1UWPX

Initial events in the photocycle of photoactive yellow protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
113
Chain Sequence
b'EHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQNAAGDITGDPKQVIGKNFKDDSPEFYGKFKEGVASGNLNTMFEYTDQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Initial events in the photocycle of photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 34
structure length 113
sequence length 124
ec nomenclature
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1uwpX00
3A0SA 1UGUA 4I5SA 2D02A 3G6OA 2JHEA 4GHIB 1OJGA 5HWVA 4WN5A 3UB6A 4R3AA 4EQ1A 5J7EA 3H7WA 1TS6A 4WLAA 2HV1A 1P0ZA 2A24A 1LSVA 2VEAA 2YKHA 4BBTA 2PR5A 2W27A 3H82A 4BBUA 2OOLA 3K3CA 4LRYC 3HJKA 1N9NA 1V9YA 4KUOA 4EW7A 2WKRA 3PHYA 2GJ3A 1UWNX 1T1CA 4EEPA 4HJ4A 3UB9A 2JN7A 4HY8A 1S66L 1GSWA 3E4PA 5HSQA 1DP6A 3H82B 4NXGA 3LIFA 1OTAA 4I3JA 5F69A 3MXQA 1LT0A 2WKPA 1TS0A 5DJUA 3SW1A 3LI8A 2WKQA 1T1AA 3GECA 2ZOIA 1DP9A 2PHYA 2VV7A 3MJQA 1F9IA 4RQ9A 3NOTC 3NOUC 3NJAA 4HHDA 3ICYA 3LICA 2YKFA 4WL9A 1XJ6A 3OLOA 3UB8A 4I38A 3MR0A 3LIDA 3UMDA 4I3IA 4I3AA 4DJ2A 4EXOA 1JNUA 2QWSA 3IBRA 4HI4A 4WF0A 4YWZA 1EW0A 4LRXC 2KX6A 2W0NA 1MZUA 4MN5A 3A0RA 2V9AA 2QHKA 5DKLA 2QKPA 4EERA 1ODVA 4KUKA 5EFWA 3F1OB 3CLOA 4HQAA 5AVFA 1VB6A 3LIBA 3LUQA 5F68A 2V1BA 5DJTA 5G4YA 5J3WA 3PYPA 2BASA 2M1CA 4HJ3A 2OWHA 1OT6A 5DKKA 1T1BA 5G4ZA 1X0OA 2V0UA 4JGRA 2Z6CA 3H7WB 3HJIA 2PD8A 2A24B 5HDCA 5HZHA 4BBVA 4HP9A 4NXEA 3EWKA 5HDDA 2L0WA 3FC7A 3B33A 4L9EA 4EETB 4HNBA 3H9WA 2K7SA 3KX0X 5AVEA 2QJ7A 1GSXA 2OWJA 4HIAA 4HH3A 1F98A 4R70A 3E4OA 1N9OA 1G28A 1S67L 1OTIA 1Y28A 3FG8A 2D01A 3BY8A 1DRMA 1S1YA 1KOUA 4NXFA 3CWFA 5IS1A 2L4RA 4R38A 2VLGA 4HH2A 4JGPA 4HJ6A 3A0VA 4PKYG 1TS7A 5I5LA 4GHIA 1S1ZA 3IS2A 1T18A 4DJ3A 4XT2A 4R6LA 2ZOHA 4LPZA 5KIZA 1NWZA 1LSWA 1S4RA 4H6JA 5HWWA 3LIAA 3NOPC 3UE6A 4EESA 4K08A 1DP8A 1D7EA 4HP4A 3GDIA 1OTEA 1V9ZA 3D72A 1GSVA 3F1NA 3ULFA 3IS2B 4GCZA 4LLOB 3EEHA 4JGQA 4L9FA 4XT2B 1T19A 2V0WA 5J4EA 5F6AA 1OTBA 3UB7A 5F5YA 4H6JB 1BYWA 1S4SA 4L9GA 2PDRA 4PKYA 4I39A 3LIEA 3T50A 4F3LA 3CAXA 4M4XA 2P7JA 1OJ5A 1D06A 1LL8A 5IU1A 3F1NB 5HD3A 4LRZE 3VOLA 3C2WA 4KQDA 4NXBA 2KDKA 4GS9A 2H28A 3MFXA 2R78A 2VV8A 3P7NA 3MQOA 2VV6A 3F1PA 4EEUA 3E4QA 2L1MA 3NHQA 1XFQA 1XJ3A 4MN6A 3VE4A 3LI9A 1LSXA 3RTYA 2PYRA 4F3LB 3RH8B 3ZQ5A 2QJ5A 2INWA 1XJ2A 2PYPA 5HDSA 3K3DA 4E04A 5TBMA 2PD7A 1TS8A 1P97A 4GS9B 5HWTA 1OT9A 5A8BA 1OTDA 3C8CA 2ZBBA 3F1PB 1WA9A 3BWLA 2EA9A 2CMNA 2J80A 1XFNA 3VE3A 3F1OA 3BY9A 1XJ4A 4HOIA 4WUJA 2B02A 2V1AA 1UWPX 3UMEA 4GW9A 5HD5A 2Z6DA 2PR6A 3LYXA 4B9OA 4JGOA 3MQQA 5TBMB 1N9LA 2I9VA
chains in the Genus database with same CATH superfamily
5F83A 1IKIA 4LGWA 1CK3A 3SS4A 5FAQA 1OJGA 4OQHA 1JTDA 4R3AA 1CQAA 1BSGA 3C7UA 3VP3A 2JKRM 5L10A 3NI9A 4WLAA 2UWXA 1BLSA 3ZG7B 2VEAA 3T4SA 3A3FA 4YNRA 4BL2A 2Q9MA 2P04A 2I72A 4BBUA 2P9VA 3TG9A 4CLCA 3HL9A 3NCKA 4CLCE 5AQBA 1BZAA 1V9YA 4BLMA 2WKRA 3PHYA 4II7A 1LI0A 3LEZA 4P0MA 1GA0A 4GLQA 1UWNX 3WS0A 4UEYA 1T1CA 5CGSA 2ZMAA 1XA7A 1LI9A 1RP5A 1K4FA 4GD8A 4C3QA 4FCFA 5HSQA 2VKSA 2EXBA 1YKDA 2HJ9C 2NUTC 5TGFA 1OTAA 1MWSA 3O3VA 4I3JA 4CLCB 2PAVP 4FOFA 4MDZA 5L2FA 1XGJA 4WBGA 4JXVA 3S22A 1IEMA 3IF6C 2KOIA 1ZHHB 5FQQA 5DJUA 4PHTA 2ZQ7A 5HAQA 2WKQA 2VJWA 2ZOIA 3SOIA 4BQMA 4DMZA 5DF8A 5HARA 2VV7A 4FH4A 1PZPA 3MJQA 3DTEA 3BW6A 3NOTC 3DWKA 3ICYA 4Y15A 2EFXA 4GJ4A 1PI5A 3LY4A 1L2SA 5DF7A 3OLOA 3LY3A 3UPNA 4NK3A 3HLCA 5GLAA 2QWSA 1QMFA 3IBRA 3PBOA 4HI4A 4YWZA 4K0XA 3HBRA 1EW0A 4RA7A 5CEDA 3NECA 3C38A 3A0RA 1PW8A 4PPRA 2V9AA 2QKPA 4UQIM 3T1RA 5L09A 4DE2A 4EERA 4GZBA 4ZBEA 2ZC6B 5GLCA 1NRJA 4CJNA 3SH8A 3NIAA 1FCOA 5EVID 4OLGA 2J8YA 5IHVA 2V1BA 5J3WA 1K56A 2M1CA 3SZTA 2OWHA 2CC1A 1OT6A 4ARZA 1PYYA 3FYZA 4A5RA 4P6ZM 4DDSA 2ZL1A 1YLJA 2J3TC 1NY0A 4JGRA 1ONGA 3KSIA 4Q0HA 5M19A 5A91A 5FQ9A 2O9AA 4H8RA 1SKFA 2PD8A 4HBTA 5HDCA 1TF1A 5HZHA 5AQ9A 3EWKA 4EUVA 3FPWA 4G3VA 5HDDA 3S1YA 3FC7A 4R23A 2XFTA 4ARZB 3T4OA 2Y4AA 3SH9A 3O86A 2PRFA 4PAUA 2ZL1B 3T1QB 4JF6A 3KX0X 3NDGA 4OPRA 1JVJA 4WM9A 1HVBA 4HH3A 2P74A 3KYQA 4OPQA 1G28A 3D9YA 1DJBA 5FQMA 2VLGA 1I2SA 2Y2OA 4HH2A 1JTGA 4JGPA 4YFMA 4GNUA 4JXGA 4Z1WA 4LV1A 2O9BA 1S1ZA 2OAQ1 4ZJ2A 3JVUA 3IS2A 1KE0A 4LFUA 2W3HA 4WZ5A 4XT2A 2O9CA 4IHQA 5FI6A 2JBFA 2H0TA 2XF3A 3IBJA 5LBRA 4EU0A 5FAPA 5A92A 4QU3A 1LHYA 5HWWA 1M40A 3FKWA 1XXMA 1JWPA 1TDLA 4OH0A 4JBFA 4S2LA 1OTEA 1V9ZA 4PM8A 4R0QA 3HLDA 1CI9A 4EBNA 3IS2B 4UHUA 2X01A 1FOFA 4JGQA 4XT2B 2OLUA 3L7HA 4QD4A 3BFFA 5F5YA 1GHPA 1DJCA 3UPOA 2R9WA 3GQZA 3WWXA 1ES4A 1ZTUA 5FDSA 3BECA 4RX2A 4I39A 2HP9A 5DTSA 4BL3A 3T50A 5FEGA 2ZC5B 5IU1A 3VOLA 2XLNA 3IT9A 2WGVA 2E8JA 2H28A 4DF6A 3ZYTA 3ZHHA 1CJFA 5CHJA 5EVIC 4EBPA 4DE1A 4X55A 1KE3A 3F1PA 3WRZA 4OQGA 3T1SA 5HL6A 2Y2MA 3E4QA 2L1MA 1LLBA 4Y13A 3NHQA 4B93A 4MN6A 1LSXA 1W8YA 3RTYA 2QJ5A 3VP0A 5FASA 4BMWA 3UB5P 3DTIA 4Y0TA 4EQIA 2A2LA 2PYPA 1K57A 1YMXA 4JPMA 3K3DA 4DE3A 3S4XA 4KZ5A 1TS8A 3Q81A 3AGFA 1E25A 1OT9A 2QYBA 4Y17A 3C8CA 3GMWA 3F1PB 3Q7VA 1VEUB 3DTMA 1U60A 4GN2A 3EGXC 2CMNA 4KZAA 2K31A 1XFNA 4ETXA 1IYQA 3VE3A 3ZG8B 1XJ4A 4WUJA 3UMEA 1D1JA 3FZCA 2EWVA 3FKVA 3ITAA 2M7VA 3MXRA 1N9LA 3QP6A 3E0YA 3PBRA 5E2GA 1O7EA 3VFHA 2W3DA 3M6BA 2D02A 3PAGA 4JXWA 5CX7A 2JHEA 3UB6A 2JE5A 4UAAA 1N4OA 2ZQAA 3H7WA 4O01A 2HV1A 1P0ZA 2A24A 1LSVA 4UA7A 4BBTA 1G68A 2Y2GA 4BENA 3HLEA 3KSGA 1Z6FA 4K91A 2HP6A 5HX9A 1Z09A 3BQ8A 4PMAA 4WYYA 1PWGA 4QPRA 4EEPA 3UB9A 1KVLA 2JN7A 4HY8A 1H5XA 1TDGA 3NBLA 1S66L 3TSGA 1VETA 2VK3A 2JKRI 1DP6A 1GHIA 1LL9A 2VGLM 1VHMA 3LR0A 4EUZA 5AQ7A 3W4QA 4P85A 5BOHA 4XUXA 5EUAA 2VGKA 3D4FA 4RX3A 1T1AA 3MZEA 5HFOA 3Q7ZA 4KG6A 1VETB 3BRMA 3JVVA 3PR6A 1XGIA 3NJAA 3S7PA 3HUMA 5C5KA 3UDXA 3GVBA 2PU4A 4C75A 1W5DA 1SKOA 3Q07A 4WZ4A 3DBAA 3MR0A 2IWDA 1ZG4A 4I3IA 4G3KA 1JNUA 3B3XA 2EWWA 4WF0A 1ESIA 1CF0A 4LRXC 2KX6A 4ZAMA 2EX6A 1IOUA 1C3BA 1PWDA 1Y4OA 4U0TA 3VV4A 4ZDXA 1E3UA 4ZJ3A 2HZ5A 1BLPA 5EFWA 3F1OB 3CLOA 5CXWA 4HQAA 1PRQA 4JF5A 3JYIA 1VB6A 3S7OA 2RL3A 2M7UA 5F68A 5DJTA 3S7QA 1K25A 1BUEA 3PYPA 3G4PA 4HJ3A 4KQOA 3KYZA 4BD0A 5CHUA 4S2PA 4E3LA 3IWIA 1YSQA 3PBQA 5DKKA 4ID4A 3O88A 3DWZA 3GTCA 2ACGA 2JCHA 4FD8A 4B88A 5CERA 1WE4A 3N8RA 2WKIA 3FV7A 1XPBA 4HP9A 2GNXA 5HW3A 2P9VB 4QY5A 3OZHA 1YAXA 1BLCA 3G2YA 4L9EA 3W2ZA 3HUOA 3ZNYA 3H9WA 4E3IA 2XK1A 3OOVA 4MBHA 1CEFA 5AVEA 2VZWA 3FWLA 3TJZC 4HIAA 4QY6A 5EM0A 1N9OA 1K55C 1S67L 1KE4A 1BTLA 3UDIA 2Y2IA 2J9OA 2WADA 3BLMA 2D01A 3EOIA 1K57C 4NXFA 3CWFA 4Y3IA 5IS1A 5GLDA 3U4LP 5KMWA 4JKTA 3EGDC 4WEJA 2G7UA 1YM1A 3CUEA 3MFDA 4OP8A 2P08A 2R9XA 4KZ8A 1ZKJA 3OPLA 1RGYA 2GDNA 1VQQA 3A0VA 1TS7A 1YLWA 3A3JA 4GHIA 3OCNA 3G34A 4K0WA 2XA7M 4CLCD 3I7JA 2C5WB 4GOGA 1T18A 2XQZA 1S0WA 3N7WA 4LV0A 5CTNA 4UQIS 4M3KA 1MXOA 5FA7A 2RCXA 4LPZA 1NWZA 1LSWA 3N6IA 4KZ3A 1S4RA 4H6JA 1Q2QA 1NZOA 5EE8A 1FSYA 4KQQA 1H8MA 2B5RA 4BJPA 3WS2A 3IX3A 4L0LA 1K38A 3D72A 2C6WB 1GSVA 4N1XA 4RYEA 3MQ0A 3ULFA 3R4KA 4MLLA 2Y2JA 5CECA 5FQJA 2PU2A 1ERQA 1K6RA 3EEHA 4P6ZS 1T19A 4BD1A 4XXRA 2ZC3B 2OV5A 1K54C 3QNBA 2V1ZA 4N9LA 1YLPA 3GSGA 4H6JB 3BM6A 3UE3A 1S4SA 2HDQA 4L9GA 5TFQA 5FSRA 3HCYA 2PDRA 4PKYA 2HJEA 1YPRA 3CAXA 2P7JA 4E3KA 5GHZA 3ZVWA 5HD3A 1NZUA 1EI5A 3RXWA 2V20A 4KQDA 3G30A 2KDKA 1KGFA 3HREA 3V39A 3G31A 4OOMA 4PM7A 3PXPA 1W7FA 3P7NA 3CJMA 4ETZA 4Y0UA 4BWIA 2ZM0A 2QZ6A 1S6RA 1XX2A 4KG2A 1XJ3A 1EROA 1VM1A 4S2NC 2ZLYA 3VE4A 4DN0A 3R7WA 5IT5A 2EXAA 3ZQ5A 2INWA 1I5QA 4QWOA 1MWTA 4XUZA 5GLBA 5TBMA 2PD7A 3CITA 4WELA 2WGWA 1OTDA 2BLSA 4F94A 5E2HA 3IXDA 1K56D 2WKEA 3W8KA 3OPPA 2HPBA 2J80A 5F1GA 3R7WB 3V3RA 5FI7A 3ZG0A 2B02A 1ERMA 2Z6DA 4IUHA 2PR6A 3LYXA 4B9OA 2XEPA 4IVIA 1FIKA 3LGOA 5TBMB 2HDRA 3BEBA 2KLIA 4PM9A 1RGZA 4DE0A 1PFLA 5FEFA 1YLTA 4HESA 1YLZA 2G2WA 2E8IA 3IWOA 1HZOA 5HWVA 1L0DA 1SHVA 3VP1A 4EQ1A 3QNCA 5J7EA 1TS6A 2H5SA 3A3DA 1BLHA 2YKHA 2PR5A 2B95A 1MC0A 2W27A 3NDEA 3WS1A 4CLCC 3B47A 5I94A 3K3CA 1YMSA 4LRYC 2VX8A 1FCNA 2ZQDA 3HJKA 4X69A 1N9NA 4FTXA 4EW7A 1W63Q 2GJ3A 3T4JA 1FCMA 3C5AA 1GSWA 3E4PA 3DAVA 3QP8A 4NXGA 5FI2A 3CZDA 1K6SA 3GV9A 1LT0A 1MKIA 2WKPA 3VOZA 4CQHA 3SW1A 3IF6A 3LI8A 1AXBA 4LV3A 3P01A 1FR1A 1DP9A 3ISGA 2PHYA 2XD5A 2PBYA 5EPHA 1L3LA 3QP2A 3ZGAB 4RQ9A 4GB7A 1O07A 3BFDA 2YKFA 1XJ6A 1CEGA 2Z2MB 5FQIA 3CG5A 4I38A 3LIDA 4GDBA 3UMDA 4I3AA 1W8QA 4DJ2A 3IF6B 4EXOA 2LB9A 1ZG6A 3NY4A 2HF6A 3PBSA 1SDNA 2W0NA 4MN5A 5MC7A 3LFVA 5DKLA 4FSFA 3Q7VB 4AFIA 2JKTM 2W3EA 3U2AA 2V8FA 3VSLA 2Y59A 2EX2A 1J9MA 2JKFA 1IYOA 1ODVA 4WMCA 3EEAA 3UDFA 5F82A 1LL5A 3MSHA 1TVFA 4DDYA 5CGXA 3LIBA 3LUQA 3ZDJA 1YLYA 5DFYA 4NETA 1KDWA 3LR5A 4E3MA 4MEZA 1Q2PA 4S2KA 5F1FA 2ZC4B 2LB5A 1PIOA 2ZMFA 4Q8IA 3LR3A 2WUQA 3WS4A 3P98A 4X56A 1QMEA 5G4ZA 2V0UA 4E3NA 3UY6A 5G18A 2Z6CA 5JYPA 3H7WB 2XDMA 3A3IA 2A24B 4KQRA 1IKGA 4X6TA 4O7DA 4MNRA 3EQVA 4LCMA 4NXEA 5U47A 2G2UA 2Z2LB 2J3WA 3MS6A 2VGLS 2VA0A 1G5UA 4PM5A 3OCLA 3IX4A 1F5MA 4MBKA 1H3QA 3IQAA 5CTMA 4R3JA 4S2MA 4HNBA 3CMZA 2XD1A 4DXCA 4MMNA 3VOYA 1GSXA 4Q0JA 3MKFA 3SS5A 3LR4A 1FQGA 4E6WA 1A0KA 3E4OA 3CPTA 1OTIA 3RXXA 3ZG5A 5HAPA 1N9BA 1Y28A 3BY8A 1S1YA 1KOUA 2Y2QA 3PBTA 3UE0A 3HLWA 4G3WA 2L4RA 3UO9A 1J3WA 3AGDA 5CHMA 2W1RA 4QJGA 2XSSA 3G35A 3QP4A 2HDUA 1EWZA 4EV4A 4HJ6A 1OPXA 5TR7A 5HAIA 1E4DA 3IXHA 4X53A 3W4OA 2MJ6A 4WZ5C 4U3TA 3CI6A 3CPTB 4E3JA 3MMHA 5EVEA 2OSUA 4ZRRA 5KIZA 3KO6A 5HPIA 3KSHA 2H0YA 3VFFA 1SKOB 3UE6A 2Q9NA 3QHYA 4EESA 4B4XA 4K08A 4OQIA 4KZ9A 1ACFA 1D7EA 1PNEA 5M1AA 1IFQA 1NYYA 2JC7A 3GDIA 3EQUA 1GA9A 4HBUA 5CGWA 2FZ0A 3M2JA 2EX8A 1JWZA 2WZXA 3N8SA 2PT7A 4L9FA 4Q0IA 2IWCA 1PI4A 4IBRA 3O5YA 4KZ7A 1H8ZA 3O87A 4Y7PA 4R1GA 1TEMA 2X02A 2OAP1 4QB8A 5J8XA 3UE1A 3SH7A 1ALQA 1FR6A 4F3LA 1G6AA 2Y2LA 4M4XA 3MZDA 1YT4A 4Y0OA 1OJ5A 1NYMA 1LL8A 2Y2NA 4Y2FA 1P9RA 3T4QA 4LRZE 1JWVA 4NXBA 5FAOA 4B4ZA 1MKMA 3MFXA 2VV8A 3UNWA 2VV6A 2Q0OA 2XFSA 5EVIA 3ZNTA 4EEUA 4OLDA 2AVXA 3FPVA 2ZMVA 3VSKA 2W3GA 2XRNA 1DY6A 3K2NA 4NKPA 3M2KA 2PYRA 2HDSA 4F3LB 1YSPA 1E3UD 3IH8A 3C7VA 1L0EA 2O0YA 1XJ2A 5FL3A 4P87A 5HDSA 3ZFZA 4OPYA 1K0KA 1NRFA 1GHMA 5HWTA 1SDEA 2XROA 1MWRA 1HTZA 1WYCA 2IWBA 2WZZA 3BLSA 1M6KA 5EVIB 1MWUA 2XA7S 4Z9QA 3AGEA 3T4LA 4EWFA 5FDHA 2VGJA 3BQAA 2FH5A 1L0GA 3BY9A 2Y55A 4HOIA 5DTTA 3RJUA 2V1AA 2H10A 2Y2KA 3Q1FA 5EVLA 4ZJ1A 4JGOA 3N4IA 3DTKA 3HLFA 4N92A 3TRCA 4JXSA 4GD6A 5AQAA 4KENB 3A0SA 1UGUA 3MXSA 4I5SA 1WYBA 3G6OA 3LCEA 2ZM8A 4GHIB 4YOFA 4WN5A 2UV0E 1ZC2A 3IHBA 5EOOA 4IBXA 3QP5A 3S7NA 3NC8A 4JF4A 3E2KA 3LEQA 3OPHA 4E6XA 1IYPA 3IHAA 5E43A 3H82A 3T4TA 4EBLA 2OOLA 3DW0A 3ITBA 2Y2HA 1SCWA 3HUNA 3UN7A 1YQSA 5HPFA 5GHXA 2DMWA 3BJNA 5E2EA 4KUOA 4QHCA 4OQ0A 4E3OA 3N8LA 4HJ4A 3V3SA 4IVKA 3H82B 4GKUA 4KG5A 5DFXA 1TD5A 3LIFA 2X71A 4R3BA 5A93A 5F69A 1KDSA 3TW8A 4P6BA 3OPRA 3Q82A 4Y5FA 3MXQA 5AJGA 1TS0A 1RCJA 3E98A 1MY8A 4S2JA 3VP2A 3T1XA 5EECA 3GECA 4X1MA 3TOIA 1MPLA 1L0FA 1P9WA 3KSFA 4FUWA 3WRTA 4MBFA 4X68A 2DNSA 1KGGA 1F9IA 2QPNA 3NOUC 4HHDA 3LICA 3HLGA 4OONA 2WGIA 3IX8A 2GZAA 2GX5A 2Y79A 4WL9A 1I2WA 3T4KA 2PBDP 5A90A 3UB8A 1PZOA 3GRJA 4O0PA 4OVDA 5GHYA 1NLZA 2V2FF 4R4RA 3UPPA 1HD8A 3ZVTA 4NG2A 1XKZA 3M6HA 4LENA 1FSWA 2WGWB 1MZUA 1PWCA 4FH2A 5EV0A 2QHKA 4R4SA 5CEBA 4S2IA 3BYDA 5E2FA 2Y91A 3GR2A 4KUKA 3RFBA 5AVFA 2B18A 4OKPA 4ME4A 2FFFB 4U0XA 2JKGA 2IA2A 5G4YA 3V50A 5DF9A 2BASA 3D3OA 5TJJA 4S2OA 2QMIA 4YINA 4CPKA 4KZ4A 1NJ4A 1K4EA 4RVAA 2ZM2A 4MN7A 1HLUP 1T1BA 2WAEA 1X0OA 4X25A 3T12B 5GL9A 1F2KA 2JKTI 3HJIA 3C4OA 3MF0A 1ONHA 3TE8A 2WYXA 4KZBA 5HL1A 4BBVA 1STZA 2OLVA 2L0WA 3BFGA 3B33A 2ZD8A 1W63M 4EETB 3W4PA 1ESUA 1SZVA 2K7SA 1FILA 3V5MA 2HP5A 1AWIA 2J9PA 2QJ7A 2OWJA 1VEUA 1F98A 3WS5A 4R70A 1XP4A 1MBLA 5KSHA 1K55A 3FG8A 1DRMA 4N1HA 3CUEC 2W3FA 3A3EA 4R38A 2ZQ9A 4LCLA 4DXBA 5L07A 1CI8A 3OC2A 4OP5A 4N9KA 1KVMA 2WKHA 3G2ZA 4PKYG 5DTKA 5I5LA 3PBNA 2WK0A 3IF5A 3MZFA 2ZQ8A 4DJ3A 1H8YA 5FATA 1W79A 4R6LA 2ZOHA 2W1TA 5KZHA 3P09A 2A49A 3V67A 4NEED 3LIAA 3NOPC 3MBZA 3BFEA 4HEFA 1DP8A 4UA6A 4HP4A 4IJGA 4X1LA 1G6OA 1NLYA 2WAFA 2ZQCA 4UA9A 3PAEA 3F1NA 1ES2A 3KYEA 3VP4A 3HLBA 4GCZA 4LLOB 2Y2PA 4OOLA 5FQKA 4ESPA 5J4EA 2V0WA 5F6AA 1OTBA 3UB7A 2EX9A 2W1TB 3IWQA 3IXGA 4MCWA 1XA1A 4O8GA 1BYWA 3SS3A 3MKEA 3E2LA 1K54A 4WEKA 2BTFP 3JPUA 4JLFA 1H0MA 3LIEA 3OBFA 4C6YA 1D06A 1KGEA 2O99A 3C4PA 3IXBA 3F1NB 5L8MA 4LV2A 3C2WA 2BG1A 5EM1A 4GS9A 1ES3A 4IUKA 2V8CA 1BT5A 2R78A 1GCEA 3NULA 2EFUA 3MQOA 5KSCA 2K2NA 1Y54A 3ZCZA 3HVFA 3L9KA 1IYSA 1ES5A 4ZTKA 1XFQA 2XH9A 3LI9A 2DRWA 4S2NA 4KZ6A 3RH8B 5M18A 3VMAA 3CHWP 4WMCD 2HGVA 4D60A 2A3UA 3PTEA 4E04A 4OOYA 1P97A 4GS9B 1DJAA 2DCFA 2XR0A 3BFCA 3QP1A 4D2OA 5A8BA 5JYOA 2ZBBA 4DKIA 1PW1A 1NXYA 1WA9A 5EOEA 5CRFA 2XGNA 3BWLA 2EA9A 4OPZA 2NUPC 4PM6A 1BULA 2FFYA 3LO7A 3F1OA 3ZG9B 2ZJ9A 1IELA 3G32A 1UWPX 5D3OA 3B42A 4GDNA 3C30A 4GW9A 2J7VA 5HD5A 4IEDA 1OMEA 2J3TD 3IH9A 3MQQA 2Y8HA 5K5BA 5DVAA 2ZC7A 2I9VA 4DRTA
chains in the Genus database with same CATH topology
3A0SA 3E0YA 3PBRA 1UGUA 4I5SA 2W3DA 2D02A 5CX7A 3G6OA 2JHEA 4YOFA 4GHIB 1OJGA 5HWVA 4WN5A 3UB6A 4R3AA 3S7NA 4EQ1A 2JKRM 5J7EA 3H7WA 1TS6A 4O01A 2HV1A 4WLAA 1P0ZA 2A24A 1LSVA 2VEAA 3T4SA 2YKHA 4BBTA 2PR5A 1MC0A 4YNRA 2W27A 3H82A 2P04A 4CLCC 3B47A 3T4TA 4BBUA 2OOLA 3KSGA 3K3CA 4CLCA 4LRYC 5HPFA 4CLCE 2DMWA 2VX8A 3BJNA 3BQ8A 3HJKA 1N9NA 1V9YA 4KUOA 4EW7A 2WKRA 3PHYA 4II7A 1W63Q 2GJ3A 4GLQA 1UWNX 4UEYA 4QPRA 1T1CA 3T4JA 4EEPA 4HJ4A 3UB9A 2JN7A 4HY8A 1S66L 1GSWA 3E4PA 2JKRI 5HSQA 1DP6A 2VKSA 3H82B 5DFXA 1YKDA 2HJ9C 1TD5A 3LIFA 4NXGA 2NUTC 1OTAA 4I3JA 4CLCB 2VGLM 4FOFA 5F69A 3TW8A 1VHMA 3LR0A 4MDZA 4Y5FA 2KOIA 3MXQA 1LT0A 2WKPA 5AJGA 1ZHHB 1TS0A 5DJUA 4CQHA 3E98A 3SW1A 4PHTA 3LI8A 2WKQA 1T1AA 3P01A 2VJWA 3GECA 2ZOIA 1P9WA 1DP9A 3KSFA 4DMZA 2PHYA 2VV7A 3MJQA 1F9IA 4RQ9A 3JVVA 3PR6A 3BW6A 3NOTC 3NOUC 3NJAA 4HHDA 3ICYA 3LICA 3S7PA 2YKFA 5C5KA 4GJ4A 4WL9A 2GZAA 2GX5A 2Y79A 1XJ6A 3T4KA 3OLOA 3UB8A 4I38A 3DBAA 3MR0A 3LIDA 4O0PA 3UMDA 4I3IA 4I3AA 1NLZA 4G3KA 4DJ2A 4EXOA 1JNUA 2LB9A 2EWWA 2QWSA 3IBRA 3PBOA 4HI4A 2HF6A 4WF0A 4YWZA 1EW0A 3PBSA 3C38A 2KX6A 4LRXC 2W0NA 1MZUA 4MN5A 3A0RA 1IOUA 5MC7A 2V9AA 3LFVA 2QHKA 5DKLA 2QKPA 4FSFA 4AFIA 4UQIM 2JKTM 3VV4A 2W3EA 3U2AA 4EERA 1ODVA 3EEAA 4KUKA 1NRJA 5EFWA 3F1OB 3RFBA 3CLOA 4HQAA 5AVFA 2B18A 1VB6A 3S7OA 4ME4A 3LIBA 3LUQA 2M7UA 5F68A 2V1BA 5DFYA 5DJTA 2IA2A 5G4YA 5J3WA 3S7QA 3PYPA 5DF9A 2BASA 3LR5A 2M1CA 3D3OA 5TJJA 4HJ3A 4KQOA 3KYZA 2OWHA 1OT6A 2LB5A 4ARZA 2ZMFA 1YSQA 3LR3A 3PBQA 5DKKA 4P6ZM 4MN7A 1T1BA 5G4ZA 1X0OA 2J3TC 2V0UA 4JGRA 3KSIA 4Q0HA 2O9AA 2Z6CA 2JKTI 3H7WB 3HJIA 3MF0A 2PD8A 2A24B 3TE8A 5HDCA 1TF1A 5HZHA 4BBVA 3EQVA 4HP9A 1STZA 2GNXA 4NXEA 2J3WA 3EWKA 4EUVA 2VGLS 2VA0A 3FPWA 3OCLA 4G3VA 2L0WA 5HDDA 3FC7A 1YAXA 3B33A 4ARZB 1F5MA 4L9EA 3T4OA 1W63M 3W2ZA 1H3QA 4EETB 4PAUA 4HNBA 3H9WA 2K7SA 3OOVA 3KX0X 5AVEA 2VZWA 4MMNA 2QJ7A 3TJZC 1GSXA 2OWJA 4Q0JA 4HIAA 3LR4A 4HH3A 1F98A 4R70A 3E4OA 1N9OA 3KYQA 1G28A 1S67L 1OTIA 1Y28A 5KSHA 3FG8A 2D01A 3EOIA 3BY8A 1DRMA 1S1YA 1KOUA 4NXFA 3CWFA 3PBTA 4Y3IA 5IS1A 3CUEC 4G3WA 2L4RA 2W3FA 4R38A 3EGDC 2VLGA 4WEJA 2G7UA 3CUEA 2W1RA 3OC2A 4HH2A 2XSSA 2P08A 4JGPA 4HJ6A 3A0VA 1OPXA 1TS7A 4PKYG 4Z1WA 5I5LA 4GHIA 3OCNA 2O9BA 3PBNA 1S1ZA 2MJ6A 2XA7M 2OAQ1 4CLCD 3JVUA 3CI6A 3IS2A 1T18A 2W3HA 4DJ3A 3MMHA 4XT2A 2O9CA 4UQIS 4IHQA 4R6LA 4ZRRA 2ZOHA 4LPZA 5KIZA 3IBJA 5LBRA 3KO6A 1NWZA 1LSWA 2W1TA 3KSHA 4EU0A 5HPIA 3V67A 1S4RA 4H6JA 4NEED 5HWWA 3LIAA 3NOPC 1H8MA 3UE6A 4EESA 4K08A 4BJPA 1DP8A 1D7EA 4HP4A 4IJGA 1G6OA 1NLYA 1IFQA 3GDIA 4L0LA 1OTEA 1V9ZA 3EQUA 3D72A 1GSVA 2FZ0A 3F1NA 3MQ0A 3ULFA 3R4KA 3IS2B 4GCZA 4LLOB 3EEHA 4JGQA 4OOLA 2PT7A 4L9FA 4XT2B 4P6ZS 1T19A 2V0WA 5J4EA 5F6AA 1OTBA 4Q0IA 3UB7A 2W1TB 3O5YA 4MCWA 5F5YA 4H6JB 4O8GA 1BYWA 3UE3A 1S4SA 4L9GA 2OAP1 3HCYA 2PDRA 4WEKA 1ZTUA 4PKYA 4I39A 2HJEA 3LIEA 3OBFA 3T50A 4F3LA 3CAXA 4M4XA 2P7JA 1OJ5A 1D06A 1LL8A 2O99A 4Y2FA 1P9RA 5IU1A 3F1NB 5L8MA 3T4QA 5HD3A 4LRZE 3VOLA 3C2WA 4KQDA 4NXBA 2KDKA 4GS9A 2H28A 4IUKA 3ZYTA 1MKMA 4OOMA 3MFXA 2R78A 3PXPA 2VV8A 3P7NA 3MQOA 2VV6A 4ETZA 3F1PA 2K2NA 4BWIA 4EEUA 5HL6A 3FPVA 3E4QA 2ZMVA 2L1MA 2W3GA 3NHQA 1XFQA 1XJ3A 4B93A 4MN6A 2XRNA 3K2NA 3LI9A 1LSXA 3VE4A 4NKPA 4DN0A 3RTYA 3R7WA 2PYRA 5IT5A 4F3LB 1YSPA 3RH8B 3ZQ5A 2QJ5A 2INWA 4BMWA 2HGVA 2A2LA 2O0YA 1XJ2A 5FL3A 2PYPA 5HDSA 3K3DA 4E04A 5TBMA 2PD7A 3CITA 1TS8A 1P97A 4GS9B 4WELA 5HWTA 1OT9A 2QYBA 2XROA 5A8BA 1OTDA 3C8CA 2ZBBA 3F1PB 1WA9A 2XA7S 3BWLA 2EA9A 3EGXC 3T4LA 2NUPC 2CMNA 2J80A 2K31A 3BQAA 1XFNA 4ETXA 3R7WB 3VE3A 2FH5A 3F1OA 3BY9A 1XJ4A 4HOIA 4WUJA 2B02A 2V1AA 1UWPX 3UMEA 3B42A 3C30A 4GW9A 5HD5A 2Z6DA 4IUHA 2EWVA 2PR6A 3LYXA 4B9OA 4JGOA 2J3TD 2M7VA 3MQQA 5TBMB 3TRCA 2Y8HA 1N9LA 5K5BA 2KLIA 2I9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0S A;  1UGU A;  4I5S A;  2D02 A;  3G6O A;  2JHE A;  4GHI B;  1OJG A;  5HWV A;  4WN5 A;  3UB6 A;  4R3A A;  4EQ1 A;  5J7E A;  3H7W A;  1TS6 A;  4WLA A;  2HV1 A;  1P0Z A;  2A24 A;  1LSV A;  2VEA A;  2YKH A;  4BBT A;  2PR5 A;  2W27 A;  3H82 A;  4BBU A;  2OOL A;  3K3C A;  4LRY C;  3HJK A;  1N9N A;  1V9Y A;  4KUO A;  4EW7 A;  2WKR A;  3PHY A;  2GJ3 A;  1UWN X;  1T1C A;  4EEP A;  4HJ4 A;  3UB9 A;  2JN7 A;  4HY8 A;  1S66 L;  1GSW A;  3E4P A;  5HSQ A;  1DP6 A;  3H82 B;  4NXG A;  3LIF A;  1OTA A;  4I3J A;  5F69 A;  3MXQ A;  1LT0 A;  2WKP A;  1TS0 A;  5DJU A;  3SW1 A;  3LI8 A;  2WKQ A;  1T1A A;  3GEC A;  2ZOI A;  1DP9 A;  2PHY A;  2VV7 A;  3MJQ A;  1F9I A;  4RQ9 A;  3NOT C;  3NOU C;  3NJA A;  4HHD A;  3ICY A;  3LIC A;  2YKF A;  4WL9 A;  1XJ6 A;  3OLO A;  3UB8 A;  4I38 A;  3MR0 A;  3LID A;  3UMD A;  4I3I A;  4I3A A;  4DJ2 A;  4EXO A;  1JNU A;  2QWS A;  3IBR A;  4HI4 A;  4WF0 A;  4YWZ A;  1EW0 A;  4LRX C;  2KX6 A;  2W0N A;  1MZU A;  4MN5 A;  3A0R A;  2V9A A;  2QHK A;  5DKL A;  2QKP A;  4EER A;  1ODV A;  4KUK A;  5EFW A;  3F1O B;  3CLO A;  4HQA A;  5AVF A;  1VB6 A;  3LIB A;  3LUQ A;  5F68 A;  2V1B A;  5DJT A;  5G4Y A;  5J3W A;  3PYP A;  2BAS A;  2M1C A;  4HJ3 A;  2OWH A;  1OT6 A;  5DKK A;  1T1B A;  5G4Z A;  1X0O A;  2V0U A;  4JGR A;  2Z6C A;  3H7W B;  3HJI A;  2PD8 A;  2A24 B;  5HDC A;  5HZH A;  4BBV A;  4HP9 A;  4NXE A;  3EWK A;  5HDD A;  2L0W A;  3FC7 A;  3B33 A;  4L9E A;  4EET B;  4HNB A;  3H9W A;  2K7S A;  3KX0 X;  5AVE A;  2QJ7 A;  1GSX A;  2OWJ A;  4HIA A;  4HH3 A;  1F98 A;  4R70 A;  3E4O A;  1N9O A;  1G28 A;  1S67 L;  1OTI A;  1Y28 A;  3FG8 A;  2D01 A;  3BY8 A;  1DRM A;  1S1Y A;  1KOU A;  4NXF A;  3CWF A;  5IS1 A;  2L4R A;  4R38 A;  2VLG A;  4HH2 A;  4JGP A;  4HJ6 A;  3A0V A;  4PKY G;  1TS7 A;  5I5L A;  4GHI A;  1S1Z A;  3IS2 A;  1T18 A;  4DJ3 A;  4XT2 A;  4R6L A;  2ZOH A;  4LPZ A;  5KIZ A;  1NWZ A;  1LSW A;  1S4R A;  4H6J A;  5HWW A;  3LIA A;  3NOP C;  3UE6 A;  4EES A;  4K08 A;  1DP8 A;  1D7E A;  4HP4 A;  3GDI A;  1OTE A;  1V9Z A;  3D72 A;  1GSV A;  3F1N A;  3ULF A;  3IS2 B;  4GCZ A;  4LLO B;  3EEH A;  4JGQ A;  4L9F A;  4XT2 B;  1T19 A;  2V0W A;  5J4E A;  5F6A A;  1OTB A;  3UB7 A;  5F5Y A;  4H6J B;  1BYW A;  1S4S A;  4L9G A;  2PDR A;  4PKY A;  4I39 A;  3LIE A;  3T50 A;  4F3L A;  3CAX A;  4M4X A;  2P7J A;  1OJ5 A;  1D06 A;  1LL8 A;  5IU1 A;  3F1N B;  5HD3 A;  4LRZ E;  3VOL A;  3C2W A;  4KQD A;  4NXB A;  2KDK A;  4GS9 A;  2H28 A;  3MFX A;  2R78 A;  2VV8 A;  3P7N A;  3MQO A;  2VV6 A;  3F1P A;  4EEU A;  3E4Q A;  2L1M A;  3NHQ A;  1XFQ A;  1XJ3 A;  4MN6 A;  3VE4 A;  3LI9 A;  1LSX A;  3RTY A;  2PYR A;  4F3L B;  3RH8 B;  3ZQ5 A;  2QJ5 A;  2INW A;  1XJ2 A;  2PYP A;  5HDS A;  3K3D A;  4E04 A;  5TBM A;  2PD7 A;  1TS8 A;  1P97 A;  4GS9 B;  5HWT A;  1OT9 A;  5A8B A;  1OTD A;  3C8C A;  2ZBB A;  3F1P B;  1WA9 A;  3BWL A;  2EA9 A;  2CMN A;  2J80 A;  1XFN A;  3VE3 A;  3F1O A;  3BY9 A;  1XJ4 A;  4HOI A;  4WUJ A;  2B02 A;  2V1A A;  1UWP X;  3UME A;  4GW9 A;  5HD5 A;  2Z6D A;  2PR6 A;  3LYX A;  4B9O A;  4JGO A;  3MQQ A;  5TBM B;  1N9L A;  2I9V A; 
#chains in the Genus database with same CATH topology
 5F83 A;  1IKI A;  4LGW A;  1CK3 A;  3SS4 A;  5FAQ A;  1OJG A;  4OQH A;  1JTD A;  4R3A A;  1CQA A;  1BSG A;  3C7U A;  3VP3 A;  2JKR M;  5L10 A;  3NI9 A;  4WLA A;  2UWX A;  1BLS A;  3ZG7 B;  2VEA A;  3T4S A;  3A3F A;  4YNR A;  4BL2 A;  2Q9M A;  2P04 A;  2I72 A;  4BBU A;  2P9V A;  3TG9 A;  4CLC A;  3HL9 A;  3NCK A;  4CLC E;  5AQB A;  1BZA A;  1V9Y A;  4BLM A;  2WKR A;  3PHY A;  4II7 A;  1LI0 A;  3LEZ A;  4P0M A;  1GA0 A;  4GLQ A;  1UWN X;  3WS0 A;  4UEY A;  1T1C A;  5CGS A;  2ZMA A;  1XA7 A;  1LI9 A;  1RP5 A;  1K4F A;  4GD8 A;  4C3Q A;  4FCF A;  5HSQ A;  2VKS A;  2EXB A;  1YKD A;  2HJ9 C;  2NUT C;  5TGF A;  1OTA A;  1MWS A;  3O3V A;  4I3J A;  4CLC B;  2PAV P;  4FOF A;  4MDZ A;  5L2F A;  1XGJ A;  4WBG A;  4JXV A;  3S22 A;  1IEM A;  3IF6 C;  2KOI A;  1ZHH B;  5FQQ A;  5DJU A;  4PHT A;  2ZQ7 A;  5HAQ A;  2WKQ A;  2VJW A;  2ZOI A;  3SOI A;  4BQM A;  4DMZ A;  5DF8 A;  5HAR A;  2VV7 A;  4FH4 A;  1PZP A;  3MJQ A;  3DTE A;  3BW6 A;  3NOT C;  3DWK A;  3ICY A;  4Y15 A;  2EFX A;  4GJ4 A;  1PI5 A;  3LY4 A;  1L2S A;  5DF7 A;  3OLO A;  3LY3 A;  3UPN A;  4NK3 A;  3HLC A;  5GLA A;  2QWS A;  1QMF A;  3IBR A;  3PBO A;  4HI4 A;  4YWZ A;  4K0X A;  3HBR A;  1EW0 A;  4RA7 A;  5CED A;  3NEC A;  3C38 A;  3A0R A;  1PW8 A;  4PPR A;  2V9A A;  2QKP A;  4UQI M;  3T1R A;  5L09 A;  4DE2 A;  4EER A;  4GZB A;  4ZBE A;  2ZC6 B;  5GLC A;  1NRJ A;  4CJN A;  3SH8 A;  3NIA A;  1FCO A;  5EVI D;  4OLG A;  2J8Y A;  5IHV A;  2V1B A;  5J3W A;  1K56 A;  2M1C A;  3SZT A;  2OWH A;  2CC1 A;  1OT6 A;  4ARZ A;  1PYY A;  3FYZ A;  4A5R A;  4P6Z M;  4DDS A;  2ZL1 A;  1YLJ A;  2J3T C;  1NY0 A;  4JGR A;  1ONG A;  3KSI A;  4Q0H A;  5M19 A;  5A91 A;  5FQ9 A;  2O9A A;  4H8R A;  1SKF A;  2PD8 A;  4HBT A;  5HDC A;  1TF1 A;  5HZH A;  5AQ9 A;  3EWK A;  4EUV A;  3FPW A;  4G3V A;  5HDD A;  3S1Y A;  3FC7 A;  4R23 A;  2XFT A;  4ARZ B;  3T4O A;  2Y4A A;  3SH9 A;  3O86 A;  2PRF A;  4PAU A;  2ZL1 B;  3T1Q B;  4JF6 A;  3KX0 X;  3NDG A;  4OPR A;  1JVJ A;  4WM9 A;  1HVB A;  4HH3 A;  2P74 A;  3KYQ A;  4OPQ A;  1G28 A;  3D9Y A;  1DJB A;  5FQM A;  2VLG A;  1I2S A;  2Y2O A;  4HH2 A;  1JTG A;  4JGP A;  4YFM A;  4GNU A;  4JXG A;  4Z1W A;  4LV1 A;  2O9B A;  1S1Z A;  2OAQ 1;  4ZJ2 A;  3JVU A;  3IS2 A;  1KE0 A;  4LFU A;  2W3H A;  4WZ5 A;  4XT2 A;  2O9C A;  4IHQ A;  5FI6 A;  2JBF A;  2H0T A;  2XF3 A;  3IBJ A;  5LBR A;  4EU0 A;  5FAP A;  5A92 A;  4QU3 A;  1LHY A;  5HWW A;  1M40 A;  3FKW A;  1XXM A;  1JWP A;  1TDL A;  4OH0 A;  4JBF A;  4S2L A;  1OTE A;  1V9Z A;  4PM8 A;  4R0Q A;  3HLD A;  1CI9 A;  4EBN A;  3IS2 B;  4UHU A;  2X01 A;  1FOF A;  4JGQ A;  4XT2 B;  2OLU A;  3L7H A;  4QD4 A;  3BFF A;  5F5Y A;  1GHP A;  1DJC A;  3UPO A;  2R9W A;  3GQZ A;  3WWX A;  1ES4 A;  1ZTU A;  5FDS A;  3BEC A;  4RX2 A;  4I39 A;  2HP9 A;  5DTS A;  4BL3 A;  3T50 A;  5FEG A;  2ZC5 B;  5IU1 A;  3VOL A;  2XLN A;  3IT9 A;  2WGV A;  2E8J A;  2H28 A;  4DF6 A;  3ZYT A;  3ZHH A;  1CJF A;  5CHJ A;  5EVI C;  4EBP A;  4DE1 A;  4X55 A;  1KE3 A;  3F1P A;  3WRZ A;  4OQG A;  3T1S A;  5HL6 A;  2Y2M A;  3E4Q A;  2L1M A;  1LLB A;  4Y13 A;  3NHQ A;  4B93 A;  4MN6 A;  1LSX A;  1W8Y A;  3RTY A;  2QJ5 A;  3VP0 A;  5FAS A;  4BMW A;  3UB5 P;  3DTI A;  4Y0T A;  4EQI A;  2A2L A;  2PYP A;  1K57 A;  1YMX A;  4JPM A;  3K3D A;  4DE3 A;  3S4X A;  4KZ5 A;  1TS8 A;  3Q81 A;  3AGF A;  1E25 A;  1OT9 A;  2QYB A;  4Y17 A;  3C8C A;  3GMW A;  3F1P B;  3Q7V A;  1VEU B;  3DTM A;  1U60 A;  4GN2 A;  3EGX C;  2CMN A;  4KZA A;  2K31 A;  1XFN A;  4ETX A;  1IYQ A;  3VE3 A;  3ZG8 B;  1XJ4 A;  4WUJ A;  3UME A;  1D1J A;  3FZC A;  2EWV A;  3FKV A;  3ITA A;  2M7V A;  3MXR A;  1N9L A;  3QP6 A;  3E0Y A;  3PBR A;  5E2G A;  1O7E A;  3VFH A;  2W3D A;  3M6B A;  2D02 A;  3PAG A;  4JXW A;  5CX7 A;  2JHE A;  3UB6 A;  2JE5 A;  4UAA A;  1N4O A;  2ZQA A;  3H7W A;  4O01 A;  2HV1 A;  1P0Z A;  2A24 A;  1LSV A;  4UA7 A;  4BBT A;  1G68 A;  2Y2G A;  4BEN A;  3HLE A;  3KSG A;  1Z6F A;  4K91 A;  2HP6 A;  5HX9 A;  1Z09 A;  3BQ8 A;  4PMA A;  4WYY A;  1PWG A;  4QPR A;  4EEP A;  3UB9 A;  1KVL A;  2JN7 A;  4HY8 A;  1H5X A;  1TDG A;  3NBL A;  1S66 L;  3TSG A;  1VET A;  2VK3 A;  2JKR I;  1DP6 A;  1GHI A;  1LL9 A;  2VGL M;  1VHM A;  3LR0 A;  4EUZ A;  5AQ7 A;  3W4Q A;  4P85 A;  5BOH A;  4XUX A;  5EUA A;  2VGK A;  3D4F A;  4RX3 A;  1T1A A;  3MZE A;  5HFO A;  3Q7Z A;  4KG6 A;  1VET B;  3BRM A;  3JVV A;  3PR6 A;  1XGI A;  3NJA A;  3S7P A;  3HUM A;  5C5K A;  3UDX A;  3GVB A;  2PU4 A;  4C75 A;  1W5D A;  1SKO A;  3Q07 A;  4WZ4 A;  3DBA A;  3MR0 A;  2IWD A;  1ZG4 A;  4I3I A;  4G3K A;  1JNU A;  3B3X A;  2EWW A;  4WF0 A;  1ESI A;  1CF0 A;  4LRX C;  2KX6 A;  4ZAM A;  2EX6 A;  1IOU A;  1C3B A;  1PWD A;  1Y4O A;  4U0T A;  3VV4 A;  4ZDX A;  1E3U A;  4ZJ3 A;  2HZ5 A;  1BLP A;  5EFW A;  3F1O B;  3CLO A;  5CXW A;  4HQA A;  1PRQ A;  4JF5 A;  3JYI A;  1VB6 A;  3S7O A;  2RL3 A;  2M7U A;  5F68 A;  5DJT A;  3S7Q A;  1K25 A;  1BUE A;  3PYP A;  3G4P A;  4HJ3 A;  4KQO A;  3KYZ A;  4BD0 A;  5CHU A;  4S2P A;  4E3L A;  3IWI A;  1YSQ A;  3PBQ A;  5DKK A;  4ID4 A;  3O88 A;  3DWZ A;  3GTC A;  2ACG A;  2JCH A;  4FD8 A;  4B88 A;  5CER A;  1WE4 A;  3N8R A;  2WKI A;  3FV7 A;  1XPB A;  4HP9 A;  2GNX A;  5HW3 A;  2P9V B;  4QY5 A;  3OZH A;  1YAX A;  1BLC A;  3G2Y A;  4L9E A;  3W2Z A;  3HUO A;  3ZNY A;  3H9W A;  4E3I A;  2XK1 A;  3OOV A;  4MBH A;  1CEF A;  5AVE A;  2VZW A;  3FWL A;  3TJZ C;  4HIA A;  4QY6 A;  5EM0 A;  1N9O A;  1K55 C;  1S67 L;  1KE4 A;  1BTL A;  3UDI A;  2Y2I A;  2J9O A;  2WAD A;  3BLM A;  2D01 A;  3EOI A;  1K57 C;  4NXF A;  3CWF A;  4Y3I A;  5IS1 A;  5GLD A;  3U4L P;  5KMW A;  4JKT A;  3EGD C;  4WEJ A;  2G7U A;  1YM1 A;  3CUE A;  3MFD A;  4OP8 A;  2P08 A;  2R9X A;  4KZ8 A;  1ZKJ A;  3OPL A;  1RGY A;  2GDN A;  1VQQ A;  3A0V A;  1TS7 A;  1YLW A;  3A3J A;  4GHI A;  3OCN A;  3G34 A;  4K0W A;  2XA7 M;  4CLC D;  3I7J A;  2C5W B;  4GOG A;  1T18 A;  2XQZ A;  1S0W A;  3N7W A;  4LV0 A;  5CTN A;  4UQI S;  4M3K A;  1MXO A;  5FA7 A;  2RCX A;  4LPZ A;  1NWZ A;  1LSW A;  3N6I A;  4KZ3 A;  1S4R A;  4H6J A;  1Q2Q A;  1NZO A;  5EE8 A;  1FSY A;  4KQQ A;  1H8M A;  2B5R A;  4BJP A;  3WS2 A;  3IX3 A;  4L0L A;  1K38 A;  3D72 A;  2C6W B;  1GSV A;  4N1X A;  4RYE A;  3MQ0 A;  3ULF A;  3R4K A;  4MLL A;  2Y2J A;  5CEC A;  5FQJ A;  2PU2 A;  1ERQ A;  1K6R A;  3EEH A;  4P6Z S;  1T19 A;  4BD1 A;  4XXR A;  2ZC3 B;  2OV5 A;  1K54 C;  3QNB A;  2V1Z A;  4N9L A;  1YLP A;  3GSG A;  4H6J B;  3BM6 A;  3UE3 A;  1S4S A;  2HDQ A;  4L9G A;  5TFQ A;  5FSR A;  3HCY A;  2PDR A;  4PKY A;  2HJE A;  1YPR A;  3CAX A;  2P7J A;  4E3K A;  5GHZ A;  3ZVW A;  5HD3 A;  1NZU A;  1EI5 A;  3RXW A;  2V20 A;  4KQD A;  3G30 A;  2KDK A;  1KGF A;  3HRE A;  3V39 A;  3G31 A;  4OOM A;  4PM7 A;  3PXP A;  1W7F A;  3P7N A;  3CJM A;  4ETZ A;  4Y0U A;  4BWI A;  2ZM0 A;  2QZ6 A;  1S6R A;  1XX2 A;  4KG2 A;  1XJ3 A;  1ERO A;  1VM1 A;  4S2N C;  2ZLY A;  3VE4 A;  4DN0 A;  3R7W A;  5IT5 A;  2EXA A;  3ZQ5 A;  2INW A;  1I5Q A;  4QWO A;  1MWT A;  4XUZ A;  5GLB A;  5TBM A;  2PD7 A;  3CIT A;  4WEL A;  2WGW A;  1OTD A;  2BLS A;  4F94 A;  5E2H A;  3IXD A;  1K56 D;  2WKE A;  3W8K A;  3OPP A;  2HPB A;  2J80 A;  5F1G A;  3R7W B;  3V3R A;  5FI7 A;  3ZG0 A;  2B02 A;  1ERM A;  2Z6D A;  4IUH A;  2PR6 A;  3LYX A;  4B9O A;  2XEP A;  4IVI A;  1FIK A;  3LGO A;  5TBM B;  2HDR A;  3BEB A;  2KLI A;  4PM9 A;  1RGZ A;  4DE0 A;  1PFL A;  5FEF A;  1YLT A;  4HES A;  1YLZ A;  2G2W A;  2E8I A;  3IWO A;  1HZO A;  5HWV A;  1L0D A;  1SHV A;  3VP1 A;  4EQ1 A;  3QNC A;  5J7E A;  1TS6 A;  2H5S A;  3A3D A;  1BLH A;  2YKH A;  2PR5 A;  2B95 A;  1MC0 A;  2W27 A;  3NDE A;  3WS1 A;  4CLC C;  3B47 A;  5I94 A;  3K3C A;  1YMS A;  4LRY C;  2VX8 A;  1FCN A;  2ZQD A;  3HJK A;  4X69 A;  1N9N A;  4FTX A;  4EW7 A;  1W63 Q;  2GJ3 A;  3T4J A;  1FCM A;  3C5A A;  1GSW A;  3E4P A;  3DAV A;  3QP8 A;  4NXG A;  5FI2 A;  3CZD A;  1K6S A;  3GV9 A;  1LT0 A;  1MKI A;  2WKP A;  3VOZ A;  4CQH A;  3SW1 A;  3IF6 A;  3LI8 A;  1AXB A;  4LV3 A;  3P01 A;  1FR1 A;  1DP9 A;  3ISG A;  2PHY A;  2XD5 A;  2PBY A;  5EPH A;  1L3L A;  3QP2 A;  3ZGA B;  4RQ9 A;  4GB7 A;  1O07 A;  3BFD A;  2YKF A;  1XJ6 A;  1CEG A;  2Z2M B;  5FQI A;  3CG5 A;  4I38 A;  3LID A;  4GDB A;  3UMD A;  4I3A A;  1W8Q A;  4DJ2 A;  3IF6 B;  4EXO A;  2LB9 A;  1ZG6 A;  3NY4 A;  2HF6 A;  3PBS A;  1SDN A;  2W0N A;  4MN5 A;  5MC7 A;  3LFV A;  5DKL A;  4FSF A;  3Q7V B;  4AFI A;  2JKT M;  2W3E A;  3U2A A;  2V8F A;  3VSL A;  2Y59 A;  2EX2 A;  1J9M A;  2JKF A;  1IYO A;  1ODV A;  4WMC A;  3EEA A;  3UDF A;  5F82 A;  1LL5 A;  3MSH A;  1TVF A;  4DDY A;  5CGX A;  3LIB A;  3LUQ A;  3ZDJ A;  1YLY A;  5DFY A;  4NET A;  1KDW A;  3LR5 A;  4E3M A;  4MEZ A;  1Q2P A;  4S2K A;  5F1F A;  2ZC4 B;  2LB5 A;  1PIO A;  2ZMF A;  4Q8I A;  3LR3 A;  2WUQ A;  3WS4 A;  3P98 A;  4X56 A;  1QME A;  5G4Z A;  2V0U A;  4E3N A;  3UY6 A;  5G18 A;  2Z6C A;  5JYP A;  3H7W B;  2XDM A;  3A3I A;  2A24 B;  4KQR A;  1IKG A;  4X6T A;  4O7D A;  4MNR A;  3EQV A;  4LCM A;  4NXE A;  5U47 A;  2G2U A;  2Z2L B;  2J3W A;  3MS6 A;  2VGL S;  2VA0 A;  1G5U A;  4PM5 A;  3OCL A;  3IX4 A;  1F5M A;  4MBK A;  1H3Q A;  3IQA A;  5CTM A;  4R3J A;  4S2M A;  4HNB A;  3CMZ A;  2XD1 A;  4DXC A;  4MMN A;  3VOY A;  1GSX A;  4Q0J A;  3MKF A;  3SS5 A;  3LR4 A;  1FQG A;  4E6W A;  1A0K A;  3E4O A;  3CPT A;  1OTI A;  3RXX A;  3ZG5 A;  5HAP A;  1N9B A;  1Y28 A;  3BY8 A;  1S1Y A;  1KOU A;  2Y2Q A;  3PBT A;  3UE0 A;  3HLW A;  4G3W A;  2L4R A;  3UO9 A;  1J3W A;  3AGD A;  5CHM A;  2W1R A;  4QJG A;  2XSS A;  3G35 A;  3QP4 A;  2HDU A;  1EWZ A;  4EV4 A;  4HJ6 A;  1OPX A;  5TR7 A;  5HAI A;  1E4D A;  3IXH A;  4X53 A;  3W4O A;  2MJ6 A;  4WZ5 C;  4U3T A;  3CI6 A;  3CPT B;  4E3J A;  3MMH A;  5EVE A;  2OSU A;  4ZRR A;  5KIZ A;  3KO6 A;  5HPI A;  3KSH A;  2H0Y A;  3VFF A;  1SKO B;  3UE6 A;  2Q9N A;  3QHY A;  4EES A;  4B4X A;  4K08 A;  4OQI A;  4KZ9 A;  1ACF A;  1D7E A;  1PNE A;  5M1A A;  1IFQ A;  1NYY A;  2JC7 A;  3GDI A;  3EQU A;  1GA9 A;  4HBU A;  5CGW A;  2FZ0 A;  3M2J A;  2EX8 A;  1JWZ A;  2WZX A;  3N8S A;  2PT7 A;  4L9F A;  4Q0I A;  2IWC A;  1PI4 A;  4IBR A;  3O5Y A;  4KZ7 A;  1H8Z A;  3O87 A;  4Y7P A;  4R1G A;  1TEM A;  2X02 A;  2OAP 1;  4QB8 A;  5J8X A;  3UE1 A;  3SH7 A;  1ALQ A;  1FR6 A;  4F3L A;  1G6A A;  2Y2L A;  4M4X A;  3MZD A;  1YT4 A;  4Y0O A;  1OJ5 A;  1NYM A;  1LL8 A;  2Y2N A;  4Y2F A;  1P9R A;  3T4Q A;  4LRZ E;  1JWV A;  4NXB A;  5FAO A;  4B4Z A;  1MKM A;  3MFX A;  2VV8 A;  3UNW A;  2VV6 A;  2Q0O A;  2XFS A;  5EVI A;  3ZNT A;  4EEU A;  4OLD A;  2AVX A;  3FPV A;  2ZMV A;  3VSK A;  2W3G A;  2XRN A;  1DY6 A;  3K2N A;  4NKP A;  3M2K A;  2PYR A;  2HDS A;  4F3L B;  1YSP A;  1E3U D;  3IH8 A;  3C7V A;  1L0E A;  2O0Y A;  1XJ2 A;  5FL3 A;  4P87 A;  5HDS A;  3ZFZ A;  4OPY A;  1K0K A;  1NRF A;  1GHM A;  5HWT A;  1SDE A;  2XRO A;  1MWR A;  1HTZ A;  1WYC A;  2IWB A;  2WZZ A;  3BLS A;  1M6K A;  5EVI B;  1MWU A;  2XA7 S;  4Z9Q A;  3AGE A;  3T4L A;  4EWF A;  5FDH A;  2VGJ A;  3BQA A;  2FH5 A;  1L0G A;  3BY9 A;  2Y55 A;  4HOI A;  5DTT A;  3RJU A;  2V1A A;  2H10 A;  2Y2K A;  3Q1F A;  5EVL A;  4ZJ1 A;  4JGO A;  3N4I A;  3DTK A;  3HLF A;  4N92 A;  3TRC A;  4JXS A;  4GD6 A;  5AQA A;  4KEN B;  3A0S A;  1UGU A;  3MXS A;  4I5S A;  1WYB A;  3G6O A;  3LCE A;  2ZM8 A;  4GHI B;  4YOF A;  4WN5 A;  2UV0 E;  1ZC2 A;  3IHB A;  5EOO A;  4IBX A;  3QP5 A;  3S7N A;  3NC8 A;  4JF4 A;  3E2K A;  3LEQ A;  3OPH A;  4E6X A;  1IYP A;  3IHA A;  5E43 A;  3H82 A;  3T4T A;  4EBL A;  2OOL A;  3DW0 A;  3ITB A;  2Y2H A;  1SCW A;  3HUN A;  3UN7 A;  1YQS A;  5HPF A;  5GHX A;  2DMW A;  3BJN A;  5E2E A;  4KUO A;  4QHC A;  4OQ0 A;  4E3O A;  3N8L A;  4HJ4 A;  3V3S A;  4IVK A;  3H82 B;  4GKU A;  4KG5 A;  5DFX A;  1TD5 A;  3LIF A;  2X71 A;  4R3B A;  5A93 A;  5F69 A;  1KDS A;  3TW8 A;  4P6B A;  3OPR A;  3Q82 A;  4Y5F A;  3MXQ A;  5AJG A;  1TS0 A;  1RCJ A;  3E98 A;  1MY8 A;  4S2J A;  3VP2 A;  3T1X A;  5EEC A;  3GEC A;  4X1M A;  3TOI A;  1MPL A;  1L0F A;  1P9W A;  3KSF A;  4FUW A;  3WRT A;  4MBF A;  4X68 A;  2DNS A;  1KGG A;  1F9I A;  2QPN A;  3NOU C;  4HHD A;  3LIC A;  3HLG A;  4OON A;  2WGI A;  3IX8 A;  2GZA A;  2GX5 A;  2Y79 A;  4WL9 A;  1I2W A;  3T4K A;  2PBD P;  5A90 A;  3UB8 A;  1PZO A;  3GRJ A;  4O0P A;  4OVD A;  5GHY A;  1NLZ A;  2V2F F;  4R4R A;  3UPP A;  1HD8 A;  3ZVT A;  4NG2 A;  1XKZ A;  3M6H A;  4LEN A;  1FSW A;  2WGW B;  1MZU A;  1PWC A;  4FH2 A;  5EV0 A;  2QHK A;  4R4S A;  5CEB A;  4S2I A;  3BYD A;  5E2F A;  2Y91 A;  3GR2 A;  4KUK A;  3RFB A;  5AVF A;  2B18 A;  4OKP A;  4ME4 A;  2FFF B;  4U0X A;  2JKG A;  2IA2 A;  5G4Y A;  3V50 A;  5DF9 A;  2BAS A;  3D3O A;  5TJJ A;  4S2O A;  2QMI A;  4YIN A;  4CPK A;  4KZ4 A;  1NJ4 A;  1K4E A;  4RVA A;  2ZM2 A;  4MN7 A;  1HLU P;  1T1B A;  2WAE A;  1X0O A;  4X25 A;  3T12 B;  5GL9 A;  1F2K A;  2JKT I;  3HJI A;  3C4O A;  3MF0 A;  1ONH A;  3TE8 A;  2WYX A;  4KZB A;  5HL1 A;  4BBV A;  1STZ A;  2OLV A;  2L0W A;  3BFG A;  3B33 A;  2ZD8 A;  1W63 M;  4EET B;  3W4P A;  1ESU A;  1SZV A;  2K7S A;  1FIL A;  3V5M A;  2HP5 A;  1AWI A;  2J9P A;  2QJ7 A;  2OWJ A;  1VEU A;  1F98 A;  3WS5 A;  4R70 A;  1XP4 A;  1MBL A;  5KSH A;  1K55 A;  3FG8 A;  1DRM A;  4N1H A;  3CUE C;  2W3F A;  3A3E A;  4R38 A;  2ZQ9 A;  4LCL A;  4DXB A;  5L07 A;  1CI8 A;  3OC2 A;  4OP5 A;  4N9K A;  1KVM A;  2WKH A;  3G2Z A;  4PKY G;  5DTK A;  5I5L A;  3PBN A;  2WK0 A;  3IF5 A;  3MZF A;  2ZQ8 A;  4DJ3 A;  1H8Y A;  5FAT A;  1W79 A;  4R6L A;  2ZOH A;  2W1T A;  5KZH A;  3P09 A;  2A49 A;  3V67 A;  4NEE D;  3LIA A;  3NOP C;  3MBZ A;  3BFE A;  4HEF A;  1DP8 A;  4UA6 A;  4HP4 A;  4IJG A;  4X1L A;  1G6O A;  1NLY A;  2WAF A;  2ZQC A;  4UA9 A;  3PAE A;  3F1N A;  1ES2 A;  3KYE A;  3VP4 A;  3HLB A;  4GCZ A;  4LLO B;  2Y2P A;  4OOL A;  5FQK A;  4ESP A;  5J4E A;  2V0W A;  5F6A A;  1OTB A;  3UB7 A;  2EX9 A;  2W1T B;  3IWQ A;  3IXG A;  4MCW A;  1XA1 A;  4O8G A;  1BYW A;  3SS3 A;  3MKE A;  3E2L A;  1K54 A;  4WEK A;  2BTF P;  3JPU A;  4JLF A;  1H0M A;  3LIE A;  3OBF A;  4C6Y A;  1D06 A;  1KGE A;  2O99 A;  3C4P A;  3IXB A;  3F1N B;  5L8M A;  4LV2 A;  3C2W A;  2BG1 A;  5EM1 A;  4GS9 A;  1ES3 A;  4IUK A;  2V8C A;  1BT5 A;  2R78 A;  1GCE A;  3NUL A;  2EFU A;  3MQO A;  5KSC A;  2K2N A;  1Y54 A;  3ZCZ A;  3HVF A;  3L9K A;  1IYS A;  1ES5 A;  4ZTK A;  1XFQ A;  2XH9 A;  3LI9 A;  2DRW A;  4S2N A;  4KZ6 A;  3RH8 B;  5M18 A;  3VMA A;  3CHW P;  4WMC D;  2HGV A;  4D60 A;  2A3U A;  3PTE A;  4E04 A;  4OOY A;  1P97 A;  4GS9 B;  1DJA A;  2DCF A;  2XR0 A;  3BFC A;  3QP1 A;  4D2O A;  5A8B A;  5JYO A;  2ZBB A;  4DKI A;  1PW1 A;  1NXY A;  1WA9 A;  5EOE A;  5CRF A;  2XGN A;  3BWL A;  2EA9 A;  4OPZ A;  2NUP C;  4PM6 A;  1BUL A;  2FFY A;  3LO7 A;  3F1O A;  3ZG9 B;  2ZJ9 A;  1IEL A;  3G32 A;  1UWP X;  5D3O A;  3B42 A;  4GDN A;  3C30 A;  4GW9 A;  2J7V A;  5HD5 A;  4IED A;  1OME A;  2J3T D;  3IH9 A;  3MQQ A;  2Y8H A;  5K5B A;  5DVA A;  2ZC7 A;  2I9V A;  4DRT A; 
#chains in the Genus database with same CATH homology
 3A0S A;  3E0Y A;  3PBR A;  1UGU A;  4I5S A;  2W3D A;  2D02 A;  5CX7 A;  3G6O A;  2JHE A;  4YOF A;  4GHI B;  1OJG A;  5HWV A;  4WN5 A;  3UB6 A;  4R3A A;  3S7N A;  4EQ1 A;  2JKR M;  5J7E A;  3H7W A;  1TS6 A;  4O01 A;  2HV1 A;  4WLA A;  1P0Z A;  2A24 A;  1LSV A;  2VEA A;  3T4S A;  2YKH A;  4BBT A;  2PR5 A;  1MC0 A;  4YNR A;  2W27 A;  3H82 A;  2P04 A;  4CLC C;  3B47 A;  3T4T A;  4BBU A;  2OOL A;  3KSG A;  3K3C A;  4CLC A;  4LRY C;  5HPF A;  4CLC E;  2DMW A;  2VX8 A;  3BJN A;  3BQ8 A;  3HJK A;  1N9N A;  1V9Y A;  4KUO A;  4EW7 A;  2WKR A;  3PHY A;  4II7 A;  1W63 Q;  2GJ3 A;  4GLQ A;  1UWN X;  4UEY A;  4QPR A;  1T1C A;  3T4J A;  4EEP A;  4HJ4 A;  3UB9 A;  2JN7 A;  4HY8 A;  1S66 L;  1GSW A;  3E4P A;  2JKR I;  5HSQ A;  1DP6 A;  2VKS A;  3H82 B;  5DFX A;  1YKD A;  2HJ9 C;  1TD5 A;  3LIF A;  4NXG A;  2NUT C;  1OTA A;  4I3J A;  4CLC B;  2VGL M;  4FOF A;  5F69 A;  3TW8 A;  1VHM A;  3LR0 A;  4MDZ A;  4Y5F A;  2KOI A;  3MXQ A;  1LT0 A;  2WKP A;  5AJG A;  1ZHH B;  1TS0 A;  5DJU A;  4CQH A;  3E98 A;  3SW1 A;  4PHT A;  3LI8 A;  2WKQ A;  1T1A A;  3P01 A;  2VJW A;  3GEC A;  2ZOI A;  1P9W A;  1DP9 A;  3KSF A;  4DMZ A;  2PHY A;  2VV7 A;  3MJQ A;  1F9I A;  4RQ9 A;  3JVV A;  3PR6 A;  3BW6 A;  3NOT C;  3NOU C;  3NJA A;  4HHD A;  3ICY A;  3LIC A;  3S7P A;  2YKF A;  5C5K A;  4GJ4 A;  4WL9 A;  2GZA A;  2GX5 A;  2Y79 A;  1XJ6 A;  3T4K A;  3OLO A;  3UB8 A;  4I38 A;  3DBA A;  3MR0 A;  3LID A;  4O0P A;  3UMD A;  4I3I A;  4I3A A;  1NLZ A;  4G3K A;  4DJ2 A;  4EXO A;  1JNU A;  2LB9 A;  2EWW A;  2QWS A;  3IBR A;  3PBO A;  4HI4 A;  2HF6 A;  4WF0 A;  4YWZ A;  1EW0 A;  3PBS A;  3C38 A;  2KX6 A;  4LRX C;  2W0N A;  1MZU A;  4MN5 A;  3A0R A;  1IOU A;  5MC7 A;  2V9A A;  3LFV A;  2QHK A;  5DKL A;  2QKP A;  4FSF A;  4AFI A;  4UQI M;  2JKT M;  3VV4 A;  2W3E A;  3U2A A;  4EER A;  1ODV A;  3EEA A;  4KUK A;  1NRJ A;  5EFW A;  3F1O B;  3RFB A;  3CLO A;  4HQA A;  5AVF A;  2B18 A;  1VB6 A;  3S7O A;  4ME4 A;  3LIB A;  3LUQ A;  2M7U A;  5F68 A;  2V1B A;  5DFY A;  5DJT A;  2IA2 A;  5G4Y A;  5J3W A;  3S7Q A;  3PYP A;  5DF9 A;  2BAS A;  3LR5 A;  2M1C A;  3D3O A;  5TJJ A;  4HJ3 A;  4KQO A;  3KYZ A;  2OWH A;  1OT6 A;  2LB5 A;  4ARZ A;  2ZMF A;  1YSQ A;  3LR3 A;  3PBQ A;  5DKK A;  4P6Z M;  4MN7 A;  1T1B A;  5G4Z A;  1X0O A;  2J3T C;  2V0U A;  4JGR A;  3KSI A;  4Q0H A;  2O9A A;  2Z6C A;  2JKT I;  3H7W B;  3HJI A;  3MF0 A;  2PD8 A;  2A24 B;  3TE8 A;  5HDC A;  1TF1 A;  5HZH A;  4BBV A;  3EQV A;  4HP9 A;  1STZ A;  2GNX A;  4NXE A;  2J3W A;  3EWK A;  4EUV A;  2VGL S;  2VA0 A;  3FPW A;  3OCL A;  4G3V A;  2L0W A;  5HDD A;  3FC7 A;  1YAX A;  3B33 A;  4ARZ B;  1F5M A;  4L9E A;  3T4O A;  1W63 M;  3W2Z A;  1H3Q A;  4EET B;  4PAU A;  4HNB A;  3H9W A;  2K7S A;  3OOV A;  3KX0 X;  5AVE A;  2VZW A;  4MMN A;  2QJ7 A;  3TJZ C;  1GSX A;  2OWJ A;  4Q0J A;  4HIA A;  3LR4 A;  4HH3 A;  1F98 A;  4R70 A;  3E4O A;  1N9O A;  3KYQ A;  1G28 A;  1S67 L;  1OTI A;  1Y28 A;  5KSH A;  3FG8 A;  2D01 A;  3EOI A;  3BY8 A;  1DRM A;  1S1Y A;  1KOU A;  4NXF A;  3CWF A;  3PBT A;  4Y3I A;  5IS1 A;  3CUE C;  4G3W A;  2L4R A;  2W3F A;  4R38 A;  3EGD C;  2VLG A;  4WEJ A;  2G7U A;  3CUE A;  2W1R A;  3OC2 A;  4HH2 A;  2XSS A;  2P08 A;  4JGP A;  4HJ6 A;  3A0V A;  1OPX A;  1TS7 A;  4PKY G;  4Z1W A;  5I5L A;  4GHI A;  3OCN A;  2O9B A;  3PBN A;  1S1Z A;  2MJ6 A;  2XA7 M;  2OAQ 1;  4CLC D;  3JVU A;  3CI6 A;  3IS2 A;  1T18 A;  2W3H A;  4DJ3 A;  3MMH A;  4XT2 A;  2O9C A;  4UQI S;  4IHQ A;  4R6L A;  4ZRR A;  2ZOH A;  4LPZ A;  5KIZ A;  3IBJ A;  5LBR A;  3KO6 A;  1NWZ A;  1LSW A;  2W1T A;  3KSH A;  4EU0 A;  5HPI A;  3V67 A;  1S4R A;  4H6J A;  4NEE D;  5HWW A;  3LIA A;  3NOP C;  1H8M A;  3UE6 A;  4EES A;  4K08 A;  4BJP A;  1DP8 A;  1D7E A;  4HP4 A;  4IJG A;  1G6O A;  1NLY A;  1IFQ A;  3GDI A;  4L0L A;  1OTE A;  1V9Z A;  3EQU A;  3D72 A;  1GSV A;  2FZ0 A;  3F1N A;  3MQ0 A;  3ULF A;  3R4K A;  3IS2 B;  4GCZ A;  4LLO B;  3EEH A;  4JGQ A;  4OOL A;  2PT7 A;  4L9F A;  4XT2 B;  4P6Z S;  1T19 A;  2V0W A;  5J4E A;  5F6A A;  1OTB A;  4Q0I A;  3UB7 A;  2W1T B;  3O5Y A;  4MCW A;  5F5Y A;  4H6J B;  4O8G A;  1BYW A;  3UE3 A;  1S4S A;  4L9G A;  2OAP 1;  3HCY A;  2PDR A;  4WEK A;  1ZTU A;  4PKY A;  4I39 A;  2HJE A;  3LIE A;  3OBF A;  3T50 A;  4F3L A;  3CAX A;  4M4X A;  2P7J A;  1OJ5 A;  1D06 A;  1LL8 A;  2O99 A;  4Y2F A;  1P9R A;  5IU1 A;  3F1N B;  5L8M A;  3T4Q A;  5HD3 A;  4LRZ E;  3VOL A;  3C2W A;  4KQD A;  4NXB A;  2KDK A;  4GS9 A;  2H28 A;  4IUK A;  3ZYT A;  1MKM A;  4OOM A;  3MFX A;  2R78 A;  3PXP A;  2VV8 A;  3P7N A;  3MQO A;  2VV6 A;  4ETZ A;  3F1P A;  2K2N A;  4BWI A;  4EEU A;  5HL6 A;  3FPV A;  3E4Q A;  2ZMV A;  2L1M A;  2W3G A;  3NHQ A;  1XFQ A;  1XJ3 A;  4B93 A;  4MN6 A;  2XRN A;  3K2N A;  3LI9 A;  1LSX A;  3VE4 A;  4NKP A;  4DN0 A;  3RTY A;  3R7W A;  2PYR A;  5IT5 A;  4F3L B;  1YSP A;  3RH8 B;  3ZQ5 A;  2QJ5 A;  2INW A;  4BMW A;  2HGV A;  2A2L A;  2O0Y A;  1XJ2 A;  5FL3 A;  2PYP A;  5HDS A;  3K3D A;  4E04 A;  5TBM A;  2PD7 A;  3CIT A;  1TS8 A;  1P97 A;  4GS9 B;  4WEL A;  5HWT A;  1OT9 A;  2QYB A;  2XRO A;  5A8B A;  1OTD A;  3C8C A;  2ZBB A;  3F1P B;  1WA9 A;  2XA7 S;  3BWL A;  2EA9 A;  3EGX C;  3T4L A;  2NUP C;  2CMN A;  2J80 A;  2K31 A;  3BQA A;  1XFN A;  4ETX A;  3R7W B;  3VE3 A;  2FH5 A;  3F1O A;  3BY9 A;  1XJ4 A;  4HOI A;  4WUJ A;  2B02 A;  2V1A A;  1UWP X;  3UME A;  3B42 A;  3C30 A;  4GW9 A;  5HD5 A;  2Z6D A;  4IUH A;  2EWV A;  2PR6 A;  3LYX A;  4B9O A;  4JGO A;  2J3T D;  2M7V A;  3MQQ A;  5TBM B;  3TRC A;  2Y8H A;  1N9L A;  5K5B A;  2KLI A;  2I9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...