1UWPX

Initial events in the photocycle of photoactive yellow protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
113
Chain Sequence
EHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQNAAGDITGDPKQVIGKNFKDDSPEFYGKFKEGVASGNLNTMFEYTDQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Initial events in the photocycle of photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 34
structure length 113
sequence length 124
ec nomenclature
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1uwpX00
2YKFA 1KOUA 3H82B 4DJ3A 1LSXA 4L9FA 3LIEA 5HDDA 3LUQA 1XFQA 2PD8A 3HJIA 4JGRA 3RH8B 3UB7A 2EA9A 2OWHA 3UB8A 1NWZA 4EERA 5J4EA 1UWNX 2CMNA 4K08A 4H6JA 1LL8A 4EXOA 3PHYA 1OTBA 4F3LA 4WL9A 1X0OA 1G28A 2Z6CA 4YWZA 2INWA 1JNUA 2VLGA 3F1PA 2OOLA 1TS6A 4NXEA 4BBVA 3C8CA 1S66L 2PR6A 3UMDA 2JN7A 1F98A 4EEUA 4PKYG 5HWWA 1MZUA 1TS8A 4GS9B 4JGQA 5TBMB 3H82A 3CWFA 4I39A 2J80A 1S4SA 3CLOA 1OJGA 4LRYC 5G4ZA 3LIFA 5DKKA 3NHQA 4L9EA 4HP4A 1OTIA 3RTYA 5HSQA 2V1AA 1N9OA 3A0SA 3BY8A 1D06A 4XT2B 1DP6A 2W0NA 4GCZA 2PYPA 5DKLA 4HOIA 4KUKA 2ZBBA 3VE4A 2K7SA 2QWSA 3BWLA 1S1YA 2PR5A 2A24A 3F1OB 2M1CA 3E4OA 3H7WB 4L9GA 4NXGA 1GSXA 3UB6A 3BY9A 4HJ4A 5F69A 2BASA 1XFNA 3UE6A 4DJ2A 1DP8A 4HY8A 1VB6A 1WA9A 5DJTA 2V0WA 4EEPA 1XJ4A 2V0UA 5TBMA 2L0WA 4RQ9A 4HJ3A 2V1BA 1DRMA 2VEAA 3GECA 4HJ6A 3C2WA 2PDRA 4XT2A 2D02A 3D72A 3MQQA 5G4YA 4HHDA 2R78A 3LI9A 1OTEA 1XJ6A 1N9NA 1T1BA 1T1AA 3T50A 4LPZA 2ZOHA 3F1OA 3UMEA 3LICA 5HDSA 3CAXA 2OWJA 1OJ5A 2WKQA 3ICYA 2D01A 3LIDA 3LI8A 4R3AA 5A8BA 3E4PA 2Z6DA 5HZHA 4BBUA 1OTDA 4WUJA 3EWKA 5F5YA 4I3IA 4I38A 2VV7A 2VV6A 3OLOA 1OTAA 3HJKA 1N9LA 1V9YA 2PYRA 4HQAA 4EESA 2JHEA 2W27A 2KDKA 4MN5A 1TS0A 3NJAA 1UGUA 5J3WA 1S67L 1T19A 1F9IA 4I5SA 3MR0A 4KUOA 5I5LA 3UB9A 1XJ2A 1XJ3A 5IS1A 4WLAA 4KQDA 3NOPC 2PHYA 5IU1A 3G6OA 4HP9A 4LRZE 2QKPA 5HD3A 2L4RA 1S1ZA 1P97A 2WKRA 4GS9A 4GW9A 1P0ZA 4JGPA 3E4QA 3LIBA 5KIZA 5HWVA 4M4XA 2HV1A 4B9OA 2H28A 1TS7A 4R38A 4LLOB 4HH2A 1UWPX 2ZOIA 3LYXA 4EQ1A 2KX6A 3GDIA 1T18A 1T1CA 3SW1A 4JGOA 5F68A 3NOTC 1LSVA 4BBTA 4HIAA 3A0VA 3IBRA 4R6LA 5J7EA 2QHKA 3MQOA 4PKYA 3MFXA 3H7WA 3KX0X 1OT6A 1S4RA 4EW7A 3H9WA 1D7EA 2A24B 2P7JA 2WKPA 4I3JA 3MXQA 3VE3A 1GSVA 3F1NB 3MJQA 5HD5A 4GHIB 5HDCA 4E04A 4HNBA 1OT9A 3ULFA 5F6AA 3IS2B 3PYPA 3EEHA 1EW0A 3VOLA 1BYWA 4LRXC 2YKHA 4WN5A 1GSWA 5HWTA 1Y28A 3P7NA 3B33A 3FC7A 3K3CA 2I9VA 2L1MA 4HI4A 2PD7A 3FG8A 4H6JB 3K3DA 1V9ZA 5EFWA 4F3LB 4EETB 3LIAA 2QJ5A 3A0RA 4MN6A 1LSWA 3ZQ5A 3F1PB 3NOUC 4WF0A 1LT0A 3F1NA 2VV8A 1DP9A 4GHIA 4HH3A 4NXFA 2V9AA 1ODVA 2GJ3A 4NXBA 5AVEA 3IS2A 4I3AA 5DJUA 4R70A 2B02A 2QJ7A 5AVFA
chains in the Genus database with same CATH superfamily
2YKFA 3ISGA 4DJ3A 2PRFA 4CLCB 2W3EA 4KQOA 1IYPA 5FDSA 2PD8A 3ZVTA 4XUZA 2EA9A 5CXWA 2FFFB 3CPTA 3UB5P 4ARZB 3KSGA 5J4EA 1Z09A 1H5XA 2OAQ1 1PI5A 3S4XA 2XLNA 4EXOA 4OQHA 2BLSA 3RFBA 2Y2NA 3U2AA 3FZCA 3BM6A 2FFYA 1HVBA 5CTMA 3NBLA 3HUNA 2ZC6B 2W1TA 3Q7VB 2INWA 3OPLA 1JNUA 2VLGA 1K56D 2OOLA 3WS1A 4LV0A 3MXRA 4NXEA 4OONA 4JXWA 2EXBA 3UMDA 2PU4A 5HWWA 4KZ8A 1MBLA 4LENA 4QJGA 3RXWA 3V39A 3DWKA 4RA7A 4PM7A 4UA9A 2IWDA 4S2MA 1PW8A 4NETA 3UE1A 3CLOA 1QMFA 3LIFA 1ZTUA 1H8YA 1G68A 1MWRA 5HSQA 5TGFA 4WYYA 3A0SA 3OPRA 2WGWA 2QWSA 2WKHA 2Z2MB 1XGJA 4X53A 2PR5A 3C38A 3BFCA 3IXHA 1P9WA 3UNWA 1Y54A 1KDWA 5D3OA 2QYBA 4R4SA 3L7HA 2DNSA 3MF0A 2BASA 1EROA 4O7DA 4JPMA 2ACGA 4PM9A 4EEPA 4QWOA 5FSRA 2QZ6A 4K91A 4OP8A 1L0EA 1K38A 5TBMA 4G3WA 3BRMA 4ZRRA 1LI9A 2P9VA 2Y2PA 4K0XA 2W3GA 5DFXA 5DF9A 3CJMA 1BSGA 2V2FF 4X56A 3ZDJA 2Y4AA 4E3IA 4HJ6A 1CI8A 4UEYA 2B18A 4KZ3A 3MQQA 4R0QA 1K55C 2R78A 1N9NA 1RCJA 1T1BA 2XA7S 2PBYA 3WS0A 1VETB 5DF8A 3IH9A 3F1OA 5FQMA 1VHMA 1BLSA 4R1GA 1TDGA 1K4EA 4L0LA 2CC1A 1BZAA 2HDSA 1MC0A 1ZG4A 4JLFA 1G5UA 3ZNYA 2JCHA 3NIAA 2ZC5B 1NYYA 3ZG8B 3LIDA 2ZJ9A 2PT7A 1IELA 3T1XA 2HP5A 1IFQA 2MJ6A 4KZ7A 3G4PA 5HPFA 4S2OA 4Y0UA 4E3JA 1CEGA 4I3IA 1OPXA 3D9YA 3WS5A 3FWLA 2R9XA 2KOIA 2EXAA 3IBJA 2P08A 1S0WA 4HQAA 4YNRA 4EESA 2JHEA 3N8RA 4H8RA 3O5YA 3O86A 5AQAA 4OLDA 2ZL1B 3IWIA 3HLDA 1PZPA 2Y2HA 1XJ3A 5L10A 5IS1A 3MKEA 4KQDA 3DTEA 2BTFP 4MBKA 5EECA 4NEED 4YOFA 1ERQA 3IX4A 2Q0OA 4EQIA 4LRZE 2EFXA 5KZHA 1LL9A 1A0KA 4UAAA 1JWZA 1ZG6A 4GS9A 1WYCA 4GW9A 4IBXA 4EV4A 5A93A 2XFSA 3KYZA 5KIZA 2HV1A 1NZUA 2JKRM 1CJFA 1SHVA 1SKOB 5CHMA 2ZMAA 3CZDA 4EUZA 3GDIA 4X1LA 3KO6A 3SOIA 4U0XA 3FKWA 1YKDA 3OOVA 5FQQA 5CX7A 4BQMA 3NOTC 4MLLA 1FR1A 4KENB 3QP1A 3A0VA 3IBRA 4R6LA 5J7EA 3MQOA 4ZTKA 1K54C 1LHYA 3KX0X 2JBFA 5E2EA 1S4RA 4DE1A 1ZHHB 5M1AA 4JBFA 3BQAA 3DBAA 3C7VA 3G30A 3MJQA 3G2YA 4KG2A 5HD5A 4GHIB 3IX3A 3QNBA 1E25A 2ZMVA 3QNCA 3GVBA 4HNBA 4OQGA 3TG9A 1NYMA 3IS2B 1YLPA 3PYPA 4U3TA 2EWWA 1IYQA 3ZYTA 4JF5A 3IXBA 5EVIC 1KGGA 4LRXC 5C5KA 3Q81A 4WN5A 3S7OA 2WYXA 4PM5A 4N1XA 2EX2A 1ALQA 1SCWA 3EEAA 5E43A 3T1QB 3K3CA 2J9OA 4ZJ3A 4DKIA 3LR3A 1FILA 3IF5A 1K57A 2X71A 1WE4A 3QP5A 4LV1A 4BWIA 5EOOA 2WADA 3M6HA 4ZDXA 4S2JA 2HZ5A 1S6RA 2J3WA 4KZ5A 5F1GA 3ZQ5A 1DJAA 3LFVA 4GD6A 3F1NA 3T4KA 3LO7A 4Q0IA 2C5WB 4QB8A 3CUEA 3S1YA 4PM6A 1VEUB 2UWXA 3UY6A 2XK1A 3A3JA 1C3BA 5DJUA 2Y2QA 2QJ7A 4X1MA 1L0FA 2LB5A 3OPHA 1BTLA 5FI6A 1LSXA 3Q1FA 4L9FA 3LIEA 2A3UA 3MZDA 1AWIA 3LUQA 3NY4A 1XFQA 2HPBA 3HJIA 4JXGA 2HDQA 1FQGA 3P09A 4BL2A 1UWNX 4K08A 1KVLA 1YSPA 4H6JA 1LL8A 2XR0A 3PHYA 4WM9A 4WMCA 5CTNA 4YWZA 3BYDA 3UPOA 5E2FA 4A5RA 2ZLYA 3PAEA 1ONHA 3F1PA 4MBHA 3DWZA 2Y79A 3B42A 3U4LP 2NUTC 4BBVA 3QP6A 4GDBA 3C8CA 4OOYA 3IWQA 2PR6A 5DFYA 2VGLS 4EEUA 5CGSA 1PWCA 4GS9B 5CGWA 3H82A 4CQHA 3CWFA 4HEFA 3UDIA 1SDNA 2J80A 4ZBEA 4F94A 1S4SA 1IYOA 1JWPA 1OJGA 5G18A 5G4ZA 3PXPA 4N1HA 4HP4A 1OTIA 4GJ4A 2Y2MA 3W4QA 1KGFA 1IOUA 1FSYA 1XPBA 4WZ4A 4FCFA 5DKLA 4BL3A 4EU0A 3WRTA 3BWLA 2PU2A 3PBNA 4Y13A 2A24A 3O3VA 3UN7A 1GSXA 2WAEA 3HLGA 1KVMA 2G2WA 4N9KA 5F69A 1K4FA 1J3WA 5HAIA 3T12B 3S22A 3SS5A 1WA9A 5DJTA 4M3KA 3HCYA 3BEBA 2V0UA 2PBDP 1YLJA 1BLPA 1W79A 2L0WA 5HW3A 1N9BA 4RQ9A 2Y2IA 4E3MA 4HJ3A 1M40A 3UDXA 3ZG9B 1PI4A 3I7JA 5DTSA 3FV7A 2V1BA 5GLDA 1DRMA 3DAVA 1RP5A 3TRCA 1PZOA 4XT2A 2D02A 4Q8IA 3D72A 5G4YA 4X25A 3IHBA 3PAGA 2OLUA 1XA1A 5I94A 1OTEA 5CECA 1BLHA 3T50A 4LPZA 2V8FA 2ZM2A 5HDSA 3CAXA 4RVAA 4ZAMA 2VJWA 3IXDA 1NRJA 1FCOA 4DE2A 1PWGA 1YAXA 1K0KA 3IHAA 1CQAA 3LY4A 4MCWA 4MDZA 1YSQA 3EOIA 2Z6DA 5HZHA 4ZJ2A 4O01A 1MWSA 2WKEA 2VV7A 3HLEA 5U47A 1V9YA 2PYRA 3AGEA 3R7WA 3HUMA 3CI6A 5KMWA 1MWUA 5TR7A 3QP4A 5LBRA 1UGUA 4OPZA 2M7UA 1T19A 1F9IA 4XXRA 3ZCZA 1KDSA 3UB9A 2VGJA 5HPIA 4WLAA 4IHQA 4LGWA 5HL1A 2XRNA 5IU1A 5AJGA 2HJEA 4HP9A 4OH0A 2QKPA 1GA9A 1S1ZA 3ZHHA 1U60A 1NLYA 4JXVA 1P97A 2ZQ8A 3AGDA 4HESA 1SKFA 3VOYA 1I2SA 4JGPA 3LR0A 3LIBA 4GB7A 4M4XA 5DTKA 2WAFA 2H28A 4MMNA 4R38A 4LLOB 5EVEA 2XROA 1I2WA 1UWPX 1KE0A 3NDEA 4P87A 2ZOIA 3LYXA 4PHTA 3WRZA 2KX6A 1NLZA 2WZXA 4RYEA 3V3SA 4LV3A 2G2UA 2WZZA 1NXYA 1E3UA 2WK0A 3SW1A 3VP0A 1IKGA 1G6AA 1LSVA 4BBTA 4HIAA 3EGDC 3G35A 3E0YA 3LGOA 4C3QA 1GHIA 2QHKA 1GHPA 1O7EA 1K55A 3FPWA 1Y4OA 3QP2A 4N9LA 1ES2A 5TJJA 3BFGA 5FQIA 4ETXA 1OT6A 3M6BA 1YLYA 3T4TA 4UHUA 3H9WA 2A24B 4EBNA 1YMXA 1FOFA 4Q0JA 3VSLA 1XX2A 3ZGAB 1GSVA 4R3JA 3IWOA 3RJUA 3IF6B 5CRFA 2W1RA 2ZC3B 3T4JA 3BFFA 4IUKA 4Y0TA 3TSGA 2VGLM 1TVFA 4S2NC 1TD5A 3CHWP 4KQRA 2DRWA 3EQUA 3IT9A 1L0DA 4EWFA 2Y2GA 5HWTA 1YPRA 5L2FA 1ESUA 1ZC2A 2Z2LB 3P7NA 3TJZC 5KSHA 3FC7A 3CPTB 4E6XA 1MKMA 2L1MA 3G2ZA 2AVXA 2HGVA 4B4XA 3GV9A 5EV0A 4IEDA 4OPYA 3C7UA 1V9ZA 2XH9A 4S2LA 2H10A 4GLQA 3LIAA 2QJ5A 3UPNA 3T4LA 4OOLA 2W1TB 5EPHA 4O8GA 3ZFZA 3NOUC 1TDLA 2Y2LA 4WF0A 3N6IA 4NXFA 3NECA 1ODVA 1NY0A 2RCXA 2GJ3A 1MPLA 5FI7A 2ZMFA 4Z9QA 2JKGA 2OSUA 5GLCA 1VQQA 4R70A 5EM1A 1W63M 5AVFA 4P6ZS 2Y2JA 3ZG7B 4ETZA 3W8KA 3HLBA 2J8YA 2A2LA 3L9KA 4DE0A 5FASA 1I5QA 1CK3A 4UA7A 2I72A 5E2HA 2OAP1 3UB7A 2OWHA 3UB8A 3LR4A 3UO9A 1W63Q 1N4OA 1NJ4A 3ITAA 4QHCA 1W5DA 1KE3A 4YINA 1K54A 1F5MA 5CEBA 2UV0E 1K25A 4QU3A 2WGWB 1JWVA 1MY8A 2Y91A 4WBGA 4IBRA 3ZG5A 1OTBA 4F3LA 4WL9A 1X0OA 1G28A 3HL9A 5FL3A 3FPVA 3DTMA 3BECA 5JYPA 4MNRA 3CITA 5L07A 3P98A 3IX8A 2EX8A 3A3FA 5FQ9A 4P6BA 2O0YA 4G3KA 1MZUA 1SDEA 1TS8A 2VGKA 1STZA 5A92A 4UA6A 5EVIA 1LI0A 5TBMB 1KE4A 5JYOA 2P9VB 3NI9A 3JVVA 4CLCA 3SH9A 5DF7A 1W8YA 1OMEA 2P74A 2V20A 3DW0A 4FSFA 2JKRI 3ZNTA 4EBPA 5K5BA 1FSWA 5DKKA 2J7VA 3NHQA 4ARZA 4Y5FA 4L9EA 4EUVA 2V1AA 4DMZA 1N9OA 5TFQA 3CG5A 1FCNA 5F83A 2K2NA 4HOIA 2ZBBA 1IKIA 2O9AA 3VE4A 2W3FA 4OPQA 3N7WA 5FI2A 1S1YA 1K57C 2E8JA 3F1OB 4R4RA 2ZQ7A 5EE8A 4L9GA 5GHZA 3HUOA 2HF6A 2B5RA 2XEPA 1HZOA 4JF4A 4X55A 1ONGA 4IVIA 3GMWA 1DP8A 2GNXA 4HY8A 4DRTA 3MKFA 1PW1A 2ZQCA 3LY3A 3E2KA 1HTZA 3R4KA 1PRQA 3QP8A 3VP2A 3WWXA 4DN0A 1XXMA 5FAOA 3KSIA 4Z1WA 2HP6A 2VEAA 1J9MA 3GECA 4OVDA 5CERA 2O9CA 1PWDA 2PAVP 1DJCA 3LI9A 4LV2A 1XJ6A 2XA7M 2ZC7A 4ME4A 3MZFA 4KZBA 4PM8A 3VP4A 1ES5A 4N92A 1OJ5A 2HDRA 2ZM0A 3ICYA 2O9BA 2VX8A 2JKTI 3A3EA 2LB9A 5M18A 4QD4A 2WGVA 5HFOA 1PYYA 4E6WA 3HBRA 3LI8A 1Q2PA 5FEFA 3VFHA 3E4PA 5AQ7A 4BBUA 2EWVA 1TEMA 2JKFA 2IWBA 4WUJA 4MBFA 5E2GA 4DXCA 3LR5A 5F5YA 3PBSA 1LLBA 5MC7A 4S2IA 4BD1A 3VSKA 1OTAA 4CPKA 2Y8HA 3HJKA 1N9LA 1XKZA 1MXOA 2W27A 3O88A 2KDKA 1TS0A 3D4FA 2VZWA 3NJAA 4CLCD 3C5AA 4I5SA 4OOMA 3MR0A 3JVUA 1VETA 3V67A 1K6RA 3E98A 3LEZA 4WZ5C 1H3QA 5FQJA 1XA7A 3G6OA 3NCKA 2V8CA 1HD8A 3MXSA 5HD3A 2L4RA 3C30A 2X01A 3IF6C 4WELA 3A3IA 4LCMA 5EUAA 2XDMA 2OV5A 5J8XA 2DMWA 4HBUA 4HH2A 4P6ZM 3V5MA 2J9PA 3A3DA 2X02A 4EQ1A 4P0MA 3UE0A 3VMAA 3PBQA 4B4ZA 1T1CA 3DTKA 1YLZA 4JGOA 4JXSA 3W2ZA 5F68A 3HLFA 2WUQA 1JTDA 1CEFA 5GHYA 4JF6A 2OLVA 4DDYA 2HP9A 3AGFA 4KZ6A 3MFDA 2ZL1A 3WS2A 3SH7A 2A49A 3D3OA 3MFXA 3H7WA 4KZAA 5A90A 3M2KA 4QY5A 2ZQDA 5GLBA 4GZBA 4EW7A 2FZ0A 2IWCA 4I3JA 3MXQA 2XGNA 4WMCD 3VE3A 2NUPC 3CMZA 3F1NB 4BENA 5IHVA 4KZ4A 4D60A 2XQZA 5HARA 2QMIA 3Q82A 5DTTA 3HVFA 1SKOA 3OC2A 3VOLA 1YQSA 4MEZA 3SH8A 1BYWA 4E3OA 3BJNA 3T4QA 4FH4A 5A91A 3GR2A 3M2JA 3W4OA 1MWTA 1Y28A 2XF3A 5FDHA 4GD8A 4R3BA 1L3LA 3UDFA 2O99A 4C75A 3B33A 4IUHA 5GHXA 3KSFA 2Y2OA 1XP4A 2VKSA 4HI4A 2V1ZA 2PD7A 3FG8A 4H6JB 3K3DA 3B3XA 1GCEA 5EFWA 3TW8A 4GDNA 1FIKA 3G34A 3TOIA 3OCLA 4EETB 3O87A 4B93A 3A0RA 4MN6A 4OP5A 4RX2A 2J3TD 3F1PB 1LT0A 1H0MA 1VM1A 3ZVWA 3MQ0A 4GHIA 3N8LA 1BLCA 4IJGA 1RGYA 4E3LA 5AVEA 3IS2A 4I3AA 2B02A 1JTGA 2EX6A 4Y17A 1KOUA 3H82B 3JYIA 2ZQAA 1IYSA 3SS4A 5HAPA 2WGIA 5HDDA 3Q07A 3WS4A 4NK3A 5CGXA 3HLWA 3RH8B 4JGRA 1MKIA 1NZOA 2Y2KA 1NWZA 4EERA 3FYZA 5L09A 3ZG0A 1L2SA 2CMNA 2Y55A 4BD0A 4PAUA 5L8MA 4YFMA 3K2NA 4ZJ1A 2Z6CA 2HDUA 3EGXC 2XD1A 4NG2A 4EBLA 5DVAA 4B88A 4AFIA 4IVKA 1TS6A 1JVJA 4X6TA 2W3DA 1VEUA 4X68A 2Q9NA 3GSGA 1S66L 4K0WA 3EQVA 4QPRA 1YM1A 2H5SA 2JN7A 2G7UA 1F98A 1M6KA 4S2NA 3NULA 4PKYG 4JGQA 1Q2QA 4HBTA 2K31A 4I39A 3OZHA 2GDNA 4UQIS 4S2PA 4LRYC 3V50A 4KG6A 3GTCA 3OCNA 1ZKJA 1HLUP 4D2OA 4Y7PA 3RTYA 2IA2A 3MSHA 3BY8A 1D06A 4XT2B 1DP6A 2W0NA 4GCZA 1K6SA 2PYPA 4KUKA 3KSHA 4DXBA 1ESIA 2K7SA 4ESPA 1F2KA 3E2LA 4CJNA 4WEJA 5FAQA 3SZTA 3BLMA 2E8IA 3G32A 2M1CA 3E4OA 3H7WB 4PPRA 4NXGA 3UB6A 3BY9A 3PBTA 4XUXA 3VV4A 4HJ4A 3T1SA 1FCMA 3QHYA 4P85A 1CF0A 1XFNA 3UE6A 4E3KA 4DJ2A 1VB6A 3S7QA 2V0WA 3VFFA 2JE5A 1DY6A 1XJ4A 3OPPA 3G31A 3N8SA 4OQIA 2GZAA 3MMHA 3SS3A 2HJ9C 5EM0A 1ERMA 1PNEA 5FATA 4GN2A 3MZEA 3S7NA 1BUEA 2EX9A 2ZD8A 5F82A 3R7WB 3C4OA 3JPUA 1GA0A 3C2WA 2PDRA 5AQ9A 3Q7ZA 1E3UD 1WYBA 4HHDA 5CHJA 3TE8A 4GOGA 4PMAA 2DCFA 3MS6A 1EI5A 1T1AA 3UMEA 2ZOHA 4CLCE 3LICA 1DJBA 2EFUA 4KQQA 2OWJA 2WKIA 2ZQ9A 2WKQA 4RX3A 1YMSA 5HL6A 3DTIA 4NKPA 4U0TA 1P9RA 3S7PA 3T1RA 3FKVA 2D01A 1L0GA 4ID4A 4G3VA 4E3NA 4R3AA 3HREA 1W7FA 4Y0OA 5A8BA 3RXXA 1OTDA 5CEDA 3KYEA 2VA0A 3EWKA 4Y2FA 3BFEA 4DDSA 1D1JA 4I38A 2QPNA 2VV6A 3OBFA 3HLCA 3OLOA 4O0PA 4BLMA 4S2KA 3B47A 4CLCC 5AQBA 3NC8A 1EWZA 4MN5A 4FD8A 4C6YA 3LEQA 5J3WA 1S67L 1PFLA 4KUOA 5I5LA 5EOEA 1XJ2A 3Q7VA 4DE3A 2H0YA 4QY6A 2W3HA 1YLWA 3IXGA 3VP3A 5GL9A 1AXBA 3PBOA 2JKTM 3NOPC 2PHYA 4DF6A 1ACFA 4OLGA 2FH5A 2GX5A 1QMEA 1ES4A 2WKRA 3CUEC 1XGIA 5KSCA 1P0ZA 2BG1A 3E4QA 5HWVA 1YLTA 4B9OA 1TS7A 3VP1A 5FQKA 5IT5A 2XSSA 1BULA 1IEMA 1LL5A 1T18A 2P04A 5M19A 3P01A 4GNUA 5HAQA 4Y15A 1CI9A 4PKYA 4R23A 1PIOA 1K56A 1E4DA 5CHUA 4OKPA 1Z6FA 4OQ0A 3V3RA 4OPRA 2Y59A 3GQZA 1ES3A 2ZM8A 4Y3IA 3UE3A 5FA7A 1D7EA 2XFTA 3GRJA 2P7JA 2JC7A 2WKPA 3ITBA 2R9WA 5HDCA 4II7A 4E04A 4FTXA 5BOHA 1OT9A 3IH8A 3ULFA 5F6AA 3PBRA 4LCLA 3LCEA 1W8QA 1H8ZA 4GKUA 1FR6A 3EEHA 1EW0A 3VOZA 1H8MA 4JKTA 3NDGA 4BJPA 2YKHA 4FUWA 3T4SA 3W4PA 4FH2A 5EVID 4MN7A 2KLIA 1GSWA 2B95A 4UQIM 3BQ8A 1NRFA 3BW6A 3UPPA 3KYQA 4Q0HA 3PTEA 3IQAA 1RGZA 2I9VA 5FAPA 1YT4A 5GLAA 2RL3A 1BT5A 4KZ9A 5FEGA 2H0TA 5EVLA 3T4OA 2ZC4B 4KG5A 4X69A 1GHMA 4F3LB 2J3TC 4WZ5A 1TF1A 5HX9A 2M7VA 3BFDA 1LSWA 3N4IA 3C4PA 4FOFA 2C6WB 4WEKA 1G6OA 2VV8A 1DP9A 1KGEA 5F1FA 3IF6A 4HH3A 2V9AA 3PR6A 1SZVA 2VK3A 1O07A 2XD5A 3BLSA 4NXBA 4BMWA 4LFUA 5EVIB 3MBZA 2Q9MA
chains in the Genus database with same CATH topology
2YKFA 1KOUA 3H82B 4DJ3A 2A2LA 1LSXA 4CLCB 4L9FA 3LIEA 5HDDA 2W3EA 4KQOA 3LUQA 1XFQA 2PD8A 2OAP1 3HJIA 4JGRA 3RH8B 3UB7A 2EA9A 2OWHA 3UB8A 3LR4A 4ARZB 1NWZA 1W63Q 3KSGA 4EERA 5J4EA 1UWNX 2OAQ1 2CMNA 4K08A 1F5MA 1YSPA 4H6JA 1LL8A 4EXOA 4PAUA 3RFBA 5L8MA 3U2AA 3PHYA 1OTBA 4F3LA 3K2NA 4WL9A 1X0OA 1G28A 2Z6CA 4YWZA 3EGXC 2W1TA 5FL3A 2INWA 1JNUA 2VLGA 3F1PA 2OOLA 3FPVA 2Y79A 3B42A 4AFIA 1TS6A 3CITA 2NUTC 4NXEA 2W3DA 4BBVA 3C8CA 1S66L 3EQVA 4QPRA 2PR6A 5DFYA 3UMDA 2VGLS 2JN7A 2G7UA 2O0YA 1F98A 4EEUA 4G3KA 4PKYG 5HWWA 1MZUA 1TS8A 1STZA 4GS9B 4JGQA 5TBMB 3H82A 2K31A 4CQHA 3CWFA 4I39A 3JVVA 4CLCA 2J80A 4UQIS 1S4SA 3CLOA 4FSFA 1OJGA 4LRYC 2JKRI 5K5BA 5G4ZA 3LIFA 3PXPA 1ZTUA 5DKKA 3OCNA 3NHQA 4ARZA 4Y5FA 4L9EA 4HP4A 4EUVA 1OTIA 4GJ4A 3RTYA 5HSQA 2IA2A 2V1AA 4DMZA 1N9OA 3A0SA 3BY8A 1IOUA 1D06A 4XT2B 1DP6A 2W0NA 4GCZA 2PYPA 5DKLA 2K2NA 4HOIA 4KUKA 3KSHA 2ZBBA 2O9AA 4EU0A 3VE4A 2W3FA 2K7SA 2QWSA 3BWLA 1S1YA 3C38A 2PR5A 3PBNA 2A24A 1P9WA 4WEJA 3F1OB 2M1CA 3E4OA 3H7WB 4L9GA 4NXGA 1GSXA 3UB6A 2QYBA 3BY9A 3PBTA 2HF6A 3VV4A 3MF0A 4HJ4A 5F69A 2BASA 1XFNA 3UE6A 4DJ2A 1DP8A 2GNXA 4HY8A 1VB6A 1WA9A 3S7QA 5DJTA 2V0WA 4EEPA 1XJ4A 3HCYA 2V0UA 5TBMA 4G3WA 2GZAA 3R4KA 4ZRRA 3MMHA 2L0WA 2HJ9C 4RQ9A 2W3GA 5DFXA 5DF9A 4DN0A 4HJ3A 3KSIA 3S7NA 4Z1WA 2V1BA 1DRMA 2VEAA 3R7WB 3GECA 4HJ6A 3C2WA 2PDRA 3TRCA 4UEYA 2B18A 2O9CA 4XT2A 2D02A 3D72A 3MQQA 5G4YA 4HHDA 2R78A 3LI9A 1OTEA 3TE8A 1XJ6A 1N9NA 2XA7M 4ME4A 1T1BA 2XA7S 1T1AA 3T50A 4LPZA 2ZOHA 3F1OA 1VHMA 3UMEA 4CLCE 3LICA 5HDSA 3CAXA 2OWJA 1OJ5A 4L0LA 2WKQA 3ICYA 2O9BA 1MC0A 2VX8A 2JKTI 5HL6A 2LB9A 4NKPA 2VJWA 1P9RA 1NRJA 3S7PA 1YAXA 2D01A 3LIDA 3LI8A 4G3VA 2PT7A 4R3AA 4MCWA 4MDZA 1YSQA 1IFQA 5A8BA 3E4PA 2MJ6A 3EOIA 2Z6DA 5HZHA 4BBUA 1OTDA 2EWVA 5HPFA 4O01A 4WUJA 2VA0A 3EWKA 4Y2FA 3LR5A 5F5YA 3PBSA 4I3IA 4I38A 1OPXA 2VV7A 5MC7A 2VV6A 3OBFA 3OLOA 2KOIA 4O0PA 1OTAA 3IBJA 2Y8HA 3HJKA 1N9LA 2P08A 3B47A 1V9YA 2PYRA 4CLCC 3R7WA 4HQAA 4YNRA 4EESA 2JHEA 2W27A 3CI6A 2KDKA 3O5YA 4MN5A 1TS0A 2VZWA 5LBRA 3NJAA 4CLCD 1UGUA 2M7UA 5J3WA 1S67L 1T19A 1F9IA 4I5SA 4OOMA 3MR0A 4KUOA 5I5LA 3JVUA 3UB9A 1XJ2A 1XJ3A 5IS1A 5HPIA 2W3HA 3V67A 4WLAA 3E98A 4KQDA 4IHQA 1H3QA 3PBOA 2XRNA 2JKTM 3NOPC 2PHYA 5IU1A 4NEED 5AJGA 3G6OA 4YOFA 2HJEA 4HP9A 4LRZE 2QKPA 5HD3A 2L4RA 1S1ZA 3C30A 2FH5A 2GX5A 1NLYA 1P97A 2WKRA 3CUEC 4WELA 4GS9A 4GW9A 1P0ZA 4JGPA 3LR0A 3KYZA 3E4QA 3LIBA 5KIZA 5HWVA 4M4XA 2HV1A 4B9OA 2H28A 4MMNA 1TS7A 2JKRM 4R38A 4LLOB 2DMWA 4HH2A 2XROA 1UWPX 4P6ZM 2ZOIA 3LYXA 5IT5A 4EQ1A 4PHTA 2KX6A 2XSSA 3GDIA 1NLZA 3KO6A 3PBQA 1T18A 1T1CA 2P04A 1YKDA 3OOVA 3SW1A 4JGOA 3W2ZA 5F68A 5CX7A 3NOTC 1LSVA 3P01A 4BBTA 4HIAA 3EGDC 3A0VA 3IBRA 3E0YA 4R6LA 5J7EA 2QHKA 3MQOA 4PKYA 3FPWA 3D3OA 5TJJA 3MFXA 3H7WA 4ETXA 3KX0X 1OT6A 3T4TA 1S4RA 4Y3IA 3UE3A 4EW7A 3H9WA 1D7EA 2FZ0A 2A24B 1ZHHB 2P7JA 2WKPA 4I3JA 4Q0JA 3MXQA 3VE3A 3BQAA 3DBAA 1GSVA 2NUPC 3F1NB 3MJQA 5HD5A 4GHIB 5HDCA 4II7A 2W1RA 4E04A 3T4JA 4IUKA 2ZMVA 4HNBA 1OT9A 3ULFA 5F6AA 3PBRA 3IS2B 3PYPA 2EWWA 2VGLM 3ZYTA 1TD5A 3EEHA 1EW0A 1H8MA 3OC2A 3VOLA 4BJPA 1BYWA 4LRXC 2YKHA 5C5KA 3BJNA 3T4SA 4WN5A 3EQUA 3T4QA 3S7OA 4MN7A 2KLIA 1GSWA 5HWTA 1Y28A 4UQIM 3BQ8A 3BW6A 2O99A 3EEAA 3KYQA 5KSHA 3P7NA 3TJZC 3B33A 3FC7A 4IUHA 3K3CA 4Q0HA 2I9VA 1MKMA 3KSFA 2L1MA 3LR3A 2HGVA 2VKSA 4HI4A 2PD7A 3FG8A 4H6JB 3K3DA 4BWIA 3T4OA 1V9ZA 5EFWA 3TW8A 4F3LB 2J3TC 1TF1A 3OCLA 4GLQA 3LIAA 4EETB 2QJ5A 4B93A 3A0RA 4MN6A 3T4LA 2J3WA 2M7VA 4OOLA 2W1TB 1LSWA 2J3TD 4O8GA 3ZQ5A 3F1PB 3LFVA 3NOUC 4FOFA 4WF0A 1LT0A 4WEKA 3F1NA 3T4KA 1G6OA 2VV8A 1DP9A 4Q0IA 3MQ0A 3CUEA 4GHIA 4HH3A 4NXFA 2V9AA 3PR6A 1ODVA 4IJGA 2GJ3A 2ZMFA 4NXBA 5AVEA 3IS2A 4I3AA 5DJUA 4BMWA 4R70A 2B02A 1W63M 2QJ7A 5AVFA 4P6ZS 4ETZA 2LB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKF A;  1KOU A;  3H82 B;  4DJ3 A;  1LSX A;  4L9F A;  3LIE A;  5HDD A;  3LUQ A;  1XFQ A;  2PD8 A;  3HJI A;  4JGR A;  3RH8 B;  3UB7 A;  2EA9 A;  2OWH A;  3UB8 A;  1NWZ A;  4EER A;  5J4E A;  1UWN X;  2CMN A;  4K08 A;  4H6J A;  1LL8 A;  4EXO A;  3PHY A;  1OTB A;  4F3L A;  4WL9 A;  1X0O A;  1G28 A;  2Z6C A;  4YWZ A;  2INW A;  1JNU A;  2VLG A;  3F1P A;  2OOL A;  1TS6 A;  4NXE A;  4BBV A;  3C8C A;  1S66 L;  2PR6 A;  3UMD A;  2JN7 A;  1F98 A;  4EEU A;  4PKY G;  5HWW A;  1MZU A;  1TS8 A;  4GS9 B;  4JGQ A;  5TBM B;  3H82 A;  3CWF A;  4I39 A;  2J80 A;  1S4S A;  3CLO A;  1OJG A;  4LRY C;  5G4Z A;  3LIF A;  5DKK A;  3NHQ A;  4L9E A;  4HP4 A;  1OTI A;  3RTY A;  5HSQ A;  2V1A A;  1N9O A;  3A0S A;  3BY8 A;  1D06 A;  4XT2 B;  1DP6 A;  2W0N A;  4GCZ A;  2PYP A;  5DKL A;  4HOI A;  4KUK A;  2ZBB A;  3VE4 A;  2K7S A;  2QWS A;  3BWL A;  1S1Y A;  2PR5 A;  2A24 A;  3F1O B;  2M1C A;  3E4O A;  3H7W B;  4L9G A;  4NXG A;  1GSX A;  3UB6 A;  3BY9 A;  4HJ4 A;  5F69 A;  2BAS A;  1XFN A;  3UE6 A;  4DJ2 A;  1DP8 A;  4HY8 A;  1VB6 A;  1WA9 A;  5DJT A;  2V0W A;  4EEP A;  1XJ4 A;  2V0U A;  5TBM A;  2L0W A;  4RQ9 A;  4HJ3 A;  2V1B A;  1DRM A;  2VEA A;  3GEC A;  4HJ6 A;  3C2W A;  2PDR A;  4XT2 A;  2D02 A;  3D72 A;  3MQQ A;  5G4Y A;  4HHD A;  2R78 A;  3LI9 A;  1OTE A;  1XJ6 A;  1N9N A;  1T1B A;  1T1A A;  3T50 A;  4LPZ A;  2ZOH A;  3F1O A;  3UME A;  3LIC A;  5HDS A;  3CAX A;  2OWJ A;  1OJ5 A;  2WKQ A;  3ICY A;  2D01 A;  3LID A;  3LI8 A;  4R3A A;  5A8B A;  3E4P A;  2Z6D A;  5HZH A;  4BBU A;  1OTD A;  4WUJ A;  3EWK A;  5F5Y A;  4I3I A;  4I38 A;  2VV7 A;  2VV6 A;  3OLO A;  1OTA A;  3HJK A;  1N9L A;  1V9Y A;  2PYR A;  4HQA A;  4EES A;  2JHE A;  2W27 A;  2KDK A;  4MN5 A;  1TS0 A;  3NJA A;  1UGU A;  5J3W A;  1S67 L;  1T19 A;  1F9I A;  4I5S A;  3MR0 A;  4KUO A;  5I5L A;  3UB9 A;  1XJ2 A;  1XJ3 A;  5IS1 A;  4WLA A;  4KQD A;  3NOP C;  2PHY A;  5IU1 A;  3G6O A;  4HP9 A;  4LRZ E;  2QKP A;  5HD3 A;  2L4R A;  1S1Z A;  1P97 A;  2WKR A;  4GS9 A;  4GW9 A;  1P0Z A;  4JGP A;  3E4Q A;  3LIB A;  5KIZ A;  5HWV A;  4M4X A;  2HV1 A;  4B9O A;  2H28 A;  1TS7 A;  4R38 A;  4LLO B;  4HH2 A;  1UWP X;  2ZOI A;  3LYX A;  4EQ1 A;  2KX6 A;  3GDI A;  1T18 A;  1T1C A;  3SW1 A;  4JGO A;  5F68 A;  3NOT C;  1LSV A;  4BBT A;  4HIA A;  3A0V A;  3IBR A;  4R6L A;  5J7E A;  2QHK A;  3MQO A;  4PKY A;  3MFX A;  3H7W A;  3KX0 X;  1OT6 A;  1S4R A;  4EW7 A;  3H9W A;  1D7E A;  2A24 B;  2P7J A;  2WKP A;  4I3J A;  3MXQ A;  3VE3 A;  1GSV A;  3F1N B;  3MJQ A;  5HD5 A;  4GHI B;  5HDC A;  4E04 A;  4HNB A;  1OT9 A;  3ULF A;  5F6A A;  3IS2 B;  3PYP A;  3EEH A;  1EW0 A;  3VOL A;  1BYW A;  4LRX C;  2YKH A;  4WN5 A;  1GSW A;  5HWT A;  1Y28 A;  3P7N A;  3B33 A;  3FC7 A;  3K3C A;  2I9V A;  2L1M A;  4HI4 A;  2PD7 A;  3FG8 A;  4H6J B;  3K3D A;  1V9Z A;  5EFW A;  4F3L B;  4EET B;  3LIA A;  2QJ5 A;  3A0R A;  4MN6 A;  1LSW A;  3ZQ5 A;  3F1P B;  3NOU C;  4WF0 A;  1LT0 A;  3F1N A;  2VV8 A;  1DP9 A;  4GHI A;  4HH3 A;  4NXF A;  2V9A A;  1ODV A;  2GJ3 A;  4NXB A;  5AVE A;  3IS2 A;  4I3A A;  5DJU A;  4R70 A;  2B02 A;  2QJ7 A;  5AVF A; 
#chains in the Genus database with same CATH topology
 2YKF A;  3ISG A;  4DJ3 A;  2PRF A;  4CLC B;  2W3E A;  4KQO A;  1IYP A;  5FDS A;  2PD8 A;  3ZVT A;  4XUZ A;  2EA9 A;  5CXW A;  2FFF B;  3CPT A;  3UB5 P;  4ARZ B;  3KSG A;  5J4E A;  1Z09 A;  1H5X A;  2OAQ 1;  1PI5 A;  3S4X A;  2XLN A;  4EXO A;  4OQH A;  2BLS A;  3RFB A;  2Y2N A;  3U2A A;  3FZC A;  3BM6 A;  2FFY A;  1HVB A;  5CTM A;  3NBL A;  3HUN A;  2ZC6 B;  2W1T A;  3Q7V B;  2INW A;  3OPL A;  1JNU A;  2VLG A;  1K56 D;  2OOL A;  3WS1 A;  4LV0 A;  3MXR A;  4NXE A;  4OON A;  4JXW A;  2EXB A;  3UMD A;  2PU4 A;  5HWW A;  4KZ8 A;  1MBL A;  4LEN A;  4QJG A;  3RXW A;  3V39 A;  3DWK A;  4RA7 A;  4PM7 A;  4UA9 A;  2IWD A;  4S2M A;  1PW8 A;  4NET A;  3UE1 A;  3CLO A;  1QMF A;  3LIF A;  1ZTU A;  1H8Y A;  1G68 A;  1MWR A;  5HSQ A;  5TGF A;  4WYY A;  3A0S A;  3OPR A;  2WGW A;  2QWS A;  2WKH A;  2Z2M B;  1XGJ A;  4X53 A;  2PR5 A;  3C38 A;  3BFC A;  3IXH A;  1P9W A;  3UNW A;  1Y54 A;  1KDW A;  5D3O A;  2QYB A;  4R4S A;  3L7H A;  2DNS A;  3MF0 A;  2BAS A;  1ERO A;  4O7D A;  4JPM A;  2ACG A;  4PM9 A;  4EEP A;  4QWO A;  5FSR A;  2QZ6 A;  4K91 A;  4OP8 A;  1L0E A;  1K38 A;  5TBM A;  4G3W A;  3BRM A;  4ZRR A;  1LI9 A;  2P9V A;  2Y2P A;  4K0X A;  2W3G A;  5DFX A;  5DF9 A;  3CJM A;  1BSG A;  2V2F F;  4X56 A;  3ZDJ A;  2Y4A A;  4E3I A;  4HJ6 A;  1CI8 A;  4UEY A;  2B18 A;  4KZ3 A;  3MQQ A;  4R0Q A;  1K55 C;  2R78 A;  1N9N A;  1RCJ A;  1T1B A;  2XA7 S;  2PBY A;  3WS0 A;  1VET B;  5DF8 A;  3IH9 A;  3F1O A;  5FQM A;  1VHM A;  1BLS A;  4R1G A;  1TDG A;  1K4E A;  4L0L A;  2CC1 A;  1BZA A;  2HDS A;  1MC0 A;  1ZG4 A;  4JLF A;  1G5U A;  3ZNY A;  2JCH A;  3NIA A;  2ZC5 B;  1NYY A;  3ZG8 B;  3LID A;  2ZJ9 A;  2PT7 A;  1IEL A;  3T1X A;  2HP5 A;  1IFQ A;  2MJ6 A;  4KZ7 A;  3G4P A;  5HPF A;  4S2O A;  4Y0U A;  4E3J A;  1CEG A;  4I3I A;  1OPX A;  3D9Y A;  3WS5 A;  3FWL A;  2R9X A;  2KOI A;  2EXA A;  3IBJ A;  2P08 A;  1S0W A;  4HQA A;  4YNR A;  4EES A;  2JHE A;  3N8R A;  4H8R A;  3O5Y A;  3O86 A;  5AQA A;  4OLD A;  2ZL1 B;  3IWI A;  3HLD A;  1PZP A;  2Y2H A;  1XJ3 A;  5L10 A;  5IS1 A;  3MKE A;  4KQD A;  3DTE A;  2BTF P;  4MBK A;  5EEC A;  4NEE D;  4YOF A;  1ERQ A;  3IX4 A;  2Q0O A;  4EQI A;  4LRZ E;  2EFX A;  5KZH A;  1LL9 A;  1A0K A;  4UAA A;  1JWZ A;  1ZG6 A;  4GS9 A;  1WYC A;  4GW9 A;  4IBX A;  4EV4 A;  5A93 A;  2XFS A;  3KYZ A;  5KIZ A;  2HV1 A;  1NZU A;  2JKR M;  1CJF A;  1SHV A;  1SKO B;  5CHM A;  2ZMA A;  3CZD A;  4EUZ A;  3GDI A;  4X1L A;  3KO6 A;  3SOI A;  4U0X A;  3FKW A;  1YKD A;  3OOV A;  5FQQ A;  5CX7 A;  4BQM A;  3NOT C;  4MLL A;  1FR1 A;  4KEN B;  3QP1 A;  3A0V A;  3IBR A;  4R6L A;  5J7E A;  3MQO A;  4ZTK A;  1K54 C;  1LHY A;  3KX0 X;  2JBF A;  5E2E A;  1S4R A;  4DE1 A;  1ZHH B;  5M1A A;  4JBF A;  3BQA A;  3DBA A;  3C7V A;  3G30 A;  3MJQ A;  3G2Y A;  4KG2 A;  5HD5 A;  4GHI B;  3IX3 A;  3QNB A;  1E25 A;  2ZMV A;  3QNC A;  3GVB A;  4HNB A;  4OQG A;  3TG9 A;  1NYM A;  3IS2 B;  1YLP A;  3PYP A;  4U3T A;  2EWW A;  1IYQ A;  3ZYT A;  4JF5 A;  3IXB A;  5EVI C;  1KGG A;  4LRX C;  5C5K A;  3Q81 A;  4WN5 A;  3S7O A;  2WYX A;  4PM5 A;  4N1X A;  2EX2 A;  1ALQ A;  1SCW A;  3EEA A;  5E43 A;  3T1Q B;  3K3C A;  2J9O A;  4ZJ3 A;  4DKI A;  3LR3 A;  1FIL A;  3IF5 A;  1K57 A;  2X71 A;  1WE4 A;  3QP5 A;  4LV1 A;  4BWI A;  5EOO A;  2WAD A;  3M6H A;  4ZDX A;  4S2J A;  2HZ5 A;  1S6R A;  2J3W A;  4KZ5 A;  5F1G A;  3ZQ5 A;  1DJA A;  3LFV A;  4GD6 A;  3F1N A;  3T4K A;  3LO7 A;  4Q0I A;  2C5W B;  4QB8 A;  3CUE A;  3S1Y A;  4PM6 A;  1VEU B;  2UWX A;  3UY6 A;  2XK1 A;  3A3J A;  1C3B A;  5DJU A;  2Y2Q A;  2QJ7 A;  4X1M A;  1L0F A;  2LB5 A;  3OPH A;  1BTL A;  5FI6 A;  1LSX A;  3Q1F A;  4L9F A;  3LIE A;  2A3U A;  3MZD A;  1AWI A;  3LUQ A;  3NY4 A;  1XFQ A;  2HPB A;  3HJI A;  4JXG A;  2HDQ A;  1FQG A;  3P09 A;  4BL2 A;  1UWN X;  4K08 A;  1KVL A;  1YSP A;  4H6J A;  1LL8 A;  2XR0 A;  3PHY A;  4WM9 A;  4WMC A;  5CTN A;  4YWZ A;  3BYD A;  3UPO A;  5E2F A;  4A5R A;  2ZLY A;  3PAE A;  1ONH A;  3F1P A;  4MBH A;  3DWZ A;  2Y79 A;  3B42 A;  3U4L P;  2NUT C;  4BBV A;  3QP6 A;  4GDB A;  3C8C A;  4OOY A;  3IWQ A;  2PR6 A;  5DFY A;  2VGL S;  4EEU A;  5CGS A;  1PWC A;  4GS9 B;  5CGW A;  3H82 A;  4CQH A;  3CWF A;  4HEF A;  3UDI A;  1SDN A;  2J80 A;  4ZBE A;  4F94 A;  1S4S A;  1IYO A;  1JWP A;  1OJG A;  5G18 A;  5G4Z A;  3PXP A;  4N1H A;  4HP4 A;  1OTI A;  4GJ4 A;  2Y2M A;  3W4Q A;  1KGF A;  1IOU A;  1FSY A;  1XPB A;  4WZ4 A;  4FCF A;  5DKL A;  4BL3 A;  4EU0 A;  3WRT A;  3BWL A;  2PU2 A;  3PBN A;  4Y13 A;  2A24 A;  3O3V A;  3UN7 A;  1GSX A;  2WAE A;  3HLG A;  1KVM A;  2G2W A;  4N9K A;  5F69 A;  1K4F A;  1J3W A;  5HAI A;  3T12 B;  3S22 A;  3SS5 A;  1WA9 A;  5DJT A;  4M3K A;  3HCY A;  3BEB A;  2V0U A;  2PBD P;  1YLJ A;  1BLP A;  1W79 A;  2L0W A;  5HW3 A;  1N9B A;  4RQ9 A;  2Y2I A;  4E3M A;  4HJ3 A;  1M40 A;  3UDX A;  3ZG9 B;  1PI4 A;  3I7J A;  5DTS A;  3FV7 A;  2V1B A;  5GLD A;  1DRM A;  3DAV A;  1RP5 A;  3TRC A;  1PZO A;  4XT2 A;  2D02 A;  4Q8I A;  3D72 A;  5G4Y A;  4X25 A;  3IHB A;  3PAG A;  2OLU A;  1XA1 A;  5I94 A;  1OTE A;  5CEC A;  1BLH A;  3T50 A;  4LPZ A;  2V8F A;  2ZM2 A;  5HDS A;  3CAX A;  4RVA A;  4ZAM A;  2VJW A;  3IXD A;  1NRJ A;  1FCO A;  4DE2 A;  1PWG A;  1YAX A;  1K0K A;  3IHA A;  1CQA A;  3LY4 A;  4MCW A;  4MDZ A;  1YSQ A;  3EOI A;  2Z6D A;  5HZH A;  4ZJ2 A;  4O01 A;  1MWS A;  2WKE A;  2VV7 A;  3HLE A;  5U47 A;  1V9Y A;  2PYR A;  3AGE A;  3R7W A;  3HUM A;  3CI6 A;  5KMW A;  1MWU A;  5TR7 A;  3QP4 A;  5LBR A;  1UGU A;  4OPZ A;  2M7U A;  1T19 A;  1F9I A;  4XXR A;  3ZCZ A;  1KDS A;  3UB9 A;  2VGJ A;  5HPI A;  4WLA A;  4IHQ A;  4LGW A;  5HL1 A;  2XRN A;  5IU1 A;  5AJG A;  2HJE A;  4HP9 A;  4OH0 A;  2QKP A;  1GA9 A;  1S1Z A;  3ZHH A;  1U60 A;  1NLY A;  4JXV A;  1P97 A;  2ZQ8 A;  3AGD A;  4HES A;  1SKF A;  3VOY A;  1I2S A;  4JGP A;  3LR0 A;  3LIB A;  4GB7 A;  4M4X A;  5DTK A;  2WAF A;  2H28 A;  4MMN A;  4R38 A;  4LLO B;  5EVE A;  2XRO A;  1I2W A;  1UWP X;  1KE0 A;  3NDE A;  4P87 A;  2ZOI A;  3LYX A;  4PHT A;  3WRZ A;  2KX6 A;  1NLZ A;  2WZX A;  4RYE A;  3V3S A;  4LV3 A;  2G2U A;  2WZZ A;  1NXY A;  1E3U A;  2WK0 A;  3SW1 A;  3VP0 A;  1IKG A;  1G6A A;  1LSV A;  4BBT A;  4HIA A;  3EGD C;  3G35 A;  3E0Y A;  3LGO A;  4C3Q A;  1GHI A;  2QHK A;  1GHP A;  1O7E A;  1K55 A;  3FPW A;  1Y4O A;  3QP2 A;  4N9L A;  1ES2 A;  5TJJ A;  3BFG A;  5FQI A;  4ETX A;  1OT6 A;  3M6B A;  1YLY A;  3T4T A;  4UHU A;  3H9W A;  2A24 B;  4EBN A;  1YMX A;  1FOF A;  4Q0J A;  3VSL A;  1XX2 A;  3ZGA B;  1GSV A;  4R3J A;  3IWO A;  3RJU A;  3IF6 B;  5CRF A;  2W1R A;  2ZC3 B;  3T4J A;  3BFF A;  4IUK A;  4Y0T A;  3TSG A;  2VGL M;  1TVF A;  4S2N C;  1TD5 A;  3CHW P;  4KQR A;  2DRW A;  3EQU A;  3IT9 A;  1L0D A;  4EWF A;  2Y2G A;  5HWT A;  1YPR A;  5L2F A;  1ESU A;  1ZC2 A;  2Z2L B;  3P7N A;  3TJZ C;  5KSH A;  3FC7 A;  3CPT B;  4E6X A;  1MKM A;  2L1M A;  3G2Z A;  2AVX A;  2HGV A;  4B4X A;  3GV9 A;  5EV0 A;  4IED A;  4OPY A;  3C7U A;  1V9Z A;  2XH9 A;  4S2L A;  2H10 A;  4GLQ A;  3LIA A;  2QJ5 A;  3UPN A;  3T4L A;  4OOL A;  2W1T B;  5EPH A;  4O8G A;  3ZFZ A;  3NOU C;  1TDL A;  2Y2L A;  4WF0 A;  3N6I A;  4NXF A;  3NEC A;  1ODV A;  1NY0 A;  2RCX A;  2GJ3 A;  1MPL A;  5FI7 A;  2ZMF A;  4Z9Q A;  2JKG A;  2OSU A;  5GLC A;  1VQQ A;  4R70 A;  5EM1 A;  1W63 M;  5AVF A;  4P6Z S;  2Y2J A;  3ZG7 B;  4ETZ A;  3W8K A;  3HLB A;  2J8Y A;  2A2L A;  3L9K A;  4DE0 A;  5FAS A;  1I5Q A;  1CK3 A;  4UA7 A;  2I72 A;  5E2H A;  2OAP 1;  3UB7 A;  2OWH A;  3UB8 A;  3LR4 A;  3UO9 A;  1W63 Q;  1N4O A;  1NJ4 A;  3ITA A;  4QHC A;  1W5D A;  1KE3 A;  4YIN A;  1K54 A;  1F5M A;  5CEB A;  2UV0 E;  1K25 A;  4QU3 A;  2WGW B;  1JWV A;  1MY8 A;  2Y91 A;  4WBG A;  4IBR A;  3ZG5 A;  1OTB A;  4F3L A;  4WL9 A;  1X0O A;  1G28 A;  3HL9 A;  5FL3 A;  3FPV A;  3DTM A;  3BEC A;  5JYP A;  4MNR A;  3CIT A;  5L07 A;  3P98 A;  3IX8 A;  2EX8 A;  3A3F A;  5FQ9 A;  4P6B A;  2O0Y A;  4G3K A;  1MZU A;  1SDE A;  1TS8 A;  2VGK A;  1STZ A;  5A92 A;  4UA6 A;  5EVI A;  1LI0 A;  5TBM B;  1KE4 A;  5JYO A;  2P9V B;  3NI9 A;  3JVV A;  4CLC A;  3SH9 A;  5DF7 A;  1W8Y A;  1OME A;  2P74 A;  2V20 A;  3DW0 A;  4FSF A;  2JKR I;  3ZNT A;  4EBP A;  5K5B A;  1FSW A;  5DKK A;  2J7V A;  3NHQ A;  4ARZ A;  4Y5F A;  4L9E A;  4EUV A;  2V1A A;  4DMZ A;  1N9O A;  5TFQ A;  3CG5 A;  1FCN A;  5F83 A;  2K2N A;  4HOI A;  2ZBB A;  1IKI A;  2O9A A;  3VE4 A;  2W3F A;  4OPQ A;  3N7W A;  5FI2 A;  1S1Y A;  1K57 C;  2E8J A;  3F1O B;  4R4R A;  2ZQ7 A;  5EE8 A;  4L9G A;  5GHZ A;  3HUO A;  2HF6 A;  2B5R A;  2XEP A;  1HZO A;  4JF4 A;  4X55 A;  1ONG A;  4IVI A;  3GMW A;  1DP8 A;  2GNX A;  4HY8 A;  4DRT A;  3MKF A;  1PW1 A;  2ZQC A;  3LY3 A;  3E2K A;  1HTZ A;  3R4K A;  1PRQ A;  3QP8 A;  3VP2 A;  3WWX A;  4DN0 A;  1XXM A;  5FAO A;  3KSI A;  4Z1W A;  2HP6 A;  2VEA A;  1J9M A;  3GEC A;  4OVD A;  5CER A;  2O9C A;  1PWD A;  2PAV P;  1DJC A;  3LI9 A;  4LV2 A;  1XJ6 A;  2XA7 M;  2ZC7 A;  4ME4 A;  3MZF A;  4KZB A;  4PM8 A;  3VP4 A;  1ES5 A;  4N92 A;  1OJ5 A;  2HDR A;  2ZM0 A;  3ICY A;  2O9B A;  2VX8 A;  2JKT I;  3A3E A;  2LB9 A;  5M18 A;  4QD4 A;  2WGV A;  5HFO A;  1PYY A;  4E6W A;  3HBR A;  3LI8 A;  1Q2P A;  5FEF A;  3VFH A;  3E4P A;  5AQ7 A;  4BBU A;  2EWV A;  1TEM A;  2JKF A;  2IWB A;  4WUJ A;  4MBF A;  5E2G A;  4DXC A;  3LR5 A;  5F5Y A;  3PBS A;  1LLB A;  5MC7 A;  4S2I A;  4BD1 A;  3VSK A;  1OTA A;  4CPK A;  2Y8H A;  3HJK A;  1N9L A;  1XKZ A;  1MXO A;  2W27 A;  3O88 A;  2KDK A;  1TS0 A;  3D4F A;  2VZW A;  3NJA A;  4CLC D;  3C5A A;  4I5S A;  4OOM A;  3MR0 A;  3JVU A;  1VET A;  3V67 A;  1K6R A;  3E98 A;  3LEZ A;  4WZ5 C;  1H3Q A;  5FQJ A;  1XA7 A;  3G6O A;  3NCK A;  2V8C A;  1HD8 A;  3MXS A;  5HD3 A;  2L4R A;  3C30 A;  2X01 A;  3IF6 C;  4WEL A;  3A3I A;  4LCM A;  5EUA A;  2XDM A;  2OV5 A;  5J8X A;  2DMW A;  4HBU A;  4HH2 A;  4P6Z M;  3V5M A;  2J9P A;  3A3D A;  2X02 A;  4EQ1 A;  4P0M A;  3UE0 A;  3VMA A;  3PBQ A;  4B4Z A;  1T1C A;  3DTK A;  1YLZ A;  4JGO A;  4JXS A;  3W2Z A;  5F68 A;  3HLF A;  2WUQ A;  1JTD A;  1CEF A;  5GHY A;  4JF6 A;  2OLV A;  4DDY A;  2HP9 A;  3AGF A;  4KZ6 A;  3MFD A;  2ZL1 A;  3WS2 A;  3SH7 A;  2A49 A;  3D3O A;  3MFX A;  3H7W A;  4KZA A;  5A90 A;  3M2K A;  4QY5 A;  2ZQD A;  5GLB A;  4GZB A;  4EW7 A;  2FZ0 A;  2IWC A;  4I3J A;  3MXQ A;  2XGN A;  4WMC D;  3VE3 A;  2NUP C;  3CMZ A;  3F1N B;  4BEN A;  5IHV A;  4KZ4 A;  4D60 A;  2XQZ A;  5HAR A;  2QMI A;  3Q82 A;  5DTT A;  3HVF A;  1SKO A;  3OC2 A;  3VOL A;  1YQS A;  4MEZ A;  3SH8 A;  1BYW A;  4E3O A;  3BJN A;  3T4Q A;  4FH4 A;  5A91 A;  3GR2 A;  3M2J A;  3W4O A;  1MWT A;  1Y28 A;  2XF3 A;  5FDH A;  4GD8 A;  4R3B A;  1L3L A;  3UDF A;  2O99 A;  4C75 A;  3B33 A;  4IUH A;  5GHX A;  3KSF A;  2Y2O A;  1XP4 A;  2VKS A;  4HI4 A;  2V1Z A;  2PD7 A;  3FG8 A;  4H6J B;  3K3D A;  3B3X A;  1GCE A;  5EFW A;  3TW8 A;  4GDN A;  1FIK A;  3G34 A;  3TOI A;  3OCL A;  4EET B;  3O87 A;  4B93 A;  3A0R A;  4MN6 A;  4OP5 A;  4RX2 A;  2J3T D;  3F1P B;  1LT0 A;  1H0M A;  1VM1 A;  3ZVW A;  3MQ0 A;  4GHI A;  3N8L A;  1BLC A;  4IJG A;  1RGY A;  4E3L A;  5AVE A;  3IS2 A;  4I3A A;  2B02 A;  1JTG A;  2EX6 A;  4Y17 A;  1KOU A;  3H82 B;  3JYI A;  2ZQA A;  1IYS A;  3SS4 A;  5HAP A;  2WGI A;  5HDD A;  3Q07 A;  3WS4 A;  4NK3 A;  5CGX A;  3HLW A;  3RH8 B;  4JGR A;  1MKI A;  1NZO A;  2Y2K A;  1NWZ A;  4EER A;  3FYZ A;  5L09 A;  3ZG0 A;  1L2S A;  2CMN A;  2Y55 A;  4BD0 A;  4PAU A;  5L8M A;  4YFM A;  3K2N A;  4ZJ1 A;  2Z6C A;  2HDU A;  3EGX C;  2XD1 A;  4NG2 A;  4EBL A;  5DVA A;  4B88 A;  4AFI A;  4IVK A;  1TS6 A;  1JVJ A;  4X6T A;  2W3D A;  1VEU A;  4X68 A;  2Q9N A;  3GSG A;  1S66 L;  4K0W A;  3EQV A;  4QPR A;  1YM1 A;  2H5S A;  2JN7 A;  2G7U A;  1F98 A;  1M6K A;  4S2N A;  3NUL A;  4PKY G;  4JGQ A;  1Q2Q A;  4HBT A;  2K31 A;  4I39 A;  3OZH A;  2GDN A;  4UQI S;  4S2P A;  4LRY C;  3V50 A;  4KG6 A;  3GTC A;  3OCN A;  1ZKJ A;  1HLU P;  4D2O A;  4Y7P A;  3RTY A;  2IA2 A;  3MSH A;  3BY8 A;  1D06 A;  4XT2 B;  1DP6 A;  2W0N A;  4GCZ A;  1K6S A;  2PYP A;  4KUK A;  3KSH A;  4DXB A;  1ESI A;  2K7S A;  4ESP A;  1F2K A;  3E2L A;  4CJN A;  4WEJ A;  5FAQ A;  3SZT A;  3BLM A;  2E8I A;  3G32 A;  2M1C A;  3E4O A;  3H7W B;  4PPR A;  4NXG A;  3UB6 A;  3BY9 A;  3PBT A;  4XUX A;  3VV4 A;  4HJ4 A;  3T1S A;  1FCM A;  3QHY A;  4P85 A;  1CF0 A;  1XFN A;  3UE6 A;  4E3K A;  4DJ2 A;  1VB6 A;  3S7Q A;  2V0W A;  3VFF A;  2JE5 A;  1DY6 A;  1XJ4 A;  3OPP A;  3G31 A;  3N8S A;  4OQI A;  2GZA A;  3MMH A;  3SS3 A;  2HJ9 C;  5EM0 A;  1ERM A;  1PNE A;  5FAT A;  4GN2 A;  3MZE A;  3S7N A;  1BUE A;  2EX9 A;  2ZD8 A;  5F82 A;  3R7W B;  3C4O A;  3JPU A;  1GA0 A;  3C2W A;  2PDR A;  5AQ9 A;  3Q7Z A;  1E3U D;  1WYB A;  4HHD A;  5CHJ A;  3TE8 A;  4GOG A;  4PMA A;  2DCF A;  3MS6 A;  1EI5 A;  1T1A A;  3UME A;  2ZOH A;  4CLC E;  3LIC A;  1DJB A;  2EFU A;  4KQQ A;  2OWJ A;  2WKI A;  2ZQ9 A;  2WKQ A;  4RX3 A;  1YMS A;  5HL6 A;  3DTI A;  4NKP A;  4U0T A;  1P9R A;  3S7P A;  3T1R A;  3FKV A;  2D01 A;  1L0G A;  4ID4 A;  4G3V A;  4E3N A;  4R3A A;  3HRE A;  1W7F A;  4Y0O A;  5A8B A;  3RXX A;  1OTD A;  5CED A;  3KYE A;  2VA0 A;  3EWK A;  4Y2F A;  3BFE A;  4DDS A;  1D1J A;  4I38 A;  2QPN A;  2VV6 A;  3OBF A;  3HLC A;  3OLO A;  4O0P A;  4BLM A;  4S2K A;  3B47 A;  4CLC C;  5AQB A;  3NC8 A;  1EWZ A;  4MN5 A;  4FD8 A;  4C6Y A;  3LEQ A;  5J3W A;  1S67 L;  1PFL A;  4KUO A;  5I5L A;  5EOE A;  1XJ2 A;  3Q7V A;  4DE3 A;  2H0Y A;  4QY6 A;  2W3H A;  1YLW A;  3IXG A;  3VP3 A;  5GL9 A;  1AXB A;  3PBO A;  2JKT M;  3NOP C;  2PHY A;  4DF6 A;  1ACF A;  4OLG A;  2FH5 A;  2GX5 A;  1QME A;  1ES4 A;  2WKR A;  3CUE C;  1XGI A;  5KSC A;  1P0Z A;  2BG1 A;  3E4Q A;  5HWV A;  1YLT A;  4B9O A;  1TS7 A;  3VP1 A;  5FQK A;  5IT5 A;  2XSS A;  1BUL A;  1IEM A;  1LL5 A;  1T18 A;  2P04 A;  5M19 A;  3P01 A;  4GNU A;  5HAQ A;  4Y15 A;  1CI9 A;  4PKY A;  4R23 A;  1PIO A;  1K56 A;  1E4D A;  5CHU A;  4OKP A;  1Z6F A;  4OQ0 A;  3V3R A;  4OPR A;  2Y59 A;  3GQZ A;  1ES3 A;  2ZM8 A;  4Y3I A;  3UE3 A;  5FA7 A;  1D7E A;  2XFT A;  3GRJ A;  2P7J A;  2JC7 A;  2WKP A;  3ITB A;  2R9W A;  5HDC A;  4II7 A;  4E04 A;  4FTX A;  5BOH A;  1OT9 A;  3IH8 A;  3ULF A;  5F6A A;  3PBR A;  4LCL A;  3LCE A;  1W8Q A;  1H8Z A;  4GKU A;  1FR6 A;  3EEH A;  1EW0 A;  3VOZ A;  1H8M A;  4JKT A;  3NDG A;  4BJP A;  2YKH A;  4FUW A;  3T4S A;  3W4P A;  4FH2 A;  5EVI D;  4MN7 A;  2KLI A;  1GSW A;  2B95 A;  4UQI M;  3BQ8 A;  1NRF A;  3BW6 A;  3UPP A;  3KYQ A;  4Q0H A;  3PTE A;  3IQA A;  1RGZ A;  2I9V A;  5FAP A;  1YT4 A;  5GLA A;  2RL3 A;  1BT5 A;  4KZ9 A;  5FEG A;  2H0T A;  5EVL A;  3T4O A;  2ZC4 B;  4KG5 A;  4X69 A;  1GHM A;  4F3L B;  2J3T C;  4WZ5 A;  1TF1 A;  5HX9 A;  2M7V A;  3BFD A;  1LSW A;  3N4I A;  3C4P A;  4FOF A;  2C6W B;  4WEK A;  1G6O A;  2VV8 A;  1DP9 A;  1KGE A;  5F1F A;  3IF6 A;  4HH3 A;  2V9A A;  3PR6 A;  1SZV A;  2VK3 A;  1O07 A;  2XD5 A;  3BLS A;  4NXB A;  4BMW A;  4LFU A;  5EVI B;  3MBZ A;  2Q9M A; 
#chains in the Genus database with same CATH homology
 2YKF A;  1KOU A;  3H82 B;  4DJ3 A;  2A2L A;  1LSX A;  4CLC B;  4L9F A;  3LIE A;  5HDD A;  2W3E A;  4KQO A;  3LUQ A;  1XFQ A;  2PD8 A;  2OAP 1;  3HJI A;  4JGR A;  3RH8 B;  3UB7 A;  2EA9 A;  2OWH A;  3UB8 A;  3LR4 A;  4ARZ B;  1NWZ A;  1W63 Q;  3KSG A;  4EER A;  5J4E A;  1UWN X;  2OAQ 1;  2CMN A;  4K08 A;  1F5M A;  1YSP A;  4H6J A;  1LL8 A;  4EXO A;  4PAU A;  3RFB A;  5L8M A;  3U2A A;  3PHY A;  1OTB A;  4F3L A;  3K2N A;  4WL9 A;  1X0O A;  1G28 A;  2Z6C A;  4YWZ A;  3EGX C;  2W1T A;  5FL3 A;  2INW A;  1JNU A;  2VLG A;  3F1P A;  2OOL A;  3FPV A;  2Y79 A;  3B42 A;  4AFI A;  1TS6 A;  3CIT A;  2NUT C;  4NXE A;  2W3D A;  4BBV A;  3C8C A;  1S66 L;  3EQV A;  4QPR A;  2PR6 A;  5DFY A;  3UMD A;  2VGL S;  2JN7 A;  2G7U A;  2O0Y A;  1F98 A;  4EEU A;  4G3K A;  4PKY G;  5HWW A;  1MZU A;  1TS8 A;  1STZ A;  4GS9 B;  4JGQ A;  5TBM B;  3H82 A;  2K31 A;  4CQH A;  3CWF A;  4I39 A;  3JVV A;  4CLC A;  2J80 A;  4UQI S;  1S4S A;  3CLO A;  4FSF A;  1OJG A;  4LRY C;  2JKR I;  5K5B A;  5G4Z A;  3LIF A;  3PXP A;  1ZTU A;  5DKK A;  3OCN A;  3NHQ A;  4ARZ A;  4Y5F A;  4L9E A;  4HP4 A;  4EUV A;  1OTI A;  4GJ4 A;  3RTY A;  5HSQ A;  2IA2 A;  2V1A A;  4DMZ A;  1N9O A;  3A0S A;  3BY8 A;  1IOU A;  1D06 A;  4XT2 B;  1DP6 A;  2W0N A;  4GCZ A;  2PYP A;  5DKL A;  2K2N A;  4HOI A;  4KUK A;  3KSH A;  2ZBB A;  2O9A A;  4EU0 A;  3VE4 A;  2W3F A;  2K7S A;  2QWS A;  3BWL A;  1S1Y A;  3C38 A;  2PR5 A;  3PBN A;  2A24 A;  1P9W A;  4WEJ A;  3F1O B;  2M1C A;  3E4O A;  3H7W B;  4L9G A;  4NXG A;  1GSX A;  3UB6 A;  2QYB A;  3BY9 A;  3PBT A;  2HF6 A;  3VV4 A;  3MF0 A;  4HJ4 A;  5F69 A;  2BAS A;  1XFN A;  3UE6 A;  4DJ2 A;  1DP8 A;  2GNX A;  4HY8 A;  1VB6 A;  1WA9 A;  3S7Q A;  5DJT A;  2V0W A;  4EEP A;  1XJ4 A;  3HCY A;  2V0U A;  5TBM A;  4G3W A;  2GZA A;  3R4K A;  4ZRR A;  3MMH A;  2L0W A;  2HJ9 C;  4RQ9 A;  2W3G A;  5DFX A;  5DF9 A;  4DN0 A;  4HJ3 A;  3KSI A;  3S7N A;  4Z1W A;  2V1B A;  1DRM A;  2VEA A;  3R7W B;  3GEC A;  4HJ6 A;  3C2W A;  2PDR A;  3TRC A;  4UEY A;  2B18 A;  2O9C A;  4XT2 A;  2D02 A;  3D72 A;  3MQQ A;  5G4Y A;  4HHD A;  2R78 A;  3LI9 A;  1OTE A;  3TE8 A;  1XJ6 A;  1N9N A;  2XA7 M;  4ME4 A;  1T1B A;  2XA7 S;  1T1A A;  3T50 A;  4LPZ A;  2ZOH A;  3F1O A;  1VHM A;  3UME A;  4CLC E;  3LIC A;  5HDS A;  3CAX A;  2OWJ A;  1OJ5 A;  4L0L A;  2WKQ A;  3ICY A;  2O9B A;  1MC0 A;  2VX8 A;  2JKT I;  5HL6 A;  2LB9 A;  4NKP A;  2VJW A;  1P9R A;  1NRJ A;  3S7P A;  1YAX A;  2D01 A;  3LID A;  3LI8 A;  4G3V A;  2PT7 A;  4R3A A;  4MCW A;  4MDZ A;  1YSQ A;  1IFQ A;  5A8B A;  3E4P A;  2MJ6 A;  3EOI A;  2Z6D A;  5HZH A;  4BBU A;  1OTD A;  2EWV A;  5HPF A;  4O01 A;  4WUJ A;  2VA0 A;  3EWK A;  4Y2F A;  3LR5 A;  5F5Y A;  3PBS A;  4I3I A;  4I38 A;  1OPX A;  2VV7 A;  5MC7 A;  2VV6 A;  3OBF A;  3OLO A;  2KOI A;  4O0P A;  1OTA A;  3IBJ A;  2Y8H A;  3HJK A;  1N9L A;  2P08 A;  3B47 A;  1V9Y A;  2PYR A;  4CLC C;  3R7W A;  4HQA A;  4YNR A;  4EES A;  2JHE A;  2W27 A;  3CI6 A;  2KDK A;  3O5Y A;  4MN5 A;  1TS0 A;  2VZW A;  5LBR A;  3NJA A;  4CLC D;  1UGU A;  2M7U A;  5J3W A;  1S67 L;  1T19 A;  1F9I A;  4I5S A;  4OOM A;  3MR0 A;  4KUO A;  5I5L A;  3JVU A;  3UB9 A;  1XJ2 A;  1XJ3 A;  5IS1 A;  5HPI A;  2W3H A;  3V67 A;  4WLA A;  3E98 A;  4KQD A;  4IHQ A;  1H3Q A;  3PBO A;  2XRN A;  2JKT M;  3NOP C;  2PHY A;  5IU1 A;  4NEE D;  5AJG A;  3G6O A;  4YOF A;  2HJE A;  4HP9 A;  4LRZ E;  2QKP A;  5HD3 A;  2L4R A;  1S1Z A;  3C30 A;  2FH5 A;  2GX5 A;  1NLY A;  1P97 A;  2WKR A;  3CUE C;  4WEL A;  4GS9 A;  4GW9 A;  1P0Z A;  4JGP A;  3LR0 A;  3KYZ A;  3E4Q A;  3LIB A;  5KIZ A;  5HWV A;  4M4X A;  2HV1 A;  4B9O A;  2H28 A;  4MMN A;  1TS7 A;  2JKR M;  4R38 A;  4LLO B;  2DMW A;  4HH2 A;  2XRO A;  1UWP X;  4P6Z M;  2ZOI A;  3LYX A;  5IT5 A;  4EQ1 A;  4PHT A;  2KX6 A;  2XSS A;  3GDI A;  1NLZ A;  3KO6 A;  3PBQ A;  1T18 A;  1T1C A;  2P04 A;  1YKD A;  3OOV A;  3SW1 A;  4JGO A;  3W2Z A;  5F68 A;  5CX7 A;  3NOT C;  1LSV A;  3P01 A;  4BBT A;  4HIA A;  3EGD C;  3A0V A;  3IBR A;  3E0Y A;  4R6L A;  5J7E A;  2QHK A;  3MQO A;  4PKY A;  3FPW A;  3D3O A;  5TJJ A;  3MFX A;  3H7W A;  4ETX A;  3KX0 X;  1OT6 A;  3T4T A;  1S4R A;  4Y3I A;  3UE3 A;  4EW7 A;  3H9W A;  1D7E A;  2FZ0 A;  2A24 B;  1ZHH B;  2P7J A;  2WKP A;  4I3J A;  4Q0J A;  3MXQ A;  3VE3 A;  3BQA A;  3DBA A;  1GSV A;  2NUP C;  3F1N B;  3MJQ A;  5HD5 A;  4GHI B;  5HDC A;  4II7 A;  2W1R A;  4E04 A;  3T4J A;  4IUK A;  2ZMV A;  4HNB A;  1OT9 A;  3ULF A;  5F6A A;  3PBR A;  3IS2 B;  3PYP A;  2EWW A;  2VGL M;  3ZYT A;  1TD5 A;  3EEH A;  1EW0 A;  1H8M A;  3OC2 A;  3VOL A;  4BJP A;  1BYW A;  4LRX C;  2YKH A;  5C5K A;  3BJN A;  3T4S A;  4WN5 A;  3EQU A;  3T4Q A;  3S7O A;  4MN7 A;  2KLI A;  1GSW A;  5HWT A;  1Y28 A;  4UQI M;  3BQ8 A;  3BW6 A;  2O99 A;  3EEA A;  3KYQ A;  5KSH A;  3P7N A;  3TJZ C;  3B33 A;  3FC7 A;  4IUH A;  3K3C A;  4Q0H A;  2I9V A;  1MKM A;  3KSF A;  2L1M A;  3LR3 A;  2HGV A;  2VKS A;  4HI4 A;  2PD7 A;  3FG8 A;  4H6J B;  3K3D A;  4BWI A;  3T4O A;  1V9Z A;  5EFW A;  3TW8 A;  4F3L B;  2J3T C;  1TF1 A;  3OCL A;  4GLQ A;  3LIA A;  4EET B;  2QJ5 A;  4B93 A;  3A0R A;  4MN6 A;  3T4L A;  2J3W A;  2M7V A;  4OOL A;  2W1T B;  1LSW A;  2J3T D;  4O8G A;  3ZQ5 A;  3F1P B;  3LFV A;  3NOU C;  4FOF A;  4WF0 A;  1LT0 A;  4WEK A;  3F1N A;  3T4K A;  1G6O A;  2VV8 A;  1DP9 A;  4Q0I A;  3MQ0 A;  3CUE A;  4GHI A;  4HH3 A;  4NXF A;  2V9A A;  3PR6 A;  1ODV A;  4IJG A;  2GJ3 A;  2ZMF A;  4NXB A;  5AVE A;  3IS2 A;  4I3A A;  5DJU A;  4BMW A;  4R70 A;  2B02 A;  1W63 M;  2QJ7 A;  5AVF A;  4P6Z S;  4ETZ A;  2LB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...