1UWPX

Initial events in the photocycle of photoactive yellow protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
113
Chain Sequence
EHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQNAAGDITGDPKQVIGKNFKDDSPEFYGKFKEGVASGNLNTMFEYTDQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Initial events in the photocycle of photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 34
structure length 113
sequence length 124
ec nomenclature
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1uwpX00
4WLAA 3IS2A 1LSXA 2WKRA 1UWPX 4JGPA 2CMNA 5HWVA 2R78A 3ICYA 4HOIA 3LYXA 3P7NA 1GSWA 4WUJA 5G4ZA 3BWLA 1N9OA 3ULFA 3MR0A 4PKYA 1OTEA 4I5SA 5HD3A 3K3DA 2PD8A 4HH2A 4KUOA 2JN7A 5HWTA 1V9YA 2V1BA 1S1YA 3MXQA 4GHIB 4HP4A 1OTDA 2YKFA 3LICA 4JGQA 4JGRA 3SW1A 5I5LA 1OJ5A 5HDCA 5EFWA 1N9NA 2OWHA 2EA9A 2PYPA 1DP6A 1OTIA 4HHDA 3UB7A 5F6AA 3CWFA 1LSVA 4EEUA 3H7WA 3UB9A 2W27A 2GJ3A 5AVFA 2QKPA 2BASA 3NOUC 4HJ3A 4BBUA 4RQ9A 4I39A 1Y28A 3D72A 3LIFA 3H7WB 4DJ2A 2PYRA 2D02A 1S67L 3H82A 5F69A 5A8BA 3VE4A 1TS6A 1XJ4A 5HD5A 3UB6A 1P0ZA 4GS9A 1XFQA 4GW9A 4WN5A 3NOTC 2H28A 1UGUA 3PYPA 3LIAA 3T50A 4B9OA 1N9LA 1LT0A 3LIBA 3H82B 3EEHA 3GDIA 4EW7A 4GS9B 4MN5A 1GSVA 1T18A 1VB6A 1D06A 3BY9A 2A24A 3LIEA 2V9AA 3F1PB 1XJ2A 4HP9A 1OTBA 4LLOB 2INWA 4I3IA 5DJTA 2M1CA 1EW0A 2PR6A 2HV1A 2Z6DA 1T1CA 1GSXA 1DP9A 5J7EA 4GHIA 4E04A 5IS1A 4JGOA 2A24B 1V9ZA 3A0SA 2PD7A 3HJKA 2K7SA 4EESA 2OOLA 3OLOA 1TS8A 4LRYC 3LIDA 3HJIA 1BYWA 4GCZA 4HI4A 2ZOHA 2L0WA 2VV7A 2WKQA 3MFXA 1F98A 4R38A 3LI8A 3LUQA 4YWZA 2OWJA 2PR5A 4HNBA 3B33A 2Z6CA 1XFNA 1P97A 1LSWA 3G6OA 3UMDA 3C2WA 4XT2B 3NHQA 2L4RA 3IBRA 1OT6A 4F3LA 3E4QA 4HY8A 4EQ1A 5HDSA 4EETB 2PHYA 4I38A 2L1MA 3VOLA 3E4PA 3F1OA 2QWSA 3MJQA 3FC7A 1XJ6A 4BBTA 4F3LB 4KQDA 3RTYA 5HSQA 1OJGA 2VV8A 3K3CA 3C8CA 2D01A 3F1OB 4NXEA 2VEAA 4HQAA 1G28A 5KIZA 4H6JB 1KOUA 5IU1A 1ODVA 3F1PA 3CAXA 2KX6A 3LI9A 5HZHA 1S4RA 4HIAA 1JNUA 4L9EA 4DJ3A 1OTAA 1S66L 1S1ZA 4LPZA 2WKPA 4NXBA 5TBMA 3VE3A 5F5YA 4HJ4A 4MN6A 4NXFA 4KUKA 4BBVA 1WA9A 4LRXC 2B02A 3MQQA 5TBMB 2V0UA 2ZBBA 5G4YA 2V1AA 3IS2B 5J4EA 5HWWA 5HDDA 4XT2A 3NJAA 1UWNX 3A0VA 3KX0X 3A0RA 1S4SA 5AVEA 1X0OA 3BY8A 5J3WA 3UMEA 2I9VA 3NOPC 2QHKA 2W0NA 4EERA 4I3AA 3F1NA 1TS7A 3RH8B 1LL8A 1DRMA 2ZOIA 4I3JA 3FG8A 4R3AA 3CLOA 2QJ5A 2JHEA 1T1AA 5F68A 2KDKA 4M4XA 2VLGA 4H6JA 3F1NB 1T19A 3MQOA 1OT9A 4HJ6A 3H9WA 1MZUA 5DKKA 2P7JA 2QJ7A 2PDRA 3UB8A 4LRZE 4NXGA 5DJUA 3EWKA 4PKYG 2J80A 4EEPA 1NWZA 4R70A 1XJ3A 3GECA 1F9IA 5DKLA 2VV6A 3E4OA 4R6LA 2YKHA 3UE6A 4HH3A 1TS0A 2V0WA 1T1BA 3PHYA 4WF0A 1DP8A 3ZQ5A 4K08A 4EXOA 4WL9A 1D7EA 4L9FA 4L9GA
chains in the Genus database with same CATH superfamily
4CPKA 4EBNA 1UWPX 5G18A 1IOUA 4X1MA 3ICYA 3PR6A 3LYXA 1GSWA 3FWLA 4GZBA 2Y2JA 5G4ZA 3TE8A 1K55C 2WK0A 2QZ6A 1ZG6A 2EWWA 1RGZA 3C7UA 1PRQA 1N9BA 3SH8A 2GX5A 2JKTI 5FEGA 3LY3A 1OTEA 1PNEA 5HWTA 1BUEA 5FQQA 4B88A 1ERMA 3W4QA 3NBLA 4GHIB 2HF6A 3LICA 5CECA 1M40A 3SW1A 1CF0A 1OJ5A 3ZG7B 4U0TA 4WM9A 3L7HA 1P9RA 3G30A 1HZOA 3Q81A 4Q0HA 3CWFA 3U4LP 4DDYA 3EOIA 1ZTUA 3ZGAB 3LR5A 4H8RA 1FCMA 1BT5A 3IWOA 3H7WA 1OPXA 4UAAA 2UV0E 2AVXA 1W79A 1PI4A 2GJ3A 2QKPA 2IWBA 4GD6A 1BLSA 1NYMA 2BASA 4S2KA 2C5WB 4HJ3A 5CEDA 3SH9A 4LGWA 4QPRA 4I39A 3LIFA 1CK3A 2PYRA 4KZ6A 1S67L 3H82A 3LCEA 1XJ4A 4ZRRA 2J8YA 3A3EA 4GS9A 4WN5A 1YQSA 3IWQA 3PYPA 3LIAA 3T50A 2ZQ8A 3UY6A 4B9OA 2PT7A 5HL1A 4BL3A 1LT0A 3UDFA 3PBSA 3EEHA 3P98A 1YLZA 3CG5A 3T4KA 5TJJA 3GTCA 3NI9A 4P87A 5EM0A 4GLQA 1VB6A 3I7JA 2A24A 2WGVA 2VGLS 2V9AA 3F1PB 1XJ2A 5CRFA 4HP9A 4ZJ3A 4I3IA 3WS0A 4O8GA 2M1CA 2WGIA 2Z6DA 1L0GA 3ITAA 4E3LA 2P9VA 5EECA 4DE3A 1H8ZA 5J7EA 4E04A 2XF3A 4JPMA 3B47A 1L2SA 5GHYA 2PD7A 3KO6A 2DCFA 4R3JA 4EESA 1YT4A 3OLOA 3ZDJA 4Q0IA 4E3OA 4DF6A 5L10A 2KLIA 2ZL1A 4FSFA 1Z09A 2WZZA 4HI4A 4DXBA 3NCKA 3MQ0A 4N92A 3MFXA 1F98A 4OKPA 4R4RA 3LUQA 4YWZA 2OWJA 2PR5A 4OH0A 1PIOA 5FA7A 1NLZA 4R0QA 4Y2FA 1XPBA 1P97A 1LSWA 3FV7A 3HLCA 4CLCB 3WS5A 1GA0A 1J3WA 2V2FF 1JTGA 4MBFA 1Y54A 4Y5FA 3E4QA 4P85A 4HY8A 2K31A 4E6XA 2PHYA 5DF7A 5JYOA 2HGVA 3NECA 2XD5A 4GB7A 4WMCD 1GA9A 3IH9A 5HAQA 4LCLA 4QU3A 2JKFA 1KE4A 1XJ6A 1HTZA 4GJ4A 3T4OA 5HSQA 2V1ZA 3VP4A 4B4ZA 3K3CA 5CGXA 1IKGA 4NXEA 4RX3A 4K0WA 4ZTKA 3LR4A 3WS4A 5KIZA 3UB5P 3T1XA 5A91A 4ETXA 4WZ4A 4UA9A 4ZJ1A 4PHTA 4NK3A 3SS4A 3C5AA 2HP5A 2A2LA 4GKUA 1MXOA 1QMFA 3P01A 3MZEA 4YINA 3PAEA 1JNUA 1GHMA 3ZVWA 3MZFA 1K56A 5GL9A 2EFXA 3A3DA 3G32A 5F82A 4N1HA 4X1LA 2Q0OA 3PBTA 4NXFA 3N4IA 3IXHA 3DW0A 2VGJA 3IF5A 2PAVP 1K54C 3W4PA 3VOZA 1PZOA 4ARZA 3E0YA 4WBGA 4QY5A 4LRXC 4CQHA 1WYBA 3MQQA 5C5KA 2V0UA 4FH2A 3U2AA 5FI6A 5FATA 5HWWA 3V50A 1LLBA 3HUNA 5HPIA 1IYPA 5BOHA 1YMXA 4X53A 3W2ZA 2OAQ1 4WYYA 3FPVA 3MFDA 3P09A 3RH8B 4P6BA 3IX4A 1LL8A 4I3JA 1ONHA 1TF1A 2O0YA 4KZ8A 3T4SA 3M2JA 3MMHA 4BMWA 1KGEA 3GV9A 2ZQCA 1T1AA 5EPHA 2W1TB 4DE1A 3DWZA 3UE1A 4BQMA 2XD1A 2B95A 4H6JA 2ZC3B 5GLCA 3S7NA 3S7QA 3NC8A 3KSHA 4S2OA 5DKKA 2ZQAA 4UA7A 2P7JA 4FCFA 4CLCE 3GR2A 4PKYG 5KMWA 4OQIA 3VFFA 4EEPA 2XR0A 2Y91A 4EU0A 1W8QA 3T1RA 5DKLA 4R6LA 3GRJA 2GZAA 3GMWA 5AQ9A 3RJUA 1YSPA 1PYYA 3OCNA 3CZDA 2NUPC 2JE5A 4PMAA 2JC7A 4L9FA 1IKIA 5F1GA 3UDIA 3NULA 3IS2A 4WLAA 4CLCC 3M6HA 4S2PA 4Y0TA 2W3FA 3N8SA 1I5QA 3EGXC 3HCYA 4GDNA 1G68A 4JGPA 1KE0A 5HPFA 5HWVA 4WZ5A 1D1JA 2BG1A 2J3TC 1FCNA 3PBNA 4FH4A 5FQIA 4K91A 2EXBA 1NXYA 3TG9A 4GDBA 1MBLA 4IEDA 3A3FA 2LB9A 3NY4A 5HD3A 4HH2A 1WYCA 3MKFA 5EE8A 2ZJ9A 1KGFA 5EVLA 3BECA 1S1YA 4FOFA 4QB8A 4U0XA 1K54A 5I5LA 4ME4A 1PWDA 2ZD8A 1MC0A 5L2FA 2OWHA 2PYPA 4R1GA 1ACFA 4OP8A 4HHDA 3UB7A 2PU4A 4UQIM 1E25A 1YLJA 3Q7VA 1G6AA 4EQIA 1ES3A 4KZ3A 1DY6A 5J8XA 2XGNA 3PBRA 5CHUA 4MEZA 3UB9A 3T4JA 1LI9A 1W7FA 4XXRA 1L0DA 3N6IA 2XFTA 5KZHA 4NKPA 5TGFA 4RQ9A 2VGKA 5CEBA 3CUEC 1JWVA 4DMZA 4Z9QA 2J3WA 5CHMA 4DJ2A 4Y13A 1JVJA 4X69A 2A49A 3B3XA 4CLCD 3TJZC 5HD5A 3HLBA 2XROA 4N1XA 1G5UA 3N8RA 3MKEA 4OONA 1UGUA 2P74A 1KVMA 2J3TD 5DTSA 3CHWP 2H10A 1VETB 3LIBA 3BYDA 2X01A 3GDIA 1KE3A 3ITBA 1NZUA 4MN5A 1GSVA 1T18A 2PRFA 3G31A 4L0LA 4OPYA 1PZPA 3AGDA 3BQ8A 1L0FA 5M1AA 1ZKJA 4Y15A 4KZBA 4FD8A 3QP2A 1OTBA 4LLOB 2INWA 2XEPA 5DJTA 2FH5A 2PR6A 1BULA 3R4KA 1BLCA 1T1CA 1GSXA 4X25A 5IS1A 2PU2A 1E3UD 5L8MA 3AGEA 1W8YA 3A0SA 3HJKA 5EM1A 2OV5A 1EROA 2K7SA 3QP6A 3UN7A 2OOLA 4M3KA 1TS8A 1K57C 3KYQA 4LENA 4QY6A 4S2MA 2Y2OA 3QP5A 3LIDA 3PBOA 1BYWA 1ESIA 4S2NA 1YLTA 2WKQA 3JYIA 2EX2A 1H5XA 4HNBA 2XFSA 3B33A 1PFLA 1LL9A 1XFNA 3NDEA 1Z6FA 3IXBA 1OMEA 3DAVA 2OSUA 5DTTA 3TSGA 3C2WA 2VK3A 3HREA 4XT2B 2L4RA 1LL5A 1OT6A 3VP2A 1SKOB 2Y2LA 4E6WA 1XX2A 4EQ1A 5HDSA 3HLFA 1SKFA 4IUHA 4MN7A 4Y3IA 4X68A 4QHCA 4OQGA 3LO7A 2QWSA 1PWGA 4B4XA 3MJQA 4C75A 2HDQA 3G2YA 4YNRA 5FQJA 2ZQ7A 1MWSA 4BBTA 1E3UA 4F3LB 3VP3A 5CHJA 1ES4A 5HFOA 1OJGA 1IEMA 4MDZA 1WE4A 3O3VA 3C8CA 3F1OB 3UE0A 4HQAA 5L07A 3ZCZA 1G28A 2O99A 5EVIC 1KOUA 3HLGA 1ODVA 4N9LA 4ETZA 3OPRA 1S4RA 3UPNA 3IF6C 3UNWA 1PW8A 3S4XA 4L9EA 3RXWA 1S66L 4LPZA 5AQ7A 3QP4A 5F83A 5A93A 5F5YA 5IT5A 4HJ4A 4EBLA 4MBKA 5DVAA 2B5RA 4C3QA 2JKRI 4NEED 3SOIA 1BLPA 3IHAA 3PAGA 2HDSA 5CX7A 3SS5A 5CGWA 2ZBBA 1ESUA 2G2UA 4EV4A 2V1AA 5HDDA 3NJAA 1K38A 1XGIA 1FR6A 5LBRA 3HUMA 3O5YA 3KX0X 4GD8A 3VV4A 4ZBEA 4PM6A 1K55A 1SHVA 1K0KA 3BY8A 5J3WA 2EXAA 4DE2A 3FKWA 4EERA 4IVIA 3TW8A 1K25A 3V3SA 3UDXA 4BWIA 2WGWA 2ZC5B 5CERA 3FG8A 1CI8A 4D2OA 3S1YA 3D4FA 4BJPA 3FKVA 4UHUA 1K6RA 2VLGA 3MXSA 3OCLA 5HAIA 4JF5A 1K4EA 1MZUA 4X56A 5GHZA 3M6BA 4FUWA 2QJ7A 2V8CA 2LB5A 5DF8A 2WYXA 3UB8A 4E3JA 3C4PA 3B42A 5DJUA 3EWKA 1ES2A 1DJAA 2IA2A 2J80A 2QPNA 3WS1A 3IXGA 4MMNA 2JKTM 4Q0JA 3N8LA 1CQAA 1TDLA 5CTMA 2VA0A 2ZM8A 4KZ7A 3GECA 3V3RA 4E3MA 3O86A 1LHYA 2X71A 2VV6A 1NLYA 3OC2A 4UA6A 5FI2A 3UE6A 4KG6A 4Y0UA 4LV2A 3ZQ5A 3UPPA 2O9AA 3BRMA 3G34A 4B93A 4WL9A 4WMCA 3NDGA 2HDRA 3QP1A 3BM6A 4ZJ2A 1LSXA 4OPRA 2OLUA 4KG5A 3IT9A 1W63M 2Q9NA 4OLDA 4F94A 1F2KA 2R78A 2Y55A 2ZQ9A 5GLBA 4S2LA 4WUJA 4KQQA 1JTDA 2K2NA 2HJEA 5A92A 1H0MA 1BTLA 3V39A 4HBTA 3BEBA 3ULFA 3VP1A 1I2SA 4RX2A 3MR0A 4PKYA 4E3IA 3PBQA 4I5SA 2PD8A 2XQZA 5FASA 2JN7A 2W1RA 5TFQA 1V9YA 2V1BA 2XDMA 1S0WA 4LV0A 2P9VB 1NZOA 3MXQA 4X55A 5E43A 4HP4A 2Z2LB 2YKFA 3DTKA 4JGQA 2HZ5A 1FOFA 3KSIA 3E98A 3IX8A 5HDCA 2EA9A 1MY8A 3LFVA 3TOIA 4R23A 1DP6A 1CEFA 1OTIA 3R7WB 5EV0A 3A3IA 2WAFA 4EEUA 2WAEA 3ZG0A 3BLSA 1H8MA 5FQKA 1RGYA 4K0XA 4IBXA 1AWIA 1YLWA 1KVLA 2W27A 1N4OA 5AVFA 2Q9MA 3CPTA 2ZM0A 4N9KA 1SZVA 3NOUC 4BBUA 4JKTA 2FFFB 2ZC6B 2MJ6A 3D72A 5AQBA 2ACGA 5F1FA 1U60A 3T4QA 1VETA 5F69A 2ZC4B 5A8BA 5DFXA 3VE4A 3UB6A 1P0ZA 3UO9A 1SCWA 1XFQA 4GW9A 2W3EA 4R3BA 3OOVA 5EUAA 4MNRA 1L0EA 1XP4A 4PAUA 1O07A 4EUVA 3T12B 4EW7A 3BJNA 1D06A 2RL3A 3BY9A 1GCEA 3LIEA 3KSFA 1ALQA 1XA7A 5CGSA 3ZG8B 5FL3A 1FSYA 3DBAA 1MWRA 4CJNA 3ZFZA 1DP9A 4ZAMA 2VJWA 4GHIA 1Y4OA 1STZA 3ISGA 4DE0A 5EVIB 4O0PA 2VGLM 2Y2PA 5A90A 2WKIA 4IHQA 1FSWA 4HBUA 4EBPA 2XA7S 3T1QB 1ONGA 4LRYC 2JKGA 3HJIA 2KOIA 4GCZA 3IF6B 2ZOHA 2VV7A 4R38A 3LI8A 4YFMA 3SH7A 2WUQA 1F5MA 5KSCA 1K4FA 1XKZA 3VFHA 3OPLA 4ARZB 4WEJA 4P6ZS 4KZ9A 4S2JA 2GDNA 1EI5A 3EQUA 1VEUB 4GNUA 1IFQA 2JCHA 3NHQA 2G7UA 3IBRA 4KQOA 3S22A 5FDSA 3SZTA 2M7UA 4F3LA 1PW1A 4EETB 3MZDA 3QP8A 1S6RA 2E8JA 2HP6A 1W63Q 3D3OA 2XH9A 2L1MA 4OP5A 2ZQDA 3F1OA 5M19A 2GNXA 4Y17A 5HW3A 3KYEA 3FC7A 4KQDA 4EUZA 3RTYA 2ZLYA 1PWCA 1KGGA 1XXMA 2VV8A 4OPQA 1HVBA 5KSHA 3WRZA 2VEAA 2VX8A 3WWXA 4H6JB 3LGOA 4O7DA 3F1PA 3KYZA 3CAXA 3LI9A 3ZG5A 4JF4A 1ZC2A 5GLDA 1CEGA 4ESPA 3TRCA 5AJGA 1Q2PA 1OTAA 3O87A 1S1ZA 5E2EA 1A0KA 2OAP1 4NXBA 3MXRA 4OPZA 3M2KA 2EX6A 3VE3A 3WRTA 1K6SA 5E2HA 5IHVA 4PPRA 2WZXA 4DKIA 5E2FA 3LR3A 1ZHHB 2CC1A 1WA9A 4DXCA 1NRJA 4JF6A 1JWZA 2B02A 2XRNA 5HL6A 5TBMB 1E4DA 2ZMVA 4CLCA 3IS2B 1IYOA 3W4OA 1YLPA 2QMIA 3G2ZA 5CTNA 5FEFA 3ZHHA 3JVVA 4RVAA 3ZNYA 1J9MA 3BW6A 3E2LA 4PM5A 1S4SA 2HPBA 3G35A 4LCMA 3JVUA 2WADA 3GSGA 2I9VA 4P0MA 3NOPC 2QHKA 2E8IA 5EVEA 4Q8IA 4JBFA 3MS6A 4IBRA 1TS7A 4DN0A 3EEAA 1I2WA 1YAXA 3FPWA 2Y2HA 4S2IA 3CITA 2QJ5A 2JHEA 2X02A 2I72A 1FQGA 5F68A 2BTFP 1L3LA 1P9WA 4M4XA 4RA7A 1SDNA 1XA1A 1NRFA 3F1NB 1T19A 3MQOA 4IVKA 3CMZA 2QYBA 4O01A 1OT9A 2EX9A 4WELA 1G6OA 3H9WA 3IH8A 2H5SA 3HLDA 3S7OA 3BLMA 4Y0OA 3BFFA 1KDWA 4HEFA 2PDRA 3W8KA 4LRZE 1MWTA 3LEZA 4NXGA 3O88A 1CI9A 2R9WA 4R4SA 3Q7VB 3EGDC 3T4LA 1YSQA 1QMEA 4PM7A 3IQAA 1NWZA 3V5MA 1ZG4A 4EWFA 2DNSA 3HL9A 4MLLA 1FIKA 4JXGA 1F9IA 3LR0A 3T1SA 5HAPA 3VP0A 3NIAA 3BFEA 2HJ9C 1TS0A 2Y4AA 3JPUA 1T1BA 3CUEA 3PHYA 2WKEA 1TD5A 4II7A 1TVFA 1NY0A 2J9PA 1D7EA 2DMWA 2XK1A 3UE3A 2WKRA 4LFUA 1NJ4A 1TEMA 2H0YA 4IUKA 1BZAA 2CMNA 3OPPA 4NETA 2Y2IA 3OPHA 4HOIA 2FZ0A 3P7NA 1MPLA 3BWLA 2Y2QA 4KZAA 3ZYTA 1O7EA 2M7VA 3BQAA 4JXSA 4OOLA 1N9OA 2FFYA 5CXWA 3D9YA 2VZWA 3IWIA 4JLFA 1Q2QA 2EX8A 4OOMA 4LV3A 2BLSA 3G4PA 3K3DA 4JXVA 4KUOA 1FILA 3R7WA 3RFBA 4UQIS 4LV1A 5FSRA 2W1TA 4PM8A 3LEQA 1OTDA 3AGFA 1VM1A 4JGRA 1H8YA 4E3KA 5EFWA 1N9NA 1K57A 2XA7M 5F6AA 2Y8HA 1LSVA 3HLWA 5FI7A 2O9CA 1LI0A 2A3UA 5EVID 2V20A 4KENB 1K56D 2EFUA 3VOYA 5L09A 2H0TA 4P6ZM 1ES5A 2G2WA 4BENA 5EOEA 3HUOA 2C6WB 1Y28A 3H7WB 4OQHA 2D02A 4UEYA 1IYQA 2DRWA 4C6YA 5GLAA 3IHBA 4G3KA 1TS6A 4DRTA 4Z1WA 3NOTC 2H28A 1SDEA 4OVDA 4WZ5C 2XLNA 1HLUP 1N9LA 5HX9A 4U3TA 3H82B 2HDUA 2EWVA 5FQMA 4KQRA 4GS9B 1GHPA 3GQZA 5DFYA 2W3DA 3ZNTA 3RXXA 5EVIA 5DTKA 5FQ9A 2W3HA 5MC7A 4OLGA 3LY4A 3S7PA 3FZCA 5JYPA 1EW0A 2HV1A 4DDSA 2UWXA 4HESA 3IF6A 1NYYA 3Q82A 2ZM2A 1FCOA 5EOOA 4JGOA 1AXBA 2A24B 1V9ZA 4AFIA 3Q1FA 4MBHA 4QJGA 3MF0A 2Y2KA 3Q07A 3WS2A 1YLYA 3IX3A 4BLMA 2PBYA 3PTEA 1VEUA 3C38A 4NG2A 2L0WA 1DJBA 4BD1A 3HVFA 2Z6CA 3A3JA 3KSGA 4A5RA 4MCWA 4BD0A 4QWOA 3CI6A 3G6OA 2ZL1B 4YOFA 3C4OA 3VMAA 3UMDA 3PXPA 2PBDP 1XGJA 4XUZA 2ZMAA 4I38A 3VSKA 3VOLA 3E4PA 2Y2MA 4QD4A 2JKRM 2R9XA 3K2NA 4OQ0A 3IBJA 1HD8A 3QNBA 5AQAA 1YKDA 3SS3A 4WEKA 2WGWB 1W5DA 3Q7ZA 3VSLA 2D01A 4GOGA 4D60A 1BSGA 5E2GA 2O9BA 1DJCA 5IU1A 3MBZA 5M18A 3UPOA 3DTMA 2V8FA 3N7WA 5HARA 4XUXA 2KX6A 3T4TA 5HZHA 3EQVA 3GVBA 4Y7PA 3L9KA 4KZ4A 4HIAA 4G3WA 4DJ3A 5FAPA 5TR7A 3ZG9B 4PM9A 3ZVTA 2JBFA 2WKPA 5FDHA 5TBMA 5K5BA 2ZC7A 2OLVA 4MN6A 4RYEA 5DF9A 1BLHA 3BFGA 3BFDA 4KUKA 4S2NC 4BBVA 4IJGA 3DTEA 2ZMFA 2HP9A 2IWCA 1MKIA 3HLEA 1M6KA 3HBRA 5G4YA 4X6TA 3OZHA 5J4EA 2Z2MB 2Y59A 4XT2A 1FR1A 1SKOA 1VQQA 5FAQA 1UWNX 2VKSA 3QNCA 3A0VA 4OOYA 2RCXA 3A0RA 4ID4A 3C30A 3OBFA 1ERQA 5AVEA 1CJFA 5U47A 1X0OA 3UMEA 1GHIA 3CJMA 2W0NA 3E2KA 1EWZA 1YMSA 4I3AA 3F1NA 4ZDXA 1DRMA 1RP5A 2ZOIA 4FTXA 1C3BA 2WKHA 4JXWA 1JWPA 3C7VA 2Y2NA 1IYSA 3CLOA 4R3AA 2P08A 4G3VA 2KDKA 3MSHA 2P04A 1YPRA 2Y2GA 4E3NA 3FYZA 1RCJA 5GHXA 4HJ6A 3DTIA 4KG2A 2J7VA 4BL2A 3IXDA 5I94A 1PI5A 5FAOA 1TDGA 3BFCA 1KDSA 2W3GA 1MWUA 1IELA 2Y79A 4R70A 1XJ3A 1MKMA 3CPTB 2NUTC 4GN2A 3E4OA 5D3OA 2XSSA 2YKHA 4HH3A 1YM1A 2V0WA 4KZ5A 2IWDA 3DWKA 1VHMA 4WF0A 1DP8A 2J9OA 4K08A 4EXOA 3QHYA 2B18A 4L9GA 1H3QA 3V67A
chains in the Genus database with same CATH topology
4WLAA 3IS2A 4CLCC 1LSXA 2WKRA 3UE3A 2W3FA 1UWPX 4IUKA 1IOUA 3EGXC 3HCYA 4JGPA 2CMNA 1W63M 5HPFA 5HWVA 2R78A 3ICYA 3PR6A 4HOIA 3LYXA 2FZ0A 3P7NA 1GSWA 4WUJA 2J3TC 5G4ZA 3PBNA 3TE8A 3BWLA 3ZYTA 2K2NA 2M7VA 2HJEA 3BQAA 4OOLA 1N9OA 2VZWA 3ULFA 2EWWA 2GX5A 2JKTI 3MR0A 4OOMA 4PKYA 1OTEA 2LB9A 3PBQA 4I5SA 5HD3A 3K3DA 2PD8A 4HH2A 4KUOA 2JN7A 2W1RA 5HWTA 3R7WA 3RFBA 4UQIS 1V9YA 2V1BA 2W1TA 1S1YA 3MXQA 4FOFA 4GHIB 4HP4A 2HF6A 1OTDA 2YKFA 3LICA 4JGQA 4JGRA 3SW1A 5I5LA 1OJ5A 4ME4A 3KSIA 1MC0A 3E98A 5HDCA 5EFWA 1N9NA 2OWHA 2EA9A 3LFVA 1P9RA 2PYPA 1DP6A 1OTIA 2XA7M 4HHDA 3R7WB 3UB7A 4Q0HA 5F6AA 3CWFA 2Y8HA 4UQIM 1LSVA 3EOIA 1ZTUA 4EEUA 2O9CA 3LR5A 1H8MA 3PBRA 3H7WA 3UB9A 1OPXA 3T4JA 2W27A 4P6ZM 2GJ3A 5AVFA 2QKPA 2BASA 3NOUC 4HJ3A 4BBUA 4NKPA 4RQ9A 3CUEC 4QPRA 4DMZA 4I39A 1Y28A 2MJ6A 3D72A 3LIFA 3H7WB 2J3WA 4DJ2A 2PYRA 2D02A 1S67L 4UEYA 3T4QA 3H82A 5F69A 5A8BA 4G3KA 4CLCD 5DFXA 3VE4A 1TS6A 1XJ4A 4ZRRA 3TJZC 5HD5A 3UB6A 1P0ZA 4GS9A 2XROA 1XFQA 4GW9A 2W3EA 4WN5A 3OOVA 4Z1WA 3NOTC 2H28A 1UGUA 3PYPA 3LIAA 3T50A 4PAUA 4B9OA 2PT7A 1N9LA 2J3TD 1LT0A 3LIBA 3H82B 3PBSA 3EEHA 3T4KA 2EWVA 5TJJA 4EUVA 3GDIA 4EW7A 4GS9B 4MN5A 1GSVA 1T18A 3BJNA 4GLQA 1VB6A 1D06A 3BY9A 4L0LA 2A24A 2W3DA 5DFYA 3BQ8A 3LIEA 2VGLS 3KSFA 2V9AA 2W3HA 5MC7A 3F1PB 1XJ2A 4HP9A 5FL3A 1OTBA 4LLOB 3S7PA 3DBAA 2INWA 4I3IA 5DJTA 4O8GA 2FH5A 2M1CA 1EW0A 2PR6A 2HV1A 3R4KA 2Z6DA 1T1CA 1GSXA 1DP9A 5J7EA 2VJWA 4GHIA 4E04A 5IS1A 4JGOA 1STZA 2A24B 1V9ZA 3B47A 5L8MA 4AFIA 3A0SA 2PD7A 2VGLM 3HJKA 4O0PA 3KO6A 4IHQA 2K7SA 4EESA 3MF0A 2OOLA 3OLOA 2XA7S 1TS8A 4Q0IA 2KLIA 3KYQA 4LRYC 3LIDA 3HJIA 3PBOA 4FSFA 1BYWA 2KOIA 4GCZA 3C38A 4HI4A 2ZOHA 3MQ0A 2L0WA 2VV7A 2WKQA 3MFXA 1F98A 4R38A 3LI8A 3LUQA 4YWZA 2OWJA 2PR5A 4HNBA 1F5MA 3B33A 2Z6CA 3KSGA 4ARZB 4WEJA 4MCWA 4P6ZS 1XFNA 1NLZA 4Y2FA 1P97A 1LSWA 3CI6A 3G6OA 4YOFA 3EQUA 4CLCB 3UMDA 3C2WA 1IFQA 3PXPA 4XT2B 3NHQA 2L4RA 2G7UA 3IBRA 4Y5FA 4KQOA 1OT6A 4F3LA 3E4QA 2M7UA 4HY8A 4EQ1A 5HDSA 2K31A 4EETB 2PHYA 4IUHA 1W63Q 2HGVA 3D3OA 4I38A 2L1MA 4MN7A 3VOLA 4Y3IA 3E4PA 3F1OA 2GNXA 2QWSA 3MJQA 2JKRM 4YNRA 3FC7A 3K2NA 1XJ6A 4BBTA 4GJ4A 3T4OA 4F3LB 4KQDA 3RTYA 3IBJA 5HSQA 1YKDA 4WEKA 1OJGA 2VV8A 3K3CA 4MDZA 3C8CA 2D01A 3F1OB 4NXEA 5KSHA 2VEAA 4HQAA 3LR4A 2O9BA 1G28A 2VX8A 5KIZA 4H6JB 2O99A 4ETXA 1KOUA 5IU1A 1ODVA 3F1PA 3KYZA 4ETZA 3CAXA 4PHTA 2KX6A 3LI9A 3T4TA 5HZHA 2A2LA 1S4RA 3EQVA 3P01A 4HIAA 3TRCA 5AJGA 1JNUA 4L9EA 4G3WA 4DJ3A 1OTAA 1S66L 1S1ZA 4LPZA 2OAP1 2WKPA 4NXBA 5TBMA 5K5BA 3VE3A 3PBTA 5F5YA 5IT5A 4HJ4A 4MN6A 4NXFA 5DF9A 4KUKA 2JKRI 4NEED 4BBVA 4IJGA 3LR3A 1ZHHB 1WA9A 2ZMFA 1NRJA 4ARZA 3E0YA 4LRXC 5CX7A 2B02A 2XRNA 4CQHA 3MQQA 5HL6A 5C5KA 5TBMB 2V0UA 2ZBBA 2ZMVA 5G4YA 2V1AA 4CLCA 3IS2B 3U2AA 5J4EA 5HWWA 5HDDA 4XT2A 3NJAA 5LBRA 1UWNX 2VKSA 3JVVA 3O5YA 5HPIA 3A0VA 3KX0X 3A0RA 3BW6A 3C30A 1S4SA 3OBFA 3VV4A 5AVEA 3JVUA 1X0OA 3BY8A 5J3WA 3UMEA 3W2ZA 2I9VA 3NOPC 2OAQ1 2QHKA 2W0NA 3FPVA 4I3AA 4EERA 3TW8A 3F1NA 1TS7A 4DN0A 3RH8B 3EEAA 1YAXA 3FPWA 1LL8A 1DRMA 2ZOIA 4BWIA 3CITA 4I3JA 3FG8A 1TF1A 2O0YA 4R3AA 3CLOA 3T4SA 3MMHA 4BMWA 2QJ5A 2JHEA 2P08A 4BJPA 1T1AA 4G3VA 5F68A 2KDKA 1P9WA 2W1TB 4M4XA 2P04A 2VLGA 4H6JA 3F1NB 1T19A 3MQOA 2QYBA 4O01A 1OT9A 3OCLA 4WELA 1G6OA 4HJ6A 3H9WA 3S7NA 1MZUA 3S7QA 3KSHA 3S7OA 5DKKA 2P7JA 2QJ7A 2PDRA 2LB5A 3UB8A 4LRZE 4NXGA 4CLCE 3B42A 5DJUA 3EWKA 4PKYG 2IA2A 3EGDC 2J80A 3T4LA 4EEPA 1YSQA 2W3GA 4MMNA 2JKTM 4Q0JA 1NWZA 2Y79A 4R70A 2VA0A 1XJ3A 3GECA 4EU0A 1F9IA 3LR0A 1MKMA 5DKLA 2NUTC 2VV6A 1NLYA 3OC2A 3E4OA 4R6LA 2GZAA 2XSSA 2YKHA 3UE6A 2HJ9C 4HH3A 1TS0A 2V0WA 1T1BA 3CUEA 3PHYA 1VHMA 1YSPA 4WF0A 1TD5A 1DP8A 3OCNA 4II7A 3ZQ5A 2O9AA 4K08A 2NUPC 4EXOA 4B93A 4WL9A 1D7EA 4L9FA 2DMWA 2B18A 4L9GA 1H3QA 3V67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WLA A;  3IS2 A;  1LSX A;  2WKR A;  1UWP X;  4JGP A;  2CMN A;  5HWV A;  2R78 A;  3ICY A;  4HOI A;  3LYX A;  3P7N A;  1GSW A;  4WUJ A;  5G4Z A;  3BWL A;  1N9O A;  3ULF A;  3MR0 A;  4PKY A;  1OTE A;  4I5S A;  5HD3 A;  3K3D A;  2PD8 A;  4HH2 A;  4KUO A;  2JN7 A;  5HWT A;  1V9Y A;  2V1B A;  1S1Y A;  3MXQ A;  4GHI B;  4HP4 A;  1OTD A;  2YKF A;  3LIC A;  4JGQ A;  4JGR A;  3SW1 A;  5I5L A;  1OJ5 A;  5HDC A;  5EFW A;  1N9N A;  2OWH A;  2EA9 A;  2PYP A;  1DP6 A;  1OTI A;  4HHD A;  3UB7 A;  5F6A A;  3CWF A;  1LSV A;  4EEU A;  3H7W A;  3UB9 A;  2W27 A;  2GJ3 A;  5AVF A;  2QKP A;  2BAS A;  3NOU C;  4HJ3 A;  4BBU A;  4RQ9 A;  4I39 A;  1Y28 A;  3D72 A;  3LIF A;  3H7W B;  4DJ2 A;  2PYR A;  2D02 A;  1S67 L;  3H82 A;  5F69 A;  5A8B A;  3VE4 A;  1TS6 A;  1XJ4 A;  5HD5 A;  3UB6 A;  1P0Z A;  4GS9 A;  1XFQ A;  4GW9 A;  4WN5 A;  3NOT C;  2H28 A;  1UGU A;  3PYP A;  3LIA A;  3T50 A;  4B9O A;  1N9L A;  1LT0 A;  3LIB A;  3H82 B;  3EEH A;  3GDI A;  4EW7 A;  4GS9 B;  4MN5 A;  1GSV A;  1T18 A;  1VB6 A;  1D06 A;  3BY9 A;  2A24 A;  3LIE A;  2V9A A;  3F1P B;  1XJ2 A;  4HP9 A;  1OTB A;  4LLO B;  2INW A;  4I3I A;  5DJT A;  2M1C A;  1EW0 A;  2PR6 A;  2HV1 A;  2Z6D A;  1T1C A;  1GSX A;  1DP9 A;  5J7E A;  4GHI A;  4E04 A;  5IS1 A;  4JGO A;  2A24 B;  1V9Z A;  3A0S A;  2PD7 A;  3HJK A;  2K7S A;  4EES A;  2OOL A;  3OLO A;  1TS8 A;  4LRY C;  3LID A;  3HJI A;  1BYW A;  4GCZ A;  4HI4 A;  2ZOH A;  2L0W A;  2VV7 A;  2WKQ A;  3MFX A;  1F98 A;  4R38 A;  3LI8 A;  3LUQ A;  4YWZ A;  2OWJ A;  2PR5 A;  4HNB A;  3B33 A;  2Z6C A;  1XFN A;  1P97 A;  1LSW A;  3G6O A;  3UMD A;  3C2W A;  4XT2 B;  3NHQ A;  2L4R A;  3IBR A;  1OT6 A;  4F3L A;  3E4Q A;  4HY8 A;  4EQ1 A;  5HDS A;  4EET B;  2PHY A;  4I38 A;  2L1M A;  3VOL A;  3E4P A;  3F1O A;  2QWS A;  3MJQ A;  3FC7 A;  1XJ6 A;  4BBT A;  4F3L B;  4KQD A;  3RTY A;  5HSQ A;  1OJG A;  2VV8 A;  3K3C A;  3C8C A;  2D01 A;  3F1O B;  4NXE A;  2VEA A;  4HQA A;  1G28 A;  5KIZ A;  4H6J B;  1KOU A;  5IU1 A;  1ODV A;  3F1P A;  3CAX A;  2KX6 A;  3LI9 A;  5HZH A;  1S4R A;  4HIA A;  1JNU A;  4L9E A;  4DJ3 A;  1OTA A;  1S66 L;  1S1Z A;  4LPZ A;  2WKP A;  4NXB A;  5TBM A;  3VE3 A;  5F5Y A;  4HJ4 A;  4MN6 A;  4NXF A;  4KUK A;  4BBV A;  1WA9 A;  4LRX C;  2B02 A;  3MQQ A;  5TBM B;  2V0U A;  2ZBB A;  5G4Y A;  2V1A A;  3IS2 B;  5J4E A;  5HWW A;  5HDD A;  4XT2 A;  3NJA A;  1UWN X;  3A0V A;  3KX0 X;  3A0R A;  1S4S A;  5AVE A;  1X0O A;  3BY8 A;  5J3W A;  3UME A;  2I9V A;  3NOP C;  2QHK A;  2W0N A;  4EER A;  4I3A A;  3F1N A;  1TS7 A;  3RH8 B;  1LL8 A;  1DRM A;  2ZOI A;  4I3J A;  3FG8 A;  4R3A A;  3CLO A;  2QJ5 A;  2JHE A;  1T1A A;  5F68 A;  2KDK A;  4M4X A;  2VLG A;  4H6J A;  3F1N B;  1T19 A;  3MQO A;  1OT9 A;  4HJ6 A;  3H9W A;  1MZU A;  5DKK A;  2P7J A;  2QJ7 A;  2PDR A;  3UB8 A;  4LRZ E;  4NXG A;  5DJU A;  3EWK A;  4PKY G;  2J80 A;  4EEP A;  1NWZ A;  4R70 A;  1XJ3 A;  3GEC A;  1F9I A;  5DKL A;  2VV6 A;  3E4O A;  4R6L A;  2YKH A;  3UE6 A;  4HH3 A;  1TS0 A;  2V0W A;  1T1B A;  3PHY A;  4WF0 A;  1DP8 A;  3ZQ5 A;  4K08 A;  4EXO A;  4WL9 A;  1D7E A;  4L9F A;  4L9G A; 
#chains in the Genus database with same CATH topology
 4CPK A;  4EBN A;  1UWP X;  5G18 A;  1IOU A;  4X1M A;  3ICY A;  3PR6 A;  3LYX A;  1GSW A;  3FWL A;  4GZB A;  2Y2J A;  5G4Z A;  3TE8 A;  1K55 C;  2WK0 A;  2QZ6 A;  1ZG6 A;  2EWW A;  1RGZ A;  3C7U A;  1PRQ A;  1N9B A;  3SH8 A;  2GX5 A;  2JKT I;  5FEG A;  3LY3 A;  1OTE A;  1PNE A;  5HWT A;  1BUE A;  5FQQ A;  4B88 A;  1ERM A;  3W4Q A;  3NBL A;  4GHI B;  2HF6 A;  3LIC A;  5CEC A;  1M40 A;  3SW1 A;  1CF0 A;  1OJ5 A;  3ZG7 B;  4U0T A;  4WM9 A;  3L7H A;  1P9R A;  3G30 A;  1HZO A;  3Q81 A;  4Q0H A;  3CWF A;  3U4L P;  4DDY A;  3EOI A;  1ZTU A;  3ZGA B;  3LR5 A;  4H8R A;  1FCM A;  1BT5 A;  3IWO A;  3H7W A;  1OPX A;  4UAA A;  2UV0 E;  2AVX A;  1W79 A;  1PI4 A;  2GJ3 A;  2QKP A;  2IWB A;  4GD6 A;  1BLS A;  1NYM A;  2BAS A;  4S2K A;  2C5W B;  4HJ3 A;  5CED A;  3SH9 A;  4LGW A;  4QPR A;  4I39 A;  3LIF A;  1CK3 A;  2PYR A;  4KZ6 A;  1S67 L;  3H82 A;  3LCE A;  1XJ4 A;  4ZRR A;  2J8Y A;  3A3E A;  4GS9 A;  4WN5 A;  1YQS A;  3IWQ A;  3PYP A;  3LIA A;  3T50 A;  2ZQ8 A;  3UY6 A;  4B9O A;  2PT7 A;  5HL1 A;  4BL3 A;  1LT0 A;  3UDF A;  3PBS A;  3EEH A;  3P98 A;  1YLZ A;  3CG5 A;  3T4K A;  5TJJ A;  3GTC A;  3NI9 A;  4P87 A;  5EM0 A;  4GLQ A;  1VB6 A;  3I7J A;  2A24 A;  2WGV A;  2VGL S;  2V9A A;  3F1P B;  1XJ2 A;  5CRF A;  4HP9 A;  4ZJ3 A;  4I3I A;  3WS0 A;  4O8G A;  2M1C A;  2WGI A;  2Z6D A;  1L0G A;  3ITA A;  4E3L A;  2P9V A;  5EEC A;  4DE3 A;  1H8Z A;  5J7E A;  4E04 A;  2XF3 A;  4JPM A;  3B47 A;  1L2S A;  5GHY A;  2PD7 A;  3KO6 A;  2DCF A;  4R3J A;  4EES A;  1YT4 A;  3OLO A;  3ZDJ A;  4Q0I A;  4E3O A;  4DF6 A;  5L10 A;  2KLI A;  2ZL1 A;  4FSF A;  1Z09 A;  2WZZ A;  4HI4 A;  4DXB A;  3NCK A;  3MQ0 A;  4N92 A;  3MFX A;  1F98 A;  4OKP A;  4R4R A;  3LUQ A;  4YWZ A;  2OWJ A;  2PR5 A;  4OH0 A;  1PIO A;  5FA7 A;  1NLZ A;  4R0Q A;  4Y2F A;  1XPB A;  1P97 A;  1LSW A;  3FV7 A;  3HLC A;  4CLC B;  3WS5 A;  1GA0 A;  1J3W A;  2V2F F;  1JTG A;  4MBF A;  1Y54 A;  4Y5F A;  3E4Q A;  4P85 A;  4HY8 A;  2K31 A;  4E6X A;  2PHY A;  5DF7 A;  5JYO A;  2HGV A;  3NEC A;  2XD5 A;  4GB7 A;  4WMC D;  1GA9 A;  3IH9 A;  5HAQ A;  4LCL A;  4QU3 A;  2JKF A;  1KE4 A;  1XJ6 A;  1HTZ A;  4GJ4 A;  3T4O A;  5HSQ A;  2V1Z A;  3VP4 A;  4B4Z A;  3K3C A;  5CGX A;  1IKG A;  4NXE A;  4RX3 A;  4K0W A;  4ZTK A;  3LR4 A;  3WS4 A;  5KIZ A;  3UB5 P;  3T1X A;  5A91 A;  4ETX A;  4WZ4 A;  4UA9 A;  4ZJ1 A;  4PHT A;  4NK3 A;  3SS4 A;  3C5A A;  2HP5 A;  2A2L A;  4GKU A;  1MXO A;  1QMF A;  3P01 A;  3MZE A;  4YIN A;  3PAE A;  1JNU A;  1GHM A;  3ZVW A;  3MZF A;  1K56 A;  5GL9 A;  2EFX A;  3A3D A;  3G32 A;  5F82 A;  4N1H A;  4X1L A;  2Q0O A;  3PBT A;  4NXF A;  3N4I A;  3IXH A;  3DW0 A;  2VGJ A;  3IF5 A;  2PAV P;  1K54 C;  3W4P A;  3VOZ A;  1PZO A;  4ARZ A;  3E0Y A;  4WBG A;  4QY5 A;  4LRX C;  4CQH A;  1WYB A;  3MQQ A;  5C5K A;  2V0U A;  4FH2 A;  3U2A A;  5FI6 A;  5FAT A;  5HWW A;  3V50 A;  1LLB A;  3HUN A;  5HPI A;  1IYP A;  5BOH A;  1YMX A;  4X53 A;  3W2Z A;  2OAQ 1;  4WYY A;  3FPV A;  3MFD A;  3P09 A;  3RH8 B;  4P6B A;  3IX4 A;  1LL8 A;  4I3J A;  1ONH A;  1TF1 A;  2O0Y A;  4KZ8 A;  3T4S A;  3M2J A;  3MMH A;  4BMW A;  1KGE A;  3GV9 A;  2ZQC A;  1T1A A;  5EPH A;  2W1T B;  4DE1 A;  3DWZ A;  3UE1 A;  4BQM A;  2XD1 A;  2B95 A;  4H6J A;  2ZC3 B;  5GLC A;  3S7N A;  3S7Q A;  3NC8 A;  3KSH A;  4S2O A;  5DKK A;  2ZQA A;  4UA7 A;  2P7J A;  4FCF A;  4CLC E;  3GR2 A;  4PKY G;  5KMW A;  4OQI A;  3VFF A;  4EEP A;  2XR0 A;  2Y91 A;  4EU0 A;  1W8Q A;  3T1R A;  5DKL A;  4R6L A;  3GRJ A;  2GZA A;  3GMW A;  5AQ9 A;  3RJU A;  1YSP A;  1PYY A;  3OCN A;  3CZD A;  2NUP C;  2JE5 A;  4PMA A;  2JC7 A;  4L9F A;  1IKI A;  5F1G A;  3UDI A;  3NUL A;  3IS2 A;  4WLA A;  4CLC C;  3M6H A;  4S2P A;  4Y0T A;  2W3F A;  3N8S A;  1I5Q A;  3EGX C;  3HCY A;  4GDN A;  1G68 A;  4JGP A;  1KE0 A;  5HPF A;  5HWV A;  4WZ5 A;  1D1J A;  2BG1 A;  2J3T C;  1FCN A;  3PBN A;  4FH4 A;  5FQI A;  4K91 A;  2EXB A;  1NXY A;  3TG9 A;  4GDB A;  1MBL A;  4IED A;  3A3F A;  2LB9 A;  3NY4 A;  5HD3 A;  4HH2 A;  1WYC A;  3MKF A;  5EE8 A;  2ZJ9 A;  1KGF A;  5EVL A;  3BEC A;  1S1Y A;  4FOF A;  4QB8 A;  4U0X A;  1K54 A;  5I5L A;  4ME4 A;  1PWD A;  2ZD8 A;  1MC0 A;  5L2F A;  2OWH A;  2PYP A;  4R1G A;  1ACF A;  4OP8 A;  4HHD A;  3UB7 A;  2PU4 A;  4UQI M;  1E25 A;  1YLJ A;  3Q7V A;  1G6A A;  4EQI A;  1ES3 A;  4KZ3 A;  1DY6 A;  5J8X A;  2XGN A;  3PBR A;  5CHU A;  4MEZ A;  3UB9 A;  3T4J A;  1LI9 A;  1W7F A;  4XXR A;  1L0D A;  3N6I A;  2XFT A;  5KZH A;  4NKP A;  5TGF A;  4RQ9 A;  2VGK A;  5CEB A;  3CUE C;  1JWV A;  4DMZ A;  4Z9Q A;  2J3W A;  5CHM A;  4DJ2 A;  4Y13 A;  1JVJ A;  4X69 A;  2A49 A;  3B3X A;  4CLC D;  3TJZ C;  5HD5 A;  3HLB A;  2XRO A;  4N1X A;  1G5U A;  3N8R A;  3MKE A;  4OON A;  1UGU A;  2P74 A;  1KVM A;  2J3T D;  5DTS A;  3CHW P;  2H10 A;  1VET B;  3LIB A;  3BYD A;  2X01 A;  3GDI A;  1KE3 A;  3ITB A;  1NZU A;  4MN5 A;  1GSV A;  1T18 A;  2PRF A;  3G31 A;  4L0L A;  4OPY A;  1PZP A;  3AGD A;  3BQ8 A;  1L0F A;  5M1A A;  1ZKJ A;  4Y15 A;  4KZB A;  4FD8 A;  3QP2 A;  1OTB A;  4LLO B;  2INW A;  2XEP A;  5DJT A;  2FH5 A;  2PR6 A;  1BUL A;  3R4K A;  1BLC A;  1T1C A;  1GSX A;  4X25 A;  5IS1 A;  2PU2 A;  1E3U D;  5L8M A;  3AGE A;  1W8Y A;  3A0S A;  3HJK A;  5EM1 A;  2OV5 A;  1ERO A;  2K7S A;  3QP6 A;  3UN7 A;  2OOL A;  4M3K A;  1TS8 A;  1K57 C;  3KYQ A;  4LEN A;  4QY6 A;  4S2M A;  2Y2O A;  3QP5 A;  3LID A;  3PBO A;  1BYW A;  1ESI A;  4S2N A;  1YLT A;  2WKQ A;  3JYI A;  2EX2 A;  1H5X A;  4HNB A;  2XFS A;  3B33 A;  1PFL A;  1LL9 A;  1XFN A;  3NDE A;  1Z6F A;  3IXB A;  1OME A;  3DAV A;  2OSU A;  5DTT A;  3TSG A;  3C2W A;  2VK3 A;  3HRE A;  4XT2 B;  2L4R A;  1LL5 A;  1OT6 A;  3VP2 A;  1SKO B;  2Y2L A;  4E6W A;  1XX2 A;  4EQ1 A;  5HDS A;  3HLF A;  1SKF A;  4IUH A;  4MN7 A;  4Y3I A;  4X68 A;  4QHC A;  4OQG A;  3LO7 A;  2QWS A;  1PWG A;  4B4X A;  3MJQ A;  4C75 A;  2HDQ A;  3G2Y A;  4YNR A;  5FQJ A;  2ZQ7 A;  1MWS A;  4BBT A;  1E3U A;  4F3L B;  3VP3 A;  5CHJ A;  1ES4 A;  5HFO A;  1OJG A;  1IEM A;  4MDZ A;  1WE4 A;  3O3V A;  3C8C A;  3F1O B;  3UE0 A;  4HQA A;  5L07 A;  3ZCZ A;  1G28 A;  2O99 A;  5EVI C;  1KOU A;  3HLG A;  1ODV A;  4N9L A;  4ETZ A;  3OPR A;  1S4R A;  3UPN A;  3IF6 C;  3UNW A;  1PW8 A;  3S4X A;  4L9E A;  3RXW A;  1S66 L;  4LPZ A;  5AQ7 A;  3QP4 A;  5F83 A;  5A93 A;  5F5Y A;  5IT5 A;  4HJ4 A;  4EBL A;  4MBK A;  5DVA A;  2B5R A;  4C3Q A;  2JKR I;  4NEE D;  3SOI A;  1BLP A;  3IHA A;  3PAG A;  2HDS A;  5CX7 A;  3SS5 A;  5CGW A;  2ZBB A;  1ESU A;  2G2U A;  4EV4 A;  2V1A A;  5HDD A;  3NJA A;  1K38 A;  1XGI A;  1FR6 A;  5LBR A;  3HUM A;  3O5Y A;  3KX0 X;  4GD8 A;  3VV4 A;  4ZBE A;  4PM6 A;  1K55 A;  1SHV A;  1K0K A;  3BY8 A;  5J3W A;  2EXA A;  4DE2 A;  3FKW A;  4EER A;  4IVI A;  3TW8 A;  1K25 A;  3V3S A;  3UDX A;  4BWI A;  2WGW A;  2ZC5 B;  5CER A;  3FG8 A;  1CI8 A;  4D2O A;  3S1Y A;  3D4F A;  4BJP A;  3FKV A;  4UHU A;  1K6R A;  2VLG A;  3MXS A;  3OCL A;  5HAI A;  4JF5 A;  1K4E A;  1MZU A;  4X56 A;  5GHZ A;  3M6B A;  4FUW A;  2QJ7 A;  2V8C A;  2LB5 A;  5DF8 A;  2WYX A;  3UB8 A;  4E3J A;  3C4P A;  3B42 A;  5DJU A;  3EWK A;  1ES2 A;  1DJA A;  2IA2 A;  2J80 A;  2QPN A;  3WS1 A;  3IXG A;  4MMN A;  2JKT M;  4Q0J A;  3N8L A;  1CQA A;  1TDL A;  5CTM A;  2VA0 A;  2ZM8 A;  4KZ7 A;  3GEC A;  3V3R A;  4E3M A;  3O86 A;  1LHY A;  2X71 A;  2VV6 A;  1NLY A;  3OC2 A;  4UA6 A;  5FI2 A;  3UE6 A;  4KG6 A;  4Y0U A;  4LV2 A;  3ZQ5 A;  3UPP A;  2O9A A;  3BRM A;  3G34 A;  4B93 A;  4WL9 A;  4WMC A;  3NDG A;  2HDR A;  3QP1 A;  3BM6 A;  4ZJ2 A;  1LSX A;  4OPR A;  2OLU A;  4KG5 A;  3IT9 A;  1W63 M;  2Q9N A;  4OLD A;  4F94 A;  1F2K A;  2R78 A;  2Y55 A;  2ZQ9 A;  5GLB A;  4S2L A;  4WUJ A;  4KQQ A;  1JTD A;  2K2N A;  2HJE A;  5A92 A;  1H0M A;  1BTL A;  3V39 A;  4HBT A;  3BEB A;  3ULF A;  3VP1 A;  1I2S A;  4RX2 A;  3MR0 A;  4PKY A;  4E3I A;  3PBQ A;  4I5S A;  2PD8 A;  2XQZ A;  5FAS A;  2JN7 A;  2W1R A;  5TFQ A;  1V9Y A;  2V1B A;  2XDM A;  1S0W A;  4LV0 A;  2P9V B;  1NZO A;  3MXQ A;  4X55 A;  5E43 A;  4HP4 A;  2Z2L B;  2YKF A;  3DTK A;  4JGQ A;  2HZ5 A;  1FOF A;  3KSI A;  3E98 A;  3IX8 A;  5HDC A;  2EA9 A;  1MY8 A;  3LFV A;  3TOI A;  4R23 A;  1DP6 A;  1CEF A;  1OTI A;  3R7W B;  5EV0 A;  3A3I A;  2WAF A;  4EEU A;  2WAE A;  3ZG0 A;  3BLS A;  1H8M A;  5FQK A;  1RGY A;  4K0X A;  4IBX A;  1AWI A;  1YLW A;  1KVL A;  2W27 A;  1N4O A;  5AVF A;  2Q9M A;  3CPT A;  2ZM0 A;  4N9K A;  1SZV A;  3NOU C;  4BBU A;  4JKT A;  2FFF B;  2ZC6 B;  2MJ6 A;  3D72 A;  5AQB A;  2ACG A;  5F1F A;  1U60 A;  3T4Q A;  1VET A;  5F69 A;  2ZC4 B;  5A8B A;  5DFX A;  3VE4 A;  3UB6 A;  1P0Z A;  3UO9 A;  1SCW A;  1XFQ A;  4GW9 A;  2W3E A;  4R3B A;  3OOV A;  5EUA A;  4MNR A;  1L0E A;  1XP4 A;  4PAU A;  1O07 A;  4EUV A;  3T12 B;  4EW7 A;  3BJN A;  1D06 A;  2RL3 A;  3BY9 A;  1GCE A;  3LIE A;  3KSF A;  1ALQ A;  1XA7 A;  5CGS A;  3ZG8 B;  5FL3 A;  1FSY A;  3DBA A;  1MWR A;  4CJN A;  3ZFZ A;  1DP9 A;  4ZAM A;  2VJW A;  4GHI A;  1Y4O A;  1STZ A;  3ISG A;  4DE0 A;  5EVI B;  4O0P A;  2VGL M;  2Y2P A;  5A90 A;  2WKI A;  4IHQ A;  1FSW A;  4HBU A;  4EBP A;  2XA7 S;  3T1Q B;  1ONG A;  4LRY C;  2JKG A;  3HJI A;  2KOI A;  4GCZ A;  3IF6 B;  2ZOH A;  2VV7 A;  4R38 A;  3LI8 A;  4YFM A;  3SH7 A;  2WUQ A;  1F5M A;  5KSC A;  1K4F A;  1XKZ A;  3VFH A;  3OPL A;  4ARZ B;  4WEJ A;  4P6Z S;  4KZ9 A;  4S2J A;  2GDN A;  1EI5 A;  3EQU A;  1VEU B;  4GNU A;  1IFQ A;  2JCH A;  3NHQ A;  2G7U A;  3IBR A;  4KQO A;  3S22 A;  5FDS A;  3SZT A;  2M7U A;  4F3L A;  1PW1 A;  4EET B;  3MZD A;  3QP8 A;  1S6R A;  2E8J A;  2HP6 A;  1W63 Q;  3D3O A;  2XH9 A;  2L1M A;  4OP5 A;  2ZQD A;  3F1O A;  5M19 A;  2GNX A;  4Y17 A;  5HW3 A;  3KYE A;  3FC7 A;  4KQD A;  4EUZ A;  3RTY A;  2ZLY A;  1PWC A;  1KGG A;  1XXM A;  2VV8 A;  4OPQ A;  1HVB A;  5KSH A;  3WRZ A;  2VEA A;  2VX8 A;  3WWX A;  4H6J B;  3LGO A;  4O7D A;  3F1P A;  3KYZ A;  3CAX A;  3LI9 A;  3ZG5 A;  4JF4 A;  1ZC2 A;  5GLD A;  1CEG A;  4ESP A;  3TRC A;  5AJG A;  1Q2P A;  1OTA A;  3O87 A;  1S1Z A;  5E2E A;  1A0K A;  2OAP 1;  4NXB A;  3MXR A;  4OPZ A;  3M2K A;  2EX6 A;  3VE3 A;  3WRT A;  1K6S A;  5E2H A;  5IHV A;  4PPR A;  2WZX A;  4DKI A;  5E2F A;  3LR3 A;  1ZHH B;  2CC1 A;  1WA9 A;  4DXC A;  1NRJ A;  4JF6 A;  1JWZ A;  2B02 A;  2XRN A;  5HL6 A;  5TBM B;  1E4D A;  2ZMV A;  4CLC A;  3IS2 B;  1IYO A;  3W4O A;  1YLP A;  2QMI A;  3G2Z A;  5CTN A;  5FEF A;  3ZHH A;  3JVV A;  4RVA A;  3ZNY A;  1J9M A;  3BW6 A;  3E2L A;  4PM5 A;  1S4S A;  2HPB A;  3G35 A;  4LCM A;  3JVU A;  2WAD A;  3GSG A;  2I9V A;  4P0M A;  3NOP C;  2QHK A;  2E8I A;  5EVE A;  4Q8I A;  4JBF A;  3MS6 A;  4IBR A;  1TS7 A;  4DN0 A;  3EEA A;  1I2W A;  1YAX A;  3FPW A;  2Y2H A;  4S2I A;  3CIT A;  2QJ5 A;  2JHE A;  2X02 A;  2I72 A;  1FQG A;  5F68 A;  2BTF P;  1L3L A;  1P9W A;  4M4X A;  4RA7 A;  1SDN A;  1XA1 A;  1NRF A;  3F1N B;  1T19 A;  3MQO A;  4IVK A;  3CMZ A;  2QYB A;  4O01 A;  1OT9 A;  2EX9 A;  4WEL A;  1G6O A;  3H9W A;  3IH8 A;  2H5S A;  3HLD A;  3S7O A;  3BLM A;  4Y0O A;  3BFF A;  1KDW A;  4HEF A;  2PDR A;  3W8K A;  4LRZ E;  1MWT A;  3LEZ A;  4NXG A;  3O88 A;  1CI9 A;  2R9W A;  4R4S A;  3Q7V B;  3EGD C;  3T4L A;  1YSQ A;  1QME A;  4PM7 A;  3IQA A;  1NWZ A;  3V5M A;  1ZG4 A;  4EWF A;  2DNS A;  3HL9 A;  4MLL A;  1FIK A;  4JXG A;  1F9I A;  3LR0 A;  3T1S A;  5HAP A;  3VP0 A;  3NIA A;  3BFE A;  2HJ9 C;  1TS0 A;  2Y4A A;  3JPU A;  1T1B A;  3CUE A;  3PHY A;  2WKE A;  1TD5 A;  4II7 A;  1TVF A;  1NY0 A;  2J9P A;  1D7E A;  2DMW A;  2XK1 A;  3UE3 A;  2WKR A;  4LFU A;  1NJ4 A;  1TEM A;  2H0Y A;  4IUK A;  1BZA A;  2CMN A;  3OPP A;  4NET A;  2Y2I A;  3OPH A;  4HOI A;  2FZ0 A;  3P7N A;  1MPL A;  3BWL A;  2Y2Q A;  4KZA A;  3ZYT A;  1O7E A;  2M7V A;  3BQA A;  4JXS A;  4OOL A;  1N9O A;  2FFY A;  5CXW A;  3D9Y A;  2VZW A;  3IWI A;  4JLF A;  1Q2Q A;  2EX8 A;  4OOM A;  4LV3 A;  2BLS A;  3G4P A;  3K3D A;  4JXV A;  4KUO A;  1FIL A;  3R7W A;  3RFB A;  4UQI S;  4LV1 A;  5FSR A;  2W1T A;  4PM8 A;  3LEQ A;  1OTD A;  3AGF A;  1VM1 A;  4JGR A;  1H8Y A;  4E3K A;  5EFW A;  1N9N A;  1K57 A;  2XA7 M;  5F6A A;  2Y8H A;  1LSV A;  3HLW A;  5FI7 A;  2O9C A;  1LI0 A;  2A3U A;  5EVI D;  2V20 A;  4KEN B;  1K56 D;  2EFU A;  3VOY A;  5L09 A;  2H0T A;  4P6Z M;  1ES5 A;  2G2W A;  4BEN A;  5EOE A;  3HUO A;  2C6W B;  1Y28 A;  3H7W B;  4OQH A;  2D02 A;  4UEY A;  1IYQ A;  2DRW A;  4C6Y A;  5GLA A;  3IHB A;  4G3K A;  1TS6 A;  4DRT A;  4Z1W A;  3NOT C;  2H28 A;  1SDE A;  4OVD A;  4WZ5 C;  2XLN A;  1HLU P;  1N9L A;  5HX9 A;  4U3T A;  3H82 B;  2HDU A;  2EWV A;  5FQM A;  4KQR A;  4GS9 B;  1GHP A;  3GQZ A;  5DFY A;  2W3D A;  3ZNT A;  3RXX A;  5EVI A;  5DTK A;  5FQ9 A;  2W3H A;  5MC7 A;  4OLG A;  3LY4 A;  3S7P A;  3FZC A;  5JYP A;  1EW0 A;  2HV1 A;  4DDS A;  2UWX A;  4HES A;  3IF6 A;  1NYY A;  3Q82 A;  2ZM2 A;  1FCO A;  5EOO A;  4JGO A;  1AXB A;  2A24 B;  1V9Z A;  4AFI A;  3Q1F A;  4MBH A;  4QJG A;  3MF0 A;  2Y2K A;  3Q07 A;  3WS2 A;  1YLY A;  3IX3 A;  4BLM A;  2PBY A;  3PTE A;  1VEU A;  3C38 A;  4NG2 A;  2L0W A;  1DJB A;  4BD1 A;  3HVF A;  2Z6C A;  3A3J A;  3KSG A;  4A5R A;  4MCW A;  4BD0 A;  4QWO A;  3CI6 A;  3G6O A;  2ZL1 B;  4YOF A;  3C4O A;  3VMA A;  3UMD A;  3PXP A;  2PBD P;  1XGJ A;  4XUZ A;  2ZMA A;  4I38 A;  3VSK A;  3VOL A;  3E4P A;  2Y2M A;  4QD4 A;  2JKR M;  2R9X A;  3K2N A;  4OQ0 A;  3IBJ A;  1HD8 A;  3QNB A;  5AQA A;  1YKD A;  3SS3 A;  4WEK A;  2WGW B;  1W5D A;  3Q7Z A;  3VSL A;  2D01 A;  4GOG A;  4D60 A;  1BSG A;  5E2G A;  2O9B A;  1DJC A;  5IU1 A;  3MBZ A;  5M18 A;  3UPO A;  3DTM A;  2V8F A;  3N7W A;  5HAR A;  4XUX A;  2KX6 A;  3T4T A;  5HZH A;  3EQV A;  3GVB A;  4Y7P A;  3L9K A;  4KZ4 A;  4HIA A;  4G3W A;  4DJ3 A;  5FAP A;  5TR7 A;  3ZG9 B;  4PM9 A;  3ZVT A;  2JBF A;  2WKP A;  5FDH A;  5TBM A;  5K5B A;  2ZC7 A;  2OLV A;  4MN6 A;  4RYE A;  5DF9 A;  1BLH A;  3BFG A;  3BFD A;  4KUK A;  4S2N C;  4BBV A;  4IJG A;  3DTE A;  2ZMF A;  2HP9 A;  2IWC A;  1MKI A;  3HLE A;  1M6K A;  3HBR A;  5G4Y A;  4X6T A;  3OZH A;  5J4E A;  2Z2M B;  2Y59 A;  4XT2 A;  1FR1 A;  1SKO A;  1VQQ A;  5FAQ A;  1UWN X;  2VKS A;  3QNC A;  3A0V A;  4OOY A;  2RCX A;  3A0R A;  4ID4 A;  3C30 A;  3OBF A;  1ERQ A;  5AVE A;  1CJF A;  5U47 A;  1X0O A;  3UME A;  1GHI A;  3CJM A;  2W0N A;  3E2K A;  1EWZ A;  1YMS A;  4I3A A;  3F1N A;  4ZDX A;  1DRM A;  1RP5 A;  2ZOI A;  4FTX A;  1C3B A;  2WKH A;  4JXW A;  1JWP A;  3C7V A;  2Y2N A;  1IYS A;  3CLO A;  4R3A A;  2P08 A;  4G3V A;  2KDK A;  3MSH A;  2P04 A;  1YPR A;  2Y2G A;  4E3N A;  3FYZ A;  1RCJ A;  5GHX A;  4HJ6 A;  3DTI A;  4KG2 A;  2J7V A;  4BL2 A;  3IXD A;  5I94 A;  1PI5 A;  5FAO A;  1TDG A;  3BFC A;  1KDS A;  2W3G A;  1MWU A;  1IEL A;  2Y79 A;  4R70 A;  1XJ3 A;  1MKM A;  3CPT B;  2NUT C;  4GN2 A;  3E4O A;  5D3O A;  2XSS A;  2YKH A;  4HH3 A;  1YM1 A;  2V0W A;  4KZ5 A;  2IWD A;  3DWK A;  1VHM A;  4WF0 A;  1DP8 A;  2J9O A;  4K08 A;  4EXO A;  3QHY A;  2B18 A;  4L9G A;  1H3Q A;  3V67 A; 
#chains in the Genus database with same CATH homology
 4WLA A;  3IS2 A;  4CLC C;  1LSX A;  2WKR A;  3UE3 A;  2W3F A;  1UWP X;  4IUK A;  1IOU A;  3EGX C;  3HCY A;  4JGP A;  2CMN A;  1W63 M;  5HPF A;  5HWV A;  2R78 A;  3ICY A;  3PR6 A;  4HOI A;  3LYX A;  2FZ0 A;  3P7N A;  1GSW A;  4WUJ A;  2J3T C;  5G4Z A;  3PBN A;  3TE8 A;  3BWL A;  3ZYT A;  2K2N A;  2M7V A;  2HJE A;  3BQA A;  4OOL A;  1N9O A;  2VZW A;  3ULF A;  2EWW A;  2GX5 A;  2JKT I;  3MR0 A;  4OOM A;  4PKY A;  1OTE A;  2LB9 A;  3PBQ A;  4I5S A;  5HD3 A;  3K3D A;  2PD8 A;  4HH2 A;  4KUO A;  2JN7 A;  2W1R A;  5HWT A;  3R7W A;  3RFB A;  4UQI S;  1V9Y A;  2V1B A;  2W1T A;  1S1Y A;  3MXQ A;  4FOF A;  4GHI B;  4HP4 A;  2HF6 A;  1OTD A;  2YKF A;  3LIC A;  4JGQ A;  4JGR A;  3SW1 A;  5I5L A;  1OJ5 A;  4ME4 A;  3KSI A;  1MC0 A;  3E98 A;  5HDC A;  5EFW A;  1N9N A;  2OWH A;  2EA9 A;  3LFV A;  1P9R A;  2PYP A;  1DP6 A;  1OTI A;  2XA7 M;  4HHD A;  3R7W B;  3UB7 A;  4Q0H A;  5F6A A;  3CWF A;  2Y8H A;  4UQI M;  1LSV A;  3EOI A;  1ZTU A;  4EEU A;  2O9C A;  3LR5 A;  1H8M A;  3PBR A;  3H7W A;  3UB9 A;  1OPX A;  3T4J A;  2W27 A;  4P6Z M;  2GJ3 A;  5AVF A;  2QKP A;  2BAS A;  3NOU C;  4HJ3 A;  4BBU A;  4NKP A;  4RQ9 A;  3CUE C;  4QPR A;  4DMZ A;  4I39 A;  1Y28 A;  2MJ6 A;  3D72 A;  3LIF A;  3H7W B;  2J3W A;  4DJ2 A;  2PYR A;  2D02 A;  1S67 L;  4UEY A;  3T4Q A;  3H82 A;  5F69 A;  5A8B A;  4G3K A;  4CLC D;  5DFX A;  3VE4 A;  1TS6 A;  1XJ4 A;  4ZRR A;  3TJZ C;  5HD5 A;  3UB6 A;  1P0Z A;  4GS9 A;  2XRO A;  1XFQ A;  4GW9 A;  2W3E A;  4WN5 A;  3OOV A;  4Z1W A;  3NOT C;  2H28 A;  1UGU A;  3PYP A;  3LIA A;  3T50 A;  4PAU A;  4B9O A;  2PT7 A;  1N9L A;  2J3T D;  1LT0 A;  3LIB A;  3H82 B;  3PBS A;  3EEH A;  3T4K A;  2EWV A;  5TJJ A;  4EUV A;  3GDI A;  4EW7 A;  4GS9 B;  4MN5 A;  1GSV A;  1T18 A;  3BJN A;  4GLQ A;  1VB6 A;  1D06 A;  3BY9 A;  4L0L A;  2A24 A;  2W3D A;  5DFY A;  3BQ8 A;  3LIE A;  2VGL S;  3KSF A;  2V9A A;  2W3H A;  5MC7 A;  3F1P B;  1XJ2 A;  4HP9 A;  5FL3 A;  1OTB A;  4LLO B;  3S7P A;  3DBA A;  2INW A;  4I3I A;  5DJT A;  4O8G A;  2FH5 A;  2M1C A;  1EW0 A;  2PR6 A;  2HV1 A;  3R4K A;  2Z6D A;  1T1C A;  1GSX A;  1DP9 A;  5J7E A;  2VJW A;  4GHI A;  4E04 A;  5IS1 A;  4JGO A;  1STZ A;  2A24 B;  1V9Z A;  3B47 A;  5L8M A;  4AFI A;  3A0S A;  2PD7 A;  2VGL M;  3HJK A;  4O0P A;  3KO6 A;  4IHQ A;  2K7S A;  4EES A;  3MF0 A;  2OOL A;  3OLO A;  2XA7 S;  1TS8 A;  4Q0I A;  2KLI A;  3KYQ A;  4LRY C;  3LID A;  3HJI A;  3PBO A;  4FSF A;  1BYW A;  2KOI A;  4GCZ A;  3C38 A;  4HI4 A;  2ZOH A;  3MQ0 A;  2L0W A;  2VV7 A;  2WKQ A;  3MFX A;  1F98 A;  4R38 A;  3LI8 A;  3LUQ A;  4YWZ A;  2OWJ A;  2PR5 A;  4HNB A;  1F5M A;  3B33 A;  2Z6C A;  3KSG A;  4ARZ B;  4WEJ A;  4MCW A;  4P6Z S;  1XFN A;  1NLZ A;  4Y2F A;  1P97 A;  1LSW A;  3CI6 A;  3G6O A;  4YOF A;  3EQU A;  4CLC B;  3UMD A;  3C2W A;  1IFQ A;  3PXP A;  4XT2 B;  3NHQ A;  2L4R A;  2G7U A;  3IBR A;  4Y5F A;  4KQO A;  1OT6 A;  4F3L A;  3E4Q A;  2M7U A;  4HY8 A;  4EQ1 A;  5HDS A;  2K31 A;  4EET B;  2PHY A;  4IUH A;  1W63 Q;  2HGV A;  3D3O A;  4I38 A;  2L1M A;  4MN7 A;  3VOL A;  4Y3I A;  3E4P A;  3F1O A;  2GNX A;  2QWS A;  3MJQ A;  2JKR M;  4YNR A;  3FC7 A;  3K2N A;  1XJ6 A;  4BBT A;  4GJ4 A;  3T4O A;  4F3L B;  4KQD A;  3RTY A;  3IBJ A;  5HSQ A;  1YKD A;  4WEK A;  1OJG A;  2VV8 A;  3K3C A;  4MDZ A;  3C8C A;  2D01 A;  3F1O B;  4NXE A;  5KSH A;  2VEA A;  4HQA A;  3LR4 A;  2O9B A;  1G28 A;  2VX8 A;  5KIZ A;  4H6J B;  2O99 A;  4ETX A;  1KOU A;  5IU1 A;  1ODV A;  3F1P A;  3KYZ A;  4ETZ A;  3CAX A;  4PHT A;  2KX6 A;  3LI9 A;  3T4T A;  5HZH A;  2A2L A;  1S4R A;  3EQV A;  3P01 A;  4HIA A;  3TRC A;  5AJG A;  1JNU A;  4L9E A;  4G3W A;  4DJ3 A;  1OTA A;  1S66 L;  1S1Z A;  4LPZ A;  2OAP 1;  2WKP A;  4NXB A;  5TBM A;  5K5B A;  3VE3 A;  3PBT A;  5F5Y A;  5IT5 A;  4HJ4 A;  4MN6 A;  4NXF A;  5DF9 A;  4KUK A;  2JKR I;  4NEE D;  4BBV A;  4IJG A;  3LR3 A;  1ZHH B;  1WA9 A;  2ZMF A;  1NRJ A;  4ARZ A;  3E0Y A;  4LRX C;  5CX7 A;  2B02 A;  2XRN A;  4CQH A;  3MQQ A;  5HL6 A;  5C5K A;  5TBM B;  2V0U A;  2ZBB A;  2ZMV A;  5G4Y A;  2V1A A;  4CLC A;  3IS2 B;  3U2A A;  5J4E A;  5HWW A;  5HDD A;  4XT2 A;  3NJA A;  5LBR A;  1UWN X;  2VKS A;  3JVV A;  3O5Y A;  5HPI A;  3A0V A;  3KX0 X;  3A0R A;  3BW6 A;  3C30 A;  1S4S A;  3OBF A;  3VV4 A;  5AVE A;  3JVU A;  1X0O A;  3BY8 A;  5J3W A;  3UME A;  3W2Z A;  2I9V A;  3NOP C;  2OAQ 1;  2QHK A;  2W0N A;  3FPV A;  4I3A A;  4EER A;  3TW8 A;  3F1N A;  1TS7 A;  4DN0 A;  3RH8 B;  3EEA A;  1YAX A;  3FPW A;  1LL8 A;  1DRM A;  2ZOI A;  4BWI A;  3CIT A;  4I3J A;  3FG8 A;  1TF1 A;  2O0Y A;  4R3A A;  3CLO A;  3T4S A;  3MMH A;  4BMW A;  2QJ5 A;  2JHE A;  2P08 A;  4BJP A;  1T1A A;  4G3V A;  5F68 A;  2KDK A;  1P9W A;  2W1T B;  4M4X A;  2P04 A;  2VLG A;  4H6J A;  3F1N B;  1T19 A;  3MQO A;  2QYB A;  4O01 A;  1OT9 A;  3OCL A;  4WEL A;  1G6O A;  4HJ6 A;  3H9W A;  3S7N A;  1MZU A;  3S7Q A;  3KSH A;  3S7O A;  5DKK A;  2P7J A;  2QJ7 A;  2PDR A;  2LB5 A;  3UB8 A;  4LRZ E;  4NXG A;  4CLC E;  3B42 A;  5DJU A;  3EWK A;  4PKY G;  2IA2 A;  3EGD C;  2J80 A;  3T4L A;  4EEP A;  1YSQ A;  2W3G A;  4MMN A;  2JKT M;  4Q0J A;  1NWZ A;  2Y79 A;  4R70 A;  2VA0 A;  1XJ3 A;  3GEC A;  4EU0 A;  1F9I A;  3LR0 A;  1MKM A;  5DKL A;  2NUT C;  2VV6 A;  1NLY A;  3OC2 A;  3E4O A;  4R6L A;  2GZA A;  2XSS A;  2YKH A;  3UE6 A;  2HJ9 C;  4HH3 A;  1TS0 A;  2V0W A;  1T1B A;  3CUE A;  3PHY A;  1VHM A;  1YSP A;  4WF0 A;  1TD5 A;  1DP8 A;  3OCN A;  4II7 A;  3ZQ5 A;  2O9A A;  4K08 A;  2NUP C;  4EXO A;  4B93 A;  4WL9 A;  1D7E A;  4L9F A;  2DMW A;  2B18 A;  4L9G A;  1H3Q A;  3V67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...