;  5TJJ A;  4ETZ A;  2K7S A;  3GEC A;  3ICY A;  3KSH A;  2KLI A;  3H82 A;  2INW A;  4R3A A;  2EA9 A;  1XJ6 A;  3CIT A;  1LSX A;  1Y28 A;  2FH5 A;  4NKP A;  1GSV A;  5KIZ A;  2O99 A;  3IS2 B;  4LLO B;  1XFN A;  2J3T C;  2FZ0 A;  2G7U A;  3UE3 A;  3JVV A;  4GW9 A;  4MN6 A;  1OTE A;  4GLQ A;  4G3K A;  1F5M A;  4Q0I A;  4WLA A;  3MQ0 A;  4Y5F A;  3LIE A;  4L9F A;  5HD3 A;  4HHD A;  1YAX A;  1KOU A;  4CQH A;  4BJP A;  2VEA A;  3GDI A;  4R6L A;  3T4T A;  1D7E A;  1UGU A;  4HNB A;  4MCW A;  1OTD A;  1S67 L;  3ZQ5 A;  2PD7 A;  5DKK A;  3VV4 A;  4CLC C;  1GSX A;  4GJ4 A;  1WA9 A;  1GSW A;  2QYB A;  1DP6 A;  1STZ A;  1YKD A;  2K2N A;  4CLC E;  4I3I A;  2VX8 A;  5DFX A;  4P6Z S;  4YNR A;  3ZYT A;  4MN7 A;  2QJ5 A;  1G28 A;  4XT2 B;  3PBQ A;  4RQ9 A;  1MC0 A;  4OOL A;  3S7P A;  1BYW A;  3U2A A;  3F1P B;  3LR5 A;  3FC7 A;  3MQQ A;  4H6J B;  5HDC A;  3CUE A;  4DN0 A;  4F3L A;  4I5S A;  5IT5 A;  3A0R A;  2QHK A;  1D06 A;  3UME A;  1IOU A;  4DJ2 A;  1V9Z A;  3MFX A;  2EWV A;  4IUH A;  3A0V A;  2GNX A;  2B18 A;  4JGQ A;  3E4P A;  3UB7 A;  3T50 A;  4GHI A;  2PDR A;  2VV7 A;  3EOI A;  3SW1 A;  1H8M A;  2VV8 A;  2XA7 S;  3EQV A;  3PBN A;  4OOM A;  5F6A A;  1MKM A;  2EWW A;  3EEH A;  4HJ3 A;  2V0U A;  4ARZ A;  4WF0 A;  2Y8H A;  3BY8 A;  4YOF A;  2QKP A;  1XJ4 A;  2KDK A;  4HJ6 A;  4EES A;  1OTI A;  3RTY A;  4WEL A;  4HJ4 A;  4IHQ A;  3MQO A;  2OWJ A;  2PYR A;  4EUV A;  2V0W A;  1DP9 A;  5J7E A;  1TS0 A;  1EW0 A;  3BJN A;  2H28 A;  4K08 A;  4JGO A;  4MDZ A;  5DJT A;  2HJ9 C;  5LBR A;  4B93 A;  1S1Z A;  4M4X A;  2KOI A;  2HGV A;  3D72 A;  4UQI S;  5AJG A;  1H3Q A;  3LYX A;  3NOU C;  1TS6 A;  2L4R A;  4IJG A;  4NXB A;  1NLZ A;  4PKY A;  2D01 A;  5HDD A;  4NXE A;  4II7 A;  4E04 A;  3HJI A;  2V1A A;  4LPZ A;  3MR0 A;  4Q0H A;  2XRN A;  3CI6 A;  3F1N A;  2W0N A;  3NOT C;  1W63 M;  4G3W A;  3KX0 X;  4KUK A;  2BAS A;  1NRJ A;  3F1O A;  3R4K A;  4MN5 A;  4NXF A;  3E4Q A;  5EFW A;  1T1A A;  2QJ7 A;  3JVU A;  5HD5 A;  2JKT I;  5HDS A;  2P04 A;  5DF9 A;  1VB6 A;  5L8M A;  5DFY A;  3PXP A;  4ARZ B;  2ZOI A;  3LR0 A;  3OBF A;  3B47 A;  2ZMV A;  4UEY A;  5C5K A;  1S66 L;  2XSS A;  2CMN A;  5DKL A;  5TBM A;  3H9W A;  3P01 A;  1S1Y A;  2NUT C;  4NEE D;  4DJ3 A;  1P97 A;  5KSH A;  3OCN A;  5IU1 A;  4Z1W A;  3EWK A;  3FPV A;  4HP9 A;  4HI4 A;  4LRY C;  3R7W A;  4HIA A;  3T4O A;  2J3W A;  2OWH A;  3B42 A;  4PKY G;  3NOP C;  3LID A;  2V9A A;  2WKR A;  5HWW A;  2IA2 A;  2WKP A;  4YWZ A;  2JN7 A;  3VOL A;  4P6Z M;  4LRZ E;  1MZU A;  1IFQ A;  5HZH A;  5HPI A;  3MJQ A;  3S7Q A;  3T4J A;  3BWL A;  2A24 A;  4L0L A;  5G4Z A;  3K2N A;  1OJG A;  2R78 A;  2Z6C A;  2W1T B;  3MF0 A;  4DMZ A;  3O5Y A;  3KYZ A;  3DBA A;  5FL3 A;  2O9A A;  3CLO A;  2W1R A;  4Y2F A;  3F1O B;  3HCY A;  2O9B A;  3H82 B;  1LSV A;  3BQA A;  2P7J A;  5HWV A;  1DP8 A;  2MJ6 A;  2Z6D A;  4KQO A;  2XA7 M;  2W3G A;  5G4Y A;  4AFI A;  2J80 A;  3C2W A;  2VV6 A;  1T19 A;  4BBV A;  4JGP A;  4EW7 A;  5TBM B;  2J3T D;  3NHQ A;  4I3J A;  4HQA A;  3S7N A;  5HPF A;  3UE6 A;  1NLY A;  2I9V A;  2PR5 A;  3FPW A;  3H7W A;  2W3F A;  3R7W B;  3V67 A;  1F9I A;  3CUE C;  3K3C A;  3LR4 A;  2OOL A;  3C8C A;  3OOV A;  3C30 A;  1TF1 A;  2VGL S;  1N9L A;  2O9C A;  2L0W A;  3IS2 A;  3BW6 A;  1G6O A;  5HWT A;  2M7U A;  4HOI A;  1OPX A;  1N9O A;  3KYQ A;  1T1C A;  4UQI M;  3LI9 A;  5HL6 A;  1VHM A;  5AVF A;  5IS1 A;  4ME4 A;  3PBR A;  2A24 B;  4ETX A;  2D02 A;  4F3L B;  2GX5 A;  1XJ2 A;  1P9W A;  4QPR A;  1OT6 A;  3OLO A;  2O0Y A;  3FG8 A;  4BWI A;  5F68 A;  3LIA A;  2ZOH A;  3KSI A;  1F98 A;  3LI8 A;  2P08 A;  2QWS A;  2W27 A;  1TD5 A;  2PYP A;  2LB5 A;  4GS9 A;  2M7V A;  4GHI B;  2HF6 A;  3PHY A;  3PBO A;  2NUP C;  4BBU A;  3T4S A;  3P7N A;  2A2L A;  3LIC A;  3F1P A;  4Y3I A;  2VA0 A;  1TS7 A;  4JGR A;  4H6J A;  2K31 A;  1T1B A;  5MC7 A;  4O01 A;  2OAQ 1;  2B02 A;  2KX6 A;  4LRX C;  4CLC A;  3B33 A;  2GJ3 A;  3T4Q A;  5AVE A;  2HJE A;  4EEU A;  5A8B A;  3A0S A;  2GZA A;  2VLG A;  3TW8 A;  1N9N A;  3UB9 A;  3H7W B;  4O8G A;  3HJK A;  4I3A A;  1UWP X;  2W3H A;  3UB8 A;  1LSW A;  1V9Y A;  5CX7 A;  1P0Z A;  4L9E A;  4KUO A;  3PBS A;  5F5Y A;  3T4L A;  1S4R A;  3LFV A;  3PR6 A;  2M1C A;  1P9R A;  1DRM A;  1NWZ A;  2Y79 A;  3K3D A;  2PR6 A;  4Q0J A;  3E4O A;  1X0O A;  3OC2 A;  1LT0 A;  3NJA A;  4WEJ A;  3BY9 A;  4BMW A;  2VZW A;  4L9G A;  3E0Y A;  4R70 A;  3F1N B;  5J3W A;  2V1B A;  3TJZ C;  2YKF A;  4EU0 A;  3RFB A;  4GS9 B;  4I38 A;  3PBT A;  5DJU A;  3TE8 A;  1YSQ A;  2L1M A;  2ZMF A;  1OTA A;  1JNU A;  1ZTU A;  5F69 A;  2JKR M;  2VJW A;  1S4S A;  2PHY A;  3CAX A;  4PAU A;  3MMH A;  4HP4 A;  1TS8 A;  4CLC B;  3UMD A;  2WKQ A;  4WL9 A;  4MMN A;  1T18 A;  3OCL A;  4EER A;  3RH8 B;  3BQ8 A;  1W63 Q;  3E98 A;  3EGX C;  1LL8 A;  3EQU A;  2W3D A;  4WUJ A;  4FOF A;  3IBR A;  2YKH A;  1OT9 A;  3ULF A;  1UWN X;  4EET B;  3TRC A;  3LIB A;  5J4E A;  4PHT A;  2OAP 1;  2VGL M;  4EQ1 A;  3G6O A;  4CLC D;  3C38 A;  2JKR I;  1OJ5 A;  2PT7 A;  4FSF A;  3W2Z A;  3LR3 A;  2DMW A;  3IBJ A;  3VE4 A;  2ZBB A;  4R38 A;  4IUK A;  4B9O A;  4KQD A;  4BBT A;  4GCZ A;  3VE3 A;  3EEA A;  1XJ3 A;  5I5L A;  2W3E A;  3LUQ A;  2PD8 A;  2XRO A;  1YSP A;  4HH3 A;  3MXQ A;  1XFQ A;  4G3V A;  1ODV A;  3KSF A;  2LB9 A;  4EEP A;  1ZHH B;  2JKT M;  4EXO A;  3EGD C;  1OTB A;  4I39 A;  4WEK A;  4O0P A;  3T4K A;  3D3O A;  4XT2 A;  3CWF A;  3PYP A;  4HH2 A;  3KSG A;  5K5B A;  4NXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...