4P85A

Crystal structure of est-y29, a novel penicillin-binding protein/beta-lactamase homolog from a metagenomic library
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
390
structure length
390
Chain Sequence
SMPDLLTNVAENYVNQDLFAGIEWRIDQDGKPIFQGCAGVKDIETRTFIPKNAIYRIYSMTKPIVSFLAMMLIERGVFRLSSPIQNFDPRFKSMKVIDQHAHIEPATALITIEHLLTHQAGFSYDFSLGCPISAHYRDAQLIEDGGRDLTDMMGVLAELPLVFHPGTQWKYSISTDVLAHIIECATGERVDDLLQRLIFDPLDMQDTGFSLPLDGASRLMEVYGMRSLHGLPALKPAPHVLVPADLGSSHPTDDPDFRRGGHGLYSTLDDYMAFANMLLSGQTPEGETLLSPAVLKLALAPRVHFGARGMRINDEPFAGYSWNLLGRVMTDVGAAAYATHLGEFGWSGAAATYFWVDPTKNMTGCVMTQFLGSQHPIGSDMQAAAMSMLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Est-Y29
publication title Crystallographic analysis and biochemical applications of a novel penicillin-binding protein/ beta-lactamase homologue from a metagenomic library.
pubmed doi rcsb
source organism Metagenome
molecule tags Hydrolase
total genus 124
structure length 390
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4p85A00
4C6YA 5A92A 1W79A 4LCMA 2WYXA 2X71A 1GHIA 1PWGA 3V3SA 1Z6FA 3MFDA 4H8RA 3SS5A 2QPNA 3W4QA 4QD4A 3SOIA 1ZG6A 3OZHA 2HP5A 3GRJA 3NI9A 1BLCA 2E8IA 5FATA 4KZ5A 3SH7A 2ZC7A 3IXHA 4QU3A 1DJAA 2P9VB 2OLUA 2ZJ9A 4UAAA 4QHCA 3OCNA 4KG5A 3GSGA 1K4FA 1XX2A 1L0FA 1MWTA 4PM8A 4R1GA 3UDFA 1CI9A 1RP5A 1IEMA 3GR2A 3OPPA 3OC2A 1GA0A 4UA7A 2JE5A 1RGYA 1KDWA 1XA7A 1DJBA 1I2SA 4S2JA 4NETA 3IT9A 1NRFA 1FCNA 3NCKA 4KQRA 2XR0A 4DKIA 5KSHA 4MLLA 5DVAA 1NZUA 2WKEA 4OOYA 2H0TA 3MBZA 3QHYA 4X68A 5HX9A 2WADA 1JWVA 3O87A 5EVIC 4NK3A 3PBSA 5A93A 4S2NA 3SH9A 4DE0A 5CECA 2Y2JA 2V20A 2I72A 4KENB 1L0GA 5BOHA 4KZ7A 2HPBA 1J9MA 5CTMA 3A3EA 4S2OA 4QB8A 1WYCA 5EVIB 1K57C 5DF8A 3FKVA 4XXRA 2H0YA 4QJGA 1GCEA 1U60A 3BEBA 5M1AA 5JYOA 1GHMA 2ZLYA 2EX2A 3N8SA 1G6AA 4HEFA 1XA1A 1IELA 4OOLA 4R4RA 1YLJA 3HREA 3S4XA 2Q9MA 3DWZA 1PZOA 4N92A 4ZAMA 4OP5A 4S2PA 5FAQA 1MBLA 4OLGA 4B88A 5EPHA 1MXOA 4S2MA 1K56A 3RJUA 3G4PA 1G68A 4Z9QA 4GB7A 4M3KA 3MKEA 3BLSA 2XD1A 5KSCA 1LI0A 1K4EA 2RCXA 2VGKA 4OPQA 3C4PA 2WGVA 3M6HA 1BLHA 4K91A 4DDSA 4DXCA 2XDMA 3RXWA 1JVJA 1DJCA 4OPZA 3VP2A 3P09A 3ZG8B 3ZG0A 4N1HA 1N9BA 4QY5A 3BM6A 1FOFA 2H10A 3ZVWA 3LCEA 2P9VA 4UHUA 4FH2A 4KZAA 4WBGA 5U47A 3VP0A 1NY0A 1PWCA 4ZTKA 4ZBEA 3TSGA 1ESUA 1H5XA 3SS3A 3IF6B 2WUQA 5FA7A 4C75A 3G32A 2EX8A 1DY6A 5GLDA 2PBYA 3IWOA 2A49A 3AGDA 2Y2PA 3C7VA 5HAIA 3HUNA 1YLZA 5FQIA 4UA6A 3UY6A 3BLMA 1IYSA 4HBUA 3BFDA 1KVMA 5CGSA 4DDYA 3N4IA 2ZC4B 1LL9A 1IYOA 3E2KA 5EVIA 4BLMA 1GA9A 1M40A 3PAGA 4OQGA 5TR7A 1N4OA 4PM6A 2XH9A 3FV7A 4Q8IA 1KGGA 2UWXA 3NY4A 3IHBA 5CTNA 4OQHA 5AQ9A 2G2WA 1EI5A 3CZDA 4GNUA 1XGIA 2BG1A 3LEZA 1FQGA 5GLBA 1K57A 1I2WA 5F1GA 3MZDA 3CG5A 1C3BA 2XK1A 3WS4A 1O7EA 1K55A 2EXAA 4LV1A 4EBPA 1ZKJA 4R23A 1L0EA 2OSUA 3V5MA 4RVAA 1QMEA 2IWDA 3FYZA 3MXRA 4FCFA 1FSWA 2EXBA 2Y2KA 5FAOA 5GL9A 2CC1A 4IBRA 1MWRA 4K0XA 1EWZA 4LV3A 5L2FA 2XF3A 3ISGA 4PPRA 5DTSA 1NJ4A 4S2LA 4OPYA 1AXBA 1ESIA 1RGZA 3BFCA 1Q2QA 5M19A 1ZG4A 5F82A 2J8YA 4WYYA 3VP3A 2VGJA 5CGWA 4KG2A 1YLPA 4WELA 3ZNTA 3PBNA 3PBQA 3Q7VB 4WZ5C 4BL3A 3PBRA 1RCJA 3ZFZA 4EUZA 5FQ9A 1CEFA 1WYBA 3BFGA 4GDNA 1SKFA 1K54A 4LV2A 4WEKA 5HARA 4Y0UA 1OMEA 3C4OA 1FSYA 4DXBA 5F83A 3WRZA 3IF6A 3M2KA 1W8QA 1BLSA 1W8YA 3AGFA 3HLWA 1EROA 2HP6A 2QZ6A 1SDNA 1H8ZA 2XGNA 1KE3A 1PI5A 3DWKA 3HLDA 3IQAA 3NDGA 2JCHA 4LENA 1XXMA 1VQQA 4Y0TA 3DW0A 1L0DA 5CHJA 4EBNA 3IH9A 1Q2PA 3A3JA 4U0TA 1SHVA 5DF7A 5EOEA 5CHMA 4BJPA 1KGEA 4WM9A 4XUXA 4EWFA 4JF6A 3N8LA 4LCLA 1ALQA 1ES5A 2ZQ8A 3G2YA 5CEDA 3ZG5A 4JXGA 2Y59A 3Q81A 3HL9A 4OLDA 4PMAA 4MEZA 1E3UD 1NXYA 1ES2A 1PWDA 4HESA 5DF9A 1JTGA 4N1XA 5M18A 1WE4A 4FD8A 2XQZA 1YLTA 1K6SA 3BRMA 3OCLA 2EX9A 1LLBA 3WS1A 5TGFA 3GMWA 1L2SA 1HD8A 1K6RA 3SH8A 3HVFA 3N6IA 5A91A 1JWZA 3G2ZA 2PU4A 4WZ4A 5G18A 4E3OA 1MWUA 4X53A 4LV0A 4DE3A 1IYQA 3UPPA 3ZVTA 4E3IA 1TEMA 1QMFA 2ZM2A 3LY3A 1I5QA 1TVFA 1LI9A 5HAQA 3QNBA 2OLVA 4GN2A 3OPLA 5KZHA 4GOGA 5FASA 1ONGA 3P98A 4Y0OA 2WZZA 5E2HA 5FI6A 3UO9A 2R9XA 2ZMAA 3IHAA 5TFQA 3SS4A 4R3BA 3HBRA 4WMCD 4D2OA 2ZQ7A 3Q7VA 2J9OA 3IWQA 2WGWB 3MKFA 4S2KA 5E2GA 2ZM0A 1LL5A 2OV5A 1S0WA 3V50A 4X55A 3CJMA 3ZHHA 3IXBA 4KZ8A 2WK0A 4DRTA 4B4XA 4BD1A 4WZ5A 5GHZA 4E6WA 4OP8A 3EQVA 4E3MA 2Y2MA 2ZC6B 1IKIA 2EFUA 3HUOA 4ZJ1A 3Q07A 5CXWA 1H8YA 3PAEA 3I7JA 1FCOA 3D4FA 3WRTA 3A3DA 3NDEA 3Q7ZA 3Q1FA 3TG9A 4OOMA 4R0QA 1E25A 1KE4A 4MBFA 4DE2A 4EV4A 4U3TA 3HLGA 1IYPA 2WKIA 4JPMA 5AQBA 5GHYA 4BL2A 3FKWA 2Z2LB 2Z2MB 3GTCA 5E2EA 5J8XA 5HFOA 4MBKA 5GLAA 5EECA 2P74A 3G34A 2QMIA 4DE1A 5FQQA 1XKZA 3UPNA 3HLCA 2RL3A 5GLCA 1FCMA 1SCWA 3BECA 3RXXA 2V2FF 3DTMA 3WS0A 3G30A 5CRFA 1NZOA 4OVDA 4O7DA 1XPBA 3BYDA 2DNSA 2C5WB 3AGEA 1KDSA 4KZ6A 3PTEA 4BQMA 1SDEA 5FQKA 3MZFA 4CPKA 4E3JA 5FQMA 4OONA 4E3KA 4JXVA 1S6RA 4JF5A 3UDIA 2JC7A 1BTLA 2J9PA 2WKHA 3FWLA 2Y91A 1Y54A 4P85A 3VOZA 3M2JA 4IVIA 4BENA 3VSKA 1ERMA 1FR6A 4YFMA 3E2LA 3C7UA 5FI2A 5FQJA 5EE8A 2WGWA 4E3NA 2ZC5B 4FH4A 1TDLA 4MBHA 4DF6A 3GV9A 4JF4A 1E4DA 1M6KA 1KVLA 4KQQA 2WGIA 1YMSA 3EQUA 4RX2A 4JLFA 3WS2A 1XP4A 1KGFA 2ZC3B 3GQZA 3NBLA 2Q9NA 4IEDA 3PBOA 3VOYA 3G31A 3IXGA 4FSFA 2XD5A 5E2FA 3UPOA 1MKIA 5FAPA 3BFFA 2XLNA 2Y2GA 2Y2QA 1YLYA 1K38A 4PM7A 3O88A 4GD8A 4OPRA 1KE0A 2X01A 2EX6A 3S1YA 3A3FA 5AQ7A 3IF5A 5FDHA 1E3UA 3ZCZA 4CJNA 3FZCA 3ZG7B 3MXSA 2EFXA 3IH8A 3ZNYA 5F1FA 1BULA 1HZOA 2WAFA 2ZQDA 3LY4A 5EVLA 2X02A 3WS5A 1HVBA 3VFHA 3ITAA 4KQOA 3LO7A 3UNWA 3NIAA 3NC8A 4IBXA 1MWSA 4ID4A 5D3OA 4OH0A 1YM1A 1K55C 4E3LA 2DCFA 5EOOA 4RYEA 2V1ZA 2ZQ9A 1XGJA 1PZPA 1BT5A 1JTDA 5FSRA 3ZDJA 1NYYA 4P0MA 2XEPA 2XFSA 4N9KA 3JYIA 4JKTA 5CHUA 2Y55A 4P6BA 2IWCA 4EQIA 1FR1A 2BLSA 2HDUA 4B4ZA 4GKUA 4X69A 4XUZA 5CGXA 5DTTA 1IKGA 4HBTA 4WMCA 4N9LA 4IVKA 3UDXA 3HLFA 3UE1A 5HW3A 3C5AA 3N7WA 3IXDA 3UE3A 2WZXA 1CEGA 4OQ0A 1K56D 1PYYA 4Y7PA 4KG6A 3Q82A 4X56A 2ZQCA 2HDSA 4MNRA 4JXSA 4KZ3A 4U0XA 3VP1A 4WEJA 2WAEA 3VSLA 5AQAA 1YT4A 2Y2NA 3IWIA 3O86A 3GVBA 2Y2HA 4GD6A 1K54C 3O3VA 2H5SA 4QY6A 1GHPA 1LHYA 5IHVA 4A5RA 4E6XA 5I94A 2G2UA 5FI7A 1ERQA 2XFTA 2ZM8A 3QNCA 3WWXA 3IF6C 2R9WA 2IWBA 4S2NC 5DTKA 5CEBA 5E43A 1NYMA 5KMWA 4F94A 4ZJ3A 3VMAA 1PW8A 4P87A 1ES4A 5HAPA 3A3IA 3BFEA 1MPLA 3W4OA 4R4SA 4X6TA 3G35A 2B5RA 5CERA 2Y4AA 3PBTA 4R3JA 3VFFA 3CMZA 2FFFB 1K25A 4EBLA 4GZBA 3V3RA 2Y2OA 4JBFA 4L0LA 5EUAA 3S22A 3W4PA 4ZDXA 3M6BA 4UA9A 4ZJ2A 2ZD8A 1BUEA 4KZBA 3ITBA 2A3UA 4PM9A 1CI8A 2Y2LA 1CK3A 3UN7A 3W8KA 1YQSA 2J7VA 4RA7A 1JWPA 2HDRA 2DRWA 4KZ9A 1PIOA 1W5DA 3N8RA 3VP4A 4OKPA 4BD0A 1PI4A 3TOIA 3HLBA 2C6WB 4OQIA 3HLEA 4GDBA 4KZ4A 5EVID 2JBFA 3B3XA 2ZQAA 4S2IA 2FFYA 2PU2A 3OPHA 2HP9A 5GHXA 4K0WA 5A90A 1BZAA 1ONHA 1TDGA 1MY8A 1VM1A 3HUMA 2Y2IA 1HTZA 1BSGA 1W7FA 3OPRA 5HL1A 1BLPA 2GDNA 5JYPA 1PW1A 4JXWA 4RX3A 3MZEA 4C3QA 3UE0A 3ZGAB 4PM5A 4YINA 3V39A 1ES3A 1O07A 1YLWA 3ZG9B 1ZC2A 2HDQA 1YMXA
chains in the Genus database with same CATH superfamily
2PYPA 4LCMA 3NHQA 3G6OA 3SS5A 4QD4A 3OZHA 2E8IA 5FATA 4KZ5A 3QP8A 3IXHA 2ZJ9A 2OLUA 3PHYA 1K0KA 1L0FA 4PM8A 1RP5A 4UA7A 1RGYA 1KDWA 4S2JA 3IT9A 4KQRA 2XR0A 3UB9A 2H0TA 3U2AA 3QHYA 2GX5A 1DP9A 1CJFA 4NK3A 5A93A 3SH9A 5CECA 1DP8A 3C8CA 4KZ7A 2HPBA 1J9MA 2EA9A 3A3EA 3KYQA 1K57C 5AJGA 5DF8A 3FKVA 4QJGA 1U60A 5M1AA 5JYOA 1H3QA 2EX2A 4R4RA 1YLJA 3HREA 4XT2B 4ZRRA 3S4XA 4GW9A 3DWZA 4UQIM 4OP5A 3K2NA 4S2MA 2VX8A 3LIAA 1LSWA 4M3KA 5KSCA 4R70A 3H82A 3JVVA 2VGKA 2CMNA 1BLHA 4DDSA 3MFXA 5MC7A 3D72A 4DXCA 3RXWA 3T1RA 3ZG0A 1N9BA 4HP4A 4DN0A 5FL3A 4ZBEA 2W27A 1S67L 1FIKA 2FZ0A 4CQHA 3G32A 5GLDA 2PBYA 4ETXA 1YLZA 1LL8A 3UY6A 4YOFA 3BFDA 4DDYA 1OPXA 4L9GA 4O0PA 5EVIA 1WA9A 4HJ3A 4BLMA 1GA9A 3PAGA 1N4OA 2XH9A 5CTNA 4OQHA 4Y13A 1ACFA 2BG1A 4EU0A 1I2WA 1SKOA 3MZDA 2B95A 3WS4A 2W1RA 4EBPA 2HJEA 3V5MA 2IWDA 3FPWA 3LR5A 2Y2KA 2V0WA 4F3LB 3ISGA 5DTSA 1NJ4A 4S2LA 1ESIA 3BFCA 1Q2QA 5F82A 4L9FA 2VGJA 4R38A 5CGWA 3PBNA 1NLZA 4BL3A 3PBRA 4CLCE 3MQOA 5HDCA 3BFGA 2JN7A 4GJ4A 3HJKA 5DFXA 1SKFA 1K54A 4LV2A 4WEKA 4Y0UA 2JKTM 3B47A 4NEED 3T4OA 3WRZA 1W8QA 1EROA 2DMWA 4D60A 1SDNA 1H8ZA 1T18A 3H7WB 1VQQA 2OAP1 1OTBA 5DF7A 5CHMA 1OTDA 2PR5A 1F98A 4LCLA 1ES5A 2QKPA 2O9BA 1SKOB 2Y59A 4PMAA 1NXYA 1PWDA 4ESPA 2JKGA 5DF9A 4FD8A 2KX6A 1YLTA 3OCLA 3S7PA 1LLBA 3LI8A 1YPRA 5A91A 1JWZA 4E3OA 1MWUA 1OT9A 4X53A 4LV0A 4KUOA 4E3IA 1VEUA 2IA2A 3QNBA 5A8BA 3P7NA 5FI6A 3SS4A 2J9OA 3IWQA 2WGWB 4B4XA 4NXFA 4WZ5A 5GHZA 1CF0A 4E6WA 1UWNX 4OP8A 4MCWA 3MMHA 5CXWA 3I7JA 3C30A 3D4FA 3MQQA 3Q1FA 4OOMA 4R0QA 1KE4A 4MBFA 4DE2A 1IYPA 1D1JA 1JNUA 5GLAA 1PNEA 2VA0A 2P74A 3G34A 2QMIA 5AVFA 4NKPA 1W63M 3HLCA 5DJTA 3BJNA 5L09A 1YSPA 1FCMA 3U4LP 3L7HA 4H6JA 3RXXA 1S1YA 4Y5FA 1NWZA 4O7DA 2HF6A 2V0UA 5F5YA 3S7OA 5FQMA 4OONA 3UDIA 3E4QA 2WKHA 2YKHA 2Y91A 1Y54A 3A0SA 3M2JA 4BENA 3VSKA 3SZTA 5FI2A 4E3NA 4FH4A 1TDLA 3QP6A 1S4SA 2W3DA 3EQUA 2ZC3B 4I39A 2P7JA 1UWPX 1TD5A 3GQZA 2Q9NA 3NBLA 1D06A 3PBOA 4IEDA 3G31A 3IXGA 3UPOA 1ZHHB 2Y2GA 2P04A 2VGLM 1YLYA 2Y2QA 4PM7A 4GD8A 3MF0A 2EX6A 2Z6CA 3A3FA 5AQ7A 5FDHA 1E3UA 3C38A 1SZVA 3ZNYA 5F1FA 2VZWA 2X02A 3VFHA 4H6JB 2XA7S 4IBXA 1MWSA 4E3LA 2DCFA 4RYEA 1JTDA 2B02A 3ZDJA 2EWWA 1STZA 4P0MA 2XEPA 3KSFA 5IT5A 4P6BA 3OBFA 2IWCA 4NXBA 4EQIA 2BLSA 3QP4A 3A0VA 4GKUA 1Z09A 4WMCA 4N9LA 3UE1A 3C5AA 3UE3A 5HZHA 1CEGA 4OQ0A 1PYYA 5J7EA 2ZL1A 5HD5A 2ZQCA 4KZ3A 4U0XA 2OWHA 2Y2NA 3GVBA 4GD6A 1K54C 1GHPA 3LYXA 5I94A 2XFTA 2ZM8A 3WWXA 5CEBA 3GDIA 4WLAA 4MMNA 5J3WA 1AWIA 4FUWA 3PBTA 1LSVA 3CMZA 4EBLA 4JBFA 4L0LA 4JGQA 1VETA 3M6BA 4ZJ2A 4KZBA 4PM9A 3EGDC 3CAXA 3IX8A 2DRWA 3N8RA 3T1QB 3TOIA 4YNRA 3HLBA 4X25A 4KZ4A 5DFYA 2FFYA 2PU2A 1BZAA 5C5KA 2Y2IA 2H28A 3OPRA 5HL1A 4I38A 1BLPA 3T4LA 4YINA 1O07A 4JGOA 5A92A 2X71A 3UB8A 3V3SA 3MFDA 2QPNA 3F1PB 2W3FA 2HP5A 2QYBA 2ZC7A 1DJAA 2P9VB 4UAAA 3HJIA 2O9AA 1PFLA 2VKSA 1XA7A 1J3WA 1FCNA 4DKIA 3T4JA 2K7SA 5KSHA 4MLLA 5DVAA 5HX9A 3LFVA 1JWVA 3KSGA 1Y28A 2V20A 4KENB 3IS2B 5BOHA 3OOVA 3VOLA 4I3IA 5TBMA 2H0YA 2B18A 3BEBA 3CWFA 2QWSA 1XA1A 1IELA 4OOLA 1NLYA 3RTYA 3MR0A 3V67A 1PZOA 4N92A 4ZAMA 3QP2A 2JKTI 2HGVA 5EPHA 1MXOA 3RJUA 4Z9QA 4GB7A 3NOPC 1LI0A 2RCXA 4OPQA 3EEAA 3M6HA 2QJ5A 4K91A 4BBVA 1T1BA 2Q0OA 4GS9A 4N1HA 4CLCD 2H10A 3ZVWA 3LCEA 4FH2A 4KZAA 4WBGA 3R7WA 5U47A 2VJWA 3VP0A 3T50A 2PD8A 1F2KA 2EX8A 3AGDA 5HAIA 5TBMB 4UA6A 3BLMA 1IYSA 5CGSA 1IYOA 3F1OB 3A0RA 4PM6A 1KGGA 2UWXA 3NY4A 1P9WA 1LT0A 5AQ9A 4B9OA 2G2WA 3CZDA 5EM1A 3ZQ5A 1XGIA 4XT2A 1C3BA 1K55A 4LV1A 4GLQA 4R23A 1L0EA 4CLCC 4FCFA 1FSWA 3B42A 2P08A 4GS9B 4DMZA 1ZG4A 1YAXA 2HJ9C 3R7WB 3VP3A 1PRQA 4KG2A 4WELA 3KSHA 4EUZA 3T1XA 5FQ9A 1IOUA 5F83A 3M2KA 5HSQA 3HLWA 1DRMA 1KE3A 1NRJA 1PI5A 1TS8A 3DWKA 3HLDA 3NDGA 5HDSA 3MSHA 1XXMA 1Y4OA 1CQAA 1L0DA 1Q2PA 3A3JA 4U0TA 5EOEA 1TS0A 4BJPA 3E4PA 1KGEA 4LPZA 3CI6A 2E8JA 2ZQ8A 5CEDA 4JXGA 2V8FA 5TJJA 4HESA 4N1XA 5M18A 1WE4A 1T19A 3DTKA 3E4OA 1G28A 3MJQA 2W3HA 5TGFA 3GMWA 3EGXC 4I3AA 3SH8A 1GSVA 4WZ4A 4F3LA 1VB6A 2ZM2A 3LY3A 3LR4A 1TVFA 1V9ZA 5HAQA 1XFNA 4II7A 5KZHA 3LICA 5FASA 3P98A 3PR6A 3IHAA 4D2OA 4S2KA 2Y79A 2OV5A 3CJMA 3IXBA 2WK0A 1OTIA 5HL6A 4BD1A 3CHWP 3EQVA 2Y2MA 2EFUA 3Q07A 4IJGA 2ZOHA 2W0NA 3H7WA 3WRTA 3NDEA 4LFUA 4BBTA 3TG9A 1E25A 3HLGA 4JPMA 3FKWA 3LR0A 2Z2MB 5HFOA 4MBKA 5EECA 4DE1A 5FQQA 1XKZA 3ULFA 1A0KA 2RL3A 1SCWA 3DTMA 3WS0A 4OVDA 3BYDA 2C5WB 3AGEA 1KDSA 4KZ6A 3CUEA 4MN6A 1SDEA 5FQKA 1G5UA 2INWA 1S6RA 4JF5A 3VOZA 3CPTB 4IVIA 3E2LA 3CLOA 2WGWA 4MBHA 4JF4A 5DJUA 1XJ4A 4KQQA 4JLFA 3WS2A 4HH3A 4BWIA 2XLNA 4BMWA 2K2NA 3LEQA 1KOUA 3ZCZA 3FZCA 3IBJA 3ZG7B 5HWVA 3IH8A 4Y3IA 2WAFA 5EVLA 4LRXC 3KSIA 3TJZC 3QP5A 3ITAA 3FPVA 3NC8A 1YM1A 1K55C 1PZPA 1BT5A 2A2LA 1OJ5A 2O99A 4X69A 5DTTA 5F6AA 1IFQA 4HBTA 5EVEA 5HW3A 4Y17A 3HLFA 3ICYA 4MNRA 4WEJA 2WAEA 4P6ZM 2VV8A 1YT4A 4NG2A 2H5SA 4QY6A 1LHYA 4HOIA 2VEAA 4A5RA 4E6XA 1MKMA 5HPIA 3QNCA 5DTKA 4Q0JA 4F94A 3BFEA 4X6TA 2B5RA 4M4XA 2Y4AA 2FH5A 2WKQA 4GZBA 2Y2OA 3S22A 5EUAA 3W4PA 2ZD8A 1BUEA 4PHTA 5EFWA 2Y2LA 2HZ5A 3W8KA 4RA7A 5F69A 5IS1A 1W5DA 2C6WB 1LSXA 4OQIA 3HLEA 3T4SA 5EVID 2JBFA 3B3XA 5A90A 1S4RA 3IX4A 1W7FA 2J3WA 4JXWA 4RX3A 3UE0A 3ZGAB 2PBDP 3V39A 5F68A 4EEUA 1YLWA 1ZC2A 2HDQA 4C6YA 4O8GA 3C2WA 2WYXA 3DAVA 1PWGA 3NI9A 4QU3A 4UQIS 4QHCA 4KG5A 3GSGA 1XX2A 3UDFA 1GA0A 4NETA 1ODVA 1NRFA 2WKEA 4OOYA 4WF0A 3MBZA 4X68A 5EVIC 4S2NA 3BQ8A 5HDDA 2Y2JA 2I72A 3DTEA 5CTMA 1WYCA 3UB5P 4XXRA 1OTEA 3LIBA 3LIDA 1H8MA 3N8SA 4HH2A 1G6AA 2OAQ1 1G6OA 3NECA 5FAQA 4S2PA 1S1ZA 3EEHA 2HV1A 4B88A 4E04A 1K56A 3G4PA 1G68A 3MKEA 2XD1A 2VK3A 3MS6A 1ZTUA 5EV0A 3VP2A 3F1PA 2O0YA 3P09A 3ZG8B 4QY5A 5L8MA 2A24B 2P9VA 1PWCA 1H5XA 3SS3A 3IF6B 4PKYG 2WUQA 2V1AA 1DY6A 2A49A 2Y2PA 3HUNA 3NULA 5FQIA 1L3LA 1P9RA 4HBUA 1KVMA 3IS2A 3N4IA 1N9LA 4LRZE 1M40A 3FV7A 2M7UA 3IHBA 4GNUA 2L1MA 1FQGA 5GLBA 1K57A 2D01A 4HJ6A 5F1GA 1MC0A 3LI9A 2XK1A 1O7EA 1ZKJA 4RVAA 1QMEA 3MXRA 3S7NA 4IBRA 1MWRA 4K0XA 3FG8A 2XF3A 2PT7A 4CLCB 1FILA 4PPRA 4HHDA 4OPYA 1RGZA 5I5LA 4WYYA 1YLPA 3PBQA 3Q7VB 4WZ5C 3ZFZA 2JKFA 1CEFA 1WYBA 4GDNA 1HLUP 4RQ9A 5HARA 3BY8A 1FSYA 3JVUA 4DXBA 2OOLA 3UB7A 1BLSA 2QZ6A 2XGNA 2EWVA 3T4TA 3IQAA 3LGOA 5CHJA 4Z1WA 4EBNA 3IH9A 1SHVA 2W3GA 3F1OA 4WM9A 1ALQA 3CITA 2ZBBA 3GECA 1E3UD 4MEZA 5KIZA 1ES2A 1JTGA 2L4RA 4ARZB 3DTIA 3LR3A 4WUJA 3FC7A 3L9KA 1K6SA 2UV0E 3BW6A 2J3TD 3VE4A 3HVFA 3N6IA 4EUVA 4DE3A 2NUTC 3UPPA 3ZVTA 4G3VA 1TEMA 3D3OA 2VV6A 3VE3A 1LI9A 2OLVA 3P01A 1ONGA 2WZZA 5E2HA 3UO9A 2R9XA 5TFQA 3HBRA 4WMCD 2ZQ7A 2M1CA 5E2GA 2ZM0A 1LL5A 3K3CA 4X55A 3ZHHA 5HWWA 2V1BA 4DRTA 4E3MA 4KQDA 2ZC6B 3PAEA 4G3KA 1OTAA 5DKKA 1FCOA 1EW0A 3A3DA 4U3TA 5AQBA 4BL2A 2J3TC 2BASA 5E2EA 2ZOIA 5J8XA 2ZMFA 1TF1A 2D02A 3UPNA 4DJ3A 2V2FF 2VGLS 1NZOA 4FOFA 3PTEA 4BQMA 3EWKA 4CPKA 4IUHA 3JPUA 2JC7A 1X0OA 3FWLA 4P85A 1ERMA 4YFMA 3C7UA 5FQJA 4DF6A 1M6KA 1KVLA 1YMSA 4HY8A 1XP4A 1KGFA 2JHEA 3VOYA 4FSFA 2XD5A 5L10A 4YWZA 4MN7A 1MKIA 3BFFA 3IX3A 1H0MA 1K38A 4OPRA 4Y2FA 3IF5A 4CJNA 4G3WA 2EFXA 2LB9A 2ZQDA 3LY4A 1HVBA 1N9NA 4KQOA 3LO7A 3UNWA 3NIAA 5D3OA 4OH0A 2PYRA 5EOOA 2V1ZA 1XGJA 3NJAA 1NYYA 2WKPA 2XFSA 4N9KA 3JYIA 2Y55A 2GNXA 2QJ7A 1FR1A 2PD7A 2HDUA 4B4ZA 3UDXA 4IVKA 3MQ0A 3N7WA 3IXDA 4Y7PA 3Q82A 4X56A 2GZAA 2HDSA 1P97A 4JXSA 3CPTA 5CX7A 1W63Q 3IWIA 3O86A 3O3VA 5IHVA 5DKLA 2R9WA 2XA7M 2IWBA 2PR6A 5E43A 1NYMA 4ZJ3A 4B93A 3VMAA 4P87A 3A3IA 3ZYTA 3TW8A 3G35A 3TRCA 5FDSA 3NOUC 4R3JA 3VFFA 4X1LA 4ZDXA 4UA9A 2WKRA 3ITBA 2NUPC 3LIFA 4UEYA 1JWPA 3T12B 4KZ9A 2BTFP 2ZQAA 2HP9A 3W2ZA 2JKRM 1VM1A 1MY8A 3RFBA 1BSGA 3MZEA 4C3QA 1VHMA 3H82B 2PHYA 4KUKA 2VLGA 1OT6A 4EXOA 2I9VA 1W79A 3HCYA 2Y8HA 3VV4A 1GHIA 1Z6FA 4H8RA 4HI4A 3W4QA 3SOIA 1ZG6A 3GRJA 1BLCA 3SH7A 1YKDA 1F5MA 3OCNA 1K4FA 1MWTA 4R1GA 1CI9A 2OWJA 1IEMA 3GR2A 3OPPA 3OC2A 3K3DA 4WN5A 2JE5A 3DBAA 1DJBA 1I2SA 3B33A 5AVEA 4PAUA 3NCKA 3NOTC 4X1MA 5HD3A 1NZUA 3PXPA 2WADA 4JGPA 3O87A 3PBSA 2W3EA 4DE0A 1L0GA 1XJ2A 4S2OA 4QB8A 5EVIB 4AFIA 4ME4A 4NXEA 1GCEA 1GHMA 2ZLYA 2O9CA 4HEFA 5FEGA 3UMDA 2Q9MA 1UGUA 1MBLA 3KYZA 4OLGA 3UE6A 4L9EA 3BLSA 1K4EA 2ACGA 3C4PA 2V8CA 2WGVA 4HJ4A 2XDMA 1JVJA 1DJCA 4OPZA 5G4YA 4K08A 3BM6A 1FOFA 3BY9A 3UB6A 4UHUA 1NY0A 2K31A 4ZTKA 3TSGA 1ESUA 4EERA 5FA7A 4C75A 1N9OA 4LLOB 3IWOA 3C7VA 4EETB 1S66L 5EM0A 5K5BA 4LGWA 3BQAA 4BBUA 2ZC4B 1LL9A 3E2KA 3T1SA 4OQGA 5TR7A 4Q8IA 1EI5A 2Z6DA 2PRFA 3LEZA 4EW7A 3CG5A 2M7VA 2EXAA 4IUKA 2OSUA 3FYZA 1P0ZA 2EXBA 5FAOA 5GL9A 2CC1A 1XJ3A 1EWZA 4LV3A 5L2FA 1D7EA 1VEUB 1AXBA 5M19A 2J8YA 4ETZA 3SW1A 3ZNTA 2A24A 1RCJA 2V9AA 5FEFA 2XRNA 4I5SA 3KYEA 4MDZA 1OMEA 3C4OA 1OJGA 2KLIA 4DJ2A 4EEPA 3IF6A 1W8YA 3AGFA 3TE8A 2HP6A 2JCHA 4LENA 4Y0TA 3E98A 5HPFA 3DW0A 4XUXA 4EWFA 4JF6A 3N8LA 3G2YA 3ZG5A 4OLDA 3Q81A 3HL9A 5LBRA 3E0YA 2XQZA 3CUEC 3BRMA 2EX9A 3WS1A 3T4QA 4PKYA 4EESA 5IU1A 1BYWA 1L2SA 1HD8A 1K6RA 3G2ZA 2PU4A 4Q0IA 5G18A 2AVXA 1T1AA 4IHQA 1IYQA 4CLCA 1QMFA 1I5QA 2W1TA 4Y15A 4GN2A 3OPLA 1GSWA 4GOGA 4Y0OA 2ZMAA 4R3BA 3Q7VA 3MKFA 1S0WA 3V50A 2KDKA 4KZ8A 1IKIA 4QPRA 3BWLA 3HUOA 4ZJ1A 1H8YA 3Q7ZA 4EV4A 2WKIA 5GHYA 1V9YA 1F9IA 2Z2LB 3GTCA 3LIEA 5GLCA 3BECA 4ARZA 2ZMVA 3G30A 4GCZA 5CRFA 1XPBA 2DNSA 3KO6A 4FTXA 4MN5A 2W1TB 3MZFA 4E3JA 3MXQA 4E3KA 4JXVA 3T4KA 2ZL1B 1BTLA 2J9PA 4HP9A 1FR6A 5EE8A 2R78A 4Q0HA 5L07A 2ZC5B 3GV9A 1E4DA 2J80A 4RX2A 2WGIA 3F1NA 2QHKA 5HWTA 2JKRI 3D9YA 5E2FA 5FAPA 4HNBA 3O88A 1KE0A 2X01A 3S1YA 4GHIA 2PDRA 4P6ZS 2YKFA 3R4KA 1MZUA 4O01A 1VETB 2VV7A 3MXSA 4QWOA 1BULA 1TS7A 1HZOA 3WS5A 3PYPA 3O5YA 4ID4A 4HQAA 2ZQ9A 5FSRA 3EOIA 4JGRA 4I3JA 2GJ3A 4JKTA 5CHUA 1XFQA 4XUZA 5CGXA 2KOIA 1IKGA 3KX0X 4EQ1A 5J4EA 2WZXA 1K56D 2MJ6A 4KG6A 3RH8B 1DP6A 3IBRA 2PAVP 2XROA 3VP1A 3VSLA 5AQAA 3F1NB 1TS6A 2Y2HA 1XJ6A 2G2UA 5FI7A 1ERQA 2L0WA 3IF6C 4S2NC 1GSXA 5KMWA 1PW8A 4GHIB 1ES4A 5HAPA 1MPLA 3W4OA 4R4SA 4HIAA 3LUQA 5CERA 3QP1A 2FFFB 1K25A 3V3RA 3H9WA 3OLOA 2A3UA 1CI8A 1CK3A 3UN7A 1YQSA 2J7VA 2HDRA 5G4ZA 4BD0A 1PIOA 3VP4A 4OKPA 1T1CA 1PI4A 4R3AA 3UMEA 4GDBA 2XSSA 2G7UA 4S2IA 4LRYC 3OPHA 5GHXA 4K0WA 1ONHA 1TDGA 1YSQA 3HUMA 4NXGA 4R6LA 1HTZA 5JYPA 2GDNA 1PW1A 4WL9A 3S7QA 4PM5A 1ES3A 2LB5A 3ZG9B 1YMXA
chains in the Genus database with same CATH topology
4C6YA 5A92A 1W79A 4LCMA 2WYXA 2X71A 1GHIA 1PWGA 3V3SA 1Z6FA 3MFDA 4H8RA 3SS5A 2QPNA 3W4QA 4QD4A 3SOIA 1ZG6A 3OZHA 2HP5A 3GRJA 3NI9A 1BLCA 2E8IA 5FATA 4KZ5A 3SH7A 2ZC7A 3IXHA 4QU3A 1DJAA 2P9VB 2OLUA 2ZJ9A 4UAAA 4QHCA 3OCNA 4KG5A 3GSGA 1K4FA 1XX2A 1L0FA 1MWTA 4PM8A 4R1GA 3UDFA 1CI9A 1RP5A 1IEMA 3GR2A 3OPPA 3OC2A 1GA0A 4UA7A 2JE5A 1RGYA 1KDWA 1XA7A 1DJBA 1I2SA 4S2JA 4NETA 3IT9A 1NRFA 1FCNA 3NCKA 4KQRA 2XR0A 4DKIA 5KSHA 4MLLA 5DVAA 1NZUA 2WKEA 4OOYA 2H0TA 3MBZA 3QHYA 4X68A 5HX9A 2WADA 1JWVA 3O87A 5EVIC 4NK3A 3PBSA 5A93A 4S2NA 3SH9A 4DE0A 5CECA 2Y2JA 2V20A 2I72A 4KENB 1L0GA 5BOHA 4KZ7A 2HPBA 1J9MA 5CTMA 3A3EA 4S2OA 4QB8A 1WYCA 5EVIB 1K57C 5DF8A 3FKVA 4XXRA 2H0YA 4QJGA 1GCEA 1U60A 3BEBA 5M1AA 5JYOA 1GHMA 2ZLYA 2EX2A 3N8SA 1G6AA 4HEFA 1XA1A 1IELA 4OOLA 4R4RA 1YLJA 3HREA 3S4XA 2Q9MA 3DWZA 1PZOA 4N92A 4ZAMA 4OP5A 4S2PA 5FAQA 1MBLA 4OLGA 4B88A 5EPHA 1MXOA 4S2MA 1K56A 3RJUA 3G4PA 1G68A 4Z9QA 4GB7A 4M3KA 3MKEA 3BLSA 2XD1A 5KSCA 1LI0A 1K4EA 2RCXA 2VGKA 4OPQA 3C4PA 2WGVA 3M6HA 1BLHA 4K91A 4DDSA 4DXCA 2XDMA 3RXWA 1JVJA 1DJCA 4OPZA 3VP2A 3P09A 3ZG8B 3ZG0A 4N1HA 1N9BA 4QY5A 3BM6A 1FOFA 2H10A 3ZVWA 3LCEA 2P9VA 4UHUA 4FH2A 4KZAA 4WBGA 5U47A 3VP0A 1NY0A 1PWCA 4ZTKA 4ZBEA 3TSGA 1ESUA 1H5XA 3SS3A 3IF6B 2WUQA 5FA7A 4C75A 3G32A 2EX8A 1DY6A 5GLDA 2PBYA 3IWOA 2A49A 3AGDA 2Y2PA 3C7VA 5HAIA 3HUNA 1YLZA 5FQIA 4UA6A 3UY6A 3BLMA 1IYSA 4HBUA 3BFDA 1KVMA 5CGSA 4DDYA 3N4IA 2ZC4B 1LL9A 1IYOA 3E2KA 5EVIA 4BLMA 1GA9A 1M40A 3PAGA 4OQGA 5TR7A 1N4OA 4PM6A 2XH9A 3FV7A 4Q8IA 1KGGA 2UWXA 3NY4A 3IHBA 5CTNA 4OQHA 5AQ9A 2G2WA 1EI5A 3CZDA 4GNUA 1XGIA 2BG1A 3LEZA 1FQGA 5GLBA 1K57A 1I2WA 5F1GA 3MZDA 3CG5A 1C3BA 2XK1A 3WS4A 1O7EA 1K55A 2EXAA 4LV1A 4EBPA 1ZKJA 4R23A 1L0EA 2OSUA 3V5MA 4RVAA 1QMEA 2IWDA 3FYZA 3MXRA 4FCFA 1FSWA 2EXBA 2Y2KA 5FAOA 5GL9A 2CC1A 4IBRA 1MWRA 4K0XA 1EWZA 4LV3A 5L2FA 2XF3A 3ISGA 4PPRA 5DTSA 1NJ4A 4S2LA 4OPYA 1AXBA 1ESIA 1RGZA 3BFCA 1Q2QA 5M19A 1ZG4A 5F82A 2J8YA 4WYYA 3VP3A 2VGJA 5CGWA 4KG2A 1YLPA 4WELA 3ZNTA 3PBNA 3PBQA 3Q7VB 4WZ5C 4BL3A 3PBRA 1RCJA 3ZFZA 4EUZA 5FQ9A 1CEFA 1WYBA 3BFGA 4GDNA 1SKFA 1K54A 4LV2A 4WEKA 5HARA 4Y0UA 1OMEA 3C4OA 1FSYA 4DXBA 5F83A 3WRZA 3IF6A 3M2KA 1W8QA 1BLSA 1W8YA 3AGFA 3HLWA 1EROA 2HP6A 2QZ6A 1SDNA 1H8ZA 2XGNA 1KE3A 1PI5A 3DWKA 3HLDA 3IQAA 3NDGA 2JCHA 4LENA 1XXMA 1VQQA 4Y0TA 3DW0A 1L0DA 5CHJA 4EBNA 3IH9A 1Q2PA 3A3JA 4U0TA 1SHVA 5DF7A 5EOEA 5CHMA 4BJPA 1KGEA 4WM9A 4XUXA 4EWFA 4JF6A 3N8LA 4LCLA 1ALQA 1ES5A 2ZQ8A 3G2YA 5CEDA 3ZG5A 4JXGA 2Y59A 3Q81A 3HL9A 4OLDA 4PMAA 4MEZA 1E3UD 1NXYA 1ES2A 1PWDA 4HESA 5DF9A 1JTGA 4N1XA 5M18A 1WE4A 4FD8A 2XQZA 1YLTA 1K6SA 3BRMA 3OCLA 2EX9A 1LLBA 3WS1A 5TGFA 3GMWA 1L2SA 1HD8A 1K6RA 3SH8A 3HVFA 3N6IA 5A91A 1JWZA 3G2ZA 2PU4A 4WZ4A 5G18A 4E3OA 1MWUA 4X53A 4LV0A 4DE3A 1IYQA 3UPPA 3ZVTA 4E3IA 1TEMA 1QMFA 2ZM2A 3LY3A 1I5QA 1TVFA 1LI9A 5HAQA 3QNBA 2OLVA 4GN2A 3OPLA 5KZHA 4GOGA 5FASA 1ONGA 3P98A 4Y0OA 2WZZA 5E2HA 5FI6A 3UO9A 2R9XA 2ZMAA 3IHAA 5TFQA 3SS4A 4R3BA 3HBRA 4WMCD 4D2OA 2ZQ7A 3Q7VA 2J9OA 3IWQA 2WGWB 3MKFA 4S2KA 5E2GA 2ZM0A 1LL5A 2OV5A 1S0WA 3V50A 4X55A 3CJMA 3ZHHA 3IXBA 4KZ8A 2WK0A 4DRTA 4B4XA 4BD1A 4WZ5A 5GHZA 4E6WA 4OP8A 3EQVA 4E3MA 2Y2MA 2ZC6B 1IKIA 2EFUA 3HUOA 4ZJ1A 3Q07A 5CXWA 1H8YA 3PAEA 3I7JA 1FCOA 3D4FA 3WRTA 3A3DA 3NDEA 3Q7ZA 3Q1FA 3TG9A 4OOMA 4R0QA 1E25A 1KE4A 4MBFA 4DE2A 4EV4A 4U3TA 3HLGA 1IYPA 2WKIA 4JPMA 5AQBA 5GHYA 4BL2A 3FKWA 2Z2LB 2Z2MB 3GTCA 5E2EA 5J8XA 5HFOA 4MBKA 5GLAA 5EECA 2P74A 3G34A 2QMIA 4DE1A 5FQQA 1XKZA 3UPNA 3HLCA 2RL3A 5GLCA 1FCMA 1SCWA 3BECA 3RXXA 2V2FF 3DTMA 3WS0A 3G30A 5CRFA 1NZOA 4OVDA 4O7DA 1XPBA 3BYDA 2DNSA 2C5WB 3AGEA 1KDSA 4KZ6A 3PTEA 4BQMA 1SDEA 5FQKA 3MZFA 4CPKA 4E3JA 5FQMA 4OONA 4E3KA 4JXVA 1S6RA 4JF5A 3UDIA 2JC7A 1BTLA 2J9PA 2WKHA 3FWLA 2Y91A 1Y54A 4P85A 3VOZA 3M2JA 4IVIA 4BENA 3VSKA 1ERMA 1FR6A 4YFMA 3E2LA 3C7UA 5FI2A 5FQJA 5EE8A 2WGWA 4E3NA 2ZC5B 4FH4A 1TDLA 4MBHA 4DF6A 3GV9A 4JF4A 1E4DA 1M6KA 1KVLA 4KQQA 2WGIA 1YMSA 3EQUA 4RX2A 4JLFA 3WS2A 1XP4A 1KGFA 2ZC3B 3GQZA 3NBLA 2Q9NA 4IEDA 3PBOA 3VOYA 3G31A 3IXGA 4FSFA 2XD5A 5E2FA 3UPOA 1MKIA 5FAPA 3BFFA 2XLNA 2Y2GA 2Y2QA 1YLYA 1K38A 4PM7A 3O88A 4GD8A 4OPRA 1KE0A 2X01A 2EX6A 3S1YA 3A3FA 5AQ7A 3IF5A 5FDHA 1E3UA 3ZCZA 4CJNA 3FZCA 3ZG7B 3MXSA 2EFXA 3IH8A 3ZNYA 5F1FA 1BULA 1HZOA 2WAFA 2ZQDA 3LY4A 5EVLA 2X02A 3WS5A 1HVBA 3VFHA 3ITAA 4KQOA 3LO7A 3UNWA 3NIAA 3NC8A 4IBXA 1MWSA 4ID4A 5D3OA 4OH0A 1YM1A 1K55C 4E3LA 2DCFA 5EOOA 4RYEA 2V1ZA 2ZQ9A 1XGJA 1PZPA 1BT5A 1JTDA 5FSRA 3ZDJA 1NYYA 4P0MA 2XEPA 2XFSA 4N9KA 3JYIA 4JKTA 5CHUA 2Y55A 4P6BA 2IWCA 4EQIA 1FR1A 2BLSA 2HDUA 4B4ZA 4GKUA 4X69A 4XUZA 5CGXA 5DTTA 1IKGA 4HBTA 4WMCA 4N9LA 4IVKA 3UDXA 3HLFA 3UE1A 5HW3A 3C5AA 3N7WA 3IXDA 3UE3A 2WZXA 1CEGA 4OQ0A 1K56D 1PYYA 4Y7PA 4KG6A 3Q82A 4X56A 2ZQCA 2HDSA 4MNRA 4JXSA 4KZ3A 4U0XA 3VP1A 4WEJA 2WAEA 3VSLA 5AQAA 1YT4A 2Y2NA 3IWIA 3O86A 3GVBA 2Y2HA 4GD6A 1K54C 3O3VA 2H5SA 4QY6A 1GHPA 1LHYA 5IHVA 4A5RA 4E6XA 5I94A 2G2UA 5FI7A 1ERQA 2XFTA 2ZM8A 3QNCA 3WWXA 3IF6C 2R9WA 2IWBA 4S2NC 5DTKA 5CEBA 5E43A 1NYMA 5KMWA 4F94A 4ZJ3A 3VMAA 1PW8A 4P87A 1ES4A 5HAPA 3A3IA 3BFEA 1MPLA 3W4OA 4R4SA 4X6TA 3G35A 2B5RA 5CERA 2Y4AA 3PBTA 4R3JA 3VFFA 3CMZA 2FFFB 1K25A 4EBLA 4GZBA 3V3RA 2Y2OA 4JBFA 4L0LA 5EUAA 3S22A 3W4PA 4ZDXA 3M6BA 4UA9A 4ZJ2A 2ZD8A 1BUEA 4KZBA 3ITBA 2A3UA 4PM9A 1CI8A 2Y2LA 1CK3A 3UN7A 3W8KA 1YQSA 2J7VA 4RA7A 1JWPA 2HDRA 2DRWA 4KZ9A 1PIOA 1W5DA 3N8RA 3VP4A 4OKPA 4BD0A 1PI4A 3TOIA 3HLBA 2C6WB 4OQIA 3HLEA 4GDBA 4KZ4A 5EVID 2JBFA 3B3XA 2ZQAA 4S2IA 2FFYA 2PU2A 3OPHA 2HP9A 5GHXA 4K0WA 5A90A 1BZAA 1ONHA 1TDGA 1MY8A 1VM1A 3HUMA 2Y2IA 1HTZA 1BSGA 1W7FA 3OPRA 5HL1A 1BLPA 2GDNA 5JYPA 1PW1A 4JXWA 4RX3A 3MZEA 4C3QA 3UE0A 3ZGAB 4PM5A 4YINA 3V39A 1ES3A 1O07A 1YLWA 3ZG9B 1ZC2A 2HDQA 1YMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C6Y A;  5A92 A;  1W79 A;  4LCM A;  2WYX A;  2X71 A;  1GHI A;  1PWG A;  3V3S A;  1Z6F A;  3MFD A;  4H8R A;  3SS5 A;  2QPN A;  3W4Q A;  4QD4 A;  3SOI A;  1ZG6 A;  3OZH A;  2HP5 A;  3GRJ A;  3NI9 A;  1BLC A;  2E8I A;  5FAT A;  4KZ5 A;  3SH7 A;  2ZC7 A;  3IXH A;  4QU3 A;  1DJA A;  2P9V B;  2OLU A;  2ZJ9 A;  4UAA A;  4QHC A;  3OCN A;  4KG5 A;  3GSG A;  1K4F A;  1XX2 A;  1L0F A;  1MWT A;  4PM8 A;  4R1G A;  3UDF A;  1CI9 A;  1RP5 A;  1IEM A;  3GR2 A;  3OPP A;  3OC2 A;  1GA0 A;  4UA7 A;  2JE5 A;  1RGY A;  1KDW A;  1XA7 A;  1DJB A;  1I2S A;  4S2J A;  4NET A;  3IT9 A;  1NRF A;  1FCN A;  3NCK A;  4KQR A;  2XR0 A;  4DKI A;  5KSH A;  4MLL A;  5DVA A;  1NZU A;  2WKE A;  4OOY A;  2H0T A;  3MBZ A;  3QHY A;  4X68 A;  5HX9 A;  2WAD A;  1JWV A;  3O87 A;  5EVI C;  4NK3 A;  3PBS A;  5A93 A;  4S2N A;  3SH9 A;  4DE0 A;  5CEC A;  2Y2J A;  2V20 A;  2I72 A;  4KEN B;  1L0G A;  5BOH A;  4KZ7 A;  2HPB A;  1J9M A;  5CTM A;  3A3E A;  4S2O A;  4QB8 A;  1WYC A;  5EVI B;  1K57 C;  5DF8 A;  3FKV A;  4XXR A;  2H0Y A;  4QJG A;  1GCE A;  1U60 A;  3BEB A;  5M1A A;  5JYO A;  1GHM A;  2ZLY A;  2EX2 A;  3N8S A;  1G6A A;  4HEF A;  1XA1 A;  1IEL A;  4OOL A;  4R4R A;  1YLJ A;  3HRE A;  3S4X A;  2Q9M A;  3DWZ A;  1PZO A;  4N92 A;  4ZAM A;  4OP5 A;  4S2P A;  5FAQ A;  1MBL A;  4OLG A;  4B88 A;  5EPH A;  1MXO A;  4S2M A;  1K56 A;  3RJU A;  3G4P A;  1G68 A;  4Z9Q A;  4GB7 A;  4M3K A;  3MKE A;  3BLS A;  2XD1 A;  5KSC A;  1LI0 A;  1K4E A;  2RCX A;  2VGK A;  4OPQ A;  3C4P A;  2WGV A;  3M6H A;  1BLH A;  4K91 A;  4DDS A;  4DXC A;  2XDM A;  3RXW A;  1JVJ A;  1DJC A;  4OPZ A;  3VP2 A;  3P09 A;  3ZG8 B;  3ZG0 A;  4N1H A;  1N9B A;  4QY5 A;  3BM6 A;  1FOF A;  2H10 A;  3ZVW A;  3LCE A;  2P9V A;  4UHU A;  4FH2 A;  4KZA A;  4WBG A;  5U47 A;  3VP0 A;  1NY0 A;  1PWC A;  4ZTK A;  4ZBE A;  3TSG A;  1ESU A;  1H5X A;  3SS3 A;  3IF6 B;  2WUQ A;  5FA7 A;  4C75 A;  3G32 A;  2EX8 A;  1DY6 A;  5GLD A;  2PBY A;  3IWO A;  2A49 A;  3AGD A;  2Y2P A;  3C7V A;  5HAI A;  3HUN A;  1YLZ A;  5FQI A;  4UA6 A;  3UY6 A;  3BLM A;  1IYS A;  4HBU A;  3BFD A;  1KVM A;  5CGS A;  4DDY A;  3N4I A;  2ZC4 B;  1LL9 A;  1IYO A;  3E2K A;  5EVI A;  4BLM A;  1GA9 A;  1M40 A;  3PAG A;  4OQG A;  5TR7 A;  1N4O A;  4PM6 A;  2XH9 A;  3FV7 A;  4Q8I A;  1KGG A;  2UWX A;  3NY4 A;  3IHB A;  5CTN A;  4OQH A;  5AQ9 A;  2G2W A;  1EI5 A;  3CZD A;  4GNU A;  1XGI A;  2BG1 A;  3LEZ A;  1FQG A;  5GLB A;  1K57 A;  1I2W A;  5F1G A;  3MZD A;  3CG5 A;  1C3B A;  2XK1 A;  3WS4 A;  1O7E A;  1K55 A;  2EXA A;  4LV1 A;  4EBP A;  1ZKJ A;  4R23 A;  1L0E A;  2OSU A;  3V5M A;  4RVA A;  1QME A;  2IWD A;  3FYZ A;  3MXR A;  4FCF A;  1FSW A;  2EXB A;  2Y2K A;  5FAO A;  5GL9 A;  2CC1 A;  4IBR A;  1MWR A;  4K0X A;  1EWZ A;  4LV3 A;  5L2F A;  2XF3 A;  3ISG A;  4PPR A;  5DTS A;  1NJ4 A;  4S2L A;  4OPY A;  1AXB A;  1ESI A;  1RGZ A;  3BFC A;  1Q2Q A;  5M19 A;  1ZG4 A;  5F82 A;  2J8Y A;  4WYY A;  3VP3 A;  2VGJ A;  5CGW A;  4KG2 A;  1YLP A;  4WEL A;  3ZNT A;  3PBN A;  3PBQ A;  3Q7V B;  4WZ5 C;  4BL3 A;  3PBR A;  1RCJ A;  3ZFZ A;  4EUZ A;  5FQ9 A;  1CEF A;  1WYB A;  3BFG A;  4GDN A;  1SKF A;  1K54 A;  4LV2 A;  4WEK A;  5HAR A;  4Y0U A;  1OME A;  3C4O A;  1FSY A;  4DXB A;  5F83 A;  3WRZ A;  3IF6 A;  3M2K A;  1W8Q A;  1BLS A;  1W8Y A;  3AGF A;  3HLW A;  1ERO A;  2HP6 A;  2QZ6 A;  1SDN A;  1H8Z A;  2XGN A;  1KE3 A;  1PI5 A;  3DWK A;  3HLD A;  3IQA A;  3NDG A;  2JCH A;  4LEN A;  1XXM A;  1VQQ A;  4Y0T A;  3DW0 A;  1L0D A;  5CHJ A;  4EBN A;  3IH9 A;  1Q2P A;  3A3J A;  4U0T A;  1SHV A;  5DF7 A;  5EOE A;  5CHM A;  4BJP A;  1KGE A;  4WM9 A;  4XUX A;  4EWF A;  4JF6 A;  3N8L A;  4LCL A;  1ALQ A;  1ES5 A;  2ZQ8 A;  3G2Y A;  5CED A;  3ZG5 A;  4JXG A;  2Y59 A;  3Q81 A;  3HL9 A;  4OLD A;  4PMA A;  4MEZ A;  1E3U D;  1NXY A;  1ES2 A;  1PWD A;  4HES A;  5DF9 A;  1JTG A;  4N1X A;  5M18 A;  1WE4 A;  4FD8 A;  2XQZ A;  1YLT A;  1K6S A;  3BRM A;  3OCL A;  2EX9 A;  1LLB A;  3WS1 A;  5TGF A;  3GMW A;  1L2S A;  1HD8 A;  1K6R A;  3SH8 A;  3HVF A;  3N6I A;  5A91 A;  1JWZ A;  3G2Z A;  2PU4 A;  4WZ4 A;  5G18 A;  4E3O A;  1MWU A;  4X53 A;  4LV0 A;  4DE3 A;  1IYQ A;  3UPP A;  3ZVT A;  4E3I A;  1TEM A;  1QMF A;  2ZM2 A;  3LY3 A;  1I5Q A;  1TVF A;  1LI9 A;  5HAQ A;  3QNB A;  2OLV A;  4GN2 A;  3OPL A;  5KZH A;  4GOG A;  5FAS A;  1ONG A;  3P98 A;  4Y0O A;  2WZZ A;  5E2H A;  5FI6 A;  3UO9 A;  2R9X A;  2ZMA A;  3IHA A;  5TFQ A;  3SS4 A;  4R3B A;  3HBR A;  4WMC D;  4D2O A;  2ZQ7 A;  3Q7V A;  2J9O A;  3IWQ A;  2WGW B;  3MKF A;  4S2K A;  5E2G A;  2ZM0 A;  1LL5 A;  2OV5 A;  1S0W A;  3V50 A;  4X55 A;  3CJM A;  3ZHH A;  3IXB A;  4KZ8 A;  2WK0 A;  4DRT A;  4B4X A;  4BD1 A;  4WZ5 A;  5GHZ A;  4E6W A;  4OP8 A;  3EQV A;  4E3M A;  2Y2M A;  2ZC6 B;  1IKI A;  2EFU A;  3HUO A;  4ZJ1 A;  3Q07 A;  5CXW A;  1H8Y A;  3PAE A;  3I7J A;  1FCO A;  3D4F A;  3WRT A;  3A3D A;  3NDE A;  3Q7Z A;  3Q1F A;  3TG9 A;  4OOM A;  4R0Q A;  1E25 A;  1KE4 A;  4MBF A;  4DE2 A;  4EV4 A;  4U3T A;  3HLG A;  1IYP A;  2WKI A;  4JPM A;  5AQB A;  5GHY A;  4BL2 A;  3FKW A;  2Z2L B;  2Z2M B;  3GTC A;  5E2E A;  5J8X A;  5HFO A;  4MBK A;  5GLA A;  5EEC A;  2P74 A;  3G34 A;  2QMI A;  4DE1 A;  5FQQ A;  1XKZ A;  3UPN A;  3HLC A;  2RL3 A;  5GLC A;  1FCM A;  1SCW A;  3BEC A;  3RXX A;  2V2F F;  3DTM A;  3WS0 A;  3G30 A;  5CRF A;  1NZO A;  4OVD A;  4O7D A;  1XPB A;  3BYD A;  2DNS A;  2C5W B;  3AGE A;  1KDS A;  4KZ6 A;  3PTE A;  4BQM A;  1SDE A;  5FQK A;  3MZF A;  4CPK A;  4E3J A;  5FQM A;  4OON A;  4E3K A;  4JXV A;  1S6R A;  4JF5 A;  3UDI A;  2JC7 A;  1BTL A;  2J9P A;  2WKH A;  3FWL A;  2Y91 A;  1Y54 A;  4P85 A;  3VOZ A;  3M2J A;  4IVI A;  4BEN A;  3VSK A;  1ERM A;  1FR6 A;  4YFM A;  3E2L A;  3C7U A;  5FI2 A;  5FQJ A;  5EE8 A;  2WGW A;  4E3N A;  2ZC5 B;  4FH4 A;  1TDL A;  4MBH A;  4DF6 A;  3GV9 A;  4JF4 A;  1E4D A;  1M6K A;  1KVL A;  4KQQ A;  2WGI A;  1YMS A;  3EQU A;  4RX2 A;  4JLF A;  3WS2 A;  1XP4 A;  1KGF A;  2ZC3 B;  3GQZ A;  3NBL A;  2Q9N A;  4IED A;  3PBO A;  3VOY A;  3G31 A;  3IXG A;  4FSF A;  2XD5 A;  5E2F A;  3UPO A;  1MKI A;  5FAP A;  3BFF A;  2XLN A;  2Y2G A;  2Y2Q A;  1YLY A;  1K38 A;  4PM7 A;  3O88 A;  4GD8 A;  4OPR A;  1KE0 A;  2X01 A;  2EX6 A;  3S1Y A;  3A3F A;  5AQ7 A;  3IF5 A;  5FDH A;  1E3U A;  3ZCZ A;  4CJN A;  3FZC A;  3ZG7 B;  3MXS A;  2EFX A;  3IH8 A;  3ZNY A;  5F1F A;  1BUL A;  1HZO A;  2WAF A;  2ZQD A;  3LY4 A;  5EVL A;  2X02 A;  3WS5 A;  1HVB A;  3VFH A;  3ITA A;  4KQO A;  3LO7 A;  3UNW A;  3NIA A;  3NC8 A;  4IBX A;  1MWS A;  4ID4 A;  5D3O A;  4OH0 A;  1YM1 A;  1K55 C;  4E3L A;  2DCF A;  5EOO A;  4RYE A;  2V1Z A;  2ZQ9 A;  1XGJ A;  1PZP A;  1BT5 A;  1JTD A;  5FSR A;  3ZDJ A;  1NYY A;  4P0M A;  2XEP A;  2XFS A;  4N9K A;  3JYI A;  4JKT A;  5CHU A;  2Y55 A;  4P6B A;  2IWC A;  4EQI A;  1FR1 A;  2BLS A;  2HDU A;  4B4Z A;  4GKU A;  4X69 A;  4XUZ A;  5CGX A;  5DTT A;  1IKG A;  4HBT A;  4WMC A;  4N9L A;  4IVK A;  3UDX A;  3HLF A;  3UE1 A;  5HW3 A;  3C5A A;  3N7W A;  3IXD A;  3UE3 A;  2WZX A;  1CEG A;  4OQ0 A;  1K56 D;  1PYY A;  4Y7P A;  4KG6 A;  3Q82 A;  4X56 A;  2ZQC A;  2HDS A;  4MNR A;  4JXS A;  4KZ3 A;  4U0X A;  3VP1 A;  4WEJ A;  2WAE A;  3VSL A;  5AQA A;  1YT4 A;  2Y2N A;  3IWI A;  3O86 A;  3GVB A;  2Y2H A;  4GD6 A;  1K54 C;  3O3V A;  2H5S A;  4QY6 A;  1GHP A;  1LHY A;  5IHV A;  4A5R A;  4E6X A;  5I94 A;  2G2U A;  5FI7 A;  1ERQ A;  2XFT A;  2ZM8 A;  3QNC A;  3WWX A;  3IF6 C;  2R9W A;  2IWB A;  4S2N C;  5DTK A;  5CEB A;  5E43 A;  1NYM A;  5KMW A;  4F94 A;  4ZJ3 A;  3VMA A;  1PW8 A;  4P87 A;  1ES4 A;  5HAP A;  3A3I A;  3BFE A;  1MPL A;  3W4O A;  4R4S A;  4X6T A;  3G35 A;  2B5R A;  5CER A;  2Y4A A;  3PBT A;  4R3J A;  3VFF A;  3CMZ A;  2FFF B;  1K25 A;  4EBL A;  4GZB A;  3V3R A;  2Y2O A;  4JBF A;  4L0L A;  5EUA A;  3S22 A;  3W4P A;  4ZDX A;  3M6B A;  4UA9 A;  4ZJ2 A;  2ZD8 A;  1BUE A;  4KZB A;  3ITB A;  2A3U A;  4PM9 A;  1CI8 A;  2Y2L A;  1CK3 A;  3UN7 A;  3W8K A;  1YQS A;  2J7V A;  4RA7 A;  1JWP A;  2HDR A;  2DRW A;  4KZ9 A;  1PIO A;  1W5D A;  3N8R A;  3VP4 A;  4OKP A;  4BD0 A;  1PI4 A;  3TOI A;  3HLB A;  2C6W B;  4OQI A;  3HLE A;  4GDB A;  4KZ4 A;  5EVI D;  2JBF A;  3B3X A;  2ZQA A;  4S2I A;  2FFY A;  2PU2 A;  3OPH A;  2HP9 A;  5GHX A;  4K0W A;  5A90 A;  1BZA A;  1ONH A;  1TDG A;  1MY8 A;  1VM1 A;  3HUM A;  2Y2I A;  1HTZ A;  1BSG A;  1W7F A;  3OPR A;  5HL1 A;  1BLP A;  2GDN A;  5JYP A;  1PW1 A;  4JXW A;  4RX3 A;  3MZE A;  4C3Q A;  3UE0 A;  3ZGA B;  4PM5 A;  4YIN A;  3V39 A;  1ES3 A;  1O07 A;  1YLW A;  3ZG9 B;  1ZC2 A;  2HDQ A;  1YMX A; 
#chains in the Genus database with same CATH topology
 2PYP A;  4LCM A;  3NHQ A;  3G6O A;  3SS5 A;  4QD4 A;  3OZH A;  2E8I A;  5FAT A;  4KZ5 A;  3QP8 A;  3IXH A;  2ZJ9 A;  2OLU A;  3PHY A;  1K0K A;  1L0F A;  4PM8 A;  1RP5 A;  4UA7 A;  1RGY A;  1KDW A;  4S2J A;  3IT9 A;  4KQR A;  2XR0 A;  3UB9 A;  2H0T A;  3U2A A;  3QHY A;  2GX5 A;  1DP9 A;  1CJF A;  4NK3 A;  5A93 A;  3SH9 A;  5CEC A;  1DP8 A;  3C8C A;  4KZ7 A;  2HPB A;  1J9M A;  2EA9 A;  3A3E A;  3KYQ A;  1K57 C;  5AJG A;  5DF8 A;  3FKV A;  4QJG A;  1U60 A;  5M1A A;  5JYO A;  1H3Q A;  2EX2 A;  4R4R A;  1YLJ A;  3HRE A;  4XT2 B;  4ZRR A;  3S4X A;  4GW9 A;  3DWZ A;  4UQI M;  4OP5 A;  3K2N A;  4S2M A;  2VX8 A;  3LIA A;  1LSW A;  4M3K A;  5KSC A;  4R70 A;  3H82 A;  3JVV A;  2VGK A;  2CMN A;  1BLH A;  4DDS A;  3MFX A;  5MC7 A;  3D72 A;  4DXC A;  3RXW A;  3T1R A;  3ZG0 A;  1N9B A;  4HP4 A;  4DN0 A;  5FL3 A;  4ZBE A;  2W27 A;  1S67 L;  1FIK A;  2FZ0 A;  4CQH A;  3G32 A;  5GLD A;  2PBY A;  4ETX A;  1YLZ A;  1LL8 A;  3UY6 A;  4YOF A;  3BFD A;  4DDY A;  1OPX A;  4L9G A;  4O0P A;  5EVI A;  1WA9 A;  4HJ3 A;  4BLM A;  1GA9 A;  3PAG A;  1N4O A;  2XH9 A;  5CTN A;  4OQH A;  4Y13 A;  1ACF A;  2BG1 A;  4EU0 A;  1I2W A;  1SKO A;  3MZD A;  2B95 A;  3WS4 A;  2W1R A;  4EBP A;  2HJE A;  3V5M A;  2IWD A;  3FPW A;  3LR5 A;  2Y2K A;  2V0W A;  4F3L B;  3ISG A;  5DTS A;  1NJ4 A;  4S2L A;  1ESI A;  3BFC A;  1Q2Q A;  5F82 A;  4L9F A;  2VGJ A;  4R38 A;  5CGW A;  3PBN A;  1NLZ A;  4BL3 A;  3PBR A;  4CLC E;  3MQO A;  5HDC A;  3BFG A;  2JN7 A;  4GJ4 A;  3HJK A;  5DFX A;  1SKF A;  1K54 A;  4LV2 A;  4WEK A;  4Y0U A;  2JKT M;  3B47 A;  4NEE D;  3T4O A;  3WRZ A;  1W8Q A;  1ERO A;  2DMW A;  4D60 A;  1SDN A;  1H8Z A;  1T18 A;  3H7W B;  1VQQ A;  2OAP 1;  1OTB A;  5DF7 A;  5CHM A;  1OTD A;  2PR5 A;  1F98 A;  4LCL A;  1ES5 A;  2QKP A;  2O9B A;  1SKO B;  2Y59 A;  4PMA A;  1NXY A;  1PWD A;  4ESP A;  2JKG A;  5DF9 A;  4FD8 A;  2KX6 A;  1YLT A;  3OCL A;  3S7P A;  1LLB A;  3LI8 A;  1YPR A;  5A91 A;  1JWZ A;  4E3O A;  1MWU A;  1OT9 A;  4X53 A;  4LV0 A;  4KUO A;  4E3I A;  1VEU A;  2IA2 A;  3QNB A;  5A8B A;  3P7N A;  5FI6 A;  3SS4 A;  2J9O A;  3IWQ A;  2WGW B;  4B4X A;  4NXF A;  4WZ5 A;  5GHZ A;  1CF0 A;  4E6W A;  1UWN X;  4OP8 A;  4MCW A;  3MMH A;  5CXW A;  3I7J A;  3C30 A;  3D4F A;  3MQQ A;  3Q1F A;  4OOM A;  4R0Q A;  1KE4 A;  4MBF A;  4DE2 A;  1IYP A;  1D1J A;  1JNU A;  5GLA A;  1PNE A;  2VA0 A;  2P74 A;  3G34 A;  2QMI A;  5AVF A;  4NKP A;  1W63 M;  3HLC A;  5DJT A;  3BJN A;  5L09 A;  1YSP A;  1FCM A;  3U4L P;  3L7H A;  4H6J A;  3RXX A;  1S1Y A;  4Y5F A;  1NWZ A;  4O7D A;  2HF6 A;  2V0U A;  5F5Y A;  3S7O A;  5FQM A;  4OON A;  3UDI A;  3E4Q A;  2WKH A;  2YKH A;  2Y91 A;  1Y54 A;  3A0S A;  3M2J A;  4BEN A;  3VSK A;  3SZT A;  5FI2 A;  4E3N A;  4FH4 A;  1TDL A;  3QP6 A;  1S4S A;  2W3D A;  3EQU A;  2ZC3 B;  4I39 A;  2P7J A;  1UWP X;  1TD5 A;  3GQZ A;  2Q9N A;  3NBL A;  1D06 A;  3PBO A;  4IED A;  3G31 A;  3IXG A;  3UPO A;  1ZHH B;  2Y2G A;  2P04 A;  2VGL M;  1YLY A;  2Y2Q A;  4PM7 A;  4GD8 A;  3MF0 A;  2EX6 A;  2Z6C A;  3A3F A;  5AQ7 A;  5FDH A;  1E3U A;  3C38 A;  1SZV A;  3ZNY A;  5F1F A;  2VZW A;  2X02 A;  3VFH A;  4H6J B;  2XA7 S;  4IBX A;  1MWS A;  4E3L A;  2DCF A;  4RYE A;  1JTD A;  2B02 A;  3ZDJ A;  2EWW A;  1STZ A;  4P0M A;  2XEP A;  3KSF A;  5IT5 A;  4P6B A;  3OBF A;  2IWC A;  4NXB A;  4EQI A;  2BLS A;  3QP4 A;  3A0V A;  4GKU A;  1Z09 A;  4WMC A;  4N9L A;  3UE1 A;  3C5A A;  3UE3 A;  5HZH A;  1CEG A;  4OQ0 A;  1PYY A;  5J7E A;  2ZL1 A;  5HD5 A;  2ZQC A;  4KZ3 A;  4U0X A;  2OWH A;  2Y2N A;  3GVB A;  4GD6 A;  1K54 C;  1GHP A;  3LYX A;  5I94 A;  2XFT A;  2ZM8 A;  3WWX A;  5CEB A;  3GDI A;  4WLA A;  4MMN A;  5J3W A;  1AWI A;  4FUW A;  3PBT A;  1LSV A;  3CMZ A;  4EBL A;  4JBF A;  4L0L A;  4JGQ A;  1VET A;  3M6B A;  4ZJ2 A;  4KZB A;  4PM9 A;  3EGD C;  3CAX A;  3IX8 A;  2DRW A;  3N8R A;  3T1Q B;  3TOI A;  4YNR A;  3HLB A;  4X25 A;  4KZ4 A;  5DFY A;  2FFY A;  2PU2 A;  1BZA A;  5C5K A;  2Y2I A;  2H28 A;  3OPR A;  5HL1 A;  4I38 A;  1BLP A;  3T4L A;  4YIN A;  1O07 A;  4JGO A;  5A92 A;  2X71 A;  3UB8 A;  3V3S A;  3MFD A;  2QPN A;  3F1P B;  2W3F A;  2HP5 A;  2QYB A;  2ZC7 A;  1DJA A;  2P9V B;  4UAA A;  3HJI A;  2O9A A;  1PFL A;  2VKS A;  1XA7 A;  1J3W A;  1FCN A;  4DKI A;  3T4J A;  2K7S A;  5KSH A;  4MLL A;  5DVA A;  5HX9 A;  3LFV A;  1JWV A;  3KSG A;  1Y28 A;  2V20 A;  4KEN B;  3IS2 B;  5BOH A;  3OOV A;  3VOL A;  4I3I A;  5TBM A;  2H0Y A;  2B18 A;  3BEB A;  3CWF A;  2QWS A;  1XA1 A;  1IEL A;  4OOL A;  1NLY A;  3RTY A;  3MR0 A;  3V67 A;  1PZO A;  4N92 A;  4ZAM A;  3QP2 A;  2JKT I;  2HGV A;  5EPH A;  1MXO A;  3RJU A;  4Z9Q A;  4GB7 A;  3NOP C;  1LI0 A;  2RCX A;  4OPQ A;  3EEA A;  3M6H A;  2QJ5 A;  4K91 A;  4BBV A;  1T1B A;  2Q0O A;  4GS9 A;  4N1H A;  4CLC D;  2H10 A;  3ZVW A;  3LCE A;  4FH2 A;  4KZA A;  4WBG A;  3R7W A;  5U47 A;  2VJW A;  3VP0 A;  3T50 A;  2PD8 A;  1F2K A;  2EX8 A;  3AGD A;  5HAI A;  5TBM B;  4UA6 A;  3BLM A;  1IYS A;  5CGS A;  1IYO A;  3F1O B;  3A0R A;  4PM6 A;  1KGG A;  2UWX A;  3NY4 A;  1P9W A;  1LT0 A;  5AQ9 A;  4B9O A;  2G2W A;  3CZD A;  5EM1 A;  3ZQ5 A;  1XGI A;  4XT2 A;  1C3B A;  1K55 A;  4LV1 A;  4GLQ A;  4R23 A;  1L0E A;  4CLC C;  4FCF A;  1FSW A;  3B42 A;  2P08 A;  4GS9 B;  4DMZ A;  1ZG4 A;  1YAX A;  2HJ9 C;  3R7W B;  3VP3 A;  1PRQ A;  4KG2 A;  4WEL A;  3KSH A;  4EUZ A;  3T1X A;  5FQ9 A;  1IOU A;  5F83 A;  3M2K A;  5HSQ A;  3HLW A;  1DRM A;  1KE3 A;  1NRJ A;  1PI5 A;  1TS8 A;  3DWK A;  3HLD A;  3NDG A;  5HDS A;  3MSH A;  1XXM A;  1Y4O A;  1CQA A;  1L0D A;  1Q2P A;  3A3J A;  4U0T A;  5EOE A;  1TS0 A;  4BJP A;  3E4P A;  1KGE A;  4LPZ A;  3CI6 A;  2E8J A;  2ZQ8 A;  5CED A;  4JXG A;  2V8F A;  5TJJ A;  4HES A;  4N1X A;  5M18 A;  1WE4 A;  1T19 A;  3DTK A;  3E4O A;  1G28 A;  3MJQ A;  2W3H A;  5TGF A;  3GMW A;  3EGX C;  4I3A A;  3SH8 A;  1GSV A;  4WZ4 A;  4F3L A;  1VB6 A;  2ZM2 A;  3LY3 A;  3LR4 A;  1TVF A;  1V9Z A;  5HAQ A;  1XFN A;  4II7 A;  5KZH A;  3LIC A;  5FAS A;  3P98 A;  3PR6 A;  3IHA A;  4D2O A;  4S2K A;  2Y79 A;  2OV5 A;  3CJM A;  3IXB A;  2WK0 A;  1OTI A;  5HL6 A;  4BD1 A;  3CHW P;  3EQV A;  2Y2M A;  2EFU A;  3Q07 A;  4IJG A;  2ZOH A;  2W0N A;  3H7W A;  3WRT A;  3NDE A;  4LFU A;  4BBT A;  3TG9 A;  1E25 A;  3HLG A;  4JPM A;  3FKW A;  3LR0 A;  2Z2M B;  5HFO A;  4MBK A;  5EEC A;  4DE1 A;  5FQQ A;  1XKZ A;  3ULF A;  1A0K A;  2RL3 A;  1SCW A;  3DTM A;  3WS0 A;  4OVD A;  3BYD A;  2C5W B;  3AGE A;  1KDS A;  4KZ6 A;  3CUE A;  4MN6 A;  1SDE A;  5FQK A;  1G5U A;  2INW A;  1S6R A;  4JF5 A;  3VOZ A;  3CPT B;  4IVI A;  3E2L A;  3CLO A;  2WGW A;  4MBH A;  4JF4 A;  5DJU A;  1XJ4 A;  4KQQ A;  4JLF A;  3WS2 A;  4HH3 A;  4BWI A;  2XLN A;  4BMW A;  2K2N A;  3LEQ A;  1KOU A;  3ZCZ A;  3FZC A;  3IBJ A;  3ZG7 B;  5HWV A;  3IH8 A;  4Y3I A;  2WAF A;  5EVL A;  4LRX C;  3KSI A;  3TJZ C;  3QP5 A;  3ITA A;  3FPV A;  3NC8 A;  1YM1 A;  1K55 C;  1PZP A;  1BT5 A;  2A2L A;  1OJ5 A;  2O99 A;  4X69 A;  5DTT A;  5F6A A;  1IFQ A;  4HBT A;  5EVE A;  5HW3 A;  4Y17 A;  3HLF A;  3ICY A;  4MNR A;  4WEJ A;  2WAE A;  4P6Z M;  2VV8 A;  1YT4 A;  4NG2 A;  2H5S A;  4QY6 A;  1LHY A;  4HOI A;  2VEA A;  4A5R A;  4E6X A;  1MKM A;  5HPI A;  3QNC A;  5DTK A;  4Q0J A;  4F94 A;  3BFE A;  4X6T A;  2B5R A;  4M4X A;  2Y4A A;  2FH5 A;  2WKQ A;  4GZB A;  2Y2O A;  3S22 A;  5EUA A;  3W4P A;  2ZD8 A;  1BUE A;  4PHT A;  5EFW A;  2Y2L A;  2HZ5 A;  3W8K A;  4RA7 A;  5F69 A;  5IS1 A;  1W5D A;  2C6W B;  1LSX A;  4OQI A;  3HLE A;  3T4S A;  5EVI D;  2JBF A;  3B3X A;  5A90 A;  1S4R A;  3IX4 A;  1W7F A;  2J3W A;  4JXW A;  4RX3 A;  3UE0 A;  3ZGA B;  2PBD P;  3V39 A;  5F68 A;  4EEU A;  1YLW A;  1ZC2 A;  2HDQ A;  4C6Y A;  4O8G A;  3C2W A;  2WYX A;  3DAV A;  1PWG A;  3NI9 A;  4QU3 A;  4UQI S;  4QHC A;  4KG5 A;  3GSG A;  1XX2 A;  3UDF A;  1GA0 A;  4NET A;  1ODV A;  1NRF A;  2WKE A;  4OOY A;  4WF0 A;  3MBZ A;  4X68 A;  5EVI C;  4S2N A;  3BQ8 A;  5HDD A;  2Y2J A;  2I72 A;  3DTE A;  5CTM A;  1WYC A;  3UB5 P;  4XXR A;  1OTE A;  3LIB A;  3LID A;  1H8M A;  3N8S A;  4HH2 A;  1G6A A;  2OAQ 1;  1G6O A;  3NEC A;  5FAQ A;  4S2P A;  1S1Z A;  3EEH A;  2HV1 A;  4B88 A;  4E04 A;  1K56 A;  3G4P A;  1G68 A;  3MKE A;  2XD1 A;  2VK3 A;  3MS6 A;  1ZTU A;  5EV0 A;  3VP2 A;  3F1P A;  2O0Y A;  3P09 A;  3ZG8 B;  4QY5 A;  5L8M A;  2A24 B;  2P9V A;  1PWC A;  1H5X A;  3SS3 A;  3IF6 B;  4PKY G;  2WUQ A;  2V1A A;  1DY6 A;  2A49 A;  2Y2P A;  3HUN A;  3NUL A;  5FQI A;  1L3L A;  1P9R A;  4HBU A;  1KVM A;  3IS2 A;  3N4I A;  1N9L A;  4LRZ E;  1M40 A;  3FV7 A;  2M7U A;  3IHB A;  4GNU A;  2L1M A;  1FQG A;  5GLB A;  1K57 A;  2D01 A;  4HJ6 A;  5F1G A;  1MC0 A;  3LI9 A;  2XK1 A;  1O7E A;  1ZKJ A;  4RVA A;  1QME A;  3MXR A;  3S7N A;  4IBR A;  1MWR A;  4K0X A;  3FG8 A;  2XF3 A;  2PT7 A;  4CLC B;  1FIL A;  4PPR A;  4HHD A;  4OPY A;  1RGZ A;  5I5L A;  4WYY A;  1YLP A;  3PBQ A;  3Q7V B;  4WZ5 C;  3ZFZ A;  2JKF A;  1CEF A;  1WYB A;  4GDN A;  1HLU P;  4RQ9 A;  5HAR A;  3BY8 A;  1FSY A;  3JVU A;  4DXB A;  2OOL A;  3UB7 A;  1BLS A;  2QZ6 A;  2XGN A;  2EWV A;  3T4T A;  3IQA A;  3LGO A;  5CHJ A;  4Z1W A;  4EBN A;  3IH9 A;  1SHV A;  2W3G A;  3F1O A;  4WM9 A;  1ALQ A;  3CIT A;  2ZBB A;  3GEC A;  1E3U D;  4MEZ A;  5KIZ A;  1ES2 A;  1JTG A;  2L4R A;  4ARZ B;  3DTI A;  3LR3 A;  4WUJ A;  3FC7 A;  3L9K A;  1K6S A;  2UV0 E;  3BW6 A;  2J3T D;  3VE4 A;  3HVF A;  3N6I A;  4EUV A;  4DE3 A;  2NUT C;  3UPP A;  3ZVT A;  4G3V A;  1TEM A;  3D3O A;  2VV6 A;  3VE3 A;  1LI9 A;  2OLV A;  3P01 A;  1ONG A;  2WZZ A;  5E2H A;  3UO9 A;  2R9X A;  5TFQ A;  3HBR A;  4WMC D;  2ZQ7 A;  2M1C A;  5E2G A;  2ZM0 A;  1LL5 A;  3K3C A;  4X55 A;  3ZHH A;  5HWW A;  2V1B A;  4DRT A;  4E3M A;  4KQD A;  2ZC6 B;  3PAE A;  4G3K A;  1OTA A;  5DKK A;  1FCO A;  1EW0 A;  3A3D A;  4U3T A;  5AQB A;  4BL2 A;  2J3T C;  2BAS A;  5E2E A;  2ZOI A;  5J8X A;  2ZMF A;  1TF1 A;  2D02 A;  3UPN A;  4DJ3 A;  2V2F F;  2VGL S;  1NZO A;  4FOF A;  3PTE A;  4BQM A;  3EWK A;  4CPK A;  4IUH A;  3JPU A;  2JC7 A;  1X0O A;  3FWL A;  4P85 A;  1ERM A;  4YFM A;  3C7U A;  5FQJ A;  4DF6 A;  1M6K A;  1KVL A;  1YMS A;  4HY8 A;  1XP4 A;  1KGF A;  2JHE A;  3VOY A;  4FSF A;  2XD5 A;  5L10 A;  4YWZ A;  4MN7 A;  1MKI A;  3BFF A;  3IX3 A;  1H0M A;  1K38 A;  4OPR A;  4Y2F A;  3IF5 A;  4CJN A;  4G3W A;  2EFX A;  2LB9 A;  2ZQD A;  3LY4 A;  1HVB A;  1N9N A;  4KQO A;  3LO7 A;  3UNW A;  3NIA A;  5D3O A;  4OH0 A;  2PYR A;  5EOO A;  2V1Z A;  1XGJ A;  3NJA A;  1NYY A;  2WKP A;  2XFS A;  4N9K A;  3JYI A;  2Y55 A;  2GNX A;  2QJ7 A;  1FR1 A;  2PD7 A;  2HDU A;  4B4Z A;  3UDX A;  4IVK A;  3MQ0 A;  3N7W A;  3IXD A;  4Y7P A;  3Q82 A;  4X56 A;  2GZA A;  2HDS A;  1P97 A;  4JXS A;  3CPT A;  5CX7 A;  1W63 Q;  3IWI A;  3O86 A;  3O3V A;  5IHV A;  5DKL A;  2R9W A;  2XA7 M;  2IWB A;  2PR6 A;  5E43 A;  1NYM A;  4ZJ3 A;  4B93 A;  3VMA A;  4P87 A;  3A3I A;  3ZYT A;  3TW8 A;  3G35 A;  3TRC A;  5FDS A;  3NOU C;  4R3J A;  3VFF A;  4X1L A;  4ZDX A;  4UA9 A;  2WKR A;  3ITB A;  2NUP C;  3LIF A;  4UEY A;  1JWP A;  3T12 B;  4KZ9 A;  2BTF P;  2ZQA A;  2HP9 A;  3W2Z A;  2JKR M;  1VM1 A;  1MY8 A;  3RFB A;  1BSG A;  3MZE A;  4C3Q A;  1VHM A;  3H82 B;  2PHY A;  4KUK A;  2VLG A;  1OT6 A;  4EXO A;  2I9V A;  1W79 A;  3HCY A;  2Y8H A;  3VV4 A;  1GHI A;  1Z6F A;  4H8R A;  4HI4 A;  3W4Q A;  3SOI A;  1ZG6 A;  3GRJ A;  1BLC A;  3SH7 A;  1YKD A;  1F5M A;  3OCN A;  1K4F A;  1MWT A;  4R1G A;  1CI9 A;  2OWJ A;  1IEM A;  3GR2 A;  3OPP A;  3OC2 A;  3K3D A;  4WN5 A;  2JE5 A;  3DBA A;  1DJB A;  1I2S A;  3B33 A;  5AVE A;  4PAU A;  3NCK A;  3NOT C;  4X1M A;  5HD3 A;  1NZU A;  3PXP A;  2WAD A;  4JGP A;  3O87 A;  3PBS A;  2W3E A;  4DE0 A;  1L0G A;  1XJ2 A;  4S2O A;  4QB8 A;  5EVI B;  4AFI A;  4ME4 A;  4NXE A;  1GCE A;  1GHM A;  2ZLY A;  2O9C A;  4HEF A;  5FEG A;  3UMD A;  2Q9M A;  1UGU A;  1MBL A;  3KYZ A;  4OLG A;  3UE6 A;  4L9E A;  3BLS A;  1K4E A;  2ACG A;  3C4P A;  2V8C A;  2WGV A;  4HJ4 A;  2XDM A;  1JVJ A;  1DJC A;  4OPZ A;  5G4Y A;  4K08 A;  3BM6 A;  1FOF A;  3BY9 A;  3UB6 A;  4UHU A;  1NY0 A;  2K31 A;  4ZTK A;  3TSG A;  1ESU A;  4EER A;  5FA7 A;  4C75 A;  1N9O A;  4LLO B;  3IWO A;  3C7V A;  4EET B;  1S66 L;  5EM0 A;  5K5B A;  4LGW A;  3BQA A;  4BBU A;  2ZC4 B;  1LL9 A;  3E2K A;  3T1S A;  4OQG A;  5TR7 A;  4Q8I A;  1EI5 A;  2Z6D A;  2PRF A;  3LEZ A;  4EW7 A;  3CG5 A;  2M7V A;  2EXA A;  4IUK A;  2OSU A;  3FYZ A;  1P0Z A;  2EXB A;  5FAO A;  5GL9 A;  2CC1 A;  1XJ3 A;  1EWZ A;  4LV3 A;  5L2F A;  1D7E A;  1VEU B;  1AXB A;  5M19 A;  2J8Y A;  4ETZ A;  3SW1 A;  3ZNT A;  2A24 A;  1RCJ A;  2V9A A;  5FEF A;  2XRN A;  4I5S A;  3KYE A;  4MDZ A;  1OME A;  3C4O A;  1OJG A;  2KLI A;  4DJ2 A;  4EEP A;  3IF6 A;  1W8Y A;  3AGF A;  3TE8 A;  2HP6 A;  2JCH A;  4LEN A;  4Y0T A;  3E98 A;  5HPF A;  3DW0 A;  4XUX A;  4EWF A;  4JF6 A;  3N8L A;  3G2Y A;  3ZG5 A;  4OLD A;  3Q81 A;  3HL9 A;  5LBR A;  3E0Y A;  2XQZ A;  3CUE C;  3BRM A;  2EX9 A;  3WS1 A;  3T4Q A;  4PKY A;  4EES A;  5IU1 A;  1BYW A;  1L2S A;  1HD8 A;  1K6R A;  3G2Z A;  2PU4 A;  4Q0I A;  5G18 A;  2AVX A;  1T1A A;  4IHQ A;  1IYQ A;  4CLC A;  1QMF A;  1I5Q A;  2W1T A;  4Y15 A;  4GN2 A;  3OPL A;  1GSW A;  4GOG A;  4Y0O A;  2ZMA A;  4R3B A;  3Q7V A;  3MKF A;  1S0W A;  3V50 A;  2KDK A;  4KZ8 A;  1IKI A;  4QPR A;  3BWL A;  3HUO A;  4ZJ1 A;  1H8Y A;  3Q7Z A;  4EV4 A;  2WKI A;  5GHY A;  1V9Y A;  1F9I A;  2Z2L B;  3GTC A;  3LIE A;  5GLC A;  3BEC A;  4ARZ A;  2ZMV A;  3G30 A;  4GCZ A;  5CRF A;  1XPB A;  2DNS A;  3KO6 A;  4FTX A;  4MN5 A;  2W1T B;  3MZF A;  4E3J A;  3MXQ A;  4E3K A;  4JXV A;  3T4K A;  2ZL1 B;  1BTL A;  2J9P A;  4HP9 A;  1FR6 A;  5EE8 A;  2R78 A;  4Q0H A;  5L07 A;  2ZC5 B;  3GV9 A;  1E4D A;  2J80 A;  4RX2 A;  2WGI A;  3F1N A;  2QHK A;  5HWT A;  2JKR I;  3D9Y A;  5E2F A;  5FAP A;  4HNB A;  3O88 A;  1KE0 A;  2X01 A;  3S1Y A;  4GHI A;  2PDR A;  4P6Z S;  2YKF A;  3R4K A;  1MZU A;  4O01 A;  1VET B;  2VV7 A;  3MXS A;  4QWO A;  1BUL A;  1TS7 A;  1HZO A;  3WS5 A;  3PYP A;  3O5Y A;  4ID4 A;  4HQA A;  2ZQ9 A;  5FSR A;  3EOI A;  4JGR A;  4I3J A;  2GJ3 A;  4JKT A;  5CHU A;  1XFQ A;  4XUZ A;  5CGX A;  2KOI A;  1IKG A;  3KX0 X;  4EQ1 A;  5J4E A;  2WZX A;  1K56 D;  2MJ6 A;  4KG6 A;  3RH8 B;  1DP6 A;  3IBR A;  2PAV P;  2XRO A;  3VP1 A;  3VSL A;  5AQA A;  3F1N B;  1TS6 A;  2Y2H A;  1XJ6 A;  2G2U A;  5FI7 A;  1ERQ A;  2L0W A;  3IF6 C;  4S2N C;  1GSX A;  5KMW A;  1PW8 A;  4GHI B;  1ES4 A;  5HAP A;  1MPL A;  3W4O A;  4R4S A;  4HIA A;  3LUQ A;  5CER A;  3QP1 A;  2FFF B;  1K25 A;  3V3R A;  3H9W A;  3OLO A;  2A3U A;  1CI8 A;  1CK3 A;  3UN7 A;  1YQS A;  2J7V A;  2HDR A;  5G4Z A;  4BD0 A;  1PIO A;  3VP4 A;  4OKP A;  1T1C A;  1PI4 A;  4R3A A;  3UME A;  4GDB A;  2XSS A;  2G7U A;  4S2I A;  4LRY C;  3OPH A;  5GHX A;  4K0W A;  1ONH A;  1TDG A;  1YSQ A;  3HUM A;  4NXG A;  4R6L A;  1HTZ A;  5JYP A;  2GDN A;  1PW1 A;  4WL9 A;  3S7Q A;  4PM5 A;  1ES3 A;  2LB5 A;  3ZG9 B;  1YMX A; 
#chains in the Genus database with same CATH homology
 4C6Y A;  5A92 A;  1W79 A;  4LCM A;  2WYX A;  2X71 A;  1GHI A;  1PWG A;  3V3S A;  1Z6F A;  3MFD A;  4H8R A;  3SS5 A;  2QPN A;  3W4Q A;  4QD4 A;  3SOI A;  1ZG6 A;  3OZH A;  2HP5 A;  3GRJ A;  3NI9 A;  1BLC A;  2E8I A;  5FAT A;  4KZ5 A;  3SH7 A;  2ZC7 A;  3IXH A;  4QU3 A;  1DJA A;  2P9V B;  2OLU A;  2ZJ9 A;  4UAA A;  4QHC A;  3OCN A;  4KG5 A;  3GSG A;  1K4F A;  1XX2 A;  1L0F A;  1MWT A;  4PM8 A;  4R1G A;  3UDF A;  1CI9 A;  1RP5 A;  1IEM A;  3GR2 A;  3OPP A;  3OC2 A;  1GA0 A;  4UA7 A;  2JE5 A;  1RGY A;  1KDW A;  1XA7 A;  1DJB A;  1I2S A;  4S2J A;  4NET A;  3IT9 A;  1NRF A;  1FCN A;  3NCK A;  4KQR A;  2XR0 A;  4DKI A;  5KSH A;  4MLL A;  5DVA A;  1NZU A;  2WKE A;  4OOY A;  2H0T A;  3MBZ A;  3QHY A;  4X68 A;  5HX9 A;  2WAD A;  1JWV A;  3O87 A;  5EVI C;  4NK3 A;  3PBS A;  5A93 A;  4S2N A;  3SH9 A;  4DE0 A;  5CEC A;  2Y2J A;  2V20 A;  2I72 A;  4KEN B;  1L0G A;  5BOH A;  4KZ7 A;  2HPB A;  1J9M A;  5CTM A;  3A3E A;  4S2O A;  4QB8 A;  1WYC A;  5EVI B;  1K57 C;  5DF8 A;  3FKV A;  4XXR A;  2H0Y A;  4QJG A;  1GCE A;  1U60 A;  3BEB A;  5M1A A;  5JYO A;  1GHM A;  2ZLY A;  2EX2 A;  3N8S A;  1G6A A;  4HEF A;  1XA1 A;  1IEL A;  4OOL A;  4R4R A;  1YLJ A;  3HRE A;  3S4X A;  2Q9M A;  3DWZ A;  1PZO A;  4N92 A;  4ZAM A;  4OP5 A;  4S2P A;  5FAQ A;  1MBL A;  4OLG A;  4B88 A;  5EPH A;  1MXO A;  4S2M A;  1K56 A;  3RJU A;  3G4P A;  1G68 A;  4Z9Q A;  4GB7 A;  4M3K A;  3MKE A;  3BLS A;  2XD1 A;  5KSC A;  1LI0 A;  1K4E A;  2RCX A;  2VGK A;  4OPQ A;  3C4P A;  2WGV A;  3M6H A;  1BLH A;  4K91 A;  4DDS A;  4DXC A;  2XDM A;  3RXW A;  1JVJ A;  1DJC A;  4OPZ A;  3VP2 A;  3P09 A;  3ZG8 B;  3ZG0 A;  4N1H A;  1N9B A;  4QY5 A;  3BM6 A;  1FOF A;  2H10 A;  3ZVW A;  3LCE A;  2P9V A;  4UHU A;  4FH2 A;  4KZA A;  4WBG A;  5U47 A;  3VP0 A;  1NY0 A;  1PWC A;  4ZTK A;  4ZBE A;  3TSG A;  1ESU A;  1H5X A;  3SS3 A;  3IF6 B;  2WUQ A;  5FA7 A;  4C75 A;  3G32 A;  2EX8 A;  1DY6 A;  5GLD A;  2PBY A;  3IWO A;  2A49 A;  3AGD A;  2Y2P A;  3C7V A;  5HAI A;  3HUN A;  1YLZ A;  5FQI A;  4UA6 A;  3UY6 A;  3BLM A;  1IYS A;  4HBU A;  3BFD A;  1KVM A;  5CGS A;  4DDY A;  3N4I A;  2ZC4 B;  1LL9 A;  1IYO A;  3E2K A;  5EVI A;  4BLM A;  1GA9 A;  1M40 A;  3PAG A;  4OQG A;  5TR7 A;  1N4O A;  4PM6 A;  2XH9 A;  3FV7 A;  4Q8I A;  1KGG A;  2UWX A;  3NY4 A;  3IHB A;  5CTN A;  4OQH A;  5AQ9 A;  2G2W A;  1EI5 A;  3CZD A;  4GNU A;  1XGI A;  2BG1 A;  3LEZ A;  1FQG A;  5GLB A;  1K57 A;  1I2W A;  5F1G A;  3MZD A;  3CG5 A;  1C3B A;  2XK1 A;  3WS4 A;  1O7E A;  1K55 A;  2EXA A;  4LV1 A;  4EBP A;  1ZKJ A;  4R23 A;  1L0E A;  2OSU A;  3V5M A;  4RVA A;  1QME A;  2IWD A;  3FYZ A;  3MXR A;  4FCF A;  1FSW A;  2EXB A;  2Y2K A;  5FAO A;  5GL9 A;  2CC1 A;  4IBR A;  1MWR A;  4K0X A;  1EWZ A;  4LV3 A;  5L2F A;  2XF3 A;  3ISG A;  4PPR A;  5DTS A;  1NJ4 A;  4S2L A;  4OPY A;  1AXB A;  1ESI A;  1RGZ A;  3BFC A;  1Q2Q A;  5M19 A;  1ZG4 A;  5F82 A;  2J8Y A;  4WYY A;  3VP3 A;  2VGJ A;  5CGW A;  4KG2 A;  1YLP A;  4WEL A;  3ZNT A;  3PBN A;  3PBQ A;  3Q7V B;  4WZ5 C;  4BL3 A;  3PBR A;  1RCJ A;  3ZFZ A;  4EUZ A;  5FQ9 A;  1CEF A;  1WYB A;  3BFG A;  4GDN A;  1SKF A;  1K54 A;  4LV2 A;  4WEK A;  5HAR A;  4Y0U A;  1OME A;  3C4O A;  1FSY A;  4DXB A;  5F83 A;  3WRZ A;  3IF6 A;  3M2K A;  1W8Q A;  1BLS A;  1W8Y A;  3AGF A;  3HLW A;  1ERO A;  2HP6 A;  2QZ6 A;  1SDN A;  1H8Z A;  2XGN A;  1KE3 A;  1PI5 A;  3DWK A;  3HLD A;  3IQA A;  3NDG A;  2JCH A;  4LEN A;  1XXM A;  1VQQ A;  4Y0T A;  3DW0 A;  1L0D A;  5CHJ A;  4EBN A;  3IH9 A;  1Q2P A;  3A3J A;  4U0T A;  1SHV A;  5DF7 A;  5EOE A;  5CHM A;  4BJP A;  1KGE A;  4WM9 A;  4XUX A;  4EWF A;  4JF6 A;  3N8L A;  4LCL A;  1ALQ A;  1ES5 A;  2ZQ8 A;  3G2Y A;  5CED A;  3ZG5 A;  4JXG A;  2Y59 A;  3Q81 A;  3HL9 A;  4OLD A;  4PMA A;  4MEZ A;  1E3U D;  1NXY A;  1ES2 A;  1PWD A;  4HES A;  5DF9 A;  1JTG A;  4N1X A;  5M18 A;  1WE4 A;  4FD8 A;  2XQZ A;  1YLT A;  1K6S A;  3BRM A;  3OCL A;  2EX9 A;  1LLB A;  3WS1 A;  5TGF A;  3GMW A;  1L2S A;  1HD8 A;  1K6R A;  3SH8 A;  3HVF A;  3N6I A;  5A91 A;  1JWZ A;  3G2Z A;  2PU4 A;  4WZ4 A;  5G18 A;  4E3O A;  1MWU A;  4X53 A;  4LV0 A;  4DE3 A;  1IYQ A;  3UPP A;  3ZVT A;  4E3I A;  1TEM A;  1QMF A;  2ZM2 A;  3LY3 A;  1I5Q A;  1TVF A;  1LI9 A;  5HAQ A;  3QNB A;  2OLV A;  4GN2 A;  3OPL A;  5KZH A;  4GOG A;  5FAS A;  1ONG A;  3P98 A;  4Y0O A;  2WZZ A;  5E2H A;  5FI6 A;  3UO9 A;  2R9X A;  2ZMA A;  3IHA A;  5TFQ A;  3SS4 A;  4R3B A;  3HBR A;  4WMC D;  4D2O A;  2ZQ7 A;  3Q7V A;  2J9O A;  3IWQ A;  2WGW B;  3MKF A;  4S2K A;  5E2G A;  2ZM0 A;  1LL5 A;  2OV5 A;  1S0W A;  3V50 A;  4X55 A;  3CJM A;  3ZHH A;  3IXB A;  4KZ8 A;  2WK0 A;  4DRT A;  4B4X A;  4BD1 A;  4WZ5 A;  5GHZ A;  4E6W A;  4OP8 A;  3EQV A;  4E3M A;  2Y2M A;  2ZC6 B;  1IKI A;  2EFU A;  3HUO A;  4ZJ1 A;  3Q07 A;  5CXW A;  1H8Y A;  3PAE A;  3I7J A;  1FCO A;  3D4F A;  3WRT A;  3A3D A;  3NDE A;  3Q7Z A;  3Q1F A;  3TG9 A;  4OOM A;  4R0Q A;  1E25 A;  1KE4 A;  4MBF A;  4DE2 A;  4EV4 A;  4U3T A;  3HLG A;  1IYP A;  2WKI A;  4JPM A;  5AQB A;  5GHY A;  4BL2 A;  3FKW A;  2Z2L B;  2Z2M B;  3GTC A;  5E2E A;  5J8X A;  5HFO A;  4MBK A;  5GLA A;  5EEC A;  2P74 A;  3G34 A;  2QMI A;  4DE1 A;  5FQQ A;  1XKZ A;  3UPN A;  3HLC A;  2RL3 A;  5GLC A;  1FCM A;  1SCW A;  3BEC A;  3RXX A;  2V2F F;  3DTM A;  3WS0 A;  3G30 A;  5CRF A;  1NZO A;  4OVD A;  4O7D A;  1XPB A;  3BYD A;  2DNS A;  2C5W B;  3AGE A;  1KDS A;  4KZ6 A;  3PTE A;  4BQM A;  1SDE A;  5FQK A;  3MZF A;  4CPK A;  4E3J A;  5FQM A;  4OON A;  4E3K A;  4JXV A;  1S6R A;  4JF5 A;  3UDI A;  2JC7 A;  1BTL A;  2J9P A;  2WKH A;  3FWL A;  2Y91 A;  1Y54 A;  4P85 A;  3VOZ A;  3M2J A;  4IVI A;  4BEN A;  3VSK A;  1ERM A;  1FR6 A;  4YFM A;  3E2L A;  3C7U A;  5FI2 A;  5FQJ A;  5EE8 A;  2WGW A;  4E3N A;  2ZC5 B;  4FH4 A;  1TDL A;  4MBH A;  4DF6 A;  3GV9 A;  4JF4 A;  1E4D A;  1M6K A;  1KVL A;  4KQQ A;  2WGI A;  1YMS A;  3EQU A;  4RX2 A;  4JLF A;  3WS2 A;  1XP4 A;  1KGF A;  2ZC3 B;  3GQZ A;  3NBL A;  2Q9N A;  4IED A;  3PBO A;  3VOY A;  3G31 A;  3IXG A;  4FSF A;  2XD5 A;  5E2F A;  3UPO A;  1MKI A;  5FAP A;  3BFF A;  2XLN A;  2Y2G A;  2Y2Q A;  1YLY A;  1K38 A;  4PM7 A;  3O88 A;  4GD8 A;  4OPR A;  1KE0 A;  2X01 A;  2EX6 A;  3S1Y A;  3A3F A;  5AQ7 A;  3IF5 A;  5FDH A;  1E3U A;  3ZCZ A;  4CJN A;  3FZC A;  3ZG7 B;  3MXS A;  2EFX A;  3IH8 A;  3ZNY A;  5F1F A;  1BUL A;  1HZO A;  2WAF A;  2ZQD A;  3LY4 A;  5EVL A;  2X02 A;  3WS5 A;  1HVB A;  3VFH A;  3ITA A;  4KQO A;  3LO7 A;  3UNW A;  3NIA A;  3NC8 A;  4IBX A;  1MWS A;  4ID4 A;  5D3O A;  4OH0 A;  1YM1 A;  1K55 C;  4E3L A;  2DCF A;  5EOO A;  4RYE A;  2V1Z A;  2ZQ9 A;  1XGJ A;  1PZP A;  1BT5 A;  1JTD A;  5FSR A;  3ZDJ A;  1NYY A;  4P0M A;  2XEP A;  2XFS A;  4N9K A;  3JYI A;  4JKT A;  5CHU A;  2Y55 A;  4P6B A;  2IWC A;  4EQI A;  1FR1 A;  2BLS A;  2HDU A;  4B4Z A;  4GKU A;  4X69 A;  4XUZ A;  5CGX A;  5DTT A;  1IKG A;  4HBT A;  4WMC A;  4N9L A;  4IVK A;  3UDX A;  3HLF A;  3UE1 A;  5HW3 A;  3C5A A;  3N7W A;  3IXD A;  3UE3 A;  2WZX A;  1CEG A;  4OQ0 A;  1K56 D;  1PYY A;  4Y7P A;  4KG6 A;  3Q82 A;  4X56 A;  2ZQC A;  2HDS A;  4MNR A;  4JXS A;  4KZ3 A;  4U0X A;  3VP1 A;  4WEJ A;  2WAE A;  3VSL A;  5AQA A;  1YT4 A;  2Y2N A;  3IWI A;  3O86 A;  3GVB A;  2Y2H A;  4GD6 A;  1K54 C;  3O3V A;  2H5S A;  4QY6 A;  1GHP A;  1LHY A;  5IHV A;  4A5R A;  4E6X A;  5I94 A;  2G2U A;  5FI7 A;  1ERQ A;  2XFT A;  2ZM8 A;  3QNC A;  3WWX A;  3IF6 C;  2R9W A;  2IWB A;  4S2N C;  5DTK A;  5CEB A;  5E43 A;  1NYM A;  5KMW A;  4F94 A;  4ZJ3 A;  3VMA A;  1PW8 A;  4P87 A;  1ES4 A;  5HAP A;  3A3I A;  3BFE A;  1MPL A;  3W4O A;  4R4S A;  4X6T A;  3G35 A;  2B5R A;  5CER A;  2Y4A A;  3PBT A;  4R3J A;  3VFF A;  3CMZ A;  2FFF B;  1K25 A;  4EBL A;  4GZB A;  3V3R A;  2Y2O A;  4JBF A;  4L0L A;  5EUA A;  3S22 A;  3W4P A;  4ZDX A;  3M6B A;  4UA9 A;  4ZJ2 A;  2ZD8 A;  1BUE A;  4KZB A;  3ITB A;  2A3U A;  4PM9 A;  1CI8 A;  2Y2L A;  1CK3 A;  3UN7 A;  3W8K A;  1YQS A;  2J7V A;  4RA7 A;  1JWP A;  2HDR A;  2DRW A;  4KZ9 A;  1PIO A;  1W5D A;  3N8R A;  3VP4 A;  4OKP A;  4BD0 A;  1PI4 A;  3TOI A;  3HLB A;  2C6W B;  4OQI A;  3HLE A;  4GDB A;  4KZ4 A;  5EVI D;  2JBF A;  3B3X A;  2ZQA A;  4S2I A;  2FFY A;  2PU2 A;  3OPH A;  2HP9 A;  5GHX A;  4K0W A;  5A90 A;  1BZA A;  1ONH A;  1TDG A;  1MY8 A;  1VM1 A;  3HUM A;  2Y2I A;  1HTZ A;  1BSG A;  1W7F A;  3OPR A;  5HL1 A;  1BLP A;  2GDN A;  5JYP A;  1PW1 A;  4JXW A;  4RX3 A;  3MZE A;  4C3Q A;  3UE0 A;  3ZGA B;  4PM5 A;  4YIN A;  3V39 A;  1ES3 A;  1O07 A;  1YLW A;  3ZG9 B;  1ZC2 A;  2HDQ A;  1YMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...