5CXWA

Structure of the pona1 protein from mycobacterium tuberculosis in complex with penicillin v
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
380
structure length
376
Chain Sequence
KGPNGLIERQVTRELLELFNIDEQTLNTQGLVVTTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSIDPHNGAVRAYYGGDNANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDGIKITNVEGEGCGTCNIAEALKMSLNTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVAHTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGIYHPPHFVQKVVSANGQVLFDASTGDQRIPKAVADNVTAAMEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANKDAWMVGYTPSLSTAVWVGTVKGDEPLVTASGAAIYGSGLPSDIWKATMDGALKGTSNETFPKPTEVGGYAGVPPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Penicillin-binding protein/antibiotic
molecule keywords Penicillin-binding protein 1A
publication title Crystal structures of the transpeptidase domain of the Mycobacterium tuberculosis penicillin-binding protein PonA1 reveal potential mechanisms of antibiotic resistance.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 119
structure length 376
sequence length 380
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5cxwA00
2XF3A 4E3KA 1Q2QA 4QU3A 2E8IA 2EFXA 2ZQAA 4KG2A 3MFDA 2XQZA 1IYPA 2HDQA 2WZZA 3UY6A 3IXGA 4OH0A 4EBLA 5FAOA 1YT4A 2WKEA 1SDEA 4KQRA 3PBQA 4LENA 3TG9A 3LO7A 4KZBA 4QD4A 1L0GA 2Y2KA 2OV5A 5CERA 3VFFA 4UA9A 3N4IA 5CEBA 3ZNTA 4UHUA 3WRZA 3WS4A 3LEZA 3Q7VB 1MWRA 2WAFA 2ZC6B 3ITAA 5DTTA 3Q1FA 4Y0OA 2XDMA 3O87A 2IWBA 5EVLA 1KE3A 2H0YA 4LCMA 1JTGA 5JYPA 1NZUA 1PYYA 3NY4A 3VP2A 2HPBA 4JKTA 3UN7A 1K57A 3WRTA 2HP9A 5AQ9A 2P9VB 2Y2JA 4OPQA 3V5MA 3IWIA 2V1ZA 1DJAA 5I94A 2ZD8A 2Z2LB 2J9OA 2P74A 1JWPA 1LL5A 1YLTA 2EXBA 3DW0A 3EQUA 2XK1A 3LCEA 1BLHA 1K38A 4MLLA 5G18A 3IWOA 2RL3A 3N6IA 3VFHA 3PBRA 1MWUA 1K57C 1XGJA 2R9XA 3OPPA 4C6YA 1PWCA 3BLSA 3ZNYA 4XUZA 4RYEA 2GDNA 4BENA 3N8LA 4FH2A 4KG5A 1PI4A 3ZG8B 3BFFA 5CGSA 1J9MA 5F82A 4PM5A 2WADA 4ZJ3A 1LHYA 5EVID 3JYIA 4C3QA 3MXRA 1MY8A 4K91A 4C75A 1KDSA 4P6BA 3I7JA 4JBFA 4BJPA 5E43A 4JLFA 5CGWA 3GMWA 1OMEA 5AQAA 1PW8A 2ZQ7A 4R0QA 4GB7A 1BTLA 5FI7A 3RJUA 1W7FA 4JF4A 3FV7A 3W4QA 1NXYA 1PWGA 4S2JA 5EVIB 5DF7A 4OOLA 5TGFA 1BT5A 1YM1A 4H8RA 1SCWA 4OVDA 4DXCA 3VSLA 3PBTA 3MBZA 1XPBA 4MNRA 4X56A 4JF5A 4B88A 1I5QA 3HL9A 2VGKA 5HX9A 5M19A 4OONA 1W79A 4HESA 3NDEA 1H8YA 2BLSA 1FSWA 1BLSA 3A3EA 4NETA 3VMAA 1E4DA 2XR0A 1E25A 3QNBA 3E2LA 2Y59A 4KENB 4DE2A 2JE5A 1NRFA 3HLDA 4N9KA 3G30A 1WYBA 2IWDA 4OPRA 3VSKA 1Q2PA 2ZQ8A 3BFGA 5FQ9A 3DTMA 1PIOA 1QMFA 3HLEA 4ZJ1A 5KSCA 3UDXA 2HP6A 4PM6A 4U0XA 1PZOA 1IYSA 2WGVA 1KVLA 2ZQDA 4MBKA 3ZG9B 3EQVA 2J7VA 4WZ5C 2Y2NA 3UDIA 3NIAA 3HLWA 1BSGA 4GKUA 3O3VA 4OQHA 4ZBEA 3VP3A 2Y2PA 3N7WA 3GRJA 5FASA 3MZDA 1LL9A 1W5DA 3S4XA 4KZ3A 2FFYA 3G2ZA 4WYYA 2G2UA 3MZEA 3V39A 2QMIA 3LY4A 3M2KA 4KQOA 3VP4A 5FQMA 3HLCA 3SS5A 4OOYA 1HZOA 4DE3A 2Q9MA 1GA0A 1YLYA 1C3BA 2C5WB 1JVJA 2V20A 5EOOA 3WS5A 1E3UD 3UO9A 1DJCA 1ZC2A 2DNSA 4EBPA 2ZMAA 5TFQA 4R1GA 3TOIA 4LCLA 4MEZA 2X71A 1L0DA 2EX2A 4M3KA 2J9PA 2ZC5B 3BFCA 3BM6A 3HUNA 3OPLA 3M2JA 2ZC7A 3FKVA 4IBXA 5CGXA 2X01A 4E6XA 1PW1A 3VP0A 3BFEA 3UE0A 5FI2A 4KG6A 3QNCA 2OLVA 4PM8A 3V3RA 4OP8A 1ESIA 1IKGA 3SH9A 2ZLYA 2Y4AA 2XH9A 1L0FA 1YQSA 4HBUA 1K4FA 3BRMA 4S2NA 4BD0A 1N4OA 1EROA 1S6RA 3CZDA 1XXMA 3IWQA 3HLGA 5EE8A 3SOIA 4FD8A 3Q82A 4N9LA 3GSGA 1CK3A 2PU4A 1RGZA 1IYOA 4JF6A 3IHBA 5CECA 5HAPA 3OPRA 4LV0A 4ZAMA 5M18A 1EWZA 4X6TA 4R23A 3QHYA 1ERQA 3FYZA 1FCNA 5GL9A 2XGNA 5DF8A 5FAPA 1ONGA 2WKHA 1JWZA 4L0LA 4OQGA 4QB8A 5TR7A 5J8XA 3Q81A 3IXDA 2RCXA 3WS0A 4N1HA 1M6KA 2XFTA 4FH4A 4K0XA 4PM7A 3S22A 3W8KA 2WK0A 5IHVA 4EV4A 5KSHA 1DJBA 4WEJA 1ZG6A 2X02A 2WAEA 3CJMA 5GHXA 1AXBA 2ZC4B 4UA7A 1HVBA 4QY6A 3G31A 4ZDXA 3M6HA 3IXHA 5HAQA 1GA9A 1GHIA 1K4EA 1Z6FA 2VGJA 4QY5A 1FR6A 2Y2QA 3HLFA 1KE0A 5EUAA 3IXBA 2Y2LA 1K55A 3S1YA 1Y54A 4WMCA 2QZ6A 4F94A 2HP5A 4P0MA 4Q8IA 1K25A 1W8QA 3M6BA 4GD6A 3E2KA 5A91A 5FQQA 5E2HA 1K56A 5M1AA 4DDSA 5CHUA 2XFSA 2I72A 4OQ0A 4OP5A 3ZG5A 2ZQCA 4A5RA 4QHCA 4YFMA 5CEDA 4OKPA 3UNWA 2IWCA 2XLNA 1CI8A 1MWTA 4EBNA 2HDSA 3ISGA 3MXSA 3OCNA 3VOYA 4QJGA 5BOHA 4D2OA 5KMWA 5FQIA 2Y2OA 3P09A 4KZ6A 3LY3A 2OSUA 1I2WA 3SS4A 3NBLA 4PMAA 5DVAA 5E2EA 1MPLA 1ERMA 3A3IA 3OCLA 1BULA 1CI9A 5CXWA 2H0TA 4N92A 4UAAA 5A93A 1ESUA 1KGEA 1YLZA 1JWVA 4WZ4A 2JC7A 2JBFA 4IVKA 1PWDA 3SH7A 1MKIA 4GOGA 4R3BA 1NJ4A 3Q7VA 2EX8A 1MWSA 3O88A 5CHJA 4IVIA 5CRFA 3BECA 1G68A 2XD5A 4K0WA 4E3JA 4RX2A 4OQIA 1K6RA 1XA1A 4OOMA 3ZG0A 4BL3A 2PBYA 1L0EA 1XKZA 3FKWA 3ZVWA 4S2PA 3D4FA 5GLDA 5DF9A 4OPYA 1RCJA 1YLWA 5FATA 5A92A 3V3SA 2WKIA 4HEFA 3UPPA 1M40A 5F83A 3ZGAB 5AQ7A 1L2SA 5FDHA 4JXWA 3SH8A 2Y2HA 3IF5A 1NZOA 4WELA 3FWLA 5FAQA 1TVFA 5F1FA 4EUZA 3IH9A 3CMZA 4KZ5A 4RX3A 5FA7A 1RP5A 2Y2MA 4X55A 4LV1A 4E3NA 1O7EA 4S2IA 4RVAA 4KQQA 4LV2A 1MXOA 1NYMA 3G4PA 1RGYA 1U60A 3IF6A 3IHAA 4S2OA 4KZ4A 2PU2A 4WMCD 3DWZA 5L2FA 2ZQ9A 2WGWA 1K54A 1H5XA 4DF6A 1BLPA 3C4OA 3C4PA 3N8SA 4JPMA 2CC1A 3G35A 1BLCA 3Q07A 5E2GA 5U47A 3SS3A 5EVIA 4JXGA 5CTMA 1IEMA 3WWXA 3UDFA 3IF6C 2DCFA 4WEKA 5D3OA 5GHYA 1I2SA 2ZM2A 2B5RA 4OLDA 3UPOA 1K54C 4S2LA 4P87A 2J8YA 2Y2GA 3ZFZA 3HBRA 2Y91A 3OZHA 1YLJA 3CG5A 1W8YA 2EFUA 4X53A 3NI9A 4Z9QA 1SKFA 4RA7A 5CHMA 1GHMA 1WE4A 4GDNA 1QMEA 1XP4A 4GNUA 1DY6A 1KGFA 4R3JA 1ES4A 1ONHA 1LI9A 4B4ZA 4BQMA 5HARA 4S2NC 3C7UA 1JTDA 4X68A 4EQIA 5GLAA 2XEPA 4E3IA 3WS2A 1KDWA 2XD1A 3VP1A 4MBHA 5FSRA 4EWFA 1XA7A 4DDYA 2Z2MB 4KZAA 3UE3A 4GZBA 3FZCA 4OPZA 4UA6A 4XUXA 5EPHA 5GLBA 4CPKA 5FQJA 3UE1A 3WS1A 1WYCA 3A3DA 2DRWA 3HVFA 3BEBA 3ZVTA 2H5SA 3O86A 4DE1A 1ZG4A 2H10A 4NK3A 3HUOA 4MBFA 1MBLA 4S2KA 4B4XA 4CJNA 4DXBA 4LV3A 1VQQA 4JXVA 1PZPA 3ZCZA 1ZKJA 4BD1A 1TDGA 4DRTA 3GQZA 3VOZA 1KE4A 4R4SA 2FFFB 1YMXA 5JYOA 2HDRA 3G2YA 3IH8A 3OPHA 1BZAA 4DKIA 2R9WA 1G6AA 1LI0A 1K55C 5HW3A 1KGGA 1CEFA 3GVBA 2HDUA 1S0WA 4GN2A 3RXWA 4GDBA 1H8ZA 2EX9A 2G2WA 1E3UA 2C6WB 3HLBA 5CTNA 1GHPA 3IF6B 3NCKA 2V2FF 3HUMA 4GD8A 2WUQA 2OLUA 3PBOA 2WGWB 4KZ9A 3NDGA 3V50A 2Y2IA 1FOFA 3BYDA 1NY0A 1N9BA 3GV9A 3IQAA 3TSGA 2EXAA 3BLMA 4ZJ2A 1VM1A 4E3MA 1FSYA 1FCOA 3NC8A 4O7DA 1FCMA 4OLGA 1YMSA 1O07A 3BFDA 4R4RA 2A3UA 3ITBA 1XX2A 3MKEA 3ZG7B 1BUEA 4Y0TA 1LLBA 2QPNA 1K6SA 2ZM8A 5DTKA 3PBSA 1IELA 3ZHHA 4BLMA 4E6WA 1NYYA 1EI5A 1ES3A 2WYXA 2ZM0A 5EECA 1TEMA 3MKFA 4E3LA 3GTCA 2P9VA 4XXRA 2Y55A 4WZ5A 3PTEA 3AGEA 1CEGA 4X69A 5GHZA 5KZHA 3RXXA 1HTZA 5HAIA 4U0TA 1ES5A 3G34A 3PBNA 5AQBA 1HD8A 3W4OA 3HREA 1ALQA 3P98A 4DE0A 3IT9A 3UPNA 3N8RA 2WGIA 2WZXA 3AGDA 5HFOA 4HBTA 4S2MA 3B3XA 4ID4A 4WBGA 3ZDJA 2UWXA 2JCHA 3Q7ZA 3AGFA 3DWKA 4FCFA 1FQGA 5EOEA 3A3FA 5A90A 1IYQA 1PI5A 5FI6A 4YINA 4Y7PA 4E3OA 4P85A 5FQKA 4KZ8A 1K56D 4N1XA 4ZTKA 2A49A 1IKIA 5GLCA 3W4PA 5F1GA 3C5AA 4BL2A 1SDNA 4FSFA 4IBRA 4PM9A 4KZ7A 1TDLA 1SHVA 3C7VA 2BG1A 2Q9NA 3PAGA 4IEDA 3MZFA 1KVMA 2EX6A 1YLPA 3G32A 5E2FA 5HL1A 3A3JA 1GCEA 1ES2A 4JXSA 5DTSA 2ZJ9A 4WM9A 1XGIA 2ZC3B 3OC2A 3GR2A 4Y0UA 1FR1A 4PPRA 3PAEA 5EVIC 4U3TA
chains in the Genus database with same CATH superfamily
2XF3A 2K7SA 3MFDA 3UY6A 4EBLA 4OH0A 3DAVA 2ZL1B 4LENA 2PRFA 5I5LA 3KSIA 5CEBA 3WRZA 3WS4A 3ITAA 3Q1FA 4GJ4A 3O87A 2IWBA 5EVLA 2ZOIA 1NZUA 3VP2A 4JKTA 2V0UA 3WRTA 4OPQA 4WF0A 2Z2LB 3EOIA 1LL5A 3DW0A 2RL3A 3VFHA 3RTYA 4XUZA 4I38A 4EQ1A 4BENA 1TD5A 4FH2A 3V67A 1LSVA 1PI4A 5CGSA 4PM5A 3R4KA 5EVID 3DTKA 2VEAA 1YSPA 3IBRA 4JLFA 5CGWA 2ZQ7A 4R0QA 3W4QA 1NXYA 1YM1A 4H8RA 4H6JB 3EEAA 3UMDA 5HX9A 1W79A 1H8YA 1OT9A 4I5SA 1E4DA 5DFYA 3QNBA 4KENB 2D01A 4XT2B 1NRFA 4DMZA 4N9KA 4OPRA 2O9CA 2ZQ8A 5FQ9A 3DTMA 3RFBA 2VKSA 4WZ5C 1S66L 3O3VA 3R7WA 2XA7M 1IOUA 4F3LA 2PDRA 3S4XA 2FFYA 3MZEA 2O99A 4HP9A 4KQOA 3VP4A 3PHYA 2LB5A 2Q9MA 1GA0A 3BQAA 2C5WB 1JVJA 4CLCC 3IBJA 3UO9A 1ZC2A 4DJ2A 2DNSA 4EBPA 2ZMAA 2X71A 1L0DA 3OPLA 2J9PA 3BFCA 3HUNA 3LYXA 3M2JA 2ZC7A 2P04A 3OBFA 2OLVA 4OP8A 1IKGA 2ZLYA 4HBUA 1N4OA 1EROA 4MN5A 3Q82A 2PU4A 3MR0A 4JF6A 2AVXA 5CECA 5HAPA 4ZAMA 2WKHA 1NWZA 4QB8A 5TR7A 3UB8A 2RCXA 4N1HA 4K0XA 4CLCE 3T4JA 3CJMA 3A0SA 1AXBA 2ZC4B 1ACFA 1STZA 2A24A 3IXHA 3KO6A 5J4EA 1Z6FA 1XJ6A 2Y2QA 4Q0HA 2Y2LA 1Y54A 2L4RA 4F94A 2HP5A 4Q8IA 4B93A 3SW1A 4ESPA 1Z09A 4QHCA 4R38A 1V9YA 4OKPA 4YOFA 2IWCA 4EBNA 2ZMFA 1J3WA 2ACGA 5BOHA 3CHWP 1TS7A 1I2WA 2OSUA 1KOUA 3MQQA 3F1NA 3T1RA 1BULA 3KYQA 4N92A 5A93A 4LRYC 1ESUA 1KGEA 1YLZA 2QHKA 1PWDA 1NJ4A 1JNUA 4FUWA 1MWSA 3JVVA 3O88A 4IVIA 3F1OB 1G68A 4LPZA 1K6RA 1XA1A 3BJNA 4MN7A 3CWFA 2K2NA 3FKWA 3DBAA 4ME4A 1OT6A 2PYPA 3KSHA 5A92A 3V3SA 5AQ7A 1X0OA 2V8CA 4BBUA 2Y2HA 5F1FA 5K5BA 4EUZA 3TW8A 1MXOA 5F68A 2PU2A 4WMCD 2PHYA 3U2AA 3C4PA 1BLCA 5FDSA 5U47A 4JXGA 3IF6C 4WEKA 3LICA 1S67L 2B5RA 1K54C 4GS9B 3CG5A 2EFUA 2V8FA 1UWPX 4YNRA 4WN5A 1WE4A 4GDNA 1XP4A 3CLOA 1ONHA 5A8BA 4GHIB 4EQIA 3T1XA 2FH5A 3LIEA 4E3IA 3WS2A 1OJGA 3FZCA 4R70A 4XUXA 4L9GA 5FQJA 2WKQA 3HVFA 3BEBA 2H5SA 3O86A 2H10A 4S2KA 3HUOA 4JXVA 1ZKJA 4BMWA 4BD1A 3MF0A 1D1JA 1TDGA 4PAUA 3GQZA 4R4SA 2W3EA 3G2YA 1LI0A 3RXWA 1H8ZA 2V2FF 5F5YA 2VV7A 2OLUA 1GSWA 3V50A 1FOFA 1NY0A 1ZHHB 4YWZA 2EXAA 3BLMA 3T1QB 3FC7A 4ZJ2A 4E3MA 2PR6A 1FCMA 3BY9A 1YSQA 3ITBA 3MMHA 3ZG7B 5EM1A 3UB5P 4HNBA 1EI5A 1ES3A 2WYXA 5EVEA 4E3LA 2KLIA 2J3TD 3PTEA 4HJ3A 2EWVA 5GHZA 1HTZA 2W3FA 3G34A 5AQBA 2QKPA 3F1PB 1ALQA 3IT9A 3UPNA 3AGDA 4HBTA 4WBGA 3ZDJA 2UWXA 2JCHA 3Q7ZA 1CQAA 5FI6A 2JN7A 3QP5A 3UB7A 3C5AA 4EETB 4KZ7A 2Q9NA 3PAGA 2ZMVA 1GCEA 2HJEA 4X1LA 1MZUA 2JKFA 3LFVA 3PAEA 4E3KA 4QU3A 5TBMB 2B02A 2E8IA 2W3DA 2ZQAA 4KG2A 2XQZA 2HDQA 5FAOA 3A0RA 1YT4A 3EGXC 1LSXA 2JKTI 3F1OA 3TG9A 1YKDA 3LO7A 4KZBA 2OV5A 3A0VA 1XFQA 4UA9A 3N4IA 3ZYTA 5HDDA 1MWRA 2HPBA 2R78A 2KX6A 3E98A 3K2NA 2G7UA 2HP9A 4JGQA 5L09A 3IWIA 5I94A 2ZD8A 2P74A 3NOPC 2EXBA 1K38A 4MLLA 3O5YA 5FEFA 1XGJA 2H28A 3OPPA 4C6YA 1PWCA 4KG5A 3BFFA 1J9MA 1XJ3A 4ZJ3A 1ZTUA 4C75A 3OLOA 4BJPA 5HPIA 4Y5FA 1OMEA 5FI7A 3RJUA 1BTLA 3K3CA 1PWGA 4OOLA 2QJ7A 3L7HA 4DXCA 2W27A 3PBTA 1XPBA 1EW0A 5M19A 2VGKA 4EXOA 4WLAA 2HZ5A 2BLSA 1FSWA 3A3EA 4NETA 2M7VA 1E25A 4O0PA 1LSWA 4DE2A 3CPTA 3VSKA 4PM6A 4U0XA 5HL6A 2WGVA 2ZQDA 4P6ZS 3S7OA 3UDIA 3UB6A 1S1YA 3HLWA 5L07A 4L9EA 4GKUA 4ZBEA 4P6ZM 4EERA 3MZDA 4KZ3A 2V0WA 4DN0A 3LY4A 3M2KA 1TS6A 5HDSA 1N9OA 2GX5A 5FQMA 4OOYA 4I3JA 2V20A 5AJGA 4LCLA 2EX2A 2VGLM 4M3KA 1OPXA 4Y17A 4II7A 4G3KA 4RQ9A 4GW9A 3DTEA 4HI4A 1ESIA 3SH9A 4ZRRA 2XH9A 1L0FA 1YQSA 3H9WA 2JKRM 4BD0A 3BWLA 3ICYA 1S6RA 3T50A 1IYOA 4JGOA 3IHBA 5M18A 3HJIA 3OPRA 4LV0A 4X6TA 3QHYA 1ERQA 4R3AA 5GL9A 2XGNA 5FAPA 1JWZA 4L0LA 1CF0A 3IXDA 3WS0A 1OTEA 1N9LA 3TJZC 4EV4A 3F1PA 2J3WA 1ZG6A 3NECA 4HHDA 2W3GA 5HAQA 1GA9A 1GHIA 4QY5A 3HLFA 5EUAA 3CI6A 5J3WA 4WMCA 3S1YA 5DJUA 2HV1A 3EEHA 4GD6A 2PD7A 3T12B 5FQQA 1F98A 3D3OA 5E2HA 4CLCB 5HWTA 5CHUA 4OQ0A 2ZOHA 3B33A 1MWTA 3ISGA 5KMWA 1NRJA 3P09A 2GNXA 1TF1A 5DVAA 2XRNA 3C2WA 1T1AA 5CXWA 4UAAA 4MMNA 2O9AA 1JWVA 4HIAA 1MKIA 3BW6A 5CRFA 4IHQA 3BECA 2EWWA 3KYZA 4OOMA 1L0EA 3B47A 3ZVWA 1VEUB 3D4FA 5GLDA 4X25A 3H82A 4EUVA 3IS2B 3UPPA 3MFXA 3ZGAB 4UQIS 1L2SA 4KUKA 3SH8A 3FPVA 3IF5A 5FAQA 2KDKA 3CMZA 4KZ5A 2Y2MA 3TE8A 4E3NA 3NOUC 4UQIM 4FOFA 3G4PA 1RGYA 4S2OA 3EGDC 4Y2FA 3DWZA 4DF6A 1TS0A 1H8MA 1L3LA 3Q07A 2OWHA 5E2GA 3SS3A 3NJAA 3WWXA 2DCFA 5D3OA 3LI9A 3G6OA 4Y13A 4S2LA 4ETXA 3CITA 1A0KA 2VJWA 1DY6A 4R3JA 1ES4A 4BQMA 4S2NC 4UEYA 2XEPA 2ZBBA 3LIFA 4LRZE 4MBHA 5FSRA 1XA7A 4KZAA 3UE3A 2PR5A 1TS8A 3S7NA 3UMEA 3E4PA 3A3DA 1VETB 3ZVTA 1ZG4A 4MBFA 1MBLA 4PHTA 2L0WA 1F9IA 3W2ZA 2JHEA 2B95A 3KYEA 3LEQA 2J80A 3L9KA 3OPHA 1BZAA 1K55C 4GDBA 3IF6B 5EM0A 2WGWB 4KZ9A 2ZL1A 3GV9A 1DP9A 1VM1A 2Z6DA 1FSYA 3NC8A 2HJ9C 4OLGA 3NHQA 4O8GA 3EWKA 3MKEA 4Y0TA 2QPNA 2ZM8A 3PBSA 1IELA 3QP6A 4HH3A 4WZ5A 3RXXA 5HAIA 3W4OA 4BBTA 4DE0A 1S4SA 2HGVA 5HD5A 3MJQA 3AGFA 4HP4A 5EOEA 3HJKA 1PI5A 4Y7PA 4CLCA 4EU0A 4KZ8A 3LIBA 5GLCA 1SDNA 4FSFA 2K31A 1TDLA 2BG1A 4H6JA 1KVMA 1YLPA 2DMWA 3IX3A 3FG8A 2GZAA 4JXSA 5DTSA 2ZJ9A 1T1BA 5EVIC 1Q2QA 5HD3A 4XT2A 2WZZA 3IXGA 4NEED 2WKEA 3PBQA 2OAQ1 1L0GA 4DJ3A 4UHUA 3LEZA 2WAFA 2PD8A 1OJ5A 5DTTA 4Q0IA 2XDMA 4GLQA 1PYYA 3NY4A 4AFIA 1K57A 5AQ9A 2P9VB 2Y2JA 3V5MA 2V1ZA 1DJAA 4LLOB 4HQAA 4MN6A 1JWPA 3EQUA 1YLTA 1OTBA 5HWWA 3PBRA 2P7JA 3BLSA 3ZNYA 2GDNA 4IUKA 3ZG8B 5F82A 2WADA 2UV0E 1LHYA 4C3QA 1MY8A 4P6BA 5E43A 3GMWA 5AQAA 1PW8A 3KX0X 1W7FA 3FV7A 4S2JA 5TGFA 2VK3A 1BT5A 2XROA 1SCWA 3DTIA 2W1RA 5CX7A 3VSLA 3MBZA 4X56A 4B88A 3VE4A 1P97A 3QP8A 2FZ0A 3NDEA 1F5MA 1BLSA 3VMAA 2XR0A 3PXPA 1N9NA 1WYBA 2IWDA 1T1CA 3HLEA 4NXEA 4ZJ1A 5KSCA 3UDXA 2HP6A 1PZOA 3BQ8A 4MBKA 3ZG9B 2J7VA 2Y2NA 1T19A 3NIAA 1BSGA 3BY8A 3VP3A 2Y2PA 3GRJA 1W5DA 3G2ZA 4GCZA 4WYYA 3CUEA 2QMIA 3E4OA 4DE3A 1G28A 5EOOA 3WS5A 5FEGA 1DP6A 1S1ZA 1DJCA 2M1CA 4KQDA 2ZC5B 3UPOA 4E6XA 2X01A 2QYBA 5MC7A 3BFEA 3UE0A 5FI2A 3LR4A 4KG6A 2Q0OA 3QNCA 4PM8A 1W63M 3V3RA 3S7QA 4HY8A 2Y4AA 2W1TB 1K4FA 3BRMA 1LT0A 4JGRA 3MXQA 3CZDA 1MC0A 3HLGA 4LFUA 5EE8A 3SOIA 1CK3A 3B42A 1FCNA 4MCWA 5J8XA 5L10A 4M4XA 4FH4A 4PM7A 3W8KA 2X02A 3T4KA 1HVBA 4ZDXA 1K4EA 2VGJA 1KE0A 4X1MA 1H0MA 3VE3A 3IXBA 4CLCD 2QZ6A 1K25A 3M6BA 4MDZA 5A91A 4NXBA 1K56A 4F3LB 5M1AA 2XFSA 2I72A 2INWA 4GS9A 1HLUP 3ZG5A 2ZQCA 3RH8B 2VLGA 3QP1A 2XLNA 1CI8A 5HDCA 2HDSA 3OCNA 4QJGA 3T4TA 5FQIA 2Y2OA 4GHIA 1G6OA 3LR3A 2OAP1 3NBLA 4PMAA 5E2EA 5HZHA 1MPLA 1ERMA 3OCLA 2H0TA 4FTXA 4WZ4A 2JC7A 2JBFA 4IVKA 5TJJA 4R3BA 2EX8A 5CHJA 4K0WA 1PFLA 4E3JA 4OQIA 3ZG0A 1XJ4A 4BL3A 4D60A 1XKZA 5DF9A 4EEUA 2GJ3A 1RCJA 2WKIA 4HEFA 3UE6A 1M40A 5F83A 1BYWA 5FDHA 1NZOA 5L8MA 3FWLA 3IH9A 4RX3A 5FA7A 1RP5A 4LV1A 1O7EA 4RVAA 4LV2A 5DFXA 2JKTM 3IHAA 4Q0JA 2A24B 4KZ4A 4L9FA 3N8SA 3G35A 2BTFP 4EEPA 5EV0A 1IEMA 3UDFA 5GHYA 3IX8A 4P87A 3KSGA 3HBRA 3OZHA 5IU1A 1W8YA 1XJ2A 4Z9QA 4RA7A 1GHMA 1MKMA 1LI9A 3KSFA 4O01A 5HARA 3C7UA 4X68A 4LRXC 1KDWA 3F1NB 3HCYA 1OTAA 4EWFA 3CAXA 2Z2MB 4GZBA 3ULFA 5HSQA 4UA6A 4CPKA 1WYCA 1D06A 2J3TC 4DE1A 4B4XA 5DKKA 1VQQA 4HH2A 3ZCZA 4DRTA 3NULA 3VOZA 4HJ4A 2IA2A 3IH8A 2R9WA 1G6AA 5HW3A 3C8CA 3T4SA 1KGGA 5C5KA 3GVBA 2HDUA 4GN2A 2EX9A 5TBMA 2KOIA 1E3UA 2C6WB 3HLBA 4Y15A 5CTNA 1GHPA 2YKHA 3NCKA 4GD8A 3P01A 3PBOA 3NDGA 2W1TA 3BYDA 3TSGA 1N9BA 2QJ5A 4HOIA 4O7DA 1YMSA 1O07A 1FILA 1OTDA 4R4RA 2A3UA 1XX2A 3GECA 1K6SA 5DTKA 3ZHHA 4BLMA 4E6WA 3LIAA 3T4OA 2M7UA 2ZM0A 1TEMA 4I3AA 5AVEA 3GTCA 4BBVA 4X69A 1CEGA 5KZHA 4ARZB 1HD8A 2VA0A 3JVUA 3HREA 3UB9A 3N8RA 2XA7S 5HFOA 4S2MA 3B3XA 4ID4A 1UWNX 3DWKA 4E04A 5A90A 1V9ZA 4JGPA 1W63Q 2XSSA 2Y8HA 1NLYA 4P85A 1K56D 4N1XA 4ZTKA 2A49A 1IKIA 3W4PA 5F1GA 4BL2A 3LIDA 4IBRA 4PM9A 5G4YA 2A2LA 4IEDA 3MZFA 4KUOA 5E2FA 5HL1A 4LGWA 3GR2A 1FR1A 4PPRA 1Y4OA 2PBDP 2B18A 2EFXA 2PT7A 4B9OA 1IYPA 1SDEA 4KQRA 4EESA 3VFFA 1OTIA 4QD4A 3VOLA 2Y2KA 2NUPC 2P08A 5CERA 2PAVP 3MSHA 1SKOB 3ZNTA 3Q7VB 2ZC6B 4Y0OA 1KE3A 2H0YA 4LCMA 1JTGA 1VB6A 5JYPA 1FIKA 3UN7A 4G3WA 2OOLA 4WL9A 2J9OA 3D9YA 3LCEA 2XK1A 1BLHA 5G18A 3IWOA 3T1SA 2Y79A 3N6IA 1MWUA 1K57C 2R9XA 4RYEA 3N8LA 3S7PA 2LB9A 3LR0A 3JYIA 3MXRA 4K91A 4PKYG 1KDSA 3I7JA 4JBFA 1DP8A 4GB7A 4JF4A 5EVIB 5DF7A 2VV8A 3T4LA 2W3HA 4OVDA 1T18A 4MNRA 4JF5A 1I5QA 3HL9A 5HPFA 4I39A 4OONA 4HESA 3MS6A 3OOVA 3E2LA 2E8JA 2Y59A 3C30A 2JE5A 2OWJA 2VV6A 3HLDA 4IJGA 3G30A 4Z1WA 3E0YA 1Q2PA 3BFGA 1Y28A 1PIOA 1QMFA 1IYSA 4QPRA 1KVLA 4NG2A 4Y3IA 3EQVA 5KIZA 3LGOA 3P7NA 3QP4A 2MJ6A 2VZWA 4OQHA 1NLZA 2L1MA 2Z6CA 3N7WA 5FASA 1LL9A 4BWIA 2NUTC 2G2UA 3V39A 3HLCA 3SS5A 1HZOA 2I9VA 1YLYA 1C3BA 2BASA 1E3UD 5DKLA 3TOIA 5TFQA 4R1GA 3IX4A 4MEZA 2D02A 3CUEC 3BM6A 4IBXA 5CGXA 3FKVA 1PW1A 3VP0A 3U4LP 1YAXA 1VHMA 5J7EA 1IFQA 2WKRA 4S2NA 1WA9A 1XXMA 3IWQA 3TRCA 3T4QA 3VV4A 4FD8A 1VEUA 3GSGA 4N9LA 1RGZA 4NXFA 3SZTA 1EWZA 3NOTC 4R23A 3FYZA 5DF8A 1ONGA 3IS2A 3PR6A 1D7EA 4OQGA 3Q81A 1M6KA 2JKGA 4ARZA 2XFTA 3S22A 2WK0A 5IHVA 5KSHA 1DJBA 4WEJA 2WAEA 5GHXA 4UA7A 3CPTB 4QY6A 3G31A 3FPWA 3M6HA 2O0YA 1FR6A 1XFNA 3MQ0A 2HF6A 1K55A 2VX8A 5LBRA 4P0MA 2YKFA 1W8QA 4QWOA 3E2KA 3H7WB 4DDSA 4OP5A 5HWVA 4A5RA 4YFMA 5CEDA 4NXGA 3UNWA 1GSVA 3C38A 3MXSA 3VOYA 4D2OA 1DRMA 4EW7A 4KZ6A 5F6AA 3LY3A 3SS4A 4IUHA 3A3IA 1CI9A 5G4ZA 1SKOA 3SH7A 4GOGA 3Q7VA 1P9RA 2XD5A 1VETA 4RX2A 3QP2A 2PBYA 4S2PA 4OPYA 5EFWA 5AVFA 1YLWA 5FATA 2EA9A 1P0ZA 4JXWA 4WELA 1TVFA 4X55A 4CQHA 4S2IA 4KQQA 1NYMA 1U60A 3IF6A 5L2FA 3MQOA 2ZQ9A 2WGWA 1K54A 1H5XA 4ETZA 1BLPA 3C4OA 4JPMA 2CC1A 3K3DA 5EVIA 2PYRA 5CTMA 1I2SA 2ZM2A 4OLDA 2J8YA 4PKYA 2Y2GA 3ZFZA 2Y91A 1YLJA 4X53A 3NI9A 1SKFA 5CHMA 5IT5A 1QMEA 4GNUA 1KGFA 4B4ZA 4WUJA 4NKPA 1JTDA 5GLAA 2V1AA 2XD1A 3VP1A 4G3VA 4DDYA 4OPZA 5EPHA 5GLBA 3UE1A 3WS1A 1ODVA 2WKPA 5FL3A 2DRWA 3E4QA 1F2KA 4NK3A 4CJNA 4DXBA 2JKRI 4LV3A 1PZPA 1S4RA 3H82B 3R7WB 1KE4A 2FFFB 3LUQA 1YMXA 5JYOA 2HDRA 4DKIA 5DJTA 3LI8A 1CEFA 1K0KA 4HJ6A 1S0WA 2G2WA 3HUMA 2WUQA 1G5UA 1H3QA 2Y2IA 3IQAA 3ZQ5A 4I3IA 3GDIA 1FCOA 3BFDA 1YPRA 1BUEA 1LLBA 2V9AA 2CMNA 5F69A 1NYYA 1UGUA 5EECA 3MKFA 2P9VA 4XXRA 2Y55A 3AGEA 5IS1A 1CJFA 1ES5A 3PBNA 4U0TA 1SZVA 2V1BA 3P98A 1P9WA 2WGIA 3JPUA 2WZXA 4FCFA 1FQGA 3A3FA 3LR5A 1IYQA 1LL8A 4YINA 4E3OA 3H7WA 2W0NA 5FQKA 3PYPA 1GSXA 1AWIA 3C7VA 1SHVA 2EX6A 4K08A 3G32A 2VGLS 2O9BA 4R6LA 3A3JA 1ES2A 1PRQA 4WM9A 1XGIA 1PNEA 2ZC3B 3OC2A 2QWSA 4Y0UA 3D72A 4U3TA
chains in the Genus database with same CATH topology
2XF3A 4E3KA 1Q2QA 4QU3A 2E8IA 2EFXA 2ZQAA 4KG2A 3MFDA 2XQZA 1IYPA 2HDQA 2WZZA 3UY6A 3IXGA 4OH0A 4EBLA 5FAOA 1YT4A 2WKEA 1SDEA 4KQRA 3PBQA 4LENA 3TG9A 3LO7A 4KZBA 4QD4A 1L0GA 2Y2KA 2OV5A 5CERA 3VFFA 4UA9A 3N4IA 5CEBA 3ZNTA 4UHUA 3WRZA 3WS4A 3LEZA 3Q7VB 1MWRA 2WAFA 2ZC6B 3ITAA 5DTTA 3Q1FA 4Y0OA 2XDMA 3O87A 2IWBA 5EVLA 1KE3A 2H0YA 4LCMA 1JTGA 5JYPA 1NZUA 1PYYA 3NY4A 3VP2A 2HPBA 4JKTA 3UN7A 1K57A 3WRTA 2HP9A 5AQ9A 2P9VB 2Y2JA 4OPQA 3V5MA 3IWIA 2V1ZA 1DJAA 5I94A 2ZD8A 2Z2LB 2J9OA 2P74A 1JWPA 1LL5A 1YLTA 2EXBA 3DW0A 3EQUA 2XK1A 3LCEA 1BLHA 1K38A 4MLLA 5G18A 3IWOA 2RL3A 3N6IA 3VFHA 3PBRA 1MWUA 1K57C 1XGJA 2R9XA 3OPPA 4C6YA 1PWCA 3BLSA 3ZNYA 4XUZA 4RYEA 2GDNA 4BENA 3N8LA 4FH2A 4KG5A 1PI4A 3ZG8B 3BFFA 5CGSA 1J9MA 5F82A 4PM5A 2WADA 4ZJ3A 1LHYA 5EVID 3JYIA 4C3QA 3MXRA 1MY8A 4K91A 4C75A 1KDSA 4P6BA 3I7JA 4JBFA 4BJPA 5E43A 4JLFA 5CGWA 3GMWA 1OMEA 5AQAA 1PW8A 2ZQ7A 4R0QA 4GB7A 1BTLA 5FI7A 3RJUA 1W7FA 4JF4A 3FV7A 3W4QA 1NXYA 1PWGA 4S2JA 5EVIB 5DF7A 4OOLA 5TGFA 1BT5A 1YM1A 4H8RA 1SCWA 4OVDA 4DXCA 3VSLA 3PBTA 3MBZA 1XPBA 4MNRA 4X56A 4JF5A 4B88A 1I5QA 3HL9A 2VGKA 5HX9A 5M19A 4OONA 1W79A 4HESA 3NDEA 1H8YA 2BLSA 1FSWA 1BLSA 3A3EA 4NETA 3VMAA 1E4DA 2XR0A 1E25A 3QNBA 3E2LA 2Y59A 4KENB 4DE2A 2JE5A 1NRFA 3HLDA 4N9KA 3G30A 1WYBA 2IWDA 4OPRA 3VSKA 1Q2PA 2ZQ8A 3BFGA 5FQ9A 3DTMA 1PIOA 1QMFA 3HLEA 4ZJ1A 5KSCA 3UDXA 2HP6A 4PM6A 4U0XA 1PZOA 1IYSA 2WGVA 1KVLA 2ZQDA 4MBKA 3ZG9B 3EQVA 2J7VA 4WZ5C 2Y2NA 3UDIA 3NIAA 3HLWA 1BSGA 4GKUA 3O3VA 4OQHA 4ZBEA 3VP3A 2Y2PA 3N7WA 3GRJA 5FASA 3MZDA 1LL9A 1W5DA 3S4XA 4KZ3A 2FFYA 3G2ZA 4WYYA 2G2UA 3MZEA 3V39A 2QMIA 3LY4A 3M2KA 4KQOA 3VP4A 5FQMA 3HLCA 3SS5A 4OOYA 1HZOA 4DE3A 2Q9MA 1GA0A 1YLYA 1C3BA 2C5WB 1JVJA 2V20A 5EOOA 3WS5A 1E3UD 3UO9A 1DJCA 1ZC2A 2DNSA 4EBPA 2ZMAA 5TFQA 4R1GA 3TOIA 4LCLA 4MEZA 2X71A 1L0DA 2EX2A 4M3KA 2J9PA 2ZC5B 3BFCA 3BM6A 3HUNA 3OPLA 3M2JA 2ZC7A 3FKVA 4IBXA 5CGXA 2X01A 4E6XA 1PW1A 3VP0A 3BFEA 3UE0A 5FI2A 4KG6A 3QNCA 2OLVA 4PM8A 3V3RA 4OP8A 1ESIA 1IKGA 3SH9A 2ZLYA 2Y4AA 2XH9A 1L0FA 1YQSA 4HBUA 1K4FA 3BRMA 4S2NA 4BD0A 1N4OA 1EROA 1S6RA 3CZDA 1XXMA 3IWQA 3HLGA 5EE8A 3SOIA 4FD8A 3Q82A 4N9LA 3GSGA 1CK3A 2PU4A 1RGZA 1IYOA 4JF6A 3IHBA 5CECA 5HAPA 3OPRA 4LV0A 4ZAMA 5M18A 1EWZA 4X6TA 4R23A 3QHYA 1ERQA 3FYZA 1FCNA 5GL9A 2XGNA 5DF8A 5FAPA 1ONGA 2WKHA 1JWZA 4L0LA 4OQGA 4QB8A 5TR7A 5J8XA 3Q81A 3IXDA 2RCXA 3WS0A 4N1HA 1M6KA 2XFTA 4FH4A 4K0XA 4PM7A 3S22A 3W8KA 2WK0A 5IHVA 4EV4A 5KSHA 1DJBA 4WEJA 1ZG6A 2X02A 2WAEA 3CJMA 5GHXA 1AXBA 2ZC4B 4UA7A 1HVBA 4QY6A 3G31A 4ZDXA 3M6HA 3IXHA 5HAQA 1GA9A 1GHIA 1K4EA 1Z6FA 2VGJA 4QY5A 1FR6A 2Y2QA 3HLFA 1KE0A 5EUAA 3IXBA 2Y2LA 1K55A 3S1YA 1Y54A 4WMCA 2QZ6A 4F94A 2HP5A 4P0MA 4Q8IA 1K25A 1W8QA 3M6BA 4GD6A 3E2KA 5A91A 5FQQA 5E2HA 1K56A 5M1AA 4DDSA 5CHUA 2XFSA 2I72A 4OQ0A 4OP5A 3ZG5A 2ZQCA 4A5RA 4QHCA 4YFMA 5CEDA 4OKPA 3UNWA 2IWCA 2XLNA 1CI8A 1MWTA 4EBNA 2HDSA 3ISGA 3MXSA 3OCNA 3VOYA 4QJGA 5BOHA 4D2OA 5KMWA 5FQIA 2Y2OA 3P09A 4KZ6A 3LY3A 2OSUA 1I2WA 3SS4A 3NBLA 4PMAA 5DVAA 5E2EA 1MPLA 1ERMA 3A3IA 3OCLA 1BULA 1CI9A 5CXWA 2H0TA 4N92A 4UAAA 5A93A 1ESUA 1KGEA 1YLZA 1JWVA 4WZ4A 2JC7A 2JBFA 4IVKA 1PWDA 3SH7A 1MKIA 4GOGA 4R3BA 1NJ4A 3Q7VA 2EX8A 1MWSA 3O88A 5CHJA 4IVIA 5CRFA 3BECA 1G68A 2XD5A 4K0WA 4E3JA 4RX2A 4OQIA 1K6RA 1XA1A 4OOMA 3ZG0A 4BL3A 2PBYA 1L0EA 1XKZA 3FKWA 3ZVWA 4S2PA 3D4FA 5GLDA 5DF9A 4OPYA 1RCJA 1YLWA 5FATA 5A92A 3V3SA 2WKIA 4HEFA 3UPPA 1M40A 5F83A 3ZGAB 5AQ7A 1L2SA 5FDHA 4JXWA 3SH8A 2Y2HA 3IF5A 1NZOA 4WELA 3FWLA 5FAQA 1TVFA 5F1FA 4EUZA 3IH9A 3CMZA 4KZ5A 4RX3A 5FA7A 1RP5A 2Y2MA 4X55A 4LV1A 4E3NA 1O7EA 4S2IA 4RVAA 4KQQA 4LV2A 1MXOA 1NYMA 3G4PA 1RGYA 1U60A 3IF6A 3IHAA 4S2OA 4KZ4A 2PU2A 4WMCD 3DWZA 5L2FA 2ZQ9A 2WGWA 1K54A 1H5XA 4DF6A 1BLPA 3C4OA 3C4PA 3N8SA 4JPMA 2CC1A 3G35A 1BLCA 3Q07A 5E2GA 5U47A 3SS3A 5EVIA 4JXGA 5CTMA 1IEMA 3WWXA 3UDFA 3IF6C 2DCFA 4WEKA 5D3OA 5GHYA 1I2SA 2ZM2A 2B5RA 4OLDA 3UPOA 1K54C 4S2LA 4P87A 2J8YA 2Y2GA 3ZFZA 3HBRA 2Y91A 3OZHA 1YLJA 3CG5A 1W8YA 2EFUA 4X53A 3NI9A 4Z9QA 1SKFA 4RA7A 5CHMA 1GHMA 1WE4A 4GDNA 1QMEA 1XP4A 4GNUA 1DY6A 1KGFA 4R3JA 1ES4A 1ONHA 1LI9A 4B4ZA 4BQMA 5HARA 4S2NC 3C7UA 1JTDA 4X68A 4EQIA 5GLAA 2XEPA 4E3IA 3WS2A 1KDWA 2XD1A 3VP1A 4MBHA 5FSRA 4EWFA 1XA7A 4DDYA 2Z2MB 4KZAA 3UE3A 4GZBA 3FZCA 4OPZA 4UA6A 4XUXA 5EPHA 5GLBA 4CPKA 5FQJA 3UE1A 3WS1A 1WYCA 3A3DA 2DRWA 3HVFA 3BEBA 3ZVTA 2H5SA 3O86A 4DE1A 1ZG4A 2H10A 4NK3A 3HUOA 4MBFA 1MBLA 4S2KA 4B4XA 4CJNA 4DXBA 4LV3A 1VQQA 4JXVA 1PZPA 3ZCZA 1ZKJA 4BD1A 1TDGA 4DRTA 3GQZA 3VOZA 1KE4A 4R4SA 2FFFB 1YMXA 5JYOA 2HDRA 3G2YA 3IH8A 3OPHA 1BZAA 4DKIA 2R9WA 1G6AA 1LI0A 1K55C 5HW3A 1KGGA 1CEFA 3GVBA 2HDUA 1S0WA 4GN2A 3RXWA 4GDBA 1H8ZA 2EX9A 2G2WA 1E3UA 2C6WB 3HLBA 5CTNA 1GHPA 3IF6B 3NCKA 2V2FF 3HUMA 4GD8A 2WUQA 2OLUA 3PBOA 2WGWB 4KZ9A 3NDGA 3V50A 2Y2IA 1FOFA 3BYDA 1NY0A 1N9BA 3GV9A 3IQAA 3TSGA 2EXAA 3BLMA 4ZJ2A 1VM1A 4E3MA 1FSYA 1FCOA 3NC8A 4O7DA 1FCMA 4OLGA 1YMSA 1O07A 3BFDA 4R4RA 2A3UA 3ITBA 1XX2A 3MKEA 3ZG7B 1BUEA 4Y0TA 1LLBA 2QPNA 1K6SA 2ZM8A 5DTKA 3PBSA 1IELA 3ZHHA 4BLMA 4E6WA 1NYYA 1EI5A 1ES3A 2WYXA 2ZM0A 5EECA 1TEMA 3MKFA 4E3LA 3GTCA 2P9VA 4XXRA 2Y55A 4WZ5A 3PTEA 3AGEA 1CEGA 4X69A 5GHZA 5KZHA 3RXXA 1HTZA 5HAIA 4U0TA 1ES5A 3G34A 3PBNA 5AQBA 1HD8A 3W4OA 3HREA 1ALQA 3P98A 4DE0A 3IT9A 3UPNA 3N8RA 2WGIA 2WZXA 3AGDA 5HFOA 4HBTA 4S2MA 3B3XA 4ID4A 4WBGA 3ZDJA 2UWXA 2JCHA 3Q7ZA 3AGFA 3DWKA 4FCFA 1FQGA 5EOEA 3A3FA 5A90A 1IYQA 1PI5A 5FI6A 4YINA 4Y7PA 4E3OA 4P85A 5FQKA 4KZ8A 1K56D 4N1XA 4ZTKA 2A49A 1IKIA 5GLCA 3W4PA 5F1GA 3C5AA 4BL2A 1SDNA 4FSFA 4IBRA 4PM9A 4KZ7A 1TDLA 1SHVA 3C7VA 2BG1A 2Q9NA 3PAGA 4IEDA 3MZFA 1KVMA 2EX6A 1YLPA 3G32A 5E2FA 5HL1A 3A3JA 1GCEA 1ES2A 4JXSA 5DTSA 2ZJ9A 4WM9A 1XGIA 2ZC3B 3OC2A 3GR2A 4Y0UA 1FR1A 4PPRA 3PAEA 5EVIC 4U3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XF3 A;  4E3K A;  1Q2Q A;  4QU3 A;  2E8I A;  2EFX A;  2ZQA A;  4KG2 A;  3MFD A;  2XQZ A;  1IYP A;  2HDQ A;  2WZZ A;  3UY6 A;  3IXG A;  4OH0 A;  4EBL A;  5FAO A;  1YT4 A;  2WKE A;  1SDE A;  4KQR A;  3PBQ A;  4LEN A;  3TG9 A;  3LO7 A;  4KZB A;  4QD4 A;  1L0G A;  2Y2K A;  2OV5 A;  5CER A;  3VFF A;  4UA9 A;  3N4I A;  5CEB A;  3ZNT A;  4UHU A;  3WRZ A;  3WS4 A;  3LEZ A;  3Q7V B;  1MWR A;  2WAF A;  2ZC6 B;  3ITA A;  5DTT A;  3Q1F A;  4Y0O A;  2XDM A;  3O87 A;  2IWB A;  5EVL A;  1KE3 A;  2H0Y A;  4LCM A;  1JTG A;  5JYP A;  1NZU A;  1PYY A;  3NY4 A;  3VP2 A;  2HPB A;  4JKT A;  3UN7 A;  1K57 A;  3WRT A;  2HP9 A;  5AQ9 A;  2P9V B;  2Y2J A;  4OPQ A;  3V5M A;  3IWI A;  2V1Z A;  1DJA A;  5I94 A;  2ZD8 A;  2Z2L B;  2J9O A;  2P74 A;  1JWP A;  1LL5 A;  1YLT A;  2EXB A;  3DW0 A;  3EQU A;  2XK1 A;  3LCE A;  1BLH A;  1K38 A;  4MLL A;  5G18 A;  3IWO A;  2RL3 A;  3N6I A;  3VFH A;  3PBR A;  1MWU A;  1K57 C;  1XGJ A;  2R9X A;  3OPP A;  4C6Y A;  1PWC A;  3BLS A;  3ZNY A;  4XUZ A;  4RYE A;  2GDN A;  4BEN A;  3N8L A;  4FH2 A;  4KG5 A;  1PI4 A;  3ZG8 B;  3BFF A;  5CGS A;  1J9M A;  5F82 A;  4PM5 A;  2WAD A;  4ZJ3 A;  1LHY A;  5EVI D;  3JYI A;  4C3Q A;  3MXR A;  1MY8 A;  4K91 A;  4C75 A;  1KDS A;  4P6B A;  3I7J A;  4JBF A;  4BJP A;  5E43 A;  4JLF A;  5CGW A;  3GMW A;  1OME A;  5AQA A;  1PW8 A;  2ZQ7 A;  4R0Q A;  4GB7 A;  1BTL A;  5FI7 A;  3RJU A;  1W7F A;  4JF4 A;  3FV7 A;  3W4Q A;  1NXY A;  1PWG A;  4S2J A;  5EVI B;  5DF7 A;  4OOL A;  5TGF A;  1BT5 A;  1YM1 A;  4H8R A;  1SCW A;  4OVD A;  4DXC A;  3VSL A;  3PBT A;  3MBZ A;  1XPB A;  4MNR A;  4X56 A;  4JF5 A;  4B88 A;  1I5Q A;  3HL9 A;  2VGK A;  5HX9 A;  5M19 A;  4OON A;  1W79 A;  4HES A;  3NDE A;  1H8Y A;  2BLS A;  1FSW A;  1BLS A;  3A3E A;  4NET A;  3VMA A;  1E4D A;  2XR0 A;  1E25 A;  3QNB A;  3E2L A;  2Y59 A;  4KEN B;  4DE2 A;  2JE5 A;  1NRF A;  3HLD A;  4N9K A;  3G30 A;  1WYB A;  2IWD A;  4OPR A;  3VSK A;  1Q2P A;  2ZQ8 A;  3BFG A;  5FQ9 A;  3DTM A;  1PIO A;  1QMF A;  3HLE A;  4ZJ1 A;  5KSC A;  3UDX A;  2HP6 A;  4PM6 A;  4U0X A;  1PZO A;  1IYS A;  2WGV A;  1KVL A;  2ZQD A;  4MBK A;  3ZG9 B;  3EQV A;  2J7V A;  4WZ5 C;  2Y2N A;  3UDI A;  3NIA A;  3HLW A;  1BSG A;  4GKU A;  3O3V A;  4OQH A;  4ZBE A;  3VP3 A;  2Y2P A;  3N7W A;  3GRJ A;  5FAS A;  3MZD A;  1LL9 A;  1W5D A;  3S4X A;  4KZ3 A;  2FFY A;  3G2Z A;  4WYY A;  2G2U A;  3MZE A;  3V39 A;  2QMI A;  3LY4 A;  3M2K A;  4KQO A;  3VP4 A;  5FQM A;  3HLC A;  3SS5 A;  4OOY A;  1HZO A;  4DE3 A;  2Q9M A;  1GA0 A;  1YLY A;  1C3B A;  2C5W B;  1JVJ A;  2V20 A;  5EOO A;  3WS5 A;  1E3U D;  3UO9 A;  1DJC A;  1ZC2 A;  2DNS A;  4EBP A;  2ZMA A;  5TFQ A;  4R1G A;  3TOI A;  4LCL A;  4MEZ A;  2X71 A;  1L0D A;  2EX2 A;  4M3K A;  2J9P A;  2ZC5 B;  3BFC A;  3BM6 A;  3HUN A;  3OPL A;  3M2J A;  2ZC7 A;  3FKV A;  4IBX A;  5CGX A;  2X01 A;  4E6X A;  1PW1 A;  3VP0 A;  3BFE A;  3UE0 A;  5FI2 A;  4KG6 A;  3QNC A;  2OLV A;  4PM8 A;  3V3R A;  4OP8 A;  1ESI A;  1IKG A;  3SH9 A;  2ZLY A;  2Y4A A;  2XH9 A;  1L0F A;  1YQS A;  4HBU A;  1K4F A;  3BRM A;  4S2N A;  4BD0 A;  1N4O A;  1ERO A;  1S6R A;  3CZD A;  1XXM A;  3IWQ A;  3HLG A;  5EE8 A;  3SOI A;  4FD8 A;  3Q82 A;  4N9L A;  3GSG A;  1CK3 A;  2PU4 A;  1RGZ A;  1IYO A;  4JF6 A;  3IHB A;  5CEC A;  5HAP A;  3OPR A;  4LV0 A;  4ZAM A;  5M18 A;  1EWZ A;  4X6T A;  4R23 A;  3QHY A;  1ERQ A;  3FYZ A;  1FCN A;  5GL9 A;  2XGN A;  5DF8 A;  5FAP A;  1ONG A;  2WKH A;  1JWZ A;  4L0L A;  4OQG A;  4QB8 A;  5TR7 A;  5J8X A;  3Q81 A;  3IXD A;  2RCX A;  3WS0 A;  4N1H A;  1M6K A;  2XFT A;  4FH4 A;  4K0X A;  4PM7 A;  3S22 A;  3W8K A;  2WK0 A;  5IHV A;  4EV4 A;  5KSH A;  1DJB A;  4WEJ A;  1ZG6 A;  2X02 A;  2WAE A;  3CJM A;  5GHX A;  1AXB A;  2ZC4 B;  4UA7 A;  1HVB A;  4QY6 A;  3G31 A;  4ZDX A;  3M6H A;  3IXH A;  5HAQ A;  1GA9 A;  1GHI A;  1K4E A;  1Z6F A;  2VGJ A;  4QY5 A;  1FR6 A;  2Y2Q A;  3HLF A;  1KE0 A;  5EUA A;  3IXB A;  2Y2L A;  1K55 A;  3S1Y A;  1Y54 A;  4WMC A;  2QZ6 A;  4F94 A;  2HP5 A;  4P0M A;  4Q8I A;  1K25 A;  1W8Q A;  3M6B A;  4GD6 A;  3E2K A;  5A91 A;  5FQQ A;  5E2H A;  1K56 A;  5M1A A;  4DDS A;  5CHU A;  2XFS A;  2I72 A;  4OQ0 A;  4OP5 A;  3ZG5 A;  2ZQC A;  4A5R A;  4QHC A;  4YFM A;  5CED A;  4OKP A;  3UNW A;  2IWC A;  2XLN A;  1CI8 A;  1MWT A;  4EBN A;  2HDS A;  3ISG A;  3MXS A;  3OCN A;  3VOY A;  4QJG A;  5BOH A;  4D2O A;  5KMW A;  5FQI A;  2Y2O A;  3P09 A;  4KZ6 A;  3LY3 A;  2OSU A;  1I2W A;  3SS4 A;  3NBL A;  4PMA A;  5DVA A;  5E2E A;  1MPL A;  1ERM A;  3A3I A;  3OCL A;  1BUL A;  1CI9 A;  5CXW A;  2H0T A;  4N92 A;  4UAA A;  5A93 A;  1ESU A;  1KGE A;  1YLZ A;  1JWV A;  4WZ4 A;  2JC7 A;  2JBF A;  4IVK A;  1PWD A;  3SH7 A;  1MKI A;  4GOG A;  4R3B A;  1NJ4 A;  3Q7V A;  2EX8 A;  1MWS A;  3O88 A;  5CHJ A;  4IVI A;  5CRF A;  3BEC A;  1G68 A;  2XD5 A;  4K0W A;  4E3J A;  4RX2 A;  4OQI A;  1K6R A;  1XA1 A;  4OOM A;  3ZG0 A;  4BL3 A;  2PBY A;  1L0E A;  1XKZ A;  3FKW A;  3ZVW A;  4S2P A;  3D4F A;  5GLD A;  5DF9 A;  4OPY A;  1RCJ A;  1YLW A;  5FAT A;  5A92 A;  3V3S A;  2WKI A;  4HEF A;  3UPP A;  1M40 A;  5F83 A;  3ZGA B;  5AQ7 A;  1L2S A;  5FDH A;  4JXW A;  3SH8 A;  2Y2H A;  3IF5 A;  1NZO A;  4WEL A;  3FWL A;  5FAQ A;  1TVF A;  5F1F A;  4EUZ A;  3IH9 A;  3CMZ A;  4KZ5 A;  4RX3 A;  5FA7 A;  1RP5 A;  2Y2M A;  4X55 A;  4LV1 A;  4E3N A;  1O7E A;  4S2I A;  4RVA A;  4KQQ A;  4LV2 A;  1MXO A;  1NYM A;  3G4P A;  1RGY A;  1U60 A;  3IF6 A;  3IHA A;  4S2O A;  4KZ4 A;  2PU2 A;  4WMC D;  3DWZ A;  5L2F A;  2ZQ9 A;  2WGW A;  1K54 A;  1H5X A;  4DF6 A;  1BLP A;  3C4O A;  3C4P A;  3N8S A;  4JPM A;  2CC1 A;  3G35 A;  1BLC A;  3Q07 A;  5E2G A;  5U47 A;  3SS3 A;  5EVI A;  4JXG A;  5CTM A;  1IEM A;  3WWX A;  3UDF A;  3IF6 C;  2DCF A;  4WEK A;  5D3O A;  5GHY A;  1I2S A;  2ZM2 A;  2B5R A;  4OLD A;  3UPO A;  1K54 C;  4S2L A;  4P87 A;  2J8Y A;  2Y2G A;  3ZFZ A;  3HBR A;  2Y91 A;  3OZH A;  1YLJ A;  3CG5 A;  1W8Y A;  2EFU A;  4X53 A;  3NI9 A;  4Z9Q A;  1SKF A;  4RA7 A;  5CHM A;  1GHM A;  1WE4 A;  4GDN A;  1QME A;  1XP4 A;  4GNU A;  1DY6 A;  1KGF A;  4R3J A;  1ES4 A;  1ONH A;  1LI9 A;  4B4Z A;  4BQM A;  5HAR A;  4S2N C;  3C7U A;  1JTD A;  4X68 A;  4EQI A;  5GLA A;  2XEP A;  4E3I A;  3WS2 A;  1KDW A;  2XD1 A;  3VP1 A;  4MBH A;  5FSR A;  4EWF A;  1XA7 A;  4DDY A;  2Z2M B;  4KZA A;  3UE3 A;  4GZB A;  3FZC A;  4OPZ A;  4UA6 A;  4XUX A;  5EPH A;  5GLB A;  4CPK A;  5FQJ A;  3UE1 A;  3WS1 A;  1WYC A;  3A3D A;  2DRW A;  3HVF A;  3BEB A;  3ZVT A;  2H5S A;  3O86 A;  4DE1 A;  1ZG4 A;  2H10 A;  4NK3 A;  3HUO A;  4MBF A;  1MBL A;  4S2K A;  4B4X A;  4CJN A;  4DXB A;  4LV3 A;  1VQQ A;  4JXV A;  1PZP A;  3ZCZ A;  1ZKJ A;  4BD1 A;  1TDG A;  4DRT A;  3GQZ A;  3VOZ A;  1KE4 A;  4R4S A;  2FFF B;  1YMX A;  5JYO A;  2HDR A;  3G2Y A;  3IH8 A;  3OPH A;  1BZA A;  4DKI A;  2R9W A;  1G6A A;  1LI0 A;  1K55 C;  5HW3 A;  1KGG A;  1CEF A;  3GVB A;  2HDU A;  1S0W A;  4GN2 A;  3RXW A;  4GDB A;  1H8Z A;  2EX9 A;  2G2W A;  1E3U A;  2C6W B;  3HLB A;  5CTN A;  1GHP A;  3IF6 B;  3NCK A;  2V2F F;  3HUM A;  4GD8 A;  2WUQ A;  2OLU A;  3PBO A;  2WGW B;  4KZ9 A;  3NDG A;  3V50 A;  2Y2I A;  1FOF A;  3BYD A;  1NY0 A;  1N9B A;  3GV9 A;  3IQA A;  3TSG A;  2EXA A;  3BLM A;  4ZJ2 A;  1VM1 A;  4E3M A;  1FSY A;  1FCO A;  3NC8 A;  4O7D A;  1FCM A;  4OLG A;  1YMS A;  1O07 A;  3BFD A;  4R4R A;  2A3U A;  3ITB A;  1XX2 A;  3MKE A;  3ZG7 B;  1BUE A;  4Y0T A;  1LLB A;  2QPN A;  1K6S A;  2ZM8 A;  5DTK A;  3PBS A;  1IEL A;  3ZHH A;  4BLM A;  4E6W A;  1NYY A;  1EI5 A;  1ES3 A;  2WYX A;  2ZM0 A;  5EEC A;  1TEM A;  3MKF A;  4E3L A;  3GTC A;  2P9V A;  4XXR A;  2Y55 A;  4WZ5 A;  3PTE A;  3AGE A;  1CEG A;  4X69 A;  5GHZ A;  5KZH A;  3RXX A;  1HTZ A;  5HAI A;  4U0T A;  1ES5 A;  3G34 A;  3PBN A;  5AQB A;  1HD8 A;  3W4O A;  3HRE A;  1ALQ A;  3P98 A;  4DE0 A;  3IT9 A;  3UPN A;  3N8R A;  2WGI A;  2WZX A;  3AGD A;  5HFO A;  4HBT A;  4S2M A;  3B3X A;  4ID4 A;  4WBG A;  3ZDJ A;  2UWX A;  2JCH A;  3Q7Z A;  3AGF A;  3DWK A;  4FCF A;  1FQG A;  5EOE A;  3A3F A;  5A90 A;  1IYQ A;  1PI5 A;  5FI6 A;  4YIN A;  4Y7P A;  4E3O A;  4P85 A;  5FQK A;  4KZ8 A;  1K56 D;  4N1X A;  4ZTK A;  2A49 A;  1IKI A;  5GLC A;  3W4P A;  5F1G A;  3C5A A;  4BL2 A;  1SDN A;  4FSF A;  4IBR A;  4PM9 A;  4KZ7 A;  1TDL A;  1SHV A;  3C7V A;  2BG1 A;  2Q9N A;  3PAG A;  4IED A;  3MZF A;  1KVM A;  2EX6 A;  1YLP A;  3G32 A;  5E2F A;  5HL1 A;  3A3J A;  1GCE A;  1ES2 A;  4JXS A;  5DTS A;  2ZJ9 A;  4WM9 A;  1XGI A;  2ZC3 B;  3OC2 A;  3GR2 A;  4Y0U A;  1FR1 A;  4PPR A;  3PAE A;  5EVI C;  4U3T A; 
#chains in the Genus database with same CATH topology
 2XF3 A;  2K7S A;  3MFD A;  3UY6 A;  4EBL A;  4OH0 A;  3DAV A;  2ZL1 B;  4LEN A;  2PRF A;  5I5L A;  3KSI A;  5CEB A;  3WRZ A;  3WS4 A;  3ITA A;  3Q1F A;  4GJ4 A;  3O87 A;  2IWB A;  5EVL A;  2ZOI A;  1NZU A;  3VP2 A;  4JKT A;  2V0U A;  3WRT A;  4OPQ A;  4WF0 A;  2Z2L B;  3EOI A;  1LL5 A;  3DW0 A;  2RL3 A;  3VFH A;  3RTY A;  4XUZ A;  4I38 A;  4EQ1 A;  4BEN A;  1TD5 A;  4FH2 A;  3V67 A;  1LSV A;  1PI4 A;  5CGS A;  4PM5 A;  3R4K A;  5EVI D;  3DTK A;  2VEA A;  1YSP A;  3IBR A;  4JLF A;  5CGW A;  2ZQ7 A;  4R0Q A;  3W4Q A;  1NXY A;  1YM1 A;  4H8R A;  4H6J B;  3EEA A;  3UMD A;  5HX9 A;  1W79 A;  1H8Y A;  1OT9 A;  4I5S A;  1E4D A;  5DFY A;  3QNB A;  4KEN B;  2D01 A;  4XT2 B;  1NRF A;  4DMZ A;  4N9K A;  4OPR A;  2O9C A;  2ZQ8 A;  5FQ9 A;  3DTM A;  3RFB A;  2VKS A;  4WZ5 C;  1S66 L;  3O3V A;  3R7W A;  2XA7 M;  1IOU A;  4F3L A;  2PDR A;  3S4X A;  2FFY A;  3MZE A;  2O99 A;  4HP9 A;  4KQO A;  3VP4 A;  3PHY A;  2LB5 A;  2Q9M A;  1GA0 A;  3BQA A;  2C5W B;  1JVJ A;  4CLC C;  3IBJ A;  3UO9 A;  1ZC2 A;  4DJ2 A;  2DNS A;  4EBP A;  2ZMA A;  2X71 A;  1L0D A;  3OPL A;  2J9P A;  3BFC A;  3HUN A;  3LYX A;  3M2J A;  2ZC7 A;  2P04 A;  3OBF A;  2OLV A;  4OP8 A;  1IKG A;  2ZLY A;  4HBU A;  1N4O A;  1ERO A;  4MN5 A;  3Q82 A;  2PU4 A;  3MR0 A;  4JF6 A;  2AVX A;  5CEC A;  5HAP A;  4ZAM A;  2WKH A;  1NWZ A;  4QB8 A;  5TR7 A;  3UB8 A;  2RCX A;  4N1H A;  4K0X A;  4CLC E;  3T4J A;  3CJM A;  3A0S A;  1AXB A;  2ZC4 B;  1ACF A;  1STZ A;  2A24 A;  3IXH A;  3KO6 A;  5J4E A;  1Z6F A;  1XJ6 A;  2Y2Q A;  4Q0H A;  2Y2L A;  1Y54 A;  2L4R A;  4F94 A;  2HP5 A;  4Q8I A;  4B93 A;  3SW1 A;  4ESP A;  1Z09 A;  4QHC A;  4R38 A;  1V9Y A;  4OKP A;  4YOF A;  2IWC A;  4EBN A;  2ZMF A;  1J3W A;  2ACG A;  5BOH A;  3CHW P;  1TS7 A;  1I2W A;  2OSU A;  1KOU A;  3MQQ A;  3F1N A;  3T1R A;  1BUL A;  3KYQ A;  4N92 A;  5A93 A;  4LRY C;  1ESU A;  1KGE A;  1YLZ A;  2QHK A;  1PWD A;  1NJ4 A;  1JNU A;  4FUW A;  1MWS A;  3JVV A;  3O88 A;  4IVI A;  3F1O B;  1G68 A;  4LPZ A;  1K6R A;  1XA1 A;  3BJN A;  4MN7 A;  3CWF A;  2K2N A;  3FKW A;  3DBA A;  4ME4 A;  1OT6 A;  2PYP A;  3KSH A;  5A92 A;  3V3S A;  5AQ7 A;  1X0O A;  2V8C A;  4BBU A;  2Y2H A;  5F1F A;  5K5B A;  4EUZ A;  3TW8 A;  1MXO A;  5F68 A;  2PU2 A;  4WMC D;  2PHY A;  3U2A A;  3C4P A;  1BLC A;  5FDS A;  5U47 A;  4JXG A;  3IF6 C;  4WEK A;  3LIC A;  1S67 L;  2B5R A;  1K54 C;  4GS9 B;  3CG5 A;  2EFU A;  2V8F A;  1UWP X;  4YNR A;  4WN5 A;  1WE4 A;  4GDN A;  1XP4 A;  3CLO A;  1ONH A;  5A8B A;  4GHI B;  4EQI A;  3T1X A;  2FH5 A;  3LIE A;  4E3I A;  3WS2 A;  1OJG A;  3FZC A;  4R70 A;  4XUX A;  4L9G A;  5FQJ A;  2WKQ A;  3HVF A;  3BEB A;  2H5S A;  3O86 A;  2H10 A;  4S2K A;  3HUO A;  4JXV A;  1ZKJ A;  4BMW A;  4BD1 A;  3MF0 A;  1D1J A;  1TDG A;  4PAU A;  3GQZ A;  4R4S A;  2W3E A;  3G2Y A;  1LI0 A;  3RXW A;  1H8Z A;  2V2F F;  5F5Y A;  2VV7 A;  2OLU A;  1GSW A;  3V50 A;  1FOF A;  1NY0 A;  1ZHH B;  4YWZ A;  2EXA A;  3BLM A;  3T1Q B;  3FC7 A;  4ZJ2 A;  4E3M A;  2PR6 A;  1FCM A;  3BY9 A;  1YSQ A;  3ITB A;  3MMH A;  3ZG7 B;  5EM1 A;  3UB5 P;  4HNB A;  1EI5 A;  1ES3 A;  2WYX A;  5EVE A;  4E3L A;  2KLI A;  2J3T D;  3PTE A;  4HJ3 A;  2EWV A;  5GHZ A;  1HTZ A;  2W3F A;  3G34 A;  5AQB A;  2QKP A;  3F1P B;  1ALQ A;  3IT9 A;  3UPN A;  3AGD A;  4HBT A;  4WBG A;  3ZDJ A;  2UWX A;  2JCH A;  3Q7Z A;  1CQA A;  5FI6 A;  2JN7 A;  3QP5 A;  3UB7 A;  3C5A A;  4EET B;  4KZ7 A;  2Q9N A;  3PAG A;  2ZMV A;  1GCE A;  2HJE A;  4X1L A;  1MZU A;  2JKF A;  3LFV A;  3PAE A;  4E3K A;  4QU3 A;  5TBM B;  2B02 A;  2E8I A;  2W3D A;  2ZQA A;  4KG2 A;  2XQZ A;  2HDQ A;  5FAO A;  3A0R A;  1YT4 A;  3EGX C;  1LSX A;  2JKT I;  3F1O A;  3TG9 A;  1YKD A;  3LO7 A;  4KZB A;  2OV5 A;  3A0V A;  1XFQ A;  4UA9 A;  3N4I A;  3ZYT A;  5HDD A;  1MWR A;  2HPB A;  2R78 A;  2KX6 A;  3E98 A;  3K2N A;  2G7U A;  2HP9 A;  4JGQ A;  5L09 A;  3IWI A;  5I94 A;  2ZD8 A;  2P74 A;  3NOP C;  2EXB A;  1K38 A;  4MLL A;  3O5Y A;  5FEF A;  1XGJ A;  2H28 A;  3OPP A;  4C6Y A;  1PWC A;  4KG5 A;  3BFF A;  1J9M A;  1XJ3 A;  4ZJ3 A;  1ZTU A;  4C75 A;  3OLO A;  4BJP A;  5HPI A;  4Y5F A;  1OME A;  5FI7 A;  3RJU A;  1BTL A;  3K3C A;  1PWG A;  4OOL A;  2QJ7 A;  3L7H A;  4DXC A;  2W27 A;  3PBT A;  1XPB A;  1EW0 A;  5M19 A;  2VGK A;  4EXO A;  4WLA A;  2HZ5 A;  2BLS A;  1FSW A;  3A3E A;  4NET A;  2M7V A;  1E25 A;  4O0P A;  1LSW A;  4DE2 A;  3CPT A;  3VSK A;  4PM6 A;  4U0X A;  5HL6 A;  2WGV A;  2ZQD A;  4P6Z S;  3S7O A;  3UDI A;  3UB6 A;  1S1Y A;  3HLW A;  5L07 A;  4L9E A;  4GKU A;  4ZBE A;  4P6Z M;  4EER A;  3MZD A;  4KZ3 A;  2V0W A;  4DN0 A;  3LY4 A;  3M2K A;  1TS6 A;  5HDS A;  1N9O A;  2GX5 A;  5FQM A;  4OOY A;  4I3J A;  2V20 A;  5AJG A;  4LCL A;  2EX2 A;  2VGL M;  4M3K A;  1OPX A;  4Y17 A;  4II7 A;  4G3K A;  4RQ9 A;  4GW9 A;  3DTE A;  4HI4 A;  1ESI A;  3SH9 A;  4ZRR A;  2XH9 A;  1L0F A;  1YQS A;  3H9W A;  2JKR M;  4BD0 A;  3BWL A;  3ICY A;  1S6R A;  3T50 A;  1IYO A;  4JGO A;  3IHB A;  5M18 A;  3HJI A;  3OPR A;  4LV0 A;  4X6T A;  3QHY A;  1ERQ A;  4R3A A;  5GL9 A;  2XGN A;  5FAP A;  1JWZ A;  4L0L A;  1CF0 A;  3IXD A;  3WS0 A;  1OTE A;  1N9L A;  3TJZ C;  4EV4 A;  3F1P A;  2J3W A;  1ZG6 A;  3NEC A;  4HHD A;  2W3G A;  5HAQ A;  1GA9 A;  1GHI A;  4QY5 A;  3HLF A;  5EUA A;  3CI6 A;  5J3W A;  4WMC A;  3S1Y A;  5DJU A;  2HV1 A;  3EEH A;  4GD6 A;  2PD7 A;  3T12 B;  5FQQ A;  1F98 A;  3D3O A;  5E2H A;  4CLC B;  5HWT A;  5CHU A;  4OQ0 A;  2ZOH A;  3B33 A;  1MWT A;  3ISG A;  5KMW A;  1NRJ A;  3P09 A;  2GNX A;  1TF1 A;  5DVA A;  2XRN A;  3C2W A;  1T1A A;  5CXW A;  4UAA A;  4MMN A;  2O9A A;  1JWV A;  4HIA A;  1MKI A;  3BW6 A;  5CRF A;  4IHQ A;  3BEC A;  2EWW A;  3KYZ A;  4OOM A;  1L0E A;  3B47 A;  3ZVW A;  1VEU B;  3D4F A;  5GLD A;  4X25 A;  3H82 A;  4EUV A;  3IS2 B;  3UPP A;  3MFX A;  3ZGA B;  4UQI S;  1L2S A;  4KUK A;  3SH8 A;  3FPV A;  3IF5 A;  5FAQ A;  2KDK A;  3CMZ A;  4KZ5 A;  2Y2M A;  3TE8 A;  4E3N A;  3NOU C;  4UQI M;  4FOF A;  3G4P A;  1RGY A;  4S2O A;  3EGD C;  4Y2F A;  3DWZ A;  4DF6 A;  1TS0 A;  1H8M A;  1L3L A;  3Q07 A;  2OWH A;  5E2G A;  3SS3 A;  3NJA A;  3WWX A;  2DCF A;  5D3O A;  3LI9 A;  3G6O A;  4Y13 A;  4S2L A;  4ETX A;  3CIT A;  1A0K A;  2VJW A;  1DY6 A;  4R3J A;  1ES4 A;  4BQM A;  4S2N C;  4UEY A;  2XEP A;  2ZBB A;  3LIF A;  4LRZ E;  4MBH A;  5FSR A;  1XA7 A;  4KZA A;  3UE3 A;  2PR5 A;  1TS8 A;  3S7N A;  3UME A;  3E4P A;  3A3D A;  1VET B;  3ZVT A;  1ZG4 A;  4MBF A;  1MBL A;  4PHT A;  2L0W A;  1F9I A;  3W2Z A;  2JHE A;  2B95 A;  3KYE A;  3LEQ A;  2J80 A;  3L9K A;  3OPH A;  1BZA A;  1K55 C;  4GDB A;  3IF6 B;  5EM0 A;  2WGW B;  4KZ9 A;  2ZL1 A;  3GV9 A;  1DP9 A;  1VM1 A;  2Z6D A;  1FSY A;  3NC8 A;  2HJ9 C;  4OLG A;  3NHQ A;  4O8G A;  3EWK A;  3MKE A;  4Y0T A;  2QPN A;  2ZM8 A;  3PBS A;  1IEL A;  3QP6 A;  4HH3 A;  4WZ5 A;  3RXX A;  5HAI A;  3W4O A;  4BBT A;  4DE0 A;  1S4S A;  2HGV A;  5HD5 A;  3MJQ A;  3AGF A;  4HP4 A;  5EOE A;  3HJK A;  1PI5 A;  4Y7P A;  4CLC A;  4EU0 A;  4KZ8 A;  3LIB A;  5GLC A;  1SDN A;  4FSF A;  2K31 A;  1TDL A;  2BG1 A;  4H6J A;  1KVM A;  1YLP A;  2DMW A;  3IX3 A;  3FG8 A;  2GZA A;  4JXS A;  5DTS A;  2ZJ9 A;  1T1B A;  5EVI C;  1Q2Q A;  5HD3 A;  4XT2 A;  2WZZ A;  3IXG A;  4NEE D;  2WKE A;  3PBQ A;  2OAQ 1;  1L0G A;  4DJ3 A;  4UHU A;  3LEZ A;  2WAF A;  2PD8 A;  1OJ5 A;  5DTT A;  4Q0I A;  2XDM A;  4GLQ A;  1PYY A;  3NY4 A;  4AFI A;  1K57 A;  5AQ9 A;  2P9V B;  2Y2J A;  3V5M A;  2V1Z A;  1DJA A;  4LLO B;  4HQA A;  4MN6 A;  1JWP A;  3EQU A;  1YLT A;  1OTB A;  5HWW A;  3PBR A;  2P7J A;  3BLS A;  3ZNY A;  2GDN A;  4IUK A;  3ZG8 B;  5F82 A;  2WAD A;  2UV0 E;  1LHY A;  4C3Q A;  1MY8 A;  4P6B A;  5E43 A;  3GMW A;  5AQA A;  1PW8 A;  3KX0 X;  1W7F A;  3FV7 A;  4S2J A;  5TGF A;  2VK3 A;  1BT5 A;  2XRO A;  1SCW A;  3DTI A;  2W1R A;  5CX7 A;  3VSL A;  3MBZ A;  4X56 A;  4B88 A;  3VE4 A;  1P97 A;  3QP8 A;  2FZ0 A;  3NDE A;  1F5M A;  1BLS A;  3VMA A;  2XR0 A;  3PXP A;  1N9N A;  1WYB A;  2IWD A;  1T1C A;  3HLE A;  4NXE A;  4ZJ1 A;  5KSC A;  3UDX A;  2HP6 A;  1PZO A;  3BQ8 A;  4MBK A;  3ZG9 B;  2J7V A;  2Y2N A;  1T19 A;  3NIA A;  1BSG A;  3BY8 A;  3VP3 A;  2Y2P A;  3GRJ A;  1W5D A;  3G2Z A;  4GCZ A;  4WYY A;  3CUE A;  2QMI A;  3E4O A;  4DE3 A;  1G28 A;  5EOO A;  3WS5 A;  5FEG A;  1DP6 A;  1S1Z A;  1DJC A;  2M1C A;  4KQD A;  2ZC5 B;  3UPO A;  4E6X A;  2X01 A;  2QYB A;  5MC7 A;  3BFE A;  3UE0 A;  5FI2 A;  3LR4 A;  4KG6 A;  2Q0O A;  3QNC A;  4PM8 A;  1W63 M;  3V3R A;  3S7Q A;  4HY8 A;  2Y4A A;  2W1T B;  1K4F A;  3BRM A;  1LT0 A;  4JGR A;  3MXQ A;  3CZD A;  1MC0 A;  3HLG A;  4LFU A;  5EE8 A;  3SOI A;  1CK3 A;  3B42 A;  1FCN A;  4MCW A;  5J8X A;  5L10 A;  4M4X A;  4FH4 A;  4PM7 A;  3W8K A;  2X02 A;  3T4K A;  1HVB A;  4ZDX A;  1K4E A;  2VGJ A;  1KE0 A;  4X1M A;  1H0M A;  3VE3 A;  3IXB A;  4CLC D;  2QZ6 A;  1K25 A;  3M6B A;  4MDZ A;  5A91 A;  4NXB A;  1K56 A;  4F3L B;  5M1A A;  2XFS A;  2I72 A;  2INW A;  4GS9 A;  1HLU P;  3ZG5 A;  2ZQC A;  3RH8 B;  2VLG A;  3QP1 A;  2XLN A;  1CI8 A;  5HDC A;  2HDS A;  3OCN A;  4QJG A;  3T4T A;  5FQI A;  2Y2O A;  4GHI A;  1G6O A;  3LR3 A;  2OAP 1;  3NBL A;  4PMA A;  5E2E A;  5HZH A;  1MPL A;  1ERM A;  3OCL A;  2H0T A;  4FTX A;  4WZ4 A;  2JC7 A;  2JBF A;  4IVK A;  5TJJ A;  4R3B A;  2EX8 A;  5CHJ A;  4K0W A;  1PFL A;  4E3J A;  4OQI A;  3ZG0 A;  1XJ4 A;  4BL3 A;  4D60 A;  1XKZ A;  5DF9 A;  4EEU A;  2GJ3 A;  1RCJ A;  2WKI A;  4HEF A;  3UE6 A;  1M40 A;  5F83 A;  1BYW A;  5FDH A;  1NZO A;  5L8M A;  3FWL A;  3IH9 A;  4RX3 A;  5FA7 A;  1RP5 A;  4LV1 A;  1O7E A;  4RVA A;  4LV2 A;  5DFX A;  2JKT M;  3IHA A;  4Q0J A;  2A24 B;  4KZ4 A;  4L9F A;  3N8S A;  3G35 A;  2BTF P;  4EEP A;  5EV0 A;  1IEM A;  3UDF A;  5GHY A;  3IX8 A;  4P87 A;  3KSG A;  3HBR A;  3OZH A;  5IU1 A;  1W8Y A;  1XJ2 A;  4Z9Q A;  4RA7 A;  1GHM A;  1MKM A;  1LI9 A;  3KSF A;  4O01 A;  5HAR A;  3C7U A;  4X68 A;  4LRX C;  1KDW A;  3F1N B;  3HCY A;  1OTA A;  4EWF A;  3CAX A;  2Z2M B;  4GZB A;  3ULF A;  5HSQ A;  4UA6 A;  4CPK A;  1WYC A;  1D06 A;  2J3T C;  4DE1 A;  4B4X A;  5DKK A;  1VQQ A;  4HH2 A;  3ZCZ A;  4DRT A;  3NUL A;  3VOZ A;  4HJ4 A;  2IA2 A;  3IH8 A;  2R9W A;  1G6A A;  5HW3 A;  3C8C A;  3T4S A;  1KGG A;  5C5K A;  3GVB A;  2HDU A;  4GN2 A;  2EX9 A;  5TBM A;  2KOI A;  1E3U A;  2C6W B;  3HLB A;  4Y15 A;  5CTN A;  1GHP A;  2YKH A;  3NCK A;  4GD8 A;  3P01 A;  3PBO A;  3NDG A;  2W1T A;  3BYD A;  3TSG A;  1N9B A;  2QJ5 A;  4HOI A;  4O7D A;  1YMS A;  1O07 A;  1FIL A;  1OTD A;  4R4R A;  2A3U A;  1XX2 A;  3GEC A;  1K6S A;  5DTK A;  3ZHH A;  4BLM A;  4E6W A;  3LIA A;  3T4O A;  2M7U A;  2ZM0 A;  1TEM A;  4I3A A;  5AVE A;  3GTC A;  4BBV A;  4X69 A;  1CEG A;  5KZH A;  4ARZ B;  1HD8 A;  2VA0 A;  3JVU A;  3HRE A;  3UB9 A;  3N8R A;  2XA7 S;  5HFO A;  4S2M A;  3B3X A;  4ID4 A;  1UWN X;  3DWK A;  4E04 A;  5A90 A;  1V9Z A;  4JGP A;  1W63 Q;  2XSS A;  2Y8H A;  1NLY A;  4P85 A;  1K56 D;  4N1X A;  4ZTK A;  2A49 A;  1IKI A;  3W4P A;  5F1G A;  4BL2 A;  3LID A;  4IBR A;  4PM9 A;  5G4Y A;  2A2L A;  4IED A;  3MZF A;  4KUO A;  5E2F A;  5HL1 A;  4LGW A;  3GR2 A;  1FR1 A;  4PPR A;  1Y4O A;  2PBD P;  2B18 A;  2EFX A;  2PT7 A;  4B9O A;  1IYP A;  1SDE A;  4KQR A;  4EES A;  3VFF A;  1OTI A;  4QD4 A;  3VOL A;  2Y2K A;  2NUP C;  2P08 A;  5CER A;  2PAV P;  3MSH A;  1SKO B;  3ZNT A;  3Q7V B;  2ZC6 B;  4Y0O A;  1KE3 A;  2H0Y A;  4LCM A;  1JTG A;  1VB6 A;  5JYP A;  1FIK A;  3UN7 A;  4G3W A;  2OOL A;  4WL9 A;  2J9O A;  3D9Y A;  3LCE A;  2XK1 A;  1BLH A;  5G18 A;  3IWO A;  3T1S A;  2Y79 A;  3N6I A;  1MWU A;  1K57 C;  2R9X A;  4RYE A;  3N8L A;  3S7P A;  2LB9 A;  3LR0 A;  3JYI A;  3MXR A;  4K91 A;  4PKY G;  1KDS A;  3I7J A;  4JBF A;  1DP8 A;  4GB7 A;  4JF4 A;  5EVI B;  5DF7 A;  2VV8 A;  3T4L A;  2W3H A;  4OVD A;  1T18 A;  4MNR A;  4JF5 A;  1I5Q A;  3HL9 A;  5HPF A;  4I39 A;  4OON A;  4HES A;  3MS6 A;  3OOV A;  3E2L A;  2E8J A;  2Y59 A;  3C30 A;  2JE5 A;  2OWJ A;  2VV6 A;  3HLD A;  4IJG A;  3G30 A;  4Z1W A;  3E0Y A;  1Q2P A;  3BFG A;  1Y28 A;  1PIO A;  1QMF A;  1IYS A;  4QPR A;  1KVL A;  4NG2 A;  4Y3I A;  3EQV A;  5KIZ A;  3LGO A;  3P7N A;  3QP4 A;  2MJ6 A;  2VZW A;  4OQH A;  1NLZ A;  2L1M A;  2Z6C A;  3N7W A;  5FAS A;  1LL9 A;  4BWI A;  2NUT C;  2G2U A;  3V39 A;  3HLC A;  3SS5 A;  1HZO A;  2I9V A;  1YLY A;  1C3B A;  2BAS A;  1E3U D;  5DKL A;  3TOI A;  5TFQ A;  4R1G A;  3IX4 A;  4MEZ A;  2D02 A;  3CUE C;  3BM6 A;  4IBX A;  5CGX A;  3FKV A;  1PW1 A;  3VP0 A;  3U4L P;  1YAX A;  1VHM A;  5J7E A;  1IFQ A;  2WKR A;  4S2N A;  1WA9 A;  1XXM A;  3IWQ A;  3TRC A;  3T4Q A;  3VV4 A;  4FD8 A;  1VEU A;  3GSG A;  4N9L A;  1RGZ A;  4NXF A;  3SZT A;  1EWZ A;  3NOT C;  4R23 A;  3FYZ A;  5DF8 A;  1ONG A;  3IS2 A;  3PR6 A;  1D7E A;  4OQG A;  3Q81 A;  1M6K A;  2JKG A;  4ARZ A;  2XFT A;  3S22 A;  2WK0 A;  5IHV A;  5KSH A;  1DJB A;  4WEJ A;  2WAE A;  5GHX A;  4UA7 A;  3CPT B;  4QY6 A;  3G31 A;  3FPW A;  3M6H A;  2O0Y A;  1FR6 A;  1XFN A;  3MQ0 A;  2HF6 A;  1K55 A;  2VX8 A;  5LBR A;  4P0M A;  2YKF A;  1W8Q A;  4QWO A;  3E2K A;  3H7W B;  4DDS A;  4OP5 A;  5HWV A;  4A5R A;  4YFM A;  5CED A;  4NXG A;  3UNW A;  1GSV A;  3C38 A;  3MXS A;  3VOY A;  4D2O A;  1DRM A;  4EW7 A;  4KZ6 A;  5F6A A;  3LY3 A;  3SS4 A;  4IUH A;  3A3I A;  1CI9 A;  5G4Z A;  1SKO A;  3SH7 A;  4GOG A;  3Q7V A;  1P9R A;  2XD5 A;  1VET A;  4RX2 A;  3QP2 A;  2PBY A;  4S2P A;  4OPY A;  5EFW A;  5AVF A;  1YLW A;  5FAT A;  2EA9 A;  1P0Z A;  4JXW A;  4WEL A;  1TVF A;  4X55 A;  4CQH A;  4S2I A;  4KQQ A;  1NYM A;  1U60 A;  3IF6 A;  5L2F A;  3MQO A;  2ZQ9 A;  2WGW A;  1K54 A;  1H5X A;  4ETZ A;  1BLP A;  3C4O A;  4JPM A;  2CC1 A;  3K3D A;  5EVI A;  2PYR A;  5CTM A;  1I2S A;  2ZM2 A;  4OLD A;  2J8Y A;  4PKY A;  2Y2G A;  3ZFZ A;  2Y91 A;  1YLJ A;  4X53 A;  3NI9 A;  1SKF A;  5CHM A;  5IT5 A;  1QME A;  4GNU A;  1KGF A;  4B4Z A;  4WUJ A;  4NKP A;  1JTD A;  5GLA A;  2V1A A;  2XD1 A;  3VP1 A;  4G3V A;  4DDY A;  4OPZ A;  5EPH A;  5GLB A;  3UE1 A;  3WS1 A;  1ODV A;  2WKP A;  5FL3 A;  2DRW A;  3E4Q A;  1F2K A;  4NK3 A;  4CJN A;  4DXB A;  2JKR I;  4LV3 A;  1PZP A;  1S4R A;  3H82 B;  3R7W B;  1KE4 A;  2FFF B;  3LUQ A;  1YMX A;  5JYO A;  2HDR A;  4DKI A;  5DJT A;  3LI8 A;  1CEF A;  1K0K A;  4HJ6 A;  1S0W A;  2G2W A;  3HUM A;  2WUQ A;  1G5U A;  1H3Q A;  2Y2I A;  3IQA A;  3ZQ5 A;  4I3I A;  3GDI A;  1FCO A;  3BFD A;  1YPR A;  1BUE A;  1LLB A;  2V9A A;  2CMN A;  5F69 A;  1NYY A;  1UGU A;  5EEC A;  3MKF A;  2P9V A;  4XXR A;  2Y55 A;  3AGE A;  5IS1 A;  1CJF A;  1ES5 A;  3PBN A;  4U0T A;  1SZV A;  2V1B A;  3P98 A;  1P9W A;  2WGI A;  3JPU A;  2WZX A;  4FCF A;  1FQG A;  3A3F A;  3LR5 A;  1IYQ A;  1LL8 A;  4YIN A;  4E3O A;  3H7W A;  2W0N A;  5FQK A;  3PYP A;  1GSX A;  1AWI A;  3C7V A;  1SHV A;  2EX6 A;  4K08 A;  3G32 A;  2VGL S;  2O9B A;  4R6L A;  3A3J A;  1ES2 A;  1PRQ A;  4WM9 A;  1XGI A;  1PNE A;  2ZC3 B;  3OC2 A;  2QWS A;  4Y0U A;  3D72 A;  4U3T A; 
#chains in the Genus database with same CATH homology
 2XF3 A;  4E3K A;  1Q2Q A;  4QU3 A;  2E8I A;  2EFX A;  2ZQA A;  4KG2 A;  3MFD A;  2XQZ A;  1IYP A;  2HDQ A;  2WZZ A;  3UY6 A;  3IXG A;  4OH0 A;  4EBL A;  5FAO A;  1YT4 A;  2WKE A;  1SDE A;  4KQR A;  3PBQ A;  4LEN A;  3TG9 A;  3LO7 A;  4KZB A;  4QD4 A;  1L0G A;  2Y2K A;  2OV5 A;  5CER A;  3VFF A;  4UA9 A;  3N4I A;  5CEB A;  3ZNT A;  4UHU A;  3WRZ A;  3WS4 A;  3LEZ A;  3Q7V B;  1MWR A;  2WAF A;  2ZC6 B;  3ITA A;  5DTT A;  3Q1F A;  4Y0O A;  2XDM A;  3O87 A;  2IWB A;  5EVL A;  1KE3 A;  2H0Y A;  4LCM A;  1JTG A;  5JYP A;  1NZU A;  1PYY A;  3NY4 A;  3VP2 A;  2HPB A;  4JKT A;  3UN7 A;  1K57 A;  3WRT A;  2HP9 A;  5AQ9 A;  2P9V B;  2Y2J A;  4OPQ A;  3V5M A;  3IWI A;  2V1Z A;  1DJA A;  5I94 A;  2ZD8 A;  2Z2L B;  2J9O A;  2P74 A;  1JWP A;  1LL5 A;  1YLT A;  2EXB A;  3DW0 A;  3EQU A;  2XK1 A;  3LCE A;  1BLH A;  1K38 A;  4MLL A;  5G18 A;  3IWO A;  2RL3 A;  3N6I A;  3VFH A;  3PBR A;  1MWU A;  1K57 C;  1XGJ A;  2R9X A;  3OPP A;  4C6Y A;  1PWC A;  3BLS A;  3ZNY A;  4XUZ A;  4RYE A;  2GDN A;  4BEN A;  3N8L A;  4FH2 A;  4KG5 A;  1PI4 A;  3ZG8 B;  3BFF A;  5CGS A;  1J9M A;  5F82 A;  4PM5 A;  2WAD A;  4ZJ3 A;  1LHY A;  5EVI D;  3JYI A;  4C3Q A;  3MXR A;  1MY8 A;  4K91 A;  4C75 A;  1KDS A;  4P6B A;  3I7J A;  4JBF A;  4BJP A;  5E43 A;  4JLF A;  5CGW A;  3GMW A;  1OME A;  5AQA A;  1PW8 A;  2ZQ7 A;  4R0Q A;  4GB7 A;  1BTL A;  5FI7 A;  3RJU A;  1W7F A;  4JF4 A;  3FV7 A;  3W4Q A;  1NXY A;  1PWG A;  4S2J A;  5EVI B;  5DF7 A;  4OOL A;  5TGF A;  1BT5 A;  1YM1 A;  4H8R A;  1SCW A;  4OVD A;  4DXC A;  3VSL A;  3PBT A;  3MBZ A;  1XPB A;  4MNR A;  4X56 A;  4JF5 A;  4B88 A;  1I5Q A;  3HL9 A;  2VGK A;  5HX9 A;  5M19 A;  4OON A;  1W79 A;  4HES A;  3NDE A;  1H8Y A;  2BLS A;  1FSW A;  1BLS A;  3A3E A;  4NET A;  3VMA A;  1E4D A;  2XR0 A;  1E25 A;  3QNB A;  3E2L A;  2Y59 A;  4KEN B;  4DE2 A;  2JE5 A;  1NRF A;  3HLD A;  4N9K A;  3G30 A;  1WYB A;  2IWD A;  4OPR A;  3VSK A;  1Q2P A;  2ZQ8 A;  3BFG A;  5FQ9 A;  3DTM A;  1PIO A;  1QMF A;  3HLE A;  4ZJ1 A;  5KSC A;  3UDX A;  2HP6 A;  4PM6 A;  4U0X A;  1PZO A;  1IYS A;  2WGV A;  1KVL A;  2ZQD A;  4MBK A;  3ZG9 B;  3EQV A;  2J7V A;  4WZ5 C;  2Y2N A;  3UDI A;  3NIA A;  3HLW A;  1BSG A;  4GKU A;  3O3V A;  4OQH A;  4ZBE A;  3VP3 A;  2Y2P A;  3N7W A;  3GRJ A;  5FAS A;  3MZD A;  1LL9 A;  1W5D A;  3S4X A;  4KZ3 A;  2FFY A;  3G2Z A;  4WYY A;  2G2U A;  3MZE A;  3V39 A;  2QMI A;  3LY4 A;  3M2K A;  4KQO A;  3VP4 A;  5FQM A;  3HLC A;  3SS5 A;  4OOY A;  1HZO A;  4DE3 A;  2Q9M A;  1GA0 A;  1YLY A;  1C3B A;  2C5W B;  1JVJ A;  2V20 A;  5EOO A;  3WS5 A;  1E3U D;  3UO9 A;  1DJC A;  1ZC2 A;  2DNS A;  4EBP A;  2ZMA A;  5TFQ A;  4R1G A;  3TOI A;  4LCL A;  4MEZ A;  2X71 A;  1L0D A;  2EX2 A;  4M3K A;  2J9P A;  2ZC5 B;  3BFC A;  3BM6 A;  3HUN A;  3OPL A;  3M2J A;  2ZC7 A;  3FKV A;  4IBX A;  5CGX A;  2X01 A;  4E6X A;  1PW1 A;  3VP0 A;  3BFE A;  3UE0 A;  5FI2 A;  4KG6 A;  3QNC A;  2OLV A;  4PM8 A;  3V3R A;  4OP8 A;  1ESI A;  1IKG A;  3SH9 A;  2ZLY A;  2Y4A A;  2XH9 A;  1L0F A;  1YQS A;  4HBU A;  1K4F A;  3BRM A;  4S2N A;  4BD0 A;  1N4O A;  1ERO A;  1S6R A;  3CZD A;  1XXM A;  3IWQ A;  3HLG A;  5EE8 A;  3SOI A;  4FD8 A;  3Q82 A;  4N9L A;  3GSG A;  1CK3 A;  2PU4 A;  1RGZ A;  1IYO A;  4JF6 A;  3IHB A;  5CEC A;  5HAP A;  3OPR A;  4LV0 A;  4ZAM A;  5M18 A;  1EWZ A;  4X6T A;  4R23 A;  3QHY A;  1ERQ A;  3FYZ A;  1FCN A;  5GL9 A;  2XGN A;  5DF8 A;  5FAP A;  1ONG A;  2WKH A;  1JWZ A;  4L0L A;  4OQG A;  4QB8 A;  5TR7 A;  5J8X A;  3Q81 A;  3IXD A;  2RCX A;  3WS0 A;  4N1H A;  1M6K A;  2XFT A;  4FH4 A;  4K0X A;  4PM7 A;  3S22 A;  3W8K A;  2WK0 A;  5IHV A;  4EV4 A;  5KSH A;  1DJB A;  4WEJ A;  1ZG6 A;  2X02 A;  2WAE A;  3CJM A;  5GHX A;  1AXB A;  2ZC4 B;  4UA7 A;  1HVB A;  4QY6 A;  3G31 A;  4ZDX A;  3M6H A;  3IXH A;  5HAQ A;  1GA9 A;  1GHI A;  1K4E A;  1Z6F A;  2VGJ A;  4QY5 A;  1FR6 A;  2Y2Q A;  3HLF A;  1KE0 A;  5EUA A;  3IXB A;  2Y2L A;  1K55 A;  3S1Y A;  1Y54 A;  4WMC A;  2QZ6 A;  4F94 A;  2HP5 A;  4P0M A;  4Q8I A;  1K25 A;  1W8Q A;  3M6B A;  4GD6 A;  3E2K A;  5A91 A;  5FQQ A;  5E2H A;  1K56 A;  5M1A A;  4DDS A;  5CHU A;  2XFS A;  2I72 A;  4OQ0 A;  4OP5 A;  3ZG5 A;  2ZQC A;  4A5R A;  4QHC A;  4YFM A;  5CED A;  4OKP A;  3UNW A;  2IWC A;  2XLN A;  1CI8 A;  1MWT A;  4EBN A;  2HDS A;  3ISG A;  3MXS A;  3OCN A;  3VOY A;  4QJG A;  5BOH A;  4D2O A;  5KMW A;  5FQI A;  2Y2O A;  3P09 A;  4KZ6 A;  3LY3 A;  2OSU A;  1I2W A;  3SS4 A;  3NBL A;  4PMA A;  5DVA A;  5E2E A;  1MPL A;  1ERM A;  3A3I A;  3OCL A;  1BUL A;  1CI9 A;  5CXW A;  2H0T A;  4N92 A;  4UAA A;  5A93 A;  1ESU A;  1KGE A;  1YLZ A;  1JWV A;  4WZ4 A;  2JC7 A;  2JBF A;  4IVK A;  1PWD A;  3SH7 A;  1MKI A;  4GOG A;  4R3B A;  1NJ4 A;  3Q7V A;  2EX8 A;  1MWS A;  3O88 A;  5CHJ A;  4IVI A;  5CRF A;  3BEC A;  1G68 A;  2XD5 A;  4K0W A;  4E3J A;  4RX2 A;  4OQI A;  1K6R A;  1XA1 A;  4OOM A;  3ZG0 A;  4BL3 A;  2PBY A;  1L0E A;  1XKZ A;  3FKW A;  3ZVW A;  4S2P A;  3D4F A;  5GLD A;  5DF9 A;  4OPY A;  1RCJ A;  1YLW A;  5FAT A;  5A92 A;  3V3S A;  2WKI A;  4HEF A;  3UPP A;  1M40 A;  5F83 A;  3ZGA B;  5AQ7 A;  1L2S A;  5FDH A;  4JXW A;  3SH8 A;  2Y2H A;  3IF5 A;  1NZO A;  4WEL A;  3FWL A;  5FAQ A;  1TVF A;  5F1F A;  4EUZ A;  3IH9 A;  3CMZ A;  4KZ5 A;  4RX3 A;  5FA7 A;  1RP5 A;  2Y2M A;  4X55 A;  4LV1 A;  4E3N A;  1O7E A;  4S2I A;  4RVA A;  4KQQ A;  4LV2 A;  1MXO A;  1NYM A;  3G4P A;  1RGY A;  1U60 A;  3IF6 A;  3IHA A;  4S2O A;  4KZ4 A;  2PU2 A;  4WMC D;  3DWZ A;  5L2F A;  2ZQ9 A;  2WGW A;  1K54 A;  1H5X A;  4DF6 A;  1BLP A;  3C4O A;  3C4P A;  3N8S A;  4JPM A;  2CC1 A;  3G35 A;  1BLC A;  3Q07 A;  5E2G A;  5U47 A;  3SS3 A;  5EVI A;  4JXG A;  5CTM A;  1IEM A;  3WWX A;  3UDF A;  3IF6 C;  2DCF A;  4WEK A;  5D3O A;  5GHY A;  1I2S A;  2ZM2 A;  2B5R A;  4OLD A;  3UPO A;  1K54 C;  4S2L A;  4P87 A;  2J8Y A;  2Y2G A;  3ZFZ A;  3HBR A;  2Y91 A;  3OZH A;  1YLJ A;  3CG5 A;  1W8Y A;  2EFU A;  4X53 A;  3NI9 A;  4Z9Q A;  1SKF A;  4RA7 A;  5CHM A;  1GHM A;  1WE4 A;  4GDN A;  1QME A;  1XP4 A;  4GNU A;  1DY6 A;  1KGF A;  4R3J A;  1ES4 A;  1ONH A;  1LI9 A;  4B4Z A;  4BQM A;  5HAR A;  4S2N C;  3C7U A;  1JTD A;  4X68 A;  4EQI A;  5GLA A;  2XEP A;  4E3I A;  3WS2 A;  1KDW A;  2XD1 A;  3VP1 A;  4MBH A;  5FSR A;  4EWF A;  1XA7 A;  4DDY A;  2Z2M B;  4KZA A;  3UE3 A;  4GZB A;  3FZC A;  4OPZ A;  4UA6 A;  4XUX A;  5EPH A;  5GLB A;  4CPK A;  5FQJ A;  3UE1 A;  3WS1 A;  1WYC A;  3A3D A;  2DRW A;  3HVF A;  3BEB A;  3ZVT A;  2H5S A;  3O86 A;  4DE1 A;  1ZG4 A;  2H10 A;  4NK3 A;  3HUO A;  4MBF A;  1MBL A;  4S2K A;  4B4X A;  4CJN A;  4DXB A;  4LV3 A;  1VQQ A;  4JXV A;  1PZP A;  3ZCZ A;  1ZKJ A;  4BD1 A;  1TDG A;  4DRT A;  3GQZ A;  3VOZ A;  1KE4 A;  4R4S A;  2FFF B;  1YMX A;  5JYO A;  2HDR A;  3G2Y A;  3IH8 A;  3OPH A;  1BZA A;  4DKI A;  2R9W A;  1G6A A;  1LI0 A;  1K55 C;  5HW3 A;  1KGG A;  1CEF A;  3GVB A;  2HDU A;  1S0W A;  4GN2 A;  3RXW A;  4GDB A;  1H8Z A;  2EX9 A;  2G2W A;  1E3U A;  2C6W B;  3HLB A;  5CTN A;  1GHP A;  3IF6 B;  3NCK A;  2V2F F;  3HUM A;  4GD8 A;  2WUQ A;  2OLU A;  3PBO A;  2WGW B;  4KZ9 A;  3NDG A;  3V50 A;  2Y2I A;  1FOF A;  3BYD A;  1NY0 A;  1N9B A;  3GV9 A;  3IQA A;  3TSG A;  2EXA A;  3BLM A;  4ZJ2 A;  1VM1 A;  4E3M A;  1FSY A;  1FCO A;  3NC8 A;  4O7D A;  1FCM A;  4OLG A;  1YMS A;  1O07 A;  3BFD A;  4R4R A;  2A3U A;  3ITB A;  1XX2 A;  3MKE A;  3ZG7 B;  1BUE A;  4Y0T A;  1LLB A;  2QPN A;  1K6S A;  2ZM8 A;  5DTK A;  3PBS A;  1IEL A;  3ZHH A;  4BLM A;  4E6W A;  1NYY A;  1EI5 A;  1ES3 A;  2WYX A;  2ZM0 A;  5EEC A;  1TEM A;  3MKF A;  4E3L A;  3GTC A;  2P9V A;  4XXR A;  2Y55 A;  4WZ5 A;  3PTE A;  3AGE A;  1CEG A;  4X69 A;  5GHZ A;  5KZH A;  3RXX A;  1HTZ A;  5HAI A;  4U0T A;  1ES5 A;  3G34 A;  3PBN A;  5AQB A;  1HD8 A;  3W4O A;  3HRE A;  1ALQ A;  3P98 A;  4DE0 A;  3IT9 A;  3UPN A;  3N8R A;  2WGI A;  2WZX A;  3AGD A;  5HFO A;  4HBT A;  4S2M A;  3B3X A;  4ID4 A;  4WBG A;  3ZDJ A;  2UWX A;  2JCH A;  3Q7Z A;  3AGF A;  3DWK A;  4FCF A;  1FQG A;  5EOE A;  3A3F A;  5A90 A;  1IYQ A;  1PI5 A;  5FI6 A;  4YIN A;  4Y7P A;  4E3O A;  4P85 A;  5FQK A;  4KZ8 A;  1K56 D;  4N1X A;  4ZTK A;  2A49 A;  1IKI A;  5GLC A;  3W4P A;  5F1G A;  3C5A A;  4BL2 A;  1SDN A;  4FSF A;  4IBR A;  4PM9 A;  4KZ7 A;  1TDL A;  1SHV A;  3C7V A;  2BG1 A;  2Q9N A;  3PAG A;  4IED A;  3MZF A;  1KVM A;  2EX6 A;  1YLP A;  3G32 A;  5E2F A;  5HL1 A;  3A3J A;  1GCE A;  1ES2 A;  4JXS A;  5DTS A;  2ZJ9 A;  4WM9 A;  1XGI A;  2ZC3 B;  3OC2 A;  3GR2 A;  4Y0U A;  1FR1 A;  4PPR A;  3PAE A;  5EVI C;  4U3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...