4P85A

Crystal structure of est-y29, a novel penicillin-binding protein/beta-lactamase homolog from a metagenomic library
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
390
structure length
390
Chain Sequence
SMPDLLTNVAENYVNQDLFAGIEWRIDQDGKPIFQGCAGVKDIETRTFIPKNAIYRIYSMTKPIVSFLAMMLIERGVFRLSSPIQNFDPRFKSMKVIDQHAHIEPATALITIEHLLTHQAGFSYDFSLGCPISAHYRDAQLIEDGGRDLTDMMGVLAELPLVFHPGTQWKYSISTDVLAHIIECATGERVDDLLQRLIFDPLDMQDTGFSLPLDGASRLMEVYGMRSLHGLPALKPAPHVLVPADLGSSHPTDDPDFRRGGHGLYSTLDDYMAFANMLLSGQTPEGETLLSPAVLKLALAPRVHFGARGMRINDEPFAGYSWNLLGRVMTDVGAAAYATHLGEFGWSGAAATYFWVDPTKNMTGCVMTQFLGSQHPIGSDMQAAAMSMLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis and biochemical applications of a novel penicillin-binding protein/ beta-lactamase homologue from a metagenomic library.
pubmed doi rcsb
source organism Metagenome
molecule tags Hydrolase
molecule keywords Est-Y29
total genus 124
structure length 390
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4p85A00
5KSCA 4UA6A 4H8RA 4FCFA 2ZC6B 1SCWA 5AQAA 4S2OA 3V50A 1BT5A 4HBTA 1NY0A 1IYQA 1PZOA 4OLGA 5FQ9A 2Y4AA 3PBTA 4N9KA 4E3IA 2DRWA 1PW1A 5BOHA 4R4SA 5HAPA 4DDSA 5AQBA 2V1ZA 4IVIA 5FQKA 4QU3A 4WMCA 1L2SA 3V3RA 3B3XA 1MWSA 3IXGA 3FWLA 1RGZA 4O7DA 4E3LA 2XD5A 5FAPA 3GRJA 1L0FA 2JC7A 4BL3A 3HL9A 2PU4A 1J9MA 1LL5A 2V20A 5CERA 2J7VA 2Y2OA 1JWPA 3A3EA 4ZJ3A 2H0TA 1PWCA 2BG1A 2H10A 5HL1A 4R3BA 4LCMA 1ZG4A 5E2EA 3ZHHA 3CMZA 4P6BA 3ZVTA 4DE0A 4ID4A 4BL2A 1TEMA 4PM8A 3C4OA 1CK3A 5GHXA 3Q1FA 3UE1A 1FCNA 1IELA 3MKFA 4WM9A 4UAAA 5FASA 2XK1A 5F82A 4ZBEA 1ONHA 3S4XA 3VFFA 4HBUA 4PM9A 3O87A 1QMFA 4JBFA 3WRZA 1KDWA 1QMEA 2ZC3B 2WGWB 4OOMA 1GA0A 5CGSA 4M3KA 5GLBA 5GLCA 1RGYA 2QZ6A 4U0TA 4KQQA 1Z6FA 3OPPA 2EX2A 3OPLA 4WEJA 1ES5A 3WRTA 4D2OA 5J8XA 4WYYA 3IXDA 4YFMA 1EWZA 1SDNA 1LI9A 5F83A 1WE4A 4OPQA 1KE0A 1W8QA 3UPNA 4IBRA 3ZG0A 1K6RA 2ZLYA 3FYZA 4KZBA 2EFXA 3D4FA 4P85A 4F94A 3SS4A 4X56A 3IXBA 2R9WA 3VSLA 3TOIA 4KG6A 1GCEA 3DWKA 2P9VA 1HD8A 1S0WA 1ES4A 1XGIA 4WZ5C 5FAOA 1TVFA 3AGFA 3BFGA 3MBZA 5GLDA 4OH0A 2VGJA 5EOOA 1FOFA 3Q07A 4UHUA 2Z2MB 3HBRA 4EBNA 2Y2PA 1JWZA 2XEPA 3ITBA 3NIAA 3IWIA 5FI2A 4C6YA 3CZDA 5FATA 1MY8A 4S2LA 4DE3A 1W8YA 3MZFA 3Q82A 4EBLA 1KGGA 3V5MA 4R23A 3UDXA 1GHPA 1Y54A 4KZ9A 2GDNA 2CC1A 3NBLA 3MZDA 3HUOA 3G4PA 5AQ9A 4DXCA 1XP4A 1K56A 4KQOA 2DNSA 3BRMA 3NC8A 5IHVA 2OLVA 4IEDA 2ZM2A 2X01A 4CPKA 2WADA 2Z2LB 2ZQCA 5FA7A 2HP9A 4LV1A 2C6WB 4R4RA 5FQMA 1FR6A 3N8SA 5DF8A 2HDUA 1BLPA 4OPZA 4Q8IA 1AXBA 3PTEA 3WS1A 4RX2A 1K55C 3PBQA 3BLSA 3WS5A 4PPRA 2Y2HA 3N6IA 3CG5A 4PM7A 4S2IA 4U0XA 1K4EA 1XA7A 3DW0A 4OP5A 3LY3A 3IH8A 3PBOA 4GD6A 3GQZA 4JF4A 3Q7VB 4QB8A 3GR2A 3WS2A 1FSYA 3WS4A 3C7VA 5JYOA 1YLJA 3PBSA 4S2NC 5CTNA 5E2FA 3PAEA 1NYYA 4EWFA 1BLHA 2RCXA 4Y0UA 3RXXA 1DJAA 5A92A 3MXRA 2WYXA 1G68A 4N9LA 2Y2NA 2XDMA 1XKZA 3BFCA 4WZ4A 4E3MA 4BENA 1NZUA 4S2PA 1IYPA 4JXWA 2WZZA 1PZPA 3G31A 1XXMA 1DJCA 1IEMA 1LLBA 3ZNTA 1YLTA 5FI7A 3I7JA 5CEBA 4OLDA 3DTMA 4OOYA 3LCEA 4OPRA 3HREA 1MBLA 5HW3A 4GNUA 4Y0TA 2E8IA 4L0LA 4ZJ2A 4QD4A 3MKEA 4RYEA 1YM1A 1FR1A 1JWVA 2WGVA 3SS5A 3Q7VA 4JKTA 3SH9A 3OC2A 5A93A 3S1YA 2Y2JA 4JPMA 1YLPA 2PU2A 5KSHA 4IVKA 3G32A 5GHZA 5FDHA 3EQUA 4UA9A 1W7FA 4OQIA 5CRFA 1H5XA 1PWGA 1ESUA 3G35A 3E2KA 3QNBA 2Y91A 1K6SA 4GOGA 4MBKA 1NZOA 4HEFA 5M19A 1K55A 1BLCA 1L0GA 3UPOA 3UNWA 3VFHA 5FAQA 1ERQA 3GVBA 3SS3A 3QHYA 4P87A 1MWUA 2WZXA 4WZ5A 3N4IA 2JE5A 3HLBA 2J9OA 4FH2A 4ZTKA 4WBGA 5HAIA 5HARA 3IWQA 4KZ5A 4ZJ1A 1NYMA 2Y2IA 3IH9A 4Y0OA 3VP4A 3GV9A 1BSGA 2ZQ7A 3M2JA 3Q7ZA 1K38A 2VGKA 2EX6A 1VQQA 4JXVA 4B4XA 2XH9A 4S2NA 3N8LA 4HESA 4NETA 3VP3A 4KG5A 2HDRA 1E3UA 2Y2GA 3GTCA 3HUMA 3WWXA 4KENB 2V2FF 3BM6A 1BTLA 4PM5A 1IYSA 3N8RA 1ZKJA 3VP1A 4PM6A 5M1AA 3PBNA 3A3IA 1YMXA 2ZM0A 4Y7PA 2IWBA 2A3UA 2P9VB 3BFEA 1MKIA 1K25A 4FD8A 4KZ8A 2EXBA 3ITAA 1CEGA 5TFQA 5EOEA 1DJBA 2ZQ8A 3HLWA 2WAFA 4GDBA 2R9XA 3W4PA 1L0DA 4N92A 5EPHA 3UN7A 1I2SA 2H5SA 2HDQA 3VP2A 2XQZA 1YLZA 3BFFA 5U47A 1S6RA 3C4PA 3ZFZA 1RCJA 1WYBA 1PYYA 4OP8A 3UDFA 3HVFA 3IF6B 3AGEA 4PMAA 5G18A 2ZM8A 1MWRA 4BQMA 4LV0A 3FKWA 1OMEA 1LI0A 1YLWA 3PBRA 4JF6A 4N1XA 3DWZA 4P0MA 4X53A 5F1FA 1TDLA 3OZHA 4FH4A 4S2KA 3RXWA 4R3JA 3ZG5A 4GD8A 4QHCA 4OOLA 2A49A 3G2ZA 4X68A 3OCNA 3NY4A 1SHVA 4K0XA 3HLDA 1HZOA 1KGFA 3LEZA 3FZCA 2ZC5B 3VP0A 2C5WB 4JXGA 3MXSA 5DTTA 3NI9A 2XR0A 4MNRA 3UPPA 4E3JA 3ZG8B 2XD1A 5GLAA 1FCOA 1YMSA 3EQVA 4E3NA 3VOYA 2QMIA 2WGWA 1GA9A 3ZNYA 5CGWA 4X6TA 4QJGA 2XFSA 3IHAA 1YLYA 5CHMA 4OQ0A 3BECA 2G2WA 1E25A 1EI5A 2WAEA 3GSGA 4XUZA 1HTZA 1DY6A 3ZDJA 1K54C 4BLMA 1GHIA 1GHMA 4OKPA 2Q9MA 3VOZA 3TSGA 1YT4A 4KZ6A 5FQIA 2WGIA 3IQAA 4GKUA 2Y2LA 4DE1A 2P74A 4XXRA 2WUQA 4MBHA 4GN2A 3HLCA 1BULA 1ERMA 2HP6A 2QPNA 5D3OA 3OPRA 4DE2A 3FKVA 3V39A 5EVIB 4S2JA 3BEBA 4QY6A 2OSUA 4R0QA 5FQQA 1BLSA 3SOIA 2EFUA 5A90A 3O3VA 2WKIA 2XGNA 3G30A 2ZMAA 3A3FA 4IBXA 1L0EA 2WKHA 1EROA 1RP5A 3M6BA 4EBPA 4JLFA 4DXBA 1NXYA 2ZD8A 5DTSA 1ZC2A 4WELA 4OQGA 2I72A 5AQ7A 1MWTA 4NK3A 4E6XA 1Q2QA 5F1GA 3G2YA 3ZCZA 4A5RA 3LY4A 1Q2PA 2BLSA 5DVAA 3HLEA 1KVMA 1WYCA 3M6HA 4Z9QA 1I5QA 3QNCA 1XPBA 2IWCA 3UE3A 5I94A 1E3UD 3NDEA 5HX9A 3VMAA 1SDEA 4N1HA 3WS0A 5DF9A 3ZG9B 3C5AA 3RJUA 2Y2KA 1NJ4A 4LCLA 4MLLA 4B88A 1K4FA 3A3DA 1H8ZA 1G6AA 4DF6A 1O7EA 1TDGA 2X71A 1FQGA 2HP5A 5JYPA 4ZAMA 2FFYA 3S22A 5L2FA 4GB7A 5M18A 3IF6A 3P98A 2UWXA 3W8KA 5EVID 3V3SA 3Q81A 2FFFB 4XUXA 1K54A 2ZJ9A 4RVAA 1ES3A 2J8YA 5CEDA 1I2WA 5CTMA 5E2GA 2OLUA 1M6KA 3M2KA 4WEKA 4E6WA 5KZHA 2ZQDA 2PBYA 3A3JA 5CHJA 4K91A 1PWDA 4JXSA 3UY6A 4LV3A 1ES2A 2B5RA 2HDSA 1KE4A 2ZC7A 1K57A 1PI4A 3IHBA 5FSRA 4GZBA 4KZ7A 2XFTA 4MEZA 5CECA 4RA7A 2HPBA 1LL9A 3UO9A 5TGFA 1KDSA 4WMCD 1VM1A 1C3BA 4KZ4A 5FQJA 1N4OA 2Y55A 1CI8A 3MZEA 3HLFA 5EUAA 1E4DA 1KGEA 1ONGA 3OCLA 4YINA 4R1GA 3UDIA 1MXOA 1KE3A 3JYIA 1JTGA 5EVIC 1BZAA 2Y2MA 5CGXA 5A91A 1XA1A 5HFOA 4ZDXA 1PIOA 4FSFA 1MPLA 4KQRA 4X69A 5CXWA 3W4QA 4E3OA 5KMWA 3ZVWA 4E3KA 2Y59A 3HUNA 1ALQA 5GL9A 4UA7A 5GHYA 5DF7A 5EE8A 1PI5A 1YQSA 4OVDA 3IF5A 3SH7A 3E2LA 4B4ZA 5FI6A 1O07A 3CJMA 1FSWA 3BLMA 3BYDA 3N7WA 1PW8A 4OQHA 4KZAA 2OV5A 2IWDA 1W5DA 5HAQA 4EQIA 1ZG6A 1BUEA 1KVLA 2ZQ9A 4KZ3A 1SKFA 4BJPA 4BD0A 3SH8A 5EECA 1CEFA 1JVJA 3HLGA 4EUZA 3P09A 2JBFA 2XLNA 4OONA 3ZGAB 3NCKA 1HVBA 3G34A 5E43A 3TG9A 2Y2QA 4MBFA 1H8YA 2RL3A 4EV4A 1XX2A 3VSKA 4CJNA 3NDGA 1IKGA 4QY5A 1JTDA 5CHUA 3LO7A 4BD1A 3OPHA 4KG2A 4X55A 4DRTA 3IXHA 2X02A 1U60A 1K57C 2EXAA 3C7UA 3O86A 5DTKA 4S2MA 3IT9A 1ESIA 2EX9A 1NRFA 3O88A 2ZC4B 1IKIA 1LHYA 3GMWA 4LV2A 2DCFA 3ISGA 3BFDA 4OPYA 3PAGA 3FV7A 1M40A 1K56D 2Q9NA 2XF3A 4LENA 2J9PA 1IYOA 4GDNA 2WK0A 1N9BA 3UE0A 3IF6C 4RX3A 5EVIA 4DDYA 3W4OA 3AGDA 1XGJA 2G2UA 2ZQAA 4DKIA 1FCMA 5EVLA 4K0WA 2H0YA 4C75A 2WKEA 3MFDA 4JF5A 1W79A 4C3QA 1CI9A 4U3TA 5E2HA 3IWOA 3ZG7B 2JCHA 5TR7A 2EX8A
chains in the Genus database with same CATH superfamily
3V50A 3LICA 4OLGA 4CLCD 1CJFA 2DRWA 5BOHA 2VK3A 5FQKA 4WMCA 1L2SA 4LRZE 2LB9A 4D60A 3UB7A 3GRJA 3MS6A 4XT2A 1TS6A 1P9WA 3HL9A 2PU4A 5HL1A 5E2EA 4P6BA 2P08A 4BL2A 4PM8A 3C4OA 1CK3A 5GHXA 2XK1A 4GHIB 4ZBEA 1ONHA 2HJEA 4HBUA 3O87A 3WRZA 3CAXA 1QMEA 2ZC3B 4OOMA 1RGYA 1Z09A 1Z6FA 4WYYA 5EM1A 1LSWA 2A24B 4KZBA 4P85A 3SS4A 3IXBA 1T1CA 3TOIA 1STZA 1GCEA 4ARZA 1HD8A 5L09A 3Q07A 2Z2MB 2VV8A 2XEPA 3NIAA 3CZDA 1MY8A 3Q82A 2OOLA 3V5MA 3UDXA 4CQHA 4GW9A 2J3TC 1XP4A 1K56A 2X01A 2J3TD 2OLVA 2ZQCA 4R4RA 5FQMA 5DF8A 4B9OA 1BLPA 4HJ4A 2VGLM 3PTEA 3T1XA 5LBRA 3K3DA 1XA7A 3DW0A 4UQIS 3LY3A 4R6LA 3DBAA 3IH8A 3GR2A 1FSYA 4I39A 3KYEA 3QP8A 1BLHA 2XROA 3RXXA 4L9EA 4N9LA 5DKKA 3BFCA 4BENA 5MC7A 2WKRA 1XXMA 4OOYA 3LCEA 5HWTA 3LFVA 5HW3A 4L0LA 4NEED 3SS5A 3SH9A 3H82A 2Y2JA 4JPMA 4IVKA 3G32A 1OTIA 4UA9A 5CRFA 1H5XA 1T1BA 1K6SA 1G6OA 3CPTA 1D06A 1K55A 1L0GA 1ERQA 2PHYA 3SS3A 1MWUA 2WZXA 3HLBA 3NJAA 3IWQA 4KZ5A 4HHDA 4HIAA 1NYMA 4I38A 3NHQA 3IH9A 4Z1WA 1K38A 2EX6A 1VQQA 1VEUA 3N8RA 3PBNA 2IWBA 1N9NA 4Y5FA 5DFXA 2A3UA 2M7UA 1MKIA 2EXBA 1CEGA 3T1SA 4NXBA 1KOUA 2HJ9C 2ZQ8A 2R9XA 5EPHA 2H5SA 3VP2A 4MN5A 1YLZA 4HH3A 3T4LA 4IUKA 1RCJA 1WYBA 3L7HA 3UDFA 3IF6B 3RFBA 4KUKA 4HP4A 1MWRA 4Q0HA 4LV0A 4LGWA 1OMEA 1LI0A 1YLWA 4P0MA 5TBMA 3IX4A 2OAP1 1TDLA 4FH4A 4ETXA 4GD8A 4FTXA 4OOLA 2R78A 4K0XA 5HL6A 1HZOA 4HI4A 4UQIM 3MXSA 3CITA 5DTTA 4HNBA 4MNRA 4E3JA 3EQVA 2Y8HA 3B33A 2WGWA 1GA9A 5CHMA 4OQ0A 4BWIA 3T12B 3BECA 4O8GA 4XUZA 3BQ8A 1DY6A 3ZDJA 1G5UA 1S1ZA 4BLMA 3HJKA 3VOZA 5FQIA 5FEFA 4GN2A 3HLCA 5D3OA 4RQ9A 2PAVP 1W63Q 2E8JA 4B93A 3PYPA 4G3WA 4S2JA 4QY6A 2XGNA 2PYPA 4IBXA 1L0EA 3QP4A 1NLYA 3UB8A 1NXYA 1MWTA 3BQAA 1Q2QA 4A5RA 3UB6A 1KVMA 2EWVA 1XPBA 5I94A 3WS0A 2W27A 4LCLA 1S4RA 3IS2A 1K4FA 2PYRA 3JPUA 2X71A 2HP5A 3BJNA 5M18A 3QP5A 2UWXA 3W8KA 5DFYA 1K54A 3D72A 4RVAA 2L4RA 5CTMA 2OLUA 3M2KA 4WEKA 2PBYA 3R7WA 2A2LA 1N9LA 1KE4A 2XFTA 3MFXA 4RA7A 2Y55A 1CI8A 4H6JB 3HLFA 5EUAA 1N9OA 2I9VA 1ONGA 3OCLA 3GDIA 1KE3A 2Y2MA 5CGXA 4X69A 4KQRA 3TW8A 3W4QA 2Y59A 1D1JA 4UA7A 4WLAA 4OVDA 2JKTM 2OWHA 1S4SA 1FSWA 2ZBBA 4H6JA 2ZQ9A 4KZ3A 5EECA 4EUZA 3P09A 2JBFA 2XLNA 3ZGAB 1H0MA 4I3JA 4WL9A 2Y2QA 3VSKA 4CJNA 3NDGA 1IKGA 5CHUA 3LO7A 1S1YA 3ICYA 4KG2A 4O01A 2X02A 4S2MA 1ESIA 3O88A 1TD5A 2DCFA 3ISGA 4R3AA 1XJ2A 2V8FA 3QP1A 3W4OA 4ESPA 1XGJA 4F3LA 5EVLA 4K0WA 2H0YA 4P6ZS 4C75A 4JF5A 3MFDA 4UEYA 4C3QA 3E0YA 4IUHA 4UA6A 2ZC6B 2MJ6A 1IYQA 1PZOA 5FQ9A 2V1AA 5HAPA 3T4OA 5AQBA 5F69A 5IU1A 3B3XA 3IXGA 1PNEA 4E3LA 5FAPA 5A8BA 1L0FA 4AFIA 1J9MA 1LL5A 2VV6A 1JWPA 3G6OA 4ZJ3A 2O9AA 4LCMA 1ZG4A 4YNRA 4DE0A 3ZVTA 2QJ7A 1AWIA 1TEMA 2HZ5A 4R38A 4WM9A 1QMFA 4JBFA 3S7QA 2WGWB 5GLCA 4U0TA 3OPLA 3EWKA 1ES5A 1FILA 5J8XA 3LIEA 4Y17A 5F83A 3UPNA 3P01A 3D4FA 4X56A 1ACFA 2P9VA 3D9YA 2KOIA 5AJGA 2VGJA 1FOFA 1JNUA 3KSHA 3MZFA 3W2ZA 1GHPA 2CC1A 3G4PA 5AQ9A 3NC8A 2WADA 5FA7A 4LV1A 2C6WB 1FR6A 4OPZA 1K55C 1V9YA 4PPRA 2Y2HA 4HOIA 4PM7A 2VLGA 1TS7A 1K4EA 4U0XA 3U2AA 4ZRRA 3PBOA 4JF4A 4DN0A 4II7A 3LR4A 3WS2A 5HWWA 4K08A 5JYOA 1YLJA 5I5LA 3PBSA 5CTNA 5E2FA 1NYYA 1W63M 4EWFA 5A92A 2WYXA 1G68A 1PRQA 2P7JA 2Y2NA 3F1OB 1ZTUA 1NZUA 1GSXA 1Y28A 3G31A 3E4OA 2VX8A 1DJCA 1IEMA 1YLTA 3HREA 4Y0TA 1T19A 3K3CA 1DRMA 3H82B 4HJ3A 1FR1A 1JWVA 2WGVA 3A0VA 3Q7VA 4JKTA 4I3IA 1YLPA 5GHZA 2PR5A 5FDHA 3E2KA 3QNBA 2PR6A 2VV7A 5FEGA 4HEFA 1BLCA 3UNWA 3VFHA 3GVBA 3QHYA 4P87A 1F98A 1X0OA 2JE5A 2KX6A 2J9OA 4FH2A 1S66L 5HAIA 4ZJ1A 4Y0OA 3V67A 3H9WA 1YSQA 5C5KA 4JXVA 2XH9A 3N8LA 4HESA 2ACGA 3IBJA 2Y2GA 3MR0A 3BM6A 1BTLA 4EEUA 3EGXC 3VP1A 4PM6A 1YMXA 2ZM0A 4Y7PA 4PKYA 3HLWA 3W4PA 5HD5A 2XQZA 4BBVA 3MJQA 1S6RA 4L9FA 2VEAA 3ZFZA 1PYYA 2XA7M 2Y79A 2HV1A 3AGEA 4PMAA 4EU0A 3FKWA 4G3VA 3RXWA 4QHCA 2QKPA 2A49A 4MCWA 3G2ZA 3NY4A 3T50A 3HLDA 3LEZA 3JVUA 3UPPA 2XD1A 1NWZA 4E3NA 2QMIA 1H8MA 5EM0A 5CGWA 4X6TA 4GHIA 1E25A 1HTZA 1K54C 1GHIA 3TSGA 1YT4A 2P74A 3H7WB 4XXRA 2J3WA 2WUQA 4MBHA 4YWZA 1K0KA 1ERMA 2PD7A 3OPRA 1VEUB 3T1RA 5EVIB 3IX8A 2OSUA 4R0QA 5FQQA 3SOIA 2EFUA 5A90A 2D02A 2PBDP 3VE3A 2ZMAA 2JHEA 1EROA 2IA2A 4EBPA 4JLFA 1DP6A 1J3WA 4OQGA 4E6XA 3LY4A 1Q2PA 4Z9QA 2V8CA 1I5QA 3QNCA 3UE3A 2KLIA 3NDEA 4GJ4A 3MF0A 4N1HA 2QJ5A 1LSVA 3UMDA 3ZG9B 3C5AA 2Y2KA 4MLLA 4B88A 3T4JA 3PXPA 4DF6A 5DJTA 2WKQA 3CUEC 3S22A 3P7NA 3VV4A 1P9RA 3V3SA 1SZVA 4XUXA 4X1MA 2KDKA 1GSVA 2BASA 3LYXA 3L9KA 1I2WA 3MQ0A 2ZQDA 5CHJA 4PAUA 1PWDA 4JXSA 5EFWA 1ES2A 1YPRA 1PI4A 3IHBA 4KZ7A 4HJ6A 2HPBA 1LL9A 3UO9A 1KDSA 4WMCD 5EVEA 1KGEA 3NECA 1MXOA 3QP6A 3JYIA 2W1TA 5A91A 4M4XA 4FSFA 5CXWA 4E3OA 2Q0OA 3LR0A 5GL9A 1PI5A 3SH7A 2JKTI 3CJMA 3BYDA 4OQHA 2IWDA 4CLCC 4EQIA 4Y2FA 1SKFA 4BJPA 4BD0A 1CEFA 5HPFA 1YKDA 1OTAA 2W3GA 4EV4A 4ARZB 4NXFA 3S7PA 3OPHA 4X55A 2EA9A 3QP2A 4DRTA 3IXHA 5HD3A 3DTEA 3O86A 5DTKA 2W1RA 3EOIA 3IT9A 5HDSA 1NRFA 2A24A 3F1OA 1IKIA 1LHYA 3GMWA 4LV2A 1F5MA 3BFDA 3FV7A 3KYZA 4LENA 1VHMA 2J9PA 2JKRI 4GDNA 2WK0A 1N9BA 2M7VA 2WKPA 5G4YA 5EVIA 2G2UA 3T4TA 5E2HA 3H7WA 3CI6A 2JCHA 5TR7A 3ZG7B 4FCFA 1OTDA 1SCWA 5AQAA 1BT5A 4BBTA 1LT0A 1NY0A 2Y4AA 4N9KA 4E3IA 1PW1A 4DDSA 3NOTC 4XT2B 1MWSA 3FWLA 4O7DA 2XD5A 2O9CA 4EQ1A 2B18A 3D3OA 3ULFA 2V20A 2J7VA 3A3EA 1UWPX 3NOPC 1PWCA 4R3BA 3ZHHA 3CMZA 4GS9A 4ID4A 3TE8A 5IS1A 1A0KA 3R4KA 1IELA 4UAAA 5FASA 5F82A 4MN7A 3C30A 1KDWA 5CGSA 1GA0A 4M3KA 2QZ6A 4KQQA 3OPPA 5AVFA 2EX2A 3C8CA 4WEJA 3NOUC 4D2OA 3WRTA 3IXDA 1CQAA 2VZWA 3LUQA 4YFMA 1LI9A 1WE4A 4OPQA 1KE0A 1W8QA 3GECA 3S7OA 4ETZA 3ZG0A 1K6RA 2ZLYA 3FYZA 2EFXA 4LFUA 1S0WA 1ES4A 1XGIA 4WZ5C 1TVFA 3FC7A 3AGFA 3BFGA 5GLDA 4UHUA 2OWJA 3HBRA 2FH5A 1JWZA 3ITBA 3IWIA 5FI2A 4I5SA 4S2LA 4DE3A 2K7SA 4EBLA 3OLOA 4R23A 5HDCA 2GDNA 3NBLA 4DXCA 3MSHA 2HP9A 3N8SA 4KUOA 2HDUA 1ODVA 3PBQA 4PKYG 1P97A 3BLSA 3CG5A 2K31A 4OP5A 2XRNA 2W0NA 4GD6A 3GQZA 3Q7VB 3LEQA 4JGRA 1ZHHB 3PAEA 4Y0UA 2ZMFA 4PHTA 2PT7A 1DJAA 3MXRA 3E4PA 1VB6A 1H3QA 1XKZA 2XDMA 2NUPC 4E3MA 1IYPA 5HZHA 4GLQA 4JXWA 3LR3A 3F1PA 1LLBA 3ZNTA 5FI7A 3I7JA 5CEBA 4OLDA 3DTMA 4LRXC 1MBLA 4GNUA 2E8IA 4ZJ2A 4RYEA 3T4QA 1P0ZA 4IHQA 2GJ3A 3OC2A 2PU2A 3EQUA 4OQIA 5F6AA 4MBKA 4GOGA 1EW0A 1NZOA 2PDRA 3K2NA 5FAQA 3N4IA 4FUWA 4ZTKA 5HARA 2Y2IA 2ZQ7A 3Q7ZA 2JN7A 5TJJA 4S2NA 4NETA 1E3UA 3GTCA 3WWXA 4KENB 1IYSA 1OTBA 1ZKJA 3A3IA 2XSSA 2P9VB 3LR5A 4G3KA 3BFEA 4FD8A 4JGQA 3ITAA 1TS8A 5TFQA 4BMWA 5EOEA 4KQDA 2V0UA 3R7WB 3UN7A 2HDQA 3TJZC 2LB5A 3FPVA 3T4SA 5DKLA 3NULA 5G18A 3KSIA 4CLCE 3SZTA 4BQMA 4N1XA 3DWZA 3IS2B 2ZL1A 3S7NA 4R3JA 3U4LP 4EETB 2W3FA 3JVVA 3MQQA 4HQAA 3VP0A 3FZCA 2ZC5B 3UB5P 1TF1A 1WA9A 3OOVA 1BYWA 2M1CA 1FCOA 1T1AA 4NXEA 3VOYA 2HGVA 3ZNYA 3IHAA 3T4KA 2NUTC 5HDDA 2WAEA 3GSGA 4JGPA 3OBFA 4OKPA 3UMEA 2WGIA 3IQAA 4GKUA 4DE1A 2HP6A 4DE2A 3V39A 4F3LB 3BEBA 1BLSA 2WKIA 1CF0A 2V9AA 1RP5A 3M6BA 4DXBA 2ZD8A 1ZC2A 4WELA 5AQ7A 4NK3A 5F1GA 3G2YA 3ZCZA 4E04A 2BLSA 3M6HA 3KYQA 3PR6A 2K2NA 3LIDA 3LIBA 1OT9A 5FL3A 4GCZA 3CWFA 3TRCA 4JGOA 5HX9A 3RJUA 1NJ4A 1UGUA 5TBMB 3A3DA 1G6AA 1YAXA 1O7EA 1TDGA 4LLOB 5HSQA 2FFYA 5L2FA 2CMNA 3IF6A 3P98A 4CLCA 3Q81A 5CEDA 5KZHA 1M6KA 4E6WA 3E98A 3A3JA 2Z6DA 3CLOA 4K91A 1OPXA 2EWWA 2VGLS 2B5RA 2HDSA 5FSRA 4GZBA 1VETA 4MEZA 5CECA 1VM1A 2VA0A 1C3BA 1N4OA 1PFLA 3MZEA 1E4DA 1MZUA 3UDIA 1F9IA 2H28A 5EVIC 2W3DA 4MN6A 5HFOA 3ZVWA 5DF7A 3CPTB 2INWA 4EEPA 3E2LA 4B4ZA 5FI6A 1O07A 3PHYA 3KX0X 1PW8A 4KZAA 1W5DA 1ZG6A 1KVLA 3SH8A 3HLGA 4OONA 3NCKA 3TG9A 5E43A 3G34A 3CHWP 2GZAA 1VETB 4MBFA 1XX2A 1JTDA 2W3HA 5J4EA 2L1MA 1SKOB 5F68A 4MDZA 1FIKA 3C7UA 1U60A 1K57C 2EXAA 4Q0JA 2EX9A 4LPZA 3T1QB 4OPYA 3PAGA 4Y13A 1M40A 2Q9NA 2XF3A 3UB9A 4CLCB 3MQOA 3CUEA 4X25A 4NXGA 4RX3A 2O0YA 4DKIA 1FCMA 2ZOIA 1XJ3A 3KO6A 1W79A 2L0WA 1CI9A 4KZ8A 2EX8A 5KSCA 3KSGA 4H8RA 4S2OA 2JKRM 4EW7A 2B95A 4HBTA 3FG8A 3PBTA 4R4SA 1LSXA 2V1ZA 4IVIA 4QU3A 3V3RA 1G28A 1RGZA 4WN5A 1T18A 4BL3A 2JC7A 5CERA 2Y2OA 4X1LA 2H0TA 2BG1A 2H10A 2O99A 3HJIA 3Q1FA 3UE1A 1FCNA 3MKFA 4ME4A 3B47A 1IOUA 5F5YA 3S4XA 3VFFA 4PM9A 2J80A 5GLBA 3DTKA 5HPIA 1EWZA 1SDNA 4IBRA 4F94A 2VKSA 1SKOA 2R9WA 3LIFA 3VSLA 4KG6A 2PD8A 3DWKA 3EEHA 5FAOA 2ZL1B 2HF6A 3MBZA 4OH0A 3ZQ5A 5EOOA 4EBNA 3KSFA 2Y2PA 1XJ4A 4C6YA 5FATA 1S67L 2XA7S 1HLUP 4IJGA 1W8YA 2YKHA 3IX3A 1KGGA 1Y54A 4KZ9A 3MZDA 3HUOA 4KQOA 2DNSA 1OTEA 3BRMA 5IHVA 4IEDA 2ZM2A 4CPKA 2Z2LB 3BY8A 4Q8IA 1AXBA 3WS1A 4RX2A 1LL8A 3WS5A 5L8MA 3N6IA 4O0PA 4S2IA 3B42A 4QB8A 2O9BA 3WS4A 3C7VA 4S2NC 2RCXA 3DTIA 4WZ4A 4S2PA 2GX5A 2PRFA 4Y15A 2WZZA 1PZPA 1DP8A 3BWLA 4OPRA 3O5YA 3MMHA 4QPRA 4DJ3A 4QD4A 3MKEA 1YM1A 5A93A 5KIZA 3S1YA 1YSPA 5KSHA 3F1NA 2V1BA 3C38A 1NRJA 1W7FA 1PWGA 1ESUA 3F1PB 3G35A 2Y91A 3EGDC 1V9ZA 5M19A 3UPOA 2UV0E 4WZ5A 4WBGA 3VE4A 3VOLA 3VP4A 3GV9A 1BSGA 3M2JA 2VGKA 3FPWA 4B4XA 3VP3A 4KG5A 2HDRA 3LI8A 3HUMA 2DMWA 2V2FF 4PM5A 2ZOHA 1MKMA 5M1AA 2YKFA 4HP9A 4LRYC 1K25A 1DJBA 4GDBA 2WAFA 1L0DA 4N92A 5IT5A 1I2SA 3BFFA 5U47A 2V0WA 2VJWA 4Y3IA 3C4PA 3SW1A 4I3AA 3A0RA 4OP8A 5EV0A 3HVFA 4Q0IA 5J3WA 2AVXA 2ZM8A 3PBRA 4JF6A 5F1FA 4X53A 3OZHA 4S2KA 3ZG5A 3EEAA 3UE6A 3LIAA 4X68A 3OCNA 1SHVA 2JKGA 1KGFA 2Z6CA 2C5WB 4JXGA 4WF0A 3NI9A 1XFQA 2XR0A 1F2KA 3ZG8B 5GLAA 1YMSA 2BTFP 4FOFA 4QJGA 2XFSA 2OAQ1 1YLYA 4R70A 2G2WA 1EI5A 1IFQA 1GHMA 2Q9MA 4GS9B 4KZ6A 2Y2LA 4MMNA 1BULA 2QPNA 3RH8B 3FKVA 3O3VA 3G30A 3E4QA 3A3FA 2D01A 2WKHA 5CX7A 4WUJA 5DTSA 2I72A 3LI9A 5DVAA 3DAVA 3HLEA 1WYCA 3BW6A 4YOFA 2IWCA 1UWNX 1E3UD 1TS0A 4DMZA 3VMAA 4EUVA 1SDEA 3IBRA 5DF9A 1H8ZA 3LGOA 1FQGA 5JYPA 4ZAMA 4GB7A 5EVID 1OJGA 2FFFB 2ZJ9A 1ES3A 5HWVA 2J8YA 2FZ0A 1MC0A 4QWOA 2QWSA 5E2GA 1DP9A 3UY6A 4LV3A 2ZC7A 1K57A 3BY9A 5L10A 5TGFA 1D7EA 4KZ4A 5FQJA 5G4ZA 3HCYA 1L3LA 1OT6A 4YINA 4R1GA 4P6ZM 2P04A 1JTGA 3MXQA 4EXOA 2G7UA 1BZAA 2QYBA 1Y4OA 1XA1A 4EESA 1PIOA 4EERA 4ZDXA 1MPLA 2JKFA 5KMWA 4E3KA 3HUNA 1ALQA 2W1TB 5GHYA 2B02A 4BBUA 5EE8A 4NKPA 1YQSA 3IF5A 4NG2A 3BLMA 3N7WA 5K5BA 2OV5A 3F1NB 4HY8A 5HAQA 1BUEA 4DJ2A 5L07A 1JVJA 3A0SA 5FDSA 3RTYA 3ZYTA 5AVEA 1XFNA 1HVBA 2W3EA 1H8YA 2RL3A 4QY5A 2QHKA 1GSWA 4BD1A 1NLZA 3C2WA 2ZMVA 2ZC4B 4L9GA 1K56D 1XJ6A 1IYOA 5DJUA 1OJ5A 3IF6C 3UE0A 4DDYA 3AGDA 2ZQAA 2GNXA 4HH2A 2WKEA 5J7EA 4U3TA 3IWOA
chains in the Genus database with same CATH topology
5KSCA 4UA6A 4H8RA 4FCFA 2ZC6B 1SCWA 5AQAA 4S2OA 3V50A 1BT5A 4HBTA 1NY0A 1IYQA 1PZOA 4OLGA 5FQ9A 2Y4AA 3PBTA 4N9KA 4E3IA 2DRWA 1PW1A 5BOHA 4R4SA 5HAPA 4DDSA 5AQBA 2V1ZA 4IVIA 5FQKA 4QU3A 4WMCA 1L2SA 3V3RA 3B3XA 1MWSA 3IXGA 3FWLA 1RGZA 4O7DA 4E3LA 2XD5A 5FAPA 3GRJA 1L0FA 2JC7A 4BL3A 3HL9A 2PU4A 1J9MA 1LL5A 2V20A 5CERA 2J7VA 2Y2OA 1JWPA 3A3EA 4ZJ3A 2H0TA 1PWCA 2BG1A 2H10A 5HL1A 4R3BA 4LCMA 1ZG4A 5E2EA 3ZHHA 3CMZA 4P6BA 3ZVTA 4DE0A 4ID4A 4BL2A 1TEMA 4PM8A 3C4OA 1CK3A 5GHXA 3Q1FA 3UE1A 1FCNA 1IELA 3MKFA 4WM9A 4UAAA 5FASA 2XK1A 5F82A 4ZBEA 1ONHA 3S4XA 3VFFA 4HBUA 4PM9A 3O87A 1QMFA 4JBFA 3WRZA 1KDWA 1QMEA 2ZC3B 2WGWB 4OOMA 1GA0A 5CGSA 4M3KA 5GLBA 5GLCA 1RGYA 2QZ6A 4U0TA 4KQQA 1Z6FA 3OPPA 2EX2A 3OPLA 4WEJA 1ES5A 3WRTA 4D2OA 5J8XA 4WYYA 3IXDA 4YFMA 1EWZA 1SDNA 1LI9A 5F83A 1WE4A 4OPQA 1KE0A 1W8QA 3UPNA 4IBRA 3ZG0A 1K6RA 2ZLYA 3FYZA 4KZBA 2EFXA 3D4FA 4P85A 4F94A 3SS4A 4X56A 3IXBA 2R9WA 3VSLA 3TOIA 4KG6A 1GCEA 3DWKA 2P9VA 1HD8A 1S0WA 1ES4A 1XGIA 4WZ5C 5FAOA 1TVFA 3AGFA 3BFGA 3MBZA 5GLDA 4OH0A 2VGJA 5EOOA 1FOFA 3Q07A 4UHUA 2Z2MB 3HBRA 4EBNA 2Y2PA 1JWZA 2XEPA 3ITBA 3NIAA 3IWIA 5FI2A 4C6YA 3CZDA 5FATA 1MY8A 4S2LA 4DE3A 1W8YA 3MZFA 3Q82A 4EBLA 1KGGA 3V5MA 4R23A 3UDXA 1GHPA 1Y54A 4KZ9A 2GDNA 2CC1A 3NBLA 3MZDA 3HUOA 3G4PA 5AQ9A 4DXCA 1XP4A 1K56A 4KQOA 2DNSA 3BRMA 3NC8A 5IHVA 2OLVA 4IEDA 2ZM2A 2X01A 4CPKA 2WADA 2Z2LB 2ZQCA 5FA7A 2HP9A 4LV1A 2C6WB 4R4RA 5FQMA 1FR6A 3N8SA 5DF8A 2HDUA 1BLPA 4OPZA 4Q8IA 1AXBA 3PTEA 3WS1A 4RX2A 1K55C 3PBQA 3BLSA 3WS5A 4PPRA 2Y2HA 3N6IA 3CG5A 4PM7A 4S2IA 4U0XA 1K4EA 1XA7A 3DW0A 4OP5A 3LY3A 3IH8A 3PBOA 4GD6A 3GQZA 4JF4A 3Q7VB 4QB8A 3GR2A 3WS2A 1FSYA 3WS4A 3C7VA 5JYOA 1YLJA 3PBSA 4S2NC 5CTNA 5E2FA 3PAEA 1NYYA 4EWFA 1BLHA 2RCXA 4Y0UA 3RXXA 1DJAA 5A92A 3MXRA 2WYXA 1G68A 4N9LA 2Y2NA 2XDMA 1XKZA 3BFCA 4WZ4A 4E3MA 4BENA 1NZUA 4S2PA 1IYPA 4JXWA 2WZZA 1PZPA 3G31A 1XXMA 1DJCA 1IEMA 1LLBA 3ZNTA 1YLTA 5FI7A 3I7JA 5CEBA 4OLDA 3DTMA 4OOYA 3LCEA 4OPRA 3HREA 1MBLA 5HW3A 4GNUA 4Y0TA 2E8IA 4L0LA 4ZJ2A 4QD4A 3MKEA 4RYEA 1YM1A 1FR1A 1JWVA 2WGVA 3SS5A 3Q7VA 4JKTA 3SH9A 3OC2A 5A93A 3S1YA 2Y2JA 4JPMA 1YLPA 2PU2A 5KSHA 4IVKA 3G32A 5GHZA 5FDHA 3EQUA 4UA9A 1W7FA 4OQIA 5CRFA 1H5XA 1PWGA 1ESUA 3G35A 3E2KA 3QNBA 2Y91A 1K6SA 4GOGA 4MBKA 1NZOA 4HEFA 5M19A 1K55A 1BLCA 1L0GA 3UPOA 3UNWA 3VFHA 5FAQA 1ERQA 3GVBA 3SS3A 3QHYA 4P87A 1MWUA 2WZXA 4WZ5A 3N4IA 2JE5A 3HLBA 2J9OA 4FH2A 4ZTKA 4WBGA 5HAIA 5HARA 3IWQA 4KZ5A 4ZJ1A 1NYMA 2Y2IA 3IH9A 4Y0OA 3VP4A 3GV9A 1BSGA 2ZQ7A 3M2JA 3Q7ZA 1K38A 2VGKA 2EX6A 1VQQA 4JXVA 4B4XA 2XH9A 4S2NA 3N8LA 4HESA 4NETA 3VP3A 4KG5A 2HDRA 1E3UA 2Y2GA 3GTCA 3HUMA 3WWXA 4KENB 2V2FF 3BM6A 1BTLA 4PM5A 1IYSA 3N8RA 1ZKJA 3VP1A 4PM6A 5M1AA 3PBNA 3A3IA 1YMXA 2ZM0A 4Y7PA 2IWBA 2A3UA 2P9VB 3BFEA 1MKIA 1K25A 4FD8A 4KZ8A 2EXBA 3ITAA 1CEGA 5TFQA 5EOEA 1DJBA 2ZQ8A 3HLWA 2WAFA 4GDBA 2R9XA 3W4PA 1L0DA 4N92A 5EPHA 3UN7A 1I2SA 2H5SA 2HDQA 3VP2A 2XQZA 1YLZA 3BFFA 5U47A 1S6RA 3C4PA 3ZFZA 1RCJA 1WYBA 1PYYA 4OP8A 3UDFA 3HVFA 3IF6B 3AGEA 4PMAA 5G18A 2ZM8A 1MWRA 4BQMA 4LV0A 3FKWA 1OMEA 1LI0A 1YLWA 3PBRA 4JF6A 4N1XA 3DWZA 4P0MA 4X53A 5F1FA 1TDLA 3OZHA 4FH4A 4S2KA 3RXWA 4R3JA 3ZG5A 4GD8A 4QHCA 4OOLA 2A49A 3G2ZA 4X68A 3OCNA 3NY4A 1SHVA 4K0XA 3HLDA 1HZOA 1KGFA 3LEZA 3FZCA 2ZC5B 3VP0A 2C5WB 4JXGA 3MXSA 5DTTA 3NI9A 2XR0A 4MNRA 3UPPA 4E3JA 3ZG8B 2XD1A 5GLAA 1FCOA 1YMSA 3EQVA 4E3NA 3VOYA 2QMIA 2WGWA 1GA9A 3ZNYA 5CGWA 4X6TA 4QJGA 2XFSA 3IHAA 1YLYA 5CHMA 4OQ0A 3BECA 2G2WA 1E25A 1EI5A 2WAEA 3GSGA 4XUZA 1HTZA 1DY6A 3ZDJA 1K54C 4BLMA 1GHIA 1GHMA 4OKPA 2Q9MA 3VOZA 3TSGA 1YT4A 4KZ6A 5FQIA 2WGIA 3IQAA 4GKUA 2Y2LA 4DE1A 2P74A 4XXRA 2WUQA 4MBHA 4GN2A 3HLCA 1BULA 1ERMA 2HP6A 2QPNA 5D3OA 3OPRA 4DE2A 3FKVA 3V39A 5EVIB 4S2JA 3BEBA 4QY6A 2OSUA 4R0QA 5FQQA 1BLSA 3SOIA 2EFUA 5A90A 3O3VA 2WKIA 2XGNA 3G30A 2ZMAA 3A3FA 4IBXA 1L0EA 2WKHA 1EROA 1RP5A 3M6BA 4EBPA 4JLFA 4DXBA 1NXYA 2ZD8A 5DTSA 1ZC2A 4WELA 4OQGA 2I72A 5AQ7A 1MWTA 4NK3A 4E6XA 1Q2QA 5F1GA 3G2YA 3ZCZA 4A5RA 3LY4A 1Q2PA 2BLSA 5DVAA 3HLEA 1KVMA 1WYCA 3M6HA 4Z9QA 1I5QA 3QNCA 1XPBA 2IWCA 3UE3A 5I94A 1E3UD 3NDEA 5HX9A 3VMAA 1SDEA 4N1HA 3WS0A 5DF9A 3ZG9B 3C5AA 3RJUA 2Y2KA 1NJ4A 4LCLA 4MLLA 4B88A 1K4FA 3A3DA 1H8ZA 1G6AA 4DF6A 1O7EA 1TDGA 2X71A 1FQGA 2HP5A 5JYPA 4ZAMA 2FFYA 3S22A 5L2FA 4GB7A 5M18A 3IF6A 3P98A 2UWXA 3W8KA 5EVID 3V3SA 3Q81A 2FFFB 4XUXA 1K54A 2ZJ9A 4RVAA 1ES3A 2J8YA 5CEDA 1I2WA 5CTMA 5E2GA 2OLUA 1M6KA 3M2KA 4WEKA 4E6WA 5KZHA 2ZQDA 2PBYA 3A3JA 5CHJA 4K91A 1PWDA 4JXSA 3UY6A 4LV3A 1ES2A 2B5RA 2HDSA 1KE4A 2ZC7A 1K57A 1PI4A 3IHBA 5FSRA 4GZBA 4KZ7A 2XFTA 4MEZA 5CECA 4RA7A 2HPBA 1LL9A 3UO9A 5TGFA 1KDSA 4WMCD 1VM1A 1C3BA 4KZ4A 5FQJA 1N4OA 2Y55A 1CI8A 3MZEA 3HLFA 5EUAA 1E4DA 1KGEA 1ONGA 3OCLA 4YINA 4R1GA 3UDIA 1MXOA 1KE3A 3JYIA 1JTGA 5EVIC 1BZAA 2Y2MA 5CGXA 5A91A 1XA1A 5HFOA 4ZDXA 1PIOA 4FSFA 1MPLA 4KQRA 4X69A 5CXWA 3W4QA 4E3OA 5KMWA 3ZVWA 4E3KA 2Y59A 3HUNA 1ALQA 5GL9A 4UA7A 5GHYA 5DF7A 5EE8A 1PI5A 1YQSA 4OVDA 3IF5A 3SH7A 3E2LA 4B4ZA 5FI6A 1O07A 3CJMA 1FSWA 3BLMA 3BYDA 3N7WA 1PW8A 4OQHA 4KZAA 2OV5A 2IWDA 1W5DA 5HAQA 4EQIA 1ZG6A 1BUEA 1KVLA 2ZQ9A 4KZ3A 1SKFA 4BJPA 4BD0A 3SH8A 5EECA 1CEFA 1JVJA 3HLGA 4EUZA 3P09A 2JBFA 2XLNA 4OONA 3ZGAB 3NCKA 1HVBA 3G34A 5E43A 3TG9A 2Y2QA 4MBFA 1H8YA 2RL3A 4EV4A 1XX2A 3VSKA 4CJNA 3NDGA 1IKGA 4QY5A 1JTDA 5CHUA 3LO7A 4BD1A 3OPHA 4KG2A 4X55A 4DRTA 3IXHA 2X02A 1U60A 1K57C 2EXAA 3C7UA 3O86A 5DTKA 4S2MA 3IT9A 1ESIA 2EX9A 1NRFA 3O88A 2ZC4B 1IKIA 1LHYA 3GMWA 4LV2A 2DCFA 3ISGA 3BFDA 4OPYA 3PAGA 3FV7A 1M40A 1K56D 2Q9NA 2XF3A 4LENA 2J9PA 1IYOA 4GDNA 2WK0A 1N9BA 3UE0A 3IF6C 4RX3A 5EVIA 4DDYA 3W4OA 3AGDA 1XGJA 2G2UA 2ZQAA 4DKIA 1FCMA 5EVLA 4K0WA 2H0YA 4C75A 2WKEA 3MFDA 4JF5A 1W79A 4C3QA 1CI9A 4U3TA 5E2HA 3IWOA 3ZG7B 2JCHA 5TR7A 2EX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KSC A;  4UA6 A;  4H8R A;  4FCF A;  2ZC6 B;  1SCW A;  5AQA A;  4S2O A;  3V50 A;  1BT5 A;  4HBT A;  1NY0 A;  1IYQ A;  1PZO A;  4OLG A;  5FQ9 A;  2Y4A A;  3PBT A;  4N9K A;  4E3I A;  2DRW A;  1PW1 A;  5BOH A;  4R4S A;  5HAP A;  4DDS A;  5AQB A;  2V1Z A;  4IVI A;  5FQK A;  4QU3 A;  4WMC A;  1L2S A;  3V3R A;  3B3X A;  1MWS A;  3IXG A;  3FWL A;  1RGZ A;  4O7D A;  4E3L A;  2XD5 A;  5FAP A;  3GRJ A;  1L0F A;  2JC7 A;  4BL3 A;  3HL9 A;  2PU4 A;  1J9M A;  1LL5 A;  2V20 A;  5CER A;  2J7V A;  2Y2O A;  1JWP A;  3A3E A;  4ZJ3 A;  2H0T A;  1PWC A;  2BG1 A;  2H10 A;  5HL1 A;  4R3B A;  4LCM A;  1ZG4 A;  5E2E A;  3ZHH A;  3CMZ A;  4P6B A;  3ZVT A;  4DE0 A;  4ID4 A;  4BL2 A;  1TEM A;  4PM8 A;  3C4O A;  1CK3 A;  5GHX A;  3Q1F A;  3UE1 A;  1FCN A;  1IEL A;  3MKF A;  4WM9 A;  4UAA A;  5FAS A;  2XK1 A;  5F82 A;  4ZBE A;  1ONH A;  3S4X A;  3VFF A;  4HBU A;  4PM9 A;  3O87 A;  1QMF A;  4JBF A;  3WRZ A;  1KDW A;  1QME A;  2ZC3 B;  2WGW B;  4OOM A;  1GA0 A;  5CGS A;  4M3K A;  5GLB A;  5GLC A;  1RGY A;  2QZ6 A;  4U0T A;  4KQQ A;  1Z6F A;  3OPP A;  2EX2 A;  3OPL A;  4WEJ A;  1ES5 A;  3WRT A;  4D2O A;  5J8X A;  4WYY A;  3IXD A;  4YFM A;  1EWZ A;  1SDN A;  1LI9 A;  5F83 A;  1WE4 A;  4OPQ A;  1KE0 A;  1W8Q A;  3UPN A;  4IBR A;  3ZG0 A;  1K6R A;  2ZLY A;  3FYZ A;  4KZB A;  2EFX A;  3D4F A;  4P85 A;  4F94 A;  3SS4 A;  4X56 A;  3IXB A;  2R9W A;  3VSL A;  3TOI A;  4KG6 A;  1GCE A;  3DWK A;  2P9V A;  1HD8 A;  1S0W A;  1ES4 A;  1XGI A;  4WZ5 C;  5FAO A;  1TVF A;  3AGF A;  3BFG A;  3MBZ A;  5GLD A;  4OH0 A;  2VGJ A;  5EOO A;  1FOF A;  3Q07 A;  4UHU A;  2Z2M B;  3HBR A;  4EBN A;  2Y2P A;  1JWZ A;  2XEP A;  3ITB A;  3NIA A;  3IWI A;  5FI2 A;  4C6Y A;  3CZD A;  5FAT A;  1MY8 A;  4S2L A;  4DE3 A;  1W8Y A;  3MZF A;  3Q82 A;  4EBL A;  1KGG A;  3V5M A;  4R23 A;  3UDX A;  1GHP A;  1Y54 A;  4KZ9 A;  2GDN A;  2CC1 A;  3NBL A;  3MZD A;  3HUO A;  3G4P A;  5AQ9 A;  4DXC A;  1XP4 A;  1K56 A;  4KQO A;  2DNS A;  3BRM A;  3NC8 A;  5IHV A;  2OLV A;  4IED A;  2ZM2 A;  2X01 A;  4CPK A;  2WAD A;  2Z2L B;  2ZQC A;  5FA7 A;  2HP9 A;  4LV1 A;  2C6W B;  4R4R A;  5FQM A;  1FR6 A;  3N8S A;  5DF8 A;  2HDU A;  1BLP A;  4OPZ A;  4Q8I A;  1AXB A;  3PTE A;  3WS1 A;  4RX2 A;  1K55 C;  3PBQ A;  3BLS A;  3WS5 A;  4PPR A;  2Y2H A;  3N6I A;  3CG5 A;  4PM7 A;  4S2I A;  4U0X A;  1K4E A;  1XA7 A;  3DW0 A;  4OP5 A;  3LY3 A;  3IH8 A;  3PBO A;  4GD6 A;  3GQZ A;  4JF4 A;  3Q7V B;  4QB8 A;  3GR2 A;  3WS2 A;  1FSY A;  3WS4 A;  3C7V A;  5JYO A;  1YLJ A;  3PBS A;  4S2N C;  5CTN A;  5E2F A;  3PAE A;  1NYY A;  4EWF A;  1BLH A;  2RCX A;  4Y0U A;  3RXX A;  1DJA A;  5A92 A;  3MXR A;  2WYX A;  1G68 A;  4N9L A;  2Y2N A;  2XDM A;  1XKZ A;  3BFC A;  4WZ4 A;  4E3M A;  4BEN A;  1NZU A;  4S2P A;  1IYP A;  4JXW A;  2WZZ A;  1PZP A;  3G31 A;  1XXM A;  1DJC A;  1IEM A;  1LLB A;  3ZNT A;  1YLT A;  5FI7 A;  3I7J A;  5CEB A;  4OLD A;  3DTM A;  4OOY A;  3LCE A;  4OPR A;  3HRE A;  1MBL A;  5HW3 A;  4GNU A;  4Y0T A;  2E8I A;  4L0L A;  4ZJ2 A;  4QD4 A;  3MKE A;  4RYE A;  1YM1 A;  1FR1 A;  1JWV A;  2WGV A;  3SS5 A;  3Q7V A;  4JKT A;  3SH9 A;  3OC2 A;  5A93 A;  3S1Y A;  2Y2J A;  4JPM A;  1YLP A;  2PU2 A;  5KSH A;  4IVK A;  3G32 A;  5GHZ A;  5FDH A;  3EQU A;  4UA9 A;  1W7F A;  4OQI A;  5CRF A;  1H5X A;  1PWG A;  1ESU A;  3G35 A;  3E2K A;  3QNB A;  2Y91 A;  1K6S A;  4GOG A;  4MBK A;  1NZO A;  4HEF A;  5M19 A;  1K55 A;  1BLC A;  1L0G A;  3UPO A;  3UNW A;  3VFH A;  5FAQ A;  1ERQ A;  3GVB A;  3SS3 A;  3QHY A;  4P87 A;  1MWU A;  2WZX A;  4WZ5 A;  3N4I A;  2JE5 A;  3HLB A;  2J9O A;  4FH2 A;  4ZTK A;  4WBG A;  5HAI A;  5HAR A;  3IWQ A;  4KZ5 A;  4ZJ1 A;  1NYM A;  2Y2I A;  3IH9 A;  4Y0O A;  3VP4 A;  3GV9 A;  1BSG A;  2ZQ7 A;  3M2J A;  3Q7Z A;  1K38 A;  2VGK A;  2EX6 A;  1VQQ A;  4JXV A;  4B4X A;  2XH9 A;  4S2N A;  3N8L A;  4HES A;  4NET A;  3VP3 A;  4KG5 A;  2HDR A;  1E3U A;  2Y2G A;  3GTC A;  3HUM A;  3WWX A;  4KEN B;  2V2F F;  3BM6 A;  1BTL A;  4PM5 A;  1IYS A;  3N8R A;  1ZKJ A;  3VP1 A;  4PM6 A;  5M1A A;  3PBN A;  3A3I A;  1YMX A;  2ZM0 A;  4Y7P A;  2IWB A;  2A3U A;  2P9V B;  3BFE A;  1MKI A;  1K25 A;  4FD8 A;  4KZ8 A;  2EXB A;  3ITA A;  1CEG A;  5TFQ A;  5EOE A;  1DJB A;  2ZQ8 A;  3HLW A;  2WAF A;  4GDB A;  2R9X A;  3W4P A;  1L0D A;  4N92 A;  5EPH A;  3UN7 A;  1I2S A;  2H5S A;  2HDQ A;  3VP2 A;  2XQZ A;  1YLZ A;  3BFF A;  5U47 A;  1S6R A;  3C4P A;  3ZFZ A;  1RCJ A;  1WYB A;  1PYY A;  4OP8 A;  3UDF A;  3HVF A;  3IF6 B;  3AGE A;  4PMA A;  5G18 A;  2ZM8 A;  1MWR A;  4BQM A;  4LV0 A;  3FKW A;  1OME A;  1LI0 A;  1YLW A;  3PBR A;  4JF6 A;  4N1X A;  3DWZ A;  4P0M A;  4X53 A;  5F1F A;  1TDL A;  3OZH A;  4FH4 A;  4S2K A;  3RXW A;  4R3J A;  3ZG5 A;  4GD8 A;  4QHC A;  4OOL A;  2A49 A;  3G2Z A;  4X68 A;  3OCN A;  3NY4 A;  1SHV A;  4K0X A;  3HLD A;  1HZO A;  1KGF A;  3LEZ A;  3FZC A;  2ZC5 B;  3VP0 A;  2C5W B;  4JXG A;  3MXS A;  5DTT A;  3NI9 A;  2XR0 A;  4MNR A;  3UPP A;  4E3J A;  3ZG8 B;  2XD1 A;  5GLA A;  1FCO A;  1YMS A;  3EQV A;  4E3N A;  3VOY A;  2QMI A;  2WGW A;  1GA9 A;  3ZNY A;  5CGW A;  4X6T A;  4QJG A;  2XFS A;  3IHA A;  1YLY A;  5CHM A;  4OQ0 A;  3BEC A;  2G2W A;  1E25 A;  1EI5 A;  2WAE A;  3GSG A;  4XUZ A;  1HTZ A;  1DY6 A;  3ZDJ A;  1K54 C;  4BLM A;  1GHI A;  1GHM A;  4OKP A;  2Q9M A;  3VOZ A;  3TSG A;  1YT4 A;  4KZ6 A;  5FQI A;  2WGI A;  3IQA A;  4GKU A;  2Y2L A;  4DE1 A;  2P74 A;  4XXR A;  2WUQ A;  4MBH A;  4GN2 A;  3HLC A;  1BUL A;  1ERM A;  2HP6 A;  2QPN A;  5D3O A;  3OPR A;  4DE2 A;  3FKV A;  3V39 A;  5EVI B;  4S2J A;  3BEB A;  4QY6 A;  2OSU A;  4R0Q A;  5FQQ A;  1BLS A;  3SOI A;  2EFU A;  5A90 A;  3O3V A;  2WKI A;  2XGN A;  3G30 A;  2ZMA A;  3A3F A;  4IBX A;  1L0E A;  2WKH A;  1ERO A;  1RP5 A;  3M6B A;  4EBP A;  4JLF A;  4DXB A;  1NXY A;  2ZD8 A;  5DTS A;  1ZC2 A;  4WEL A;  4OQG A;  2I72 A;  5AQ7 A;  1MWT A;  4NK3 A;  4E6X A;  1Q2Q A;  5F1G A;  3G2Y A;  3ZCZ A;  4A5R A;  3LY4 A;  1Q2P A;  2BLS A;  5DVA A;  3HLE A;  1KVM A;  1WYC A;  3M6H A;  4Z9Q A;  1I5Q A;  3QNC A;  1XPB A;  2IWC A;  3UE3 A;  5I94 A;  1E3U D;  3NDE A;  5HX9 A;  3VMA A;  1SDE A;  4N1H A;  3WS0 A;  5DF9 A;  3ZG9 B;  3C5A A;  3RJU A;  2Y2K A;  1NJ4 A;  4LCL A;  4MLL A;  4B88 A;  1K4F A;  3A3D A;  1H8Z A;  1G6A A;  4DF6 A;  1O7E A;  1TDG A;  2X71 A;  1FQG A;  2HP5 A;  5JYP A;  4ZAM A;  2FFY A;  3S22 A;  5L2F A;  4GB7 A;  5M18 A;  3IF6 A;  3P98 A;  2UWX A;  3W8K A;  5EVI D;  3V3S A;  3Q81 A;  2FFF B;  4XUX A;  1K54 A;  2ZJ9 A;  4RVA A;  1ES3 A;  2J8Y A;  5CED A;  1I2W A;  5CTM A;  5E2G A;  2OLU A;  1M6K A;  3M2K A;  4WEK A;  4E6W A;  5KZH A;  2ZQD A;  2PBY A;  3A3J A;  5CHJ A;  4K91 A;  1PWD A;  4JXS A;  3UY6 A;  4LV3 A;  1ES2 A;  2B5R A;  2HDS A;  1KE4 A;  2ZC7 A;  1K57 A;  1PI4 A;  3IHB A;  5FSR A;  4GZB A;  4KZ7 A;  2XFT A;  4MEZ A;  5CEC A;  4RA7 A;  2HPB A;  1LL9 A;  3UO9 A;  5TGF A;  1KDS A;  4WMC D;  1VM1 A;  1C3B A;  4KZ4 A;  5FQJ A;  1N4O A;  2Y55 A;  1CI8 A;  3MZE A;  3HLF A;  5EUA A;  1E4D A;  1KGE A;  1ONG A;  3OCL A;  4YIN A;  4R1G A;  3UDI A;  1MXO A;  1KE3 A;  3JYI A;  1JTG A;  5EVI C;  1BZA A;  2Y2M A;  5CGX A;  5A91 A;  1XA1 A;  5HFO A;  4ZDX A;  1PIO A;  4FSF A;  1MPL A;  4KQR A;  4X69 A;  5CXW A;  3W4Q A;  4E3O A;  5KMW A;  3ZVW A;  4E3K A;  2Y59 A;  3HUN A;  1ALQ A;  5GL9 A;  4UA7 A;  5GHY A;  5DF7 A;  5EE8 A;  1PI5 A;  1YQS A;  4OVD A;  3IF5 A;  3SH7 A;  3E2L A;  4B4Z A;  5FI6 A;  1O07 A;  3CJM A;  1FSW A;  3BLM A;  3BYD A;  3N7W A;  1PW8 A;  4OQH A;  4KZA A;  2OV5 A;  2IWD A;  1W5D A;  5HAQ A;  4EQI A;  1ZG6 A;  1BUE A;  1KVL A;  2ZQ9 A;  4KZ3 A;  1SKF A;  4BJP A;  4BD0 A;  3SH8 A;  5EEC A;  1CEF A;  1JVJ A;  3HLG A;  4EUZ A;  3P09 A;  2JBF A;  2XLN A;  4OON A;  3ZGA B;  3NCK A;  1HVB A;  3G34 A;  5E43 A;  3TG9 A;  2Y2Q A;  4MBF A;  1H8Y A;  2RL3 A;  4EV4 A;  1XX2 A;  3VSK A;  4CJN A;  3NDG A;  1IKG A;  4QY5 A;  1JTD A;  5CHU A;  3LO7 A;  4BD1 A;  3OPH A;  4KG2 A;  4X55 A;  4DRT A;  3IXH A;  2X02 A;  1U60 A;  1K57 C;  2EXA A;  3C7U A;  3O86 A;  5DTK A;  4S2M A;  3IT9 A;  1ESI A;  2EX9 A;  1NRF A;  3O88 A;  2ZC4 B;  1IKI A;  1LHY A;  3GMW A;  4LV2 A;  2DCF A;  3ISG A;  3BFD A;  4OPY A;  3PAG A;  3FV7 A;  1M40 A;  1K56 D;  2Q9N A;  2XF3 A;  4LEN A;  2J9P A;  1IYO A;  4GDN A;  2WK0 A;  1N9B A;  3UE0 A;  3IF6 C;  4RX3 A;  5EVI A;  4DDY A;  3W4O A;  3AGD A;  1XGJ A;  2G2U A;  2ZQA A;  4DKI A;  1FCM A;  5EVL A;  4K0W A;  2H0Y A;  4C75 A;  2WKE A;  3MFD A;  4JF5 A;  1W79 A;  4C3Q A;  1CI9 A;  4U3T A;  5E2H A;  3IWO A;  3ZG7 B;  2JCH A;  5TR7 A;  2EX8 A; 
#chains in the Genus database with same CATH topology
 3V50 A;  3LIC A;  4OLG A;  4CLC D;  1CJF A;  2DRW A;  5BOH A;  2VK3 A;  5FQK A;  4WMC A;  1L2S A;  4LRZ E;  2LB9 A;  4D60 A;  3UB7 A;  3GRJ A;  3MS6 A;  4XT2 A;  1TS6 A;  1P9W A;  3HL9 A;  2PU4 A;  5HL1 A;  5E2E A;  4P6B A;  2P08 A;  4BL2 A;  4PM8 A;  3C4O A;  1CK3 A;  5GHX A;  2XK1 A;  4GHI B;  4ZBE A;  1ONH A;  2HJE A;  4HBU A;  3O87 A;  3WRZ A;  3CAX A;  1QME A;  2ZC3 B;  4OOM A;  1RGY A;  1Z09 A;  1Z6F A;  4WYY A;  5EM1 A;  1LSW A;  2A24 B;  4KZB A;  4P85 A;  3SS4 A;  3IXB A;  1T1C A;  3TOI A;  1STZ A;  1GCE A;  4ARZ A;  1HD8 A;  5L09 A;  3Q07 A;  2Z2M B;  2VV8 A;  2XEP A;  3NIA A;  3CZD A;  1MY8 A;  3Q82 A;  2OOL A;  3V5M A;  3UDX A;  4CQH A;  4GW9 A;  2J3T C;  1XP4 A;  1K56 A;  2X01 A;  2J3T D;  2OLV A;  2ZQC A;  4R4R A;  5FQM A;  5DF8 A;  4B9O A;  1BLP A;  4HJ4 A;  2VGL M;  3PTE A;  3T1X A;  5LBR A;  3K3D A;  1XA7 A;  3DW0 A;  4UQI S;  3LY3 A;  4R6L A;  3DBA A;  3IH8 A;  3GR2 A;  1FSY A;  4I39 A;  3KYE A;  3QP8 A;  1BLH A;  2XRO A;  3RXX A;  4L9E A;  4N9L A;  5DKK A;  3BFC A;  4BEN A;  5MC7 A;  2WKR A;  1XXM A;  4OOY A;  3LCE A;  5HWT A;  3LFV A;  5HW3 A;  4L0L A;  4NEE D;  3SS5 A;  3SH9 A;  3H82 A;  2Y2J A;  4JPM A;  4IVK A;  3G32 A;  1OTI A;  4UA9 A;  5CRF A;  1H5X A;  1T1B A;  1K6S A;  1G6O A;  3CPT A;  1D06 A;  1K55 A;  1L0G A;  1ERQ A;  2PHY A;  3SS3 A;  1MWU A;  2WZX A;  3HLB A;  3NJA A;  3IWQ A;  4KZ5 A;  4HHD A;  4HIA A;  1NYM A;  4I38 A;  3NHQ A;  3IH9 A;  4Z1W A;  1K38 A;  2EX6 A;  1VQQ A;  1VEU A;  3N8R A;  3PBN A;  2IWB A;  1N9N A;  4Y5F A;  5DFX A;  2A3U A;  2M7U A;  1MKI A;  2EXB A;  1CEG A;  3T1S A;  4NXB A;  1KOU A;  2HJ9 C;  2ZQ8 A;  2R9X A;  5EPH A;  2H5S A;  3VP2 A;  4MN5 A;  1YLZ A;  4HH3 A;  3T4L A;  4IUK A;  1RCJ A;  1WYB A;  3L7H A;  3UDF A;  3IF6 B;  3RFB A;  4KUK A;  4HP4 A;  1MWR A;  4Q0H A;  4LV0 A;  4LGW A;  1OME A;  1LI0 A;  1YLW A;  4P0M A;  5TBM A;  3IX4 A;  2OAP 1;  1TDL A;  4FH4 A;  4ETX A;  4GD8 A;  4FTX A;  4OOL A;  2R78 A;  4K0X A;  5HL6 A;  1HZO A;  4HI4 A;  4UQI M;  3MXS A;  3CIT A;  5DTT A;  4HNB A;  4MNR A;  4E3J A;  3EQV A;  2Y8H A;  3B33 A;  2WGW A;  1GA9 A;  5CHM A;  4OQ0 A;  4BWI A;  3T12 B;  3BEC A;  4O8G A;  4XUZ A;  3BQ8 A;  1DY6 A;  3ZDJ A;  1G5U A;  1S1Z A;  4BLM A;  3HJK A;  3VOZ A;  5FQI A;  5FEF A;  4GN2 A;  3HLC A;  5D3O A;  4RQ9 A;  2PAV P;  1W63 Q;  2E8J A;  4B93 A;  3PYP A;  4G3W A;  4S2J A;  4QY6 A;  2XGN A;  2PYP A;  4IBX A;  1L0E A;  3QP4 A;  1NLY A;  3UB8 A;  1NXY A;  1MWT A;  3BQA A;  1Q2Q A;  4A5R A;  3UB6 A;  1KVM A;  2EWV A;  1XPB A;  5I94 A;  3WS0 A;  2W27 A;  4LCL A;  1S4R A;  3IS2 A;  1K4F A;  2PYR A;  3JPU A;  2X71 A;  2HP5 A;  3BJN A;  5M18 A;  3QP5 A;  2UWX A;  3W8K A;  5DFY A;  1K54 A;  3D72 A;  4RVA A;  2L4R A;  5CTM A;  2OLU A;  3M2K A;  4WEK A;  2PBY A;  3R7W A;  2A2L A;  1N9L A;  1KE4 A;  2XFT A;  3MFX A;  4RA7 A;  2Y55 A;  1CI8 A;  4H6J B;  3HLF A;  5EUA A;  1N9O A;  2I9V A;  1ONG A;  3OCL A;  3GDI A;  1KE3 A;  2Y2M A;  5CGX A;  4X69 A;  4KQR A;  3TW8 A;  3W4Q A;  2Y59 A;  1D1J A;  4UA7 A;  4WLA A;  4OVD A;  2JKT M;  2OWH A;  1S4S A;  1FSW A;  2ZBB A;  4H6J A;  2ZQ9 A;  4KZ3 A;  5EEC A;  4EUZ A;  3P09 A;  2JBF A;  2XLN A;  3ZGA B;  1H0M A;  4I3J A;  4WL9 A;  2Y2Q A;  3VSK A;  4CJN A;  3NDG A;  1IKG A;  5CHU A;  3LO7 A;  1S1Y A;  3ICY A;  4KG2 A;  4O01 A;  2X02 A;  4S2M A;  1ESI A;  3O88 A;  1TD5 A;  2DCF A;  3ISG A;  4R3A A;  1XJ2 A;  2V8F A;  3QP1 A;  3W4O A;  4ESP A;  1XGJ A;  4F3L A;  5EVL A;  4K0W A;  2H0Y A;  4P6Z S;  4C75 A;  4JF5 A;  3MFD A;  4UEY A;  4C3Q A;  3E0Y A;  4IUH A;  4UA6 A;  2ZC6 B;  2MJ6 A;  1IYQ A;  1PZO A;  5FQ9 A;  2V1A A;  5HAP A;  3T4O A;  5AQB A;  5F69 A;  5IU1 A;  3B3X A;  3IXG A;  1PNE A;  4E3L A;  5FAP A;  5A8B A;  1L0F A;  4AFI A;  1J9M A;  1LL5 A;  2VV6 A;  1JWP A;  3G6O A;  4ZJ3 A;  2O9A A;  4LCM A;  1ZG4 A;  4YNR A;  4DE0 A;  3ZVT A;  2QJ7 A;  1AWI A;  1TEM A;  2HZ5 A;  4R38 A;  4WM9 A;  1QMF A;  4JBF A;  3S7Q A;  2WGW B;  5GLC A;  4U0T A;  3OPL A;  3EWK A;  1ES5 A;  1FIL A;  5J8X A;  3LIE A;  4Y17 A;  5F83 A;  3UPN A;  3P01 A;  3D4F A;  4X56 A;  1ACF A;  2P9V A;  3D9Y A;  2KOI A;  5AJG A;  2VGJ A;  1FOF A;  1JNU A;  3KSH A;  3MZF A;  3W2Z A;  1GHP A;  2CC1 A;  3G4P A;  5AQ9 A;  3NC8 A;  2WAD A;  5FA7 A;  4LV1 A;  2C6W B;  1FR6 A;  4OPZ A;  1K55 C;  1V9Y A;  4PPR A;  2Y2H A;  4HOI A;  4PM7 A;  2VLG A;  1TS7 A;  1K4E A;  4U0X A;  3U2A A;  4ZRR A;  3PBO A;  4JF4 A;  4DN0 A;  4II7 A;  3LR4 A;  3WS2 A;  5HWW A;  4K08 A;  5JYO A;  1YLJ A;  5I5L A;  3PBS A;  5CTN A;  5E2F A;  1NYY A;  1W63 M;  4EWF A;  5A92 A;  2WYX A;  1G68 A;  1PRQ A;  2P7J A;  2Y2N A;  3F1O B;  1ZTU A;  1NZU A;  1GSX A;  1Y28 A;  3G31 A;  3E4O A;  2VX8 A;  1DJC A;  1IEM A;  1YLT A;  3HRE A;  4Y0T A;  1T19 A;  3K3C A;  1DRM A;  3H82 B;  4HJ3 A;  1FR1 A;  1JWV A;  2WGV A;  3A0V A;  3Q7V A;  4JKT A;  4I3I A;  1YLP A;  5GHZ A;  2PR5 A;  5FDH A;  3E2K A;  3QNB A;  2PR6 A;  2VV7 A;  5FEG A;  4HEF A;  1BLC A;  3UNW A;  3VFH A;  3GVB A;  3QHY A;  4P87 A;  1F98 A;  1X0O A;  2JE5 A;  2KX6 A;  2J9O A;  4FH2 A;  1S66 L;  5HAI A;  4ZJ1 A;  4Y0O A;  3V67 A;  3H9W A;  1YSQ A;  5C5K A;  4JXV A;  2XH9 A;  3N8L A;  4HES A;  2ACG A;  3IBJ A;  2Y2G A;  3MR0 A;  3BM6 A;  1BTL A;  4EEU A;  3EGX C;  3VP1 A;  4PM6 A;  1YMX A;  2ZM0 A;  4Y7P A;  4PKY A;  3HLW A;  3W4P A;  5HD5 A;  2XQZ A;  4BBV A;  3MJQ A;  1S6R A;  4L9F A;  2VEA A;  3ZFZ A;  1PYY A;  2XA7 M;  2Y79 A;  2HV1 A;  3AGE A;  4PMA A;  4EU0 A;  3FKW A;  4G3V A;  3RXW A;  4QHC A;  2QKP A;  2A49 A;  4MCW A;  3G2Z A;  3NY4 A;  3T50 A;  3HLD A;  3LEZ A;  3JVU A;  3UPP A;  2XD1 A;  1NWZ A;  4E3N A;  2QMI A;  1H8M A;  5EM0 A;  5CGW A;  4X6T A;  4GHI A;  1E25 A;  1HTZ A;  1K54 C;  1GHI A;  3TSG A;  1YT4 A;  2P74 A;  3H7W B;  4XXR A;  2J3W A;  2WUQ A;  4MBH A;  4YWZ A;  1K0K A;  1ERM A;  2PD7 A;  3OPR A;  1VEU B;  3T1R A;  5EVI B;  3IX8 A;  2OSU A;  4R0Q A;  5FQQ A;  3SOI A;  2EFU A;  5A90 A;  2D02 A;  2PBD P;  3VE3 A;  2ZMA A;  2JHE A;  1ERO A;  2IA2 A;  4EBP A;  4JLF A;  1DP6 A;  1J3W A;  4OQG A;  4E6X A;  3LY4 A;  1Q2P A;  4Z9Q A;  2V8C A;  1I5Q A;  3QNC A;  3UE3 A;  2KLI A;  3NDE A;  4GJ4 A;  3MF0 A;  4N1H A;  2QJ5 A;  1LSV A;  3UMD A;  3ZG9 B;  3C5A A;  2Y2K A;  4MLL A;  4B88 A;  3T4J A;  3PXP A;  4DF6 A;  5DJT A;  2WKQ A;  3CUE C;  3S22 A;  3P7N A;  3VV4 A;  1P9R A;  3V3S A;  1SZV A;  4XUX A;  4X1M A;  2KDK A;  1GSV A;  2BAS A;  3LYX A;  3L9K A;  1I2W A;  3MQ0 A;  2ZQD A;  5CHJ A;  4PAU A;  1PWD A;  4JXS A;  5EFW A;  1ES2 A;  1YPR A;  1PI4 A;  3IHB A;  4KZ7 A;  4HJ6 A;  2HPB A;  1LL9 A;  3UO9 A;  1KDS A;  4WMC D;  5EVE A;  1KGE A;  3NEC A;  1MXO A;  3QP6 A;  3JYI A;  2W1T A;  5A91 A;  4M4X A;  4FSF A;  5CXW A;  4E3O A;  2Q0O A;  3LR0 A;  5GL9 A;  1PI5 A;  3SH7 A;  2JKT I;  3CJM A;  3BYD A;  4OQH A;  2IWD A;  4CLC C;  4EQI A;  4Y2F A;  1SKF A;  4BJP A;  4BD0 A;  1CEF A;  5HPF A;  1YKD A;  1OTA A;  2W3G A;  4EV4 A;  4ARZ B;  4NXF A;  3S7P A;  3OPH A;  4X55 A;  2EA9 A;  3QP2 A;  4DRT A;  3IXH A;  5HD3 A;  3DTE A;  3O86 A;  5DTK A;  2W1R A;  3EOI A;  3IT9 A;  5HDS A;  1NRF A;  2A24 A;  3F1O A;  1IKI A;  1LHY A;  3GMW A;  4LV2 A;  1F5M A;  3BFD A;  3FV7 A;  3KYZ A;  4LEN A;  1VHM A;  2J9P A;  2JKR I;  4GDN A;  2WK0 A;  1N9B A;  2M7V A;  2WKP A;  5G4Y A;  5EVI A;  2G2U A;  3T4T A;  5E2H A;  3H7W A;  3CI6 A;  2JCH A;  5TR7 A;  3ZG7 B;  4FCF A;  1OTD A;  1SCW A;  5AQA A;  1BT5 A;  4BBT A;  1LT0 A;  1NY0 A;  2Y4A A;  4N9K A;  4E3I A;  1PW1 A;  4DDS A;  3NOT C;  4XT2 B;  1MWS A;  3FWL A;  4O7D A;  2XD5 A;  2O9C A;  4EQ1 A;  2B18 A;  3D3O A;  3ULF A;  2V20 A;  2J7V A;  3A3E A;  1UWP X;  3NOP C;  1PWC A;  4R3B A;  3ZHH A;  3CMZ A;  4GS9 A;  4ID4 A;  3TE8 A;  5IS1 A;  1A0K A;  3R4K A;  1IEL A;  4UAA A;  5FAS A;  5F82 A;  4MN7 A;  3C30 A;  1KDW A;  5CGS A;  1GA0 A;  4M3K A;  2QZ6 A;  4KQQ A;  3OPP A;  5AVF A;  2EX2 A;  3C8C A;  4WEJ A;  3NOU C;  4D2O A;  3WRT A;  3IXD A;  1CQA A;  2VZW A;  3LUQ A;  4YFM A;  1LI9 A;  1WE4 A;  4OPQ A;  1KE0 A;  1W8Q A;  3GEC A;  3S7O A;  4ETZ A;  3ZG0 A;  1K6R A;  2ZLY A;  3FYZ A;  2EFX A;  4LFU A;  1S0W A;  1ES4 A;  1XGI A;  4WZ5 C;  1TVF A;  3FC7 A;  3AGF A;  3BFG A;  5GLD A;  4UHU A;  2OWJ A;  3HBR A;  2FH5 A;  1JWZ A;  3ITB A;  3IWI A;  5FI2 A;  4I5S A;  4S2L A;  4DE3 A;  2K7S A;  4EBL A;  3OLO A;  4R23 A;  5HDC A;  2GDN A;  3NBL A;  4DXC A;  3MSH A;  2HP9 A;  3N8S A;  4KUO A;  2HDU A;  1ODV A;  3PBQ A;  4PKY G;  1P97 A;  3BLS A;  3CG5 A;  2K31 A;  4OP5 A;  2XRN A;  2W0N A;  4GD6 A;  3GQZ A;  3Q7V B;  3LEQ A;  4JGR A;  1ZHH B;  3PAE A;  4Y0U A;  2ZMF A;  4PHT A;  2PT7 A;  1DJA A;  3MXR A;  3E4P A;  1VB6 A;  1H3Q A;  1XKZ A;  2XDM A;  2NUP C;  4E3M A;  1IYP A;  5HZH A;  4GLQ A;  4JXW A;  3LR3 A;  3F1P A;  1LLB A;  3ZNT A;  5FI7 A;  3I7J A;  5CEB A;  4OLD A;  3DTM A;  4LRX C;  1MBL A;  4GNU A;  2E8I A;  4ZJ2 A;  4RYE A;  3T4Q A;  1P0Z A;  4IHQ A;  2GJ3 A;  3OC2 A;  2PU2 A;  3EQU A;  4OQI A;  5F6A A;  4MBK A;  4GOG A;  1EW0 A;  1NZO A;  2PDR A;  3K2N A;  5FAQ A;  3N4I A;  4FUW A;  4ZTK A;  5HAR A;  2Y2I A;  2ZQ7 A;  3Q7Z A;  2JN7 A;  5TJJ A;  4S2N A;  4NET A;  1E3U A;  3GTC A;  3WWX A;  4KEN B;  1IYS A;  1OTB A;  1ZKJ A;  3A3I A;  2XSS A;  2P9V B;  3LR5 A;  4G3K A;  3BFE A;  4FD8 A;  4JGQ A;  3ITA A;  1TS8 A;  5TFQ A;  4BMW A;  5EOE A;  4KQD A;  2V0U A;  3R7W B;  3UN7 A;  2HDQ A;  3TJZ C;  2LB5 A;  3FPV A;  3T4S A;  5DKL A;  3NUL A;  5G18 A;  3KSI A;  4CLC E;  3SZT A;  4BQM A;  4N1X A;  3DWZ A;  3IS2 B;  2ZL1 A;  3S7N A;  4R3J A;  3U4L P;  4EET B;  2W3F A;  3JVV A;  3MQQ A;  4HQA A;  3VP0 A;  3FZC A;  2ZC5 B;  3UB5 P;  1TF1 A;  1WA9 A;  3OOV A;  1BYW A;  2M1C A;  1FCO A;  1T1A A;  4NXE A;  3VOY A;  2HGV A;  3ZNY A;  3IHA A;  3T4K A;  2NUT C;  5HDD A;  2WAE A;  3GSG A;  4JGP A;  3OBF A;  4OKP A;  3UME A;  2WGI A;  3IQA A;  4GKU A;  4DE1 A;  2HP6 A;  4DE2 A;  3V39 A;  4F3L B;  3BEB A;  1BLS A;  2WKI A;  1CF0 A;  2V9A A;  1RP5 A;  3M6B A;  4DXB A;  2ZD8 A;  1ZC2 A;  4WEL A;  5AQ7 A;  4NK3 A;  5F1G A;  3G2Y A;  3ZCZ A;  4E04 A;  2BLS A;  3M6H A;  3KYQ A;  3PR6 A;  2K2N A;  3LID A;  3LIB A;  1OT9 A;  5FL3 A;  4GCZ A;  3CWF A;  3TRC A;  4JGO A;  5HX9 A;  3RJU A;  1NJ4 A;  1UGU A;  5TBM B;  3A3D A;  1G6A A;  1YAX A;  1O7E A;  1TDG A;  4LLO B;  5HSQ A;  2FFY A;  5L2F A;  2CMN A;  3IF6 A;  3P98 A;  4CLC A;  3Q81 A;  5CED A;  5KZH A;  1M6K A;  4E6W A;  3E98 A;  3A3J A;  2Z6D A;  3CLO A;  4K91 A;  1OPX A;  2EWW A;  2VGL S;  2B5R A;  2HDS A;  5FSR A;  4GZB A;  1VET A;  4MEZ A;  5CEC A;  1VM1 A;  2VA0 A;  1C3B A;  1N4O A;  1PFL A;  3MZE A;  1E4D A;  1MZU A;  3UDI A;  1F9I A;  2H28 A;  5EVI C;  2W3D A;  4MN6 A;  5HFO A;  3ZVW A;  5DF7 A;  3CPT B;  2INW A;  4EEP A;  3E2L A;  4B4Z A;  5FI6 A;  1O07 A;  3PHY A;  3KX0 X;  1PW8 A;  4KZA A;  1W5D A;  1ZG6 A;  1KVL A;  3SH8 A;  3HLG A;  4OON A;  3NCK A;  3TG9 A;  5E43 A;  3G34 A;  3CHW P;  2GZA A;  1VET B;  4MBF A;  1XX2 A;  1JTD A;  2W3H A;  5J4E A;  2L1M A;  1SKO B;  5F68 A;  4MDZ A;  1FIK A;  3C7U A;  1U60 A;  1K57 C;  2EXA A;  4Q0J A;  2EX9 A;  4LPZ A;  3T1Q B;  4OPY A;  3PAG A;  4Y13 A;  1M40 A;  2Q9N A;  2XF3 A;  3UB9 A;  4CLC B;  3MQO A;  3CUE A;  4X25 A;  4NXG A;  4RX3 A;  2O0Y A;  4DKI A;  1FCM A;  2ZOI A;  1XJ3 A;  3KO6 A;  1W79 A;  2L0W A;  1CI9 A;  4KZ8 A;  2EX8 A;  5KSC A;  3KSG A;  4H8R A;  4S2O A;  2JKR M;  4EW7 A;  2B95 A;  4HBT A;  3FG8 A;  3PBT A;  4R4S A;  1LSX A;  2V1Z A;  4IVI A;  4QU3 A;  3V3R A;  1G28 A;  1RGZ A;  4WN5 A;  1T18 A;  4BL3 A;  2JC7 A;  5CER A;  2Y2O A;  4X1L A;  2H0T A;  2BG1 A;  2H10 A;  2O99 A;  3HJI A;  3Q1F A;  3UE1 A;  1FCN A;  3MKF A;  4ME4 A;  3B47 A;  1IOU A;  5F5Y A;  3S4X A;  3VFF A;  4PM9 A;  2J80 A;  5GLB A;  3DTK A;  5HPI A;  1EWZ A;  1SDN A;  4IBR A;  4F94 A;  2VKS A;  1SKO A;  2R9W A;  3LIF A;  3VSL A;  4KG6 A;  2PD8 A;  3DWK A;  3EEH A;  5FAO A;  2ZL1 B;  2HF6 A;  3MBZ A;  4OH0 A;  3ZQ5 A;  5EOO A;  4EBN A;  3KSF A;  2Y2P A;  1XJ4 A;  4C6Y A;  5FAT A;  1S67 L;  2XA7 S;  1HLU P;  4IJG A;  1W8Y A;  2YKH A;  3IX3 A;  1KGG A;  1Y54 A;  4KZ9 A;  3MZD A;  3HUO A;  4KQO A;  2DNS A;  1OTE A;  3BRM A;  5IHV A;  4IED A;  2ZM2 A;  4CPK A;  2Z2L B;  3BY8 A;  4Q8I A;  1AXB A;  3WS1 A;  4RX2 A;  1LL8 A;  3WS5 A;  5L8M A;  3N6I A;  4O0P A;  4S2I A;  3B42 A;  4QB8 A;  2O9B A;  3WS4 A;  3C7V A;  4S2N C;  2RCX A;  3DTI A;  4WZ4 A;  4S2P A;  2GX5 A;  2PRF A;  4Y15 A;  2WZZ A;  1PZP A;  1DP8 A;  3BWL A;  4OPR A;  3O5Y A;  3MMH A;  4QPR A;  4DJ3 A;  4QD4 A;  3MKE A;  1YM1 A;  5A93 A;  5KIZ A;  3S1Y A;  1YSP A;  5KSH A;  3F1N A;  2V1B A;  3C38 A;  1NRJ A;  1W7F A;  1PWG A;  1ESU A;  3F1P B;  3G35 A;  2Y91 A;  3EGD C;  1V9Z A;  5M19 A;  3UPO A;  2UV0 E;  4WZ5 A;  4WBG A;  3VE4 A;  3VOL A;  3VP4 A;  3GV9 A;  1BSG A;  3M2J A;  2VGK A;  3FPW A;  4B4X A;  3VP3 A;  4KG5 A;  2HDR A;  3LI8 A;  3HUM A;  2DMW A;  2V2F F;  4PM5 A;  2ZOH A;  1MKM A;  5M1A A;  2YKF A;  4HP9 A;  4LRY C;  1K25 A;  1DJB A;  4GDB A;  2WAF A;  1L0D A;  4N92 A;  5IT5 A;  1I2S A;  3BFF A;  5U47 A;  2V0W A;  2VJW A;  4Y3I A;  3C4P A;  3SW1 A;  4I3A A;  3A0R A;  4OP8 A;  5EV0 A;  3HVF A;  4Q0I A;  5J3W A;  2AVX A;  2ZM8 A;  3PBR A;  4JF6 A;  5F1F A;  4X53 A;  3OZH A;  4S2K A;  3ZG5 A;  3EEA A;  3UE6 A;  3LIA A;  4X68 A;  3OCN A;  1SHV A;  2JKG A;  1KGF A;  2Z6C A;  2C5W B;  4JXG A;  4WF0 A;  3NI9 A;  1XFQ A;  2XR0 A;  1F2K A;  3ZG8 B;  5GLA A;  1YMS A;  2BTF P;  4FOF A;  4QJG A;  2XFS A;  2OAQ 1;  1YLY A;  4R70 A;  2G2W A;  1EI5 A;  1IFQ A;  1GHM A;  2Q9M A;  4GS9 B;  4KZ6 A;  2Y2L A;  4MMN A;  1BUL A;  2QPN A;  3RH8 B;  3FKV A;  3O3V A;  3G30 A;  3E4Q A;  3A3F A;  2D01 A;  2WKH A;  5CX7 A;  4WUJ A;  5DTS A;  2I72 A;  3LI9 A;  5DVA A;  3DAV A;  3HLE A;  1WYC A;  3BW6 A;  4YOF A;  2IWC A;  1UWN X;  1E3U D;  1TS0 A;  4DMZ A;  3VMA A;  4EUV A;  1SDE A;  3IBR A;  5DF9 A;  1H8Z A;  3LGO A;  1FQG A;  5JYP A;  4ZAM A;  4GB7 A;  5EVI D;  1OJG A;  2FFF B;  2ZJ9 A;  1ES3 A;  5HWV A;  2J8Y A;  2FZ0 A;  1MC0 A;  4QWO A;  2QWS A;  5E2G A;  1DP9 A;  3UY6 A;  4LV3 A;  2ZC7 A;  1K57 A;  3BY9 A;  5L10 A;  5TGF A;  1D7E A;  4KZ4 A;  5FQJ A;  5G4Z A;  3HCY A;  1L3L A;  1OT6 A;  4YIN A;  4R1G A;  4P6Z M;  2P04 A;  1JTG A;  3MXQ A;  4EXO A;  2G7U A;  1BZA A;  2QYB A;  1Y4O A;  1XA1 A;  4EES A;  1PIO A;  4EER A;  4ZDX A;  1MPL A;  2JKF A;  5KMW A;  4E3K A;  3HUN A;  1ALQ A;  2W1T B;  5GHY A;  2B02 A;  4BBU A;  5EE8 A;  4NKP A;  1YQS A;  3IF5 A;  4NG2 A;  3BLM A;  3N7W A;  5K5B A;  2OV5 A;  3F1N B;  4HY8 A;  5HAQ A;  1BUE A;  4DJ2 A;  5L07 A;  1JVJ A;  3A0S A;  5FDS A;  3RTY A;  3ZYT A;  5AVE A;  1XFN A;  1HVB A;  2W3E A;  1H8Y A;  2RL3 A;  4QY5 A;  2QHK A;  1GSW A;  4BD1 A;  1NLZ A;  3C2W A;  2ZMV A;  2ZC4 B;  4L9G A;  1K56 D;  1XJ6 A;  1IYO A;  5DJU A;  1OJ5 A;  3IF6 C;  3UE0 A;  4DDY A;  3AGD A;  2ZQA A;  2GNX A;  4HH2 A;  2WKE A;  5J7E A;  4U3T A;  3IWO A; 
#chains in the Genus database with same CATH homology
 5KSC A;  4UA6 A;  4H8R A;  4FCF A;  2ZC6 B;  1SCW A;  5AQA A;  4S2O A;  3V50 A;  1BT5 A;  4HBT A;  1NY0 A;  1IYQ A;  1PZO A;  4OLG A;  5FQ9 A;  2Y4A A;  3PBT A;  4N9K A;  4E3I A;  2DRW A;  1PW1 A;  5BOH A;  4R4S A;  5HAP A;  4DDS A;  5AQB A;  2V1Z A;  4IVI A;  5FQK A;  4QU3 A;  4WMC A;  1L2S A;  3V3R A;  3B3X A;  1MWS A;  3IXG A;  3FWL A;  1RGZ A;  4O7D A;  4E3L A;  2XD5 A;  5FAP A;  3GRJ A;  1L0F A;  2JC7 A;  4BL3 A;  3HL9 A;  2PU4 A;  1J9M A;  1LL5 A;  2V20 A;  5CER A;  2J7V A;  2Y2O A;  1JWP A;  3A3E A;  4ZJ3 A;  2H0T A;  1PWC A;  2BG1 A;  2H10 A;  5HL1 A;  4R3B A;  4LCM A;  1ZG4 A;  5E2E A;  3ZHH A;  3CMZ A;  4P6B A;  3ZVT A;  4DE0 A;  4ID4 A;  4BL2 A;  1TEM A;  4PM8 A;  3C4O A;  1CK3 A;  5GHX A;  3Q1F A;  3UE1 A;  1FCN A;  1IEL A;  3MKF A;  4WM9 A;  4UAA A;  5FAS A;  2XK1 A;  5F82 A;  4ZBE A;  1ONH A;  3S4X A;  3VFF A;  4HBU A;  4PM9 A;  3O87 A;  1QMF A;  4JBF A;  3WRZ A;  1KDW A;  1QME A;  2ZC3 B;  2WGW B;  4OOM A;  1GA0 A;  5CGS A;  4M3K A;  5GLB A;  5GLC A;  1RGY A;  2QZ6 A;  4U0T A;  4KQQ A;  1Z6F A;  3OPP A;  2EX2 A;  3OPL A;  4WEJ A;  1ES5 A;  3WRT A;  4D2O A;  5J8X A;  4WYY A;  3IXD A;  4YFM A;  1EWZ A;  1SDN A;  1LI9 A;  5F83 A;  1WE4 A;  4OPQ A;  1KE0 A;  1W8Q A;  3UPN A;  4IBR A;  3ZG0 A;  1K6R A;  2ZLY A;  3FYZ A;  4KZB A;  2EFX A;  3D4F A;  4P85 A;  4F94 A;  3SS4 A;  4X56 A;  3IXB A;  2R9W A;  3VSL A;  3TOI A;  4KG6 A;  1GCE A;  3DWK A;  2P9V A;  1HD8 A;  1S0W A;  1ES4 A;  1XGI A;  4WZ5 C;  5FAO A;  1TVF A;  3AGF A;  3BFG A;  3MBZ A;  5GLD A;  4OH0 A;  2VGJ A;  5EOO A;  1FOF A;  3Q07 A;  4UHU A;  2Z2M B;  3HBR A;  4EBN A;  2Y2P A;  1JWZ A;  2XEP A;  3ITB A;  3NIA A;  3IWI A;  5FI2 A;  4C6Y A;  3CZD A;  5FAT A;  1MY8 A;  4S2L A;  4DE3 A;  1W8Y A;  3MZF A;  3Q82 A;  4EBL A;  1KGG A;  3V5M A;  4R23 A;  3UDX A;  1GHP A;  1Y54 A;  4KZ9 A;  2GDN A;  2CC1 A;  3NBL A;  3MZD A;  3HUO A;  3G4P A;  5AQ9 A;  4DXC A;  1XP4 A;  1K56 A;  4KQO A;  2DNS A;  3BRM A;  3NC8 A;  5IHV A;  2OLV A;  4IED A;  2ZM2 A;  2X01 A;  4CPK A;  2WAD A;  2Z2L B;  2ZQC A;  5FA7 A;  2HP9 A;  4LV1 A;  2C6W B;  4R4R A;  5FQM A;  1FR6 A;  3N8S A;  5DF8 A;  2HDU A;  1BLP A;  4OPZ A;  4Q8I A;  1AXB A;  3PTE A;  3WS1 A;  4RX2 A;  1K55 C;  3PBQ A;  3BLS A;  3WS5 A;  4PPR A;  2Y2H A;  3N6I A;  3CG5 A;  4PM7 A;  4S2I A;  4U0X A;  1K4E A;  1XA7 A;  3DW0 A;  4OP5 A;  3LY3 A;  3IH8 A;  3PBO A;  4GD6 A;  3GQZ A;  4JF4 A;  3Q7V B;  4QB8 A;  3GR2 A;  3WS2 A;  1FSY A;  3WS4 A;  3C7V A;  5JYO A;  1YLJ A;  3PBS A;  4S2N C;  5CTN A;  5E2F A;  3PAE A;  1NYY A;  4EWF A;  1BLH A;  2RCX A;  4Y0U A;  3RXX A;  1DJA A;  5A92 A;  3MXR A;  2WYX A;  1G68 A;  4N9L A;  2Y2N A;  2XDM A;  1XKZ A;  3BFC A;  4WZ4 A;  4E3M A;  4BEN A;  1NZU A;  4S2P A;  1IYP A;  4JXW A;  2WZZ A;  1PZP A;  3G31 A;  1XXM A;  1DJC A;  1IEM A;  1LLB A;  3ZNT A;  1YLT A;  5FI7 A;  3I7J A;  5CEB A;  4OLD A;  3DTM A;  4OOY A;  3LCE A;  4OPR A;  3HRE A;  1MBL A;  5HW3 A;  4GNU A;  4Y0T A;  2E8I A;  4L0L A;  4ZJ2 A;  4QD4 A;  3MKE A;  4RYE A;  1YM1 A;  1FR1 A;  1JWV A;  2WGV A;  3SS5 A;  3Q7V A;  4JKT A;  3SH9 A;  3OC2 A;  5A93 A;  3S1Y A;  2Y2J A;  4JPM A;  1YLP A;  2PU2 A;  5KSH A;  4IVK A;  3G32 A;  5GHZ A;  5FDH A;  3EQU A;  4UA9 A;  1W7F A;  4OQI A;  5CRF A;  1H5X A;  1PWG A;  1ESU A;  3G35 A;  3E2K A;  3QNB A;  2Y91 A;  1K6S A;  4GOG A;  4MBK A;  1NZO A;  4HEF A;  5M19 A;  1K55 A;  1BLC A;  1L0G A;  3UPO A;  3UNW A;  3VFH A;  5FAQ A;  1ERQ A;  3GVB A;  3SS3 A;  3QHY A;  4P87 A;  1MWU A;  2WZX A;  4WZ5 A;  3N4I A;  2JE5 A;  3HLB A;  2J9O A;  4FH2 A;  4ZTK A;  4WBG A;  5HAI A;  5HAR A;  3IWQ A;  4KZ5 A;  4ZJ1 A;  1NYM A;  2Y2I A;  3IH9 A;  4Y0O A;  3VP4 A;  3GV9 A;  1BSG A;  2ZQ7 A;  3M2J A;  3Q7Z A;  1K38 A;  2VGK A;  2EX6 A;  1VQQ A;  4JXV A;  4B4X A;  2XH9 A;  4S2N A;  3N8L A;  4HES A;  4NET A;  3VP3 A;  4KG5 A;  2HDR A;  1E3U A;  2Y2G A;  3GTC A;  3HUM A;  3WWX A;  4KEN B;  2V2F F;  3BM6 A;  1BTL A;  4PM5 A;  1IYS A;  3N8R A;  1ZKJ A;  3VP1 A;  4PM6 A;  5M1A A;  3PBN A;  3A3I A;  1YMX A;  2ZM0 A;  4Y7P A;  2IWB A;  2A3U A;  2P9V B;  3BFE A;  1MKI A;  1K25 A;  4FD8 A;  4KZ8 A;  2EXB A;  3ITA A;  1CEG A;  5TFQ A;  5EOE A;  1DJB A;  2ZQ8 A;  3HLW A;  2WAF A;  4GDB A;  2R9X A;  3W4P A;  1L0D A;  4N92 A;  5EPH A;  3UN7 A;  1I2S A;  2H5S A;  2HDQ A;  3VP2 A;  2XQZ A;  1YLZ A;  3BFF A;  5U47 A;  1S6R A;  3C4P A;  3ZFZ A;  1RCJ A;  1WYB A;  1PYY A;  4OP8 A;  3UDF A;  3HVF A;  3IF6 B;  3AGE A;  4PMA A;  5G18 A;  2ZM8 A;  1MWR A;  4BQM A;  4LV0 A;  3FKW A;  1OME A;  1LI0 A;  1YLW A;  3PBR A;  4JF6 A;  4N1X A;  3DWZ A;  4P0M A;  4X53 A;  5F1F A;  1TDL A;  3OZH A;  4FH4 A;  4S2K A;  3RXW A;  4R3J A;  3ZG5 A;  4GD8 A;  4QHC A;  4OOL A;  2A49 A;  3G2Z A;  4X68 A;  3OCN A;  3NY4 A;  1SHV A;  4K0X A;  3HLD A;  1HZO A;  1KGF A;  3LEZ A;  3FZC A;  2ZC5 B;  3VP0 A;  2C5W B;  4JXG A;  3MXS A;  5DTT A;  3NI9 A;  2XR0 A;  4MNR A;  3UPP A;  4E3J A;  3ZG8 B;  2XD1 A;  5GLA A;  1FCO A;  1YMS A;  3EQV A;  4E3N A;  3VOY A;  2QMI A;  2WGW A;  1GA9 A;  3ZNY A;  5CGW A;  4X6T A;  4QJG A;  2XFS A;  3IHA A;  1YLY A;  5CHM A;  4OQ0 A;  3BEC A;  2G2W A;  1E25 A;  1EI5 A;  2WAE A;  3GSG A;  4XUZ A;  1HTZ A;  1DY6 A;  3ZDJ A;  1K54 C;  4BLM A;  1GHI A;  1GHM A;  4OKP A;  2Q9M A;  3VOZ A;  3TSG A;  1YT4 A;  4KZ6 A;  5FQI A;  2WGI A;  3IQA A;  4GKU A;  2Y2L A;  4DE1 A;  2P74 A;  4XXR A;  2WUQ A;  4MBH A;  4GN2 A;  3HLC A;  1BUL A;  1ERM A;  2HP6 A;  2QPN A;  5D3O A;  3OPR A;  4DE2 A;  3FKV A;  3V39 A;  5EVI B;  4S2J A;  3BEB A;  4QY6 A;  2OSU A;  4R0Q A;  5FQQ A;  1BLS A;  3SOI A;  2EFU A;  5A90 A;  3O3V A;  2WKI A;  2XGN A;  3G30 A;  2ZMA A;  3A3F A;  4IBX A;  1L0E A;  2WKH A;  1ERO A;  1RP5 A;  3M6B A;  4EBP A;  4JLF A;  4DXB A;  1NXY A;  2ZD8 A;  5DTS A;  1ZC2 A;  4WEL A;  4OQG A;  2I72 A;  5AQ7 A;  1MWT A;  4NK3 A;  4E6X A;  1Q2Q A;  5F1G A;  3G2Y A;  3ZCZ A;  4A5R A;  3LY4 A;  1Q2P A;  2BLS A;  5DVA A;  3HLE A;  1KVM A;  1WYC A;  3M6H A;  4Z9Q A;  1I5Q A;  3QNC A;  1XPB A;  2IWC A;  3UE3 A;  5I94 A;  1E3U D;  3NDE A;  5HX9 A;  3VMA A;  1SDE A;  4N1H A;  3WS0 A;  5DF9 A;  3ZG9 B;  3C5A A;  3RJU A;  2Y2K A;  1NJ4 A;  4LCL A;  4MLL A;  4B88 A;  1K4F A;  3A3D A;  1H8Z A;  1G6A A;  4DF6 A;  1O7E A;  1TDG A;  2X71 A;  1FQG A;  2HP5 A;  5JYP A;  4ZAM A;  2FFY A;  3S22 A;  5L2F A;  4GB7 A;  5M18 A;  3IF6 A;  3P98 A;  2UWX A;  3W8K A;  5EVI D;  3V3S A;  3Q81 A;  2FFF B;  4XUX A;  1K54 A;  2ZJ9 A;  4RVA A;  1ES3 A;  2J8Y A;  5CED A;  1I2W A;  5CTM A;  5E2G A;  2OLU A;  1M6K A;  3M2K A;  4WEK A;  4E6W A;  5KZH A;  2ZQD A;  2PBY A;  3A3J A;  5CHJ A;  4K91 A;  1PWD A;  4JXS A;  3UY6 A;  4LV3 A;  1ES2 A;  2B5R A;  2HDS A;  1KE4 A;  2ZC7 A;  1K57 A;  1PI4 A;  3IHB A;  5FSR A;  4GZB A;  4KZ7 A;  2XFT A;  4MEZ A;  5CEC A;  4RA7 A;  2HPB A;  1LL9 A;  3UO9 A;  5TGF A;  1KDS A;  4WMC D;  1VM1 A;  1C3B A;  4KZ4 A;  5FQJ A;  1N4O A;  2Y55 A;  1CI8 A;  3MZE A;  3HLF A;  5EUA A;  1E4D A;  1KGE A;  1ONG A;  3OCL A;  4YIN A;  4R1G A;  3UDI A;  1MXO A;  1KE3 A;  3JYI A;  1JTG A;  5EVI C;  1BZA A;  2Y2M A;  5CGX A;  5A91 A;  1XA1 A;  5HFO A;  4ZDX A;  1PIO A;  4FSF A;  1MPL A;  4KQR A;  4X69 A;  5CXW A;  3W4Q A;  4E3O A;  5KMW A;  3ZVW A;  4E3K A;  2Y59 A;  3HUN A;  1ALQ A;  5GL9 A;  4UA7 A;  5GHY A;  5DF7 A;  5EE8 A;  1PI5 A;  1YQS A;  4OVD A;  3IF5 A;  3SH7 A;  3E2L A;  4B4Z A;  5FI6 A;  1O07 A;  3CJM A;  1FSW A;  3BLM A;  3BYD A;  3N7W A;  1PW8 A;  4OQH A;  4KZA A;  2OV5 A;  2IWD A;  1W5D A;  5HAQ A;  4EQI A;  1ZG6 A;  1BUE A;  1KVL A;  2ZQ9 A;  4KZ3 A;  1SKF A;  4BJP A;  4BD0 A;  3SH8 A;  5EEC A;  1CEF A;  1JVJ A;  3HLG A;  4EUZ A;  3P09 A;  2JBF A;  2XLN A;  4OON A;  3ZGA B;  3NCK A;  1HVB A;  3G34 A;  5E43 A;  3TG9 A;  2Y2Q A;  4MBF A;  1H8Y A;  2RL3 A;  4EV4 A;  1XX2 A;  3VSK A;  4CJN A;  3NDG A;  1IKG A;  4QY5 A;  1JTD A;  5CHU A;  3LO7 A;  4BD1 A;  3OPH A;  4KG2 A;  4X55 A;  4DRT A;  3IXH A;  2X02 A;  1U60 A;  1K57 C;  2EXA A;  3C7U A;  3O86 A;  5DTK A;  4S2M A;  3IT9 A;  1ESI A;  2EX9 A;  1NRF A;  3O88 A;  2ZC4 B;  1IKI A;  1LHY A;  3GMW A;  4LV2 A;  2DCF A;  3ISG A;  3BFD A;  4OPY A;  3PAG A;  3FV7 A;  1M40 A;  1K56 D;  2Q9N A;  2XF3 A;  4LEN A;  2J9P A;  1IYO A;  4GDN A;  2WK0 A;  1N9B A;  3UE0 A;  3IF6 C;  4RX3 A;  5EVI A;  4DDY A;  3W4O A;  3AGD A;  1XGJ A;  2G2U A;  2ZQA A;  4DKI A;  1FCM A;  5EVL A;  4K0W A;  2H0Y A;  4C75 A;  2WKE A;  3MFD A;  4JF5 A;  1W79 A;  4C3Q A;  1CI9 A;  4U3T A;  5E2H A;  3IWO A;  3ZG7 B;  2JCH A;  5TR7 A;  2EX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...