4CLCD

Crystal structure of ybr137w protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
172
structure length
172
Chain Sequence
MVVLDKKLLERLTSRKVPLEQLEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMAVSSLIAFANESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0303 PROTEIN YBR137W
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 56
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcD00
5CX7A 4CLCB 4CLCA 3FPVA 3FPWA 2A2LA 4CLCC 4NKPA 4BMWA 4CLCD 4CLCE
chains in the Genus database with same CATH superfamily
1UGUA 4E3KA 1OT9A 3B3XA 4PKYA 4N9LA 1HTZA 4P6ZS 3I7JA 2OAQ1 2V1BA 2WKIA 4MN5A 2XLNA 4OQHA 1ZG6A 1N9OA 3Q82A 2IWDA 1S4SA 1VEUB 1YKDA 3BFEA 1OPXA 3LY3A 2JKRM 1LSWA 2C6WB 4JKTA 2ZM2A 2OV5A 4LLOB 3BFGA 4DE2A 4LV2A 3ZNTA 5EOOA 5A92A 3ZG8B 3M2JA 3LYXA 4FSFA 2Y2IA 2O9AA 1Q2PA 4KQDA 3SH8A 1XGIA 4S2PA 3GR2A 2YKFA 3CPTA 3Q7ZA 3S7QA 4IVKA 2HDQA 2H0YA 1ESUA 3IXDA 1GHIA 1YLPA 3EGDC 2QJ5A 2W0NA 3N6IA 3K3DA 2VGLS 2V0WA 2XD5A 2WK0A 5TGFA 2GX5A 3BW6A 4RA7A 5HZHA 5EVEA 3PXPA 3LUQA 3TE8A 1JNUA 4BMWA 3UPOA 4ARZA 3VSLA 2LB5A 3KYZA 1T1BA 1DJBA 4JXGA 4MNRA 2X71A 4FUWA 3G32A 2B95A 4ME4A 1MXOA 3K3CA 2Y2HA 3PBOA 3C4OA 3MSHA 4Y2FA 2KOIA 3PBNA 1DP9A 5M1AA 3ICYA 4K91A 3E2LA 5EOEA 2PDRA 1NLZA 1W79A 2HF6A 4S2MA 4KZ9A 3M2KA 3UDXA 3OBFA 1XA7A 1KDSA 2PAVP 1Y54A 4BD0A 2ZBBA 1K56D 5FQMA 3V67A 3SS5A 3W2ZA 2WGWB 4DDSA 1FQGA 3ZQ5A 3S7OA 5M19A 4P6BA 4Z9QA 3P7NA 3G35A 1G28A 4X68A 2J9PA 4N9KA 2EWWA 3IHAA 1K4EA 5IU1A 1JWZA 4EQIA 3E4PA 5CEDA 3IWOA 2JKGA 5L09A 1LL5A 4PKYG 4QJGA 3Q07A 5GHYA 3C38A 4GD8A 3KSIA 5I5LA 5IT5A 3PTEA 3HCYA 1ZHHB 2O99A 3R7WB 1L3LA 1TDGA 4HJ6A 3HLWA 3ZVTA 4R70A 3H7WB 4UEYA 1K0KA 4F3LA 5DFYA 4R3JA 2J8YA 3QNBA 4DMZA 4GOGA 2O9BA 4K08A 4H6JA 3OPLA 4KQOA 5GLCA 4EETB 5F83A 1VQQA 4R0QA 1FOFA 3RTYA 2WGVA 2CC1A 1K6SA 3MFXA 3D3OA 3KSGA 3T1RA 1BLHA 1K38A 5HARA 1LL9A 3AGDA 2O0YA 3BFCA 3TOIA 3ZYTA 5A8BA 3NY4A 2J3TD 4BLMA 5DJUA 1KE3A 3H9WA 4YFMA 1LSXA 4WEKA 4B9OA 4BBTA 1I2WA 1NJ4A 2JCHA 3MXQA 4GS9B 1TS6A 1D1JA 1NZOA 2EWVA 4PM7A 3MKFA 2FZ0A 5FEFA 4JGQA 4ESPA 1M40A 2G2WA 1D7EA 4XUXA 3H82B 4I5SA 3ISGA 4R3AA 2PT7A 1SKFA 3GV9A 2ZQDA 4GN2A 3LEQA 2XFSA 3EWKA 4EUZA 2ZL1B 2ZC6B 3CAXA 2ZM0A 3QHYA 4BJPA 4OONA 1DP6A 4E3NA 3QP1A 1JWVA 1PI5A 3KSFA 2K2NA 3UE6A 2L0WA 4S2LA 3QP4A 2WAFA 1T1CA 3FKVA 3VE3A 2Y2NA 3C5AA 4FOFA 1IYSA 4PM5A 1IYOA 1PI4A 2FH5A 3EGXC 4E3LA 1F5MA 1C3BA 1JTDA 1MKMA 5E2EA 5FAQA 1X0OA 1NWZA 5G18A 4RQ9A 3ZG5A 3LIDA 4PHTA 2V2FF 2QWSA 2PD7A 3V3SA 4WLAA 3A3IA 3BECA 3SS4A 3EQUA 1S6RA 4N1HA 5FI2A 1SDEA 1GSXA 3P09A 1LSVA 2Q0OA 4GHIA 4Z1WA 3GDIA 2DRWA 3DTEA 3ZVWA 2Z6DA 3UNWA 3VP2A 3JVVA 5HX9A 4D60A 3HLCA 3LR3A 4JGPA 4LCLA 5HD5A 2PU2A 3NC8A 3IF6A 4CLCD 4ZJ2A 4JF5A 5DTSA 3BRMA 2IWCA 4OQIA 1TEMA 4EQ1A 3IBJA 5GLDA 4LFUA 3D9YA 3IXGA 4QD4A 3ITAA 5AQ7A 5F5YA 4WL9A 1BUEA 4EV4A 2ZOHA 3W4OA 1K57C 3ZG0A 1RGZA 2JKRI 5EVLA 1LHYA 4ZBEA 3WS4A 3C2WA 4I39A 1S0WA 5EM1A 3HLBA 5TJJA 3UB5P 1FSYA 2EA9A 4JPMA 1N4OA 5EE8A 4KUOA 3PHYA 4HESA 5FQIA 4UQIS 4X25A 4X55A 2KX6A 2XF3A 1E3UD 2XFTA 2W1TB 3HUOA 5M18A 1JWPA 1VEUA 3B33A 1FCMA 4KZBA 1MZUA 1UWPX 3AGFA 3IBRA 2G2UA 4MBFA 3IHBA 5CECA 1TD5A 2EXAA 3BM6A 1YPRA 1NZUA 3VOZA 4MN6A 5HWVA 1H3QA 5G4YA 4WZ5C 2QYBA 4OOLA 3JVUA 3NIAA 3WWXA 4P87A 5DF7A 1MPLA 1GHPA 2Y79A 3OLOA 3V5MA 3CUEA 3UMDA 4X69A 4WMCD 3F1NB 1TDLA 4GDNA 1ERQA 1JTGA 1A0KA 1HLUP 2HZ5A 1W63Q 1ACFA 1WYBA 5HSQA 2VA0A 1NLYA 3HJIA 1DY6A 1YQSA 3UY6A 4U0TA 1OJGA 3LEZA 3ZDJA 3NI9A 2VLGA 3FWLA 1CF0A 2XEPA 1YM1A 5MC7A 1K57A 5CX7A 4CLCB 4EEPA 3M6HA 2EXBA 4C3QA 5L2FA 4X6TA 4O8GA 3TG9A 4KG2A 4DE3A 4C6YA 3BFDA 4BENA 2WGWA 4RX3A 3GQZA 4PPRA 1HVBA 1VB6A 1KGEA 2PBYA 2NUTC 2WKQA 4IBXA 1ONGA 4LV3A 2XRNA 4DRTA 2HP6A 4NXEA 3CI6A 1NY0A 2INWA 1QMEA 4YINA 1BLPA 3UDIA 1G5UA 3VP0A 4OLDA 1MWUA 4LPZA 4OPQA 1ERMA 3PAGA 2Y2QA 1NYMA 3G2ZA 1MBLA 5A91A 1J3WA 3IX8A 2ZMVA 3OPRA 4XXRA 1S66L 2Q9NA 5DVAA 2BG1A 2GDNA 1O07A 2ZQAA 3G30A 3OPHA 3ULFA 3R7WA 4BQMA 3CLOA 4WZ5A 3O87A 2VV7A 5L07A 3H7WA 4LRZE 2BASA 4B4ZA 1GHMA 1IKGA 1TS0A 2EFUA 1K6RA 1PWDA 5CGXA 4RYEA 5L8MA 1W8QA 1E4DA 5EV0A 4JF6A 1CEGA 2L1MA 2ZC7A 3PYPA 4EW7A 4HY8A 3VV4A 5F1FA 1W8YA 2JE5A 3JPUA 2ZQCA 3P01A 1T19A 3NJAA 3NULA 4WEJA 4HP4A 3LIEA 3KO6A 5HDCA 1EROA 5HAIA 1H0MA 4LENA 5GLAA 1W5DA 4M4XA 5GHXA 2P9VB 4GS9A 4OQGA 2PR6A 3WS0A 4DE1A 4HIAA 3QNCA 4MN7A 4I3JA 5FI6A 2WKPA 5DF9A 3OCNA 1Z6FA 3KYQA 3LI9A 5E2HA 1DP8A 1OMEA 1P0ZA 1MWRA 2J3TC 3R4KA 3HREA 2J7VA 3F1PA 2JN7A 4S2OA 1RCJA 5DF8A 4HH2A 4LV0A 1PZPA 2ZL1A 1VHMA 3ZFZA 4MCWA 5BOHA 5FQQA 2ZOIA 2XA7M 3T50A 5HPIA 4PMAA 3JYIA 1OTEA 4EBLA 4S2NC 3CJMA 1K56A 1ONHA 1I2SA 1H8YA 1YLYA 2PD8A 1SDNA 3CMZA 4ZRRA 3ZHHA 4HJ3A 4BL2A 3SS3A 1ES2A 5C5KA 1GA9A 5HFOA 4OOMA 2HDSA 1ZTUA 1N9NA 3O5YA 3QP5A 5F6AA 3F1OB 3V39A 1Y4OA 3UB6A 3G31A 1EI5A 3FPWA 3LICA 5FA7A 1GA0A 1ES5A 2H28A 3U4LP 2W3DA 1ZKJA 2EX6A 5FDHA 3P98A 3CHWP 2K7SA 1N9LA 1ES4A 5FAOA 1PWGA 3E0YA 3MXRA 4QY5A 4ZTKA 5TBMB 1XX2A 1FSWA 4EEUA 1OT6A 4DE0A 1BZAA 1BT5A 4LGWA 5LBRA 1OTAA 4UA9A 3NCKA 3UE0A 5EPHA 2QMIA 2XD1A 3LFVA 4KZ7A 3GMWA 3LGOA 3UPNA 4IBRA 3A3JA 4CLCC 2Y2LA 4KZ6A 3LCEA 4MBHA 4A5RA 4OPZA 2W3FA 3A0SA 2VX8A 3NOPC 1NXYA 2P74A 4O7DA 4UA7A 3LY4A 4IVIA 3SH7A 3UN7A 3VFHA 1PWCA 2W1TA 3TJZC 3MBZA 4X1LA 4GD6A 3MF0A 3HUMA 4S2NA 1YLTA 4FTXA 4ZJ1A 2VJWA 5E2GA 2Y91A 4O01A 3C8CA 4S2IA 2WAEA 3LIFA 1ODVA 2W1RA 3BJNA 1EWZA 1TVFA 4RX2A 3C7UA 4DXBA 3HJKA 1LLBA 3UO9A 5AJGA 1XJ6A 5FSRA 4DN0A 3TSGA 4FH2A 2ZD8A 2V9AA 1ALQA 1IYQA 2HGVA 1S67L 5AQAA 3F1NA 4UHUA 2WKRA 3UPPA 4R6LA 2JKTM 4DKIA 1DRMA 3RXXA 3Q7VB 3BQAA 1BULA 5FATA 4GZBA 4BBUA 3E98A 3WS5A 4S2KA 1PW1A 2OWHA 2CMNA 3HBRA 1RP5A 5KZHA 3C30A 1PZOA 2V1ZA 3DWZA 3KYEA 4N92A 1IYPA 1H8ZA 2LB9A 1BSGA 3DW0A 4ARZB 2ZM8A 4LRXC 1KVLA 1XKZA 2VEAA 1AWIA 3WRZA 3T4OA 5F68A 2P7JA 3G34A 4Q0IA 2D01A 3L9KA 4U0XA 4CLCA 1ESIA 3N8LA 5CEBA 3NOTC 1KVMA 5HDSA 4I38A 2W3HA 5DJTA 2QZ6A 3VE4A 2A24B 1P9RA 1FR1A 3MJQA 1CK3A 5CHJA 5HDDA 4ZAMA 2Z2LB 3CZDA 2HP5A 4QY6A 2FFFB 4HNBA 3A3FA 4AFIA 2Y2MA 4MBKA 3QP6A 3GTCA 3RFBA 4PM9A 1E3UA 4CPKA 3BWLA 3MZEA 4KQQA 1MWSA 5E43A 2BLSA 4KZAA 3N8RA 3PR6A 3IF5A 4E3MA 2ZMAA 3PBSA 4EU0A 2M1CA 3A3EA 1S1YA 2G7UA 2OOLA 1RGYA 2XDMA 3IX4A 3IX3A 2P04A 2Y2KA 3BY9A 2W3GA 1FR6A 4YOFA 5DTTA 4EUVA 4HH3A 2Y59A 3BLSA 4EERA 1LT0A 4LCMA 1KE4A 1H8MA 2VZWA 3BYDA 4E6WA 3CG5A 2WZXA 5D3OA 5K5BA 4WMCA 1XGJA 1OJ5A 1Y28A 1IEMA 5DFXA 3IWQA 3DTIA 2R9XA 4O0PA 2P9VA 1CI9A 4ID4A 2PHYA 5F82A 3MZDA 2VV8A 3VP1A 5IHVA 3D4FA 3OOVA 2O9CA 3T1XA 5DKKA 2Y55A 3OC2A 3PBRA 2HDRA 5GLBA 5FDSA 4ETZA 1VETB 4Q8IA 4BD1A 2OLUA 2PYPA 3MQOA 4GW9A 2XROA 3T4TA 1QMFA 1J9MA 3LO7A 2ZQ9A 1W63M 5G4ZA 5F1GA 1MY8A 4HJ4A 3GSGA 1P9WA 2Y2PA 1KDWA 4OQ0A 3BEBA 3LIBA 3QP8A 3T4SA 5AQ9A 1XXMA 3HLFA 2VGJA 1V9ZA 4D2OA 1FCOA 5HPFA 4HI4A 1MWTA 3O86A 2PYRA 2XK1A 4Y0TA 2EFXA 4X53A 3T1SA 4KZ3A 1JVJA 5U47A 4KG6A 1I5QA 1OTIA 3F1OA 1STZA 4X56A 2OAP1 4GB7A 3T4LA 2VGLM 3NOUC 1F9IA 2UV0E 3FG8A 4XT2B 4DF6A 5HWTA 3MQ0A 4KUKA 2OLVA 2WADA 3VSKA 1G68A 4EWFA 3PBTA 3UDFA 3WS2A 3ZG7B 3Q1FA 2GJ3A 3N8SA 3W4PA 1OTDA 4DJ2A 4K0XA 4L0LA 4OPRA 5EUAA 4N1XA 2Y2JA 4KZ4A 1MC0A 3TW8A 5A90A 3C7VA 2Y8HA 4JGRA 2P08A 1S4RA 3ZGAB 4P85A 3V50A 4EESA 4E3OA 4Y17A 3M6BA 4IUKA 4OPYA 5AQBA 4YNRA 1SZVA 3DAVA 1YT4A 4QPRA 3HL9A 4NXFA 3UB7A 4MEZA 1LI0A 4IJGA 1YSQA 1SKOB 3BFFA 1GSVA 1ZC2A 3PBQA 4JXWA 4C75A 4K0WA 3NBLA 2VK3A 2YKHA 5FL3A 3HLDA 4B93A 1BLSA 4JF4A 4L9FA 4UAAA 2VKSA 3DTMA 2JKFA 5HD3A 2ZC3B 3NHQA 4E6XA 3GRJA 2W27A 3T4JA 2JKTI 1XPBA 5EVID 3O88A 4FH4A 2FFYA 3LIAA 2B02A 3T4KA 1CI8A 4WZ4A 4NXBA 4PAUA 5HAQA 1MKIA 4OVDA 2L4RA 5HAPA 4G3WA 1GSWA 3H82A 3T4QA 2VGKA 4Y0OA 3SH9A 2PR5A 2QJ7A 5CHUA 1K54C 2WUQA 1L0DA 3IWIA 3NECA 5CXWA 1K25A 3D72A 2QHKA 2H10A 4OP8A 2IA2A 4H8RA 4X1MA 4P0MA 1LI9A 1OTBA 2ACGA 2RCXA 4II7A 3Q7VA 1NRJA 3BLMA 2GNXA 4KQRA 5TFQA 1PNEA 1G6OA 1PYYA 4HBTA 3WS1A 3IH8A 3ZNYA 3E4QA 1L0GA 3FC7A 2V20A 3IS2B 2HV1A 2IWBA 3O3VA 5J7EA 2EX9A 4GNUA 4HEFA 4U3TA 1WA9A 5JYOA 1YSPA 2RL3A 1XJ3A 2AVXA 2Y4AA 1G6AA 3VP3A 3ZG9B 4Y15A 1BYWA 4WF0A 4R3BA 4HBUA 2HJ9C 2A24A 5F69A 4EXOA 4R38A 1AXBA 3MS6A 4IUHA 4RVAA 3FYZA 5KIZA 1YLWA 5FQKA 4I3IA 3NDEA 1XJ2A 5KSCA 4KZ5A 1XA1A 2B18A 5FAPA 4I3AA 4Y3IA 2V1AA 3FPVA 1EW0A 2PBDP 1TF1A 1K55C 1BTLA 1IOUA 3S7NA 5CTNA 2Y2OA 2ZJ9A 3G6OA 2VV6A 3MQQA 1W7FA 3B42A 3CITA 4JXVA 3UMEA 3EEAA 5EVIB 1PW8A 3QP2A 1KGFA 2M7UA 4WELA 5E2FA 1K54A 3T12B 3HLGA 3VOLA 3OPPA 1IFQA 2EX2A 5FQ9A 1VM1A 2BTFP 4CLCE 2WZZA 4GLQA 3W8KA 2J3WA 2Y2GA 3E4OA 4NETA 1HD8A 2XR0A 3S1YA 3N4IA 2I9VA 3CWFA 1NRFA 4WBGA 2OWJA 1FILA 3NDGA 1TS8A 2M7VA 5CERA 3IXBA 2W3EA 1FIKA 5HWWA 2ZQ7A 1UWNX 4WYYA 5CRFA 4L9GA 1N9BA 2V8FA 4MLLA 2R9WA 5I94A 1XFNA 4NXGA 4EBNA 4UA6A 1WYCA 1YMSA 4NK3A 1Q2QA 4JLFA 2A2LA 2MJ6A 2XA7S 4JBFA 1F2KA 5A93A 4CJNA 3IF6C 5IS1A 4R1GA 1GCEA 3G2YA 1F98A 3HLEA 5J4EA 2XSSA 4UQIM 1O7EA 5GL9A 3MZFA 1VETA 3L7HA 3W4QA 4KG5A 4HP9A 1E25A 4G3VA 3EQVA 5CHMA 2A3UA 2XGNA 3CPTB 1IELA 4DXCA 2DMWA 3F1PB 2UWXA 4E3JA 1YLZA 5KSHA 5FASA 3VOYA 5DKLA 5CTMA 1SHVA 2X02A 5AVEA 4NG2A 4KENB 2ZMFA 3SOIA 4E04A 1K55A 3VP4A 1K4FA 4B4XA 5EM0A 3Q81A 1ES3A 2E8IA 2WYXA 4XT2A 3FZCA 4MMNA 5J3WA 5J8XA 4OP5A 4OOYA 2K31A 2Z6CA 3OCLA 3U2AA 2ZC5B 3EEHA 1BLCA 3PAEA 3WRTA 3CUEC 4JXSA 1U60A 3ITBA 3B47A 2OSUA 4BWIA 4XUZA 3K2NA 4OH0A 4F94A 1PFLA 2X01A 2PRFA 2PU4A 3MKEA 4S2JA 3UB8A 4HHDA 2R78A 5CGWA 3IT9A 2H0TA 1CEFA 3UE3A 2H5SA 2NUPC 3EOIA 1XFQA 4E3IA 1DJCA 2D02A 3TRCA 3SW1A 2QPNA 1IKIA 4NEED 4QB8A 4B88A 4R4RA 2JC7A 1T18A 3DWKA 2DNSA 4FD8A 4CQHA 5AVFA 3E2KA 3RJUA 3DTKA 4ZDXA 1SKOA 1H5XA 2XH9A 1YMXA 1HZOA 2WKHA 4GCZA 5FEGA 3GECA 4M3KA 5FI7A 3LR0A 4R23A 4IHQA 1CJFA 3HUNA 2E8JA 1TS7A 4F3LB 4ETXA 4LV1A 2WGIA 1FCNA 1V9YA 1WE4A 2JHEA 2ZQ8A 2EX8A 3SZTA 1ZG4A 4R4SA 4PM6A 3GVBA 4H6JB 4Q0JA 5HW3A 1M6KA 1NYYA 1KE0A 4FCFA 2ZC4B 4L9EA 1PIOA 3VMAA 3N7WA 3IH9A 4QWOA 3FKWA 1KGGA 2JBFA 2GZAA 4GKUA 1YLJA 5CGSA 3AGEA 3RH8B 5EVIC 2J80A 4BL3A 3A0RA 4GJ4A 4GDBA 4P6ZM 1L0FA 3UB9A 2KDKA 3ZCZA 4G3KA 5EFWA 4Y7PA 2J9OA 3LR5A 5KMWA 4OLGA 3T1QB 2V8CA 4Y13A 5JYPA 3MFDA 5DTKA 5HL1A 2C5WB 4HOIA 3OZHA 1D06A 4EBPA 1L2SA 4WN5A 1CQAA 4DDYA 3IQAA 3IS2A 2I72A 4NKPA 3G4PA 2HJEA 1S1ZA 1P97A 2HP9A 4JGOA 2WKEA 1YAXA 4IEDA 4LRYC 2QKPA 3A3DA 5TR7A 2XQZA 3V3RA 2ZLYA 4Y0UA 3A0VA 4PM8A 3S22A 4YWZA 3FV7A 2Q9MA 3S7PA 1T1AA 3UE1A 2HPBA 3MXSA 2HDUA 4Y5FA 4BBVA 1DJAA 4DJ3A 3DBAA 3HVFA 5TBMA 1LL8A 1L0EA 4GHIB 4ZJ3A 1PRQA 5HL6A 4QHCA 3BQ8A 3MMHA 3LR4A 3S4XA 4WM9A 2KLIA 2B5RA 2Z2MB 3IF6B 3RXWA 5FQJA 3C4PA 4WUJA 5L10A 1XP4A 3MR0A 3KX0X 3KSHA 5EVIA 4KZ8A 1XJ4A 4MDZA 4QU3A 1Z09A 3VFFA 3BY8A 4Q0HA 2A49A 5EECA 2DCFA 1SCWA 2V0UA 3LI8A 3IXHA 5GHZA 4HQAA 1KOUA 4OKPA
chains in the Genus database with same CATH topology
1H3QA 1UGUA 2LB9A 2B18A 5G4YA 4ARZB 1OT9A 2QYBA 4I3AA 4LRXC 4OOLA 4Y3IA 3JVUA 4PKYA 2VEAA 2V1AA 3FPVA 1EW0A 3T4OA 5F68A 2P7JA 4P6ZS 1TF1A 4Q0IA 2D01A 2OAQ1 2V1BA 4MN5A 2Y79A 4CLCA 3OLOA 3CUEA 1IOUA 3S7NA 3UMDA 3F1NB 1N9OA 3G6OA 3NOTC 2VV6A 3MQQA 5HDSA 4I38A 3B42A 3CITA 3UMEA 1S4SA 3EEAA 2W3HA 5DJTA 1YKDA 2M7UA 4WELA 1OPXA 3VE4A 2A24B 1P9RA 2JKRM 1LSWA 3MJQA 1W63Q 3VOLA 1IFQA 5HSQA 4LLOB 2VA0A 5HDDA 1NLYA 3HJIA 4CLCE 4GLQA 4HNBA 1OJGA 3LYXA 4FSFA 4AFIA 2J3WA 2O9AA 3E4OA 4KQDA 2I9VA 3CWFA 2OWJA 2VLGA 1TS8A 2M7VA 2YKFA 3RFBA 3S7QA 2W3EA 5HWWA 1UWNX 5MC7A 4L9GA 3EGDC 2QJ5A 2W0NA 3BWLA 5CX7A 4CLCB 4EEPA 1XFNA 3K3DA 4NXGA 2VGLS 2V0WA 3PR6A 2GX5A 2A2LA 2MJ6A 3BW6A 3PBSA 4O8GA 5HZHA 4EU0A 2XA7S 2M1CA 3PXPA 3LUQA 3TE8A 1S1YA 2G7UA 2OOLA 1JNUA 4BMWA 4ARZA 5IS1A 1VB6A 2LB5A 2NUTC 3KYZA 2WKQA 1T1BA 2P04A 2XRNA 3BY9A 2W3GA 4NXEA 1F98A 4YOFA 3CI6A 5J4EA 4EUVA 2INWA 4HH3A 2XSSA 4UQIM 4ME4A 3K3CA 4EERA 4LPZA 1LT0A 3PBOA 4Y2FA 1H8MA 4HP9A 4G3VA 2KOIA 3EQVA 2ZMVA 3PBNA 1S66L 1DP9A 2VZWA 3ICYA 5K5BA 1OJ5A 1Y28A 2PDRA 1NLZA 2DMWA 5DFXA 3F1PB 2HF6A 4O0PA 3ULFA 3R7WA 3OBFA 3CLOA 5KSHA 2PHYA 2VV7A 3H7WA 2ZBBA 5DKLA 2VV8A 4LRZE 2BASA 3V67A 3W2ZA 5AVEA 1TS0A 2ZMFA 5L8MA 3ZQ5A 3S7OA 4E04A 3OOVA 2O9CA 3P7NA 5DKKA 1G28A 2L1MA 2EWWA 3OC2A 3PBRA 3PYPA 5IU1A 4ETZA 4EW7A 4HY8A 3E4PA 2PYPA 3VV4A 3MQOA 3P01A 4GW9A 4XT2A 2XROA 4MMNA 1T19A 3NJAA 3T4TA 4WEJA 4HP4A 4PKYG 5J3WA 1W63M 3LIEA 5G4ZA 3KO6A 5HDCA 3C38A 2K31A 3KSIA 4HJ4A 4M4XA 5I5LA 1P9WA 5IT5A 2Z6CA 3HCYA 1ZHHB 3OCLA 2O99A 3R7WB 3U2AA 3EEHA 4GS9A 4HJ6A 2PR6A 3CUEC 4R70A 4HIAA 3H7WB 4MN7A 3B47A 4I3JA 2WKPA 4UEYA 3LIBA 4F3LA 4BWIA 3T4SA 3K2NA 5DF9A 3OCNA 5DFYA 3KYQA 3LI9A 1DP8A 1P0ZA 3UB8A 4HHDA 2R78A 4DMZA 2J3TC 1V9ZA 3R4KA 5HPFA 2O9BA 4HI4A 3UE3A 4K08A 2NUPC 2PYRA 4H6JA 3EOIA 1XFQA 3F1PA 4KQOA 2JN7A 4EETB 2D02A 3TRCA 3SW1A 1OTIA 4HH2A 3F1OA 1STZA 3RTYA 1VHMA 2OAP1 4NEED 3MFXA 4MCWA 3T4LA 2VGLM 3NOUC 1T18A 3D3OA 1F9IA 3FG8A 4XT2B 4CQHA 2ZOIA 3KSGA 2XA7M 5AVFA 5HWTA 3MQ0A 4KUKA 3T50A 5HPIA 2O0YA 5A8BA 3ZYTA 2J3TD 5DJUA 3H9WA 1LSXA 4WEKA 1OTEA 4B9OA 3PBTA 4BBTA 4GCZA 2GJ3A 3GECA 3LR0A 1OTDA 4DJ2A 4L0LA 3MXQA 4GS9B 1TS6A 4IHQA 1MC0A 2PD8A 3TW8A 2EWVA 1TS7A 4F3LB 4ETXA 2FZ0A 4JGQA 4ZRRA 1V9YA 2Y8HA 2JHEA 4JGRA 2P08A 1S4RA 1D7EA 4HJ3A 3H82B 4I5SA 4R3AA 5C5KA 4OOMA 4EESA 1ZTUA 2PT7A 4H6JB 4Q0JA 1N9NA 3O5YA 4IUKA 3EWKA 5F6AA 3F1OB 4YNRA 3UB6A 4L9EA 3CAXA 4QPRA 4BJPA 3FPWA 4NXFA 3UB7A 2GZAA 3LICA 2H28A 1DP6A 4IJGA 1YSQA 2W3DA 3RH8B 1GSVA 3KSFA 2K2NA 3UE6A 3PBQA 2J80A 3A0RA 4GJ4A 2K7SA 2L0WA 1N9LA 2YKHA 5FL3A 4P6ZM 1T1CA 3E0YA 3VE3A 3UB9A 2KDKA 4G3KA 5EFWA 4B93A 5TBMB 4FOFA 4L9FA 2FH5A 2VKSA 3EGXC 1OT6A 4EEUA 3LR5A 1F5MA 1MKMA 5HD3A 1X0OA 1NWZA 5LBRA 1OTAA 3NHQA 4RQ9A 2W27A 3T4JA 2JKTI 3LIDA 3LFVA 4PHTA 2QWSA 2PD7A 3LIAA 4HOIA 4WLAA 1D06A 2B02A 3T4KA 3EQUA 4NXBA 4WN5A 4CLCC 4PAUA 1GSXA 1LSVA 4GHIA 3IS2A 4NKPA 4Z1WA 3GDIA 2Z6DA 2HJEA 1S1ZA 1P97A 3JVVA 4JGOA 2L4RA 2W3FA 3A0SA 1YAXA 4G3WA 1GSWA 2VX8A 3NOPC 3H82A 4LRYC 2QKPA 3T4QA 3LR3A 4JGPA 2PR5A 2QJ7A 3A0VA 5HD5A 3D72A 2QHKA 4YWZA 2IA2A 4CLCD 2W1TA 3TJZC 1OTBA 4EQ1A 3S7PA 4II7A 3IBJA 3MF0A 1NRJA 1T1AA 2GNXA 2VJWA 5F5YA 4WL9A 4O01A 3C8CA 4Y5FA 3LIFA 1G6OA 1ODVA 2W1RA 4BBVA 3BJNA 2ZOHA 4DJ3A 3DBAA 2JKRI 3E4QA 3HJKA 3C2WA 3FC7A 1LL8A 4I39A 5TBMA 4GHIB 3IS2B 2HV1A 5AJGA 1XJ6A 5TJJA 5J7EA 2EA9A 5HL6A 3BQ8A 4KUOA 3PHYA 4DN0A 3MMHA 3LR4A 1WA9A 4UQIS 2V9AA 2HGVA 2KX6A 1S67L 2KLIA 3F1NA 1YSPA 2WKRA 1XJ3A 4R6LA 2JKTM 2W1TB 4WUJA 1BYWA 1DRMA 4WF0A 3MR0A 3KX0X 3B33A 3KSHA 3BQAA 2HJ9C 1MZUA 1XJ4A 1UWPX 2A24A 4MDZA 5F69A 4BBUA 3E98A 3IBRA 2OWHA 3BY8A 2CMNA 4R38A 4EXOA 4Q0HA 2V0UA 4IUHA 3LI8A 5KIZA 1TD5A 3C30A 4HQAA 1KOUA 4I3IA 4MN6A 1XJ2A 5HWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CX7 A;  4CLC B;  4CLC A;  3FPV A;  3FPW A;  2A2L A;  4CLC C;  4NKP A;  4BMW A;  4CLC D;  4CLC E; 
#chains in the Genus database with same CATH topology
 1UGU A;  4E3K A;  1OT9 A;  3B3X A;  4PKY A;  4N9L A;  1HTZ A;  4P6Z S;  3I7J A;  2OAQ 1;  2V1B A;  2WKI A;  4MN5 A;  2XLN A;  4OQH A;  1ZG6 A;  1N9O A;  3Q82 A;  2IWD A;  1S4S A;  1VEU B;  1YKD A;  3BFE A;  1OPX A;  3LY3 A;  2JKR M;  1LSW A;  2C6W B;  4JKT A;  2ZM2 A;  2OV5 A;  4LLO B;  3BFG A;  4DE2 A;  4LV2 A;  3ZNT A;  5EOO A;  5A92 A;  3ZG8 B;  3M2J A;  3LYX A;  4FSF A;  2Y2I A;  2O9A A;  1Q2P A;  4KQD A;  3SH8 A;  1XGI A;  4S2P A;  3GR2 A;  2YKF A;  3CPT A;  3Q7Z A;  3S7Q A;  4IVK A;  2HDQ A;  2H0Y A;  1ESU A;  3IXD A;  1GHI A;  1YLP A;  3EGD C;  2QJ5 A;  2W0N A;  3N6I A;  3K3D A;  2VGL S;  2V0W A;  2XD5 A;  2WK0 A;  5TGF A;  2GX5 A;  3BW6 A;  4RA7 A;  5HZH A;  5EVE A;  3PXP A;  3LUQ A;  3TE8 A;  1JNU A;  4BMW A;  3UPO A;  4ARZ A;  3VSL A;  2LB5 A;  3KYZ A;  1T1B A;  1DJB A;  4JXG A;  4MNR A;  2X71 A;  4FUW A;  3G32 A;  2B95 A;  4ME4 A;  1MXO A;  3K3C A;  2Y2H A;  3PBO A;  3C4O A;  3MSH A;  4Y2F A;  2KOI A;  3PBN A;  1DP9 A;  5M1A A;  3ICY A;  4K91 A;  3E2L A;  5EOE A;  2PDR A;  1NLZ A;  1W79 A;  2HF6 A;  4S2M A;  4KZ9 A;  3M2K A;  3UDX A;  3OBF A;  1XA7 A;  1KDS A;  2PAV P;  1Y54 A;  4BD0 A;  2ZBB A;  1K56 D;  5FQM A;  3V67 A;  3SS5 A;  3W2Z A;  2WGW B;  4DDS A;  1FQG A;  3ZQ5 A;  3S7O A;  5M19 A;  4P6B A;  4Z9Q A;  3P7N A;  3G35 A;  1G28 A;  4X68 A;  2J9P A;  4N9K A;  2EWW A;  3IHA A;  1K4E A;  5IU1 A;  1JWZ A;  4EQI A;  3E4P A;  5CED A;  3IWO A;  2JKG A;  5L09 A;  1LL5 A;  4PKY G;  4QJG A;  3Q07 A;  5GHY A;  3C38 A;  4GD8 A;  3KSI A;  5I5L A;  5IT5 A;  3PTE A;  3HCY A;  1ZHH B;  2O99 A;  3R7W B;  1L3L A;  1TDG A;  4HJ6 A;  3HLW A;  3ZVT A;  4R70 A;  3H7W B;  4UEY A;  1K0K A;  4F3L A;  5DFY A;  4R3J A;  2J8Y A;  3QNB A;  4DMZ A;  4GOG A;  2O9B A;  4K08 A;  4H6J A;  3OPL A;  4KQO A;  5GLC A;  4EET B;  5F83 A;  1VQQ A;  4R0Q A;  1FOF A;  3RTY A;  2WGV A;  2CC1 A;  1K6S A;  3MFX A;  3D3O A;  3KSG A;  3T1R A;  1BLH A;  1K38 A;  5HAR A;  1LL9 A;  3AGD A;  2O0Y A;  3BFC A;  3TOI A;  3ZYT A;  5A8B A;  3NY4 A;  2J3T D;  4BLM A;  5DJU A;  1KE3 A;  3H9W A;  4YFM A;  1LSX A;  4WEK A;  4B9O A;  4BBT A;  1I2W A;  1NJ4 A;  2JCH A;  3MXQ A;  4GS9 B;  1TS6 A;  1D1J A;  1NZO A;  2EWV A;  4PM7 A;  3MKF A;  2FZ0 A;  5FEF A;  4JGQ A;  4ESP A;  1M40 A;  2G2W A;  1D7E A;  4XUX A;  3H82 B;  4I5S A;  3ISG A;  4R3A A;  2PT7 A;  1SKF A;  3GV9 A;  2ZQD A;  4GN2 A;  3LEQ A;  2XFS A;  3EWK A;  4EUZ A;  2ZL1 B;  2ZC6 B;  3CAX A;  2ZM0 A;  3QHY A;  4BJP A;  4OON A;  1DP6 A;  4E3N A;  3QP1 A;  1JWV A;  1PI5 A;  3KSF A;  2K2N A;  3UE6 A;  2L0W A;  4S2L A;  3QP4 A;  2WAF A;  1T1C A;  3FKV A;  3VE3 A;  2Y2N A;  3C5A A;  4FOF A;  1IYS A;  4PM5 A;  1IYO A;  1PI4 A;  2FH5 A;  3EGX C;  4E3L A;  1F5M A;  1C3B A;  1JTD A;  1MKM A;  5E2E A;  5FAQ A;  1X0O A;  1NWZ A;  5G18 A;  4RQ9 A;  3ZG5 A;  3LID A;  4PHT A;  2V2F F;  2QWS A;  2PD7 A;  3V3S A;  4WLA A;  3A3I A;  3BEC A;  3SS4 A;  3EQU A;  1S6R A;  4N1H A;  5FI2 A;  1SDE A;  1GSX A;  3P09 A;  1LSV A;  2Q0O A;  4GHI A;  4Z1W A;  3GDI A;  2DRW A;  3DTE A;  3ZVW A;  2Z6D A;  3UNW A;  3VP2 A;  3JVV A;  5HX9 A;  4D60 A;  3HLC A;  3LR3 A;  4JGP A;  4LCL A;  5HD5 A;  2PU2 A;  3NC8 A;  3IF6 A;  4CLC D;  4ZJ2 A;  4JF5 A;  5DTS A;  3BRM A;  2IWC A;  4OQI A;  1TEM A;  4EQ1 A;  3IBJ A;  5GLD A;  4LFU A;  3D9Y A;  3IXG A;  4QD4 A;  3ITA A;  5AQ7 A;  5F5Y A;  4WL9 A;  1BUE A;  4EV4 A;  2ZOH A;  3W4O A;  1K57 C;  3ZG0 A;  1RGZ A;  2JKR I;  5EVL A;  1LHY A;  4ZBE A;  3WS4 A;  3C2W A;  4I39 A;  1S0W A;  5EM1 A;  3HLB A;  5TJJ A;  3UB5 P;  1FSY A;  2EA9 A;  4JPM A;  1N4O A;  5EE8 A;  4KUO A;  3PHY A;  4HES A;  5FQI A;  4UQI S;  4X25 A;  4X55 A;  2KX6 A;  2XF3 A;  1E3U D;  2XFT A;  2W1T B;  3HUO A;  5M18 A;  1JWP A;  1VEU A;  3B33 A;  1FCM A;  4KZB A;  1MZU A;  1UWP X;  3AGF A;  3IBR A;  2G2U A;  4MBF A;  3IHB A;  5CEC A;  1TD5 A;  2EXA A;  3BM6 A;  1YPR A;  1NZU A;  3VOZ A;  4MN6 A;  5HWV A;  1H3Q A;  5G4Y A;  4WZ5 C;  2QYB A;  4OOL A;  3JVU A;  3NIA A;  3WWX A;  4P87 A;  5DF7 A;  1MPL A;  1GHP A;  2Y79 A;  3OLO A;  3V5M A;  3CUE A;  3UMD A;  4X69 A;  4WMC D;  3F1N B;  1TDL A;  4GDN A;  1ERQ A;  1JTG A;  1A0K A;  1HLU P;  2HZ5 A;  1W63 Q;  1ACF A;  1WYB A;  5HSQ A;  2VA0 A;  1NLY A;  3HJI A;  1DY6 A;  1YQS A;  3UY6 A;  4U0T A;  1OJG A;  3LEZ A;  3ZDJ A;  3NI9 A;  2VLG A;  3FWL A;  1CF0 A;  2XEP A;  1YM1 A;  5MC7 A;  1K57 A;  5CX7 A;  4CLC B;  4EEP A;  3M6H A;  2EXB A;  4C3Q A;  5L2F A;  4X6T A;  4O8G A;  3TG9 A;  4KG2 A;  4DE3 A;  4C6Y A;  3BFD A;  4BEN A;  2WGW A;  4RX3 A;  3GQZ A;  4PPR A;  1HVB A;  1VB6 A;  1KGE A;  2PBY A;  2NUT C;  2WKQ A;  4IBX A;  1ONG A;  4LV3 A;  2XRN A;  4DRT A;  2HP6 A;  4NXE A;  3CI6 A;  1NY0 A;  2INW A;  1QME A;  4YIN A;  1BLP A;  3UDI A;  1G5U A;  3VP0 A;  4OLD A;  1MWU A;  4LPZ A;  4OPQ A;  1ERM A;  3PAG A;  2Y2Q A;  1NYM A;  3G2Z A;  1MBL A;  5A91 A;  1J3W A;  3IX8 A;  2ZMV A;  3OPR A;  4XXR A;  1S66 L;  2Q9N A;  5DVA A;  2BG1 A;  2GDN A;  1O07 A;  2ZQA A;  3G30 A;  3OPH A;  3ULF A;  3R7W A;  4BQM A;  3CLO A;  4WZ5 A;  3O87 A;  2VV7 A;  5L07 A;  3H7W A;  4LRZ E;  2BAS A;  4B4Z A;  1GHM A;  1IKG A;  1TS0 A;  2EFU A;  1K6R A;  1PWD A;  5CGX A;  4RYE A;  5L8M A;  1W8Q A;  1E4D A;  5EV0 A;  4JF6 A;  1CEG A;  2L1M A;  2ZC7 A;  3PYP A;  4EW7 A;  4HY8 A;  3VV4 A;  5F1F A;  1W8Y A;  2JE5 A;  3JPU A;  2ZQC A;  3P01 A;  1T19 A;  3NJA A;  3NUL A;  4WEJ A;  4HP4 A;  3LIE A;  3KO6 A;  5HDC A;  1ERO A;  5HAI A;  1H0M A;  4LEN A;  5GLA A;  1W5D A;  4M4X A;  5GHX A;  2P9V B;  4GS9 A;  4OQG A;  2PR6 A;  3WS0 A;  4DE1 A;  4HIA A;  3QNC A;  4MN7 A;  4I3J A;  5FI6 A;  2WKP A;  5DF9 A;  3OCN A;  1Z6F A;  3KYQ A;  3LI9 A;  5E2H A;  1DP8 A;  1OME A;  1P0Z A;  1MWR A;  2J3T C;  3R4K A;  3HRE A;  2J7V A;  3F1P A;  2JN7 A;  4S2O A;  1RCJ A;  5DF8 A;  4HH2 A;  4LV0 A;  1PZP A;  2ZL1 A;  1VHM A;  3ZFZ A;  4MCW A;  5BOH A;  5FQQ A;  2ZOI A;  2XA7 M;  3T50 A;  5HPI A;  4PMA A;  3JYI A;  1OTE A;  4EBL A;  4S2N C;  3CJM A;  1K56 A;  1ONH A;  1I2S A;  1H8Y A;  1YLY A;  2PD8 A;  1SDN A;  3CMZ A;  4ZRR A;  3ZHH A;  4HJ3 A;  4BL2 A;  3SS3 A;  1ES2 A;  5C5K A;  1GA9 A;  5HFO A;  4OOM A;  2HDS A;  1ZTU A;  1N9N A;  3O5Y A;  3QP5 A;  5F6A A;  3F1O B;  3V39 A;  1Y4O A;  3UB6 A;  3G31 A;  1EI5 A;  3FPW A;  3LIC A;  5FA7 A;  1GA0 A;  1ES5 A;  2H28 A;  3U4L P;  2W3D A;  1ZKJ A;  2EX6 A;  5FDH A;  3P98 A;  3CHW P;  2K7S A;  1N9L A;  1ES4 A;  5FAO A;  1PWG A;  3E0Y A;  3MXR A;  4QY5 A;  4ZTK A;  5TBM B;  1XX2 A;  1FSW A;  4EEU A;  1OT6 A;  4DE0 A;  1BZA A;  1BT5 A;  4LGW A;  5LBR A;  1OTA A;  4UA9 A;  3NCK A;  3UE0 A;  5EPH A;  2QMI A;  2XD1 A;  3LFV A;  4KZ7 A;  3GMW A;  3LGO A;  3UPN A;  4IBR A;  3A3J A;  4CLC C;  2Y2L A;  4KZ6 A;  3LCE A;  4MBH A;  4A5R A;  4OPZ A;  2W3F A;  3A0S A;  2VX8 A;  3NOP C;  1NXY A;  2P74 A;  4O7D A;  4UA7 A;  3LY4 A;  4IVI A;  3SH7 A;  3UN7 A;  3VFH A;  1PWC A;  2W1T A;  3TJZ C;  3MBZ A;  4X1L A;  4GD6 A;  3MF0 A;  3HUM A;  4S2N A;  1YLT A;  4FTX A;  4ZJ1 A;  2VJW A;  5E2G A;  2Y91 A;  4O01 A;  3C8C A;  4S2I A;  2WAE A;  3LIF A;  1ODV A;  2W1R A;  3BJN A;  1EWZ A;  1TVF A;  4RX2 A;  3C7U A;  4DXB A;  3HJK A;  1LLB A;  3UO9 A;  5AJG A;  1XJ6 A;  5FSR A;  4DN0 A;  3TSG A;  4FH2 A;  2ZD8 A;  2V9A A;  1ALQ A;  1IYQ A;  2HGV A;  1S67 L;  5AQA A;  3F1N A;  4UHU A;  2WKR A;  3UPP A;  4R6L A;  2JKT M;  4DKI A;  1DRM A;  3RXX A;  3Q7V B;  3BQA A;  1BUL A;  5FAT A;  4GZB A;  4BBU A;  3E98 A;  3WS5 A;  4S2K A;  1PW1 A;  2OWH A;  2CMN A;  3HBR A;  1RP5 A;  5KZH A;  3C30 A;  1PZO A;  2V1Z A;  3DWZ A;  3KYE A;  4N92 A;  1IYP A;  1H8Z A;  2LB9 A;  1BSG A;  3DW0 A;  4ARZ B;  2ZM8 A;  4LRX C;  1KVL A;  1XKZ A;  2VEA A;  1AWI A;  3WRZ A;  3T4O A;  5F68 A;  2P7J A;  3G34 A;  4Q0I A;  2D01 A;  3L9K A;  4U0X A;  4CLC A;  1ESI A;  3N8L A;  5CEB A;  3NOT C;  1KVM A;  5HDS A;  4I38 A;  2W3H A;  5DJT A;  2QZ6 A;  3VE4 A;  2A24 B;  1P9R A;  1FR1 A;  3MJQ A;  1CK3 A;  5CHJ A;  5HDD A;  4ZAM A;  2Z2L B;  3CZD A;  2HP5 A;  4QY6 A;  2FFF B;  4HNB A;  3A3F A;  4AFI A;  2Y2M A;  4MBK A;  3QP6 A;  3GTC A;  3RFB A;  4PM9 A;  1E3U A;  4CPK A;  3BWL A;  3MZE A;  4KQQ A;  1MWS A;  5E43 A;  2BLS A;  4KZA A;  3N8R A;  3PR6 A;  3IF5 A;  4E3M A;  2ZMA A;  3PBS A;  4EU0 A;  2M1C A;  3A3E A;  1S1Y A;  2G7U A;  2OOL A;  1RGY A;  2XDM A;  3IX4 A;  3IX3 A;  2P04 A;  2Y2K A;  3BY9 A;  2W3G A;  1FR6 A;  4YOF A;  5DTT A;  4EUV A;  4HH3 A;  2Y59 A;  3BLS A;  4EER A;  1LT0 A;  4LCM A;  1KE4 A;  1H8M A;  2VZW A;  3BYD A;  4E6W A;  3CG5 A;  2WZX A;  5D3O A;  5K5B A;  4WMC A;  1XGJ A;  1OJ5 A;  1Y28 A;  1IEM A;  5DFX A;  3IWQ A;  3DTI A;  2R9X A;  4O0P A;  2P9V A;  1CI9 A;  4ID4 A;  2PHY A;  5F82 A;  3MZD A;  2VV8 A;  3VP1 A;  5IHV A;  3D4F A;  3OOV A;  2O9C A;  3T1X A;  5DKK A;  2Y55 A;  3OC2 A;  3PBR A;  2HDR A;  5GLB A;  5FDS A;  4ETZ A;  1VET B;  4Q8I A;  4BD1 A;  2OLU A;  2PYP A;  3MQO A;  4GW9 A;  2XRO A;  3T4T A;  1QMF A;  1J9M A;  3LO7 A;  2ZQ9 A;  1W63 M;  5G4Z A;  5F1G A;  1MY8 A;  4HJ4 A;  3GSG A;  1P9W A;  2Y2P A;  1KDW A;  4OQ0 A;  3BEB A;  3LIB A;  3QP8 A;  3T4S A;  5AQ9 A;  1XXM A;  3HLF A;  2VGJ A;  1V9Z A;  4D2O A;  1FCO A;  5HPF A;  4HI4 A;  1MWT A;  3O86 A;  2PYR A;  2XK1 A;  4Y0T A;  2EFX A;  4X53 A;  3T1S A;  4KZ3 A;  1JVJ A;  5U47 A;  4KG6 A;  1I5Q A;  1OTI A;  3F1O A;  1STZ A;  4X56 A;  2OAP 1;  4GB7 A;  3T4L A;  2VGL M;  3NOU C;  1F9I A;  2UV0 E;  3FG8 A;  4XT2 B;  4DF6 A;  5HWT A;  3MQ0 A;  4KUK A;  2OLV A;  2WAD A;  3VSK A;  1G68 A;  4EWF A;  3PBT A;  3UDF A;  3WS2 A;  3ZG7 B;  3Q1F A;  2GJ3 A;  3N8S A;  3W4P A;  1OTD A;  4DJ2 A;  4K0X A;  4L0L A;  4OPR A;  5EUA A;  4N1X A;  2Y2J A;  4KZ4 A;  1MC0 A;  3TW8 A;  5A90 A;  3C7V A;  2Y8H A;  4JGR A;  2P08 A;  1S4R A;  3ZGA B;  4P85 A;  3V50 A;  4EES A;  4E3O A;  4Y17 A;  3M6B A;  4IUK A;  4OPY A;  5AQB A;  4YNR A;  1SZV A;  3DAV A;  1YT4 A;  4QPR A;  3HL9 A;  4NXF A;  3UB7 A;  4MEZ A;  1LI0 A;  4IJG A;  1YSQ A;  1SKO B;  3BFF A;  1GSV A;  1ZC2 A;  3PBQ A;  4JXW A;  4C75 A;  4K0W A;  3NBL A;  2VK3 A;  2YKH A;  5FL3 A;  3HLD A;  4B93 A;  1BLS A;  4JF4 A;  4L9F A;  4UAA A;  2VKS A;  3DTM A;  2JKF A;  5HD3 A;  2ZC3 B;  3NHQ A;  4E6X A;  3GRJ A;  2W27 A;  3T4J A;  2JKT I;  1XPB A;  5EVI D;  3O88 A;  4FH4 A;  2FFY A;  3LIA A;  2B02 A;  3T4K A;  1CI8 A;  4WZ4 A;  4NXB A;  4PAU A;  5HAQ A;  1MKI A;  4OVD A;  2L4R A;  5HAP A;  4G3W A;  1GSW A;  3H82 A;  3T4Q A;  2VGK A;  4Y0O A;  3SH9 A;  2PR5 A;  2QJ7 A;  5CHU A;  1K54 C;  2WUQ A;  1L0D A;  3IWI A;  3NEC A;  5CXW A;  1K25 A;  3D72 A;  2QHK A;  2H10 A;  4OP8 A;  2IA2 A;  4H8R A;  4X1M A;  4P0M A;  1LI9 A;  1OTB A;  2ACG A;  2RCX A;  4II7 A;  3Q7V A;  1NRJ A;  3BLM A;  2GNX A;  4KQR A;  5TFQ A;  1PNE A;  1G6O A;  1PYY A;  4HBT A;  3WS1 A;  3IH8 A;  3ZNY A;  3E4Q A;  1L0G A;  3FC7 A;  2V20 A;  3IS2 B;  2HV1 A;  2IWB A;  3O3V A;  5J7E A;  2EX9 A;  4GNU A;  4HEF A;  4U3T A;  1WA9 A;  5JYO A;  1YSP A;  2RL3 A;  1XJ3 A;  2AVX A;  2Y4A A;  1G6A A;  3VP3 A;  3ZG9 B;  4Y15 A;  1BYW A;  4WF0 A;  4R3B A;  4HBU A;  2HJ9 C;  2A24 A;  5F69 A;  4EXO A;  4R38 A;  1AXB A;  3MS6 A;  4IUH A;  4RVA A;  3FYZ A;  5KIZ A;  1YLW A;  5FQK A;  4I3I A;  3NDE A;  1XJ2 A;  5KSC A;  4KZ5 A;  1XA1 A;  2B18 A;  5FAP A;  4I3A A;  4Y3I A;  2V1A A;  3FPV A;  1EW0 A;  2PBD P;  1TF1 A;  1K55 C;  1BTL A;  1IOU A;  3S7N A;  5CTN A;  2Y2O A;  2ZJ9 A;  3G6O A;  2VV6 A;  3MQQ A;  1W7F A;  3B42 A;  3CIT A;  4JXV A;  3UME A;  3EEA A;  5EVI B;  1PW8 A;  3QP2 A;  1KGF A;  2M7U A;  4WEL A;  5E2F A;  1K54 A;  3T12 B;  3HLG A;  3VOL A;  3OPP A;  1IFQ A;  2EX2 A;  5FQ9 A;  1VM1 A;  2BTF P;  4CLC E;  2WZZ A;  4GLQ A;  3W8K A;  2J3W A;  2Y2G A;  3E4O A;  4NET A;  1HD8 A;  2XR0 A;  3S1Y A;  3N4I A;  2I9V A;  3CWF A;  1NRF A;  4WBG A;  2OWJ A;  1FIL A;  3NDG A;  1TS8 A;  2M7V A;  5CER A;  3IXB A;  2W3E A;  1FIK A;  5HWW A;  2ZQ7 A;  1UWN X;  4WYY A;  5CRF A;  4L9G A;  1N9B A;  2V8F A;  4MLL A;  2R9W A;  5I94 A;  1XFN A;  4NXG A;  4EBN A;  4UA6 A;  1WYC A;  1YMS A;  4NK3 A;  1Q2Q A;  4JLF A;  2A2L A;  2MJ6 A;  2XA7 S;  4JBF A;  1F2K A;  5A93 A;  4CJN A;  3IF6 C;  5IS1 A;  4R1G A;  1GCE A;  3G2Y A;  1F98 A;  3HLE A;  5J4E A;  2XSS A;  4UQI M;  1O7E A;  5GL9 A;  3MZF A;  1VET A;  3L7H A;  3W4Q A;  4KG5 A;  4HP9 A;  1E25 A;  4G3V A;  3EQV A;  5CHM A;  2A3U A;  2XGN A;  3CPT B;  1IEL A;  4DXC A;  2DMW A;  3F1P B;  2UWX A;  4E3J A;  1YLZ A;  5KSH A;  5FAS A;  3VOY A;  5DKL A;  5CTM A;  1SHV A;  2X02 A;  5AVE A;  4NG2 A;  4KEN B;  2ZMF A;  3SOI A;  4E04 A;  1K55 A;  3VP4 A;  1K4F A;  4B4X A;  5EM0 A;  3Q81 A;  1ES3 A;  2E8I A;  2WYX A;  4XT2 A;  3FZC A;  4MMN A;  5J3W A;  5J8X A;  4OP5 A;  4OOY A;  2K31 A;  2Z6C A;  3OCL A;  3U2A A;  2ZC5 B;  3EEH A;  1BLC A;  3PAE A;  3WRT A;  3CUE C;  4JXS A;  1U60 A;  3ITB A;  3B47 A;  2OSU A;  4BWI A;  4XUZ A;  3K2N A;  4OH0 A;  4F94 A;  1PFL A;  2X01 A;  2PRF A;  2PU4 A;  3MKE A;  4S2J A;  3UB8 A;  4HHD A;  2R78 A;  5CGW A;  3IT9 A;  2H0T A;  1CEF A;  3UE3 A;  2H5S A;  2NUP C;  3EOI A;  1XFQ A;  4E3I A;  1DJC A;  2D02 A;  3TRC A;  3SW1 A;  2QPN A;  1IKI A;  4NEE D;  4QB8 A;  4B88 A;  4R4R A;  2JC7 A;  1T18 A;  3DWK A;  2DNS A;  4FD8 A;  4CQH A;  5AVF A;  3E2K A;  3RJU A;  3DTK A;  4ZDX A;  1SKO A;  1H5X A;  2XH9 A;  1YMX A;  1HZO A;  2WKH A;  4GCZ A;  5FEG A;  3GEC A;  4M3K A;  5FI7 A;  3LR0 A;  4R23 A;  4IHQ A;  1CJF A;  3HUN A;  2E8J A;  1TS7 A;  4F3L B;  4ETX A;  4LV1 A;  2WGI A;  1FCN A;  1V9Y A;  1WE4 A;  2JHE A;  2ZQ8 A;  2EX8 A;  3SZT A;  1ZG4 A;  4R4S A;  4PM6 A;  3GVB A;  4H6J B;  4Q0J A;  5HW3 A;  1M6K A;  1NYY A;  1KE0 A;  4FCF A;  2ZC4 B;  4L9E A;  1PIO A;  3VMA A;  3N7W A;  3IH9 A;  4QWO A;  3FKW A;  1KGG A;  2JBF A;  2GZA A;  4GKU A;  1YLJ A;  5CGS A;  3AGE A;  3RH8 B;  5EVI C;  2J80 A;  4BL3 A;  3A0R A;  4GJ4 A;  4GDB A;  4P6Z M;  1L0F A;  3UB9 A;  2KDK A;  3ZCZ A;  4G3K A;  5EFW A;  4Y7P A;  2J9O A;  3LR5 A;  5KMW A;  4OLG A;  3T1Q B;  2V8C A;  4Y13 A;  5JYP A;  3MFD A;  5DTK A;  5HL1 A;  2C5W B;  4HOI A;  3OZH A;  1D06 A;  4EBP A;  1L2S A;  4WN5 A;  1CQA A;  4DDY A;  3IQA A;  3IS2 A;  2I72 A;  4NKP A;  3G4P A;  2HJE A;  1S1Z A;  1P97 A;  2HP9 A;  4JGO A;  2WKE A;  1YAX A;  4IED A;  4LRY C;  2QKP A;  3A3D A;  5TR7 A;  2XQZ A;  3V3R A;  2ZLY A;  4Y0U A;  3A0V A;  4PM8 A;  3S22 A;  4YWZ A;  3FV7 A;  2Q9M A;  3S7P A;  1T1A A;  3UE1 A;  2HPB A;  3MXS A;  2HDU A;  4Y5F A;  4BBV A;  1DJA A;  4DJ3 A;  3DBA A;  3HVF A;  5TBM A;  1LL8 A;  1L0E A;  4GHI B;  4ZJ3 A;  1PRQ A;  5HL6 A;  4QHC A;  3BQ8 A;  3MMH A;  3LR4 A;  3S4X A;  4WM9 A;  2KLI A;  2B5R A;  2Z2M B;  3IF6 B;  3RXW A;  5FQJ A;  3C4P A;  4WUJ A;  5L10 A;  1XP4 A;  3MR0 A;  3KX0 X;  3KSH A;  5EVI A;  4KZ8 A;  1XJ4 A;  4MDZ A;  4QU3 A;  1Z09 A;  3VFF A;  3BY8 A;  4Q0H A;  2A49 A;  5EEC A;  2DCF A;  1SCW A;  2V0U A;  3LI8 A;  3IXH A;  5GHZ A;  4HQA A;  1KOU A;  4OKP A; 
#chains in the Genus database with same CATH homology
 1H3Q A;  1UGU A;  2LB9 A;  2B18 A;  5G4Y A;  4ARZ B;  1OT9 A;  2QYB A;  4I3A A;  4LRX C;  4OOL A;  4Y3I A;  3JVU A;  4PKY A;  2VEA A;  2V1A A;  3FPV A;  1EW0 A;  3T4O A;  5F68 A;  2P7J A;  4P6Z S;  1TF1 A;  4Q0I A;  2D01 A;  2OAQ 1;  2V1B A;  4MN5 A;  2Y79 A;  4CLC A;  3OLO A;  3CUE A;  1IOU A;  3S7N A;  3UMD A;  3F1N B;  1N9O A;  3G6O A;  3NOT C;  2VV6 A;  3MQQ A;  5HDS A;  4I38 A;  3B42 A;  3CIT A;  3UME A;  1S4S A;  3EEA A;  2W3H A;  5DJT A;  1YKD A;  2M7U A;  4WEL A;  1OPX A;  3VE4 A;  2A24 B;  1P9R A;  2JKR M;  1LSW A;  3MJQ A;  1W63 Q;  3VOL A;  1IFQ A;  5HSQ A;  4LLO B;  2VA0 A;  5HDD A;  1NLY A;  3HJI A;  4CLC E;  4GLQ A;  4HNB A;  1OJG A;  3LYX A;  4FSF A;  4AFI A;  2J3W A;  2O9A A;  3E4O A;  4KQD A;  2I9V A;  3CWF A;  2OWJ A;  2VLG A;  1TS8 A;  2M7V A;  2YKF A;  3RFB A;  3S7Q A;  2W3E A;  5HWW A;  1UWN X;  5MC7 A;  4L9G A;  3EGD C;  2QJ5 A;  2W0N A;  3BWL A;  5CX7 A;  4CLC B;  4EEP A;  1XFN A;  3K3D A;  4NXG A;  2VGL S;  2V0W A;  3PR6 A;  2GX5 A;  2A2L A;  2MJ6 A;  3BW6 A;  3PBS A;  4O8G A;  5HZH A;  4EU0 A;  2XA7 S;  2M1C A;  3PXP A;  3LUQ A;  3TE8 A;  1S1Y A;  2G7U A;  2OOL A;  1JNU A;  4BMW A;  4ARZ A;  5IS1 A;  1VB6 A;  2LB5 A;  2NUT C;  3KYZ A;  2WKQ A;  1T1B A;  2P04 A;  2XRN A;  3BY9 A;  2W3G A;  4NXE A;  1F98 A;  4YOF A;  3CI6 A;  5J4E A;  4EUV A;  2INW A;  4HH3 A;  2XSS A;  4UQI M;  4ME4 A;  3K3C A;  4EER A;  4LPZ A;  1LT0 A;  3PBO A;  4Y2F A;  1H8M A;  4HP9 A;  4G3V A;  2KOI A;  3EQV A;  2ZMV A;  3PBN A;  1S66 L;  1DP9 A;  2VZW A;  3ICY A;  5K5B A;  1OJ5 A;  1Y28 A;  2PDR A;  1NLZ A;  2DMW A;  5DFX A;  3F1P B;  2HF6 A;  4O0P A;  3ULF A;  3R7W A;  3OBF A;  3CLO A;  5KSH A;  2PHY A;  2VV7 A;  3H7W A;  2ZBB A;  5DKL A;  2VV8 A;  4LRZ E;  2BAS A;  3V67 A;  3W2Z A;  5AVE A;  1TS0 A;  2ZMF A;  5L8M A;  3ZQ5 A;  3S7O A;  4E04 A;  3OOV A;  2O9C A;  3P7N A;  5DKK A;  1G28 A;  2L1M A;  2EWW A;  3OC2 A;  3PBR A;  3PYP A;  5IU1 A;  4ETZ A;  4EW7 A;  4HY8 A;  3E4P A;  2PYP A;  3VV4 A;  3MQO A;  3P01 A;  4GW9 A;  4XT2 A;  2XRO A;  4MMN A;  1T19 A;  3NJA A;  3T4T A;  4WEJ A;  4HP4 A;  4PKY G;  5J3W A;  1W63 M;  3LIE A;  5G4Z A;  3KO6 A;  5HDC A;  3C38 A;  2K31 A;  3KSI A;  4HJ4 A;  4M4X A;  5I5L A;  1P9W A;  5IT5 A;  2Z6C A;  3HCY A;  1ZHH B;  3OCL A;  2O99 A;  3R7W B;  3U2A A;  3EEH A;  4GS9 A;  4HJ6 A;  2PR6 A;  3CUE C;  4R70 A;  4HIA A;  3H7W B;  4MN7 A;  3B47 A;  4I3J A;  2WKP A;  4UEY A;  3LIB A;  4F3L A;  4BWI A;  3T4S A;  3K2N A;  5DF9 A;  3OCN A;  5DFY A;  3KYQ A;  3LI9 A;  1DP8 A;  1P0Z A;  3UB8 A;  4HHD A;  2R78 A;  4DMZ A;  2J3T C;  1V9Z A;  3R4K A;  5HPF A;  2O9B A;  4HI4 A;  3UE3 A;  4K08 A;  2NUP C;  2PYR A;  4H6J A;  3EOI A;  1XFQ A;  3F1P A;  4KQO A;  2JN7 A;  4EET B;  2D02 A;  3TRC A;  3SW1 A;  1OTI A;  4HH2 A;  3F1O A;  1STZ A;  3RTY A;  1VHM A;  2OAP 1;  4NEE D;  3MFX A;  4MCW A;  3T4L A;  2VGL M;  3NOU C;  1T18 A;  3D3O A;  1F9I A;  3FG8 A;  4XT2 B;  4CQH A;  2ZOI A;  3KSG A;  2XA7 M;  5AVF A;  5HWT A;  3MQ0 A;  4KUK A;  3T50 A;  5HPI A;  2O0Y A;  5A8B A;  3ZYT A;  2J3T D;  5DJU A;  3H9W A;  1LSX A;  4WEK A;  1OTE A;  4B9O A;  3PBT A;  4BBT A;  4GCZ A;  2GJ3 A;  3GEC A;  3LR0 A;  1OTD A;  4DJ2 A;  4L0L A;  3MXQ A;  4GS9 B;  1TS6 A;  4IHQ A;  1MC0 A;  2PD8 A;  3TW8 A;  2EWV A;  1TS7 A;  4F3L B;  4ETX A;  2FZ0 A;  4JGQ A;  4ZRR A;  1V9Y A;  2Y8H A;  2JHE A;  4JGR A;  2P08 A;  1S4R A;  1D7E A;  4HJ3 A;  3H82 B;  4I5S A;  4R3A A;  5C5K A;  4OOM A;  4EES A;  1ZTU A;  2PT7 A;  4H6J B;  4Q0J A;  1N9N A;  3O5Y A;  4IUK A;  3EWK A;  5F6A A;  3F1O B;  4YNR A;  3UB6 A;  4L9E A;  3CAX A;  4QPR A;  4BJP A;  3FPW A;  4NXF A;  3UB7 A;  2GZA A;  3LIC A;  2H28 A;  1DP6 A;  4IJG A;  1YSQ A;  2W3D A;  3RH8 B;  1GSV A;  3KSF A;  2K2N A;  3UE6 A;  3PBQ A;  2J80 A;  3A0R A;  4GJ4 A;  2K7S A;  2L0W A;  1N9L A;  2YKH A;  5FL3 A;  4P6Z M;  1T1C A;  3E0Y A;  3VE3 A;  3UB9 A;  2KDK A;  4G3K A;  5EFW A;  4B93 A;  5TBM B;  4FOF A;  4L9F A;  2FH5 A;  2VKS A;  3EGX C;  1OT6 A;  4EEU A;  3LR5 A;  1F5M A;  1MKM A;  5HD3 A;  1X0O A;  1NWZ A;  5LBR A;  1OTA A;  3NHQ A;  4RQ9 A;  2W27 A;  3T4J A;  2JKT I;  3LID A;  3LFV A;  4PHT A;  2QWS A;  2PD7 A;  3LIA A;  4HOI A;  4WLA A;  1D06 A;  2B02 A;  3T4K A;  3EQU A;  4NXB A;  4WN5 A;  4CLC C;  4PAU A;  1GSX A;  1LSV A;  4GHI A;  3IS2 A;  4NKP A;  4Z1W A;  3GDI A;  2Z6D A;  2HJE A;  1S1Z A;  1P97 A;  3JVV A;  4JGO A;  2L4R A;  2W3F A;  3A0S A;  1YAX A;  4G3W A;  1GSW A;  2VX8 A;  3NOP C;  3H82 A;  4LRY C;  2QKP A;  3T4Q A;  3LR3 A;  4JGP A;  2PR5 A;  2QJ7 A;  3A0V A;  5HD5 A;  3D72 A;  2QHK A;  4YWZ A;  2IA2 A;  4CLC D;  2W1T A;  3TJZ C;  1OTB A;  4EQ1 A;  3S7P A;  4II7 A;  3IBJ A;  3MF0 A;  1NRJ A;  1T1A A;  2GNX A;  2VJW A;  5F5Y A;  4WL9 A;  4O01 A;  3C8C A;  4Y5F A;  3LIF A;  1G6O A;  1ODV A;  2W1R A;  4BBV A;  3BJN A;  2ZOH A;  4DJ3 A;  3DBA A;  2JKR I;  3E4Q A;  3HJK A;  3C2W A;  3FC7 A;  1LL8 A;  4I39 A;  5TBM A;  4GHI B;  3IS2 B;  2HV1 A;  5AJG A;  1XJ6 A;  5TJJ A;  5J7E A;  2EA9 A;  5HL6 A;  3BQ8 A;  4KUO A;  3PHY A;  4DN0 A;  3MMH A;  3LR4 A;  1WA9 A;  4UQI S;  2V9A A;  2HGV A;  2KX6 A;  1S67 L;  2KLI A;  3F1N A;  1YSP A;  2WKR A;  1XJ3 A;  4R6L A;  2JKT M;  2W1T B;  4WUJ A;  1BYW A;  1DRM A;  4WF0 A;  3MR0 A;  3KX0 X;  3B33 A;  3KSH A;  3BQA A;  2HJ9 C;  1MZU A;  1XJ4 A;  1UWP X;  2A24 A;  4MDZ A;  5F69 A;  4BBU A;  3E98 A;  3IBR A;  2OWH A;  3BY8 A;  2CMN A;  4R38 A;  4EXO A;  4Q0H A;  2V0U A;  4IUH A;  3LI8 A;  5KIZ A;  1TD5 A;  3C30 A;  4HQA A;  1KOU A;  4I3I A;  4MN6 A;  1XJ2 A;  5HWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...