4CLCD

Crystal structure of ybr137w protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
172
structure length
172
Chain Sequence
MVVLDKKLLERLTSRKVPLEQLEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMAVSSLIAFANESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords UPF0303 PROTEIN YBR137W
total genus 56
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcD00
4CLCD 4NKPA 4CLCB 2A2LA 5CX7A 4CLCE 3FPVA 4CLCC 3FPWA 4BMWA 4CLCA
chains in the Genus database with same CATH superfamily
5HZHA 2D02A 1T19A 2J8YA 4GB7A 5MC7A 4BD0A 2JKFA 1OMEA 4UA9A 2K2NA 3VP4A 1EROA 5J4EA 3IXBA 4IUHA 5IU1A 3VSKA 2P04A 2NUTC 5HFOA 2XA7M 5KSHA 4YNRA 3U2AA 4HJ3A 4EBPA 1KDSA 4E6XA 2DRWA 4IUKA 2QJ5A 2XSSA 4M4XA 2FFFB 1K54C 4ME4A 4G3VA 3ZQ5A 5BOHA 2Y91A 3LR4A 2HP6A 5DFYA 4JGOA 1S1ZA 1LI9A 4FSFA 1FCMA 4MN6A 5TR7A 4WL9A 3RH8B 2MJ6A 4PKYA 3DW0A 1UWNX 3WS0A 2PU2A 2Y2KA 3NC8A 4QB8A 3WS5A 1PRQA 4K0XA 2Y2IA 4XT2B 2XFSA 5HDDA 3EOIA 3S7NA 2W1TA 3L7HA 2OLVA 3T1SA 3T4JA 3HLDA 4O8GA 2L1MA 4LV0A 2ZC4B 3UDFA 3VV4A 2KX6A 1S1YA 1BYWA 5HARA 1SZVA 3B42A 2OAP1 3O86A 2WGWB 5EVID 3D72A 1Y28A 1STZA 4DRTA 3HJKA 3S1YA 4JXWA 4MBKA 4ZBEA 4CLCE 1PIOA 1SDEA 3ZHHA 2QMIA 4KZ8A 3D3OA 2XRNA 1NZUA 1XKZA 2PDRA 4GN2A 2EX2A 3OPPA 5E2GA 3LYXA 4MN7A 2UV0E 3SH9A 5FASA 5FAQA 4S2LA 2KDKA 2A24B 5FI2A 3SS4A 2HP5A 1J3WA 1FR6A 1O07A 5FQJA 4WMCA 4FH4A 4JGRA 4YOFA 2A2LA 5HSQA 2JCHA 3FV7A 1K25A 4KQDA 1BULA 3MJQA 4BJPA 1FR1A 1VHMA 4LPZA 4S2MA 1I2WA 2R9WA 3MXSA 4JPMA 1TDLA 3TJZC 4LV3A 3H9WA 4JGPA 5TBMA 4DXCA 3UMDA 1OTBA 3MKFA 1K56D 4RA7A 2Y2LA 3H82B 2GNXA 4YWZA 3HBRA 4KENB 3VE4A 1PW8A 3BW6A 4FUWA 3N4IA 4WYYA 4EQIA 4JF6A 1A0KA 5L2FA 3MXQA 1MBLA 5CGWA 3BFDA 3TSGA 1IYOA 4LV1A 2M7UA 5CHMA 3UPNA 4IVKA 3S4XA 4PMAA 1ONHA 2XGNA 4MN5A 2G2WA 4EETB 5FL3A 5CHUA 1D1JA 3SS3A 1IFQA 1W79A 3IBRA 4PHTA 4OLGA 5GLDA 1ERQA 5FEGA 4GDNA 3CAXA 5CX7A 1AXBA 1N9LA 2H0TA 5CTMA 5HL6A 4MMNA 4Q0IA 4Q8IA 3A3FA 2J7VA 4EEUA 4Y0OA 4WZ5C 3PYPA 4GS9B 2WKEA 1WYCA 3DWKA 3ICYA 2D01A 3T4QA 3E4PA 2ZMFA 2Y2NA 1ESUA 5JYOA 1YLYA 1V9ZA 2WADA 3GR2A 2B5RA 3MQ0A 4H6JA 4JXVA 4BL3A 4A5RA 5IT5A 1GHMA 2Y8HA 1IOUA 3MZDA 2I72A 2OWHA 3NY4A 1F98A 1BTLA 3EQVA 4N1HA 4EQ1A 2HV1A 4WELA 1YQSA 3AGEA 1T1CA 1ZTUA 1SKOB 1IYSA 1K6SA 3S22A 3A3IA 3BQ8A 4IVIA 3KSGA 2WGIA 5DJTA 3HJIA 3LR3A 4QHCA 3KSHA 2HF6A 4DDYA 2HDUA 1GA0A 3E0YA 2GDNA 2ZL1B 5HL1A 4HP4A 1JNUA 2WAEA 1ZG6A 3F1PA 4LLOB 2AVXA 1JWZA 2Z2MB 5GLCA 4UA7A 3JVVA 4XT2A 2VKSA 5E2FA 3A0VA 1H0MA 3N7WA 4HIAA 3FC7A 1ZG4A 1SDNA 4EBNA 4I3IA 2EXBA 2ZOIA 3SH7A 4EWFA 2O99A 3RXWA 1H8YA 3CPTB 1DP9A 4GW9A 2CMNA 4KG2A 2I9VA 1K55C 4OQIA 2WKPA 3GVBA 3IH9A 3G31A 4ID4A 2V8FA 3FKVA 4HP9A 2V9AA 4L9FA 2ZQ7A 4ARZB 4X25A 2ZM2A 5TBMB 3FKWA 3MF0A 2INWA 3LCEA 1O7EA 3EGXC 5EPHA 4KZ9A 1W8QA 5FDHA 1Z09A 2PHYA 2PD7A 4R38A 4WBGA 1H8MA 3Q1FA 2IWDA 2W1TB 1YAXA 3WWXA 3KYQA 3ZNYA 4Y5FA 4CLCD 2JE5A 5FA7A 1DP8A 3NBLA 1XJ6A 3MBZA 3OOVA 4I38A 3SH8A 3C4OA 4E3OA 2ZMAA 2ZQ8A 5EFWA 4R4RA 1LI0A 3CI6A 2QYBA 4K0WA 4LCMA 3VP2A 4Y0TA 5DTTA 1DY6A 4KZBA 4OP5A 2B02A 1YLJA 1YT4A 3QP2A 4PPRA 5FAOA 5DVAA 1IKIA 3F1OA 4L9GA 3UY6A 4L0LA 5HD5A 2DNSA 3VE3A 5F68A 4MBFA 5KIZA 3UPPA 4II7A 3QP6A 3PBTA 3QNCA 3LUQA 3BY9A 3IX4A 4Z9QA 2OWJA 4GD6A 4KQOA 4BBUA 4WEKA 3G35A 2EX6A 2PBYA 2C6WB 5CEBA 3I7JA 1IEMA 5AJGA 1BLCA 2PRFA 2Z6DA 2W3HA 3WRZA 2B95A 1GHIA 1MKMA 3VP1A 1V9YA 1D7EA 2Y2GA 4JXGA 4PM7A 5FQKA 4OPQA 2BASA 3K3DA 5AQBA 3BLSA 3BEBA 4BBVA 1OTIA 3LI9A 1VM1A 1BUEA 3MZEA 2IWCA 3EGDC 1YSPA 4LFUA 3VMAA 1SKOA 1OTEA 1T1AA 4E04A 5FI6A 2VZWA 4S2JA 3MFXA 4QY5A 3FYZA 5FAPA 4HBUA 4FH2A 1TS8A 1DP6A 1NRFA 4BLMA 3IQAA 2ZD8A 1WYBA 4IBRA 1K38A 4DN0A 1L0FA 3PBNA 4HI4A 1ZC2A 3T50A 3S7OA 3IT9A 3UB8A 2V1ZA 1YMSA 5EVIB 5EVLA 4CLCC 4B88A 3DWZA 3OPHA 3ZFZA 1L3LA 1S66L 4JBFA 5CHJA 1GSXA 2O9AA 4OQHA 1W7FA 2ZC6B 1NZOA 4S2IA 1HTZA 4YFMA 3EQUA 5KMWA 3NOPC 3LIAA 4OONA 1XGIA 3LIDA 1CEGA 5M19A 3WS1A 3EWKA 4OPZA 2PU4A 3VOYA 4RQ9A 4HESA 3QNBA 2W3GA 3N8LA 2PT7A 3DBAA 1NLYA 3FG8A 1W5DA 5DFXA 4S2PA 1NLZA 2X02A 3M2KA 2VJWA 2P9VB 1KGEA 1H3QA 1PI4A 4ZDXA 4GKUA 5FATA 3HLEA 2J3TC 1GHPA 3IX3A 3P98A 2OAQ1 2J3WA 4PM5A 3IF6A 2EX9A 3LEZA 3GV9A 3IWQA 4P6ZM 4UQIM 3ZCZA 2JBFA 2VK3A 2P7JA 1W63M 5U47A 1S6RA 4KG6A 2WZXA 4QU3A 4R3AA 2VA0A 3H82A 1Z6FA 2GZAA 2R9XA 1CEFA 1OPXA 2KLIA 1BT5A 1PWGA 4G3WA 3UB9A 1S4RA 2J9OA 4C3QA 2WUQA 3V50A 3KYEA 2XK1A 1MWSA 3UE3A 5IS1A 4GJ4A 4X68A 1W63Q 2GX5A 2ZMVA 3ZVWA 2EX8A 4I3JA 5EVIA 3G34A 1P9WA 1E3UD 4N92A 5FQMA 5G4YA 4OVDA 4H8RA 4MNRA 2A49A 3DTEA 5CTNA 1LL5A 2EFXA 2B18A 3PXPA 4S2OA 5F1GA 4XUZA 4BD1A 4OOYA 4WM9A 1DRMA 3ZDJA 5EUAA 1TS7A 2LB5A 3LY4A 3VOZA 5FQQA 2A24A 1ERMA 3IXGA 1KE0A 1ES5A 1YM1A 3ZYTA 1OJGA 1VEUA 3C7UA 4OP8A 3T4OA 3JYIA 3ZG8B 3C5AA 4R3BA 3UMEA 3Q81A 1FOFA 1D06A 4OPRA 1RP5A 3S7PA 4GHIB 1G6AA 5A92A 4EU0A 1IKGA 2JKTM 2OSUA 3ISGA 1L0GA 3ZNTA 3LIBA 4NXFA 1FIKA 3S7QA 1HD8A 3UDIA 3VP0A 2RCXA 2WAFA 1PNEA 2HZ5A 4G3KA 1EWZA 4NXBA 1OTDA 1LL8A 4LRYC 3LFVA 4UEYA 2P08A 3KO6A 5EECA 5EE8A 1SKFA 3SW1A 2L0WA 3CPTA 5F5YA 2XD5A 3G2YA 4PM9A 2DCFA 4JGQA 3R7WB 4WLAA 1YLZA 4JF5A 3IS2B 5L8MA 3VSLA 4O7DA 2FZ0A 2ZL1A 2XROA 1TDGA 2Y2OA 3NECA 1NYYA 3HLGA 3OCLA 4IEDA 3LGOA 2Q9MA 4U0TA 4O0PA 3T1QB 3IWOA 3CHWP 1G6OA 5GL9A 3Q7VB 4O01A 3PAGA 3P01A 2PYRA 3OZHA 2JKTI 4LENA 2M1CA 3G6OA 2JN7A 2P9VA 1GA9A 3B3XA 1PWCA 4EERA 2VV7A 5F69A 1P97A 2EWWA 2V20A 2Y59A 4N9KA 4E3KA 4KUOA 4R70A 5HD3A 3L9KA 3QP4A 1PW1A 1RGZA 4N1XA 2XQZA 3PR6A 4DE2A 3UN7A 1CI8A 4QPRA 3MQQA 4DJ3A 3TOIA 3VFHA 1MC0A 4BL2A 4B93A 4DMZA 3C38A 1NXYA 5HX9A 4PKYG 4X69A 4DE3A 1S4SA 1E25A 2V0WA 2NUPC 2BTFP 2Y55A 1ES2A 1ESIA 3GQZA 5L10A 2EA9A 2ZQ9A 4FTXA 3U4LP 4KQQA 2VLGA 3GTCA 5C5KA 3KSFA 4Y0UA 3WS4A 4WN5A 4S2KA 4K91A 1VQQA 5F6AA 1OJ5A 3MZFA 1TD5A 4P87A 4Y15A 1K56A 4Q0JA 4C6YA 2JHEA 3GECA 1KDWA 2O9CA 1S0WA 2Y2PA 1ES3A 3NIAA 2PD8A 5TFQA 2QPNA 1MZUA 1XFNA 1YLTA 1E4DA 3ITBA 2ZBBA 3UE6A 2QWSA 1CK3A 3C30A 2HP9A 3CITA 5HPFA 3HL9A 3RJUA 4CPKA 4GNUA 1AWIA 4DKIA 4HEFA 3MXRA 1N9NA 3FWLA 1Y54A 4BENA 1PZOA 3V67A 2Y2QA 1Q2PA 5HDSA 5A90A 1F9IA 3H7WB 1I2SA 1ES4A 3UE1A 5HAQA 3UB6A 2Q9NA 3T4SA 1P0ZA 1YLWA 3BFEA 4OLDA 2J3TD 3V5MA 1MWRA 2V0UA 4R1GA 3OPLA 1KGFA 4HJ4A 3SS5A 4NKPA 4P85A 4GZBA 3G2ZA 4WF0A 2HDSA 5E43A 3HUOA 1PFLA 1WA9A 1RCJA 4HH3A 3F1PB 4MDZA 4BMWA 2Y2MA 5J3WA 4DXBA 1CF0A 5LBRA 1GCEA 4HY8A 4S2NA 2BLSA 2V8CA 4NXGA 1K0KA 5HWVA 4Y2FA 4F3LA 2XD1A 1KGGA 3M6BA 2OV5A 4KZ3A 5EVIC 1JWPA 2ZM0A 5CRFA 5I5LA 2V1AA 3E2LA 3TW8A 3A0SA 3CMZA 3ZVTA 2M7VA 5CERA 4QWOA 4K08A 4X1LA 1BLPA 4E3NA 3PTEA 2HDQA 1RGYA 5CXWA 3CUEA 2W0NA 2ZC7A 5A91A 3IBJA 5DF7A 3RTYA 3N8SA 3IWIA 2HPBA 3IXDA 4CJNA 3NHQA 3C7VA 3OCNA 3PAEA 1Q2QA 1F2KA 3PBSA 5TJJA 4OOLA 3QP5A 2R78A 4NETA 1N9OA 3E4QA 1CI9A 3SOIA 1KE4A 1JTDA 3E2KA 3OC2A 4U3TA 5J8XA 4ZAMA 3KX0X 5I94A 4IBXA 4LGWA 2VV6A 2X01A 4EUVA 4UHUA 5DKKA 2XH9A 1ALQA 3LO7A 1YMXA 1SCWA 5F82A 3LI8A 2FFYA 1DJCA 2VGLS 3TRCA 3ULFA 4QY6A 4C75A 4KQRA 1XPBA 4X53A 1YLPA 1IELA 4UA6A 5DKLA 3AGDA 4ARZA 5D3OA 5GHYA 3NI9A 3V3SA 4LRXC 1LHYA 1DJBA 2VGLM 5M1AA 3B33A 2Y2JA 3BY8A 4WEJA 2XFTA 3MQOA 3PBQA 4KZ7A 3ZGAB 4KZ5A 3UO9A 1XJ3A 2RL3A 1VEUB 3MR0A 2O9BA 3NDGA 1MXOA 3EEAA 4BQMA 4CLCA 4X56A 4P6ZS 2OOLA 5HDCA 3BFGA 1KVMA 1I5QA 2E8IA 1PZPA 3EEHA 3WS2A 1G28A 2JKGA 3NCKA 2DMWA 2FH5A 1DJAA 4D60A 1LSXA 1L2SA 5DJUA 2Z6CA 3NOUC 1K4FA 3UNWA 4GLQA 3UE0A 1MWTA 3BLMA 4MLLA 2ZQCA 3Q07A 3G4PA 4EESA 1PI5A 4ZJ1A 2XR0A 4E3MA 3KSIA 4RX3A 4I3AA 5HWTA 5AVFA 1ODVA 3O87A 3V3RA 1LT0A 1FCNA 3M2JA 3F1NA 2HDRA 4EBLA 2QJ7A 5JYPA 5FSRA 3MFDA 4RVAA 5CGSA 5A93A 1M40A 4OH0A 1NRJA 3GMWA 3LR5A 1K54A 2UWXA 2EWVA 3HLFA 4HQAA 1TS0A 4KUKA 3BFCA 1CJFA 3CJMA 5DTKA 3IF6C 3UDXA 4L9EA 4R6LA 3BFFA 4KZAA 3BQAA 2HJEA 4D2OA 5F83A 4HOIA 4ZJ2A 4I5SA 3BWLA 1FSWA 4X1MA 4EEPA 3D4FA 4QJGA 1LL9A 4NK3A 4X6TA 2WZZA 4FOFA 5FQ9A 2WYXA 3A3EA 5EOOA 1FILA 3LY3A 4B4XA 1UWPX 3FPWA 3LEQA 2XLNA 3CWFA 4F3LB 1JTGA 1OTAA 3HREA 1EI5A 2J80A 3LIFA 3GRJA 5G4ZA 3CUEC 1OT6A 2ZJ9A 4OOMA 2OLUA 1FCOA 3CG5A 1C3BA 4ESPA 3DTKA 5GLAA 3G30A 2YKHA 1ACFA 5AQ7A 4FD8A 3T1RA 3G32A 4GDBA 3HCYA 3HLCA 1GSVA 1YSQA 2P74A 2VX8A 2IA2A 2H5SA 4PM6A 1W8YA 1U60A 5J7EA 3HVFA 2ZOHA 3P7NA 4CQHA 5K5BA 1XGJA 2VGKA 2ZQDA 3IHAA 4E3IA 2KOIA 4KG5A 2BG1A 1TEMA 3FPVA 2V1BA 3LIEA 3Q82A 4RX2A 3M6HA 3HLBA 5CEDA 3O88A 3ITAA 2XDMA 1K57C 5FI7A 1NWZA 4P6BA 1LSVA 1IYQA 3JPUA 2ZC5B 4FCFA 1IYPA 1XP4A 2WKIA 4LCLA 4Y13A 2WKQA 3R4KA 4XUXA 1QMEA 2HJ9C 5HAPA 3ZG0A 2ZC3B 4YINA 5AVEA 2PBDP 2Q0OA 3MSHA 1F5MA 4ZJ3A 3B47A 4B9OA 1K57A 3IHBA 3C2WA 4WZ5A 1N4OA 2QKPA 2EXAA 2Y79A 5GHXA 3FZCA 3C8CA 1J9MA 2WKRA 5A8BA 4GOGA 1X0OA 5EVEA 2VV8A 4OQ0A 3OBFA 1N9BA 1VB6A 3LR0A 3QHYA 3ZG5A 3AGFA 1HLUP 1ZKJA 5M18A 5E2HA 3K2NA 3A3JA 1FQGA 3IXHA 2WGWA 4S2NC 3O3VA 1P9RA 5GLBA 3RXXA 4JLFA 4Y17A 3T1XA 4ZRRA 1BZAA 1XA7A 5DF9A 3WRTA 3BJNA 5EV0A 3KYZA 2PR5A 4EW7A 3DTMA 3HLWA 3IX8A 5FEFA 2V2FF 1JVJA 1TVFA 3PBOA 2XEPA 4WUJA 3UB7A 1NJ4A 3NJAA 4PAUA 1FSYA 1G5UA 2G2UA 3T12B 4DE0A 3JVUA 3GDIA 3NOTC 3W8KA 1HZOA 1L0EA 2QZ6A 4JKTA 2WGVA 4JXSA 5HAIA 4IJGA 4HNBA 2YKFA 2Y4AA 1XX2A 2XF3A 4Q0HA 3W4OA 5AQAA 2G7UA 2J9PA 1SHVA 1GSWA 4DJ2A 4RYEA 1MPLA 2O0YA 3VFFA 1PYYA 3QP1A 2K7SA 1NYMA 4X55A 2IWBA 1KVLA 1H5XA 3BYDA 3SZTA 4AFIA 5F1FA 3F1NB 1KOUA 1YKDA 1L0DA 3A0RA 4EV4A 3K3CA 3IF5A 3CZDA 1XJ2A 5EM0A 5HW3A 3D9YA 3W2ZA 3E98A 4E3LA 3GSGA 1TS6A 2PR6A 1XA1A 4BBTA 3IS2A 3MS6A 3BECA 4P0MA 5GHZA 4HHDA 3HUNA 3N8RA 3V39A 2C5WB 1XFQA 5HPIA 1XXMA 4BWIA 3T4TA 3N6IA 4ZTKA 3F1OB 4KZ4A 4R4SA 3OPRA 4H6JB 2EFUA 4R0QA 2PAVP 4ETXA 2W3EA 2ZLYA 3R7WA 4NEED 1LLBA 4UQIS 2W27A 3P09A 1Y4OA 2ZQAA 5KZHA 3W4QA 1K4EA 1ONGA 2JKRI 3HUMA 4HJ6A 4CLCB 2WK0A 2W3DA 5L07A 5G18A 4GHIA 4WZ4A 1BLSA 3LICA 2K31A 4JF4A 1H8ZA 4EUZA 5CECA 2ZM8A 3NDEA 3MMHA 4B4ZA 5CGXA 2X71A 1BSGA 4MBHA 3MKEA 4DF6A 3QP8A 1T1BA 4E6WA 1PWDA 5EM1A 1VETA 1NY0A 2VEAA 1HVBA 3RFBA 5KSCA 2L4RA 1CQAA 1LSWA 5TGFA 3CLOA 4I39A 3IF6B 1ZHHB 2GJ3A 2E8JA 4DDSA 1BLHA 4GD8A 3OLOA 3T4KA 4Z1WA 2Y2HA 3VOLA 2WKHA 1VETB 4NG2A 4R3JA 1K55A 5FDSA 4XXRA 2JKRM 4OKPA 4UAAA 2H28A 1M6KA 4PM8A 1UGUA 3C4PA 1XJ4A 5EOEA 2H0YA 5E2EA 4ETZA 3VP3A 1MWUA 3NULA 3Q7ZA 3O5YA 4OQGA 2A3UA 1MY8A 4Y7PA 4HH2A 4QD4A 3PHYA 1MKIA 5DF8A 4EXOA 2LB9A 5IHVA 4LRZE 2W1RA 4GCZA 2JC7A 4LV2A 4GS9A 3W4PA 1QMFA 1T18A 4MEZA 4DE1A 2ACGA 2W3FA 4HBTA 2PYPA 5L09A 1OT9A 1EW0A 2VGJA 5HWWA 1S67L 4U0XA 1E3UA 4MCWA 4OPYA 3UB5P 3TE8A 4F94A 3H7WA 4N9LA 1WE4A 3A3DA 3BRMA 3DTIA 3ZG7B 1G68A 5AQ9A 3T4LA 1YPRA 4E3JA 4NXEA 1TF1A 2CC1A 3PBRA 4Y3IA 3IH8A 3DAVA 3TG9A 4M3KA 1KE3A 5FQIA 3UPOA 3ZG9B 2QHKA 3E4OA 1JWVA 2Z2LB 3BM6A 5DTSA 2HGVA 3Q7VA 2XA7S 4IHQA 4KZ6A 4WMCD 1K6RA 4R23A 2H10A
chains in the Genus database with same CATH topology
5HZHA 2D02A 2OWJA 1T19A 4WN5A 5MC7A 5F6AA 2K2NA 4KQOA 4BBUA 5J4EA 2KOIA 4WEKA 1OJ5A 1TD5A 3FPVA 4Q0JA 4IUHA 2JHEA 3GECA 5IU1A 5AJGA 2O9CA 2V1BA 2Z6DA 3LIEA 2W3HA 2P04A 2NUTC 5KSHA 2XA7M 1MKMA 4YNRA 3U2AA 2PD8A 4HJ3A 1V9YA 1D7EA 1MZUA 1XFNA 1NWZA 2BASA 3K3DA 1LSVA 4BBVA 4IUKA 2QJ5A 2XSSA 2ZBBA 1OTIA 3UE6A 4M4XA 2QWSA 4ME4A 3C30A 4G3VA 3CITA 3LI9A 3ZQ5A 3LR4A 5HPFA 5DFYA 3EGDC 2WKQA 3R4KA 1N9NA 4JGOA 1S1ZA 2HJ9C 1YSPA 3V67A 4FSFA 4MN6A 1OTEA 4WL9A 5HDSA 3RH8B 5AVEA 1T1AA 4E04A 1F9IA 3H7WB 2MJ6A 4PKYA 2VZWA 1UWNX 3UB6A 3T4SA 1P0ZA 1F5MA 2J3TD 3MFXA 3B47A 2V0UA 4B9OA 3C2WA 4HJ4A 4XT2B 5HDDA 3EOIA 3S7NA 1TS8A 4NKPA 1DP6A 2QKPA 2W1TA 3T4JA 2Y79A 4WF0A 4O8GA 1WA9A 2L1MA 4DN0A 4HH3A 3PBNA 3F1PB 4MDZA 3C8CA 2WKRA 4HI4A 4BMWA 5A8BA 1X0OA 3T50A 3S7OA 3UB8A 2VV8A 5J3WA 4CLCC 3OBFA 3VV4A 2KX6A 5LBRA 1S1YA 1S66L 1VB6A 4HY8A 1BYWA 3B42A 4NXGA 1GSXA 2O9AA 3LR0A 2OAP1 5HWVA 3D72A 1Y28A 4Y2FA 1STZA 4F3LA 3EQUA 3HJKA 3NOPC 3K2NA 3LIAA 3LIDA 5I5LA 4CLCE 2V1AA 1P9RA 4ZRRA 3TW8A 3A0SA 5DF9A 3EWKA 3BJNA 4RQ9A 2M7VA 3KYZA 3D3OA 2PR5A 2XRNA 2W3GA 4K08A 4EW7A 2PDRA 3DBAA 2PT7A 1NLYA 3FG8A 5DFXA 3LYXA 1NLZA 4MN7A 3PBOA 2VJWA 4WUJA 3UB7A 3CUEA 3NJAA 4PAUA 1H3QA 2W0NA 3IBJA 3RTYA 3JVUA 3GDIA 2KDKA 3NOTC 2A24B 3NHQA 3OCNA 2J3TC 4JGRA 3PBSA 2OAQ1 4IJGA 5TJJA 4YOFA 2J3WA 2A2LA 4OOLA 5HSQA 4HNBA 2YKFA 2R78A 1N9OA 4KQDA 3E4QA 3MJQA 4Q0HA 4BJPA 3OC2A 2G7UA 1VHMA 4LPZA 4P6ZM 4UQIM 1GSWA 3KX0X 4DJ2A 2P7JA 3TJZC 2O0YA 1W63M 2K7SA 2VV6A 3H9WA 4R3AA 2VA0A 3H82A 4AFIA 2GZAA 4JGPA 5TBMA 4EUVA 5DKKA 3F1NB 1OPXA 2KLIA 1KOUA 1OTBA 1YKDA 4G3WA 3UB9A 3UMDA 3LI8A 1S4RA 2VGLS 3A0RA 3H82B 2GNXA 3K3CA 4YWZA 3TRCA 3ULFA 3VE4A 1XJ2A 3BW6A 3W2ZA 3UE3A 5IS1A 3E98A 5DKLA 4GJ4A 3MXQA 1W63Q 2GX5A 2ZMVA 4ARZA 1TS6A 2M7UA 2PR6A 4I3JA 4BBTA 1P9WA 3IS2A 5G4YA 4LRXC 4HHDA 2VGLM 3B33A 4MN5A 3BY8A 4WEJA 4EETB 5FL3A 1XFQA 5HPIA 2B18A 3MQOA 3PBQA 3PXPA 1IFQA 3IBRA 4BWIA 4PHTA 3T4TA 1XJ3A 3F1OB 3MR0A 3CAXA 1DRMA 5CX7A 2O9BA 1TS7A 2LB5A 1N9LA 2A24A 3EEAA 4H6JB 4CLCA 4P6ZS 5HL6A 2OOLA 5HDCA 3ZYTA 1OJGA 4ETXA 2W3EA 4MMNA 3T4OA 4Q0IA 3R7WA 4NEED 4EEUA 4UQIS 2W27A 3PYPA 4GS9B 3UMEA 3ICYA 2D01A 3T4QA 1D06A 3E4PA 2ZMFA 3EEHA 1G28A 1V9ZA 2JKRI 3S7PA 2DMWA 4GHIB 2FH5A 4HJ6A 3MQ0A 4EU0A 1LSXA 2JKTM 4H6JA 5DJUA 2Z6CA 4CLCB 2W3DA 3NOUC 5IT5A 2Y8HA 3LIBA 4NXFA 4GHIA 4GLQA 3LICA 1IOUA 2K31A 3S7QA 2OWHA 1F98A 3EQVA 4EESA 4G3KA 4NXBA 4EQ1A 2HV1A 1OTDA 4WELA 1LL8A 4LRYC 3LFVA 4UEYA 3MMHA 2P08A 3KO6A 3KSIA 1T1CA 1ZTUA 4I3AA 3SW1A 2L0WA 5F5YA 5HWTA 5AVFA 1ODVA 1LT0A 4JGQA 3R7WB 4WLAA 3BQ8A 3F1NA 1T1BA 5L8MA 3IS2B 3KSGA 2QJ7A 2VEAA 5DJTA 3HJIA 2FZ0A 3RFBA 2L4RA 3LR3A 2XROA 3KSHA 1LSWA 1NRJA 3CLOA 2HF6A 4I39A 3LR5A 3OCLA 1ZHHB 2GJ3A 3E0YA 4O0PA 2EWVA 4HP4A 1JNUA 3OLOA 4HQAA 3F1PA 1G6OA 3T4KA 1TS0A 4KUKA 4Z1WA 4LLOB 4O01A 3P01A 2PYRA 3VOLA 2JKTI 4L9EA 2M1CA 4R6LA 3G6OA 3JVVA 2VKSA 4XT2A 3A0VA 2JKRM 2JN7A 4HIAA 3FC7A 2H28A 3BQAA 1UGUA 2HJEA 1XJ4A 4ETZA 4HOIA 4I3IA 2ZOIA 4EERA 4I5SA 2VV7A 2O99A 3BWLA 5F69A 3O5YA 1P97A 2EWWA 1DP9A 4GW9A 2CMNA 2I9VA 4EEPA 2WKPA 4HH2A 3PHYA 4EXOA 2LB9A 4HP9A 4LRZE 4FOFA 2V9AA 4L9FA 4KUOA 4R70A 4ARZB 5HD3A 2W1RA 4GCZA 5TBMB 3MF0A 1UWPX 2INWA 3FPWA 3PR6A 4GS9A 3EGXC 3CWFA 4F3LB 1T18A 1OTAA 2PHYA 2J80A 4QPRA 2PD7A 4R38A 2W3FA 3MQQA 2PYPA 1H8MA 1OT9A 3LIFA 4DJ3A 1EW0A 2W1TB 5HWWA 1MC0A 1YAXA 1S67L 3KYQA 5G4ZA 4Y5FA 4B93A 4CLCD 4DMZA 4MCWA 3CUEC 3C38A 1DP8A 1XJ6A 1OT6A 4OOMA 3TE8A 3H7WA 3OOVA 4I38A 4PKYG 5EFWA 1S4SA 2YKHA 2V0WA 3CI6A 2NUPC 3T4LA 2QYBA 4NXEA 1TF1A 3PBRA 4Y3IA 2B02A 2EA9A 2QHKA 3HCYA 3F1OA 3E4OA 1GSVA 4L9GA 4L0LA 1YSQA 5HD5A 2VX8A 3VE3A 2IA2A 2HGVA 2VLGA 5F68A 2XA7S 4IHQA 5C5KA 5KIZA 5J7EA 2ZOHA 4II7A 3PBTA 3P7NA 4CQHA 3KSFA 5K5BA 3LUQA 3BY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC D;  4NKP A;  4CLC B;  2A2L A;  5CX7 A;  4CLC E;  3FPV A;  4CLC C;  3FPW A;  4BMW A;  4CLC A; 
#chains in the Genus database with same CATH topology
 5HZH A;  2D02 A;  1T19 A;  2J8Y A;  4GB7 A;  5MC7 A;  4BD0 A;  2JKF A;  1OME A;  4UA9 A;  2K2N A;  3VP4 A;  1ERO A;  5J4E A;  3IXB A;  4IUH A;  5IU1 A;  3VSK A;  2P04 A;  2NUT C;  5HFO A;  2XA7 M;  5KSH A;  4YNR A;  3U2A A;  4HJ3 A;  4EBP A;  1KDS A;  4E6X A;  2DRW A;  4IUK A;  2QJ5 A;  2XSS A;  4M4X A;  2FFF B;  1K54 C;  4ME4 A;  4G3V A;  3ZQ5 A;  5BOH A;  2Y91 A;  3LR4 A;  2HP6 A;  5DFY A;  4JGO A;  1S1Z A;  1LI9 A;  4FSF A;  1FCM A;  4MN6 A;  5TR7 A;  4WL9 A;  3RH8 B;  2MJ6 A;  4PKY A;  3DW0 A;  1UWN X;  3WS0 A;  2PU2 A;  2Y2K A;  3NC8 A;  4QB8 A;  3WS5 A;  1PRQ A;  4K0X A;  2Y2I A;  4XT2 B;  2XFS A;  5HDD A;  3EOI A;  3S7N A;  2W1T A;  3L7H A;  2OLV A;  3T1S A;  3T4J A;  3HLD A;  4O8G A;  2L1M A;  4LV0 A;  2ZC4 B;  3UDF A;  3VV4 A;  2KX6 A;  1S1Y A;  1BYW A;  5HAR A;  1SZV A;  3B42 A;  2OAP 1;  3O86 A;  2WGW B;  5EVI D;  3D72 A;  1Y28 A;  1STZ A;  4DRT A;  3HJK A;  3S1Y A;  4JXW A;  4MBK A;  4ZBE A;  4CLC E;  1PIO A;  1SDE A;  3ZHH A;  2QMI A;  4KZ8 A;  3D3O A;  2XRN A;  1NZU A;  1XKZ A;  2PDR A;  4GN2 A;  2EX2 A;  3OPP A;  5E2G A;  3LYX A;  4MN7 A;  2UV0 E;  3SH9 A;  5FAS A;  5FAQ A;  4S2L A;  2KDK A;  2A24 B;  5FI2 A;  3SS4 A;  2HP5 A;  1J3W A;  1FR6 A;  1O07 A;  5FQJ A;  4WMC A;  4FH4 A;  4JGR A;  4YOF A;  2A2L A;  5HSQ A;  2JCH A;  3FV7 A;  1K25 A;  4KQD A;  1BUL A;  3MJQ A;  4BJP A;  1FR1 A;  1VHM A;  4LPZ A;  4S2M A;  1I2W A;  2R9W A;  3MXS A;  4JPM A;  1TDL A;  3TJZ C;  4LV3 A;  3H9W A;  4JGP A;  5TBM A;  4DXC A;  3UMD A;  1OTB A;  3MKF A;  1K56 D;  4RA7 A;  2Y2L A;  3H82 B;  2GNX A;  4YWZ A;  3HBR A;  4KEN B;  3VE4 A;  1PW8 A;  3BW6 A;  4FUW A;  3N4I A;  4WYY A;  4EQI A;  4JF6 A;  1A0K A;  5L2F A;  3MXQ A;  1MBL A;  5CGW A;  3BFD A;  3TSG A;  1IYO A;  4LV1 A;  2M7U A;  5CHM A;  3UPN A;  4IVK A;  3S4X A;  4PMA A;  1ONH A;  2XGN A;  4MN5 A;  2G2W A;  4EET B;  5FL3 A;  5CHU A;  1D1J A;  3SS3 A;  1IFQ A;  1W79 A;  3IBR A;  4PHT A;  4OLG A;  5GLD A;  1ERQ A;  5FEG A;  4GDN A;  3CAX A;  5CX7 A;  1AXB A;  1N9L A;  2H0T A;  5CTM A;  5HL6 A;  4MMN A;  4Q0I A;  4Q8I A;  3A3F A;  2J7V A;  4EEU A;  4Y0O A;  4WZ5 C;  3PYP A;  4GS9 B;  2WKE A;  1WYC A;  3DWK A;  3ICY A;  2D01 A;  3T4Q A;  3E4P A;  2ZMF A;  2Y2N A;  1ESU A;  5JYO A;  1YLY A;  1V9Z A;  2WAD A;  3GR2 A;  2B5R A;  3MQ0 A;  4H6J A;  4JXV A;  4BL3 A;  4A5R A;  5IT5 A;  1GHM A;  2Y8H A;  1IOU A;  3MZD A;  2I72 A;  2OWH A;  3NY4 A;  1F98 A;  1BTL A;  3EQV A;  4N1H A;  4EQ1 A;  2HV1 A;  4WEL A;  1YQS A;  3AGE A;  1T1C A;  1ZTU A;  1SKO B;  1IYS A;  1K6S A;  3S22 A;  3A3I A;  3BQ8 A;  4IVI A;  3KSG A;  2WGI A;  5DJT A;  3HJI A;  3LR3 A;  4QHC A;  3KSH A;  2HF6 A;  4DDY A;  2HDU A;  1GA0 A;  3E0Y A;  2GDN A;  2ZL1 B;  5HL1 A;  4HP4 A;  1JNU A;  2WAE A;  1ZG6 A;  3F1P A;  4LLO B;  2AVX A;  1JWZ A;  2Z2M B;  5GLC A;  4UA7 A;  3JVV A;  4XT2 A;  2VKS A;  5E2F A;  3A0V A;  1H0M A;  3N7W A;  4HIA A;  3FC7 A;  1ZG4 A;  1SDN A;  4EBN A;  4I3I A;  2EXB A;  2ZOI A;  3SH7 A;  4EWF A;  2O99 A;  3RXW A;  1H8Y A;  3CPT B;  1DP9 A;  4GW9 A;  2CMN A;  4KG2 A;  2I9V A;  1K55 C;  4OQI A;  2WKP A;  3GVB A;  3IH9 A;  3G31 A;  4ID4 A;  2V8F A;  3FKV A;  4HP9 A;  2V9A A;  4L9F A;  2ZQ7 A;  4ARZ B;  4X25 A;  2ZM2 A;  5TBM B;  3FKW A;  3MF0 A;  2INW A;  3LCE A;  1O7E A;  3EGX C;  5EPH A;  4KZ9 A;  1W8Q A;  5FDH A;  1Z09 A;  2PHY A;  2PD7 A;  4R38 A;  4WBG A;  1H8M A;  3Q1F A;  2IWD A;  2W1T B;  1YAX A;  3WWX A;  3KYQ A;  3ZNY A;  4Y5F A;  4CLC D;  2JE5 A;  5FA7 A;  1DP8 A;  3NBL A;  1XJ6 A;  3MBZ A;  3OOV A;  4I38 A;  3SH8 A;  3C4O A;  4E3O A;  2ZMA A;  2ZQ8 A;  5EFW A;  4R4R A;  1LI0 A;  3CI6 A;  2QYB A;  4K0W A;  4LCM A;  3VP2 A;  4Y0T A;  5DTT A;  1DY6 A;  4KZB A;  4OP5 A;  2B02 A;  1YLJ A;  1YT4 A;  3QP2 A;  4PPR A;  5FAO A;  5DVA A;  1IKI A;  3F1O A;  4L9G A;  3UY6 A;  4L0L A;  5HD5 A;  2DNS A;  3VE3 A;  5F68 A;  4MBF A;  5KIZ A;  3UPP A;  4II7 A;  3QP6 A;  3PBT A;  3QNC A;  3LUQ A;  3BY9 A;  3IX4 A;  4Z9Q A;  2OWJ A;  4GD6 A;  4KQO A;  4BBU A;  4WEK A;  3G35 A;  2EX6 A;  2PBY A;  2C6W B;  5CEB A;  3I7J A;  1IEM A;  5AJG A;  1BLC A;  2PRF A;  2Z6D A;  2W3H A;  3WRZ A;  2B95 A;  1GHI A;  1MKM A;  3VP1 A;  1V9Y A;  1D7E A;  2Y2G A;  4JXG A;  4PM7 A;  5FQK A;  4OPQ A;  2BAS A;  3K3D A;  5AQB A;  3BLS A;  3BEB A;  4BBV A;  1OTI A;  3LI9 A;  1VM1 A;  1BUE A;  3MZE A;  2IWC A;  3EGD C;  1YSP A;  4LFU A;  3VMA A;  1SKO A;  1OTE A;  1T1A A;  4E04 A;  5FI6 A;  2VZW A;  4S2J A;  3MFX A;  4QY5 A;  3FYZ A;  5FAP A;  4HBU A;  4FH2 A;  1TS8 A;  1DP6 A;  1NRF A;  4BLM A;  3IQA A;  2ZD8 A;  1WYB A;  4IBR A;  1K38 A;  4DN0 A;  1L0F A;  3PBN A;  4HI4 A;  1ZC2 A;  3T50 A;  3S7O A;  3IT9 A;  3UB8 A;  2V1Z A;  1YMS A;  5EVI B;  5EVL A;  4CLC C;  4B88 A;  3DWZ A;  3OPH A;  3ZFZ A;  1L3L A;  1S66 L;  4JBF A;  5CHJ A;  1GSX A;  2O9A A;  4OQH A;  1W7F A;  2ZC6 B;  1NZO A;  4S2I A;  1HTZ A;  4YFM A;  3EQU A;  5KMW A;  3NOP C;  3LIA A;  4OON A;  1XGI A;  3LID A;  1CEG A;  5M19 A;  3WS1 A;  3EWK A;  4OPZ A;  2PU4 A;  3VOY A;  4RQ9 A;  4HES A;  3QNB A;  2W3G A;  3N8L A;  2PT7 A;  3DBA A;  1NLY A;  3FG8 A;  1W5D A;  5DFX A;  4S2P A;  1NLZ A;  2X02 A;  3M2K A;  2VJW A;  2P9V B;  1KGE A;  1H3Q A;  1PI4 A;  4ZDX A;  4GKU A;  5FAT A;  3HLE A;  2J3T C;  1GHP A;  3IX3 A;  3P98 A;  2OAQ 1;  2J3W A;  4PM5 A;  3IF6 A;  2EX9 A;  3LEZ A;  3GV9 A;  3IWQ A;  4P6Z M;  4UQI M;  3ZCZ A;  2JBF A;  2VK3 A;  2P7J A;  1W63 M;  5U47 A;  1S6R A;  4KG6 A;  2WZX A;  4QU3 A;  4R3A A;  2VA0 A;  3H82 A;  1Z6F A;  2GZA A;  2R9X A;  1CEF A;  1OPX A;  2KLI A;  1BT5 A;  1PWG A;  4G3W A;  3UB9 A;  1S4R A;  2J9O A;  4C3Q A;  2WUQ A;  3V50 A;  3KYE A;  2XK1 A;  1MWS A;  3UE3 A;  5IS1 A;  4GJ4 A;  4X68 A;  1W63 Q;  2GX5 A;  2ZMV A;  3ZVW A;  2EX8 A;  4I3J A;  5EVI A;  3G34 A;  1P9W A;  1E3U D;  4N92 A;  5FQM A;  5G4Y A;  4OVD A;  4H8R A;  4MNR A;  2A49 A;  3DTE A;  5CTN A;  1LL5 A;  2EFX A;  2B18 A;  3PXP A;  4S2O A;  5F1G A;  4XUZ A;  4BD1 A;  4OOY A;  4WM9 A;  1DRM A;  3ZDJ A;  5EUA A;  1TS7 A;  2LB5 A;  3LY4 A;  3VOZ A;  5FQQ A;  2A24 A;  1ERM A;  3IXG A;  1KE0 A;  1ES5 A;  1YM1 A;  3ZYT A;  1OJG A;  1VEU A;  3C7U A;  4OP8 A;  3T4O A;  3JYI A;  3ZG8 B;  3C5A A;  4R3B A;  3UME A;  3Q81 A;  1FOF A;  1D06 A;  4OPR A;  1RP5 A;  3S7P A;  4GHI B;  1G6A A;  5A92 A;  4EU0 A;  1IKG A;  2JKT M;  2OSU A;  3ISG A;  1L0G A;  3ZNT A;  3LIB A;  4NXF A;  1FIK A;  3S7Q A;  1HD8 A;  3UDI A;  3VP0 A;  2RCX A;  2WAF A;  1PNE A;  2HZ5 A;  4G3K A;  1EWZ A;  4NXB A;  1OTD A;  1LL8 A;  4LRY C;  3LFV A;  4UEY A;  2P08 A;  3KO6 A;  5EEC A;  5EE8 A;  1SKF A;  3SW1 A;  2L0W A;  3CPT A;  5F5Y A;  2XD5 A;  3G2Y A;  4PM9 A;  2DCF A;  4JGQ A;  3R7W B;  4WLA A;  1YLZ A;  4JF5 A;  3IS2 B;  5L8M A;  3VSL A;  4O7D A;  2FZ0 A;  2ZL1 A;  2XRO A;  1TDG A;  2Y2O A;  3NEC A;  1NYY A;  3HLG A;  3OCL A;  4IED A;  3LGO A;  2Q9M A;  4U0T A;  4O0P A;  3T1Q B;  3IWO A;  3CHW P;  1G6O A;  5GL9 A;  3Q7V B;  4O01 A;  3PAG A;  3P01 A;  2PYR A;  3OZH A;  2JKT I;  4LEN A;  2M1C A;  3G6O A;  2JN7 A;  2P9V A;  1GA9 A;  3B3X A;  1PWC A;  4EER A;  2VV7 A;  5F69 A;  1P97 A;  2EWW A;  2V20 A;  2Y59 A;  4N9K A;  4E3K A;  4KUO A;  4R70 A;  5HD3 A;  3L9K A;  3QP4 A;  1PW1 A;  1RGZ A;  4N1X A;  2XQZ A;  3PR6 A;  4DE2 A;  3UN7 A;  1CI8 A;  4QPR A;  3MQQ A;  4DJ3 A;  3TOI A;  3VFH A;  1MC0 A;  4BL2 A;  4B93 A;  4DMZ A;  3C38 A;  1NXY A;  5HX9 A;  4PKY G;  4X69 A;  4DE3 A;  1S4S A;  1E25 A;  2V0W A;  2NUP C;  2BTF P;  2Y55 A;  1ES2 A;  1ESI A;  3GQZ A;  5L10 A;  2EA9 A;  2ZQ9 A;  4FTX A;  3U4L P;  4KQQ A;  2VLG A;  3GTC A;  5C5K A;  3KSF A;  4Y0U A;  3WS4 A;  4WN5 A;  4S2K A;  4K91 A;  1VQQ A;  5F6A A;  1OJ5 A;  3MZF A;  1TD5 A;  4P87 A;  4Y15 A;  1K56 A;  4Q0J A;  4C6Y A;  2JHE A;  3GEC A;  1KDW A;  2O9C A;  1S0W A;  2Y2P A;  1ES3 A;  3NIA A;  2PD8 A;  5TFQ A;  2QPN A;  1MZU A;  1XFN A;  1YLT A;  1E4D A;  3ITB A;  2ZBB A;  3UE6 A;  2QWS A;  1CK3 A;  3C30 A;  2HP9 A;  3CIT A;  5HPF A;  3HL9 A;  3RJU A;  4CPK A;  4GNU A;  1AWI A;  4DKI A;  4HEF A;  3MXR A;  1N9N A;  3FWL A;  1Y54 A;  4BEN A;  1PZO A;  3V67 A;  2Y2Q A;  1Q2P A;  5HDS A;  5A90 A;  1F9I A;  3H7W B;  1I2S A;  1ES4 A;  3UE1 A;  5HAQ A;  3UB6 A;  2Q9N A;  3T4S A;  1P0Z A;  1YLW A;  3BFE A;  4OLD A;  2J3T D;  3V5M A;  1MWR A;  2V0U A;  4R1G A;  3OPL A;  1KGF A;  4HJ4 A;  3SS5 A;  4NKP A;  4P85 A;  4GZB A;  3G2Z A;  4WF0 A;  2HDS A;  5E43 A;  3HUO A;  1PFL A;  1WA9 A;  1RCJ A;  4HH3 A;  3F1P B;  4MDZ A;  4BMW A;  2Y2M A;  5J3W A;  4DXB A;  1CF0 A;  5LBR A;  1GCE A;  4HY8 A;  4S2N A;  2BLS A;  2V8C A;  4NXG A;  1K0K A;  5HWV A;  4Y2F A;  4F3L A;  2XD1 A;  1KGG A;  3M6B A;  2OV5 A;  4KZ3 A;  5EVI C;  1JWP A;  2ZM0 A;  5CRF A;  5I5L A;  2V1A A;  3E2L A;  3TW8 A;  3A0S A;  3CMZ A;  3ZVT A;  2M7V A;  5CER A;  4QWO A;  4K08 A;  4X1L A;  1BLP A;  4E3N A;  3PTE A;  2HDQ A;  1RGY A;  5CXW A;  3CUE A;  2W0N A;  2ZC7 A;  5A91 A;  3IBJ A;  5DF7 A;  3RTY A;  3N8S A;  3IWI A;  2HPB A;  3IXD A;  4CJN A;  3NHQ A;  3C7V A;  3OCN A;  3PAE A;  1Q2Q A;  1F2K A;  3PBS A;  5TJJ A;  4OOL A;  3QP5 A;  2R78 A;  4NET A;  1N9O A;  3E4Q A;  1CI9 A;  3SOI A;  1KE4 A;  1JTD A;  3E2K A;  3OC2 A;  4U3T A;  5J8X A;  4ZAM A;  3KX0 X;  5I94 A;  4IBX A;  4LGW A;  2VV6 A;  2X01 A;  4EUV A;  4UHU A;  5DKK A;  2XH9 A;  1ALQ A;  3LO7 A;  1YMX A;  1SCW A;  5F82 A;  3LI8 A;  2FFY A;  1DJC A;  2VGL S;  3TRC A;  3ULF A;  4QY6 A;  4C75 A;  4KQR A;  1XPB A;  4X53 A;  1YLP A;  1IEL A;  4UA6 A;  5DKL A;  3AGD A;  4ARZ A;  5D3O A;  5GHY A;  3NI9 A;  3V3S A;  4LRX C;  1LHY A;  1DJB A;  2VGL M;  5M1A A;  3B33 A;  2Y2J A;  3BY8 A;  4WEJ A;  2XFT A;  3MQO A;  3PBQ A;  4KZ7 A;  3ZGA B;  4KZ5 A;  3UO9 A;  1XJ3 A;  2RL3 A;  1VEU B;  3MR0 A;  2O9B A;  3NDG A;  1MXO A;  3EEA A;  4BQM A;  4CLC A;  4X56 A;  4P6Z S;  2OOL A;  5HDC A;  3BFG A;  1KVM A;  1I5Q A;  2E8I A;  1PZP A;  3EEH A;  3WS2 A;  1G28 A;  2JKG A;  3NCK A;  2DMW A;  2FH5 A;  1DJA A;  4D60 A;  1LSX A;  1L2S A;  5DJU A;  2Z6C A;  3NOU C;  1K4F A;  3UNW A;  4GLQ A;  3UE0 A;  1MWT A;  3BLM A;  4MLL A;  2ZQC A;  3Q07 A;  3G4P A;  4EES A;  1PI5 A;  4ZJ1 A;  2XR0 A;  4E3M A;  3KSI A;  4RX3 A;  4I3A A;  5HWT A;  5AVF A;  1ODV A;  3O87 A;  3V3R A;  1LT0 A;  1FCN A;  3M2J A;  3F1N A;  2HDR A;  4EBL A;  2QJ7 A;  5JYP A;  5FSR A;  3MFD A;  4RVA A;  5CGS A;  5A93 A;  1M40 A;  4OH0 A;  1NRJ A;  3GMW A;  3LR5 A;  1K54 A;  2UWX A;  2EWV A;  3HLF A;  4HQA A;  1TS0 A;  4KUK A;  3BFC A;  1CJF A;  3CJM A;  5DTK A;  3IF6 C;  3UDX A;  4L9E A;  4R6L A;  3BFF A;  4KZA A;  3BQA A;  2HJE A;  4D2O A;  5F83 A;  4HOI A;  4ZJ2 A;  4I5S A;  3BWL A;  1FSW A;  4X1M A;  4EEP A;  3D4F A;  4QJG A;  1LL9 A;  4NK3 A;  4X6T A;  2WZZ A;  4FOF A;  5FQ9 A;  2WYX A;  3A3E A;  5EOO A;  1FIL A;  3LY3 A;  4B4X A;  1UWP X;  3FPW A;  3LEQ A;  2XLN A;  3CWF A;  4F3L B;  1JTG A;  1OTA A;  3HRE A;  1EI5 A;  2J80 A;  3LIF A;  3GRJ A;  5G4Z A;  3CUE C;  1OT6 A;  2ZJ9 A;  4OOM A;  2OLU A;  1FCO A;  3CG5 A;  1C3B A;  4ESP A;  3DTK A;  5GLA A;  3G30 A;  2YKH A;  1ACF A;  5AQ7 A;  4FD8 A;  3T1R A;  3G32 A;  4GDB A;  3HCY A;  3HLC A;  1GSV A;  1YSQ A;  2P74 A;  2VX8 A;  2IA2 A;  2H5S A;  4PM6 A;  1W8Y A;  1U60 A;  5J7E A;  3HVF A;  2ZOH A;  3P7N A;  4CQH A;  5K5B A;  1XGJ A;  2VGK A;  2ZQD A;  3IHA A;  4E3I A;  2KOI A;  4KG5 A;  2BG1 A;  1TEM A;  3FPV A;  2V1B A;  3LIE A;  3Q82 A;  4RX2 A;  3M6H A;  3HLB A;  5CED A;  3O88 A;  3ITA A;  2XDM A;  1K57 C;  5FI7 A;  1NWZ A;  4P6B A;  1LSV A;  1IYQ A;  3JPU A;  2ZC5 B;  4FCF A;  1IYP A;  1XP4 A;  2WKI A;  4LCL A;  4Y13 A;  2WKQ A;  3R4K A;  4XUX A;  1QME A;  2HJ9 C;  5HAP A;  3ZG0 A;  2ZC3 B;  4YIN A;  5AVE A;  2PBD P;  2Q0O A;  3MSH A;  1F5M A;  4ZJ3 A;  3B47 A;  4B9O A;  1K57 A;  3IHB A;  3C2W A;  4WZ5 A;  1N4O A;  2QKP A;  2EXA A;  2Y79 A;  5GHX A;  3FZC A;  3C8C A;  1J9M A;  2WKR A;  5A8B A;  4GOG A;  1X0O A;  5EVE A;  2VV8 A;  4OQ0 A;  3OBF A;  1N9B A;  1VB6 A;  3LR0 A;  3QHY A;  3ZG5 A;  3AGF A;  1HLU P;  1ZKJ A;  5M18 A;  5E2H A;  3K2N A;  3A3J A;  1FQG A;  3IXH A;  2WGW A;  4S2N C;  3O3V A;  1P9R A;  5GLB A;  3RXX A;  4JLF A;  4Y17 A;  3T1X A;  4ZRR A;  1BZA A;  1XA7 A;  5DF9 A;  3WRT A;  3BJN A;  5EV0 A;  3KYZ A;  2PR5 A;  4EW7 A;  3DTM A;  3HLW A;  3IX8 A;  5FEF A;  2V2F F;  1JVJ A;  1TVF A;  3PBO A;  2XEP A;  4WUJ A;  3UB7 A;  1NJ4 A;  3NJA A;  4PAU A;  1FSY A;  1G5U A;  2G2U A;  3T12 B;  4DE0 A;  3JVU A;  3GDI A;  3NOT C;  3W8K A;  1HZO A;  1L0E A;  2QZ6 A;  4JKT A;  2WGV A;  4JXS A;  5HAI A;  4IJG A;  4HNB A;  2YKF A;  2Y4A A;  1XX2 A;  2XF3 A;  4Q0H A;  3W4O A;  5AQA A;  2G7U A;  2J9P A;  1SHV A;  1GSW A;  4DJ2 A;  4RYE A;  1MPL A;  2O0Y A;  3VFF A;  1PYY A;  3QP1 A;  2K7S A;  1NYM A;  4X55 A;  2IWB A;  1KVL A;  1H5X A;  3BYD A;  3SZT A;  4AFI A;  5F1F A;  3F1N B;  1KOU A;  1YKD A;  1L0D A;  3A0R A;  4EV4 A;  3K3C A;  3IF5 A;  3CZD A;  1XJ2 A;  5EM0 A;  5HW3 A;  3D9Y A;  3W2Z A;  3E98 A;  4E3L A;  3GSG A;  1TS6 A;  2PR6 A;  1XA1 A;  4BBT A;  3IS2 A;  3MS6 A;  3BEC A;  4P0M A;  5GHZ A;  4HHD A;  3HUN A;  3N8R A;  3V39 A;  2C5W B;  1XFQ A;  5HPI A;  1XXM A;  4BWI A;  3T4T A;  3N6I A;  4ZTK A;  3F1O B;  4KZ4 A;  4R4S A;  3OPR A;  4H6J B;  2EFU A;  4R0Q A;  2PAV P;  4ETX A;  2W3E A;  2ZLY A;  3R7W A;  4NEE D;  1LLB A;  4UQI S;  2W27 A;  3P09 A;  1Y4O A;  2ZQA A;  5KZH A;  3W4Q A;  1K4E A;  1ONG A;  2JKR I;  3HUM A;  4HJ6 A;  4CLC B;  2WK0 A;  2W3D A;  5L07 A;  5G18 A;  4GHI A;  4WZ4 A;  1BLS A;  3LIC A;  2K31 A;  4JF4 A;  1H8Z A;  4EUZ A;  5CEC A;  2ZM8 A;  3NDE A;  3MMH A;  4B4Z A;  5CGX A;  2X71 A;  1BSG A;  4MBH A;  3MKE A;  4DF6 A;  3QP8 A;  1T1B A;  4E6W A;  1PWD A;  5EM1 A;  1VET A;  1NY0 A;  2VEA A;  1HVB A;  3RFB A;  5KSC A;  2L4R A;  1CQA A;  1LSW A;  5TGF A;  3CLO A;  4I39 A;  3IF6 B;  1ZHH B;  2GJ3 A;  2E8J A;  4DDS A;  1BLH A;  4GD8 A;  3OLO A;  3T4K A;  4Z1W A;  2Y2H A;  3VOL A;  2WKH A;  1VET B;  4NG2 A;  4R3J A;  1K55 A;  5FDS A;  4XXR A;  2JKR M;  4OKP A;  4UAA A;  2H28 A;  1M6K A;  4PM8 A;  1UGU A;  3C4P A;  1XJ4 A;  5EOE A;  2H0Y A;  5E2E A;  4ETZ A;  3VP3 A;  1MWU A;  3NUL A;  3Q7Z A;  3O5Y A;  4OQG A;  2A3U A;  1MY8 A;  4Y7P A;  4HH2 A;  4QD4 A;  3PHY A;  1MKI A;  5DF8 A;  4EXO A;  2LB9 A;  5IHV A;  4LRZ E;  2W1R A;  4GCZ A;  2JC7 A;  4LV2 A;  4GS9 A;  3W4P A;  1QMF A;  1T18 A;  4MEZ A;  4DE1 A;  2ACG A;  2W3F A;  4HBT A;  2PYP A;  5L09 A;  1OT9 A;  1EW0 A;  2VGJ A;  5HWW A;  1S67 L;  4U0X A;  1E3U A;  4MCW A;  4OPY A;  3UB5 P;  3TE8 A;  4F94 A;  3H7W A;  4N9L A;  1WE4 A;  3A3D A;  3BRM A;  3DTI A;  3ZG7 B;  1G68 A;  5AQ9 A;  3T4L A;  1YPR A;  4E3J A;  4NXE A;  1TF1 A;  2CC1 A;  3PBR A;  4Y3I A;  3IH8 A;  3DAV A;  3TG9 A;  4M3K A;  1KE3 A;  5FQI A;  3UPO A;  3ZG9 B;  2QHK A;  3E4O A;  1JWV A;  2Z2L B;  3BM6 A;  5DTS A;  2HGV A;  3Q7V A;  2XA7 S;  4IHQ A;  4KZ6 A;  4WMC D;  1K6R A;  4R23 A;  2H10 A; 
#chains in the Genus database with same CATH homology
 5HZH A;  2D02 A;  2OWJ A;  1T19 A;  4WN5 A;  5MC7 A;  5F6A A;  2K2N A;  4KQO A;  4BBU A;  5J4E A;  2KOI A;  4WEK A;  1OJ5 A;  1TD5 A;  3FPV A;  4Q0J A;  4IUH A;  2JHE A;  3GEC A;  5IU1 A;  5AJG A;  2O9C A;  2V1B A;  2Z6D A;  3LIE A;  2W3H A;  2P04 A;  2NUT C;  5KSH A;  2XA7 M;  1MKM A;  4YNR A;  3U2A A;  2PD8 A;  4HJ3 A;  1V9Y A;  1D7E A;  1MZU A;  1XFN A;  1NWZ A;  2BAS A;  3K3D A;  1LSV A;  4BBV A;  4IUK A;  2QJ5 A;  2XSS A;  2ZBB A;  1OTI A;  3UE6 A;  4M4X A;  2QWS A;  4ME4 A;  3C30 A;  4G3V A;  3CIT A;  3LI9 A;  3ZQ5 A;  3LR4 A;  5HPF A;  5DFY A;  3EGD C;  2WKQ A;  3R4K A;  1N9N A;  4JGO A;  1S1Z A;  2HJ9 C;  1YSP A;  3V67 A;  4FSF A;  4MN6 A;  1OTE A;  4WL9 A;  5HDS A;  3RH8 B;  5AVE A;  1T1A A;  4E04 A;  1F9I A;  3H7W B;  2MJ6 A;  4PKY A;  2VZW A;  1UWN X;  3UB6 A;  3T4S A;  1P0Z A;  1F5M A;  2J3T D;  3MFX A;  3B47 A;  2V0U A;  4B9O A;  3C2W A;  4HJ4 A;  4XT2 B;  5HDD A;  3EOI A;  3S7N A;  1TS8 A;  4NKP A;  1DP6 A;  2QKP A;  2W1T A;  3T4J A;  2Y79 A;  4WF0 A;  4O8G A;  1WA9 A;  2L1M A;  4DN0 A;  4HH3 A;  3PBN A;  3F1P B;  4MDZ A;  3C8C A;  2WKR A;  4HI4 A;  4BMW A;  5A8B A;  1X0O A;  3T50 A;  3S7O A;  3UB8 A;  2VV8 A;  5J3W A;  4CLC C;  3OBF A;  3VV4 A;  2KX6 A;  5LBR A;  1S1Y A;  1S66 L;  1VB6 A;  4HY8 A;  1BYW A;  3B42 A;  4NXG A;  1GSX A;  2O9A A;  3LR0 A;  2OAP 1;  5HWV A;  3D72 A;  1Y28 A;  4Y2F A;  1STZ A;  4F3L A;  3EQU A;  3HJK A;  3NOP C;  3K2N A;  3LIA A;  3LID A;  5I5L A;  4CLC E;  2V1A A;  1P9R A;  4ZRR A;  3TW8 A;  3A0S A;  5DF9 A;  3EWK A;  3BJN A;  4RQ9 A;  2M7V A;  3KYZ A;  3D3O A;  2PR5 A;  2XRN A;  2W3G A;  4K08 A;  4EW7 A;  2PDR A;  3DBA A;  2PT7 A;  1NLY A;  3FG8 A;  5DFX A;  3LYX A;  1NLZ A;  4MN7 A;  3PBO A;  2VJW A;  4WUJ A;  3UB7 A;  3CUE A;  3NJA A;  4PAU A;  1H3Q A;  2W0N A;  3IBJ A;  3RTY A;  3JVU A;  3GDI A;  2KDK A;  3NOT C;  2A24 B;  3NHQ A;  3OCN A;  2J3T C;  4JGR A;  3PBS A;  2OAQ 1;  4IJG A;  5TJJ A;  4YOF A;  2J3W A;  2A2L A;  4OOL A;  5HSQ A;  4HNB A;  2YKF A;  2R78 A;  1N9O A;  4KQD A;  3E4Q A;  3MJQ A;  4Q0H A;  4BJP A;  3OC2 A;  2G7U A;  1VHM A;  4LPZ A;  4P6Z M;  4UQI M;  1GSW A;  3KX0 X;  4DJ2 A;  2P7J A;  3TJZ C;  2O0Y A;  1W63 M;  2K7S A;  2VV6 A;  3H9W A;  4R3A A;  2VA0 A;  3H82 A;  4AFI A;  2GZA A;  4JGP A;  5TBM A;  4EUV A;  5DKK A;  3F1N B;  1OPX A;  2KLI A;  1KOU A;  1OTB A;  1YKD A;  4G3W A;  3UB9 A;  3UMD A;  3LI8 A;  1S4R A;  2VGL S;  3A0R A;  3H82 B;  2GNX A;  3K3C A;  4YWZ A;  3TRC A;  3ULF A;  3VE4 A;  1XJ2 A;  3BW6 A;  3W2Z A;  3UE3 A;  5IS1 A;  3E98 A;  5DKL A;  4GJ4 A;  3MXQ A;  1W63 Q;  2GX5 A;  2ZMV A;  4ARZ A;  1TS6 A;  2M7U A;  2PR6 A;  4I3J A;  4BBT A;  1P9W A;  3IS2 A;  5G4Y A;  4LRX C;  4HHD A;  2VGL M;  3B33 A;  4MN5 A;  3BY8 A;  4WEJ A;  4EET B;  5FL3 A;  1XFQ A;  5HPI A;  2B18 A;  3MQO A;  3PBQ A;  3PXP A;  1IFQ A;  3IBR A;  4BWI A;  4PHT A;  3T4T A;  1XJ3 A;  3F1O B;  3MR0 A;  3CAX A;  1DRM A;  5CX7 A;  2O9B A;  1TS7 A;  2LB5 A;  1N9L A;  2A24 A;  3EEA A;  4H6J B;  4CLC A;  4P6Z S;  5HL6 A;  2OOL A;  5HDC A;  3ZYT A;  1OJG A;  4ETX A;  2W3E A;  4MMN A;  3T4O A;  4Q0I A;  3R7W A;  4NEE D;  4EEU A;  4UQI S;  2W27 A;  3PYP A;  4GS9 B;  3UME A;  3ICY A;  2D01 A;  3T4Q A;  1D06 A;  3E4P A;  2ZMF A;  3EEH A;  1G28 A;  1V9Z A;  2JKR I;  3S7P A;  2DMW A;  4GHI B;  2FH5 A;  4HJ6 A;  3MQ0 A;  4EU0 A;  1LSX A;  2JKT M;  4H6J A;  5DJU A;  2Z6C A;  4CLC B;  2W3D A;  3NOU C;  5IT5 A;  2Y8H A;  3LIB A;  4NXF A;  4GHI A;  4GLQ A;  3LIC A;  1IOU A;  2K31 A;  3S7Q A;  2OWH A;  1F98 A;  3EQV A;  4EES A;  4G3K A;  4NXB A;  4EQ1 A;  2HV1 A;  1OTD A;  4WEL A;  1LL8 A;  4LRY C;  3LFV A;  4UEY A;  3MMH A;  2P08 A;  3KO6 A;  3KSI A;  1T1C A;  1ZTU A;  4I3A A;  3SW1 A;  2L0W A;  5F5Y A;  5HWT A;  5AVF A;  1ODV A;  1LT0 A;  4JGQ A;  3R7W B;  4WLA A;  3BQ8 A;  3F1N A;  1T1B A;  5L8M A;  3IS2 B;  3KSG A;  2QJ7 A;  2VEA A;  5DJT A;  3HJI A;  2FZ0 A;  3RFB A;  2L4R A;  3LR3 A;  2XRO A;  3KSH A;  1LSW A;  1NRJ A;  3CLO A;  2HF6 A;  4I39 A;  3LR5 A;  3OCL A;  1ZHH B;  2GJ3 A;  3E0Y A;  4O0P A;  2EWV A;  4HP4 A;  1JNU A;  3OLO A;  4HQA A;  3F1P A;  1G6O A;  3T4K A;  1TS0 A;  4KUK A;  4Z1W A;  4LLO B;  4O01 A;  3P01 A;  2PYR A;  3VOL A;  2JKT I;  4L9E A;  2M1C A;  4R6L A;  3G6O A;  3JVV A;  2VKS A;  4XT2 A;  3A0V A;  2JKR M;  2JN7 A;  4HIA A;  3FC7 A;  2H28 A;  3BQA A;  1UGU A;  2HJE A;  1XJ4 A;  4ETZ A;  4HOI A;  4I3I A;  2ZOI A;  4EER A;  4I5S A;  2VV7 A;  2O99 A;  3BWL A;  5F69 A;  3O5Y A;  1P97 A;  2EWW A;  1DP9 A;  4GW9 A;  2CMN A;  2I9V A;  4EEP A;  2WKP A;  4HH2 A;  3PHY A;  4EXO A;  2LB9 A;  4HP9 A;  4LRZ E;  4FOF A;  2V9A A;  4L9F A;  4KUO A;  4R70 A;  4ARZ B;  5HD3 A;  2W1R A;  4GCZ A;  5TBM B;  3MF0 A;  1UWP X;  2INW A;  3FPW A;  3PR6 A;  4GS9 A;  3EGX C;  3CWF A;  4F3L B;  1T18 A;  1OTA A;  2PHY A;  2J80 A;  4QPR A;  2PD7 A;  4R38 A;  2W3F A;  3MQQ A;  2PYP A;  1H8M A;  1OT9 A;  3LIF A;  4DJ3 A;  1EW0 A;  2W1T B;  5HWW A;  1MC0 A;  1YAX A;  1S67 L;  3KYQ A;  5G4Z A;  4Y5F A;  4B93 A;  4CLC D;  4DMZ A;  4MCW A;  3CUE C;  3C38 A;  1DP8 A;  1XJ6 A;  1OT6 A;  4OOM A;  3TE8 A;  3H7W A;  3OOV A;  4I38 A;  4PKY G;  5EFW A;  1S4S A;  2YKH A;  2V0W A;  3CI6 A;  2NUP C;  3T4L A;  2QYB A;  4NXE A;  1TF1 A;  3PBR A;  4Y3I A;  2B02 A;  2EA9 A;  2QHK A;  3HCY A;  3F1O A;  3E4O A;  1GSV A;  4L9G A;  4L0L A;  1YSQ A;  5HD5 A;  2VX8 A;  3VE3 A;  2IA2 A;  2HGV A;  2VLG A;  5F68 A;  2XA7 S;  4IHQ A;  5C5K A;  5KIZ A;  5J7E A;  2ZOH A;  4II7 A;  3PBT A;  3P7N A;  4CQH A;  3KSF A;  5K5B A;  3LUQ A;  3BY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...