4P85A

Crystal structure of est-y29, a novel penicillin-binding protein/beta-lactamase homolog from a metagenomic library
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
390
structure length
390
Chain Sequence
SMPDLLTNVAENYVNQDLFAGIEWRIDQDGKPIFQGCAGVKDIETRTFIPKNAIYRIYSMTKPIVSFLAMMLIERGVFRLSSPIQNFDPRFKSMKVIDQHAHIEPATALITIEHLLTHQAGFSYDFSLGCPISAHYRDAQLIEDGGRDLTDMMGVLAELPLVFHPGTQWKYSISTDVLAHIIECATGERVDDLLQRLIFDPLDMQDTGFSLPLDGASRLMEVYGMRSLHGLPALKPAPHVLVPADLGSSHPTDDPDFRRGGHGLYSTLDDYMAFANMLLSGQTPEGETLLSPAVLKLALAPRVHFGARGMRINDEPFAGYSWNLLGRVMTDVGAAAYATHLGEFGWSGAAATYFWVDPTKNMTGCVMTQFLGSQHPIGSDMQAAAMSMLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Est-Y29
publication title Crystallographic analysis and biochemical applications of a novel penicillin-binding protein/ beta-lactamase homologue from a metagenomic library.
pubmed doi rcsb
source organism Metagenome
total genus 124
structure length 390
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4p85A00
3NBLA 5AQ9A 1DY6A 4JKTA 3C4OA 3MXSA 5TFQA 1JWVA 1PW8A 3FZCA 1FQGA 1LLBA 1XGJA 4ID4A 3BFEA 4OQ0A 3D4FA 4JF4A 3NY4A 3BFDA 3Q82A 1W79A 2X02A 1BT5A 4Z9QA 1TEMA 3IF5A 3OPPA 2ZQDA 4KG5A 2JE5A 2ZQCA 1XXMA 1S6RA 4N1XA 2XLNA 4X56A 5EECA 2HP9A 4BJPA 4OP5A 3S4XA 3HREA 2CC1A 3WS2A 1K57C 5M1AA 3W4OA 5DTTA 2FFFB 4BD1A 1TDGA 1W5DA 1LI0A 4WEKA 1ES4A 4MNRA 4OPYA 1CEGA 4X68A 2HP5A 1GHIA 3UN7A 1YLJA 3VFHA 1E25A 5DF7A 5DF8A 4OOMA 4XXRA 4EBPA 3GTCA 1QMFA 1FSYA 1Y54A 5FQQA 4E6WA 1MBLA 5FQKA 3DW0A 3ZHHA 1E3UD 4RX2A 3GMWA 1Q2PA 3QHYA 5GHZA 1MKIA 1LI9A 4IEDA 1PZOA 3ZG8B 5KZHA 2J9OA 4UA9A 1GHMA 4ZTKA 1BLSA 3Q7VB 5A90A 1LHYA 2HP6A 4S2JA 2WKEA 5CGSA 4BL3A 2ZJ9A 2WZZA 5F82A 1BSGA 4MBKA 2WKIA 2Y2PA 5FSRA 3WRTA 4WEJA 1K56D 2BG1A 1WYCA 4HEFA 1XA1A 3ZGAB 1K56A 1ESUA 1K54C 1N4OA 3UE0A 4QU3A 1SDNA 2XR0A 3PBSA 5E2FA 4JF5A 5CERA 3JYIA 2ZQ7A 4OQIA 5BOHA 4R3BA 5FAPA 1FCMA 1IYQA 5FAQA 2WZXA 3BLMA 4KZ7A 3OC2A 1YM1A 3GR2A 1EWZA 1YLYA 1RCJA 2R9XA 1BZAA 1NRFA 3NDGA 3VP0A 3ZFZA 2OV5A 5JYOA 2X01A 4MBFA 4S2PA 5AQ7A 5TGFA 3SH9A 4S2KA 4NK3A 5GL9A 3VSKA 2JBFA 5I94A 4U3TA 1S0WA 3UDXA 1IYSA 2P9VA 1YLTA 3CMZA 4EV4A 2IWCA 4C3QA 3GSGA 4OH0A 3BFCA 5EE8A 3SOIA 3UNWA 1SKFA 2EX6A 5FATA 3ZVWA 1KDWA 2ZC5B 3VMAA 3UDIA 4PMAA 3M6BA 2QZ6A 3PBNA 3PTEA 5EUAA 4B4XA 1K4EA 4N92A 4PM6A 1DJAA 1O7EA 3HLBA 4S2MA 1Q2QA 4NETA 4R0QA 2ZD8A 3BFGA 1ALQA 4X53A 4CPKA 4DF6A 3A3DA 4WZ4A 4XUZA 5FA7A 1SCWA 4MLLA 4WYYA 3ZG7B 1PIOA 1RGYA 3IWIA 4WBGA 3TG9A 3VFFA 2HPBA 4LCLA 3AGDA 2Y2NA 3V3SA 2Z2MB 4GNUA 3QNCA 4GD8A 5FQ9A 4KZBA 2WADA 4R3JA 1M6KA 1HZOA 1K57A 2WGWA 3OPLA 4LV3A 4Y7PA 5GHXA 1K6RA 3HUOA 1MWSA 2DCFA 3VOYA 1K25A 1N9BA 3P98A 1YQSA 4OONA 1ONHA 3M2JA 3ZG0A 5HX9A 4QJGA 2XFSA 3ITAA 4E3OA 3RXWA 1ES2A 2J8YA 4ZAMA 4R23A 4DRTA 3N7WA 3C7VA 1DJBA 1YLZA 3CJMA 3PBTA 4C6YA 4E3LA 5FQJA 4PM5A 2RCXA 4KG2A 3G2YA 1PI4A 1FR6A 4YINA 3HLEA 4OPZA 3I7JA 1K55C 3ZDJA 4LCMA 5D3OA 4EWFA 5KMWA 2ZM0A 1KGGA 3G2ZA 5GLDA 1FCNA 3MKFA 3N6IA 5E2GA 4KENB 2C6WB 3FKWA 1IEMA 3MXRA 1SDEA 2ZQ9A 1KGFA 1YT4A 2JCHA 3V5MA 2Y59A 4JXWA 3M6HA 3G34A 1JWPA 3Q1FA 4FH2A 4K91A 3PBOA 4JXVA 2WUQA 4P0MA 5EPHA 5IHVA 3A3IA 4JLFA 4MBHA 4Y0UA 1IKGA 3FKVA 3VP1A 4S2LA 2OLUA 3NDEA 1IYPA 1ZG6A 1K54A 3LO7A 1EROA 1I5QA 4B4ZA 5HW3A 5M19A 1IELA 4JPMA 1FOFA 5E2HA 4OKPA 3S22A 1G6AA 4U0TA 3VSLA 3Q7VA 4WZ5C 5CTMA 2HDUA 4E3KA 2V1ZA 4R4SA 5HAIA 2EXBA 2XK1A 3BFFA 1PWGA 3WS5A 4ZBEA 1W8YA 2Y2KA 3NIAA 2ZC7A 1KE4A 1YMXA 3WS0A 4JXGA 2EFXA 2WAEA 1YMSA 5AQBA 2Z2LB 2XF3A 3S1YA 1XA7A 2X71A 5CRFA 3ITBA 1L0FA 3IF6C 3G35A 3LCEA 5HAPA 3OCNA 1GA9A 4ZJ3A 4DE0A 1BUEA 3GVBA 2EFUA 4DDSA 1ESIA 2J9PA 4CJNA 4UAAA 3PAEA 5F83A 3VP4A 3ZNYA 4XUXA 5FDHA 1ERMA 3BRMA 2XDMA 1W8QA 3GQZA 4M3KA 4QB8A 4ZJ2A 3LY3A 5FASA 1CK3A 3UPOA 2Y2JA 5JYPA 2ZQ8A 3UY6A 4KQQA 3HUMA 2HDRA 3O86A 3ZVTA 1XKZA 3PBRA 1KGEA 3MZFA 5CHUA 4P85A 3WWXA 3HL9A 4IVKA 1JTDA 4BL2A 3HUNA 4KZ5A 4LV0A 4N1HA 2VGKA 4KZ9A 4E3JA 5DVAA 5F1FA 1I2SA 4N9KA 2H10A 3WS4A 4Q8IA 5FI7A 4E3NA 3B3XA 1MWTA 3Q7ZA 3WRZA 5A92A 5CEBA 5DTSA 3WS1A 4FSFA 3SS3A 4O7DA 3E2KA 2PBYA 4D2OA 3N8SA 3FWLA 3ISGA 4WM9A 4GN2A 1K38A 2QPNA 4EQIA 3IQAA 2ZMAA 5FI6A 1ONGA 4BENA 1H8ZA 1QMEA 4FCFA 1I2WA 1IYOA 3RJUA 1E4DA 5U47A 4FH4A 2Y2IA 3Q81A 5DTKA 5TR7A 2Y2MA 4E3MA 4IBXA 4KQOA 3W4PA 2ZC4B 5L2FA 5A91A 2V20A 4GZBA 3VP3A 4QHCA 3IT9A 5EVIB 1KVLA 4OP8A 4OQGA 1JVJA 2JC7A 4X69A 5GLCA 3O3VA 3IHBA 4DE1A 4DXBA 4L0LA 5HARA 4MEZA 1FR1A 3LEZA 4GDNA 1RP5A 1YLWA 2Y91A 4U0XA 5M18A 3VP2A 2XEPA 4WMCD 3ZG5A 1LL5A 3GRJA 4GKUA 1GCEA 1L2SA 3DWZA 2G2WA 2HDQA 2WGIA 2H0YA 4WMCA 4Y0TA 3TOIA 4LV1A 1XGIA 1BLCA 1YLPA 5GHYA 2EX9A 4DKIA 3V3RA 4BLMA 1K6SA 4JXSA 4PM9A 4UHUA 4WZ5A 3E2LA 4OOLA 1GA0A 2Y55A 4B88A 5EVIC 4OLDA 1FSWA 1ES3A 3HLCA 3UPNA 4R1GA 4BQMA 2ZM8A 2V2FF 3MFDA 1IKIA 1CI9A 1C3BA 3DWKA 4LV2A 2Y2GA 4KZ4A 3IF6A 3ZG9B 1NY0A 1JTGA 4S2NC 1EI5A 1BLPA 1L0DA 1MWUA 4ZJ1A 4JBFA 2I72A 5E2EA 1DJCA 4KG6A 5CGXA 3QNBA 5A93A 3BLSA 5CTNA 5EOOA 3HBRA 2QMIA 3A3EA 3CG5A 4OLGA 3UE1A 3C4PA 2ZC6B 4EBNA 1ES5A 1W7FA 3SS5A 1TDLA 3IF6B 4WELA 4R4RA 5AQAA 1PWDA 4KZ3A 4IBRA 1WYBA 4X55A 3A3JA 5DF9A 3UE3A 2C5WB 1Z6FA 1ZG4A 4GB7A 1SHVA 1G68A 3N8LA 2G2UA 3IH9A 5G18A 4Y0OA 3TSGA 1K4FA 3BECA 4K0WA 1HD8A 4DE3A 1VQQA 1CEFA 3BM6A 3LY4A 3OCLA 4E3IA 2EX2A 3IXGA 3IWQA 2DRWA 1NYMA 2Y2LA 4RVAA 1KE0A 1TVFA 5GLAA 5KSCA 2GDNA 4EUZA 3ZCZA 5FAOA 2IWBA 3V39A 2PU2A 3EQUA 2XQZA 4HESA 5FI2A 4A5RA 1XPBA 2WKHA 3A3FA 4QY5A 4DXCA 4JF6A 3G4PA 3UPPA 3V50A 1ZC2A 3MKEA 1RGZA 3FYZA 5CHMA 3SS4A 5FQMA 3NI9A 5CECA 2OLVA 5KSHA 1H8YA 1BTLA 3IWOA 3N8RA 1MY8A 5F1GA 5EOEA 3IXDA 3G31A 3G30A 1CI8A 2ZC3B 4HBUA 4UA6A 1BULA 1E3UA 1NYYA 1U60A 4KQRA 2B5RA 2XFTA 2EX8A 2A3UA 4OPRA 3PBQA 2ZQAA 3PAGA 4OPQA 4OOYA 4K0XA 2P74A 4OQHA 4YFMA 2E8IA 1NJ4A 1PW1A 2H0TA 4GDBA 4E6XA 4FD8A 2Y2HA 1PWCA 2XD1A 3IXBA 3IXHA 2WGVA 3MZEA 4OVDA 3ZNTA 3HLFA 3C7UA 1NZOA 4PM8A 2IWDA 3W4QA 1L0GA 2H5SA 3BYDA 3UO9A 4HBTA 4GD6A 1XX2A 3AGFA 1JWZA 2WYXA 5EVID 1KDSA 5CXWA 4DDYA 1FCOA 4GOGA 4P87A 3HLDA 5EVIA 4H8RA 2R9WA 2PU4A 5HAQA 3W8KA 3M2KA 3MZDA 4S2IA 2RL3A 1K55A 1PZPA 4S2OA 1L0EA 4S2NA 2ZM2A 2WAFA 1XP4A 3EQVA 3N4IA 2XGNA 5CGWA 1VM1A 1HVBA 1O07A 3O87A 5CHJA 3HLWA 4KZAA 2ZLYA 3G32A 1ERQA 4RX3A 3IH8A 3BEBA 4PPRA 4RYEA 1KVMA 1MXOA 2UWXA 4DE2A 1NZUA 1KE3A 3DTMA 4PM7A 4QY6A 5J8XA 4LENA 2A49A 3NCKA 2Q9MA 2P9VB 2Y4AA 1J9MA 1HTZA 2VGJA 5GLBA 3MBZA 2OSUA 3OPHA 1ZKJA 4C75A 2EXAA 2WK0A 4EBLA 3SH7A 1M40A 2Q9NA 1BLHA 1NXYA 1OMEA 2BLSA 3CZDA 3O88A 3SH8A 5HL1A 2Y2QA 3C5AA 5EVLA 4RA7A 4P6BA 5E43A 3P09A 3UDFA 1AXBA 3OZHA 1MWRA 2XH9A 4BD0A 1PI5A 5HFOA 3NC8A 4IVIA 3HVFA 4N9LA 2XD5A 2Y2OA 3HLGA 5CEDA 5FQIA 3RXXA 2J7VA 3FV7A 3VOZA 3AGEA 3OPRA 1PYYA 4F94A 1WE4A 4UA7A 3IHAA 2HDSA 2DNSA 1LL9A 4KZ8A 1MPLA 4KZ6A 4X6TA 2WGWB 4ZDXA 3GV9A 1H5XA 3Q07A 4QD4A 1GHPA 2FFYA
chains in the Genus database with same CATH superfamily
4I3AA 5AQ9A 5HD3A 3T4QA 1XGJA 3OPPA 3T50A 3HCYA 5L2FA 4N1XA 4X56A 2XLNA 2HP9A 2E8JA 2CC1A 1K57C 2J3WA 3MQQA 1UGUA 1OTEA 2HF6A 3UN7A 3OBFA 1FSYA 2A24B 1Y54A 1Q2PA 2VGLS 3Q7VB 2WKEA 3B47A 2J3TD 4CLCD 3D72A 1XA1A 2QKPA 1K56A 1GSVA 3UE0A 4QU3A 3LYXA 3PBSA 5FEFA 1YAXA 4EERA 1OJ5A 1FCMA 1IYQA 3BLMA 2V0WA 1YM1A 1EWZA 3VP0A 3EWKA 5TGFA 5GL9A 3VSKA 3U2AA 1IYSA 3C8CA 3CMZA 4EV4A 3GSGA 3BFCA 3UNWA 1SKFA 3ZVWA 3VMAA 4N92A 4DN0A 4NXGA 4S2MA 3QP2A 4ETZA 3A3DA 4WYYA 3L9KA 1TD5A 2Y2NA 1W63Q 4GNUA 2M1CA 2WADA 4R3JA 1M6KA 1HZOA 4Y7PA 2XSSA 4L9GA 2DCFA 3VOYA 5HX9A 4R23A 2GZAA 3C7VA 3MF0A 3CJMA 3PBTA 4E3LA 2RCXA 4KG2A 3G2YA 5AJGA 1TS8A 2OAQ1 4LCMA 3CUEA 4NXEA 2HZ5A 3VV4A 2ZM0A 5GLDA 3MXRA 2ZQ9A 5MC7A 1XJ3A 2Y59A 4JXWA 2B95A 4K91A 2P04A 2HGVA 1VB6A 4YNRA 4Y0UA 3VP1A 3NDEA 2W3GA 1IYPA 4B4ZA 1K54A 3LO7A 4JGPA 2JKFA 2OWHA 4OKPA 3NOPC 1G6AA 4GHIB 3VSLA 3NECA 2V1ZA 3H9WA 2XK1A 1W8YA 3NIAA 5HWTA 2X71A 3IF6C 4LLOB 3LCEA 3OCNA 3TW8A 4DE0A 4DDSA 3PAEA 4X1MA 1W8QA 3GQZA 1NLYA 3CLOA 2GX5A 4FOFA 3PXPA 3H82A 4DMZA 1XKZA 4L9EA 4P85A 3WWXA 1CF0A 4KZ5A 4N1HA 3UB6A 3MSHA 5DVAA 4E3JA 5F1FA 3SW1A 2P08A 4B93A 3LR5A 5A92A 2Y79A 3SS3A 4G3VA 2NUPC 2QPNA 3NOUC 1PFLA 3PR6A 4BENA 4QPRA 3F1OA 3K2NA 4ARZA 5CX7A 1I2WA 5U47A 2Y2IA 5TR7A 3G6OA 2OOLA 4GZBA 2JKRM 5EVIB 3ICYA 1JVJA 2JC7A 3F1NA 4ARZB 4BMWA 3IHBA 1RP5A 5HDCA 3VP2A 1GCEA 1L2SA 3DWZA 2HDQA 5A8BA 4LV1A 2BASA 4MCWA 2NUTC 3V3RA 4PM9A 4WZ5A 3T4OA 2Y55A 4B88A 5EVIC 1P97A 2VLGA 4OLDA 4BQMA 3UPNA 4O0PA 1JNUA 3DWKA 4KZ4A 1NY0A 4S2NC 1MWUA 3QP8A 2I72A 5E2EA 1DJCA 2KDKA 1OTIA 3A3EA 3A0VA 4R4RA 1PWDA 4IBRA 3A3JA 5DF9A 3UE3A 3VE4A 5EM0A 4Y15A 4Y0OA 2VV8A 1CEFA 4HOIA 3FPWA 4H6JA 4X25A 2V1AA 5FAOA 4HESA 4DXCA 4JF6A 3G4PA 3V50A 3FYZA 3E4PA 5CHMA 4Q0JA 3NI9A 5KSHA 1H8YA 1BTLA 3KYEA 3IXDA 3G31A 1G5UA 1LL8A 2A3UA 4OPQA 2O9AA 2P74A 1NJ4A 1PW1A 4GDBA 4E6XA 1Z09A 1W63M 2W1RA 3LIBA 3PYPA 4PM8A 5HPFA 4UQIM 1L0GA 3W4QA 3BYDA 4PAUA 1F9IA 4GD6A 3AGFA 3DBAA 2W0NA 4Y2FA 1KDSA 4GOGA 4HJ3A 5IU1A 3W8KA 4CLCB 3M2KA 3MZDA 2RL3A 3UB5P 3F1PB 3BQ8A 3P7NA 2WAFA 1VM1A 1HVBA 3IX8A 3HLWA 4XT2A 2K2NA 3G32A 4I3IA 4EU0A 1KVMA 1ACFA 1NZUA 4L9FA 3DTMA 2A49A 4CLCC 2P9VB 1HTZA 2PR5A 2VGJA 4XT2B 1N9NA 4B9OA 5DKLA 2OSUA 1YSPA 3SH7A 1BLHA 1OMEA 1MC0A 4RA7A 5G4ZA 3P09A 4DJ2A 2XH9A 3NC8A 3HVFA 3T4SA 4HP4A 1DP8A 3IHAA 3H7WA 2JKGA 2PHYA 4F3LB 2WGWB 1YKDA 1H5XA 1GHPA 3JVUA 2FFYA 3MFXA 3OOVA 2LB9A 5L8MA 3R4KA 1JWVA 4ID4A 4OQ0A 4JF4A 3Q82A 4Z9QA 1TEMA 3IF5A 1XXMA 4BJPA 3GDIA 5J4EA 2G7UA 4OP5A 3WS2A 2W1TB 1TDGA 4G3KA 1LI0A 4MNRA 4OPYA 4X68A 1GHIA 4EQ1A 1F5MA 1YLJA 1YSQA 4ETXA 3VFHA 5DF7A 2Z6DA 3LUQA 5FQQA 4BBUA 3ZHHA 3T1QB 1YPRA 4RX2A 1PZOA 5KZHA 4KUKA 5CGSA 1GSWA 2PDRA 4HP9A 2O9BA 2Y2PA 5FSRA 3WRTA 4HQAA 3S7QA 2ZL1B 3OLOA 1WYCA 2O9CA 4IUHA 5HSQA 4LGWA 2WZXA 4KZ7A 3OC2A 1RCJA 3KYQA 3ZFZA 1VETB 5AQ7A 2JBFA 5I94A 4U3TA 1S0WA 1Y28A 3UDXA 1YLTA 1F2KA 2IWCA 3SOIA 2ZC5B 3UDIA 4Y5FA 1MKMA 3E0YA 3PBNA 4B4XA 4PM6A 1Q2QA 5HDSA 4DF6A 1SCWA 4WLAA 3ZG7B 3TG9A 2HPBA 2VK3A 3QNCA 4GD8A 1K57A 2D02A 4LV3A 5GHXA 1S4SA 3RH8B 1K25A 4D60A 3M2JA 2XFSA 4R6LA 3RXWA 3CHWP 1DP6A 4DRTA 2VV7A 2L0WA 3HJIA 1IFQA 3HLEA 3I7JA 1K55C 3KX0X 3ZDJA 2VGLM 5KMWA 4M4XA 1KGGA 2VA0A 2C6WB 3BQAA 3M6HA 3Q1FA 3FC7A 3PBOA 3DTEA 2WUQA 4P0MA 5EPHA 1A0KA 3A3IA 4JLFA 5TJJA 2A24A 4EEPA 4MN6A 3S22A 3Q7VA 5DKKA 5CTMA 2HDUA 4R4SA 3WS5A 3DTKA 1YMXA 3WS0A 1V9YA 4JGRA 3DTIA 2EFXA 1VEUB 4GS9A 2Z2LB 1XA7A 4ZRRA 5L07A 3G35A 2P7JA 4IHQA 1GA9A 4ZJ3A 2J9PA 3TRCA 4UAAA 3VP4A 5HPIA 5KIZA 4XUXA 5FDHA 3BY8A 2XDMA 4QB8A 4GS9B 4M3KA 1CK3A 3UPOA 5JYPA 4GJ4A 3UY6A 3HUMA 2BTFP 3ZVTA 1KGEA 3MZFA 4IVKA 1JTDA 4BL2A 4LV0A 5F5YA 4KZ9A 4N9KA 4Q8IA 1WA9A 5FI7A 4LRYC 3GECA 1MWTA 4R38A 5CEBA 5DTSA 4FSFA 3QP5A 4O7DA 2LB5A 2KOIA 4WM9A 3IQAA 5FI6A 1QMEA 4FCFA 4Y13A 5HD5A 1H0MA 3CPTB 4FH4A 3Q81A 4E3MA 4KQOA 4QHCA 4HY8A 3MQOA 2Y8HA 1KVLA 4OP8A 3MMHA 4OQGA 4X69A 3ZQ5A 4DE1A 4DXBA 5DJUA 4GDNA 4U0XA 4WMCD 2JKTI 4Z1WA 2XROA 2WGIA 1OPXA 3V67A 3LI9A 3S7OA 3BWLA 3UE6A 1ES3A 3HLCA 2ZMFA 2V2FF 3VOLA 2WKRA 1CI9A 3CWFA 3IF6A 3ZG9B 3CITA 3HJKA 3LR4A 1T18A 3E98A 1BLPA 2HV1A 4JBFA 4KG6A 5CGXA 4LFUA 3HBRA 3CG5A 3C4PA 4GHIA 2FZ0A 1W7FA 1OTDA 3SS5A 1TDLA 3IF6B 2PYRA 5AQAA 1WYBA 3U4LP 1Z6FA 1SHVA 3T4LA 2EWWA 2PD7A 3N8LA 4WN5A 3E4QA 3KSGA 1FIKA 3IH9A 4K0WA 1T1CA 4DE3A 1VQQA 3OCLA 3IXGA 5GLAA 2DRWA 2Y2LA 4RVAA 1KE0A 4BBVA 2IWBA 2PU2A 4A5RA 2XQZA 5FI2A 3UPPA 1GSXA 3SS4A 5FQMA 2OLVA 5EOEA 3T1SA 1BULA 1U60A 2HJEA 2H0TA 5EFWA 4FD8A 2PYPA 3ZNTA 2WGVA 1NZOA 4HH2A 2IWDA 5HDDA 4I5SA 3TE8A 3UO9A 2WKPA 1OT6A 2WYXA 4BBTA 1S1YA 4P87A 5EVIA 4H8RA 1ZTUA 3MS6A 2PU4A 4Q0HA 5LBRA 4S2IA 1PZPA 4S2NA 2ZM2A 3EQVA 1O07A 4MN7A 1ERQA 3IH8A 3BEBA 1MXOA 3LI8A 4DE2A 1VHMA 4QY6A 2Q9MA 5GLBA 3D3OA 4EXOA 1NXYA 2BLSA 2W3FA 3SH8A 3O88A 5HL1A 4O01A 2Y2QA 3C5AA 4YWZA 1D1JA 2FH5A 3OZHA 1MWRA 3FG8A 5IS1A 4BD0A 2W3EA 2XD5A 2Y2OA 1UWPX 4EETB 4E04A 3VOZA 4UA7A 1H3QA 3CAXA 3UMEA 3EGDC 3GV9A 3Q07A 3NBLA 1S67L 4JKTA 1LSXA 3C4OA 1DRMA 3MXSA 1PW8A 1FQGA 2V1BA 3BFEA 3BFDA 3BW6A 2JE5A 2ZQCA 4NXFA 1S6RA 5EECA 2ZOIA 3S4XA 4IUKA 3D9YA 4HJ6A 3W4OA 5DTTA 4BD1A 1W5DA 1CEGA 4OOMA 3UMDA 3GTCA 1QMFA 5J7EA 1G6OA 1MBLA 3DW0A 5FL3A 1OTBA 1MKIA 1LI9A 3ZG8B 2J9OA 4KUOA 3IS2B 1GHMA 4UA9A 5A90A 4S2JA 3ULFA 2L4RA 4BL3A 4R3AA 2JKRI 1XJ6A 5F82A 1BSGA 4MBKA 4WEJA 4CLCA 1K56D 2BG1A 4HEFA 3F1PA 3IBJA 1ESUA 1N4OA 1FILA 4JF5A 5CERA 2ZQ7A 5BOHA 4ME4A 4R3BA 3BJNA 1OT9A 5FAQA 3C30A 3KYZA 2AVXA 2R9XA 1YLYA 2ZOHA 2IA2A 1BYWA 2X01A 4S2PA 3SH9A 1UWNX 4S2KA 4NK3A 2YKFA 2P9VA 4K08A 1PNEA 4C3QA 4OH0A 5EE8A 4PMAA 3M6BA 2V9AA 3PTEA 5EUAA 5HWWA 1DJAA 2ACGA 3HLBA 2ZD8A 3BFGA 1ALQA 2J80A 4X53A 4XUZA 2KX6A 4MLLA 3LIEA 1RGYA 3IWIA 5TBMB 3A0RA 4LCLA 3AGDA 3UB9A 4KZBA 2GNXA 3OPLA 2WGWA 4F3LA 2D01A 1MWSA 1N9BA 3P98A 4OONA 1ONHA 3EEHA 1Y4OA 4QJGA 3C38A 3ITAA 3MJQA 1ES2A 4EESA 4NEED 5FQJA 4PM5A 1PI4A 4YINA 3KSFA 1F98A 3N6IA 3MKFA 2W1TA 1IEMA 2W3DA 2JCHA 3V5MA 4JXVA 3QP4A 5IHVA 4MBHA 2CMNA 2OLUA 1ZG6A 5HW3A 5M19A 1EROA 1I5QA 1IELA 1N9OA 1STZA 4U0TA 5HAIA 2EXBA 2ZC7A 1KE4A 4JXGA 2WAEA 5AQBA 3S1YA 2ZL1A 5HAPA 1D06A 4WUJA 5L09A 5F83A 3ZNYA 4PKYG 1ERMA 3BRMA 3JVVA 4ZJ2A 3LY3A 4KQQA 2HDRA 4P6ZS 5EV0A 3PBRA 3LEQA 1VETA 3HUNA 2XA7S 1I2SA 3WS4A 4EUVA 3LICA 4E3NA 3B3XA 3WRZA 3WS1A 3R7WB 2EWVA 3N8SA 3FWLA 3ISGA 1K38A 4FTXA 1ONGA 1P0ZA 3KO6A 1IYOA 4CQHA 3QP1A 5DTKA 2Y2MA 4IBXA 2ZC4B 5K5BA 3IT9A 2QJ5A 5GLCA 2GJ3A 5HARA 2Y91A 5M18A 2XEPA 1LL5A 3GRJA 4GKUA 2G2WA 4Y0TA 5GHYA 2PR6A 2EX9A 1K6SA 4UHUA 1T19A 4JGQA 4R1GA 4I39A 1C3BA 2Y2GA 5DFXA 1JTGA 3LIDA 1L0DA 4QWOA 5A93A 3BLSA 3VE3A 4EBNA 4OLGA 3JPUA 1G28A 1ES5A 4KZ3A 1AWIA 4MN5A 1VEUA 1P9WA 2B02A 2JKTM 3TSGA 1K4FA 1T1BA 3IBRA 1HD8A 1NWZA 1IOUA 2HJ9C 3BM6A 3LY4A 2PBDP 2EX2A 3IWQA 2JHEA 1TVFA 2QYBA 2GDNA 2B18A 4EUZA 3ZCZA 1S4RA 2XRNA 3EQUA 1XPBA 2MJ6A 2WKHA 3A3FA 4AFIA 5F68A 5CECA 1MY8A 4GCZA 1S66L 3G30A 2VV6A 4HBUA 1NYYA 3IX3A 4OPRA 3PBQA 2L1MA 2KLIA 2V8CA 4OQHA 4YFMA 2E8IA 3B33A 2WKQA 3IXBA 3IXHA 4OVDA 5DFYA 3HLFA 3C7UA 3CPTA 4I38A 5J3WA 4KQDA 5CXWA 4DDYA 3HLDA 2R9WA 3PHYA 3L7HA 5HAQA 1TS7A 4LPZA 3T1RA 3NJAA 4S2OA 1LT0A 3LFVA 1NRJA 1XP4A 2XGNA 2VJWA 5CHJA 3CI6A 4KZAA 2ZLYA 1P9RA 2UWXA 2ZMVA 1KE3A 4PM7A 5J8XA 4IJGA 1EW0A 2H28A 1J9MA 4EW7A 1K0KA 4C75A 2EXAA 4EBLA 1M40A 1TS0A 5E43A 1AXBA 4EEUA 1PI5A 5HFOA 4IVIA 4N9LA 1H8MA 4X1LA 5CEDA 2EA9A 3FV7A 2OWJA 3OPRA 1PYYA 4F94A 1WE4A 4YOFA 2HDSA 2DNSA 1LL9A 4NKPA 1MPLA 2INWA 4X6TA 3ZYTA 1X0OA 4QD4A 4MMNA 1XFNA 5HL6A 4JGOA 1DY6A 1CQAA 4PKYA 3NULA 5TFQA 3FZCA 4O8GA 3TJZC 1LLBA 3D4FA 3NY4A 1W79A 2X02A 1BT5A 3MR0A 2ZQDA 4KG5A 3HREA 3RTYA 5M1AA 2FFFB 4WEKA 1ES4A 3MQ0A 4NG2A 2HP5A 1XJ4A 1E25A 2QWSA 5DF8A 4XXRA 4EBPA 5AVFA 3QP6A 2V0UA 4ESPA 5FEGA 4E6WA 5FQKA 4DJ3A 3LR0A 1E3UD 3GMWA 3QHYA 5GHZA 3KSHA 3NOTC 4IEDA 3CUEC 4ZTKA 1BLSA 2Q0OA 1LHYA 2HP6A 5HWVA 1XFQA 2ZJ9A 2WZZA 2WKIA 5FDSA 1PRQA 3ZGAB 5HZHA 1K54C 1ZHHB 1SDNA 2XR0A 5E2FA 3JYIA 4OQIA 5FAPA 2OAP1 3H82B 3GR2A 1SKOA 1BZAA 1NRFA 2PAVP 3NDGA 2OV5A 5JYOA 4MBFA 3DAVA 1DP9A 3MXQA 2EX6A 2I9VA 5FATA 1KDWA 1SKOB 1ODVA 2QZ6A 1K4EA 1O7EA 1LSWA 3T4JA 3B42A 4NETA 4R0QA 4CPKA 2QJ7A 4WZ4A 5FA7A 1PIOA 4WBGA 3F1OB 3T4TA 3NHQA 3VFFA 1LSVA 2M7UA 3V3SA 2Z2MB 5FQ9A 1K6RA 2W27A 4WF0A 3T12B 3HUOA 1OTAA 1NLZA 3F1NB 3C2WA 1YQSA 3ZG0A 4E3OA 4ZAMA 2J8YA 3N7WA 5L10A 1DJBA 1YLZA 3T1XA 4C6YA 1FR6A 4HJ4A 3S7NA 4OPZA 3LGOA 5EVEA 5D3OA 4EWFA 3G2ZA 1FCNA 5E2GA 4KENB 3FKWA 1SDEA 4GW9A 1KGFA 1YT4A 3G34A 1JWPA 4FH2A 4HI4A 4G3WA 4NXBA 2Z6CA 2JN7A 3SZTA 1IKGA 3FKVA 4S2LA 5C5KA 4JPMA 1FOFA 5E2HA 2QHKA 3IS2A 4WZ5C 3LIAA 4E3KA 3BFFA 1PWGA 4ZBEA 2Y2KA 1YMSA 4FUWA 2XF3A 5CRFA 3ITBA 1L0FA 1BUEA 3GVBA 2EFUA 4UEYA 1ESIA 4CJNA 4HHDA 4R70A 4H6JB 5FASA 2Y2JA 2ZQ8A 3O86A 5CHUA 3EOIA 3HL9A 1D7EA 2VGKA 3P01A 5G4YA 2H10A 3Q7ZA 3E2KA 3EEAA 2PBYA 4D2OA 4GN2A 1XJ2A 4EQIA 2VKSA 3K3DA 2ZMAA 1H8ZA 4HH3A 3KSIA 3RJUA 1E4DA 5TBMA 3W4PA 5A91A 2V20A 3VP3A 2K31A 1MZUA 3O3VA 4L0LA 4LRXC 1N9LA 4MEZA 1FR1A 3LEZA 1YLWA 4Q0IA 3ZG5A 2H0YA 4WMCA 1KOUA 3TOIA 2J3TC 1XGIA 1BLCA 1YLPA 3UB7A 4DKIA 2K7SA 4UQIS 2VEAA 4BLMA 4JXSA 1S1ZA 3E2LA 2A2LA 1GA0A 4OOLA 2O0YA 2PT7A 1FSWA 4WL9A 2ZM8A 1T1AA 1IKIA 3MFDA 4LV2A 3S7PA 3BY9A 1EI5A 3O5YA 4BWIA 4ZJ1A 3QNBA 5CTNA 5EOOA 2QMIA 3UE1A 2ZC6B 4P6ZM 4WELA 3T4KA 4X55A 2C5WB 5EM1A 2XA7M 1ZG4A 3H7WB 4GB7A 2M7VA 1G68A 2G2UA 5G18A 3BECA 4HNBA 4E3IA 2R78A 1NYMA 5KSCA 5F69A 3V39A 1CJFA 3RFBA 4QY5A 1ZC2A 3MKEA 1RGZA 4GLQA 1J3WA 3UB8A 3IWOA 3N8RA 5F1GA 5AVEA 1HLUP 1CI8A 2ZC3B 4UA6A 1E3UA 3R7WA 4KQRA 2B5RA 2XFTA 2EX8A 4MDZA 3A0SA 2ZQAA 3PAGA 4OOYA 4K0XA 1TF1A 1TS6A 3E4OA 2Y2HA 1PWCA 2XD1A 3MZEA 2V8FA 2H5SA 4HBTA 2VZWA 1XX2A 1JWZA 5EVID 1FCOA 1OJGA 3FPVA 1K55A 5IT5A 2UV0E 3LR3A 1V9ZA 1L0EA 3W2ZA 3N4IA 4RQ9A 5CGWA 2O99A 3K3CA 3O87A 4RX3A 4RYEA 4PPRA 3EGXC 4LRZE 4HIAA 5DJTA 2PRFA 4CLCE 1L3LA 4LENA 3NCKA 2Y4AA 5F6AA 2ZBBA 3MBZA 3OPHA 1ZKJA 2WK0A 2Q9NA 4I3JA 3CZDA 2PD8A 5EVLA 4P6BA 3UDFA 1SZVA 2YKHA 3HLGA 3LIFA 5FQIA 4Y3IA 3RXXA 2J7VA 3AGEA 4Y17A 3IX4A 5I5LA 4KZ8A 4KZ6A 4ZDXA 4PHTA 2DMWA 2W3HA 4II7A 2VX8A
chains in the Genus database with same CATH topology
3NBLA 5AQ9A 1DY6A 4JKTA 3C4OA 3MXSA 5TFQA 1JWVA 1PW8A 3FZCA 1FQGA 1LLBA 1XGJA 4ID4A 3BFEA 4OQ0A 3D4FA 4JF4A 3NY4A 3BFDA 3Q82A 1W79A 2X02A 1BT5A 4Z9QA 1TEMA 3IF5A 3OPPA 2ZQDA 4KG5A 2JE5A 2ZQCA 1XXMA 1S6RA 4N1XA 2XLNA 4X56A 5EECA 2HP9A 4BJPA 4OP5A 3S4XA 3HREA 2CC1A 3WS2A 1K57C 5M1AA 3W4OA 5DTTA 2FFFB 4BD1A 1TDGA 1W5DA 1LI0A 4WEKA 1ES4A 4MNRA 4OPYA 1CEGA 4X68A 2HP5A 1GHIA 3UN7A 1YLJA 3VFHA 1E25A 5DF7A 5DF8A 4OOMA 4XXRA 4EBPA 3GTCA 1QMFA 1FSYA 1Y54A 5FQQA 4E6WA 1MBLA 5FQKA 3DW0A 3ZHHA 1E3UD 4RX2A 3GMWA 1Q2PA 3QHYA 5GHZA 1MKIA 1LI9A 4IEDA 1PZOA 3ZG8B 5KZHA 2J9OA 4UA9A 1GHMA 4ZTKA 1BLSA 3Q7VB 5A90A 1LHYA 2HP6A 4S2JA 2WKEA 5CGSA 4BL3A 2ZJ9A 2WZZA 5F82A 1BSGA 4MBKA 2WKIA 2Y2PA 5FSRA 3WRTA 4WEJA 1K56D 2BG1A 1WYCA 4HEFA 1XA1A 3ZGAB 1K56A 1ESUA 1K54C 1N4OA 3UE0A 4QU3A 1SDNA 2XR0A 3PBSA 5E2FA 4JF5A 5CERA 3JYIA 2ZQ7A 4OQIA 5BOHA 4R3BA 5FAPA 1FCMA 1IYQA 5FAQA 2WZXA 3BLMA 4KZ7A 3OC2A 1YM1A 3GR2A 1EWZA 1YLYA 1RCJA 2R9XA 1BZAA 1NRFA 3NDGA 3VP0A 3ZFZA 2OV5A 5JYOA 2X01A 4MBFA 4S2PA 5AQ7A 5TGFA 3SH9A 4S2KA 4NK3A 5GL9A 3VSKA 2JBFA 5I94A 4U3TA 1S0WA 3UDXA 1IYSA 2P9VA 1YLTA 3CMZA 4EV4A 2IWCA 4C3QA 3GSGA 4OH0A 3BFCA 5EE8A 3SOIA 3UNWA 1SKFA 2EX6A 5FATA 3ZVWA 1KDWA 2ZC5B 3VMAA 3UDIA 4PMAA 3M6BA 2QZ6A 3PBNA 3PTEA 5EUAA 4B4XA 1K4EA 4N92A 4PM6A 1DJAA 1O7EA 3HLBA 4S2MA 1Q2QA 4NETA 4R0QA 2ZD8A 3BFGA 1ALQA 4X53A 4CPKA 4DF6A 3A3DA 4WZ4A 4XUZA 5FA7A 1SCWA 4MLLA 4WYYA 3ZG7B 1PIOA 1RGYA 3IWIA 4WBGA 3TG9A 3VFFA 2HPBA 4LCLA 3AGDA 2Y2NA 3V3SA 2Z2MB 4GNUA 3QNCA 4GD8A 5FQ9A 4KZBA 2WADA 4R3JA 1M6KA 1HZOA 1K57A 2WGWA 3OPLA 4LV3A 4Y7PA 5GHXA 1K6RA 3HUOA 1MWSA 2DCFA 3VOYA 1K25A 1N9BA 3P98A 1YQSA 4OONA 1ONHA 3M2JA 3ZG0A 5HX9A 4QJGA 2XFSA 3ITAA 4E3OA 3RXWA 1ES2A 2J8YA 4ZAMA 4R23A 4DRTA 3N7WA 3C7VA 1DJBA 1YLZA 3CJMA 3PBTA 4C6YA 4E3LA 5FQJA 4PM5A 2RCXA 4KG2A 3G2YA 1PI4A 1FR6A 4YINA 3HLEA 4OPZA 3I7JA 1K55C 3ZDJA 4LCMA 5D3OA 4EWFA 5KMWA 2ZM0A 1KGGA 3G2ZA 5GLDA 1FCNA 3MKFA 3N6IA 5E2GA 4KENB 2C6WB 3FKWA 1IEMA 3MXRA 1SDEA 2ZQ9A 1KGFA 1YT4A 2JCHA 3V5MA 2Y59A 4JXWA 3M6HA 3G34A 1JWPA 3Q1FA 4FH2A 4K91A 3PBOA 4JXVA 2WUQA 4P0MA 5EPHA 5IHVA 3A3IA 4JLFA 4MBHA 4Y0UA 1IKGA 3FKVA 3VP1A 4S2LA 2OLUA 3NDEA 1IYPA 1ZG6A 1K54A 3LO7A 1EROA 1I5QA 4B4ZA 5HW3A 5M19A 1IELA 4JPMA 1FOFA 5E2HA 4OKPA 3S22A 1G6AA 4U0TA 3VSLA 3Q7VA 4WZ5C 5CTMA 2HDUA 4E3KA 2V1ZA 4R4SA 5HAIA 2EXBA 2XK1A 3BFFA 1PWGA 3WS5A 4ZBEA 1W8YA 2Y2KA 3NIAA 2ZC7A 1KE4A 1YMXA 3WS0A 4JXGA 2EFXA 2WAEA 1YMSA 5AQBA 2Z2LB 2XF3A 3S1YA 1XA7A 2X71A 5CRFA 3ITBA 1L0FA 3IF6C 3G35A 3LCEA 5HAPA 3OCNA 1GA9A 4ZJ3A 4DE0A 1BUEA 3GVBA 2EFUA 4DDSA 1ESIA 2J9PA 4CJNA 4UAAA 3PAEA 5F83A 3VP4A 3ZNYA 4XUXA 5FDHA 1ERMA 3BRMA 2XDMA 1W8QA 3GQZA 4M3KA 4QB8A 4ZJ2A 3LY3A 5FASA 1CK3A 3UPOA 2Y2JA 5JYPA 2ZQ8A 3UY6A 4KQQA 3HUMA 2HDRA 3O86A 3ZVTA 1XKZA 3PBRA 1KGEA 3MZFA 5CHUA 4P85A 3WWXA 3HL9A 4IVKA 1JTDA 4BL2A 3HUNA 4KZ5A 4LV0A 4N1HA 2VGKA 4KZ9A 4E3JA 5DVAA 5F1FA 1I2SA 4N9KA 2H10A 3WS4A 4Q8IA 5FI7A 4E3NA 3B3XA 1MWTA 3Q7ZA 3WRZA 5A92A 5CEBA 5DTSA 3WS1A 4FSFA 3SS3A 4O7DA 3E2KA 2PBYA 4D2OA 3N8SA 3FWLA 3ISGA 4WM9A 4GN2A 1K38A 2QPNA 4EQIA 3IQAA 2ZMAA 5FI6A 1ONGA 4BENA 1H8ZA 1QMEA 4FCFA 1I2WA 1IYOA 3RJUA 1E4DA 5U47A 4FH4A 2Y2IA 3Q81A 5DTKA 5TR7A 2Y2MA 4E3MA 4IBXA 4KQOA 3W4PA 2ZC4B 5L2FA 5A91A 2V20A 4GZBA 3VP3A 4QHCA 3IT9A 5EVIB 1KVLA 4OP8A 4OQGA 1JVJA 2JC7A 4X69A 5GLCA 3O3VA 3IHBA 4DE1A 4DXBA 4L0LA 5HARA 4MEZA 1FR1A 3LEZA 4GDNA 1RP5A 1YLWA 2Y91A 4U0XA 5M18A 3VP2A 2XEPA 4WMCD 3ZG5A 1LL5A 3GRJA 4GKUA 1GCEA 1L2SA 3DWZA 2G2WA 2HDQA 2WGIA 2H0YA 4WMCA 4Y0TA 3TOIA 4LV1A 1XGIA 1BLCA 1YLPA 5GHYA 2EX9A 4DKIA 3V3RA 4BLMA 1K6SA 4JXSA 4PM9A 4UHUA 4WZ5A 3E2LA 4OOLA 1GA0A 2Y55A 4B88A 5EVIC 4OLDA 1FSWA 1ES3A 3HLCA 3UPNA 4R1GA 4BQMA 2ZM8A 2V2FF 3MFDA 1IKIA 1CI9A 1C3BA 3DWKA 4LV2A 2Y2GA 4KZ4A 3IF6A 3ZG9B 1NY0A 1JTGA 4S2NC 1EI5A 1BLPA 1L0DA 1MWUA 4ZJ1A 4JBFA 2I72A 5E2EA 1DJCA 4KG6A 5CGXA 3QNBA 5A93A 3BLSA 5CTNA 5EOOA 3HBRA 2QMIA 3A3EA 3CG5A 4OLGA 3UE1A 3C4PA 2ZC6B 4EBNA 1ES5A 1W7FA 3SS5A 1TDLA 3IF6B 4WELA 4R4RA 5AQAA 1PWDA 4KZ3A 4IBRA 1WYBA 4X55A 3A3JA 5DF9A 3UE3A 2C5WB 1Z6FA 1ZG4A 4GB7A 1SHVA 1G68A 3N8LA 2G2UA 3IH9A 5G18A 4Y0OA 3TSGA 1K4FA 3BECA 4K0WA 1HD8A 4DE3A 1VQQA 1CEFA 3BM6A 3LY4A 3OCLA 4E3IA 2EX2A 3IXGA 3IWQA 2DRWA 1NYMA 2Y2LA 4RVAA 1KE0A 1TVFA 5GLAA 5KSCA 2GDNA 4EUZA 3ZCZA 5FAOA 2IWBA 3V39A 2PU2A 3EQUA 2XQZA 4HESA 5FI2A 4A5RA 1XPBA 2WKHA 3A3FA 4QY5A 4DXCA 4JF6A 3G4PA 3UPPA 3V50A 1ZC2A 3MKEA 1RGZA 3FYZA 5CHMA 3SS4A 5FQMA 3NI9A 5CECA 2OLVA 5KSHA 1H8YA 1BTLA 3IWOA 3N8RA 1MY8A 5F1GA 5EOEA 3IXDA 3G31A 3G30A 1CI8A 2ZC3B 4HBUA 4UA6A 1BULA 1E3UA 1NYYA 1U60A 4KQRA 2B5RA 2XFTA 2EX8A 2A3UA 4OPRA 3PBQA 2ZQAA 3PAGA 4OPQA 4OOYA 4K0XA 2P74A 4OQHA 4YFMA 2E8IA 1NJ4A 1PW1A 2H0TA 4GDBA 4E6XA 4FD8A 2Y2HA 1PWCA 2XD1A 3IXBA 3IXHA 2WGVA 3MZEA 4OVDA 3ZNTA 3HLFA 3C7UA 1NZOA 4PM8A 2IWDA 3W4QA 1L0GA 2H5SA 3BYDA 3UO9A 4HBTA 4GD6A 1XX2A 3AGFA 1JWZA 2WYXA 5EVID 1KDSA 5CXWA 4DDYA 1FCOA 4GOGA 4P87A 3HLDA 5EVIA 4H8RA 2R9WA 2PU4A 5HAQA 3W8KA 3M2KA 3MZDA 4S2IA 2RL3A 1K55A 1PZPA 4S2OA 1L0EA 4S2NA 2ZM2A 2WAFA 1XP4A 3EQVA 3N4IA 2XGNA 5CGWA 1VM1A 1HVBA 1O07A 3O87A 5CHJA 3HLWA 4KZAA 2ZLYA 3G32A 1ERQA 4RX3A 3IH8A 3BEBA 4PPRA 4RYEA 1KVMA 1MXOA 2UWXA 4DE2A 1NZUA 1KE3A 3DTMA 4PM7A 4QY6A 5J8XA 4LENA 2A49A 3NCKA 2Q9MA 2P9VB 2Y4AA 1J9MA 1HTZA 2VGJA 5GLBA 3MBZA 2OSUA 3OPHA 1ZKJA 4C75A 2EXAA 2WK0A 4EBLA 3SH7A 1M40A 2Q9NA 1BLHA 1NXYA 1OMEA 2BLSA 3CZDA 3O88A 3SH8A 5HL1A 2Y2QA 3C5AA 5EVLA 4RA7A 4P6BA 5E43A 3P09A 3UDFA 1AXBA 3OZHA 1MWRA 2XH9A 4BD0A 1PI5A 5HFOA 3NC8A 4IVIA 3HVFA 4N9LA 2XD5A 2Y2OA 3HLGA 5CEDA 5FQIA 3RXXA 2J7VA 3FV7A 3VOZA 3AGEA 3OPRA 1PYYA 4F94A 1WE4A 4UA7A 3IHAA 2HDSA 2DNSA 1LL9A 4KZ8A 1MPLA 4KZ6A 4X6TA 2WGWB 4ZDXA 3GV9A 1H5XA 3Q07A 4QD4A 1GHPA 2FFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBL A;  5AQ9 A;  1DY6 A;  4JKT A;  3C4O A;  3MXS A;  5TFQ A;  1JWV A;  1PW8 A;  3FZC A;  1FQG A;  1LLB A;  1XGJ A;  4ID4 A;  3BFE A;  4OQ0 A;  3D4F A;  4JF4 A;  3NY4 A;  3BFD A;  3Q82 A;  1W79 A;  2X02 A;  1BT5 A;  4Z9Q A;  1TEM A;  3IF5 A;  3OPP A;  2ZQD A;  4KG5 A;  2JE5 A;  2ZQC A;  1XXM A;  1S6R A;  4N1X A;  2XLN A;  4X56 A;  5EEC A;  2HP9 A;  4BJP A;  4OP5 A;  3S4X A;  3HRE A;  2CC1 A;  3WS2 A;  1K57 C;  5M1A A;  3W4O A;  5DTT A;  2FFF B;  4BD1 A;  1TDG A;  1W5D A;  1LI0 A;  4WEK A;  1ES4 A;  4MNR A;  4OPY A;  1CEG A;  4X68 A;  2HP5 A;  1GHI A;  3UN7 A;  1YLJ A;  3VFH A;  1E25 A;  5DF7 A;  5DF8 A;  4OOM A;  4XXR A;  4EBP A;  3GTC A;  1QMF A;  1FSY A;  1Y54 A;  5FQQ A;  4E6W A;  1MBL A;  5FQK A;  3DW0 A;  3ZHH A;  1E3U D;  4RX2 A;  3GMW A;  1Q2P A;  3QHY A;  5GHZ A;  1MKI A;  1LI9 A;  4IED A;  1PZO A;  3ZG8 B;  5KZH A;  2J9O A;  4UA9 A;  1GHM A;  4ZTK A;  1BLS A;  3Q7V B;  5A90 A;  1LHY A;  2HP6 A;  4S2J A;  2WKE A;  5CGS A;  4BL3 A;  2ZJ9 A;  2WZZ A;  5F82 A;  1BSG A;  4MBK A;  2WKI A;  2Y2P A;  5FSR A;  3WRT A;  4WEJ A;  1K56 D;  2BG1 A;  1WYC A;  4HEF A;  1XA1 A;  3ZGA B;  1K56 A;  1ESU A;  1K54 C;  1N4O A;  3UE0 A;  4QU3 A;  1SDN A;  2XR0 A;  3PBS A;  5E2F A;  4JF5 A;  5CER A;  3JYI A;  2ZQ7 A;  4OQI A;  5BOH A;  4R3B A;  5FAP A;  1FCM A;  1IYQ A;  5FAQ A;  2WZX A;  3BLM A;  4KZ7 A;  3OC2 A;  1YM1 A;  3GR2 A;  1EWZ A;  1YLY A;  1RCJ A;  2R9X A;  1BZA A;  1NRF A;  3NDG A;  3VP0 A;  3ZFZ A;  2OV5 A;  5JYO A;  2X01 A;  4MBF A;  4S2P A;  5AQ7 A;  5TGF A;  3SH9 A;  4S2K A;  4NK3 A;  5GL9 A;  3VSK A;  2JBF A;  5I94 A;  4U3T A;  1S0W A;  3UDX A;  1IYS A;  2P9V A;  1YLT A;  3CMZ A;  4EV4 A;  2IWC A;  4C3Q A;  3GSG A;  4OH0 A;  3BFC A;  5EE8 A;  3SOI A;  3UNW A;  1SKF A;  2EX6 A;  5FAT A;  3ZVW A;  1KDW A;  2ZC5 B;  3VMA A;  3UDI A;  4PMA A;  3M6B A;  2QZ6 A;  3PBN A;  3PTE A;  5EUA A;  4B4X A;  1K4E A;  4N92 A;  4PM6 A;  1DJA A;  1O7E A;  3HLB A;  4S2M A;  1Q2Q A;  4NET A;  4R0Q A;  2ZD8 A;  3BFG A;  1ALQ A;  4X53 A;  4CPK A;  4DF6 A;  3A3D A;  4WZ4 A;  4XUZ A;  5FA7 A;  1SCW A;  4MLL A;  4WYY A;  3ZG7 B;  1PIO A;  1RGY A;  3IWI A;  4WBG A;  3TG9 A;  3VFF A;  2HPB A;  4LCL A;  3AGD A;  2Y2N A;  3V3S A;  2Z2M B;  4GNU A;  3QNC A;  4GD8 A;  5FQ9 A;  4KZB A;  2WAD A;  4R3J A;  1M6K A;  1HZO A;  1K57 A;  2WGW A;  3OPL A;  4LV3 A;  4Y7P A;  5GHX A;  1K6R A;  3HUO A;  1MWS A;  2DCF A;  3VOY A;  1K25 A;  1N9B A;  3P98 A;  1YQS A;  4OON A;  1ONH A;  3M2J A;  3ZG0 A;  5HX9 A;  4QJG A;  2XFS A;  3ITA A;  4E3O A;  3RXW A;  1ES2 A;  2J8Y A;  4ZAM A;  4R23 A;  4DRT A;  3N7W A;  3C7V A;  1DJB A;  1YLZ A;  3CJM A;  3PBT A;  4C6Y A;  4E3L A;  5FQJ A;  4PM5 A;  2RCX A;  4KG2 A;  3G2Y A;  1PI4 A;  1FR6 A;  4YIN A;  3HLE A;  4OPZ A;  3I7J A;  1K55 C;  3ZDJ A;  4LCM A;  5D3O A;  4EWF A;  5KMW A;  2ZM0 A;  1KGG A;  3G2Z A;  5GLD A;  1FCN A;  3MKF A;  3N6I A;  5E2G A;  4KEN B;  2C6W B;  3FKW A;  1IEM A;  3MXR A;  1SDE A;  2ZQ9 A;  1KGF A;  1YT4 A;  2JCH A;  3V5M A;  2Y59 A;  4JXW A;  3M6H A;  3G34 A;  1JWP A;  3Q1F A;  4FH2 A;  4K91 A;  3PBO A;  4JXV A;  2WUQ A;  4P0M A;  5EPH A;  5IHV A;  3A3I A;  4JLF A;  4MBH A;  4Y0U A;  1IKG A;  3FKV A;  3VP1 A;  4S2L A;  2OLU A;  3NDE A;  1IYP A;  1ZG6 A;  1K54 A;  3LO7 A;  1ERO A;  1I5Q A;  4B4Z A;  5HW3 A;  5M19 A;  1IEL A;  4JPM A;  1FOF A;  5E2H A;  4OKP A;  3S22 A;  1G6A A;  4U0T A;  3VSL A;  3Q7V A;  4WZ5 C;  5CTM A;  2HDU A;  4E3K A;  2V1Z A;  4R4S A;  5HAI A;  2EXB A;  2XK1 A;  3BFF A;  1PWG A;  3WS5 A;  4ZBE A;  1W8Y A;  2Y2K A;  3NIA A;  2ZC7 A;  1KE4 A;  1YMX A;  3WS0 A;  4JXG A;  2EFX A;  2WAE A;  1YMS A;  5AQB A;  2Z2L B;  2XF3 A;  3S1Y A;  1XA7 A;  2X71 A;  5CRF A;  3ITB A;  1L0F A;  3IF6 C;  3G35 A;  3LCE A;  5HAP A;  3OCN A;  1GA9 A;  4ZJ3 A;  4DE0 A;  1BUE A;  3GVB A;  2EFU A;  4DDS A;  1ESI A;  2J9P A;  4CJN A;  4UAA A;  3PAE A;  5F83 A;  3VP4 A;  3ZNY A;  4XUX A;  5FDH A;  1ERM A;  3BRM A;  2XDM A;  1W8Q A;  3GQZ A;  4M3K A;  4QB8 A;  4ZJ2 A;  3LY3 A;  5FAS A;  1CK3 A;  3UPO A;  2Y2J A;  5JYP A;  2ZQ8 A;  3UY6 A;  4KQQ A;  3HUM A;  2HDR A;  3O86 A;  3ZVT A;  1XKZ A;  3PBR A;  1KGE A;  3MZF A;  5CHU A;  4P85 A;  3WWX A;  3HL9 A;  4IVK A;  1JTD A;  4BL2 A;  3HUN A;  4KZ5 A;  4LV0 A;  4N1H A;  2VGK A;  4KZ9 A;  4E3J A;  5DVA A;  5F1F A;  1I2S A;  4N9K A;  2H10 A;  3WS4 A;  4Q8I A;  5FI7 A;  4E3N A;  3B3X A;  1MWT A;  3Q7Z A;  3WRZ A;  5A92 A;  5CEB A;  5DTS A;  3WS1 A;  4FSF A;  3SS3 A;  4O7D A;  3E2K A;  2PBY A;  4D2O A;  3N8S A;  3FWL A;  3ISG A;  4WM9 A;  4GN2 A;  1K38 A;  2QPN A;  4EQI A;  3IQA A;  2ZMA A;  5FI6 A;  1ONG A;  4BEN A;  1H8Z A;  1QME A;  4FCF A;  1I2W A;  1IYO A;  3RJU A;  1E4D A;  5U47 A;  4FH4 A;  2Y2I A;  3Q81 A;  5DTK A;  5TR7 A;  2Y2M A;  4E3M A;  4IBX A;  4KQO A;  3W4P A;  2ZC4 B;  5L2F A;  5A91 A;  2V20 A;  4GZB A;  3VP3 A;  4QHC A;  3IT9 A;  5EVI B;  1KVL A;  4OP8 A;  4OQG A;  1JVJ A;  2JC7 A;  4X69 A;  5GLC A;  3O3V A;  3IHB A;  4DE1 A;  4DXB A;  4L0L A;  5HAR A;  4MEZ A;  1FR1 A;  3LEZ A;  4GDN A;  1RP5 A;  1YLW A;  2Y91 A;  4U0X A;  5M18 A;  3VP2 A;  2XEP A;  4WMC D;  3ZG5 A;  1LL5 A;  3GRJ A;  4GKU A;  1GCE A;  1L2S A;  3DWZ A;  2G2W A;  2HDQ A;  2WGI A;  2H0Y A;  4WMC A;  4Y0T A;  3TOI A;  4LV1 A;  1XGI A;  1BLC A;  1YLP A;  5GHY A;  2EX9 A;  4DKI A;  3V3R A;  4BLM A;  1K6S A;  4JXS A;  4PM9 A;  4UHU A;  4WZ5 A;  3E2L A;  4OOL A;  1GA0 A;  2Y55 A;  4B88 A;  5EVI C;  4OLD A;  1FSW A;  1ES3 A;  3HLC A;  3UPN A;  4R1G A;  4BQM A;  2ZM8 A;  2V2F F;  3MFD A;  1IKI A;  1CI9 A;  1C3B A;  3DWK A;  4LV2 A;  2Y2G A;  4KZ4 A;  3IF6 A;  3ZG9 B;  1NY0 A;  1JTG A;  4S2N C;  1EI5 A;  1BLP A;  1L0D A;  1MWU A;  4ZJ1 A;  4JBF A;  2I72 A;  5E2E A;  1DJC A;  4KG6 A;  5CGX A;  3QNB A;  5A93 A;  3BLS A;  5CTN A;  5EOO A;  3HBR A;  2QMI A;  3A3E A;  3CG5 A;  4OLG A;  3UE1 A;  3C4P A;  2ZC6 B;  4EBN A;  1ES5 A;  1W7F A;  3SS5 A;  1TDL A;  3IF6 B;  4WEL A;  4R4R A;  5AQA A;  1PWD A;  4KZ3 A;  4IBR A;  1WYB A;  4X55 A;  3A3J A;  5DF9 A;  3UE3 A;  2C5W B;  1Z6F A;  1ZG4 A;  4GB7 A;  1SHV A;  1G68 A;  3N8L A;  2G2U A;  3IH9 A;  5G18 A;  4Y0O A;  3TSG A;  1K4F A;  3BEC A;  4K0W A;  1HD8 A;  4DE3 A;  1VQQ A;  1CEF A;  3BM6 A;  3LY4 A;  3OCL A;  4E3I A;  2EX2 A;  3IXG A;  3IWQ A;  2DRW A;  1NYM A;  2Y2L A;  4RVA A;  1KE0 A;  1TVF A;  5GLA A;  5KSC A;  2GDN A;  4EUZ A;  3ZCZ A;  5FAO A;  2IWB A;  3V39 A;  2PU2 A;  3EQU A;  2XQZ A;  4HES A;  5FI2 A;  4A5R A;  1XPB A;  2WKH A;  3A3F A;  4QY5 A;  4DXC A;  4JF6 A;  3G4P A;  3UPP A;  3V50 A;  1ZC2 A;  3MKE A;  1RGZ A;  3FYZ A;  5CHM A;  3SS4 A;  5FQM A;  3NI9 A;  5CEC A;  2OLV A;  5KSH A;  1H8Y A;  1BTL A;  3IWO A;  3N8R A;  1MY8 A;  5F1G A;  5EOE A;  3IXD A;  3G31 A;  3G30 A;  1CI8 A;  2ZC3 B;  4HBU A;  4UA6 A;  1BUL A;  1E3U A;  1NYY A;  1U60 A;  4KQR A;  2B5R A;  2XFT A;  2EX8 A;  2A3U A;  4OPR A;  3PBQ A;  2ZQA A;  3PAG A;  4OPQ A;  4OOY A;  4K0X A;  2P74 A;  4OQH A;  4YFM A;  2E8I A;  1NJ4 A;  1PW1 A;  2H0T A;  4GDB A;  4E6X A;  4FD8 A;  2Y2H A;  1PWC A;  2XD1 A;  3IXB A;  3IXH A;  2WGV A;  3MZE A;  4OVD A;  3ZNT A;  3HLF A;  3C7U A;  1NZO A;  4PM8 A;  2IWD A;  3W4Q A;  1L0G A;  2H5S A;  3BYD A;  3UO9 A;  4HBT A;  4GD6 A;  1XX2 A;  3AGF A;  1JWZ A;  2WYX A;  5EVI D;  1KDS A;  5CXW A;  4DDY A;  1FCO A;  4GOG A;  4P87 A;  3HLD A;  5EVI A;  4H8R A;  2R9W A;  2PU4 A;  5HAQ A;  3W8K A;  3M2K A;  3MZD A;  4S2I A;  2RL3 A;  1K55 A;  1PZP A;  4S2O A;  1L0E A;  4S2N A;  2ZM2 A;  2WAF A;  1XP4 A;  3EQV A;  3N4I A;  2XGN A;  5CGW A;  1VM1 A;  1HVB A;  1O07 A;  3O87 A;  5CHJ A;  3HLW A;  4KZA A;  2ZLY A;  3G32 A;  1ERQ A;  4RX3 A;  3IH8 A;  3BEB A;  4PPR A;  4RYE A;  1KVM A;  1MXO A;  2UWX A;  4DE2 A;  1NZU A;  1KE3 A;  3DTM A;  4PM7 A;  4QY6 A;  5J8X A;  4LEN A;  2A49 A;  3NCK A;  2Q9M A;  2P9V B;  2Y4A A;  1J9M A;  1HTZ A;  2VGJ A;  5GLB A;  3MBZ A;  2OSU A;  3OPH A;  1ZKJ A;  4C75 A;  2EXA A;  2WK0 A;  4EBL A;  3SH7 A;  1M40 A;  2Q9N A;  1BLH A;  1NXY A;  1OME A;  2BLS A;  3CZD A;  3O88 A;  3SH8 A;  5HL1 A;  2Y2Q A;  3C5A A;  5EVL A;  4RA7 A;  4P6B A;  5E43 A;  3P09 A;  3UDF A;  1AXB A;  3OZH A;  1MWR A;  2XH9 A;  4BD0 A;  1PI5 A;  5HFO A;  3NC8 A;  4IVI A;  3HVF A;  4N9L A;  2XD5 A;  2Y2O A;  3HLG A;  5CED A;  5FQI A;  3RXX A;  2J7V A;  3FV7 A;  3VOZ A;  3AGE A;  3OPR A;  1PYY A;  4F94 A;  1WE4 A;  4UA7 A;  3IHA A;  2HDS A;  2DNS A;  1LL9 A;  4KZ8 A;  1MPL A;  4KZ6 A;  4X6T A;  2WGW B;  4ZDX A;  3GV9 A;  1H5X A;  3Q07 A;  4QD4 A;  1GHP A;  2FFY A; 
#chains in the Genus database with same CATH topology
 4I3A A;  5AQ9 A;  5HD3 A;  3T4Q A;  1XGJ A;  3OPP A;  3T50 A;  3HCY A;  5L2F A;  4N1X A;  4X56 A;  2XLN A;  2HP9 A;  2E8J A;  2CC1 A;  1K57 C;  2J3W A;  3MQQ A;  1UGU A;  1OTE A;  2HF6 A;  3UN7 A;  3OBF A;  1FSY A;  2A24 B;  1Y54 A;  1Q2P A;  2VGL S;  3Q7V B;  2WKE A;  3B47 A;  2J3T D;  4CLC D;  3D72 A;  1XA1 A;  2QKP A;  1K56 A;  1GSV A;  3UE0 A;  4QU3 A;  3LYX A;  3PBS A;  5FEF A;  1YAX A;  4EER A;  1OJ5 A;  1FCM A;  1IYQ A;  3BLM A;  2V0W A;  1YM1 A;  1EWZ A;  3VP0 A;  3EWK A;  5TGF A;  5GL9 A;  3VSK A;  3U2A A;  1IYS A;  3C8C A;  3CMZ A;  4EV4 A;  3GSG A;  3BFC A;  3UNW A;  1SKF A;  3ZVW A;  3VMA A;  4N92 A;  4DN0 A;  4NXG A;  4S2M A;  3QP2 A;  4ETZ A;  3A3D A;  4WYY A;  3L9K A;  1TD5 A;  2Y2N A;  1W63 Q;  4GNU A;  2M1C A;  2WAD A;  4R3J A;  1M6K A;  1HZO A;  4Y7P A;  2XSS A;  4L9G A;  2DCF A;  3VOY A;  5HX9 A;  4R23 A;  2GZA A;  3C7V A;  3MF0 A;  3CJM A;  3PBT A;  4E3L A;  2RCX A;  4KG2 A;  3G2Y A;  5AJG A;  1TS8 A;  2OAQ 1;  4LCM A;  3CUE A;  4NXE A;  2HZ5 A;  3VV4 A;  2ZM0 A;  5GLD A;  3MXR A;  2ZQ9 A;  5MC7 A;  1XJ3 A;  2Y59 A;  4JXW A;  2B95 A;  4K91 A;  2P04 A;  2HGV A;  1VB6 A;  4YNR A;  4Y0U A;  3VP1 A;  3NDE A;  2W3G A;  1IYP A;  4B4Z A;  1K54 A;  3LO7 A;  4JGP A;  2JKF A;  2OWH A;  4OKP A;  3NOP C;  1G6A A;  4GHI B;  3VSL A;  3NEC A;  2V1Z A;  3H9W A;  2XK1 A;  1W8Y A;  3NIA A;  5HWT A;  2X71 A;  3IF6 C;  4LLO B;  3LCE A;  3OCN A;  3TW8 A;  4DE0 A;  4DDS A;  3PAE A;  4X1M A;  1W8Q A;  3GQZ A;  1NLY A;  3CLO A;  2GX5 A;  4FOF A;  3PXP A;  3H82 A;  4DMZ A;  1XKZ A;  4L9E A;  4P85 A;  3WWX A;  1CF0 A;  4KZ5 A;  4N1H A;  3UB6 A;  3MSH A;  5DVA A;  4E3J A;  5F1F A;  3SW1 A;  2P08 A;  4B93 A;  3LR5 A;  5A92 A;  2Y79 A;  3SS3 A;  4G3V A;  2NUP C;  2QPN A;  3NOU C;  1PFL A;  3PR6 A;  4BEN A;  4QPR A;  3F1O A;  3K2N A;  4ARZ A;  5CX7 A;  1I2W A;  5U47 A;  2Y2I A;  5TR7 A;  3G6O A;  2OOL A;  4GZB A;  2JKR M;  5EVI B;  3ICY A;  1JVJ A;  2JC7 A;  3F1N A;  4ARZ B;  4BMW A;  3IHB A;  1RP5 A;  5HDC A;  3VP2 A;  1GCE A;  1L2S A;  3DWZ A;  2HDQ A;  5A8B A;  4LV1 A;  2BAS A;  4MCW A;  2NUT C;  3V3R A;  4PM9 A;  4WZ5 A;  3T4O A;  2Y55 A;  4B88 A;  5EVI C;  1P97 A;  2VLG A;  4OLD A;  4BQM A;  3UPN A;  4O0P A;  1JNU A;  3DWK A;  4KZ4 A;  1NY0 A;  4S2N C;  1MWU A;  3QP8 A;  2I72 A;  5E2E A;  1DJC A;  2KDK A;  1OTI A;  3A3E A;  3A0V A;  4R4R A;  1PWD A;  4IBR A;  3A3J A;  5DF9 A;  3UE3 A;  3VE4 A;  5EM0 A;  4Y15 A;  4Y0O A;  2VV8 A;  1CEF A;  4HOI A;  3FPW A;  4H6J A;  4X25 A;  2V1A A;  5FAO A;  4HES A;  4DXC A;  4JF6 A;  3G4P A;  3V50 A;  3FYZ A;  3E4P A;  5CHM A;  4Q0J A;  3NI9 A;  5KSH A;  1H8Y A;  1BTL A;  3KYE A;  3IXD A;  3G31 A;  1G5U A;  1LL8 A;  2A3U A;  4OPQ A;  2O9A A;  2P74 A;  1NJ4 A;  1PW1 A;  4GDB A;  4E6X A;  1Z09 A;  1W63 M;  2W1R A;  3LIB A;  3PYP A;  4PM8 A;  5HPF A;  4UQI M;  1L0G A;  3W4Q A;  3BYD A;  4PAU A;  1F9I A;  4GD6 A;  3AGF A;  3DBA A;  2W0N A;  4Y2F A;  1KDS A;  4GOG A;  4HJ3 A;  5IU1 A;  3W8K A;  4CLC B;  3M2K A;  3MZD A;  2RL3 A;  3UB5 P;  3F1P B;  3BQ8 A;  3P7N A;  2WAF A;  1VM1 A;  1HVB A;  3IX8 A;  3HLW A;  4XT2 A;  2K2N A;  3G32 A;  4I3I A;  4EU0 A;  1KVM A;  1ACF A;  1NZU A;  4L9F A;  3DTM A;  2A49 A;  4CLC C;  2P9V B;  1HTZ A;  2PR5 A;  2VGJ A;  4XT2 B;  1N9N A;  4B9O A;  5DKL A;  2OSU A;  1YSP A;  3SH7 A;  1BLH A;  1OME A;  1MC0 A;  4RA7 A;  5G4Z A;  3P09 A;  4DJ2 A;  2XH9 A;  3NC8 A;  3HVF A;  3T4S A;  4HP4 A;  1DP8 A;  3IHA A;  3H7W A;  2JKG A;  2PHY A;  4F3L B;  2WGW B;  1YKD A;  1H5X A;  1GHP A;  3JVU A;  2FFY A;  3MFX A;  3OOV A;  2LB9 A;  5L8M A;  3R4K A;  1JWV A;  4ID4 A;  4OQ0 A;  4JF4 A;  3Q82 A;  4Z9Q A;  1TEM A;  3IF5 A;  1XXM A;  4BJP A;  3GDI A;  5J4E A;  2G7U A;  4OP5 A;  3WS2 A;  2W1T B;  1TDG A;  4G3K A;  1LI0 A;  4MNR A;  4OPY A;  4X68 A;  1GHI A;  4EQ1 A;  1F5M A;  1YLJ A;  1YSQ A;  4ETX A;  3VFH A;  5DF7 A;  2Z6D A;  3LUQ A;  5FQQ A;  4BBU A;  3ZHH A;  3T1Q B;  1YPR A;  4RX2 A;  1PZO A;  5KZH A;  4KUK A;  5CGS A;  1GSW A;  2PDR A;  4HP9 A;  2O9B A;  2Y2P A;  5FSR A;  3WRT A;  4HQA A;  3S7Q A;  2ZL1 B;  3OLO A;  1WYC A;  2O9C A;  4IUH A;  5HSQ A;  4LGW A;  2WZX A;  4KZ7 A;  3OC2 A;  1RCJ A;  3KYQ A;  3ZFZ A;  1VET B;  5AQ7 A;  2JBF A;  5I94 A;  4U3T A;  1S0W A;  1Y28 A;  3UDX A;  1YLT A;  1F2K A;  2IWC A;  3SOI A;  2ZC5 B;  3UDI A;  4Y5F A;  1MKM A;  3E0Y A;  3PBN A;  4B4X A;  4PM6 A;  1Q2Q A;  5HDS A;  4DF6 A;  1SCW A;  4WLA A;  3ZG7 B;  3TG9 A;  2HPB A;  2VK3 A;  3QNC A;  4GD8 A;  1K57 A;  2D02 A;  4LV3 A;  5GHX A;  1S4S A;  3RH8 B;  1K25 A;  4D60 A;  3M2J A;  2XFS A;  4R6L A;  3RXW A;  3CHW P;  1DP6 A;  4DRT A;  2VV7 A;  2L0W A;  3HJI A;  1IFQ A;  3HLE A;  3I7J A;  1K55 C;  3KX0 X;  3ZDJ A;  2VGL M;  5KMW A;  4M4X A;  1KGG A;  2VA0 A;  2C6W B;  3BQA A;  3M6H A;  3Q1F A;  3FC7 A;  3PBO A;  3DTE A;  2WUQ A;  4P0M A;  5EPH A;  1A0K A;  3A3I A;  4JLF A;  5TJJ A;  2A24 A;  4EEP A;  4MN6 A;  3S22 A;  3Q7V A;  5DKK A;  5CTM A;  2HDU A;  4R4S A;  3WS5 A;  3DTK A;  1YMX A;  3WS0 A;  1V9Y A;  4JGR A;  3DTI A;  2EFX A;  1VEU B;  4GS9 A;  2Z2L B;  1XA7 A;  4ZRR A;  5L07 A;  3G35 A;  2P7J A;  4IHQ A;  1GA9 A;  4ZJ3 A;  2J9P A;  3TRC A;  4UAA A;  3VP4 A;  5HPI A;  5KIZ A;  4XUX A;  5FDH A;  3BY8 A;  2XDM A;  4QB8 A;  4GS9 B;  4M3K A;  1CK3 A;  3UPO A;  5JYP A;  4GJ4 A;  3UY6 A;  3HUM A;  2BTF P;  3ZVT A;  1KGE A;  3MZF A;  4IVK A;  1JTD A;  4BL2 A;  4LV0 A;  5F5Y A;  4KZ9 A;  4N9K A;  4Q8I A;  1WA9 A;  5FI7 A;  4LRY C;  3GEC A;  1MWT A;  4R38 A;  5CEB A;  5DTS A;  4FSF A;  3QP5 A;  4O7D A;  2LB5 A;  2KOI A;  4WM9 A;  3IQA A;  5FI6 A;  1QME A;  4FCF A;  4Y13 A;  5HD5 A;  1H0M A;  3CPT B;  4FH4 A;  3Q81 A;  4E3M A;  4KQO A;  4QHC A;  4HY8 A;  3MQO A;  2Y8H A;  1KVL A;  4OP8 A;  3MMH A;  4OQG A;  4X69 A;  3ZQ5 A;  4DE1 A;  4DXB A;  5DJU A;  4GDN A;  4U0X A;  4WMC D;  2JKT I;  4Z1W A;  2XRO A;  2WGI A;  1OPX A;  3V67 A;  3LI9 A;  3S7O A;  3BWL A;  3UE6 A;  1ES3 A;  3HLC A;  2ZMF A;  2V2F F;  3VOL A;  2WKR A;  1CI9 A;  3CWF A;  3IF6 A;  3ZG9 B;  3CIT A;  3HJK A;  3LR4 A;  1T18 A;  3E98 A;  1BLP A;  2HV1 A;  4JBF A;  4KG6 A;  5CGX A;  4LFU A;  3HBR A;  3CG5 A;  3C4P A;  4GHI A;  2FZ0 A;  1W7F A;  1OTD A;  3SS5 A;  1TDL A;  3IF6 B;  2PYR A;  5AQA A;  1WYB A;  3U4L P;  1Z6F A;  1SHV A;  3T4L A;  2EWW A;  2PD7 A;  3N8L A;  4WN5 A;  3E4Q A;  3KSG A;  1FIK A;  3IH9 A;  4K0W A;  1T1C A;  4DE3 A;  1VQQ A;  3OCL A;  3IXG A;  5GLA A;  2DRW A;  2Y2L A;  4RVA A;  1KE0 A;  4BBV A;  2IWB A;  2PU2 A;  4A5R A;  2XQZ A;  5FI2 A;  3UPP A;  1GSX A;  3SS4 A;  5FQM A;  2OLV A;  5EOE A;  3T1S A;  1BUL A;  1U60 A;  2HJE A;  2H0T A;  5EFW A;  4FD8 A;  2PYP A;  3ZNT A;  2WGV A;  1NZO A;  4HH2 A;  2IWD A;  5HDD A;  4I5S A;  3TE8 A;  3UO9 A;  2WKP A;  1OT6 A;  2WYX A;  4BBT A;  1S1Y A;  4P87 A;  5EVI A;  4H8R A;  1ZTU A;  3MS6 A;  2PU4 A;  4Q0H A;  5LBR A;  4S2I A;  1PZP A;  4S2N A;  2ZM2 A;  3EQV A;  1O07 A;  4MN7 A;  1ERQ A;  3IH8 A;  3BEB A;  1MXO A;  3LI8 A;  4DE2 A;  1VHM A;  4QY6 A;  2Q9M A;  5GLB A;  3D3O A;  4EXO A;  1NXY A;  2BLS A;  2W3F A;  3SH8 A;  3O88 A;  5HL1 A;  4O01 A;  2Y2Q A;  3C5A A;  4YWZ A;  1D1J A;  2FH5 A;  3OZH A;  1MWR A;  3FG8 A;  5IS1 A;  4BD0 A;  2W3E A;  2XD5 A;  2Y2O A;  1UWP X;  4EET B;  4E04 A;  3VOZ A;  4UA7 A;  1H3Q A;  3CAX A;  3UME A;  3EGD C;  3GV9 A;  3Q07 A;  3NBL A;  1S67 L;  4JKT A;  1LSX A;  3C4O A;  1DRM A;  3MXS A;  1PW8 A;  1FQG A;  2V1B A;  3BFE A;  3BFD A;  3BW6 A;  2JE5 A;  2ZQC A;  4NXF A;  1S6R A;  5EEC A;  2ZOI A;  3S4X A;  4IUK A;  3D9Y A;  4HJ6 A;  3W4O A;  5DTT A;  4BD1 A;  1W5D A;  1CEG A;  4OOM A;  3UMD A;  3GTC A;  1QMF A;  5J7E A;  1G6O A;  1MBL A;  3DW0 A;  5FL3 A;  1OTB A;  1MKI A;  1LI9 A;  3ZG8 B;  2J9O A;  4KUO A;  3IS2 B;  1GHM A;  4UA9 A;  5A90 A;  4S2J A;  3ULF A;  2L4R A;  4BL3 A;  4R3A A;  2JKR I;  1XJ6 A;  5F82 A;  1BSG A;  4MBK A;  4WEJ A;  4CLC A;  1K56 D;  2BG1 A;  4HEF A;  3F1P A;  3IBJ A;  1ESU A;  1N4O A;  1FIL A;  4JF5 A;  5CER A;  2ZQ7 A;  5BOH A;  4ME4 A;  4R3B A;  3BJN A;  1OT9 A;  5FAQ A;  3C30 A;  3KYZ A;  2AVX A;  2R9X A;  1YLY A;  2ZOH A;  2IA2 A;  1BYW A;  2X01 A;  4S2P A;  3SH9 A;  1UWN X;  4S2K A;  4NK3 A;  2YKF A;  2P9V A;  4K08 A;  1PNE A;  4C3Q A;  4OH0 A;  5EE8 A;  4PMA A;  3M6B A;  2V9A A;  3PTE A;  5EUA A;  5HWW A;  1DJA A;  2ACG A;  3HLB A;  2ZD8 A;  3BFG A;  1ALQ A;  2J80 A;  4X53 A;  4XUZ A;  2KX6 A;  4MLL A;  3LIE A;  1RGY A;  3IWI A;  5TBM B;  3A0R A;  4LCL A;  3AGD A;  3UB9 A;  4KZB A;  2GNX A;  3OPL A;  2WGW A;  4F3L A;  2D01 A;  1MWS A;  1N9B A;  3P98 A;  4OON A;  1ONH A;  3EEH A;  1Y4O A;  4QJG A;  3C38 A;  3ITA A;  3MJQ A;  1ES2 A;  4EES A;  4NEE D;  5FQJ A;  4PM5 A;  1PI4 A;  4YIN A;  3KSF A;  1F98 A;  3N6I A;  3MKF A;  2W1T A;  1IEM A;  2W3D A;  2JCH A;  3V5M A;  4JXV A;  3QP4 A;  5IHV A;  4MBH A;  2CMN A;  2OLU A;  1ZG6 A;  5HW3 A;  5M19 A;  1ERO A;  1I5Q A;  1IEL A;  1N9O A;  1STZ A;  4U0T A;  5HAI A;  2EXB A;  2ZC7 A;  1KE4 A;  4JXG A;  2WAE A;  5AQB A;  3S1Y A;  2ZL1 A;  5HAP A;  1D06 A;  4WUJ A;  5L09 A;  5F83 A;  3ZNY A;  4PKY G;  1ERM A;  3BRM A;  3JVV A;  4ZJ2 A;  3LY3 A;  4KQQ A;  2HDR A;  4P6Z S;  5EV0 A;  3PBR A;  3LEQ A;  1VET A;  3HUN A;  2XA7 S;  1I2S A;  3WS4 A;  4EUV A;  3LIC A;  4E3N A;  3B3X A;  3WRZ A;  3WS1 A;  3R7W B;  2EWV A;  3N8S A;  3FWL A;  3ISG A;  1K38 A;  4FTX A;  1ONG A;  1P0Z A;  3KO6 A;  1IYO A;  4CQH A;  3QP1 A;  5DTK A;  2Y2M A;  4IBX A;  2ZC4 B;  5K5B A;  3IT9 A;  2QJ5 A;  5GLC A;  2GJ3 A;  5HAR A;  2Y91 A;  5M18 A;  2XEP A;  1LL5 A;  3GRJ A;  4GKU A;  2G2W A;  4Y0T A;  5GHY A;  2PR6 A;  2EX9 A;  1K6S A;  4UHU A;  1T19 A;  4JGQ A;  4R1G A;  4I39 A;  1C3B A;  2Y2G A;  5DFX A;  1JTG A;  3LID A;  1L0D A;  4QWO A;  5A93 A;  3BLS A;  3VE3 A;  4EBN A;  4OLG A;  3JPU A;  1G28 A;  1ES5 A;  4KZ3 A;  1AWI A;  4MN5 A;  1VEU A;  1P9W A;  2B02 A;  2JKT M;  3TSG A;  1K4F A;  1T1B A;  3IBR A;  1HD8 A;  1NWZ A;  1IOU A;  2HJ9 C;  3BM6 A;  3LY4 A;  2PBD P;  2EX2 A;  3IWQ A;  2JHE A;  1TVF A;  2QYB A;  2GDN A;  2B18 A;  4EUZ A;  3ZCZ A;  1S4R A;  2XRN A;  3EQU A;  1XPB A;  2MJ6 A;  2WKH A;  3A3F A;  4AFI A;  5F68 A;  5CEC A;  1MY8 A;  4GCZ A;  1S66 L;  3G30 A;  2VV6 A;  4HBU A;  1NYY A;  3IX3 A;  4OPR A;  3PBQ A;  2L1M A;  2KLI A;  2V8C A;  4OQH A;  4YFM A;  2E8I A;  3B33 A;  2WKQ A;  3IXB A;  3IXH A;  4OVD A;  5DFY A;  3HLF A;  3C7U A;  3CPT A;  4I38 A;  5J3W A;  4KQD A;  5CXW A;  4DDY A;  3HLD A;  2R9W A;  3PHY A;  3L7H A;  5HAQ A;  1TS7 A;  4LPZ A;  3T1R A;  3NJA A;  4S2O A;  1LT0 A;  3LFV A;  1NRJ A;  1XP4 A;  2XGN A;  2VJW A;  5CHJ A;  3CI6 A;  4KZA A;  2ZLY A;  1P9R A;  2UWX A;  2ZMV A;  1KE3 A;  4PM7 A;  5J8X A;  4IJG A;  1EW0 A;  2H28 A;  1J9M A;  4EW7 A;  1K0K A;  4C75 A;  2EXA A;  4EBL A;  1M40 A;  1TS0 A;  5E43 A;  1AXB A;  4EEU A;  1PI5 A;  5HFO A;  4IVI A;  4N9L A;  1H8M A;  4X1L A;  5CED A;  2EA9 A;  3FV7 A;  2OWJ A;  3OPR A;  1PYY A;  4F94 A;  1WE4 A;  4YOF A;  2HDS A;  2DNS A;  1LL9 A;  4NKP A;  1MPL A;  2INW A;  4X6T A;  3ZYT A;  1X0O A;  4QD4 A;  4MMN A;  1XFN A;  5HL6 A;  4JGO A;  1DY6 A;  1CQA A;  4PKY A;  3NUL A;  5TFQ A;  3FZC A;  4O8G A;  3TJZ C;  1LLB A;  3D4F A;  3NY4 A;  1W79 A;  2X02 A;  1BT5 A;  3MR0 A;  2ZQD A;  4KG5 A;  3HRE A;  3RTY A;  5M1A A;  2FFF B;  4WEK A;  1ES4 A;  3MQ0 A;  4NG2 A;  2HP5 A;  1XJ4 A;  1E25 A;  2QWS A;  5DF8 A;  4XXR A;  4EBP A;  5AVF A;  3QP6 A;  2V0U A;  4ESP A;  5FEG A;  4E6W A;  5FQK A;  4DJ3 A;  3LR0 A;  1E3U D;  3GMW A;  3QHY A;  5GHZ A;  3KSH A;  3NOT C;  4IED A;  3CUE C;  4ZTK A;  1BLS A;  2Q0O A;  1LHY A;  2HP6 A;  5HWV A;  1XFQ A;  2ZJ9 A;  2WZZ A;  2WKI A;  5FDS A;  1PRQ A;  3ZGA B;  5HZH A;  1K54 C;  1ZHH B;  1SDN A;  2XR0 A;  5E2F A;  3JYI A;  4OQI A;  5FAP A;  2OAP 1;  3H82 B;  3GR2 A;  1SKO A;  1BZA A;  1NRF A;  2PAV P;  3NDG A;  2OV5 A;  5JYO A;  4MBF A;  3DAV A;  1DP9 A;  3MXQ A;  2EX6 A;  2I9V A;  5FAT A;  1KDW A;  1SKO B;  1ODV A;  2QZ6 A;  1K4E A;  1O7E A;  1LSW A;  3T4J A;  3B42 A;  4NET A;  4R0Q A;  4CPK A;  2QJ7 A;  4WZ4 A;  5FA7 A;  1PIO A;  4WBG A;  3F1O B;  3T4T A;  3NHQ A;  3VFF A;  1LSV A;  2M7U A;  3V3S A;  2Z2M B;  5FQ9 A;  1K6R A;  2W27 A;  4WF0 A;  3T12 B;  3HUO A;  1OTA A;  1NLZ A;  3F1N B;  3C2W A;  1YQS A;  3ZG0 A;  4E3O A;  4ZAM A;  2J8Y A;  3N7W A;  5L10 A;  1DJB A;  1YLZ A;  3T1X A;  4C6Y A;  1FR6 A;  4HJ4 A;  3S7N A;  4OPZ A;  3LGO A;  5EVE A;  5D3O A;  4EWF A;  3G2Z A;  1FCN A;  5E2G A;  4KEN B;  3FKW A;  1SDE A;  4GW9 A;  1KGF A;  1YT4 A;  3G34 A;  1JWP A;  4FH2 A;  4HI4 A;  4G3W A;  4NXB A;  2Z6C A;  2JN7 A;  3SZT A;  1IKG A;  3FKV A;  4S2L A;  5C5K A;  4JPM A;  1FOF A;  5E2H A;  2QHK A;  3IS2 A;  4WZ5 C;  3LIA A;  4E3K A;  3BFF A;  1PWG A;  4ZBE A;  2Y2K A;  1YMS A;  4FUW A;  2XF3 A;  5CRF A;  3ITB A;  1L0F A;  1BUE A;  3GVB A;  2EFU A;  4UEY A;  1ESI A;  4CJN A;  4HHD A;  4R70 A;  4H6J B;  5FAS A;  2Y2J A;  2ZQ8 A;  3O86 A;  5CHU A;  3EOI A;  3HL9 A;  1D7E A;  2VGK A;  3P01 A;  5G4Y A;  2H10 A;  3Q7Z A;  3E2K A;  3EEA A;  2PBY A;  4D2O A;  4GN2 A;  1XJ2 A;  4EQI A;  2VKS A;  3K3D A;  2ZMA A;  1H8Z A;  4HH3 A;  3KSI A;  3RJU A;  1E4D A;  5TBM A;  3W4P A;  5A91 A;  2V20 A;  3VP3 A;  2K31 A;  1MZU A;  3O3V A;  4L0L A;  4LRX C;  1N9L A;  4MEZ A;  1FR1 A;  3LEZ A;  1YLW A;  4Q0I A;  3ZG5 A;  2H0Y A;  4WMC A;  1KOU A;  3TOI A;  2J3T C;  1XGI A;  1BLC A;  1YLP A;  3UB7 A;  4DKI A;  2K7S A;  4UQI S;  2VEA A;  4BLM A;  4JXS A;  1S1Z A;  3E2L A;  2A2L A;  1GA0 A;  4OOL A;  2O0Y A;  2PT7 A;  1FSW A;  4WL9 A;  2ZM8 A;  1T1A A;  1IKI A;  3MFD A;  4LV2 A;  3S7P A;  3BY9 A;  1EI5 A;  3O5Y A;  4BWI A;  4ZJ1 A;  3QNB A;  5CTN A;  5EOO A;  2QMI A;  3UE1 A;  2ZC6 B;  4P6Z M;  4WEL A;  3T4K A;  4X55 A;  2C5W B;  5EM1 A;  2XA7 M;  1ZG4 A;  3H7W B;  4GB7 A;  2M7V A;  1G68 A;  2G2U A;  5G18 A;  3BEC A;  4HNB A;  4E3I A;  2R78 A;  1NYM A;  5KSC A;  5F69 A;  3V39 A;  1CJF A;  3RFB A;  4QY5 A;  1ZC2 A;  3MKE A;  1RGZ A;  4GLQ A;  1J3W A;  3UB8 A;  3IWO A;  3N8R A;  5F1G A;  5AVE A;  1HLU P;  1CI8 A;  2ZC3 B;  4UA6 A;  1E3U A;  3R7W A;  4KQR A;  2B5R A;  2XFT A;  2EX8 A;  4MDZ A;  3A0S A;  2ZQA A;  3PAG A;  4OOY A;  4K0X A;  1TF1 A;  1TS6 A;  3E4O A;  2Y2H A;  1PWC A;  2XD1 A;  3MZE A;  2V8F A;  2H5S A;  4HBT A;  2VZW A;  1XX2 A;  1JWZ A;  5EVI D;  1FCO A;  1OJG A;  3FPV A;  1K55 A;  5IT5 A;  2UV0 E;  3LR3 A;  1V9Z A;  1L0E A;  3W2Z A;  3N4I A;  4RQ9 A;  5CGW A;  2O99 A;  3K3C A;  3O87 A;  4RX3 A;  4RYE A;  4PPR A;  3EGX C;  4LRZ E;  4HIA A;  5DJT A;  2PRF A;  4CLC E;  1L3L A;  4LEN A;  3NCK A;  2Y4A A;  5F6A A;  2ZBB A;  3MBZ A;  3OPH A;  1ZKJ A;  2WK0 A;  2Q9N A;  4I3J A;  3CZD A;  2PD8 A;  5EVL A;  4P6B A;  3UDF A;  1SZV A;  2YKH A;  3HLG A;  3LIF A;  5FQI A;  4Y3I A;  3RXX A;  2J7V A;  3AGE A;  4Y17 A;  3IX4 A;  5I5L A;  4KZ8 A;  4KZ6 A;  4ZDX A;  4PHT A;  2DMW A;  2W3H A;  4II7 A;  2VX8 A; 
#chains in the Genus database with same CATH homology
 3NBL A;  5AQ9 A;  1DY6 A;  4JKT A;  3C4O A;  3MXS A;  5TFQ A;  1JWV A;  1PW8 A;  3FZC A;  1FQG A;  1LLB A;  1XGJ A;  4ID4 A;  3BFE A;  4OQ0 A;  3D4F A;  4JF4 A;  3NY4 A;  3BFD A;  3Q82 A;  1W79 A;  2X02 A;  1BT5 A;  4Z9Q A;  1TEM A;  3IF5 A;  3OPP A;  2ZQD A;  4KG5 A;  2JE5 A;  2ZQC A;  1XXM A;  1S6R A;  4N1X A;  2XLN A;  4X56 A;  5EEC A;  2HP9 A;  4BJP A;  4OP5 A;  3S4X A;  3HRE A;  2CC1 A;  3WS2 A;  1K57 C;  5M1A A;  3W4O A;  5DTT A;  2FFF B;  4BD1 A;  1TDG A;  1W5D A;  1LI0 A;  4WEK A;  1ES4 A;  4MNR A;  4OPY A;  1CEG A;  4X68 A;  2HP5 A;  1GHI A;  3UN7 A;  1YLJ A;  3VFH A;  1E25 A;  5DF7 A;  5DF8 A;  4OOM A;  4XXR A;  4EBP A;  3GTC A;  1QMF A;  1FSY A;  1Y54 A;  5FQQ A;  4E6W A;  1MBL A;  5FQK A;  3DW0 A;  3ZHH A;  1E3U D;  4RX2 A;  3GMW A;  1Q2P A;  3QHY A;  5GHZ A;  1MKI A;  1LI9 A;  4IED A;  1PZO A;  3ZG8 B;  5KZH A;  2J9O A;  4UA9 A;  1GHM A;  4ZTK A;  1BLS A;  3Q7V B;  5A90 A;  1LHY A;  2HP6 A;  4S2J A;  2WKE A;  5CGS A;  4BL3 A;  2ZJ9 A;  2WZZ A;  5F82 A;  1BSG A;  4MBK A;  2WKI A;  2Y2P A;  5FSR A;  3WRT A;  4WEJ A;  1K56 D;  2BG1 A;  1WYC A;  4HEF A;  1XA1 A;  3ZGA B;  1K56 A;  1ESU A;  1K54 C;  1N4O A;  3UE0 A;  4QU3 A;  1SDN A;  2XR0 A;  3PBS A;  5E2F A;  4JF5 A;  5CER A;  3JYI A;  2ZQ7 A;  4OQI A;  5BOH A;  4R3B A;  5FAP A;  1FCM A;  1IYQ A;  5FAQ A;  2WZX A;  3BLM A;  4KZ7 A;  3OC2 A;  1YM1 A;  3GR2 A;  1EWZ A;  1YLY A;  1RCJ A;  2R9X A;  1BZA A;  1NRF A;  3NDG A;  3VP0 A;  3ZFZ A;  2OV5 A;  5JYO A;  2X01 A;  4MBF A;  4S2P A;  5AQ7 A;  5TGF A;  3SH9 A;  4S2K A;  4NK3 A;  5GL9 A;  3VSK A;  2JBF A;  5I94 A;  4U3T A;  1S0W A;  3UDX A;  1IYS A;  2P9V A;  1YLT A;  3CMZ A;  4EV4 A;  2IWC A;  4C3Q A;  3GSG A;  4OH0 A;  3BFC A;  5EE8 A;  3SOI A;  3UNW A;  1SKF A;  2EX6 A;  5FAT A;  3ZVW A;  1KDW A;  2ZC5 B;  3VMA A;  3UDI A;  4PMA A;  3M6B A;  2QZ6 A;  3PBN A;  3PTE A;  5EUA A;  4B4X A;  1K4E A;  4N92 A;  4PM6 A;  1DJA A;  1O7E A;  3HLB A;  4S2M A;  1Q2Q A;  4NET A;  4R0Q A;  2ZD8 A;  3BFG A;  1ALQ A;  4X53 A;  4CPK A;  4DF6 A;  3A3D A;  4WZ4 A;  4XUZ A;  5FA7 A;  1SCW A;  4MLL A;  4WYY A;  3ZG7 B;  1PIO A;  1RGY A;  3IWI A;  4WBG A;  3TG9 A;  3VFF A;  2HPB A;  4LCL A;  3AGD A;  2Y2N A;  3V3S A;  2Z2M B;  4GNU A;  3QNC A;  4GD8 A;  5FQ9 A;  4KZB A;  2WAD A;  4R3J A;  1M6K A;  1HZO A;  1K57 A;  2WGW A;  3OPL A;  4LV3 A;  4Y7P A;  5GHX A;  1K6R A;  3HUO A;  1MWS A;  2DCF A;  3VOY A;  1K25 A;  1N9B A;  3P98 A;  1YQS A;  4OON A;  1ONH A;  3M2J A;  3ZG0 A;  5HX9 A;  4QJG A;  2XFS A;  3ITA A;  4E3O A;  3RXW A;  1ES2 A;  2J8Y A;  4ZAM A;  4R23 A;  4DRT A;  3N7W A;  3C7V A;  1DJB A;  1YLZ A;  3CJM A;  3PBT A;  4C6Y A;  4E3L A;  5FQJ A;  4PM5 A;  2RCX A;  4KG2 A;  3G2Y A;  1PI4 A;  1FR6 A;  4YIN A;  3HLE A;  4OPZ A;  3I7J A;  1K55 C;  3ZDJ A;  4LCM A;  5D3O A;  4EWF A;  5KMW A;  2ZM0 A;  1KGG A;  3G2Z A;  5GLD A;  1FCN A;  3MKF A;  3N6I A;  5E2G A;  4KEN B;  2C6W B;  3FKW A;  1IEM A;  3MXR A;  1SDE A;  2ZQ9 A;  1KGF A;  1YT4 A;  2JCH A;  3V5M A;  2Y59 A;  4JXW A;  3M6H A;  3G34 A;  1JWP A;  3Q1F A;  4FH2 A;  4K91 A;  3PBO A;  4JXV A;  2WUQ A;  4P0M A;  5EPH A;  5IHV A;  3A3I A;  4JLF A;  4MBH A;  4Y0U A;  1IKG A;  3FKV A;  3VP1 A;  4S2L A;  2OLU A;  3NDE A;  1IYP A;  1ZG6 A;  1K54 A;  3LO7 A;  1ERO A;  1I5Q A;  4B4Z A;  5HW3 A;  5M19 A;  1IEL A;  4JPM A;  1FOF A;  5E2H A;  4OKP A;  3S22 A;  1G6A A;  4U0T A;  3VSL A;  3Q7V A;  4WZ5 C;  5CTM A;  2HDU A;  4E3K A;  2V1Z A;  4R4S A;  5HAI A;  2EXB A;  2XK1 A;  3BFF A;  1PWG A;  3WS5 A;  4ZBE A;  1W8Y A;  2Y2K A;  3NIA A;  2ZC7 A;  1KE4 A;  1YMX A;  3WS0 A;  4JXG A;  2EFX A;  2WAE A;  1YMS A;  5AQB A;  2Z2L B;  2XF3 A;  3S1Y A;  1XA7 A;  2X71 A;  5CRF A;  3ITB A;  1L0F A;  3IF6 C;  3G35 A;  3LCE A;  5HAP A;  3OCN A;  1GA9 A;  4ZJ3 A;  4DE0 A;  1BUE A;  3GVB A;  2EFU A;  4DDS A;  1ESI A;  2J9P A;  4CJN A;  4UAA A;  3PAE A;  5F83 A;  3VP4 A;  3ZNY A;  4XUX A;  5FDH A;  1ERM A;  3BRM A;  2XDM A;  1W8Q A;  3GQZ A;  4M3K A;  4QB8 A;  4ZJ2 A;  3LY3 A;  5FAS A;  1CK3 A;  3UPO A;  2Y2J A;  5JYP A;  2ZQ8 A;  3UY6 A;  4KQQ A;  3HUM A;  2HDR A;  3O86 A;  3ZVT A;  1XKZ A;  3PBR A;  1KGE A;  3MZF A;  5CHU A;  4P85 A;  3WWX A;  3HL9 A;  4IVK A;  1JTD A;  4BL2 A;  3HUN A;  4KZ5 A;  4LV0 A;  4N1H A;  2VGK A;  4KZ9 A;  4E3J A;  5DVA A;  5F1F A;  1I2S A;  4N9K A;  2H10 A;  3WS4 A;  4Q8I A;  5FI7 A;  4E3N A;  3B3X A;  1MWT A;  3Q7Z A;  3WRZ A;  5A92 A;  5CEB A;  5DTS A;  3WS1 A;  4FSF A;  3SS3 A;  4O7D A;  3E2K A;  2PBY A;  4D2O A;  3N8S A;  3FWL A;  3ISG A;  4WM9 A;  4GN2 A;  1K38 A;  2QPN A;  4EQI A;  3IQA A;  2ZMA A;  5FI6 A;  1ONG A;  4BEN A;  1H8Z A;  1QME A;  4FCF A;  1I2W A;  1IYO A;  3RJU A;  1E4D A;  5U47 A;  4FH4 A;  2Y2I A;  3Q81 A;  5DTK A;  5TR7 A;  2Y2M A;  4E3M A;  4IBX A;  4KQO A;  3W4P A;  2ZC4 B;  5L2F A;  5A91 A;  2V20 A;  4GZB A;  3VP3 A;  4QHC A;  3IT9 A;  5EVI B;  1KVL A;  4OP8 A;  4OQG A;  1JVJ A;  2JC7 A;  4X69 A;  5GLC A;  3O3V A;  3IHB A;  4DE1 A;  4DXB A;  4L0L A;  5HAR A;  4MEZ A;  1FR1 A;  3LEZ A;  4GDN A;  1RP5 A;  1YLW A;  2Y91 A;  4U0X A;  5M18 A;  3VP2 A;  2XEP A;  4WMC D;  3ZG5 A;  1LL5 A;  3GRJ A;  4GKU A;  1GCE A;  1L2S A;  3DWZ A;  2G2W A;  2HDQ A;  2WGI A;  2H0Y A;  4WMC A;  4Y0T A;  3TOI A;  4LV1 A;  1XGI A;  1BLC A;  1YLP A;  5GHY A;  2EX9 A;  4DKI A;  3V3R A;  4BLM A;  1K6S A;  4JXS A;  4PM9 A;  4UHU A;  4WZ5 A;  3E2L A;  4OOL A;  1GA0 A;  2Y55 A;  4B88 A;  5EVI C;  4OLD A;  1FSW A;  1ES3 A;  3HLC A;  3UPN A;  4R1G A;  4BQM A;  2ZM8 A;  2V2F F;  3MFD A;  1IKI A;  1CI9 A;  1C3B A;  3DWK A;  4LV2 A;  2Y2G A;  4KZ4 A;  3IF6 A;  3ZG9 B;  1NY0 A;  1JTG A;  4S2N C;  1EI5 A;  1BLP A;  1L0D A;  1MWU A;  4ZJ1 A;  4JBF A;  2I72 A;  5E2E A;  1DJC A;  4KG6 A;  5CGX A;  3QNB A;  5A93 A;  3BLS A;  5CTN A;  5EOO A;  3HBR A;  2QMI A;  3A3E A;  3CG5 A;  4OLG A;  3UE1 A;  3C4P A;  2ZC6 B;  4EBN A;  1ES5 A;  1W7F A;  3SS5 A;  1TDL A;  3IF6 B;  4WEL A;  4R4R A;  5AQA A;  1PWD A;  4KZ3 A;  4IBR A;  1WYB A;  4X55 A;  3A3J A;  5DF9 A;  3UE3 A;  2C5W B;  1Z6F A;  1ZG4 A;  4GB7 A;  1SHV A;  1G68 A;  3N8L A;  2G2U A;  3IH9 A;  5G18 A;  4Y0O A;  3TSG A;  1K4F A;  3BEC A;  4K0W A;  1HD8 A;  4DE3 A;  1VQQ A;  1CEF A;  3BM6 A;  3LY4 A;  3OCL A;  4E3I A;  2EX2 A;  3IXG A;  3IWQ A;  2DRW A;  1NYM A;  2Y2L A;  4RVA A;  1KE0 A;  1TVF A;  5GLA A;  5KSC A;  2GDN A;  4EUZ A;  3ZCZ A;  5FAO A;  2IWB A;  3V39 A;  2PU2 A;  3EQU A;  2XQZ A;  4HES A;  5FI2 A;  4A5R A;  1XPB A;  2WKH A;  3A3F A;  4QY5 A;  4DXC A;  4JF6 A;  3G4P A;  3UPP A;  3V50 A;  1ZC2 A;  3MKE A;  1RGZ A;  3FYZ A;  5CHM A;  3SS4 A;  5FQM A;  3NI9 A;  5CEC A;  2OLV A;  5KSH A;  1H8Y A;  1BTL A;  3IWO A;  3N8R A;  1MY8 A;  5F1G A;  5EOE A;  3IXD A;  3G31 A;  3G30 A;  1CI8 A;  2ZC3 B;  4HBU A;  4UA6 A;  1BUL A;  1E3U A;  1NYY A;  1U60 A;  4KQR A;  2B5R A;  2XFT A;  2EX8 A;  2A3U A;  4OPR A;  3PBQ A;  2ZQA A;  3PAG A;  4OPQ A;  4OOY A;  4K0X A;  2P74 A;  4OQH A;  4YFM A;  2E8I A;  1NJ4 A;  1PW1 A;  2H0T A;  4GDB A;  4E6X A;  4FD8 A;  2Y2H A;  1PWC A;  2XD1 A;  3IXB A;  3IXH A;  2WGV A;  3MZE A;  4OVD A;  3ZNT A;  3HLF A;  3C7U A;  1NZO A;  4PM8 A;  2IWD A;  3W4Q A;  1L0G A;  2H5S A;  3BYD A;  3UO9 A;  4HBT A;  4GD6 A;  1XX2 A;  3AGF A;  1JWZ A;  2WYX A;  5EVI D;  1KDS A;  5CXW A;  4DDY A;  1FCO A;  4GOG A;  4P87 A;  3HLD A;  5EVI A;  4H8R A;  2R9W A;  2PU4 A;  5HAQ A;  3W8K A;  3M2K A;  3MZD A;  4S2I A;  2RL3 A;  1K55 A;  1PZP A;  4S2O A;  1L0E A;  4S2N A;  2ZM2 A;  2WAF A;  1XP4 A;  3EQV A;  3N4I A;  2XGN A;  5CGW A;  1VM1 A;  1HVB A;  1O07 A;  3O87 A;  5CHJ A;  3HLW A;  4KZA A;  2ZLY A;  3G32 A;  1ERQ A;  4RX3 A;  3IH8 A;  3BEB A;  4PPR A;  4RYE A;  1KVM A;  1MXO A;  2UWX A;  4DE2 A;  1NZU A;  1KE3 A;  3DTM A;  4PM7 A;  4QY6 A;  5J8X A;  4LEN A;  2A49 A;  3NCK A;  2Q9M A;  2P9V B;  2Y4A A;  1J9M A;  1HTZ A;  2VGJ A;  5GLB A;  3MBZ A;  2OSU A;  3OPH A;  1ZKJ A;  4C75 A;  2EXA A;  2WK0 A;  4EBL A;  3SH7 A;  1M40 A;  2Q9N A;  1BLH A;  1NXY A;  1OME A;  2BLS A;  3CZD A;  3O88 A;  3SH8 A;  5HL1 A;  2Y2Q A;  3C5A A;  5EVL A;  4RA7 A;  4P6B A;  5E43 A;  3P09 A;  3UDF A;  1AXB A;  3OZH A;  1MWR A;  2XH9 A;  4BD0 A;  1PI5 A;  5HFO A;  3NC8 A;  4IVI A;  3HVF A;  4N9L A;  2XD5 A;  2Y2O A;  3HLG A;  5CED A;  5FQI A;  3RXX A;  2J7V A;  3FV7 A;  3VOZ A;  3AGE A;  3OPR A;  1PYY A;  4F94 A;  1WE4 A;  4UA7 A;  3IHA A;  2HDS A;  2DNS A;  1LL9 A;  4KZ8 A;  1MPL A;  4KZ6 A;  4X6T A;  2WGW B;  4ZDX A;  3GV9 A;  1H5X A;  3Q07 A;  4QD4 A;  1GHP A;  2FFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...