4P85A

Crystal structure of est-y29, a novel penicillin-binding protein/beta-lactamase homolog from a metagenomic library
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
390
structure length
390
Chain Sequence
b'SMPDLLTNVAENYVNQDLFAGIEWRIDQDGKPIFQGCAGVKDIETRTFIPKNAIYRIYSMTKPIVSFLAMMLIERGVFRLSSPIQNFDPRFKSMKVIDQHAHIEPATALITIEHLLTHQAGFSYDFSLGCPISAHYRDAQLIEDGGRDLTDMMGVLAELPLVFHPGTQWKYSISTDVLAHIIECATGERVDDLLQRLIFDPLDMQDTGFSLPLDGASRLMEVYGMRSLHGLPALKPAPHVLVPADLGSSHPTDDPDFRRGGHGLYSTLDDYMAFANMLLSGQTPEGETLLSPAVLKLALAPRVHFGARGMRINDEPFAGYSWNLLGRVMTDVGAAAYATHLGEFGWSGAAATYFWVDPTKNMTGCVMTQFLGSQHPIGSDMQAAAMSMLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Est-Y29
publication title Crystallographic analysis and biochemical applications of a novel penicillin-binding protein/ beta-lactamase homologue from a metagenomic library.
pubmed doi rcsb
source organism Metagenome
molecule tags Hydrolase
total genus 124
structure length 390
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4p85A00
4JPMA 2WZZA 1YMSA 3IF6B 5AQAA 4K91A 1YQSA 4N9LA 2Y2KA 1K6SA 2CC1A 1GHMA 3HLDA 3Q07A 1XXMA 4MBKA 2IWDA 5M18A 5FASA 1GA0A 4GN2A 1GA9A 3HLEA 3S22A 1W8QA 3A3EA 5E2FA 3FWLA 1NYYA 1MWRA 5L2FA 5DVAA 3HUNA 3FV7A 4WYYA 5GLCA 4N92A 2V2FF 2VGKA 4OP8A 5EVIC 1ZKJA 2HDSA 2Y55A 3VOYA 3B3XA 2PU4A 3BFGA 3C4PA 1L2SA 4BD0A 1WYCA 3UPOA 1E3UA 1PW1A 3LY3A 4LCMA 4OOMA 4BL2A 2UWXA 4RVAA 4MNRA 4LV2A 3HLGA 3A3DA 3WS4A 1NZUA 1XGJA 1MY8A 5GLAA 3WS0A 3FZCA 1Q2QA 1DJCA 3IXBA 1K25A 2ZM0A 2OLUA 4WEJA 2XDMA 3I7JA 4R3BA 5E43A 2IWCA 1ALQA 3PBQA 2ZQAA 4HESA 3WRZA 2ZC6B 1G6AA 4ZJ3A 4GKUA 4OPQA 4E6XA 4S2MA 1Z6FA 5KSCA 2HDRA 5CGWA 2WAEA 1XP4A 4MBFA 4JBFA 3N4IA 4R1GA 4MEZA 3W4QA 5CEBA 4KQQA 1HD8A 3GTCA 4Y0TA 1FOFA 3O87A 4S2LA 4WM9A 3A3IA 3C4OA 4ZJ2A 3W4OA 1NY0A 2P74A 3FKVA 4OOYA 5EVIA 2C5WB 1YLTA 2HP6A 1W5DA 4IBXA 4PM9A 1ES5A 1K56A 2A3UA 4Y0OA 4IVIA 3PAGA 2PBYA 4A5RA 1IYPA 2DCFA 4PM5A 1ZG6A 3VP3A 3HUMA 2QPNA 1MKIA 2XFTA 4IBRA 3TSGA 2FFFB 4LENA 3IH9A 3VFHA 5A92A 3AGDA 1E3UD 5HX9A 3HLCA 1GCEA 3GVBA 3HL9A 4X53A 3VP0A 1YLWA 1NJ4A 3NCKA 1L0FA 5KZHA 3SS4A 4OKPA 5AQ7A 4S2IA 3ZG5A 2ZC5B 2XK1A 3G4PA 3MKFA 2ZQDA 4KENB 1KGEA 3M2KA 4FH4A 4OQIA 4MLLA 4Y7PA 4OPRA 4D2OA 3ZG0A 1K4FA 2ZLYA 4RYEA 1HTZA 1SCWA 4FCFA 4KZ3A 4GNUA 4U0XA 1AXBA 3LCEA 4DE0A 1DJAA 4JXSA 2X01A 3BFEA 1YM1A 4M3KA 1ES2A 4C75A 3GSGA 3VFFA 3UPNA 3N6IA 5FQQA 1YLJA 3HLFA 1I5QA 2JE5A 3LO7A 4E6WA 5GL9A 2VGJA 3V39A 4Q8IA 1ESUA 4OP5A 4X55A 1QMFA 3OPPA 1K56D 3PAEA 2HDUA 4EBLA 5CXWA 2C6WB 2OSUA 4S2NA 2XD1A 3Q7VB 3E2KA 4ID4A 1BULA 4BQMA 4KZAA 1IKIA 3OPHA 3MKEA 4JKTA 3SH8A 5BOHA 1BLCA 3Q81A 2P9VA 3ZNTA 4F94A 3MBZA 2WAFA 2ZM8A 3DTMA 3DW0A 3HUOA 4GOGA 5DF8A 2HP9A 3FYZA 2WADA 3MZEA 5A93A 3Q1FA 1KGFA 3IHAA 3ZFZA 5F83A 1CI9A 3GRJA 1FSYA 2Y2QA 5CGSA 3ISGA 2J8YA 4KG5A 4GB7A 2EX2A 5CHMA 1XX2A 4GDNA 4C6YA 4WEKA 4OPZA 4WZ4A 3M6BA 2WKIA 1IELA 3UDXA 4FD8A 4P6BA 3Q82A 1TVFA 3RXXA 1IYSA 1DJBA 1K55A 1ZG4A 3IHBA 5FAQA 1PIOA 5FATA 2ZQ8A 3MXRA 2H0TA 5I94A 2RCXA 3BFDA 4H8RA 1Y54A 3SOIA 4R4RA 3EQVA 3IXHA 4HBUA 4WZ5A 3UN7A 2ZM2A 3ZG9B 1M40A 3SH7A 3NDEA 3Q7VA 1BLPA 4B88A 4E3MA 5FQMA 3UE3A 2ZQCA 1PI5A 5EOEA 2G2UA 2R9XA 4K0WA 3ZVTA 3M2JA 3N8LA 3CZDA 3CG5A 3VSKA 3WS1A 1LI9A 4JXVA 4CJNA 1WE4A 3IH8A 5HAPA 4UA7A 1KE3A 4N9KA 5DTTA 3OC2A 4UHUA 1N4OA 2OV5A 4GDBA 1EI5A 4XUXA 4FSFA 1S0WA 5FQKA 5KMWA 3A3JA 2ZJ9A 5G18A 1FR6A 2ZQ7A 3MXSA 4R23A 4S2OA 5A91A 2WGIA 1BTLA 1FCOA 1IEMA 3MZFA 2XFSA 3IF6A 3UNWA 5CEDA 3G32A 5F82A 4X6TA 3G34A 1OMEA 1XA7A 1SKFA 1JTDA 1W8YA 2XR0A 2WKHA 5F1FA 3VMAA 4UAAA 3BLMA 5E2GA 3UDIA 3OCNA 1KGGA 1JVJA 1QMEA 2JC7A 4BJPA 1K57A 4OH0A 1L0DA 3NDGA 5CGXA 1ES3A 2XD5A 5AQBA 1MWUA 1KE0A 2EFUA 2H10A 4Y0UA 3NBLA 5EECA 4RX2A 1CEGA 2BLSA 3UE1A 4KZ6A 4RA7A 1PW8A 4WELA 5DF7A 4DXCA 3VOZA 4S2NC 4EQIA 4JLFA 1U60A 1FR1A 1L0GA 2OLVA 2A49A 4U3TA 3C5AA 4C3QA 3DWKA 1K38A 3WRTA 3IWIA 4ZAMA 3N8SA 4EBPA 5FAPA 4EUZA 1NYMA 2Y91A 4JXGA 4BD1A 5GLBA 1Q2PA 3IT9A 3V5MA 5HL1A 4BENA 4BLMA 4EV4A 4GD6A 5J8XA 3ZHHA 2Q9NA 2XLNA 4X68A 4ZDXA 2HPBA 4JXWA 3SH9A 3ITAA 3IF5A 3HLWA 2B5RA 1NXYA 3AGEA 1FQGA 3SS3A 1K6RA 3O3VA 1MBLA 1NZOA 3WS2A 1C3BA 2RL3A 3VP4A 4B4ZA 3V50A 2FFYA 2Y2GA 1K55C 3GV9A 1CI8A 3BLSA 1BT5A 2X02A 3AGFA 3LY4A 5FDHA 1N9BA 4HBTA 3JYIA 3C7UA 4N1XA 3CJMA 4OQHA 5EVLA 4WZ5C 2DRWA 5JYPA 3DWZA 3RXWA 1RCJA 3IWQA 5HFOA 5F1GA 1G68A 1XGIA 1MWTA 3G2ZA 1KE4A 1ONHA 5CTMA 3PBSA 4YINA 1PWCA 4E3IA 5A90A 1J9MA 4MBHA 1PZPA 1MPLA 3QNCA 4QU3A 1E4DA 2BG1A 3LEZA 3OCLA 5JYOA 4KG2A 4YFMA 3BRMA 1JWPA 2EFXA 3Q7ZA 1BSGA 2HP5A 1MXOA 2Z2MB 5CHUA 5FAOA 1JWVA 2JCHA 4UA6A 3IF6C 5AQ9A 2ZQ9A 1SDEA 2WZXA 1VM1A 5U47A 1M6KA 4KQOA 5TR7A 4JF5A 3S4XA 1TEMA 3S1YA 4E3LA 2XGNA 4WBGA 3BECA 4OLGA 4OVDA 1ES4A 4U0TA 4R4SA 1K57C 2H5SA 1EWZA 3G31A 5CRFA 3E2LA 4IEDA 1LLBA 2ZC7A 4HEFA 3EQUA 1NRFA 4KZBA 4LCLA 2GDNA 3GQZA 3UY6A 1FCMA 1BZAA 4DKIA 2IWBA 1HVBA 2XF3A 3OZHA 5M19A 3N8RA 4KZ8A 2EX8A 1CK3A 5CECA 2H0YA 3C7VA 5EVIB 4KZ5A 5DTKA 4JF4A 4N1HA 1O7EA 3VP1A 5DTSA 1BLHA 2WUQA 4PM6A 4X56A 1E25A 1I2WA 5D3OA 2E8IA 5E2HA 5GHXA 3PBOA 4WMCA 1XPBA 1W79A 2J9OA 2J7VA 3BFCA 2JBFA 3HLBA 1XA1A 4Z9QA 2WKEA 3UO9A 3W4PA 5HAQA 3ZCZA 4EBNA 1MWSA 5GHYA 3WS5A 4E3NA 3IXGA 1TDGA 4QD4A 1IKGA 3M6HA 3P98A 3TG9A 2J9PA 1PI4A 2Y2LA 3ZG8B 4DE1A 3ZG7B 3PBNA 4RX3A 4FH2A 1JTGA 3P09A 1H8YA 1KVMA 2EXAA 4OLDA 3FKWA 3ZDJA 3ITBA 2Q9MA 3IXDA 4LV3A 4OPYA 2XEPA 1PYYA 3VSLA 2Y2JA 2Y4AA 1LI0A 4PM8A 4DE3A 5FQ9A 3BFFA 2EX6A 3BEBA 1FSWA 2XQZA 5KSHA 2R9WA 3MFDA 4KZ4A 4BL3A 1ONGA 4CPKA 3PBTA 2Y59A 4O7DA 1EROA 2DNSA 4ZBEA 1ZC2A 1BLSA 2WGWB 2ZD8A 4L0LA 3GR2A 4LV1A 3V3RA 1L0EA 1KVLA 1GHPA 3HBRA 3PTEA 3OPLA 4E3KA 4OQGA 5HW3A 2EX9A 3ZVWA 3IWOA 4DF6A 2Y2OA 3G30A 2WK0A 3NY4A 4S2PA 5FI2A 4DE2A 4EWFA 4DDSA 3BYDA 5CERA 3TOIA 1LHYA 2XH9A 5EUAA 1IYQA 1LL9A 5IHVA 3CMZA 4R3JA 3O86A 1SDNA 5FI6A 5FI7A 4ZTKA 5HARA 1RP5A 5FQIA 2HDQA 2I72A 2V20A 2X71A 4WMCD 4QY6A 1CEFA 5EOOA 1K54C 5E2EA 5CTNA 1H8ZA 4X69A 1JWZA 1PZOA 3QNBA 4P85A 1KDWA 2Y2NA 1KDSA 1FCNA 1H5XA 3PBRA 4KZ7A 1XKZA 4PM7A 4ZJ1A 4OQ0A 3IQAA 2ZMAA 4PPRA 2P9VB 3N7WA 1VQQA 4E3OA 1K4EA 1SHVA 3OPRA 5EE8A 4JF6A 5FSRA 4DXBA 1S6RA 3NIAA 3MZDA 4KZ9A 5HAIA 2Y2MA 2Y2HA 4DDYA 4LV0A 1IYOA 4UA9A 1RGZA 2EXBA 4GD8A 3V3SA 5GHZA 4QHCA 4S2KA 1ESIA 1PWGA 5FQJA 1YT4A 2WGWA 4DRTA 4NETA 3WWXA 2QMIA 3G2YA 1DY6A 3D4FA 3NC8A 3QHYA 4XUZA 5EPHA 2ZC3B 3UDFA 3VP2A 3W8KA 3UE0A 2G2WA 1I2SA 2V1ZA 4QY5A 4KG6A 4P0MA 1RGYA 1YLZA 3BM6A 4R0QA 4S2JA 3RJUA 1PWDA 1TDLA 4QB8A 1YLYA 5DF9A 5EVID 1GHIA 4K0XA 3ZGAB 1K54A 4OONA 5TFQA 4KQRA 1BUEA 3A3FA 4NK3A 3ZNYA 2Y2PA 5FA7A 5GLDA 2Y2IA 2ZC4B 5M1AA 4PMAA 1LL5A 1YMXA 2PU2A 4GZBA 1ERMA 3HVFA 3UPPA 4P87A 2QZ6A 2Z2LB 4IVKA 1WYBA 5CHJA 3NI9A 3GMWA 1HZOA 1O07A 4QJGA 2WYXA 1W7FA 4XXRA 3HREA 2WGVA 4B4XA 1YLPA 3SS5A 4OOLA 5TGFA 4E3JA 3O88A 3G35A 1ERQA
chains in the Genus database with same CATH superfamily
3IF6B 1YMSA 2Y2KA 1K6SA 1LL8A 3CPTA 5M18A 3KSIA 5FASA 1GA0A 4GN2A 1W8QA 5E2FA 3FWLA 3HUNA 2VGKA 5EVIC 4DN0A 3BFGA 3C4PA 1L2SA 4OOMA 4LPZA 1Y4OA 4Y3IA 4WUJA 3A3DA 1D1JA 3DTKA 1MY8A 5GLAA 4WEJA 5DJUA 4NXFA 2IWCA 3WRZA 2XRNA 4HESA 1G6AA 3R4KA 4ZJ3A 4GKUA 4OPQA 5CGWA 4MBFA 4JBFA 4S2LA 4EEPA 1OT9A 2QYBA 4WM9A 2VV8A 3A3IA 2P74A 3FKVA 4OOYA 1VETA 1YLTA 2HP6A 3B42A 1ES5A 2A3UA 2DCFA 1ZG6A 3TSGA 3IH9A 5A92A 4MN5A 5HX9A 1GCEA 3GVBA 1NJ4A 4GLQA 2VA0A 3E0YA 4Y15A 3SS4A 1OT6A 3KSFA 3T4JA 5AQ7A 3FPWA 4OQIA 3M2KA 1SCWA 4GNUA 3EGDC 4GJ4A 1AXBA 1DJAA 2PYPA 5L8MA 4IUKA 3GSGA 3VFFA 1LSVA 1YLJA 1I5QA 5FL3A 3V39A 3C38A 5CXWA 4NXEA 2OSUA 3Q7VB 4ID4A 3JVVA 4QPRA 4BQMA 4KZAA 3LR4A 3SH8A 1BLCA 2P9VA 4IHQA 2BASA 1EW0A 3MZEA 3DTEA 1DP6A 1FSYA 3IX3A 1XX2A 4C6YA 4OPZA 3LGOA 1OJGA 1IELA 3Q82A 1TVFA 3RXXA 1K55A 1NWZA 3L7HA 5F68A 5I94A 2H0TA 4I3IA 4R4RA 3EQVA 3UN7A 4Y13A 3SH7A 4R3AA 5FQMA 3UE3A 1PI5A 4HQAA 5EOEA 2R9XA 5L10A 3N8LA 1KOUA 5DTTA 4MCWA 4UHUA 3LIEA 3F1PA 3BWLA 2ZJ9A 4R23A 1ZTUA 4S2OA 1BTLA 1FCOA 1IEMA 3MZFA 1LSWA 1OTAA 3G32A 1OMEA 1DP9A 2XR0A 3B33A 3LUQA 3T4OA 4BJPA 3F1OA 5CGXA 1ES3A 3LFVA 3T12B 2O9AA 5EECA 4RX2A 4UEYA 4RA7A 1IFQA 5G4YA 1FR1A 1L0GA 3NULA 3C5AA 5FDSA 3DWKA 3WRTA 3IWIA 4EUZA 2QWSA 4UQIS 3NECA 3TRCA 3ZHHA 2Q9NA 2HPBA 4ARZA 5J7EA 3HLWA 3H9WA 1NXYA 1TS7A 3SS3A 3WS2A 2O99A 3V50A 5FDHA 2X02A 1N9BA 1OJ5A 2XA7S 5FEFA 1GSVA 3CPTB 4WZ5C 3DWZA 2HF6A 1RCJA 2VZWA 5F1GA 1A0KA 1G68A 1MWTA 4E3IA 5A90A 3IX8A 2Q0OA 1E4DA 3LEZA 1DP8A 3RTYA 1JWPA 3Q7ZA 2XSSA 2W3FA 2R78A 1JWVA 4IUHA 2KOIA 1VM1A 5TR7A 4JF5A 3D3OA 3S7OA 2XGNA 2EWVA 4WBGA 2O9CA 4R4SA 2H5SA 4XT2A 5CRFA 3E2LA 3NHQA 1LLBA 3EQUA 1NRFA 1AWIA 2W0NA 4CLCD 1HVBA 4WN5A 5L07A 4JGOA 2XROA 2J3WA 5DTKA 4LRZE 5F6AA 4F3LA 3ZCZA 1MWSA 5GHYA 3IXGA 1TDGA 2K7SA 4QWOA 5DKLA 1UWNX 3ZG7B 4RX3A 4R38A 3P09A 1H8YA 3FKWA 4OPYA 3ITBA 3BY9A 3MQ0A 4MDZA 3MFDA 4BL3A 2W3DA 3BY8A 1ZC2A 2A24A 2ZD8A 3V3RA 4CLCC 4L9FA 4YNRA 1GHPA 3OPLA 4E3KA 3H82A 3IWOA 3NY4A 4DE2A 5FI2A 3RH8B 3BYDA 1LHYA 2B02A 3CMZA 4R3JA 3O86A 1SDNA 2INWA 4X1MA 5FQIA 2HDQA 2I72A 2V20A 3S7QA 2X71A 3UB7A 5E2EA 3T1RA 4X69A 5HD3A 2W27A 1KDWA 4P85A 2Y2NA 2JKRM 1H5XA 2O0YA 4PM7A 3K2NA 2P9VB 1P97A 3N7WA 1K0KA 4DXBA 1S6RA 3CUEA 4KZ9A 1VHMA 5G4ZA 4UA9A 3MSHA 1RGZA 4HHDA 4NETA 2QMIA 3G2YA 3D4FA 3CHWP 4M4XA 1N9NA 5DKKA 2OOLA 2GNXA 4LGWA 4P0MA 1YLZA 3NOPC 3RJUA 1TF1A 1TD5A 1TDLA 3ZGAB 3MFXA 4KQRA 4PAUA 5TJJA 3A3FA 4NK3A 1VB6A 4GZBA 2QZ6A 5HDCA 3GMWA 3T1QB 3HREA 4FOFA 1Z09A 4OOLA 3G35A 2JHEA 5AQAA 2PHYA 4K91A 3E98A 4N9LA 1GHMA 4MBKA 1XXMA 3HLEA 3ICYA 1NYYA 3F1OB 2GX5A 3MMHA 5GLCA 2HDSA 3VOYA 2PU4A 1E3UA 1PW1A 4LCMA 1S66L 4I38A 2PR6A 3FZCA 1DJCA 2NUTC 3DBAA 5L09A 3PBQA 2ZC6B 2K31A 1Z6FA 3ULFA 4ARZB 5MC7A 4R1GA 3N4IA 4MEZA 2QJ5A 3GTCA 2K2NA 2L4RA 1K56A 4Y0OA 4KUKA 3PAGA 3HUMA 1S1YA 1MKIA 4LENA 3EWKA 3VFHA 1G28A 3EOIA 3HLCA 1YLWA 3NCKA 4HP4A 4S2IA 4II7A 5EM1A 4BBTA 2ZQDA 1KGEA 3QP6A 4D2OA 1K4FA 2Y79A 2ZMVA 3LR5A 4JXSA 4B93A 1ES2A 4IJGA 3N6IA 3HLFA 2JE5A 3VOLA 4XT2B 4Q8IA 3K3CA 4X55A 5IS1A 3OPPA 2XD1A 3E2KA 1Y28A 1IKIA 3OPHA 1PRQA 3MKEA 3H7WA 4JKTA 4HP9A 2UV0E 3FG8A 4EERA 5BOHA 3Q81A 4F94A 2XA7M 2G7UA 3MBZA 3OOVA 5F5YA 4GOGA 2HP9A 4F3LB 1GSWA 4DMZA 1KGFA 3IHAA 5F83A 1SZVA 3GRJA 5CGSA 1TS6A 3ISGA 4KG5A 2EX2A 5CHMA 4GDNA 5HZHA 2WKIA 3UDXA 4GS9A 3EGXC 3MXRA 2Y8HA 2A24B 3SOIA 4PKYA 1TS8A 2FH5A 2ZM2A 5LBRA 3ZG9B 3H82B 3NDEA 1NRJA 4B88A 4E3MA 2ZQCA 4CJNA 2V8CA 3IH8A 5HAPA 3NJAA 1H8MA 4N9KA 1N4OA 1EI5A 3MR0A 4XUXA 5FQKA 2OAQ1 2ZQ7A 4EQ1A 2XFSA 5F82A 2W1RA 4Z1WA 4X6TA 3G34A 4NXGA 1SKFA 1W8YA 5F1FA 4UAAA 3BLMA 2D02A 3OCNA 1IOUA 1JVJA 1QMEA 2JC7A 3T50A 1H3QA 3HJKA 1K57A 1L0DA 3NDGA 5HWTA 2H10A 4WLAA 1CEGA 4DXCA 4S2NC 1F98A 5HDDA 1U60A 1X0OA 3W2ZA 2W1TA 3N8SA 2Y91A 2WKQA 4JGQA 4KUOA 5C5KA 1FILA 4BLMA 4EV4A 5J8XA 2XLNA 1G6OA 4JXWA 3U2AA 3SH9A 3ITAA 2B5RA 2PD7A 1VEUA 1K6RA 1MBLA 1NZOA 1C3BA 2RL3A 2FFYA 2B95A 1BT5A 1XFNA 3SW1A 4GHIA 1GSXA 3C7UA 4N1XA 5EVLA 3VE3A 5JYPA 2VK3A 5CTMA 4YINA 1J9MA 4Y17A 1PZPA 1MPLA 3QNCA 4QU3A 2P04A 1H0MA 2BG1A 3BRMA 3SZTA 1MXOA 2Z2MB 1N9OA 3R7WA 3MXQA 3K3DA 2JCHA 3IF6C 5AQ9A 2AVXA 5U47A 2D01A 3L9KA 3CI6A 4OLGA 5HPIA 3E4QA 4KZBA 2ZC7A 4LCLA 2GDNA 1FCMA 4DKIA 3KYEA 3IBRA 2LB5A 2EX8A 5CECA 2H0YA 3E4OA 5DFXA 5DTSA 5E2HA 4PM6A 5GHXA 3PBOA 2J9OA 2JKTI 3MQQA 3BFCA 2JBFA 3HLBA 5HAQA 3W4PA 1YSQA 4PHTA 3O5YA 4E3NA 2J9PA 5EM0A 3NOTC 2VKSA 1KVMA 4ETZA 2Q9MA 1PYYA 2HV1A 2Y2JA 4PM8A 4DE3A 5FQ9A 3BEBA 2VX8A 5KSHA 2R9WA 1ONGA 3PBTA 1HLUP 4OQGA 3CWFA 2Y2OA 3G30A 4S2PA 4DDSA 3TOIA 5IHVA 1OTIA 5AVEA 5HARA 4ESPA 1PNEA 1RP5A 1CF0A 2O9BA 4WMCD 4QY6A 1JWZA 3QNBA 3H7WB 4KZ7A 4GW9A 4ZJ1A 4HH3A 2HJEA 1SHVA 3OPRA 4HJ3A 5FSRA 5HPFA 3FC7A 5TBMB 3LR3A 5HAIA 2Y2HA 4DDYA 1IYOA 4EW7A 3G6OA 3V3SA 5GHZA 1PWGA 5FQJA 2WGWA 4DRTA 1OTBA 3WWXA 3QHYA 3UDFA 3W8KA 1ZHHB 2G2WA 4NKPA 4HJ6A 1YLYA 4P6ZS 1GHIA 4K0XA 1K54A 2PDRA 1N9LA 1BUEA 2Y2PA 5GLDA 2Y2IA 2ZC4B 5M1AA 2VV6A 1LL5A 3LICA 3QP1A 1ERMA 2V0UA 4IVKA 2W3GA 4O8GA 1HZOA 1F5MA 4O01A 4QJGA 1YSPA 2WYXA 2M7VA 3QP4A 2WGVA 4B4XA 3LIFA 4E3JA 3ZYTA 4LV1A 1G5UA 2OWJA 3D9YA 3HLDA 1LSXA 2WKPA 2DMWA 4FTXA 3A3EA 1VETB 1MWRA 5L2FA 5DVAA 3EEAA 4WYYA 4OP8A 3B3XA 3T4KA 2ZOHA 4MNRA 2B18A 4GCZA 2W1TB 1ODVA 1NZUA 1XGJA 1XJ3A 3WS0A 1P9WA 4BWIA 3IXBA 2V1BA 2EWWA 2OLUA 2XDMA 1ALQA 4E6XA 4S2MA 5IT5A 2HDRA 1OPXA 1D7EA 3W4QA 5CEBA 4KQQA 1HD8A 4Y0TA 3O87A 1VEUB 4HY8A 3C4OA 4ZJ2A 3W4OA 3CAXA 4IBXA 4PM9A 3QP5A 4A5RA 2PBYA 4HH2A 4PKYG 4PM5A 4GHIB 1W63Q 2GJ3A 2QPNA 2XFTA 3TE8A 3AGDA 1XJ4A 3HL9A 5KZHA 4MN6A 4OKPA 4Y5FA 2I9VA 3ZG5A 2ZC5B 2XK1A 3G4PA 3MKFA 2A2LA 4MLLA 4Y7PA 4Y2FA 3ZG0A 2ZLYA 2P7JA 2KX6A 4RYEA 3IS2A 4FCFA 4KZ3A 4U0XA 1S4RA 1NLYA 3PXPA 4DE0A 2X01A 3BFEA 1YM1A 4M3KA 2E8JA 3UMEA 4C75A 4JGPA 3UPNA 5FQQA 4E6WA 5GL9A 2VGJA 3LIBA 4OP5A 1QMFA 3BQAA 3F1NA 3PAEA 3U4LP 4EBLA 1XJ2A 3ZNTA 2WAFA 3BQ8A 3F1PB 3Q1FA 3T4SA 2Y2QA 2J8YA 5DJTA 1T1CA 1ACFA 4WEKA 3M6BA 3IHBA 5FAQA 1PIOA 5FATA 2NUPC 2ZQ8A 2RCXA 3BFDA 4H8RA 4HBUA 3IXHA 4WZ5A 2PT7A 3Q7VA 1BLPA 2HZ5A 4K08A 3ZVTA 1OTDA 3M2JA 3VSKA 1LI9A 1WE4A 3A0SA 4UA7A 1P9RA 3LIDA 3LI9A 3OC2A 4GDBA 4FSFA 1S0WA 4AFIA 3MXSA 5CEDA 1WA9A 1UWPX 1XA7A 2HGVA 1MZUA 3KX0X 2WKHA 3VMAA 3JVUA 3UDIA 1KGGA 2XD5A 5AQBA 1MWUA 1KE0A 2EFUA 3NBLA 1S4SA 1V9YA 2BLSA 2QKPA 3UE1A 3V67A 5DF7A 2OLVA 1K38A 4ZAMA 4EBPA 1NYMA 4JXGA 4BD1A 1Q2PA 2PBDP 5HL1A 4BENA 4ZDXA 3MJQA 3NOUC 3AGEA 3C30A 3O3VA 3VP4A 4B4ZA 1K55C 1CI8A 3BLSA 3BW6A 3LY4A 4R70A 4CLCA 4HBTA 4OQHA 3CJMA 2Z6CA 3OLOA 3MF0A 5F69A 3UMDA 4H6JA 3PBSA 2JN7A 4X1LA 5JYOA 4YFMA 2HP5A 4HNBA 1STZA 3UE6A 5HD5A 1FIKA 3KO6A 4P6ZM 3S4XA 1TEMA 3S1YA 4NEED 2VEAA 3T1XA 4OVDA 4U0TA 3G31A 1EWZA 4BBUA 4HEFA 2ZMFA 3GQZA 3UY6A 3BJNA 2IWBA 3OZHA 3C7VA 4KZ5A 4JF4A 2YKFA 1O7EA 3VP1A 3A0RA 2WUQA 1I2WA 1XPBA 4Z9QA 5AVFA 4EBNA 2HJ9C 4QD4A 1PI4A 2Y2LA 3ZG8B 4FH2A 5FEGA 1XFQA 2EXAA 3ZDJA 2V8FA 3IXDA 2Y4AA 5J4EA 4NXBA 3BFFA 2EX6A 1FSWA 2XQZA 4KZ4A 5AJGA 1EROA 3IS2B 2DNSA 1BLSA 3HBRA 3PTEA 5HW3A 2EX9A 4DF6A 4I5SA 4EWFA 2IA2A 4Q0IA 2XH9A 1IYQA 1LL9A 2WKRA 5FI6A 4ZTKA 3F1NB 3PHYA 2VJWA 1SKOA 5EOOA 1CEFA 1K54C 4EUVA 5CTNA 1H8ZA 2GZAA 1PZOA 5K5BA 1KDSA 1FCNA 3QP2A 3PBRA 4CQHA 1XKZA 3S7PA 3GDIA 3UB5P 2ZMAA 4PPRA 3CITA 4E3OA 1VQQA 2FZ0A 4ZRRA 5EE8A 4JF6A 4I3AA 3NIAA 2MJ6A 2W3EA 2VLGA 1W63M 4RQ9A 2EXBA 2JKRI 4QHCA 3MS6A 1ESIA 4XUZA 1DY6A 2VV7A 4YOFA 3UE0A 2V1ZA 3A0VA 4KG6A 3BM6A 1F9IA 4R0QA 4S2JA 4G3VA 4QB8A 3T4TA 4OONA 5FA7A 3LEQA 1YMXA 3TJZC 3HVFA 2Z2LB 1DRMA 2Z6DA 3NI9A 1W7FA 4I39A 4XXRA 5DFYA 1YLPA 3SS5A 4B9OA 5TGFA 4I3JA 3O88A 4JPMA 2WZZA 1YQSA 4KQDA 2CC1A 4DJ3A 3Q07A 2IWDA 3FPVA 1GA9A 2M1CA 3S22A 3CLOA 1CQAA 3FV7A 4JGRA 3EEHA 4N92A 2V2FF 1ZKJA 2Y55A 4BD0A 1WYCA 5HDSA 3UPOA 3P7NA 1YAXA 5EFWA 3LY3A 4BL2A 2UWXA 4RVAA 4LV2A 3HLGA 4Q0HA 3S7NA 2H28A 3WS4A 1CJFA 4HIAA 2OAP1 1Q2QA 1K25A 2ZM0A 4MMNA 5J3WA 3I7JA 3LYXA 4G3WA 4R3BA 5E43A 3CUEC 2ZQAA 5KSCA 2WAEA 1XP4A 5HWVA 2W3HA 5IU1A 1FOFA 3P01A 1NY0A 4BBVA 5EVIA 2C5WB 1UGUA 1W5DA 2ZL1A 4IVIA 4CLCB 1IYPA 3VP3A 4EU0A 2OWHA 4IBRA 3KYQA 2L1MA 2FFFB 3HJIA 2KDKA 1E3UD 1OTEA 4H6JB 3HCYA 4X53A 3VP0A 5HSQA 1L0FA 2PYRA 4X25A 5HL6A 4KENB 4FH4A 4OPRA 3DAVA 1HTZA 4CLCE 2VGLM 3C8CA 3LCEA 5EV0A 4WF0A 1JNUA 4GS9B 3LO7A 2P08A 3LIAA 1ESUA 4WL9A 1K56D 2HDUA 2C6WB 4S2NA 3RFBA 1BULA 4ME4A 5EVEA 3DTIA 3PYPA 3C2WA 4E04A 1TS0A 2ZM8A 5DF8A 3DTMA 3DW0A 3HUOA 1T19A 2V1AA 3FYZA 2WADA 5A93A 2V9AA 3ZFZA 1CI9A 2EA9A 2PR5A 4GB7A 3ZQ5A 1YPRA 4WZ4A 2BTFP 4BMWA 4FD8A 4P6BA 1IYSA 1DJBA 1ZG4A 1MKMA 2J3TD 1Y54A 1F2KA 1YKDA 1M40A 2G2UA 3B47A 4K0WA 3CZDA 3CG5A 3WS1A 4JXVA 3UB6A 1KE3A 2V0WA 2OV5A 1SKOB 5KMWA 3A3JA 3IX4A 1LT0A 5G18A 1FR6A 4LLOB 5A91A 2WGIA 3UNWA 1P0ZA 3IF6A 3KYZA 2YKHA 1JTDA 3D72A 3GECA 2ZBBA 5E2GA 2LB9A 4OH0A 5I5LA 2JKGA 2J3TC 4Y0UA 4EESA 4KZ6A 4EETB 1PW8A 4WELA 3VOZA 4EQIA 4JLFA 3T1SA 3OBFA 2A49A 4U3TA 1MC0A 4C3QA 2ZOIA 5FAPA 5CX7A 5GLBA 3KSGA 3IT9A 3V5MA 3MQOA 2M7UA 2KLIA 4GD6A 3R7WB 4X68A 3IF5A 1S67L 1FQGA 1L3LA 2Y2GA 3GV9A 3AGFA 3JYIA 2DRWA 2PD8A 3RXWA 3IWQA 5HFOA 1XGIA 3G2ZA 1KE4A 1ONHA 4EXOA 1PWCA 4HOIA 4MBHA 3OCLA 4KG2A 3VE4A 2EFXA 1BSGA 3T4LA 5CHUA 5FAOA 4UA6A 3E4PA 1T1BA 2ZQ9A 1SDEA 2WZXA 4LFUA 1M6KA 4KQOA 3TW8A 4E3LA 4LRXC 3PR6A 4R6LA 3BECA 1ES4A 4G3KA 1K57C 4IEDA 4Q0JA 1BZAA 2JKTM 2XF3A 4YWZA 5M19A 3N8RA 4KZ8A 1CK3A 5EVIB 1T18A 2ZL1B 4N1HA 3JPUA 3KSHA 4L9GA 1BLHA 4HI4A 4X56A 5D3OA 1E25A 2E8IA 5KIZA 4WMCA 1W79A 2J7VA 3UO9A 1XA1A 2WKEA 1BYWA 4O0PA 4L9EA 3QP8A 3WS5A 1IKGA 3M6HA 3P98A 3TG9A 4DE1A 3PBNA 1JTGA 4OLDA 2JKFA 4LV3A 3VSLA 2XEPA 4DJ2A 1LI0A 4HJ4A 4CPKA 1NLZA 4ETXA 3LI8A 2Y59A 4O7DA 4ZBEA 4L0LA 2WGWB 3GR2A 2CMNA 4EEUA 1L0EA 4MN7A 1KVLA 1V9ZA 2ACGA 3ZVWA 2WK0A 2VGLS 5CERA 3LR0A 5EUAA 5FI7A 4LRYC 2PAVP 2L0WA 1T1AA 4NG2A 1D06A 4OQ0A 3IQAA 1K4EA 1PFLA 5HWWA 4D60A 3MZDA 2QHKA 2QJ7A 2Y2MA 4LV0A 4GD8A 1J3WA 4S2KA 1YT4A 3T4QA 3NC8A 5EPHA 2ZC3B 3VP2A 5A8BA 1I2SA 3UB9A 4QY5A 1RGYA 4UQIM 1PWDA 5DF9A 5EVID 3VV4A 1XJ6A 5TFQA 3IBJA 4FUWA 3ZNYA 2PRFA 4PMAA 3UB8A 2J80A 1S1ZA 2PU2A 3UPPA 4P87A 1WYBA 5CHJA 1O07A 5TBMA 1ERQA
chains in the Genus database with same CATH topology
4JPMA 2WZZA 1YMSA 3IF6B 5AQAA 4K91A 1YQSA 4N9LA 2Y2KA 1K6SA 2CC1A 1GHMA 3HLDA 3Q07A 1XXMA 4MBKA 2IWDA 5M18A 5FASA 1GA0A 4GN2A 1GA9A 3HLEA 3S22A 1W8QA 3A3EA 5E2FA 3FWLA 1NYYA 1MWRA 5L2FA 5DVAA 3HUNA 3FV7A 4WYYA 5GLCA 4N92A 2V2FF 2VGKA 4OP8A 5EVIC 1ZKJA 2HDSA 2Y55A 3VOYA 3B3XA 2PU4A 3BFGA 3C4PA 1L2SA 4BD0A 1WYCA 3UPOA 1E3UA 1PW1A 3LY3A 4LCMA 4OOMA 4BL2A 2UWXA 4RVAA 4MNRA 4LV2A 3HLGA 3A3DA 3WS4A 1NZUA 1XGJA 1MY8A 5GLAA 3WS0A 3FZCA 1Q2QA 1DJCA 3IXBA 1K25A 2ZM0A 2OLUA 4WEJA 2XDMA 3I7JA 4R3BA 5E43A 2IWCA 1ALQA 3PBQA 2ZQAA 4HESA 3WRZA 2ZC6B 1G6AA 4ZJ3A 4GKUA 4OPQA 4E6XA 4S2MA 1Z6FA 5KSCA 2HDRA 5CGWA 2WAEA 1XP4A 4MBFA 4JBFA 3N4IA 4R1GA 4MEZA 3W4QA 5CEBA 4KQQA 1HD8A 3GTCA 4Y0TA 1FOFA 3O87A 4S2LA 4WM9A 3A3IA 3C4OA 4ZJ2A 3W4OA 1NY0A 2P74A 3FKVA 4OOYA 5EVIA 2C5WB 1YLTA 2HP6A 1W5DA 4IBXA 4PM9A 1ES5A 1K56A 2A3UA 4Y0OA 4IVIA 3PAGA 2PBYA 4A5RA 1IYPA 2DCFA 4PM5A 1ZG6A 3VP3A 3HUMA 2QPNA 1MKIA 2XFTA 4IBRA 3TSGA 2FFFB 4LENA 3IH9A 3VFHA 5A92A 3AGDA 1E3UD 5HX9A 3HLCA 1GCEA 3GVBA 3HL9A 4X53A 3VP0A 1YLWA 1NJ4A 3NCKA 1L0FA 5KZHA 3SS4A 4OKPA 5AQ7A 4S2IA 3ZG5A 2ZC5B 2XK1A 3G4PA 3MKFA 2ZQDA 4KENB 1KGEA 3M2KA 4FH4A 4OQIA 4MLLA 4Y7PA 4OPRA 4D2OA 3ZG0A 1K4FA 2ZLYA 4RYEA 1HTZA 1SCWA 4FCFA 4KZ3A 4GNUA 4U0XA 1AXBA 3LCEA 4DE0A 1DJAA 4JXSA 2X01A 3BFEA 1YM1A 4M3KA 1ES2A 4C75A 3GSGA 3VFFA 3UPNA 3N6IA 5FQQA 1YLJA 3HLFA 1I5QA 2JE5A 3LO7A 4E6WA 5GL9A 2VGJA 3V39A 4Q8IA 1ESUA 4OP5A 4X55A 1QMFA 3OPPA 1K56D 3PAEA 2HDUA 4EBLA 5CXWA 2C6WB 2OSUA 4S2NA 2XD1A 3Q7VB 3E2KA 4ID4A 1BULA 4BQMA 4KZAA 1IKIA 3OPHA 3MKEA 4JKTA 3SH8A 5BOHA 1BLCA 3Q81A 2P9VA 3ZNTA 4F94A 3MBZA 2WAFA 2ZM8A 3DTMA 3DW0A 3HUOA 4GOGA 5DF8A 2HP9A 3FYZA 2WADA 3MZEA 5A93A 3Q1FA 1KGFA 3IHAA 3ZFZA 5F83A 1CI9A 3GRJA 1FSYA 2Y2QA 5CGSA 3ISGA 2J8YA 4KG5A 4GB7A 2EX2A 5CHMA 1XX2A 4GDNA 4C6YA 4WEKA 4OPZA 4WZ4A 3M6BA 2WKIA 1IELA 3UDXA 4FD8A 4P6BA 3Q82A 1TVFA 3RXXA 1IYSA 1DJBA 1K55A 1ZG4A 3IHBA 5FAQA 1PIOA 5FATA 2ZQ8A 3MXRA 2H0TA 5I94A 2RCXA 3BFDA 4H8RA 1Y54A 3SOIA 4R4RA 3EQVA 3IXHA 4HBUA 4WZ5A 3UN7A 2ZM2A 3ZG9B 1M40A 3SH7A 3NDEA 3Q7VA 1BLPA 4B88A 4E3MA 5FQMA 3UE3A 2ZQCA 1PI5A 5EOEA 2G2UA 2R9XA 4K0WA 3ZVTA 3M2JA 3N8LA 3CZDA 3CG5A 3VSKA 3WS1A 1LI9A 4JXVA 4CJNA 1WE4A 3IH8A 5HAPA 4UA7A 1KE3A 4N9KA 5DTTA 3OC2A 4UHUA 1N4OA 2OV5A 4GDBA 1EI5A 4XUXA 4FSFA 1S0WA 5FQKA 5KMWA 3A3JA 2ZJ9A 5G18A 1FR6A 2ZQ7A 3MXSA 4R23A 4S2OA 5A91A 2WGIA 1BTLA 1FCOA 1IEMA 3MZFA 2XFSA 3IF6A 3UNWA 5CEDA 3G32A 5F82A 4X6TA 3G34A 1OMEA 1XA7A 1SKFA 1JTDA 1W8YA 2XR0A 2WKHA 5F1FA 3VMAA 4UAAA 3BLMA 5E2GA 3UDIA 3OCNA 1KGGA 1JVJA 1QMEA 2JC7A 4BJPA 1K57A 4OH0A 1L0DA 3NDGA 5CGXA 1ES3A 2XD5A 5AQBA 1MWUA 1KE0A 2EFUA 2H10A 4Y0UA 3NBLA 5EECA 4RX2A 1CEGA 2BLSA 3UE1A 4KZ6A 4RA7A 1PW8A 4WELA 5DF7A 4DXCA 3VOZA 4S2NC 4EQIA 4JLFA 1U60A 1FR1A 1L0GA 2OLVA 2A49A 4U3TA 3C5AA 4C3QA 3DWKA 1K38A 3WRTA 3IWIA 4ZAMA 3N8SA 4EBPA 5FAPA 4EUZA 1NYMA 2Y91A 4JXGA 4BD1A 5GLBA 1Q2PA 3IT9A 3V5MA 5HL1A 4BENA 4BLMA 4EV4A 4GD6A 5J8XA 3ZHHA 2Q9NA 2XLNA 4X68A 4ZDXA 2HPBA 4JXWA 3SH9A 3ITAA 3IF5A 3HLWA 2B5RA 1NXYA 3AGEA 1FQGA 3SS3A 1K6RA 3O3VA 1MBLA 1NZOA 3WS2A 1C3BA 2RL3A 3VP4A 4B4ZA 3V50A 2FFYA 2Y2GA 1K55C 3GV9A 1CI8A 3BLSA 1BT5A 2X02A 3AGFA 3LY4A 5FDHA 1N9BA 4HBTA 3JYIA 3C7UA 4N1XA 3CJMA 4OQHA 5EVLA 4WZ5C 2DRWA 5JYPA 3DWZA 3RXWA 1RCJA 3IWQA 5HFOA 5F1GA 1G68A 1XGIA 1MWTA 3G2ZA 1KE4A 1ONHA 5CTMA 3PBSA 4YINA 1PWCA 4E3IA 5A90A 1J9MA 4MBHA 1PZPA 1MPLA 3QNCA 4QU3A 1E4DA 2BG1A 3LEZA 3OCLA 5JYOA 4KG2A 4YFMA 3BRMA 1JWPA 2EFXA 3Q7ZA 1BSGA 2HP5A 1MXOA 2Z2MB 5CHUA 5FAOA 1JWVA 2JCHA 4UA6A 3IF6C 5AQ9A 2ZQ9A 1SDEA 2WZXA 1VM1A 5U47A 1M6KA 4KQOA 5TR7A 4JF5A 3S4XA 1TEMA 3S1YA 4E3LA 2XGNA 4WBGA 3BECA 4OLGA 4OVDA 1ES4A 4U0TA 4R4SA 1K57C 2H5SA 1EWZA 3G31A 5CRFA 3E2LA 4IEDA 1LLBA 2ZC7A 4HEFA 3EQUA 1NRFA 4KZBA 4LCLA 2GDNA 3GQZA 3UY6A 1FCMA 1BZAA 4DKIA 2IWBA 1HVBA 2XF3A 3OZHA 5M19A 3N8RA 4KZ8A 2EX8A 1CK3A 5CECA 2H0YA 3C7VA 5EVIB 4KZ5A 5DTKA 4JF4A 4N1HA 1O7EA 3VP1A 5DTSA 1BLHA 2WUQA 4PM6A 4X56A 1E25A 1I2WA 5D3OA 2E8IA 5E2HA 5GHXA 3PBOA 4WMCA 1XPBA 1W79A 2J9OA 2J7VA 3BFCA 2JBFA 3HLBA 1XA1A 4Z9QA 2WKEA 3UO9A 3W4PA 5HAQA 3ZCZA 4EBNA 1MWSA 5GHYA 3WS5A 4E3NA 3IXGA 1TDGA 4QD4A 1IKGA 3M6HA 3P98A 3TG9A 2J9PA 1PI4A 2Y2LA 3ZG8B 4DE1A 3ZG7B 3PBNA 4RX3A 4FH2A 1JTGA 3P09A 1H8YA 1KVMA 2EXAA 4OLDA 3FKWA 3ZDJA 3ITBA 2Q9MA 3IXDA 4LV3A 4OPYA 2XEPA 1PYYA 3VSLA 2Y2JA 2Y4AA 1LI0A 4PM8A 4DE3A 5FQ9A 3BFFA 2EX6A 3BEBA 1FSWA 2XQZA 5KSHA 2R9WA 3MFDA 4KZ4A 4BL3A 1ONGA 4CPKA 3PBTA 2Y59A 4O7DA 1EROA 2DNSA 4ZBEA 1ZC2A 1BLSA 2WGWB 2ZD8A 4L0LA 3GR2A 4LV1A 3V3RA 1L0EA 1KVLA 1GHPA 3HBRA 3PTEA 3OPLA 4E3KA 4OQGA 5HW3A 2EX9A 3ZVWA 3IWOA 4DF6A 2Y2OA 3G30A 2WK0A 3NY4A 4S2PA 5FI2A 4DE2A 4EWFA 4DDSA 3BYDA 5CERA 3TOIA 1LHYA 2XH9A 5EUAA 1IYQA 1LL9A 5IHVA 3CMZA 4R3JA 3O86A 1SDNA 5FI6A 5FI7A 4ZTKA 5HARA 1RP5A 5FQIA 2HDQA 2I72A 2V20A 2X71A 4WMCD 4QY6A 1CEFA 5EOOA 1K54C 5E2EA 5CTNA 1H8ZA 4X69A 1JWZA 1PZOA 3QNBA 4P85A 1KDWA 2Y2NA 1KDSA 1FCNA 1H5XA 3PBRA 4KZ7A 1XKZA 4PM7A 4ZJ1A 4OQ0A 3IQAA 2ZMAA 4PPRA 2P9VB 3N7WA 1VQQA 4E3OA 1K4EA 1SHVA 3OPRA 5EE8A 4JF6A 5FSRA 4DXBA 1S6RA 3NIAA 3MZDA 4KZ9A 5HAIA 2Y2MA 2Y2HA 4DDYA 4LV0A 1IYOA 4UA9A 1RGZA 2EXBA 4GD8A 3V3SA 5GHZA 4QHCA 4S2KA 1ESIA 1PWGA 5FQJA 1YT4A 2WGWA 4DRTA 4NETA 3WWXA 2QMIA 3G2YA 1DY6A 3D4FA 3NC8A 3QHYA 4XUZA 5EPHA 2ZC3B 3UDFA 3VP2A 3W8KA 3UE0A 2G2WA 1I2SA 2V1ZA 4QY5A 4KG6A 4P0MA 1RGYA 1YLZA 3BM6A 4R0QA 4S2JA 3RJUA 1PWDA 1TDLA 4QB8A 1YLYA 5DF9A 5EVID 1GHIA 4K0XA 3ZGAB 1K54A 4OONA 5TFQA 4KQRA 1BUEA 3A3FA 4NK3A 3ZNYA 2Y2PA 5FA7A 5GLDA 2Y2IA 2ZC4B 5M1AA 4PMAA 1LL5A 1YMXA 2PU2A 4GZBA 1ERMA 3HVFA 3UPPA 4P87A 2QZ6A 2Z2LB 4IVKA 1WYBA 5CHJA 3NI9A 3GMWA 1HZOA 1O07A 4QJGA 2WYXA 1W7FA 4XXRA 3HREA 2WGVA 4B4XA 1YLPA 3SS5A 4OOLA 5TGFA 4E3JA 3O88A 3G35A 1ERQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JPM A;  2WZZ A;  1YMS A;  3IF6 B;  5AQA A;  4K91 A;  1YQS A;  4N9L A;  2Y2K A;  1K6S A;  2CC1 A;  1GHM A;  3HLD A;  3Q07 A;  1XXM A;  4MBK A;  2IWD A;  5M18 A;  5FAS A;  1GA0 A;  4GN2 A;  1GA9 A;  3HLE A;  3S22 A;  1W8Q A;  3A3E A;  5E2F A;  3FWL A;  1NYY A;  1MWR A;  5L2F A;  5DVA A;  3HUN A;  3FV7 A;  4WYY A;  5GLC A;  4N92 A;  2V2F F;  2VGK A;  4OP8 A;  5EVI C;  1ZKJ A;  2HDS A;  2Y55 A;  3VOY A;  3B3X A;  2PU4 A;  3BFG A;  3C4P A;  1L2S A;  4BD0 A;  1WYC A;  3UPO A;  1E3U A;  1PW1 A;  3LY3 A;  4LCM A;  4OOM A;  4BL2 A;  2UWX A;  4RVA A;  4MNR A;  4LV2 A;  3HLG A;  3A3D A;  3WS4 A;  1NZU A;  1XGJ A;  1MY8 A;  5GLA A;  3WS0 A;  3FZC A;  1Q2Q A;  1DJC A;  3IXB A;  1K25 A;  2ZM0 A;  2OLU A;  4WEJ A;  2XDM A;  3I7J A;  4R3B A;  5E43 A;  2IWC A;  1ALQ A;  3PBQ A;  2ZQA A;  4HES A;  3WRZ A;  2ZC6 B;  1G6A A;  4ZJ3 A;  4GKU A;  4OPQ A;  4E6X A;  4S2M A;  1Z6F A;  5KSC A;  2HDR A;  5CGW A;  2WAE A;  1XP4 A;  4MBF A;  4JBF A;  3N4I A;  4R1G A;  4MEZ A;  3W4Q A;  5CEB A;  4KQQ A;  1HD8 A;  3GTC A;  4Y0T A;  1FOF A;  3O87 A;  4S2L A;  4WM9 A;  3A3I A;  3C4O A;  4ZJ2 A;  3W4O A;  1NY0 A;  2P74 A;  3FKV A;  4OOY A;  5EVI A;  2C5W B;  1YLT A;  2HP6 A;  1W5D A;  4IBX A;  4PM9 A;  1ES5 A;  1K56 A;  2A3U A;  4Y0O A;  4IVI A;  3PAG A;  2PBY A;  4A5R A;  1IYP A;  2DCF A;  4PM5 A;  1ZG6 A;  3VP3 A;  3HUM A;  2QPN A;  1MKI A;  2XFT A;  4IBR A;  3TSG A;  2FFF B;  4LEN A;  3IH9 A;  3VFH A;  5A92 A;  3AGD A;  1E3U D;  5HX9 A;  3HLC A;  1GCE A;  3GVB A;  3HL9 A;  4X53 A;  3VP0 A;  1YLW A;  1NJ4 A;  3NCK A;  1L0F A;  5KZH A;  3SS4 A;  4OKP A;  5AQ7 A;  4S2I A;  3ZG5 A;  2ZC5 B;  2XK1 A;  3G4P A;  3MKF A;  2ZQD A;  4KEN B;  1KGE A;  3M2K A;  4FH4 A;  4OQI A;  4MLL A;  4Y7P A;  4OPR A;  4D2O A;  3ZG0 A;  1K4F A;  2ZLY A;  4RYE A;  1HTZ A;  1SCW A;  4FCF A;  4KZ3 A;  4GNU A;  4U0X A;  1AXB A;  3LCE A;  4DE0 A;  1DJA A;  4JXS A;  2X01 A;  3BFE A;  1YM1 A;  4M3K A;  1ES2 A;  4C75 A;  3GSG A;  3VFF A;  3UPN A;  3N6I A;  5FQQ A;  1YLJ A;  3HLF A;  1I5Q A;  2JE5 A;  3LO7 A;  4E6W A;  5GL9 A;  2VGJ A;  3V39 A;  4Q8I A;  1ESU A;  4OP5 A;  4X55 A;  1QMF A;  3OPP A;  1K56 D;  3PAE A;  2HDU A;  4EBL A;  5CXW A;  2C6W B;  2OSU A;  4S2N A;  2XD1 A;  3Q7V B;  3E2K A;  4ID4 A;  1BUL A;  4BQM A;  4KZA A;  1IKI A;  3OPH A;  3MKE A;  4JKT A;  3SH8 A;  5BOH A;  1BLC A;  3Q81 A;  2P9V A;  3ZNT A;  4F94 A;  3MBZ A;  2WAF A;  2ZM8 A;  3DTM A;  3DW0 A;  3HUO A;  4GOG A;  5DF8 A;  2HP9 A;  3FYZ A;  2WAD A;  3MZE A;  5A93 A;  3Q1F A;  1KGF A;  3IHA A;  3ZFZ A;  5F83 A;  1CI9 A;  3GRJ A;  1FSY A;  2Y2Q A;  5CGS A;  3ISG A;  2J8Y A;  4KG5 A;  4GB7 A;  2EX2 A;  5CHM A;  1XX2 A;  4GDN A;  4C6Y A;  4WEK A;  4OPZ A;  4WZ4 A;  3M6B A;  2WKI A;  1IEL A;  3UDX A;  4FD8 A;  4P6B A;  3Q82 A;  1TVF A;  3RXX A;  1IYS A;  1DJB A;  1K55 A;  1ZG4 A;  3IHB A;  5FAQ A;  1PIO A;  5FAT A;  2ZQ8 A;  3MXR A;  2H0T A;  5I94 A;  2RCX A;  3BFD A;  4H8R A;  1Y54 A;  3SOI A;  4R4R A;  3EQV A;  3IXH A;  4HBU A;  4WZ5 A;  3UN7 A;  2ZM2 A;  3ZG9 B;  1M40 A;  3SH7 A;  3NDE A;  3Q7V A;  1BLP A;  4B88 A;  4E3M A;  5FQM A;  3UE3 A;  2ZQC A;  1PI5 A;  5EOE A;  2G2U A;  2R9X A;  4K0W A;  3ZVT A;  3M2J A;  3N8L A;  3CZD A;  3CG5 A;  3VSK A;  3WS1 A;  1LI9 A;  4JXV A;  4CJN A;  1WE4 A;  3IH8 A;  5HAP A;  4UA7 A;  1KE3 A;  4N9K A;  5DTT A;  3OC2 A;  4UHU A;  1N4O A;  2OV5 A;  4GDB A;  1EI5 A;  4XUX A;  4FSF A;  1S0W A;  5FQK A;  5KMW A;  3A3J A;  2ZJ9 A;  5G18 A;  1FR6 A;  2ZQ7 A;  3MXS A;  4R23 A;  4S2O A;  5A91 A;  2WGI A;  1BTL A;  1FCO A;  1IEM A;  3MZF A;  2XFS A;  3IF6 A;  3UNW A;  5CED A;  3G32 A;  5F82 A;  4X6T A;  3G34 A;  1OME A;  1XA7 A;  1SKF A;  1JTD A;  1W8Y A;  2XR0 A;  2WKH A;  5F1F A;  3VMA A;  4UAA A;  3BLM A;  5E2G A;  3UDI A;  3OCN A;  1KGG A;  1JVJ A;  1QME A;  2JC7 A;  4BJP A;  1K57 A;  4OH0 A;  1L0D A;  3NDG A;  5CGX A;  1ES3 A;  2XD5 A;  5AQB A;  1MWU A;  1KE0 A;  2EFU A;  2H10 A;  4Y0U A;  3NBL A;  5EEC A;  4RX2 A;  1CEG A;  2BLS A;  3UE1 A;  4KZ6 A;  4RA7 A;  1PW8 A;  4WEL A;  5DF7 A;  4DXC A;  3VOZ A;  4S2N C;  4EQI A;  4JLF A;  1U60 A;  1FR1 A;  1L0G A;  2OLV A;  2A49 A;  4U3T A;  3C5A A;  4C3Q A;  3DWK A;  1K38 A;  3WRT A;  3IWI A;  4ZAM A;  3N8S A;  4EBP A;  5FAP A;  4EUZ A;  1NYM A;  2Y91 A;  4JXG A;  4BD1 A;  5GLB A;  1Q2P A;  3IT9 A;  3V5M A;  5HL1 A;  4BEN A;  4BLM A;  4EV4 A;  4GD6 A;  5J8X A;  3ZHH A;  2Q9N A;  2XLN A;  4X68 A;  4ZDX A;  2HPB A;  4JXW A;  3SH9 A;  3ITA A;  3IF5 A;  3HLW A;  2B5R A;  1NXY A;  3AGE A;  1FQG A;  3SS3 A;  1K6R A;  3O3V A;  1MBL A;  1NZO A;  3WS2 A;  1C3B A;  2RL3 A;  3VP4 A;  4B4Z A;  3V50 A;  2FFY A;  2Y2G A;  1K55 C;  3GV9 A;  1CI8 A;  3BLS A;  1BT5 A;  2X02 A;  3AGF A;  3LY4 A;  5FDH A;  1N9B A;  4HBT A;  3JYI A;  3C7U A;  4N1X A;  3CJM A;  4OQH A;  5EVL A;  4WZ5 C;  2DRW A;  5JYP A;  3DWZ A;  3RXW A;  1RCJ A;  3IWQ A;  5HFO A;  5F1G A;  1G68 A;  1XGI A;  1MWT A;  3G2Z A;  1KE4 A;  1ONH A;  5CTM A;  3PBS A;  4YIN A;  1PWC A;  4E3I A;  5A90 A;  1J9M A;  4MBH A;  1PZP A;  1MPL A;  3QNC A;  4QU3 A;  1E4D A;  2BG1 A;  3LEZ A;  3OCL A;  5JYO A;  4KG2 A;  4YFM A;  3BRM A;  1JWP A;  2EFX A;  3Q7Z A;  1BSG A;  2HP5 A;  1MXO A;  2Z2M B;  5CHU A;  5FAO A;  1JWV A;  2JCH A;  4UA6 A;  3IF6 C;  5AQ9 A;  2ZQ9 A;  1SDE A;  2WZX A;  1VM1 A;  5U47 A;  1M6K A;  4KQO A;  5TR7 A;  4JF5 A;  3S4X A;  1TEM A;  3S1Y A;  4E3L A;  2XGN A;  4WBG A;  3BEC A;  4OLG A;  4OVD A;  1ES4 A;  4U0T A;  4R4S A;  1K57 C;  2H5S A;  1EWZ A;  3G31 A;  5CRF A;  3E2L A;  4IED A;  1LLB A;  2ZC7 A;  4HEF A;  3EQU A;  1NRF A;  4KZB A;  4LCL A;  2GDN A;  3GQZ A;  3UY6 A;  1FCM A;  1BZA A;  4DKI A;  2IWB A;  1HVB A;  2XF3 A;  3OZH A;  5M19 A;  3N8R A;  4KZ8 A;  2EX8 A;  1CK3 A;  5CEC A;  2H0Y A;  3C7V A;  5EVI B;  4KZ5 A;  5DTK A;  4JF4 A;  4N1H A;  1O7E A;  3VP1 A;  5DTS A;  1BLH A;  2WUQ A;  4PM6 A;  4X56 A;  1E25 A;  1I2W A;  5D3O A;  2E8I A;  5E2H A;  5GHX A;  3PBO A;  4WMC A;  1XPB A;  1W79 A;  2J9O A;  2J7V A;  3BFC A;  2JBF A;  3HLB A;  1XA1 A;  4Z9Q A;  2WKE A;  3UO9 A;  3W4P A;  5HAQ A;  3ZCZ A;  4EBN A;  1MWS A;  5GHY A;  3WS5 A;  4E3N A;  3IXG A;  1TDG A;  4QD4 A;  1IKG A;  3M6H A;  3P98 A;  3TG9 A;  2J9P A;  1PI4 A;  2Y2L A;  3ZG8 B;  4DE1 A;  3ZG7 B;  3PBN A;  4RX3 A;  4FH2 A;  1JTG A;  3P09 A;  1H8Y A;  1KVM A;  2EXA A;  4OLD A;  3FKW A;  3ZDJ A;  3ITB A;  2Q9M A;  3IXD A;  4LV3 A;  4OPY A;  2XEP A;  1PYY A;  3VSL A;  2Y2J A;  2Y4A A;  1LI0 A;  4PM8 A;  4DE3 A;  5FQ9 A;  3BFF A;  2EX6 A;  3BEB A;  1FSW A;  2XQZ A;  5KSH A;  2R9W A;  3MFD A;  4KZ4 A;  4BL3 A;  1ONG A;  4CPK A;  3PBT A;  2Y59 A;  4O7D A;  1ERO A;  2DNS A;  4ZBE A;  1ZC2 A;  1BLS A;  2WGW B;  2ZD8 A;  4L0L A;  3GR2 A;  4LV1 A;  3V3R A;  1L0E A;  1KVL A;  1GHP A;  3HBR A;  3PTE A;  3OPL A;  4E3K A;  4OQG A;  5HW3 A;  2EX9 A;  3ZVW A;  3IWO A;  4DF6 A;  2Y2O A;  3G30 A;  2WK0 A;  3NY4 A;  4S2P A;  5FI2 A;  4DE2 A;  4EWF A;  4DDS A;  3BYD A;  5CER A;  3TOI A;  1LHY A;  2XH9 A;  5EUA A;  1IYQ A;  1LL9 A;  5IHV A;  3CMZ A;  4R3J A;  3O86 A;  1SDN A;  5FI6 A;  5FI7 A;  4ZTK A;  5HAR A;  1RP5 A;  5FQI A;  2HDQ A;  2I72 A;  2V20 A;  2X71 A;  4WMC D;  4QY6 A;  1CEF A;  5EOO A;  1K54 C;  5E2E A;  5CTN A;  1H8Z A;  4X69 A;  1JWZ A;  1PZO A;  3QNB A;  4P85 A;  1KDW A;  2Y2N A;  1KDS A;  1FCN A;  1H5X A;  3PBR A;  4KZ7 A;  1XKZ A;  4PM7 A;  4ZJ1 A;  4OQ0 A;  3IQA A;  2ZMA A;  4PPR A;  2P9V B;  3N7W A;  1VQQ A;  4E3O A;  1K4E A;  1SHV A;  3OPR A;  5EE8 A;  4JF6 A;  5FSR A;  4DXB A;  1S6R A;  3NIA A;  3MZD A;  4KZ9 A;  5HAI A;  2Y2M A;  2Y2H A;  4DDY A;  4LV0 A;  1IYO A;  4UA9 A;  1RGZ A;  2EXB A;  4GD8 A;  3V3S A;  5GHZ A;  4QHC A;  4S2K A;  1ESI A;  1PWG A;  5FQJ A;  1YT4 A;  2WGW A;  4DRT A;  4NET A;  3WWX A;  2QMI A;  3G2Y A;  1DY6 A;  3D4F A;  3NC8 A;  3QHY A;  4XUZ A;  5EPH A;  2ZC3 B;  3UDF A;  3VP2 A;  3W8K A;  3UE0 A;  2G2W A;  1I2S A;  2V1Z A;  4QY5 A;  4KG6 A;  4P0M A;  1RGY A;  1YLZ A;  3BM6 A;  4R0Q A;  4S2J A;  3RJU A;  1PWD A;  1TDL A;  4QB8 A;  1YLY A;  5DF9 A;  5EVI D;  1GHI A;  4K0X A;  3ZGA B;  1K54 A;  4OON A;  5TFQ A;  4KQR A;  1BUE A;  3A3F A;  4NK3 A;  3ZNY A;  2Y2P A;  5FA7 A;  5GLD A;  2Y2I A;  2ZC4 B;  5M1A A;  4PMA A;  1LL5 A;  1YMX A;  2PU2 A;  4GZB A;  1ERM A;  3HVF A;  3UPP A;  4P87 A;  2QZ6 A;  2Z2L B;  4IVK A;  1WYB A;  5CHJ A;  3NI9 A;  3GMW A;  1HZO A;  1O07 A;  4QJG A;  2WYX A;  1W7F A;  4XXR A;  3HRE A;  2WGV A;  4B4X A;  1YLP A;  3SS5 A;  4OOL A;  5TGF A;  4E3J A;  3O88 A;  3G35 A;  1ERQ A; 
#chains in the Genus database with same CATH topology
 3IF6 B;  1YMS A;  2Y2K A;  1K6S A;  1LL8 A;  3CPT A;  5M18 A;  3KSI A;  5FAS A;  1GA0 A;  4GN2 A;  1W8Q A;  5E2F A;  3FWL A;  3HUN A;  2VGK A;  5EVI C;  4DN0 A;  3BFG A;  3C4P A;  1L2S A;  4OOM A;  4LPZ A;  1Y4O A;  4Y3I A;  4WUJ A;  3A3D A;  1D1J A;  3DTK A;  1MY8 A;  5GLA A;  4WEJ A;  5DJU A;  4NXF A;  2IWC A;  3WRZ A;  2XRN A;  4HES A;  1G6A A;  3R4K A;  4ZJ3 A;  4GKU A;  4OPQ A;  5CGW A;  4MBF A;  4JBF A;  4S2L A;  4EEP A;  1OT9 A;  2QYB A;  4WM9 A;  2VV8 A;  3A3I A;  2P74 A;  3FKV A;  4OOY A;  1VET A;  1YLT A;  2HP6 A;  3B42 A;  1ES5 A;  2A3U A;  2DCF A;  1ZG6 A;  3TSG A;  3IH9 A;  5A92 A;  4MN5 A;  5HX9 A;  1GCE A;  3GVB A;  1NJ4 A;  4GLQ A;  2VA0 A;  3E0Y A;  4Y15 A;  3SS4 A;  1OT6 A;  3KSF A;  3T4J A;  5AQ7 A;  3FPW A;  4OQI A;  3M2K A;  1SCW A;  4GNU A;  3EGD C;  4GJ4 A;  1AXB A;  1DJA A;  2PYP A;  5L8M A;  4IUK A;  3GSG A;  3VFF A;  1LSV A;  1YLJ A;  1I5Q A;  5FL3 A;  3V39 A;  3C38 A;  5CXW A;  4NXE A;  2OSU A;  3Q7V B;  4ID4 A;  3JVV A;  4QPR A;  4BQM A;  4KZA A;  3LR4 A;  3SH8 A;  1BLC A;  2P9V A;  4IHQ A;  2BAS A;  1EW0 A;  3MZE A;  3DTE A;  1DP6 A;  1FSY A;  3IX3 A;  1XX2 A;  4C6Y A;  4OPZ A;  3LGO A;  1OJG A;  1IEL A;  3Q82 A;  1TVF A;  3RXX A;  1K55 A;  1NWZ A;  3L7H A;  5F68 A;  5I94 A;  2H0T A;  4I3I A;  4R4R A;  3EQV A;  3UN7 A;  4Y13 A;  3SH7 A;  4R3A A;  5FQM A;  3UE3 A;  1PI5 A;  4HQA A;  5EOE A;  2R9X A;  5L10 A;  3N8L A;  1KOU A;  5DTT A;  4MCW A;  4UHU A;  3LIE A;  3F1P A;  3BWL A;  2ZJ9 A;  4R23 A;  1ZTU A;  4S2O A;  1BTL A;  1FCO A;  1IEM A;  3MZF A;  1LSW A;  1OTA A;  3G32 A;  1OME A;  1DP9 A;  2XR0 A;  3B33 A;  3LUQ A;  3T4O A;  4BJP A;  3F1O A;  5CGX A;  1ES3 A;  3LFV A;  3T12 B;  2O9A A;  5EEC A;  4RX2 A;  4UEY A;  4RA7 A;  1IFQ A;  5G4Y A;  1FR1 A;  1L0G A;  3NUL A;  3C5A A;  5FDS A;  3DWK A;  3WRT A;  3IWI A;  4EUZ A;  2QWS A;  4UQI S;  3NEC A;  3TRC A;  3ZHH A;  2Q9N A;  2HPB A;  4ARZ A;  5J7E A;  3HLW A;  3H9W A;  1NXY A;  1TS7 A;  3SS3 A;  3WS2 A;  2O99 A;  3V50 A;  5FDH A;  2X02 A;  1N9B A;  1OJ5 A;  2XA7 S;  5FEF A;  1GSV A;  3CPT B;  4WZ5 C;  3DWZ A;  2HF6 A;  1RCJ A;  2VZW A;  5F1G A;  1A0K A;  1G68 A;  1MWT A;  4E3I A;  5A90 A;  3IX8 A;  2Q0O A;  1E4D A;  3LEZ A;  1DP8 A;  3RTY A;  1JWP A;  3Q7Z A;  2XSS A;  2W3F A;  2R78 A;  1JWV A;  4IUH A;  2KOI A;  1VM1 A;  5TR7 A;  4JF5 A;  3D3O A;  3S7O A;  2XGN A;  2EWV A;  4WBG A;  2O9C A;  4R4S A;  2H5S A;  4XT2 A;  5CRF A;  3E2L A;  3NHQ A;  1LLB A;  3EQU A;  1NRF A;  1AWI A;  2W0N A;  4CLC D;  1HVB A;  4WN5 A;  5L07 A;  4JGO A;  2XRO A;  2J3W A;  5DTK A;  4LRZ E;  5F6A A;  4F3L A;  3ZCZ A;  1MWS A;  5GHY A;  3IXG A;  1TDG A;  2K7S A;  4QWO A;  5DKL A;  1UWN X;  3ZG7 B;  4RX3 A;  4R38 A;  3P09 A;  1H8Y A;  3FKW A;  4OPY A;  3ITB A;  3BY9 A;  3MQ0 A;  4MDZ A;  3MFD A;  4BL3 A;  2W3D A;  3BY8 A;  1ZC2 A;  2A24 A;  2ZD8 A;  3V3R A;  4CLC C;  4L9F A;  4YNR A;  1GHP A;  3OPL A;  4E3K A;  3H82 A;  3IWO A;  3NY4 A;  4DE2 A;  5FI2 A;  3RH8 B;  3BYD A;  1LHY A;  2B02 A;  3CMZ A;  4R3J A;  3O86 A;  1SDN A;  2INW A;  4X1M A;  5FQI A;  2HDQ A;  2I72 A;  2V20 A;  3S7Q A;  2X71 A;  3UB7 A;  5E2E A;  3T1R A;  4X69 A;  5HD3 A;  2W27 A;  1KDW A;  4P85 A;  2Y2N A;  2JKR M;  1H5X A;  2O0Y A;  4PM7 A;  3K2N A;  2P9V B;  1P97 A;  3N7W A;  1K0K A;  4DXB A;  1S6R A;  3CUE A;  4KZ9 A;  1VHM A;  5G4Z A;  4UA9 A;  3MSH A;  1RGZ A;  4HHD A;  4NET A;  2QMI A;  3G2Y A;  3D4F A;  3CHW P;  4M4X A;  1N9N A;  5DKK A;  2OOL A;  2GNX A;  4LGW A;  4P0M A;  1YLZ A;  3NOP C;  3RJU A;  1TF1 A;  1TD5 A;  1TDL A;  3ZGA B;  3MFX A;  4KQR A;  4PAU A;  5TJJ A;  3A3F A;  4NK3 A;  1VB6 A;  4GZB A;  2QZ6 A;  5HDC A;  3GMW A;  3T1Q B;  3HRE A;  4FOF A;  1Z09 A;  4OOL A;  3G35 A;  2JHE A;  5AQA A;  2PHY A;  4K91 A;  3E98 A;  4N9L A;  1GHM A;  4MBK A;  1XXM A;  3HLE A;  3ICY A;  1NYY A;  3F1O B;  2GX5 A;  3MMH A;  5GLC A;  2HDS A;  3VOY A;  2PU4 A;  1E3U A;  1PW1 A;  4LCM A;  1S66 L;  4I38 A;  2PR6 A;  3FZC A;  1DJC A;  2NUT C;  3DBA A;  5L09 A;  3PBQ A;  2ZC6 B;  2K31 A;  1Z6F A;  3ULF A;  4ARZ B;  5MC7 A;  4R1G A;  3N4I A;  4MEZ A;  2QJ5 A;  3GTC A;  2K2N A;  2L4R A;  1K56 A;  4Y0O A;  4KUK A;  3PAG A;  3HUM A;  1S1Y A;  1MKI A;  4LEN A;  3EWK A;  3VFH A;  1G28 A;  3EOI A;  3HLC A;  1YLW A;  3NCK A;  4HP4 A;  4S2I A;  4II7 A;  5EM1 A;  4BBT A;  2ZQD A;  1KGE A;  3QP6 A;  4D2O A;  1K4F A;  2Y79 A;  2ZMV A;  3LR5 A;  4JXS A;  4B93 A;  1ES2 A;  4IJG A;  3N6I A;  3HLF A;  2JE5 A;  3VOL A;  4XT2 B;  4Q8I A;  3K3C A;  4X55 A;  5IS1 A;  3OPP A;  2XD1 A;  3E2K A;  1Y28 A;  1IKI A;  3OPH A;  1PRQ A;  3MKE A;  3H7W A;  4JKT A;  4HP9 A;  2UV0 E;  3FG8 A;  4EER A;  5BOH A;  3Q81 A;  4F94 A;  2XA7 M;  2G7U A;  3MBZ A;  3OOV A;  5F5Y A;  4GOG A;  2HP9 A;  4F3L B;  1GSW A;  4DMZ A;  1KGF A;  3IHA A;  5F83 A;  1SZV A;  3GRJ A;  5CGS A;  1TS6 A;  3ISG A;  4KG5 A;  2EX2 A;  5CHM A;  4GDN A;  5HZH A;  2WKI A;  3UDX A;  4GS9 A;  3EGX C;  3MXR A;  2Y8H A;  2A24 B;  3SOI A;  4PKY A;  1TS8 A;  2FH5 A;  2ZM2 A;  5LBR A;  3ZG9 B;  3H82 B;  3NDE A;  1NRJ A;  4B88 A;  4E3M A;  2ZQC A;  4CJN A;  2V8C A;  3IH8 A;  5HAP A;  3NJA A;  1H8M A;  4N9K A;  1N4O A;  1EI5 A;  3MR0 A;  4XUX A;  5FQK A;  2OAQ 1;  2ZQ7 A;  4EQ1 A;  2XFS A;  5F82 A;  2W1R A;  4Z1W A;  4X6T A;  3G34 A;  4NXG A;  1SKF A;  1W8Y A;  5F1F A;  4UAA A;  3BLM A;  2D02 A;  3OCN A;  1IOU A;  1JVJ A;  1QME A;  2JC7 A;  3T50 A;  1H3Q A;  3HJK A;  1K57 A;  1L0D A;  3NDG A;  5HWT A;  2H10 A;  4WLA A;  1CEG A;  4DXC A;  4S2N C;  1F98 A;  5HDD A;  1U60 A;  1X0O A;  3W2Z A;  2W1T A;  3N8S A;  2Y91 A;  2WKQ A;  4JGQ A;  4KUO A;  5C5K A;  1FIL A;  4BLM A;  4EV4 A;  5J8X A;  2XLN A;  1G6O A;  4JXW A;  3U2A A;  3SH9 A;  3ITA A;  2B5R A;  2PD7 A;  1VEU A;  1K6R A;  1MBL A;  1NZO A;  1C3B A;  2RL3 A;  2FFY A;  2B95 A;  1BT5 A;  1XFN A;  3SW1 A;  4GHI A;  1GSX A;  3C7U A;  4N1X A;  5EVL A;  3VE3 A;  5JYP A;  2VK3 A;  5CTM A;  4YIN A;  1J9M A;  4Y17 A;  1PZP A;  1MPL A;  3QNC A;  4QU3 A;  2P04 A;  1H0M A;  2BG1 A;  3BRM A;  3SZT A;  1MXO A;  2Z2M B;  1N9O A;  3R7W A;  3MXQ A;  3K3D A;  2JCH A;  3IF6 C;  5AQ9 A;  2AVX A;  5U47 A;  2D01 A;  3L9K A;  3CI6 A;  4OLG A;  5HPI A;  3E4Q A;  4KZB A;  2ZC7 A;  4LCL A;  2GDN A;  1FCM A;  4DKI A;  3KYE A;  3IBR A;  2LB5 A;  2EX8 A;  5CEC A;  2H0Y A;  3E4O A;  5DFX A;  5DTS A;  5E2H A;  4PM6 A;  5GHX A;  3PBO A;  2J9O A;  2JKT I;  3MQQ A;  3BFC A;  2JBF A;  3HLB A;  5HAQ A;  3W4P A;  1YSQ A;  4PHT A;  3O5Y A;  4E3N A;  2J9P A;  5EM0 A;  3NOT C;  2VKS A;  1KVM A;  4ETZ A;  2Q9M A;  1PYY A;  2HV1 A;  2Y2J A;  4PM8 A;  4DE3 A;  5FQ9 A;  3BEB A;  2VX8 A;  5KSH A;  2R9W A;  1ONG A;  3PBT A;  1HLU P;  4OQG A;  3CWF A;  2Y2O A;  3G30 A;  4S2P A;  4DDS A;  3TOI A;  5IHV A;  1OTI A;  5AVE A;  5HAR A;  4ESP A;  1PNE A;  1RP5 A;  1CF0 A;  2O9B A;  4WMC D;  4QY6 A;  1JWZ A;  3QNB A;  3H7W B;  4KZ7 A;  4GW9 A;  4ZJ1 A;  4HH3 A;  2HJE A;  1SHV A;  3OPR A;  4HJ3 A;  5FSR A;  5HPF A;  3FC7 A;  5TBM B;  3LR3 A;  5HAI A;  2Y2H A;  4DDY A;  1IYO A;  4EW7 A;  3G6O A;  3V3S A;  5GHZ A;  1PWG A;  5FQJ A;  2WGW A;  4DRT A;  1OTB A;  3WWX A;  3QHY A;  3UDF A;  3W8K A;  1ZHH B;  2G2W A;  4NKP A;  4HJ6 A;  1YLY A;  4P6Z S;  1GHI A;  4K0X A;  1K54 A;  2PDR A;  1N9L A;  1BUE A;  2Y2P A;  5GLD A;  2Y2I A;  2ZC4 B;  5M1A A;  2VV6 A;  1LL5 A;  3LIC A;  3QP1 A;  1ERM A;  2V0U A;  4IVK A;  2W3G A;  4O8G A;  1HZO A;  1F5M A;  4O01 A;  4QJG A;  1YSP A;  2WYX A;  2M7V A;  3QP4 A;  2WGV A;  4B4X A;  3LIF A;  4E3J A;  3ZYT A;  4LV1 A;  1G5U A;  2OWJ A;  3D9Y A;  3HLD A;  1LSX A;  2WKP A;  2DMW A;  4FTX A;  3A3E A;  1VET B;  1MWR A;  5L2F A;  5DVA A;  3EEA A;  4WYY A;  4OP8 A;  3B3X A;  3T4K A;  2ZOH A;  4MNR A;  2B18 A;  4GCZ A;  2W1T B;  1ODV A;  1NZU A;  1XGJ A;  1XJ3 A;  3WS0 A;  1P9W A;  4BWI A;  3IXB A;  2V1B A;  2EWW A;  2OLU A;  2XDM A;  1ALQ A;  4E6X A;  4S2M A;  5IT5 A;  2HDR A;  1OPX A;  1D7E A;  3W4Q A;  5CEB A;  4KQQ A;  1HD8 A;  4Y0T A;  3O87 A;  1VEU B;  4HY8 A;  3C4O A;  4ZJ2 A;  3W4O A;  3CAX A;  4IBX A;  4PM9 A;  3QP5 A;  4A5R A;  2PBY A;  4HH2 A;  4PKY G;  4PM5 A;  4GHI B;  1W63 Q;  2GJ3 A;  2QPN A;  2XFT A;  3TE8 A;  3AGD A;  1XJ4 A;  3HL9 A;  5KZH A;  4MN6 A;  4OKP A;  4Y5F A;  2I9V A;  3ZG5 A;  2ZC5 B;  2XK1 A;  3G4P A;  3MKF A;  2A2L A;  4MLL A;  4Y7P A;  4Y2F A;  3ZG0 A;  2ZLY A;  2P7J A;  2KX6 A;  4RYE A;  3IS2 A;  4FCF A;  4KZ3 A;  4U0X A;  1S4R A;  1NLY A;  3PXP A;  4DE0 A;  2X01 A;  3BFE A;  1YM1 A;  4M3K A;  2E8J A;  3UME A;  4C75 A;  4JGP A;  3UPN A;  5FQQ A;  4E6W A;  5GL9 A;  2VGJ A;  3LIB A;  4OP5 A;  1QMF A;  3BQA A;  3F1N A;  3PAE A;  3U4L P;  4EBL A;  1XJ2 A;  3ZNT A;  2WAF A;  3BQ8 A;  3F1P B;  3Q1F A;  3T4S A;  2Y2Q A;  2J8Y A;  5DJT A;  1T1C A;  1ACF A;  4WEK A;  3M6B A;  3IHB A;  5FAQ A;  1PIO A;  5FAT A;  2NUP C;  2ZQ8 A;  2RCX A;  3BFD A;  4H8R A;  4HBU A;  3IXH A;  4WZ5 A;  2PT7 A;  3Q7V A;  1BLP A;  2HZ5 A;  4K08 A;  3ZVT A;  1OTD A;  3M2J A;  3VSK A;  1LI9 A;  1WE4 A;  3A0S A;  4UA7 A;  1P9R A;  3LID A;  3LI9 A;  3OC2 A;  4GDB A;  4FSF A;  1S0W A;  4AFI A;  3MXS A;  5CED A;  1WA9 A;  1UWP X;  1XA7 A;  2HGV A;  1MZU A;  3KX0 X;  2WKH A;  3VMA A;  3JVU A;  3UDI A;  1KGG A;  2XD5 A;  5AQB A;  1MWU A;  1KE0 A;  2EFU A;  3NBL A;  1S4S A;  1V9Y A;  2BLS A;  2QKP A;  3UE1 A;  3V67 A;  5DF7 A;  2OLV A;  1K38 A;  4ZAM A;  4EBP A;  1NYM A;  4JXG A;  4BD1 A;  1Q2P A;  2PBD P;  5HL1 A;  4BEN A;  4ZDX A;  3MJQ A;  3NOU C;  3AGE A;  3C30 A;  3O3V A;  3VP4 A;  4B4Z A;  1K55 C;  1CI8 A;  3BLS A;  3BW6 A;  3LY4 A;  4R70 A;  4CLC A;  4HBT A;  4OQH A;  3CJM A;  2Z6C A;  3OLO A;  3MF0 A;  5F69 A;  3UMD A;  4H6J A;  3PBS A;  2JN7 A;  4X1L A;  5JYO A;  4YFM A;  2HP5 A;  4HNB A;  1STZ A;  3UE6 A;  5HD5 A;  1FIK A;  3KO6 A;  4P6Z M;  3S4X A;  1TEM A;  3S1Y A;  4NEE D;  2VEA A;  3T1X A;  4OVD A;  4U0T A;  3G31 A;  1EWZ A;  4BBU A;  4HEF A;  2ZMF A;  3GQZ A;  3UY6 A;  3BJN A;  2IWB A;  3OZH A;  3C7V A;  4KZ5 A;  4JF4 A;  2YKF A;  1O7E A;  3VP1 A;  3A0R A;  2WUQ A;  1I2W A;  1XPB A;  4Z9Q A;  5AVF A;  4EBN A;  2HJ9 C;  4QD4 A;  1PI4 A;  2Y2L A;  3ZG8 B;  4FH2 A;  5FEG A;  1XFQ A;  2EXA A;  3ZDJ A;  2V8F A;  3IXD A;  2Y4A A;  5J4E A;  4NXB A;  3BFF A;  2EX6 A;  1FSW A;  2XQZ A;  4KZ4 A;  5AJG A;  1ERO A;  3IS2 B;  2DNS A;  1BLS A;  3HBR A;  3PTE A;  5HW3 A;  2EX9 A;  4DF6 A;  4I5S A;  4EWF A;  2IA2 A;  4Q0I A;  2XH9 A;  1IYQ A;  1LL9 A;  2WKR A;  5FI6 A;  4ZTK A;  3F1N B;  3PHY A;  2VJW A;  1SKO A;  5EOO A;  1CEF A;  1K54 C;  4EUV A;  5CTN A;  1H8Z A;  2GZA A;  1PZO A;  5K5B A;  1KDS A;  1FCN A;  3QP2 A;  3PBR A;  4CQH A;  1XKZ A;  3S7P A;  3GDI A;  3UB5 P;  2ZMA A;  4PPR A;  3CIT A;  4E3O A;  1VQQ A;  2FZ0 A;  4ZRR A;  5EE8 A;  4JF6 A;  4I3A A;  3NIA A;  2MJ6 A;  2W3E A;  2VLG A;  1W63 M;  4RQ9 A;  2EXB A;  2JKR I;  4QHC A;  3MS6 A;  1ESI A;  4XUZ A;  1DY6 A;  2VV7 A;  4YOF A;  3UE0 A;  2V1Z A;  3A0V A;  4KG6 A;  3BM6 A;  1F9I A;  4R0Q A;  4S2J A;  4G3V A;  4QB8 A;  3T4T A;  4OON A;  5FA7 A;  3LEQ A;  1YMX A;  3TJZ C;  3HVF A;  2Z2L B;  1DRM A;  2Z6D A;  3NI9 A;  1W7F A;  4I39 A;  4XXR A;  5DFY A;  1YLP A;  3SS5 A;  4B9O A;  5TGF A;  4I3J A;  3O88 A;  4JPM A;  2WZZ A;  1YQS A;  4KQD A;  2CC1 A;  4DJ3 A;  3Q07 A;  2IWD A;  3FPV A;  1GA9 A;  2M1C A;  3S22 A;  3CLO A;  1CQA A;  3FV7 A;  4JGR A;  3EEH A;  4N92 A;  2V2F F;  1ZKJ A;  2Y55 A;  4BD0 A;  1WYC A;  5HDS A;  3UPO A;  3P7N A;  1YAX A;  5EFW A;  3LY3 A;  4BL2 A;  2UWX A;  4RVA A;  4LV2 A;  3HLG A;  4Q0H A;  3S7N A;  2H28 A;  3WS4 A;  1CJF A;  4HIA A;  2OAP 1;  1Q2Q A;  1K25 A;  2ZM0 A;  4MMN A;  5J3W A;  3I7J A;  3LYX A;  4G3W A;  4R3B A;  5E43 A;  3CUE C;  2ZQA A;  5KSC A;  2WAE A;  1XP4 A;  5HWV A;  2W3H A;  5IU1 A;  1FOF A;  3P01 A;  1NY0 A;  4BBV A;  5EVI A;  2C5W B;  1UGU A;  1W5D A;  2ZL1 A;  4IVI A;  4CLC B;  1IYP A;  3VP3 A;  4EU0 A;  2OWH A;  4IBR A;  3KYQ A;  2L1M A;  2FFF B;  3HJI A;  2KDK A;  1E3U D;  1OTE A;  4H6J B;  3HCY A;  4X53 A;  3VP0 A;  5HSQ A;  1L0F A;  2PYR A;  4X25 A;  5HL6 A;  4KEN B;  4FH4 A;  4OPR A;  3DAV A;  1HTZ A;  4CLC E;  2VGL M;  3C8C A;  3LCE A;  5EV0 A;  4WF0 A;  1JNU A;  4GS9 B;  3LO7 A;  2P08 A;  3LIA A;  1ESU A;  4WL9 A;  1K56 D;  2HDU A;  2C6W B;  4S2N A;  3RFB A;  1BUL A;  4ME4 A;  5EVE A;  3DTI A;  3PYP A;  3C2W A;  4E04 A;  1TS0 A;  2ZM8 A;  5DF8 A;  3DTM A;  3DW0 A;  3HUO A;  1T19 A;  2V1A A;  3FYZ A;  2WAD A;  5A93 A;  2V9A A;  3ZFZ A;  1CI9 A;  2EA9 A;  2PR5 A;  4GB7 A;  3ZQ5 A;  1YPR A;  4WZ4 A;  2BTF P;  4BMW A;  4FD8 A;  4P6B A;  1IYS A;  1DJB A;  1ZG4 A;  1MKM A;  2J3T D;  1Y54 A;  1F2K A;  1YKD A;  1M40 A;  2G2U A;  3B47 A;  4K0W A;  3CZD A;  3CG5 A;  3WS1 A;  4JXV A;  3UB6 A;  1KE3 A;  2V0W A;  2OV5 A;  1SKO B;  5KMW A;  3A3J A;  3IX4 A;  1LT0 A;  5G18 A;  1FR6 A;  4LLO B;  5A91 A;  2WGI A;  3UNW A;  1P0Z A;  3IF6 A;  3KYZ A;  2YKH A;  1JTD A;  3D72 A;  3GEC A;  2ZBB A;  5E2G A;  2LB9 A;  4OH0 A;  5I5L A;  2JKG A;  2J3T C;  4Y0U A;  4EES A;  4KZ6 A;  4EET B;  1PW8 A;  4WEL A;  3VOZ A;  4EQI A;  4JLF A;  3T1S A;  3OBF A;  2A49 A;  4U3T A;  1MC0 A;  4C3Q A;  2ZOI A;  5FAP A;  5CX7 A;  5GLB A;  3KSG A;  3IT9 A;  3V5M A;  3MQO A;  2M7U A;  2KLI A;  4GD6 A;  3R7W B;  4X68 A;  3IF5 A;  1S67 L;  1FQG A;  1L3L A;  2Y2G A;  3GV9 A;  3AGF A;  3JYI A;  2DRW A;  2PD8 A;  3RXW A;  3IWQ A;  5HFO A;  1XGI A;  3G2Z A;  1KE4 A;  1ONH A;  4EXO A;  1PWC A;  4HOI A;  4MBH A;  3OCL A;  4KG2 A;  3VE4 A;  2EFX A;  1BSG A;  3T4L A;  5CHU A;  5FAO A;  4UA6 A;  3E4P A;  1T1B A;  2ZQ9 A;  1SDE A;  2WZX A;  4LFU A;  1M6K A;  4KQO A;  3TW8 A;  4E3L A;  4LRX C;  3PR6 A;  4R6L A;  3BEC A;  1ES4 A;  4G3K A;  1K57 C;  4IED A;  4Q0J A;  1BZA A;  2JKT M;  2XF3 A;  4YWZ A;  5M19 A;  3N8R A;  4KZ8 A;  1CK3 A;  5EVI B;  1T18 A;  2ZL1 B;  4N1H A;  3JPU A;  3KSH A;  4L9G A;  1BLH A;  4HI4 A;  4X56 A;  5D3O A;  1E25 A;  2E8I A;  5KIZ A;  4WMC A;  1W79 A;  2J7V A;  3UO9 A;  1XA1 A;  2WKE A;  1BYW A;  4O0P A;  4L9E A;  3QP8 A;  3WS5 A;  1IKG A;  3M6H A;  3P98 A;  3TG9 A;  4DE1 A;  3PBN A;  1JTG A;  4OLD A;  2JKF A;  4LV3 A;  3VSL A;  2XEP A;  4DJ2 A;  1LI0 A;  4HJ4 A;  4CPK A;  1NLZ A;  4ETX A;  3LI8 A;  2Y59 A;  4O7D A;  4ZBE A;  4L0L A;  2WGW B;  3GR2 A;  2CMN A;  4EEU A;  1L0E A;  4MN7 A;  1KVL A;  1V9Z A;  2ACG A;  3ZVW A;  2WK0 A;  2VGL S;  5CER A;  3LR0 A;  5EUA A;  5FI7 A;  4LRY C;  2PAV P;  2L0W A;  1T1A A;  4NG2 A;  1D06 A;  4OQ0 A;  3IQA A;  1K4E A;  1PFL A;  5HWW A;  4D60 A;  3MZD A;  2QHK A;  2QJ7 A;  2Y2M A;  4LV0 A;  4GD8 A;  1J3W A;  4S2K A;  1YT4 A;  3T4Q A;  3NC8 A;  5EPH A;  2ZC3 B;  3VP2 A;  5A8B A;  1I2S A;  3UB9 A;  4QY5 A;  1RGY A;  4UQI M;  1PWD A;  5DF9 A;  5EVI D;  3VV4 A;  1XJ6 A;  5TFQ A;  3IBJ A;  4FUW A;  3ZNY A;  2PRF A;  4PMA A;  3UB8 A;  2J80 A;  1S1Z A;  2PU2 A;  3UPP A;  4P87 A;  1WYB A;  5CHJ A;  1O07 A;  5TBM A;  1ERQ A; 
#chains in the Genus database with same CATH homology
 4JPM A;  2WZZ A;  1YMS A;  3IF6 B;  5AQA A;  4K91 A;  1YQS A;  4N9L A;  2Y2K A;  1K6S A;  2CC1 A;  1GHM A;  3HLD A;  3Q07 A;  1XXM A;  4MBK A;  2IWD A;  5M18 A;  5FAS A;  1GA0 A;  4GN2 A;  1GA9 A;  3HLE A;  3S22 A;  1W8Q A;  3A3E A;  5E2F A;  3FWL A;  1NYY A;  1MWR A;  5L2F A;  5DVA A;  3HUN A;  3FV7 A;  4WYY A;  5GLC A;  4N92 A;  2V2F F;  2VGK A;  4OP8 A;  5EVI C;  1ZKJ A;  2HDS A;  2Y55 A;  3VOY A;  3B3X A;  2PU4 A;  3BFG A;  3C4P A;  1L2S A;  4BD0 A;  1WYC A;  3UPO A;  1E3U A;  1PW1 A;  3LY3 A;  4LCM A;  4OOM A;  4BL2 A;  2UWX A;  4RVA A;  4MNR A;  4LV2 A;  3HLG A;  3A3D A;  3WS4 A;  1NZU A;  1XGJ A;  1MY8 A;  5GLA A;  3WS0 A;  3FZC A;  1Q2Q A;  1DJC A;  3IXB A;  1K25 A;  2ZM0 A;  2OLU A;  4WEJ A;  2XDM A;  3I7J A;  4R3B A;  5E43 A;  2IWC A;  1ALQ A;  3PBQ A;  2ZQA A;  4HES A;  3WRZ A;  2ZC6 B;  1G6A A;  4ZJ3 A;  4GKU A;  4OPQ A;  4E6X A;  4S2M A;  1Z6F A;  5KSC A;  2HDR A;  5CGW A;  2WAE A;  1XP4 A;  4MBF A;  4JBF A;  3N4I A;  4R1G A;  4MEZ A;  3W4Q A;  5CEB A;  4KQQ A;  1HD8 A;  3GTC A;  4Y0T A;  1FOF A;  3O87 A;  4S2L A;  4WM9 A;  3A3I A;  3C4O A;  4ZJ2 A;  3W4O A;  1NY0 A;  2P74 A;  3FKV A;  4OOY A;  5EVI A;  2C5W B;  1YLT A;  2HP6 A;  1W5D A;  4IBX A;  4PM9 A;  1ES5 A;  1K56 A;  2A3U A;  4Y0O A;  4IVI A;  3PAG A;  2PBY A;  4A5R A;  1IYP A;  2DCF A;  4PM5 A;  1ZG6 A;  3VP3 A;  3HUM A;  2QPN A;  1MKI A;  2XFT A;  4IBR A;  3TSG A;  2FFF B;  4LEN A;  3IH9 A;  3VFH A;  5A92 A;  3AGD A;  1E3U D;  5HX9 A;  3HLC A;  1GCE A;  3GVB A;  3HL9 A;  4X53 A;  3VP0 A;  1YLW A;  1NJ4 A;  3NCK A;  1L0F A;  5KZH A;  3SS4 A;  4OKP A;  5AQ7 A;  4S2I A;  3ZG5 A;  2ZC5 B;  2XK1 A;  3G4P A;  3MKF A;  2ZQD A;  4KEN B;  1KGE A;  3M2K A;  4FH4 A;  4OQI A;  4MLL A;  4Y7P A;  4OPR A;  4D2O A;  3ZG0 A;  1K4F A;  2ZLY A;  4RYE A;  1HTZ A;  1SCW A;  4FCF A;  4KZ3 A;  4GNU A;  4U0X A;  1AXB A;  3LCE A;  4DE0 A;  1DJA A;  4JXS A;  2X01 A;  3BFE A;  1YM1 A;  4M3K A;  1ES2 A;  4C75 A;  3GSG A;  3VFF A;  3UPN A;  3N6I A;  5FQQ A;  1YLJ A;  3HLF A;  1I5Q A;  2JE5 A;  3LO7 A;  4E6W A;  5GL9 A;  2VGJ A;  3V39 A;  4Q8I A;  1ESU A;  4OP5 A;  4X55 A;  1QMF A;  3OPP A;  1K56 D;  3PAE A;  2HDU A;  4EBL A;  5CXW A;  2C6W B;  2OSU A;  4S2N A;  2XD1 A;  3Q7V B;  3E2K A;  4ID4 A;  1BUL A;  4BQM A;  4KZA A;  1IKI A;  3OPH A;  3MKE A;  4JKT A;  3SH8 A;  5BOH A;  1BLC A;  3Q81 A;  2P9V A;  3ZNT A;  4F94 A;  3MBZ A;  2WAF A;  2ZM8 A;  3DTM A;  3DW0 A;  3HUO A;  4GOG A;  5DF8 A;  2HP9 A;  3FYZ A;  2WAD A;  3MZE A;  5A93 A;  3Q1F A;  1KGF A;  3IHA A;  3ZFZ A;  5F83 A;  1CI9 A;  3GRJ A;  1FSY A;  2Y2Q A;  5CGS A;  3ISG A;  2J8Y A;  4KG5 A;  4GB7 A;  2EX2 A;  5CHM A;  1XX2 A;  4GDN A;  4C6Y A;  4WEK A;  4OPZ A;  4WZ4 A;  3M6B A;  2WKI A;  1IEL A;  3UDX A;  4FD8 A;  4P6B A;  3Q82 A;  1TVF A;  3RXX A;  1IYS A;  1DJB A;  1K55 A;  1ZG4 A;  3IHB A;  5FAQ A;  1PIO A;  5FAT A;  2ZQ8 A;  3MXR A;  2H0T A;  5I94 A;  2RCX A;  3BFD A;  4H8R A;  1Y54 A;  3SOI A;  4R4R A;  3EQV A;  3IXH A;  4HBU A;  4WZ5 A;  3UN7 A;  2ZM2 A;  3ZG9 B;  1M40 A;  3SH7 A;  3NDE A;  3Q7V A;  1BLP A;  4B88 A;  4E3M A;  5FQM A;  3UE3 A;  2ZQC A;  1PI5 A;  5EOE A;  2G2U A;  2R9X A;  4K0W A;  3ZVT A;  3M2J A;  3N8L A;  3CZD A;  3CG5 A;  3VSK A;  3WS1 A;  1LI9 A;  4JXV A;  4CJN A;  1WE4 A;  3IH8 A;  5HAP A;  4UA7 A;  1KE3 A;  4N9K A;  5DTT A;  3OC2 A;  4UHU A;  1N4O A;  2OV5 A;  4GDB A;  1EI5 A;  4XUX A;  4FSF A;  1S0W A;  5FQK A;  5KMW A;  3A3J A;  2ZJ9 A;  5G18 A;  1FR6 A;  2ZQ7 A;  3MXS A;  4R23 A;  4S2O A;  5A91 A;  2WGI A;  1BTL A;  1FCO A;  1IEM A;  3MZF A;  2XFS A;  3IF6 A;  3UNW A;  5CED A;  3G32 A;  5F82 A;  4X6T A;  3G34 A;  1OME A;  1XA7 A;  1SKF A;  1JTD A;  1W8Y A;  2XR0 A;  2WKH A;  5F1F A;  3VMA A;  4UAA A;  3BLM A;  5E2G A;  3UDI A;  3OCN A;  1KGG A;  1JVJ A;  1QME A;  2JC7 A;  4BJP A;  1K57 A;  4OH0 A;  1L0D A;  3NDG A;  5CGX A;  1ES3 A;  2XD5 A;  5AQB A;  1MWU A;  1KE0 A;  2EFU A;  2H10 A;  4Y0U A;  3NBL A;  5EEC A;  4RX2 A;  1CEG A;  2BLS A;  3UE1 A;  4KZ6 A;  4RA7 A;  1PW8 A;  4WEL A;  5DF7 A;  4DXC A;  3VOZ A;  4S2N C;  4EQI A;  4JLF A;  1U60 A;  1FR1 A;  1L0G A;  2OLV A;  2A49 A;  4U3T A;  3C5A A;  4C3Q A;  3DWK A;  1K38 A;  3WRT A;  3IWI A;  4ZAM A;  3N8S A;  4EBP A;  5FAP A;  4EUZ A;  1NYM A;  2Y91 A;  4JXG A;  4BD1 A;  5GLB A;  1Q2P A;  3IT9 A;  3V5M A;  5HL1 A;  4BEN A;  4BLM A;  4EV4 A;  4GD6 A;  5J8X A;  3ZHH A;  2Q9N A;  2XLN A;  4X68 A;  4ZDX A;  2HPB A;  4JXW A;  3SH9 A;  3ITA A;  3IF5 A;  3HLW A;  2B5R A;  1NXY A;  3AGE A;  1FQG A;  3SS3 A;  1K6R A;  3O3V A;  1MBL A;  1NZO A;  3WS2 A;  1C3B A;  2RL3 A;  3VP4 A;  4B4Z A;  3V50 A;  2FFY A;  2Y2G A;  1K55 C;  3GV9 A;  1CI8 A;  3BLS A;  1BT5 A;  2X02 A;  3AGF A;  3LY4 A;  5FDH A;  1N9B A;  4HBT A;  3JYI A;  3C7U A;  4N1X A;  3CJM A;  4OQH A;  5EVL A;  4WZ5 C;  2DRW A;  5JYP A;  3DWZ A;  3RXW A;  1RCJ A;  3IWQ A;  5HFO A;  5F1G A;  1G68 A;  1XGI A;  1MWT A;  3G2Z A;  1KE4 A;  1ONH A;  5CTM A;  3PBS A;  4YIN A;  1PWC A;  4E3I A;  5A90 A;  1J9M A;  4MBH A;  1PZP A;  1MPL A;  3QNC A;  4QU3 A;  1E4D A;  2BG1 A;  3LEZ A;  3OCL A;  5JYO A;  4KG2 A;  4YFM A;  3BRM A;  1JWP A;  2EFX A;  3Q7Z A;  1BSG A;  2HP5 A;  1MXO A;  2Z2M B;  5CHU A;  5FAO A;  1JWV A;  2JCH A;  4UA6 A;  3IF6 C;  5AQ9 A;  2ZQ9 A;  1SDE A;  2WZX A;  1VM1 A;  5U47 A;  1M6K A;  4KQO A;  5TR7 A;  4JF5 A;  3S4X A;  1TEM A;  3S1Y A;  4E3L A;  2XGN A;  4WBG A;  3BEC A;  4OLG A;  4OVD A;  1ES4 A;  4U0T A;  4R4S A;  1K57 C;  2H5S A;  1EWZ A;  3G31 A;  5CRF A;  3E2L A;  4IED A;  1LLB A;  2ZC7 A;  4HEF A;  3EQU A;  1NRF A;  4KZB A;  4LCL A;  2GDN A;  3GQZ A;  3UY6 A;  1FCM A;  1BZA A;  4DKI A;  2IWB A;  1HVB A;  2XF3 A;  3OZH A;  5M19 A;  3N8R A;  4KZ8 A;  2EX8 A;  1CK3 A;  5CEC A;  2H0Y A;  3C7V A;  5EVI B;  4KZ5 A;  5DTK A;  4JF4 A;  4N1H A;  1O7E A;  3VP1 A;  5DTS A;  1BLH A;  2WUQ A;  4PM6 A;  4X56 A;  1E25 A;  1I2W A;  5D3O A;  2E8I A;  5E2H A;  5GHX A;  3PBO A;  4WMC A;  1XPB A;  1W79 A;  2J9O A;  2J7V A;  3BFC A;  2JBF A;  3HLB A;  1XA1 A;  4Z9Q A;  2WKE A;  3UO9 A;  3W4P A;  5HAQ A;  3ZCZ A;  4EBN A;  1MWS A;  5GHY A;  3WS5 A;  4E3N A;  3IXG A;  1TDG A;  4QD4 A;  1IKG A;  3M6H A;  3P98 A;  3TG9 A;  2J9P A;  1PI4 A;  2Y2L A;  3ZG8 B;  4DE1 A;  3ZG7 B;  3PBN A;  4RX3 A;  4FH2 A;  1JTG A;  3P09 A;  1H8Y A;  1KVM A;  2EXA A;  4OLD A;  3FKW A;  3ZDJ A;  3ITB A;  2Q9M A;  3IXD A;  4LV3 A;  4OPY A;  2XEP A;  1PYY A;  3VSL A;  2Y2J A;  2Y4A A;  1LI0 A;  4PM8 A;  4DE3 A;  5FQ9 A;  3BFF A;  2EX6 A;  3BEB A;  1FSW A;  2XQZ A;  5KSH A;  2R9W A;  3MFD A;  4KZ4 A;  4BL3 A;  1ONG A;  4CPK A;  3PBT A;  2Y59 A;  4O7D A;  1ERO A;  2DNS A;  4ZBE A;  1ZC2 A;  1BLS A;  2WGW B;  2ZD8 A;  4L0L A;  3GR2 A;  4LV1 A;  3V3R A;  1L0E A;  1KVL A;  1GHP A;  3HBR A;  3PTE A;  3OPL A;  4E3K A;  4OQG A;  5HW3 A;  2EX9 A;  3ZVW A;  3IWO A;  4DF6 A;  2Y2O A;  3G30 A;  2WK0 A;  3NY4 A;  4S2P A;  5FI2 A;  4DE2 A;  4EWF A;  4DDS A;  3BYD A;  5CER A;  3TOI A;  1LHY A;  2XH9 A;  5EUA A;  1IYQ A;  1LL9 A;  5IHV A;  3CMZ A;  4R3J A;  3O86 A;  1SDN A;  5FI6 A;  5FI7 A;  4ZTK A;  5HAR A;  1RP5 A;  5FQI A;  2HDQ A;  2I72 A;  2V20 A;  2X71 A;  4WMC D;  4QY6 A;  1CEF A;  5EOO A;  1K54 C;  5E2E A;  5CTN A;  1H8Z A;  4X69 A;  1JWZ A;  1PZO A;  3QNB A;  4P85 A;  1KDW A;  2Y2N A;  1KDS A;  1FCN A;  1H5X A;  3PBR A;  4KZ7 A;  1XKZ A;  4PM7 A;  4ZJ1 A;  4OQ0 A;  3IQA A;  2ZMA A;  4PPR A;  2P9V B;  3N7W A;  1VQQ A;  4E3O A;  1K4E A;  1SHV A;  3OPR A;  5EE8 A;  4JF6 A;  5FSR A;  4DXB A;  1S6R A;  3NIA A;  3MZD A;  4KZ9 A;  5HAI A;  2Y2M A;  2Y2H A;  4DDY A;  4LV0 A;  1IYO A;  4UA9 A;  1RGZ A;  2EXB A;  4GD8 A;  3V3S A;  5GHZ A;  4QHC A;  4S2K A;  1ESI A;  1PWG A;  5FQJ A;  1YT4 A;  2WGW A;  4DRT A;  4NET A;  3WWX A;  2QMI A;  3G2Y A;  1DY6 A;  3D4F A;  3NC8 A;  3QHY A;  4XUZ A;  5EPH A;  2ZC3 B;  3UDF A;  3VP2 A;  3W8K A;  3UE0 A;  2G2W A;  1I2S A;  2V1Z A;  4QY5 A;  4KG6 A;  4P0M A;  1RGY A;  1YLZ A;  3BM6 A;  4R0Q A;  4S2J A;  3RJU A;  1PWD A;  1TDL A;  4QB8 A;  1YLY A;  5DF9 A;  5EVI D;  1GHI A;  4K0X A;  3ZGA B;  1K54 A;  4OON A;  5TFQ A;  4KQR A;  1BUE A;  3A3F A;  4NK3 A;  3ZNY A;  2Y2P A;  5FA7 A;  5GLD A;  2Y2I A;  2ZC4 B;  5M1A A;  4PMA A;  1LL5 A;  1YMX A;  2PU2 A;  4GZB A;  1ERM A;  3HVF A;  3UPP A;  4P87 A;  2QZ6 A;  2Z2L B;  4IVK A;  1WYB A;  5CHJ A;  3NI9 A;  3GMW A;  1HZO A;  1O07 A;  4QJG A;  2WYX A;  1W7F A;  4XXR A;  3HRE A;  2WGV A;  4B4X A;  1YLP A;  3SS5 A;  4OOL A;  5TGF A;  4E3J A;  3O88 A;  3G35 A;  1ERQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...