5CXWA

Structure of the pona1 protein from mycobacterium tuberculosis in complex with penicillin v
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
380
structure length
376
Chain Sequence
KGPNGLIERQVTRELLELFNIDEQTLNTQGLVVTTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSIDPHNGAVRAYYGGDNANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDGIKITNVEGEGCGTCNIAEALKMSLNTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVAHTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGIYHPPHFVQKVVSANGQVLFDASTGDQRIPKAVADNVTAAMEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANKDAWMVGYTPSLSTAVWVGTVKGDEPLVTASGAAIYGSGLPSDIWKATMDGALKGTSNETFPKPTEVGGYAGVPPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 1A
publication title Crystal structures of the transpeptidase domain of the Mycobacterium tuberculosis penicillin-binding protein PonA1 reveal potential mechanisms of antibiotic resistance.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Penicillin-binding protein/antibiotic
total genus 119
structure length 376
sequence length 380
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5cxwA00
1KVLA 4R0QA 1L0DA 2WGWB 2C5WB 4LCMA 3N8SA 2OLVA 2B5RA 5EOEA 2ZQAA 4RYEA 2EX2A 3BFCA 1FCNA 3OCLA 5E2GA 5FSRA 2WYXA 3A3EA 2ZM8A 3N8RA 3IF6A 4JXVA 1YLWA 4MBKA 5FAPA 1KE3A 5CHJA 4Y7PA 4KZ3A 3G32A 2WKEA 3GTCA 3S1YA 3MFDA 3N7WA 3BFFA 4N1XA 2Y91A 4P87A 3HVFA 2X02A 4ZAMA 1E3UD 1PZOA 1C3BA 3ZNYA 1JWVA 4KZ4A 3UDXA 1IKIA 2HDQA 4DRTA 4DKIA 3SH9A 3IWOA 2ZM0A 3C7VA 4NK3A 5HARA 1NXYA 3IT9A 1MWSA 4Y0UA 3BRMA 2Y59A 2OSUA 2JC7A 3IXGA 2ZLYA 3PBRA 4RVAA 1RGYA 1FR1A 2V20A 5FQJA 5IHVA 3ZG5A 5DTSA 3WRTA 1MXOA 4PPRA 3RXXA 3LCEA 3QHYA 4OP8A 2HDUA 3SH7A 1U60A 4DF6A 4EBLA 4F94A 3UPOA 4QY5A 2HPBA 3N4IA 3PBNA 5F83A 2H5SA 4S2MA 2ZD8A 5GLDA 3BYDA 1PW1A 2ZQCA 3Q82A 1IKGA 2QMIA 5EOOA 4B88A 3SS5A 4BQMA 2OLUA 1GA9A 2ZC6B 4WELA 3NBLA 1ES4A 2PU2A 1FOFA 5FI2A 4OOMA 4K91A 3DWZA 1WE4A 4N1HA 3MZEA 1LI0A 2XGNA 1G6AA 3FYZA 4UAAA 4DE2A 5FQ9A 5D3OA 2XH9A 4CJNA 3OPPA 4Y0TA 1QMFA 3G31A 4E3KA 2H0YA 5JYOA 3W4QA 4KENB 1YM1A 4JLFA 2OV5A 1HZOA 4DXCA 1FSYA 4R1GA 3MXRA 4YFMA 1RCJA 4BLMA 2WGWA 3EQUA 4X55A 4E3OA 1NJ4A 2XFSA 5CGXA 1LLBA 3FWLA 3BFEA 4RX3A 4JF4A 3VP3A 2Y2HA 2EX8A 3DWKA 3HLEA 1N9BA 2PU4A 5E43A 1Q2QA 3FKWA 2Y55A 1ERMA 4K0XA 4JXWA 4WBGA 4EUZA 2Y2JA 1W5DA 4UA9A 2C6WB 3LY3A 4OLDA 4OVDA 1H5XA 5TFQA 3ZG7B 5L2FA 1RP5A 1SDNA 2Q9MA 4OQ0A 3D4FA 1NZUA 5A90A 2VGJA 2Y2PA 1PWCA 1FSWA 4IBXA 4QHCA 1K55C 3SOIA 4S2KA 1CI9A 4GDBA 1G68A 2ZQ9A 5M19A 5GHXA 1LL5A 4WYYA 5GLBA 5CERA 5CHMA 1KGFA 1MWTA 1LL9A 4GN2A 2J9PA 1YT4A 5TGFA 3GMWA 1IYOA 3TG9A 1TDGA 5DF7A 3BFGA 3UO9A 5J8XA 3O88A 2V1ZA 4C6YA 3BLMA 4GNUA 2J9OA 2X01A 1BLHA 3VSLA 4X68A 1YMXA 1JWPA 3A3IA 4R23A 1BLCA 5CTMA 5FQIA 5F1FA 4B4XA 1ZG6A 4IEDA 4PM9A 1BZAA 1MKIA 1E25A 3BFDA 3C4PA 4KQOA 4OPYA 4WZ4A 1I2WA 4S2OA 2XQZA 3MZDA 5HW3A 4ZDXA 5KSHA 2BLSA 2ZC4B 4OONA 3S4XA 3MKFA 3UPPA 5DTKA 1NRFA 4BD1A 4MLLA 2ZQ8A 4OOLA 4X53A 3UN7A 4OLGA 1FR6A 2Y2GA 4DDYA 4OOYA 4S2NA 4PM8A 3UDIA 4KZ8A 4S2LA 4IVKA 2Y2LA 3AGDA 5EVIB 4GKUA 3SH8A 4C75A 3A3DA 4X56A 3ZDJA 1LI9A 3P09A 1CEFA 4EV4A 2WGVA 5FQMA 2Y2NA 3CG5A 2R9XA 5CEDA 1IYPA 1FCOA 4QY6A 1GHIA 4PM7A 1RGZA 3PBOA 3NDGA 3VFHA 4BD0A 4EQIA 4QJGA 3HREA 3VP2A 2R9WA 1K6RA 4FD8A 2UWXA 1TDLA 3ZGAB 1BLSA 1DY6A 2WAEA 4OQIA 4E3IA 4ZJ2A 4LENA 5A93A 1YLYA 1PW8A 1XXMA 5GHYA 3G2ZA 4WZ5C 5GLAA 1K4EA 4KG5A 2PBYA 1AXBA 3VOZA 4LCLA 3M2JA 5CGSA 1Z6FA 1YLPA 3DW0A 1O7EA 1PYYA 1ZKJA 3NCKA 3UE1A 4OKPA 4GD8A 4JXGA 2JBFA 1K38A 5E2HA 4B4ZA 1N4OA 2EXBA 3BM6A 3BLSA 3V50A 4GOGA 3WRZA 4JF6A 3HBRA 4DE1A 3IXBA 1K54A 1BTLA 3IF6C 1ONHA 1M6KA 1H8ZA 4BL2A 2HP6A 4UA6A 3FV7A 2ZQDA 3HLWA 1E4DA 4M3KA 3UDFA 3HLBA 5FA7A 2WADA 3PAEA 4MBFA 4PM6A 2Q9NA 2XR0A 5U47A 2WGIA 2XEPA 3FZCA 3HLGA 3W4PA 1ESUA 1SCWA 3VP0A 3UNWA 3ZCZA 5BOHA 2CC1A 2JE5A 1TVFA 4EBPA 3ZG8B 2JCHA 2Y2IA 3BECA 4H8RA 3IHBA 4PM5A 4HESA 2ZM2A 5EVID 4IBRA 5EVIA 5DF8A 3VP1A 4FCFA 2XD1A 3TOIA 2I72A 3LEZA 3EQVA 3QNCA 2EX9A 1W7FA 1ES5A 4E3LA 2Z2LB 4ID4A 4IVIA 5HAIA 4K0WA 3A3FA 4ZBEA 3NIAA 1PZPA 3Q81A 4Q8IA 4S2PA 5G18A 3Q1FA 3C4OA 4N9LA 4X6TA 2WUQA 3N6IA 1CEGA 5EECA 4BENA 4BJPA 1H8YA 5FDHA 3Q7ZA 4GB7A 1K56A 4E3NA 3HLFA 2XDMA 3ITAA 1KE4A 4OH0A 1YQSA 2G2UA 3W8KA 3WS5A 1K6SA 3IQAA 1NY0A 3AGEA 3FKVA 4C3QA 5AQ7A 2ZQ7A 4EWFA 1IELA 3V39A 3IXHA 5EVIC 2A3UA 1HVBA 4KZ6A 1HTZA 1MWRA 3AGFA 4S2IA 1K57A 1S6RA 2EFXA 1ERQA 3HUOA 2ZC7A 4KG2A 3HL9A 1DJAA 3M2KA 4U0XA 2V2FF 3RXWA 1KE0A 1YLJA 2XLNA 5CGWA 3C7UA 1TEMA 4FH2A 4E6WA 2EFUA 3LO7A 5DTTA 3NI9A 5TR7A 1PWDA 3RJUA 4OQGA 4OPRA 4P6BA 2J8YA 2H10A 3P98A 1L0GA 2DRWA 4R3JA 5FI7A 3BEBA 1W79A 5DVAA 1XA1A 3IH9A 1ES3A 1GHPA 5CTNA 2Y2MA 5CRFA 2XD5A 2WAFA 4R4RA 3V3RA 3ZVWA 1CK3A 2ZC3B 2DCFA 3GQZA 3JYIA 4ZTKA 1LHYA 1W8QA 4QD4A 4FSFA 2QZ6A 3G35A 4N92A 1XX2A 1CI8A 2VGKA 3VOYA 4WEJA 5FQKA 3ZNTA 1EI5A 1S0WA 3E2KA 4U3TA 3ZHHA 1KDWA 1FQGA 5DF9A 5CXWA 5KSCA 3VSKA 3UPNA 3OC2A 1KVMA 2RCXA 3CZDA 1YLTA 3UE0A 4JBFA 5KZHA 5F82A 3ZG0A 1Q2PA 1BUEA 1YLZA 4ZJ3A 3DTMA 5HX9A 1JTGA 1L0FA 2WK0A 2Y2QA 3GVBA 3WS1A 3LY4A 5HAPA 4YINA 4FH4A 1VQQA 4QU3A 3IWQA 5GLCA 4XUZA 4S2NC 3ISGA 3MBZA 4MBHA 3CMZA 5E2FA 4ZJ1A 1K4FA 1XGIA 3OPLA 4O7DA 5A91A 5JYPA 1IYQA 4GDNA 1PI5A 1EWZA 1JVJA 1PIOA 5HAQA 1HD8A 5CHUA 2Z2MB 2ZJ9A 1KGGA 1Y54A 3A3JA 4WEKA 3G34A 4KQQA 5AQAA 3V3SA 3CJMA 1NZOA 1E3UA 4E3JA 4OQHA 1OMEA 3Q07A 3E2LA 4E6XA 3N8LA 3C5AA 3Q7VA 2J7VA 2X71A 3ITBA 3NC8A 2HP9A 1ONGA 5FAOA 4MEZA 5EVLA 3ZVTA 3ZG9B 4LV3A 1KDSA 2P74A 3MXSA 4P0MA 5F1GA 3G30A 1MWUA 3OPRA 4P85A 5M1AA 2QPNA 5EUAA 4N9KA 3VP4A 1KGEA 2XF3A 3QNBA 2XFTA 4S2JA 1L0EA 4U0TA 2WKIA 5AQBA 4KG6A 1WYCA 2HDRA 2H0TA 2ZMAA 1GCEA 5FATA 1SHVA 3GR2A 4GD6A 4RA7A 4PMAA 5FI6A 3WS4A 4GZBA 4JXSA 1I5QA 4KZ5A 2G2WA 1BT5A 4UA7A 1XGJA 5HFOA 4DXBA 1K54C 1BULA 2P9VB 3M6HA 5CECA 3GRJA 3IF5A 4MNRA 4HBUA 4UHUA 1EROA 1YMSA 4LV2A 3SS4A 3OCNA 1SKFA 1K55A 4DDSA 5EPHA 2Y2KA 4HEFA 1BSGA 2EXAA 4R4SA 4KQRA 4KZBA 4EBNA 4KZ7A 3IH8A 4E3MA 4A5RA 1L2SA 3O86A 1K56D 2IWCA 3NDEA 3GSGA 3I7JA 3PTEA 5GL9A 4QB8A 2WKHA 3HLDA 4LV1A 4JF5A 3V5MA 3HUNA 5CEBA 1DJBA 1WYBA 1PWGA 3PBTA 4WMCD 5HL1A 5KMWA 4Z9QA 5I94A 4WMCA 3OPHA 3IF6B 2FFYA 3SS3A 4OP5A 3PAGA 1SDEA 2ZC5B 1FCMA 1JTDA 4DE3A 1J9MA 4KZAA 3VMAA 3OZHA 1BLPA 1VM1A 1XP4A 4R3BA 3IHAA 3PBQA 5AQ9A 4XUXA 1MPLA 4WM9A 3W4OA 1MBLA 3Q7VB 4XXRA 3HUMA 2RL3A 4L0LA 4X69A 1NYMA 1ES2A 1MY8A 3IWIA 5FQQA 1K25A 3WWXA 5GHZA 4HBTA 3GV9A 3PBSA 2Y2OA 1ALQA 2WZXA 2IWBA 4BL3A 2BG1A 2HDSA 3G4PA 3UY6A 2WZZA 2DNSA 3WS2A 5M18A 3HLCA 3VFFA 5FAQA 3MKEA 4OPZA 3TSGA 2HP5A 1IEMA 3S22A 3NY4A 1JWZA 3IXDA 1GA0A 4JKTA 3UE3A 2GDNA 4OPQA 1NYYA 1XKZA 4RX2A 1K57C 5FASA 2IWDA 3MZFA 1XPBA 3WS0A 1ZC2A 1XA7A 4JPMA 3O3VA 1QMEA 2P9VA 1IYSA 1GHMA 3ZFZA 4Y0OA 1ZG4A 1M40A 3G2YA 4WZ5A 3B3XA 3M6BA 1W8YA 4D2OA 2Y4AA 5E2EA 4KZ9A 5A92A 2XK1A 2A49A 1DJCA 3O87A 1PI4A 5EE8A 1O07A 2EX6A 1ESIA 2FFFB 4DE0A 4CPKA 1I2SA 4NETA 2E8IA 4LV0A
chains in the Genus database with same CATH superfamily
1L0DA 4LCMA 3OLOA 4RYEA 1FCNA 4Y13A 2WYXA 3N8RA 4JXVA 5FAPA 5CHJA 3C8CA 4UQIS 1XJ4A 3MFDA 4N1XA 3HVFA 1TS6A 4I38A 1PZOA 4KZ4A 5L8MA 4DKIA 3S7QA 3KYEA 3R7WA 3BRMA 2OSUA 2ZLYA 3CPTA 1FR1A 2V20A 1OTAA 5IHVA 2Y8HA 3BW6A 3FG8A 4GCZA 3LCEA 2HDUA 1U60A 2QKPA 4QY5A 2K2NA 3PBNA 4S2MA 5GLDA 1PW1A 2PHYA 5EOOA 4B88A 3SS5A 5IU1A 3LIBA 2OLUA 3DTKA 3NBLA 5FI2A 4K91A 4Y3IA 1G6AA 3FYZA 5FQ9A 3OPPA 1QMFA 5JYOA 1HZOA 5F68A 4YFMA 4BLMA 1ZTUA 4X55A 4E3OA 4EUVA 2XFSA 3BFEA 2GX5A 4NXFA 1Q2QA 3FKWA 4WBGA 4UA9A 3LY3A 4OVDA 2MJ6A 1SDNA 1IOUA 3OOVA 4OQ0A 3H9WA 1NZUA 1FSWA 4QHCA 2UV0E 4S2KA 5GHXA 3IX4A 1KGFA 2VGLS 2LB9A 2PBDP 3TG9A 5FL3A 4FTXA 2A24B 5DF7A 4C6YA 4GNUA 2J9OA 1BLHA 1BLCA 2YKHA 3BFDA 4KQOA 1I2WA 2WKPA 3EEHA 4BD1A 3GDIA 4DDYA 4OOYA 2Y2LA 3SH8A 3A3DA 4X56A 3IS2B 3BJNA 1DRMA 3CG5A 1FCOA 4PM7A 5TBMB 3QP1A 4BD0A 3MQOA 3HREA 3VP2A 1K6RA 4E3IA 1XXMA 1GSVA 3G2ZA 3VOZA 2O0YA 2PR6A 1TS7A 3UE1A 4GD8A 5E2HA 1N4OA 3LR5A 1VETA 1S1YA 2BASA 1M6KA 4KUKA 4WLAA 4M3KA 1E4DA 3ZYTA 1TF1A 3PAEA 2Q9NA 4CLCB 3FZCA 3UNWA 2PD8A 2CC1A 5FDSA 3BECA 4HESA 3ZQ5A 4IHQA 1H0MA 4IBRA 3VP1A 4HNBA 1LT0A 3PHYA 4XT2A 1ES5A 4ID4A 2PYPA 1OJGA 3T4TA 4Q8IA 4S2PA 4N9LA 1P9RA 3KSFA 3F1NA 1GSXA 4KQDA 3JPUA 4GB7A 3RTYA 5K5BA 2G2UA 2M7UA 2KOIA 2O9CA 4EWFA 1IELA 2A3UA 1HVBA 1HTZA 1MWRA 4S2IA 2ZC7A 3M2KA 2HJ9C 2XLNA 2D02A 4FH2A 5G4ZA 1DP9A 5DTTA 3IX8A 4BMWA 2H10A 3P98A 2OAP1 4MMNA 5DJUA 5DVAA 3IH9A 1ES3A 2W3DA 3MSHA 4X1MA 1VHMA 4HP9A 2DCFA 4ZTKA 4QD4A 2QZ6A 3G35A 4IJGA 1CI8A 2VGKA 3NOTC 4WEJA 1EI5A 1FQGA 5DF9A 4UQIM 3CZDA 5HPFA 4YOFA 4Z1WA 2QJ7A 3E0YA 3GVBA 5AVFA 3LY4A 1LL8A 4QU3A 4D60A 3ISGA 1V9YA 4BBTA 1XGIA 3IX3A 1NLZA 5A91A 1PI5A 4JGQA 1EWZA 5HAQA 1Y54A 4WEKA 5AQAA 1NZOA 3LIDA 2V0UA 3Q7VA 2J7VA 4X25A 4DJ3A 5EVLA 2P74A 5C5KA 4P0MA 2KX6A 4N9KA 4GS9B 4U0TA 5AQBA 2INWA 1WYCA 2H0TA 1GCEA 4DDSA 1SHVA 3C30A 2J80A 5EM1A 4B9OA 3VE4A 3IF5A 3TJZC 4HBUA 4ARZA 3OCNA 4HP4A 1K55A 5EPHA 2JN7A 2Y2KA 2EXAA 4KZBA 4EBNA 4KZ7A 3HCYA 3D9YA 4A5RA 1L2SA 3K2NA 4QB8A 1WYBA 5HL1A 4IUHA 3K3CA 5I94A 2VGLM 3IF6B 4EW7A 4OP5A 5HWTA 4HJ6A 2XRNA 5HZHA 1XP4A 4XUXA 1OTBA 3L9KA 1Y28A 3IWIA 3WWXA 3IBRA 2Y2OA 3UY6A 2WZZA 3HLCA 5FAQA 4HH2A 3H7WA 3NY4A 4JKTA 2PRFA 1NYYA 1XKZA 4JPMA 3BQAA 2P9VA 3ZFZA 1M40A 4WZ5A 3B3XA 4NXEA 4D2OA 2Y4AA 2XK1A 1AWIA 3SW1A 1ESIA 1YAXA 2QWSA 1I2SA 3T4QA 2OLVA 5EOEA 1P9WA 3DTIA 5FSRA 2ZM8A 1KE3A 4Y7PA 3N7WA 3BFFA 2R78A 1C3BA 2EWWA 2ZMVA 3MMHA 3ZNYA 1JWVA 4DRTA 3SH9A 3IWOA 3C7VA 4NK3A 5HARA 1NXYA 2HJEA 1MC0A 2JC7A 1RGYA 3ZG5A 4EETB 3RXXA 3T4SA 2O9BA 4EBLA 4F94A 2HPBA 2ZQCA 3Q82A 4MDZA 1GA9A 2HZ5A 2ZC6B 1ES4A 4OOMA 2V1BA 3DWZA 1WE4A 2XH9A 3G31A 2E8JA 4JLFA 2OV5A 1FSYA 2VJWA 1LSWA 1YSQA 3CI6A 2WGWA 5CGXA 3FWLA 5TBMA 2EX8A 3HLEA 1N9BA 4GJ4A 3DBAA 1ERMA 4EUZA 3KO6A 1YKDA 2PD7A 5TFQA 1H5XA 1F9IA 2JKTM 5DKLA 2VGJA 2Y2PA 3T4JA 3UB5P 1K55C 1CI9A 3LR4A 2ZQ9A 3LR3A 4UEYA 3F1PB 4BBUA 5CERA 5CHMA 5HD3A 1F5MA 3GMWA 1UWPX 4CQHA 5J8XA 3LIFA 1XJ2A 3BLMA 2X01A 4X68A 1YMXA 3A3IA 4R23A 3W2ZA 3UB7A 2I9VA 4CLCA 4WZ4A 4OPYA 4S2OA 3MZDA 5HW3A 4OONA 2B02A 5DTKA 4MLLA 4OOLA 3UN7A 3QP6A 2Y2GA 2V1AA 4KZ8A 5EVIB 4GKUA 4EV4A 3P09A 1CEFA 5DJTA 4ZRRA 2R9XA 1IYPA 3NOUC 1RGZA 3NDGA 2XA7M 1OTDA 4EQIA 4QJGA 3ULFA 2R9WA 1DY6A 2WAEA 4LENA 3UMDA 1PW8A 4WZ5C 1KOUA 2PBYA 4KG5A 4L9EA 3MR0A 4LCLA 5CGSA 1YLPA 2JKGA 1VEUB 1OT6A 1O7EA 3JVUA 1ZKJA 5J3WA 4ME4A 4OKPA 5L10A 2JBFA 1K38A 1Z09A 2EXBA 4LRYC 4EU0A 4GOGA 4JF6A 1K54A 2J3TD 1ONHA 2KDKA 1XJ6A 4BL2A 1XFNA 4UA6A 3FV7A 3S7OA 3HLWA 3UDFA 3HLBA 4PM6A 3F1OA 5U47A 2WGIA 2XEPA 3HLGA 3W4PA 4GLQA 1N9LA 1S67L 1TVFA 2ZM2A 4O0PA 2B95A 2XD1A 3S7PA 5DFXA 3EQVA 4X1LA 2EX9A 1W7FA 4EERA 5HAIA 3A3FA 2PYRA 1YSPA 3Q1FA 3C4OA 1JNUA 4EXOA 4BENA 3BY8A 1UWNX 2V8FA 1ODVA 2G7UA 4BJPA 3H82A 2JKRI 5HD5A 1OPXA 3KSIA 3AGEA 3FKVA 4BWIA 3V39A 3IXHA 4KZ6A 3AGFA 3E4QA 1H3QA 4KG2A 2GJ3A 4U0XA 2EWVA 5CGWA 3G6OA 4CLCD 1PWDA 3GECA 4OQGA 1SKOA 1TS0A 1L0GA 5J4EA 1L3LA 3EGDC 3FPWA 1XA1A 5CTNA 4MN5A 4PKYG 4R4RA 3JYIA 2VZWA 5F5YA 1XX2A 4JGOA 5F6AA 3E2KA 1KDWA 2IA2A 3VSKA 3UPNA 1YLTA 3UE0A 4K08A 4CLCC 5F82A 5KZHA 1Q2PA 1JTGA 1L0FA 3WS1A 5HAPA 3NULA 2QHKA 4I39A 2J3WA 4MBHA 3OPLA 4R70A 1A0KA 1S66L 1JVJA 5CHUA 2ZJ9A 1OMEA 3E2LA 4ESPA 5L07A 2X71A 3ITBA 3NC8A 4MEZA 3MXSA 5M1AA 2W1TA 2QPNA 3VP4A 3E4PA 3QNBA 2XFTA 4KG6A 2HDRA 4R3AA 5FI6A 3GR2A 3WS4A 4RA7A 4GZBA 4UA7A 1K54C 2VX8A 3KYQA 1NRJA 5CECA 3NJAA 1GSWA 1K0KA 1BSGA 1T1BA 2B18A 4PHTA 3BY9A 2IWCA 3PTEA 3HLDA 2P08A 4JF5A 4QWOA 3HUNA 1DJBA 2WKRA 1PWGA 3PBTA 3DAVA 5HWVA 3OPHA 3LIEA 3PAGA 1SDEA 1Y4OA 3C38A 1FCMA 5AJGA 5HDSA 2W3HA 1J9MA 3OZHA 1BLPA 5AQ9A 3MFXA 2VV6A 4WM9A 1MBLA 1S1ZA 2RL3A 4X69A 3R7WB 1NYMA 1ES2A 1MY8A 2HF6A 1K25A 5GHZA 4CLCE 3GV9A 4H6JA 2IWBA 3UE6A 3LICA 2DNSA 4NXBA 1MKMA 2HP5A 1IEMA 1JWZA 2W0NA 1D06A 2YKFA 2OOLA 3P7NA 1XPBA 1IYSA 1GHMA 1ZG4A 3G2YA 1H8MA 3M6BA 1OTIA 5E2EA 2V0WA 1DJCA 3K3DA 1IFQA 5EE8A 4DE0A 1KVLA 4R0QA 2C5WB 1FIKA 3N8SA 2ZQAA 2EX2A 3OCLA 3A3EA 1YLWA 4KZ3A 2XA7S 2WKEA 3GTCA 2WKQA 1T1CA 2Y91A 2X02A 2HDQA 2XROA 2VKSA 2Q0OA 4KUOA 2NUTC 2PAVP 2ZL1A 2QJ5A 1MWSA 2Y59A 2PR5A 4HOIA 2VV8A 5DTSA 4PPRA 3QHYA 4OP8A 2LB5A 3SH7A 1V9ZA 3CHWP 3KYZA 5F83A 3N4IA 2ZD8A 3BYDA 4G3VA 1MZUA 4F3LA 3A0RA 4B93A 3MZEA 1LI0A 2XGNA 4UAAA 5D3OA 4Y0TA 4Q0JA 1BYWA 2H0YA 4KENB 2K7SA 4DXCA 4R1GA 1VB6A 1NJ4A 1LLBA 4RX3A 4JF4A 2PU4A 5E43A 3T1RA 2Y55A 1NWZA 4L9GA 4JXWA 5IT5A 2C6WB 5HPIA 3ZG7B 1HLUP 2VEAA 4Q0IA 2Q9MA 3D4FA 2QYBA 3UB8A 2W3GA 1DP6A 3SOIA 4GDBA 5M19A 1S4SA 1YPRA 3E4OA 1T18A 1LL9A 3LFVA 5DFYA 3MQQA 1IYOA 1VETB 2V1ZA 5CTMA 5FQIA 4G3KA 4IEDA 1MKIA 1E25A 3C4PA 5KSHA 4ZDXA 3S4XA 3T1QB 3MKFA 4P6ZS 2ZQ8A 1FR6A 3UDIA 5G4YA 2ZMFA 1LI9A 2DMWA 4XT2B 5CEDA 2Y2NA 1GHIA 5HDCA 3PBOA 4I5SA 4RQ9A 3VFHA 4FD8A 1TDLA 4OQIA 4DJ2A 4ZJ2A 3UB6A 5GLAA 2K31A 1K4EA 3CUEC 1Z6FA 1PYYA 3NCKA 3BM6A 2A24A 2OWHA 3BLSA 3LR0A 1H8ZA 3VOLA 1D1JA 5FA7A 4MBFA 2XR0A 4WF0A 3VP0A 3ZCZA 2GZAA 5BOHA 1T1AA 2JE5A 4EBPA 2Y2IA 3BWLA 4L9FA 4H8RA 5EVID 5KIZA 1CQAA 5DF8A 1ACFA 3NECA 4FCFA 3TOIA 3IS2A 3LEZA 3QNCA 2HV1A 2M1CA 4IVIA 4I3IA 5G18A 3PYPA 4X6TA 1DP8A 3A0VA 3N6IA 1CEGA 1H8YA 3LI8A 3T4LA 3S7NA 3QP8A 2XDMA 2VA0A 3ITAA 1KE4A 4OH0A 3RH8B 5AVEA 5HWWA 3WS5A 4BBVA 1K6SA 2VLGA 2KLIA 5AQ7A 2ZQ7A 5J7EA 1W63Q 5EVIC 4LFUA 2JKFA 1K57A 4I3JA 3T1XA 1DJAA 1STZA 3RXWA 3C7UA 4E6WA 3R4KA 4LLOB 3RJUA 1CF0A 2J8YA 3TW8A 4R3JA 5FI7A 3UB9A 3FC7A 2VK3A 1GHPA 2Y2MA 2P7JA 2WAFA 3V3RA 1CK3A 3GQZA 4II7A 1G28A 1LHYA 1W8QA 4GHIB 4FSFA 4N92A 1NLYA 3O5YA 3MS6A 2FZ0A 3VOYA 1S0WA 1N9OA 4U3TA 3ZHHA 5I5LA 3OC2A 4ARZB 2RCXA 1WA9A 4HY8A 3ZG0A 2HGVA 1YLZA 4HH3A 4ZJ3A 5HDDA 4YINA 2PDRA 4FH4A 4FUWA 3T1SA 5E2FA 1K4FA 2Z6DA 4O7DA 5JYPA 4M4XA 3LYXA 1IYQA 4GDNA 1PIOA 1HD8A 2D01A 2Z2MB 1KGGA 3A3JA 3G34A 1E3UA 2NUPC 4OQHA 4E3JA 3Q07A 4E6XA 3N8LA 1PFLA 3C5AA 1F98A 2HP9A 1FILA 5FAOA 3ZVTA 1F2KA 3OPRA 4P85A 5EUAA 1KGEA 2XF3A 2WKIA 3TE8A 2ZOIA 3H7WB 5FATA 4PMAA 1LSVA 4JXSA 3MF0A 2VV7A 1XGJA 5HFOA 1BULA 2P9VB 3M6HA 4FOFA 2J3TC 4DMZA 4MNRA 4UHUA 1OTEA 1YMSA 4LV2A 1SKFA 1W63M 3IH8A 3I7JA 5GL9A 4ETZA 4LV1A 3V5MA 3LEQA 5CEBA 3CLOA 4WMCD 5KMWA 2JKTI 2FFYA 3LUQA 2M7VA 1XFQA 3MQ0A 1JTDA 4R3BA 3IHAA 3PBQA 4HHDA 3KX0X 2L1MA 3W4OA 4XXRA 3HUMA 3B47A 4L0LA 4HIAA 4HBTA 4P6ZM 3PBSA 4R6LA 1ALQA 2WZXA 2HDSA 4GS9A 4WUJA 3WS2A 3MKEA 4OPZA 3S22A 3D72A 3BQ8A 1K57C 3MZFA 1XA7A 3PXPA 4Y2FA 3O3VA 3U4LP 3ICYA 1UGUA 1W8YA 1SZVA 3O87A 1PI4A 4AFIA 2EX6A 1XJ3A 1LSXA 1G6OA 4NETA 4LV0A 4LGWA 2WGWB 4JGPA 2B5RA 5EM0A 1OJ5A 3BFCA 5E2GA 3IF6A 4MBKA 2BTFP 3G32A 3U2AA 3S1YA 2W27A 4P87A 4ZAMA 1E3UD 3UDXA 1IKIA 2Y79A 2ZM0A 4GW9A 3IT9A 3VE3A 4Y0UA 3IXGA 3PBRA 3QP5A 4RVAA 5FQJA 3WRTA 1MXOA 3UPOA 4DF6A 2ZOHA 4JGRA 2H5SA 4R38A 1IKGA 2QMIA 3TRCA 4BQMA 4WELA 5MC7A 2PU2A 4ETXA 1FOFA 2ACGA 4N1HA 4DE2A 4CJNA 4E3KA 3W4QA 1YM1A 4HJ4A 2PT7A 3MXRA 1RCJA 3EQUA 4QPRA 3DTEA 3VP3A 2Y2HA 3DWKA 5FEGA 2FH5A 2CMNA 4K0XA 2Y2JA 1W5DA 1X0OA 1CJFA 4OLDA 5EV0A 5HL6A 5L2FA 1EW0A 1RP5A 5A90A 4G3WA 1PWCA 4IBXA 4MN7A 4WL9A 3T4KA 1G68A 1S4RA 1LL5A 4WYYA 5GLBA 4LPZA 1MWTA 4GN2A 2J9PA 1OT9A 2OWJA 3T50A 1YT4A 5EFWA 3CPTB 5TGFA 3LI9A 1TDGA 4NG2A 1N9NA 3BFGA 5DKKA 1TD5A 3UO9A 3O88A 3VSLA 4EEPA 1JWPA 5F1FA 3A0SA 4B4XA 1ZG6A 4I3AA 3FPVA 3L7HA 4PM9A 1BZAA 3F1OB 2XQZA 3EOIA 2BLSA 2ZC4B 3CUEA 3MXQA 3UPPA 1NRFA 2L0WA 4X53A 4OLGA 4S2NA 4PM8A 3UMEA 4S2LA 4IVKA 3AGDA 4PKYA 4C75A 3ZDJA 3D3OA 2WGVA 5LBRA 4YNRA 4Y15A 5FQMA 5F69A 4MN6A 4QY6A 2UWXA 4HJ3A 3ZGAB 1BLSA 5A93A 1YLYA 4Y5FA 5GHYA 3H82B 1AXBA 2OAQ1 3QP2A 3M2JA 3F1PA 5L09A 3DW0A 4JXGA 1PRQA 4B4ZA 3V50A 3WRZA 3HBRA 4DE1A 3IXBA 3B33A 1BTLA 3IF6C 4EEUA 2HP6A 5TJJA 2ZQDA 3VV4A 2W3FA 2WADA 1SKOB 2JHEA 1ESUA 1SCWA 4WN5A 1D7EA 1G5UA 3ZG8B 2JCHA 3IHBA 4PM5A 3T12B 2P04A 5EVIA 4NEED 4GHIA 2ZBBA 2I72A 3T4OA 3MJQA 4E3LA 2Z2LB 4K0WA 3KSGA 4ZBEA 3NIAA 1PZPA 1J3WA 3Q81A 2L4RA 2WUQA 5EECA 4YWZA 2H28A 5FDHA 3Q7ZA 1K56A 4E3NA 3HLFA 1YQSA 3W8KA 4C3QA 3IQAA 1NY0A 1VEUA 2V8CA 4NXGA 4LRXC 2AVXA 1S6RA 2EFXA 1ERQA 3HUOA 3HL9A 2V2FF 1KE0A 2GNXA 1YLJA 4DN0A 1TEMA 3EWKA 2EFUA 3LO7A 3NI9A 5TR7A 3CAXA 4OPRA 4P6BA 5IS1A 3LIAA 2DRWA 3BEBA 1W79A 5A8BA 4MCWA 2W1TB 5CRFA 3EGXC 2XD5A 3ZVWA 4Q0HA 2ZC3B 4PAUA 4HI4A 3OBFA 2W1RA 3SZTA 5FQKA 3ZNTA 3QP4A 4NKPA 5CXWA 5KSCA 1KVMA 4JBFA 3F1NB 1BUEA 3DTMA 5HX9A 2Y2QA 2WK0A 3EEAA 1VQQA 2V9AA 3IWQA 5GLCA 4XUZA 4S2NC 3MBZA 3CMZA 4ZJ1A 2XSSA 4EQ1A 3V3SA 4KQQA 3CJMA 4LRZE 1ONGA 3ZG9B 2A2LA 1KDSA 4LV3A 1P97A 5F1GA 3G30A 1MWUA 4H6JB 4S2JA 1L0EA 3NOPC 4EESA 3HJIA 2O99A 2ZMAA 1T19A 4GD6A 1I5QA 4KZ5A 2G2WA 1BT5A 1PNEA 4DXBA 3GRJA 3E98A 1EROA 5EVEA 3SS4A 3HJKA 2W3EA 4HEFA 4R4SA 4KQRA 3NHQA 3C2WA 4E3MA 4O8GA 3O86A 1K56D 3PR6A 3NDEA 3GSGA 2WKHA 1P0ZA 3KSHA 2JKRM 3CITA 5CX7A 3RFBA 4Z9QA 4WMCA 3SS3A 1ZHHB 1TS8A 5FEFA 3B42A 2ZC5B 4DE3A 3VMAA 4KZAA 1VM1A 3V67A 2Z6CA 1MPLA 3JVVA 5HSQA 3Q7VB 4HQAA 4E04A 2ZL1B 3P01A 5FQQA 2EA9A 4BL3A 2BG1A 3G4PA 5M18A 3VFFA 3TSGA 3UE3A 3IXDA 1GA0A 2GDNA 4OPQA 4RX2A 5FASA 2IWDA 4O01A 3LGOA 3WS0A 3CWFA 1ZC2A 1QMEA 2O9AA 4Y0OA 3IBJA 4F3LB 4IUKA 4KZ9A 5A92A 2A49A 1O07A 4Y17A 2FFFB 4CPKA 2E8IA
chains in the Genus database with same CATH topology
1KVLA 4R0QA 1L0DA 2WGWB 2C5WB 4LCMA 3N8SA 2OLVA 2B5RA 5EOEA 2ZQAA 4RYEA 2EX2A 3BFCA 1FCNA 3OCLA 5E2GA 5FSRA 2WYXA 3A3EA 2ZM8A 3N8RA 3IF6A 4JXVA 1YLWA 4MBKA 5FAPA 1KE3A 5CHJA 4Y7PA 4KZ3A 3G32A 2WKEA 3GTCA 3S1YA 3MFDA 3N7WA 3BFFA 4N1XA 2Y91A 4P87A 3HVFA 2X02A 4ZAMA 1E3UD 1PZOA 1C3BA 3ZNYA 1JWVA 4KZ4A 3UDXA 1IKIA 2HDQA 4DRTA 4DKIA 3SH9A 3IWOA 2ZM0A 3C7VA 4NK3A 5HARA 1NXYA 3IT9A 1MWSA 4Y0UA 3BRMA 2Y59A 2OSUA 2JC7A 3IXGA 2ZLYA 3PBRA 4RVAA 1RGYA 1FR1A 2V20A 5FQJA 5IHVA 3ZG5A 5DTSA 3WRTA 1MXOA 4PPRA 3RXXA 3LCEA 3QHYA 4OP8A 2HDUA 3SH7A 1U60A 4DF6A 4EBLA 4F94A 3UPOA 4QY5A 2HPBA 3N4IA 3PBNA 5F83A 2H5SA 4S2MA 2ZD8A 5GLDA 3BYDA 1PW1A 2ZQCA 3Q82A 1IKGA 2QMIA 5EOOA 4B88A 3SS5A 4BQMA 2OLUA 1GA9A 2ZC6B 4WELA 3NBLA 1ES4A 2PU2A 1FOFA 5FI2A 4OOMA 4K91A 3DWZA 1WE4A 4N1HA 3MZEA 1LI0A 2XGNA 1G6AA 3FYZA 4UAAA 4DE2A 5FQ9A 5D3OA 2XH9A 4CJNA 3OPPA 4Y0TA 1QMFA 3G31A 4E3KA 2H0YA 5JYOA 3W4QA 4KENB 1YM1A 4JLFA 2OV5A 1HZOA 4DXCA 1FSYA 4R1GA 3MXRA 4YFMA 1RCJA 4BLMA 2WGWA 3EQUA 4X55A 4E3OA 1NJ4A 2XFSA 5CGXA 1LLBA 3FWLA 3BFEA 4RX3A 4JF4A 3VP3A 2Y2HA 2EX8A 3DWKA 3HLEA 1N9BA 2PU4A 5E43A 1Q2QA 3FKWA 2Y55A 1ERMA 4K0XA 4JXWA 4WBGA 4EUZA 2Y2JA 1W5DA 4UA9A 2C6WB 3LY3A 4OLDA 4OVDA 1H5XA 5TFQA 3ZG7B 5L2FA 1RP5A 1SDNA 2Q9MA 4OQ0A 3D4FA 1NZUA 5A90A 2VGJA 2Y2PA 1PWCA 1FSWA 4IBXA 4QHCA 1K55C 3SOIA 4S2KA 1CI9A 4GDBA 1G68A 2ZQ9A 5M19A 5GHXA 1LL5A 4WYYA 5GLBA 5CERA 5CHMA 1KGFA 1MWTA 1LL9A 4GN2A 2J9PA 1YT4A 5TGFA 3GMWA 1IYOA 3TG9A 1TDGA 5DF7A 3BFGA 3UO9A 5J8XA 3O88A 2V1ZA 4C6YA 3BLMA 4GNUA 2J9OA 2X01A 1BLHA 3VSLA 4X68A 1YMXA 1JWPA 3A3IA 4R23A 1BLCA 5CTMA 5FQIA 5F1FA 4B4XA 1ZG6A 4IEDA 4PM9A 1BZAA 1MKIA 1E25A 3BFDA 3C4PA 4KQOA 4OPYA 4WZ4A 1I2WA 4S2OA 2XQZA 3MZDA 5HW3A 4ZDXA 5KSHA 2BLSA 2ZC4B 4OONA 3S4XA 3MKFA 3UPPA 5DTKA 1NRFA 4BD1A 4MLLA 2ZQ8A 4OOLA 4X53A 3UN7A 4OLGA 1FR6A 2Y2GA 4DDYA 4OOYA 4S2NA 4PM8A 3UDIA 4KZ8A 4S2LA 4IVKA 2Y2LA 3AGDA 5EVIB 4GKUA 3SH8A 4C75A 3A3DA 4X56A 3ZDJA 1LI9A 3P09A 1CEFA 4EV4A 2WGVA 5FQMA 2Y2NA 3CG5A 2R9XA 5CEDA 1IYPA 1FCOA 4QY6A 1GHIA 4PM7A 1RGZA 3PBOA 3NDGA 3VFHA 4BD0A 4EQIA 4QJGA 3HREA 3VP2A 2R9WA 1K6RA 4FD8A 2UWXA 1TDLA 3ZGAB 1BLSA 1DY6A 2WAEA 4OQIA 4E3IA 4ZJ2A 4LENA 5A93A 1YLYA 1PW8A 1XXMA 5GHYA 3G2ZA 4WZ5C 5GLAA 1K4EA 4KG5A 2PBYA 1AXBA 3VOZA 4LCLA 3M2JA 5CGSA 1Z6FA 1YLPA 3DW0A 1O7EA 1PYYA 1ZKJA 3NCKA 3UE1A 4OKPA 4GD8A 4JXGA 2JBFA 1K38A 5E2HA 4B4ZA 1N4OA 2EXBA 3BM6A 3BLSA 3V50A 4GOGA 3WRZA 4JF6A 3HBRA 4DE1A 3IXBA 1K54A 1BTLA 3IF6C 1ONHA 1M6KA 1H8ZA 4BL2A 2HP6A 4UA6A 3FV7A 2ZQDA 3HLWA 1E4DA 4M3KA 3UDFA 3HLBA 5FA7A 2WADA 3PAEA 4MBFA 4PM6A 2Q9NA 2XR0A 5U47A 2WGIA 2XEPA 3FZCA 3HLGA 3W4PA 1ESUA 1SCWA 3VP0A 3UNWA 3ZCZA 5BOHA 2CC1A 2JE5A 1TVFA 4EBPA 3ZG8B 2JCHA 2Y2IA 3BECA 4H8RA 3IHBA 4PM5A 4HESA 2ZM2A 5EVID 4IBRA 5EVIA 5DF8A 3VP1A 4FCFA 2XD1A 3TOIA 2I72A 3LEZA 3EQVA 3QNCA 2EX9A 1W7FA 1ES5A 4E3LA 2Z2LB 4ID4A 4IVIA 5HAIA 4K0WA 3A3FA 4ZBEA 3NIAA 1PZPA 3Q81A 4Q8IA 4S2PA 5G18A 3Q1FA 3C4OA 4N9LA 4X6TA 2WUQA 3N6IA 1CEGA 5EECA 4BENA 4BJPA 1H8YA 5FDHA 3Q7ZA 4GB7A 1K56A 4E3NA 3HLFA 2XDMA 3ITAA 1KE4A 4OH0A 1YQSA 2G2UA 3W8KA 3WS5A 1K6SA 3IQAA 1NY0A 3AGEA 3FKVA 4C3QA 5AQ7A 2ZQ7A 4EWFA 1IELA 3V39A 3IXHA 5EVIC 2A3UA 1HVBA 4KZ6A 1HTZA 1MWRA 3AGFA 4S2IA 1K57A 1S6RA 2EFXA 1ERQA 3HUOA 2ZC7A 4KG2A 3HL9A 1DJAA 3M2KA 4U0XA 2V2FF 3RXWA 1KE0A 1YLJA 2XLNA 5CGWA 3C7UA 1TEMA 4FH2A 4E6WA 2EFUA 3LO7A 5DTTA 3NI9A 5TR7A 1PWDA 3RJUA 4OQGA 4OPRA 4P6BA 2J8YA 2H10A 3P98A 1L0GA 2DRWA 4R3JA 5FI7A 3BEBA 1W79A 5DVAA 1XA1A 3IH9A 1ES3A 1GHPA 5CTNA 2Y2MA 5CRFA 2XD5A 2WAFA 4R4RA 3V3RA 3ZVWA 1CK3A 2ZC3B 2DCFA 3GQZA 3JYIA 4ZTKA 1LHYA 1W8QA 4QD4A 4FSFA 2QZ6A 3G35A 4N92A 1XX2A 1CI8A 2VGKA 3VOYA 4WEJA 5FQKA 3ZNTA 1EI5A 1S0WA 3E2KA 4U3TA 3ZHHA 1KDWA 1FQGA 5DF9A 5CXWA 5KSCA 3VSKA 3UPNA 3OC2A 1KVMA 2RCXA 3CZDA 1YLTA 3UE0A 4JBFA 5KZHA 5F82A 3ZG0A 1Q2PA 1BUEA 1YLZA 4ZJ3A 3DTMA 5HX9A 1JTGA 1L0FA 2WK0A 2Y2QA 3GVBA 3WS1A 3LY4A 5HAPA 4YINA 4FH4A 1VQQA 4QU3A 3IWQA 5GLCA 4XUZA 4S2NC 3ISGA 3MBZA 4MBHA 3CMZA 5E2FA 4ZJ1A 1K4FA 1XGIA 3OPLA 4O7DA 5A91A 5JYPA 1IYQA 4GDNA 1PI5A 1EWZA 1JVJA 1PIOA 5HAQA 1HD8A 5CHUA 2Z2MB 2ZJ9A 1KGGA 1Y54A 3A3JA 4WEKA 3G34A 4KQQA 5AQAA 3V3SA 3CJMA 1NZOA 1E3UA 4E3JA 4OQHA 1OMEA 3Q07A 3E2LA 4E6XA 3N8LA 3C5AA 3Q7VA 2J7VA 2X71A 3ITBA 3NC8A 2HP9A 1ONGA 5FAOA 4MEZA 5EVLA 3ZVTA 3ZG9B 4LV3A 1KDSA 2P74A 3MXSA 4P0MA 5F1GA 3G30A 1MWUA 3OPRA 4P85A 5M1AA 2QPNA 5EUAA 4N9KA 3VP4A 1KGEA 2XF3A 3QNBA 2XFTA 4S2JA 1L0EA 4U0TA 2WKIA 5AQBA 4KG6A 1WYCA 2HDRA 2H0TA 2ZMAA 1GCEA 5FATA 1SHVA 3GR2A 4GD6A 4RA7A 4PMAA 5FI6A 3WS4A 4GZBA 4JXSA 1I5QA 4KZ5A 2G2WA 1BT5A 4UA7A 1XGJA 5HFOA 4DXBA 1K54C 1BULA 2P9VB 3M6HA 5CECA 3GRJA 3IF5A 4MNRA 4HBUA 4UHUA 1EROA 1YMSA 4LV2A 3SS4A 3OCNA 1SKFA 1K55A 4DDSA 5EPHA 2Y2KA 4HEFA 1BSGA 2EXAA 4R4SA 4KQRA 4KZBA 4EBNA 4KZ7A 3IH8A 4E3MA 4A5RA 1L2SA 3O86A 1K56D 2IWCA 3NDEA 3GSGA 3I7JA 3PTEA 5GL9A 4QB8A 2WKHA 3HLDA 4LV1A 4JF5A 3V5MA 3HUNA 5CEBA 1DJBA 1WYBA 1PWGA 3PBTA 4WMCD 5HL1A 5KMWA 4Z9QA 5I94A 4WMCA 3OPHA 3IF6B 2FFYA 3SS3A 4OP5A 3PAGA 1SDEA 2ZC5B 1FCMA 1JTDA 4DE3A 1J9MA 4KZAA 3VMAA 3OZHA 1BLPA 1VM1A 1XP4A 4R3BA 3IHAA 3PBQA 5AQ9A 4XUXA 1MPLA 4WM9A 3W4OA 1MBLA 3Q7VB 4XXRA 3HUMA 2RL3A 4L0LA 4X69A 1NYMA 1ES2A 1MY8A 3IWIA 5FQQA 1K25A 3WWXA 5GHZA 4HBTA 3GV9A 3PBSA 2Y2OA 1ALQA 2WZXA 2IWBA 4BL3A 2BG1A 2HDSA 3G4PA 3UY6A 2WZZA 2DNSA 3WS2A 5M18A 3HLCA 3VFFA 5FAQA 3MKEA 4OPZA 3TSGA 2HP5A 1IEMA 3S22A 3NY4A 1JWZA 3IXDA 1GA0A 4JKTA 3UE3A 2GDNA 4OPQA 1NYYA 1XKZA 4RX2A 1K57C 5FASA 2IWDA 3MZFA 1XPBA 3WS0A 1ZC2A 1XA7A 4JPMA 3O3VA 1QMEA 2P9VA 1IYSA 1GHMA 3ZFZA 4Y0OA 1ZG4A 1M40A 3G2YA 4WZ5A 3B3XA 3M6BA 1W8YA 4D2OA 2Y4AA 5E2EA 4KZ9A 5A92A 2XK1A 2A49A 1DJCA 3O87A 1PI4A 5EE8A 1O07A 2EX6A 1ESIA 2FFFB 4DE0A 4CPKA 1I2SA 4NETA 2E8IA 4LV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KVL A;  4R0Q A;  1L0D A;  2WGW B;  2C5W B;  4LCM A;  3N8S A;  2OLV A;  2B5R A;  5EOE A;  2ZQA A;  4RYE A;  2EX2 A;  3BFC A;  1FCN A;  3OCL A;  5E2G A;  5FSR A;  2WYX A;  3A3E A;  2ZM8 A;  3N8R A;  3IF6 A;  4JXV A;  1YLW A;  4MBK A;  5FAP A;  1KE3 A;  5CHJ A;  4Y7P A;  4KZ3 A;  3G32 A;  2WKE A;  3GTC A;  3S1Y A;  3MFD A;  3N7W A;  3BFF A;  4N1X A;  2Y91 A;  4P87 A;  3HVF A;  2X02 A;  4ZAM A;  1E3U D;  1PZO A;  1C3B A;  3ZNY A;  1JWV A;  4KZ4 A;  3UDX A;  1IKI A;  2HDQ A;  4DRT A;  4DKI A;  3SH9 A;  3IWO A;  2ZM0 A;  3C7V A;  4NK3 A;  5HAR A;  1NXY A;  3IT9 A;  1MWS A;  4Y0U A;  3BRM A;  2Y59 A;  2OSU A;  2JC7 A;  3IXG A;  2ZLY A;  3PBR A;  4RVA A;  1RGY A;  1FR1 A;  2V20 A;  5FQJ A;  5IHV A;  3ZG5 A;  5DTS A;  3WRT A;  1MXO A;  4PPR A;  3RXX A;  3LCE A;  3QHY A;  4OP8 A;  2HDU A;  3SH7 A;  1U60 A;  4DF6 A;  4EBL A;  4F94 A;  3UPO A;  4QY5 A;  2HPB A;  3N4I A;  3PBN A;  5F83 A;  2H5S A;  4S2M A;  2ZD8 A;  5GLD A;  3BYD A;  1PW1 A;  2ZQC A;  3Q82 A;  1IKG A;  2QMI A;  5EOO A;  4B88 A;  3SS5 A;  4BQM A;  2OLU A;  1GA9 A;  2ZC6 B;  4WEL A;  3NBL A;  1ES4 A;  2PU2 A;  1FOF A;  5FI2 A;  4OOM A;  4K91 A;  3DWZ A;  1WE4 A;  4N1H A;  3MZE A;  1LI0 A;  2XGN A;  1G6A A;  3FYZ A;  4UAA A;  4DE2 A;  5FQ9 A;  5D3O A;  2XH9 A;  4CJN A;  3OPP A;  4Y0T A;  1QMF A;  3G31 A;  4E3K A;  2H0Y A;  5JYO A;  3W4Q A;  4KEN B;  1YM1 A;  4JLF A;  2OV5 A;  1HZO A;  4DXC A;  1FSY A;  4R1G A;  3MXR A;  4YFM A;  1RCJ A;  4BLM A;  2WGW A;  3EQU A;  4X55 A;  4E3O A;  1NJ4 A;  2XFS A;  5CGX A;  1LLB A;  3FWL A;  3BFE A;  4RX3 A;  4JF4 A;  3VP3 A;  2Y2H A;  2EX8 A;  3DWK A;  3HLE A;  1N9B A;  2PU4 A;  5E43 A;  1Q2Q A;  3FKW A;  2Y55 A;  1ERM A;  4K0X A;  4JXW A;  4WBG A;  4EUZ A;  2Y2J A;  1W5D A;  4UA9 A;  2C6W B;  3LY3 A;  4OLD A;  4OVD A;  1H5X A;  5TFQ A;  3ZG7 B;  5L2F A;  1RP5 A;  1SDN A;  2Q9M A;  4OQ0 A;  3D4F A;  1NZU A;  5A90 A;  2VGJ A;  2Y2P A;  1PWC A;  1FSW A;  4IBX A;  4QHC A;  1K55 C;  3SOI A;  4S2K A;  1CI9 A;  4GDB A;  1G68 A;  2ZQ9 A;  5M19 A;  5GHX A;  1LL5 A;  4WYY A;  5GLB A;  5CER A;  5CHM A;  1KGF A;  1MWT A;  1LL9 A;  4GN2 A;  2J9P A;  1YT4 A;  5TGF A;  3GMW A;  1IYO A;  3TG9 A;  1TDG A;  5DF7 A;  3BFG A;  3UO9 A;  5J8X A;  3O88 A;  2V1Z A;  4C6Y A;  3BLM A;  4GNU A;  2J9O A;  2X01 A;  1BLH A;  3VSL A;  4X68 A;  1YMX A;  1JWP A;  3A3I A;  4R23 A;  1BLC A;  5CTM A;  5FQI A;  5F1F A;  4B4X A;  1ZG6 A;  4IED A;  4PM9 A;  1BZA A;  1MKI A;  1E25 A;  3BFD A;  3C4P A;  4KQO A;  4OPY A;  4WZ4 A;  1I2W A;  4S2O A;  2XQZ A;  3MZD A;  5HW3 A;  4ZDX A;  5KSH A;  2BLS A;  2ZC4 B;  4OON A;  3S4X A;  3MKF A;  3UPP A;  5DTK A;  1NRF A;  4BD1 A;  4MLL A;  2ZQ8 A;  4OOL A;  4X53 A;  3UN7 A;  4OLG A;  1FR6 A;  2Y2G A;  4DDY A;  4OOY A;  4S2N A;  4PM8 A;  3UDI A;  4KZ8 A;  4S2L A;  4IVK A;  2Y2L A;  3AGD A;  5EVI B;  4GKU A;  3SH8 A;  4C75 A;  3A3D A;  4X56 A;  3ZDJ A;  1LI9 A;  3P09 A;  1CEF A;  4EV4 A;  2WGV A;  5FQM A;  2Y2N A;  3CG5 A;  2R9X A;  5CED A;  1IYP A;  1FCO A;  4QY6 A;  1GHI A;  4PM7 A;  1RGZ A;  3PBO A;  3NDG A;  3VFH A;  4BD0 A;  4EQI A;  4QJG A;  3HRE A;  3VP2 A;  2R9W A;  1K6R A;  4FD8 A;  2UWX A;  1TDL A;  3ZGA B;  1BLS A;  1DY6 A;  2WAE A;  4OQI A;  4E3I A;  4ZJ2 A;  4LEN A;  5A93 A;  1YLY A;  1PW8 A;  1XXM A;  5GHY A;  3G2Z A;  4WZ5 C;  5GLA A;  1K4E A;  4KG5 A;  2PBY A;  1AXB A;  3VOZ A;  4LCL A;  3M2J A;  5CGS A;  1Z6F A;  1YLP A;  3DW0 A;  1O7E A;  1PYY A;  1ZKJ A;  3NCK A;  3UE1 A;  4OKP A;  4GD8 A;  4JXG A;  2JBF A;  1K38 A;  5E2H A;  4B4Z A;  1N4O A;  2EXB A;  3BM6 A;  3BLS A;  3V50 A;  4GOG A;  3WRZ A;  4JF6 A;  3HBR A;  4DE1 A;  3IXB A;  1K54 A;  1BTL A;  3IF6 C;  1ONH A;  1M6K A;  1H8Z A;  4BL2 A;  2HP6 A;  4UA6 A;  3FV7 A;  2ZQD A;  3HLW A;  1E4D A;  4M3K A;  3UDF A;  3HLB A;  5FA7 A;  2WAD A;  3PAE A;  4MBF A;  4PM6 A;  2Q9N A;  2XR0 A;  5U47 A;  2WGI A;  2XEP A;  3FZC A;  3HLG A;  3W4P A;  1ESU A;  1SCW A;  3VP0 A;  3UNW A;  3ZCZ A;  5BOH A;  2CC1 A;  2JE5 A;  1TVF A;  4EBP A;  3ZG8 B;  2JCH A;  2Y2I A;  3BEC A;  4H8R A;  3IHB A;  4PM5 A;  4HES A;  2ZM2 A;  5EVI D;  4IBR A;  5EVI A;  5DF8 A;  3VP1 A;  4FCF A;  2XD1 A;  3TOI A;  2I72 A;  3LEZ A;  3EQV A;  3QNC A;  2EX9 A;  1W7F A;  1ES5 A;  4E3L A;  2Z2L B;  4ID4 A;  4IVI A;  5HAI A;  4K0W A;  3A3F A;  4ZBE A;  3NIA A;  1PZP A;  3Q81 A;  4Q8I A;  4S2P A;  5G18 A;  3Q1F A;  3C4O A;  4N9L A;  4X6T A;  2WUQ A;  3N6I A;  1CEG A;  5EEC A;  4BEN A;  4BJP A;  1H8Y A;  5FDH A;  3Q7Z A;  4GB7 A;  1K56 A;  4E3N A;  3HLF A;  2XDM A;  3ITA A;  1KE4 A;  4OH0 A;  1YQS A;  2G2U A;  3W8K A;  3WS5 A;  1K6S A;  3IQA A;  1NY0 A;  3AGE A;  3FKV A;  4C3Q A;  5AQ7 A;  2ZQ7 A;  4EWF A;  1IEL A;  3V39 A;  3IXH A;  5EVI C;  2A3U A;  1HVB A;  4KZ6 A;  1HTZ A;  1MWR A;  3AGF A;  4S2I A;  1K57 A;  1S6R A;  2EFX A;  1ERQ A;  3HUO A;  2ZC7 A;  4KG2 A;  3HL9 A;  1DJA A;  3M2K A;  4U0X A;  2V2F F;  3RXW A;  1KE0 A;  1YLJ A;  2XLN A;  5CGW A;  3C7U A;  1TEM A;  4FH2 A;  4E6W A;  2EFU A;  3LO7 A;  5DTT A;  3NI9 A;  5TR7 A;  1PWD A;  3RJU A;  4OQG A;  4OPR A;  4P6B A;  2J8Y A;  2H10 A;  3P98 A;  1L0G A;  2DRW A;  4R3J A;  5FI7 A;  3BEB A;  1W79 A;  5DVA A;  1XA1 A;  3IH9 A;  1ES3 A;  1GHP A;  5CTN A;  2Y2M A;  5CRF A;  2XD5 A;  2WAF A;  4R4R A;  3V3R A;  3ZVW A;  1CK3 A;  2ZC3 B;  2DCF A;  3GQZ A;  3JYI A;  4ZTK A;  1LHY A;  1W8Q A;  4QD4 A;  4FSF A;  2QZ6 A;  3G35 A;  4N92 A;  1XX2 A;  1CI8 A;  2VGK A;  3VOY A;  4WEJ A;  5FQK A;  3ZNT A;  1EI5 A;  1S0W A;  3E2K A;  4U3T A;  3ZHH A;  1KDW A;  1FQG A;  5DF9 A;  5CXW A;  5KSC A;  3VSK A;  3UPN A;  3OC2 A;  1KVM A;  2RCX A;  3CZD A;  1YLT A;  3UE0 A;  4JBF A;  5KZH A;  5F82 A;  3ZG0 A;  1Q2P A;  1BUE A;  1YLZ A;  4ZJ3 A;  3DTM A;  5HX9 A;  1JTG A;  1L0F A;  2WK0 A;  2Y2Q A;  3GVB A;  3WS1 A;  3LY4 A;  5HAP A;  4YIN A;  4FH4 A;  1VQQ A;  4QU3 A;  3IWQ A;  5GLC A;  4XUZ A;  4S2N C;  3ISG A;  3MBZ A;  4MBH A;  3CMZ A;  5E2F A;  4ZJ1 A;  1K4F A;  1XGI A;  3OPL A;  4O7D A;  5A91 A;  5JYP A;  1IYQ A;  4GDN A;  1PI5 A;  1EWZ A;  1JVJ A;  1PIO A;  5HAQ A;  1HD8 A;  5CHU A;  2Z2M B;  2ZJ9 A;  1KGG A;  1Y54 A;  3A3J A;  4WEK A;  3G34 A;  4KQQ A;  5AQA A;  3V3S A;  3CJM A;  1NZO A;  1E3U A;  4E3J A;  4OQH A;  1OME A;  3Q07 A;  3E2L A;  4E6X A;  3N8L A;  3C5A A;  3Q7V A;  2J7V A;  2X71 A;  3ITB A;  3NC8 A;  2HP9 A;  1ONG A;  5FAO A;  4MEZ A;  5EVL A;  3ZVT A;  3ZG9 B;  4LV3 A;  1KDS A;  2P74 A;  3MXS A;  4P0M A;  5F1G A;  3G30 A;  1MWU A;  3OPR A;  4P85 A;  5M1A A;  2QPN A;  5EUA A;  4N9K A;  3VP4 A;  1KGE A;  2XF3 A;  3QNB A;  2XFT A;  4S2J A;  1L0E A;  4U0T A;  2WKI A;  5AQB A;  4KG6 A;  1WYC A;  2HDR A;  2H0T A;  2ZMA A;  1GCE A;  5FAT A;  1SHV A;  3GR2 A;  4GD6 A;  4RA7 A;  4PMA A;  5FI6 A;  3WS4 A;  4GZB A;  4JXS A;  1I5Q A;  4KZ5 A;  2G2W A;  1BT5 A;  4UA7 A;  1XGJ A;  5HFO A;  4DXB A;  1K54 C;  1BUL A;  2P9V B;  3M6H A;  5CEC A;  3GRJ A;  3IF5 A;  4MNR A;  4HBU A;  4UHU A;  1ERO A;  1YMS A;  4LV2 A;  3SS4 A;  3OCN A;  1SKF A;  1K55 A;  4DDS A;  5EPH A;  2Y2K A;  4HEF A;  1BSG A;  2EXA A;  4R4S A;  4KQR A;  4KZB A;  4EBN A;  4KZ7 A;  3IH8 A;  4E3M A;  4A5R A;  1L2S A;  3O86 A;  1K56 D;  2IWC A;  3NDE A;  3GSG A;  3I7J A;  3PTE A;  5GL9 A;  4QB8 A;  2WKH A;  3HLD A;  4LV1 A;  4JF5 A;  3V5M A;  3HUN A;  5CEB A;  1DJB A;  1WYB A;  1PWG A;  3PBT A;  4WMC D;  5HL1 A;  5KMW A;  4Z9Q A;  5I94 A;  4WMC A;  3OPH A;  3IF6 B;  2FFY A;  3SS3 A;  4OP5 A;  3PAG A;  1SDE A;  2ZC5 B;  1FCM A;  1JTD A;  4DE3 A;  1J9M A;  4KZA A;  3VMA A;  3OZH A;  1BLP A;  1VM1 A;  1XP4 A;  4R3B A;  3IHA A;  3PBQ A;  5AQ9 A;  4XUX A;  1MPL A;  4WM9 A;  3W4O A;  1MBL A;  3Q7V B;  4XXR A;  3HUM A;  2RL3 A;  4L0L A;  4X69 A;  1NYM A;  1ES2 A;  1MY8 A;  3IWI A;  5FQQ A;  1K25 A;  3WWX A;  5GHZ A;  4HBT A;  3GV9 A;  3PBS A;  2Y2O A;  1ALQ A;  2WZX A;  2IWB A;  4BL3 A;  2BG1 A;  2HDS A;  3G4P A;  3UY6 A;  2WZZ A;  2DNS A;  3WS2 A;  5M18 A;  3HLC A;  3VFF A;  5FAQ A;  3MKE A;  4OPZ A;  3TSG A;  2HP5 A;  1IEM A;  3S22 A;  3NY4 A;  1JWZ A;  3IXD A;  1GA0 A;  4JKT A;  3UE3 A;  2GDN A;  4OPQ A;  1NYY A;  1XKZ A;  4RX2 A;  1K57 C;  5FAS A;  2IWD A;  3MZF A;  1XPB A;  3WS0 A;  1ZC2 A;  1XA7 A;  4JPM A;  3O3V A;  1QME A;  2P9V A;  1IYS A;  1GHM A;  3ZFZ A;  4Y0O A;  1ZG4 A;  1M40 A;  3G2Y A;  4WZ5 A;  3B3X A;  3M6B A;  1W8Y A;  4D2O A;  2Y4A A;  5E2E A;  4KZ9 A;  5A92 A;  2XK1 A;  2A49 A;  1DJC A;  3O87 A;  1PI4 A;  5EE8 A;  1O07 A;  2EX6 A;  1ESI A;  2FFF B;  4DE0 A;  4CPK A;  1I2S A;  4NET A;  2E8I A;  4LV0 A; 
#chains in the Genus database with same CATH topology
 1L0D A;  4LCM A;  3OLO A;  4RYE A;  1FCN A;  4Y13 A;  2WYX A;  3N8R A;  4JXV A;  5FAP A;  5CHJ A;  3C8C A;  4UQI S;  1XJ4 A;  3MFD A;  4N1X A;  3HVF A;  1TS6 A;  4I38 A;  1PZO A;  4KZ4 A;  5L8M A;  4DKI A;  3S7Q A;  3KYE A;  3R7W A;  3BRM A;  2OSU A;  2ZLY A;  3CPT A;  1FR1 A;  2V20 A;  1OTA A;  5IHV A;  2Y8H A;  3BW6 A;  3FG8 A;  4GCZ A;  3LCE A;  2HDU A;  1U60 A;  2QKP A;  4QY5 A;  2K2N A;  3PBN A;  4S2M A;  5GLD A;  1PW1 A;  2PHY A;  5EOO A;  4B88 A;  3SS5 A;  5IU1 A;  3LIB A;  2OLU A;  3DTK A;  3NBL A;  5FI2 A;  4K91 A;  4Y3I A;  1G6A A;  3FYZ A;  5FQ9 A;  3OPP A;  1QMF A;  5JYO A;  1HZO A;  5F68 A;  4YFM A;  4BLM A;  1ZTU A;  4X55 A;  4E3O A;  4EUV A;  2XFS A;  3BFE A;  2GX5 A;  4NXF A;  1Q2Q A;  3FKW A;  4WBG A;  4UA9 A;  3LY3 A;  4OVD A;  2MJ6 A;  1SDN A;  1IOU A;  3OOV A;  4OQ0 A;  3H9W A;  1NZU A;  1FSW A;  4QHC A;  2UV0 E;  4S2K A;  5GHX A;  3IX4 A;  1KGF A;  2VGL S;  2LB9 A;  2PBD P;  3TG9 A;  5FL3 A;  4FTX A;  2A24 B;  5DF7 A;  4C6Y A;  4GNU A;  2J9O A;  1BLH A;  1BLC A;  2YKH A;  3BFD A;  4KQO A;  1I2W A;  2WKP A;  3EEH A;  4BD1 A;  3GDI A;  4DDY A;  4OOY A;  2Y2L A;  3SH8 A;  3A3D A;  4X56 A;  3IS2 B;  3BJN A;  1DRM A;  3CG5 A;  1FCO A;  4PM7 A;  5TBM B;  3QP1 A;  4BD0 A;  3MQO A;  3HRE A;  3VP2 A;  1K6R A;  4E3I A;  1XXM A;  1GSV A;  3G2Z A;  3VOZ A;  2O0Y A;  2PR6 A;  1TS7 A;  3UE1 A;  4GD8 A;  5E2H A;  1N4O A;  3LR5 A;  1VET A;  1S1Y A;  2BAS A;  1M6K A;  4KUK A;  4WLA A;  4M3K A;  1E4D A;  3ZYT A;  1TF1 A;  3PAE A;  2Q9N A;  4CLC B;  3FZC A;  3UNW A;  2PD8 A;  2CC1 A;  5FDS A;  3BEC A;  4HES A;  3ZQ5 A;  4IHQ A;  1H0M A;  4IBR A;  3VP1 A;  4HNB A;  1LT0 A;  3PHY A;  4XT2 A;  1ES5 A;  4ID4 A;  2PYP A;  1OJG A;  3T4T A;  4Q8I A;  4S2P A;  4N9L A;  1P9R A;  3KSF A;  3F1N A;  1GSX A;  4KQD A;  3JPU A;  4GB7 A;  3RTY A;  5K5B A;  2G2U A;  2M7U A;  2KOI A;  2O9C A;  4EWF A;  1IEL A;  2A3U A;  1HVB A;  1HTZ A;  1MWR A;  4S2I A;  2ZC7 A;  3M2K A;  2HJ9 C;  2XLN A;  2D02 A;  4FH2 A;  5G4Z A;  1DP9 A;  5DTT A;  3IX8 A;  4BMW A;  2H10 A;  3P98 A;  2OAP 1;  4MMN A;  5DJU A;  5DVA A;  3IH9 A;  1ES3 A;  2W3D A;  3MSH A;  4X1M A;  1VHM A;  4HP9 A;  2DCF A;  4ZTK A;  4QD4 A;  2QZ6 A;  3G35 A;  4IJG A;  1CI8 A;  2VGK A;  3NOT C;  4WEJ A;  1EI5 A;  1FQG A;  5DF9 A;  4UQI M;  3CZD A;  5HPF A;  4YOF A;  4Z1W A;  2QJ7 A;  3E0Y A;  3GVB A;  5AVF A;  3LY4 A;  1LL8 A;  4QU3 A;  4D60 A;  3ISG A;  1V9Y A;  4BBT A;  1XGI A;  3IX3 A;  1NLZ A;  5A91 A;  1PI5 A;  4JGQ A;  1EWZ A;  5HAQ A;  1Y54 A;  4WEK A;  5AQA A;  1NZO A;  3LID A;  2V0U A;  3Q7V A;  2J7V A;  4X25 A;  4DJ3 A;  5EVL A;  2P74 A;  5C5K A;  4P0M A;  2KX6 A;  4N9K A;  4GS9 B;  4U0T A;  5AQB A;  2INW A;  1WYC A;  2H0T A;  1GCE A;  4DDS A;  1SHV A;  3C30 A;  2J80 A;  5EM1 A;  4B9O A;  3VE4 A;  3IF5 A;  3TJZ C;  4HBU A;  4ARZ A;  3OCN A;  4HP4 A;  1K55 A;  5EPH A;  2JN7 A;  2Y2K A;  2EXA A;  4KZB A;  4EBN A;  4KZ7 A;  3HCY A;  3D9Y A;  4A5R A;  1L2S A;  3K2N A;  4QB8 A;  1WYB A;  5HL1 A;  4IUH A;  3K3C A;  5I94 A;  2VGL M;  3IF6 B;  4EW7 A;  4OP5 A;  5HWT A;  4HJ6 A;  2XRN A;  5HZH A;  1XP4 A;  4XUX A;  1OTB A;  3L9K A;  1Y28 A;  3IWI A;  3WWX A;  3IBR A;  2Y2O A;  3UY6 A;  2WZZ A;  3HLC A;  5FAQ A;  4HH2 A;  3H7W A;  3NY4 A;  4JKT A;  2PRF A;  1NYY A;  1XKZ A;  4JPM A;  3BQA A;  2P9V A;  3ZFZ A;  1M40 A;  4WZ5 A;  3B3X A;  4NXE A;  4D2O A;  2Y4A A;  2XK1 A;  1AWI A;  3SW1 A;  1ESI A;  1YAX A;  2QWS A;  1I2S A;  3T4Q A;  2OLV A;  5EOE A;  1P9W A;  3DTI A;  5FSR A;  2ZM8 A;  1KE3 A;  4Y7P A;  3N7W A;  3BFF A;  2R78 A;  1C3B A;  2EWW A;  2ZMV A;  3MMH A;  3ZNY A;  1JWV A;  4DRT A;  3SH9 A;  3IWO A;  3C7V A;  4NK3 A;  5HAR A;  1NXY A;  2HJE A;  1MC0 A;  2JC7 A;  1RGY A;  3ZG5 A;  4EET B;  3RXX A;  3T4S A;  2O9B A;  4EBL A;  4F94 A;  2HPB A;  2ZQC A;  3Q82 A;  4MDZ A;  1GA9 A;  2HZ5 A;  2ZC6 B;  1ES4 A;  4OOM A;  2V1B A;  3DWZ A;  1WE4 A;  2XH9 A;  3G31 A;  2E8J A;  4JLF A;  2OV5 A;  1FSY A;  2VJW A;  1LSW A;  1YSQ A;  3CI6 A;  2WGW A;  5CGX A;  3FWL A;  5TBM A;  2EX8 A;  3HLE A;  1N9B A;  4GJ4 A;  3DBA A;  1ERM A;  4EUZ A;  3KO6 A;  1YKD A;  2PD7 A;  5TFQ A;  1H5X A;  1F9I A;  2JKT M;  5DKL A;  2VGJ A;  2Y2P A;  3T4J A;  3UB5 P;  1K55 C;  1CI9 A;  3LR4 A;  2ZQ9 A;  3LR3 A;  4UEY A;  3F1P B;  4BBU A;  5CER A;  5CHM A;  5HD3 A;  1F5M A;  3GMW A;  1UWP X;  4CQH A;  5J8X A;  3LIF A;  1XJ2 A;  3BLM A;  2X01 A;  4X68 A;  1YMX A;  3A3I A;  4R23 A;  3W2Z A;  3UB7 A;  2I9V A;  4CLC A;  4WZ4 A;  4OPY A;  4S2O A;  3MZD A;  5HW3 A;  4OON A;  2B02 A;  5DTK A;  4MLL A;  4OOL A;  3UN7 A;  3QP6 A;  2Y2G A;  2V1A A;  4KZ8 A;  5EVI B;  4GKU A;  4EV4 A;  3P09 A;  1CEF A;  5DJT A;  4ZRR A;  2R9X A;  1IYP A;  3NOU C;  1RGZ A;  3NDG A;  2XA7 M;  1OTD A;  4EQI A;  4QJG A;  3ULF A;  2R9W A;  1DY6 A;  2WAE A;  4LEN A;  3UMD A;  1PW8 A;  4WZ5 C;  1KOU A;  2PBY A;  4KG5 A;  4L9E A;  3MR0 A;  4LCL A;  5CGS A;  1YLP A;  2JKG A;  1VEU B;  1OT6 A;  1O7E A;  3JVU A;  1ZKJ A;  5J3W A;  4ME4 A;  4OKP A;  5L10 A;  2JBF A;  1K38 A;  1Z09 A;  2EXB A;  4LRY C;  4EU0 A;  4GOG A;  4JF6 A;  1K54 A;  2J3T D;  1ONH A;  2KDK A;  1XJ6 A;  4BL2 A;  1XFN A;  4UA6 A;  3FV7 A;  3S7O A;  3HLW A;  3UDF A;  3HLB A;  4PM6 A;  3F1O A;  5U47 A;  2WGI A;  2XEP A;  3HLG A;  3W4P A;  4GLQ A;  1N9L A;  1S67 L;  1TVF A;  2ZM2 A;  4O0P A;  2B95 A;  2XD1 A;  3S7P A;  5DFX A;  3EQV A;  4X1L A;  2EX9 A;  1W7F A;  4EER A;  5HAI A;  3A3F A;  2PYR A;  1YSP A;  3Q1F A;  3C4O A;  1JNU A;  4EXO A;  4BEN A;  3BY8 A;  1UWN X;  2V8F A;  1ODV A;  2G7U A;  4BJP A;  3H82 A;  2JKR I;  5HD5 A;  1OPX A;  3KSI A;  3AGE A;  3FKV A;  4BWI A;  3V39 A;  3IXH A;  4KZ6 A;  3AGF A;  3E4Q A;  1H3Q A;  4KG2 A;  2GJ3 A;  4U0X A;  2EWV A;  5CGW A;  3G6O A;  4CLC D;  1PWD A;  3GEC A;  4OQG A;  1SKO A;  1TS0 A;  1L0G A;  5J4E A;  1L3L A;  3EGD C;  3FPW A;  1XA1 A;  5CTN A;  4MN5 A;  4PKY G;  4R4R A;  3JYI A;  2VZW A;  5F5Y A;  1XX2 A;  4JGO A;  5F6A A;  3E2K A;  1KDW A;  2IA2 A;  3VSK A;  3UPN A;  1YLT A;  3UE0 A;  4K08 A;  4CLC C;  5F82 A;  5KZH A;  1Q2P A;  1JTG A;  1L0F A;  3WS1 A;  5HAP A;  3NUL A;  2QHK A;  4I39 A;  2J3W A;  4MBH A;  3OPL A;  4R70 A;  1A0K A;  1S66 L;  1JVJ A;  5CHU A;  2ZJ9 A;  1OME A;  3E2L A;  4ESP A;  5L07 A;  2X71 A;  3ITB A;  3NC8 A;  4MEZ A;  3MXS A;  5M1A A;  2W1T A;  2QPN A;  3VP4 A;  3E4P A;  3QNB A;  2XFT A;  4KG6 A;  2HDR A;  4R3A A;  5FI6 A;  3GR2 A;  3WS4 A;  4RA7 A;  4GZB A;  4UA7 A;  1K54 C;  2VX8 A;  3KYQ A;  1NRJ A;  5CEC A;  3NJA A;  1GSW A;  1K0K A;  1BSG A;  1T1B A;  2B18 A;  4PHT A;  3BY9 A;  2IWC A;  3PTE A;  3HLD A;  2P08 A;  4JF5 A;  4QWO A;  3HUN A;  1DJB A;  2WKR A;  1PWG A;  3PBT A;  3DAV A;  5HWV A;  3OPH A;  3LIE A;  3PAG A;  1SDE A;  1Y4O A;  3C38 A;  1FCM A;  5AJG A;  5HDS A;  2W3H A;  1J9M A;  3OZH A;  1BLP A;  5AQ9 A;  3MFX A;  2VV6 A;  4WM9 A;  1MBL A;  1S1Z A;  2RL3 A;  4X69 A;  3R7W B;  1NYM A;  1ES2 A;  1MY8 A;  2HF6 A;  1K25 A;  5GHZ A;  4CLC E;  3GV9 A;  4H6J A;  2IWB A;  3UE6 A;  3LIC A;  2DNS A;  4NXB A;  1MKM A;  2HP5 A;  1IEM A;  1JWZ A;  2W0N A;  1D06 A;  2YKF A;  2OOL A;  3P7N A;  1XPB A;  1IYS A;  1GHM A;  1ZG4 A;  3G2Y A;  1H8M A;  3M6B A;  1OTI A;  5E2E A;  2V0W A;  1DJC A;  3K3D A;  1IFQ A;  5EE8 A;  4DE0 A;  1KVL A;  4R0Q A;  2C5W B;  1FIK A;  3N8S A;  2ZQA A;  2EX2 A;  3OCL A;  3A3E A;  1YLW A;  4KZ3 A;  2XA7 S;  2WKE A;  3GTC A;  2WKQ A;  1T1C A;  2Y91 A;  2X02 A;  2HDQ A;  2XRO A;  2VKS A;  2Q0O A;  4KUO A;  2NUT C;  2PAV P;  2ZL1 A;  2QJ5 A;  1MWS A;  2Y59 A;  2PR5 A;  4HOI A;  2VV8 A;  5DTS A;  4PPR A;  3QHY A;  4OP8 A;  2LB5 A;  3SH7 A;  1V9Z A;  3CHW P;  3KYZ A;  5F83 A;  3N4I A;  2ZD8 A;  3BYD A;  4G3V A;  1MZU A;  4F3L A;  3A0R A;  4B93 A;  3MZE A;  1LI0 A;  2XGN A;  4UAA A;  5D3O A;  4Y0T A;  4Q0J A;  1BYW A;  2H0Y A;  4KEN B;  2K7S A;  4DXC A;  4R1G A;  1VB6 A;  1NJ4 A;  1LLB A;  4RX3 A;  4JF4 A;  2PU4 A;  5E43 A;  3T1R A;  2Y55 A;  1NWZ A;  4L9G A;  4JXW A;  5IT5 A;  2C6W B;  5HPI A;  3ZG7 B;  1HLU P;  2VEA A;  4Q0I A;  2Q9M A;  3D4F A;  2QYB A;  3UB8 A;  2W3G A;  1DP6 A;  3SOI A;  4GDB A;  5M19 A;  1S4S A;  1YPR A;  3E4O A;  1T18 A;  1LL9 A;  3LFV A;  5DFY A;  3MQQ A;  1IYO A;  1VET B;  2V1Z A;  5CTM A;  5FQI A;  4G3K A;  4IED A;  1MKI A;  1E25 A;  3C4P A;  5KSH A;  4ZDX A;  3S4X A;  3T1Q B;  3MKF A;  4P6Z S;  2ZQ8 A;  1FR6 A;  3UDI A;  5G4Y A;  2ZMF A;  1LI9 A;  2DMW A;  4XT2 B;  5CED A;  2Y2N A;  1GHI A;  5HDC A;  3PBO A;  4I5S A;  4RQ9 A;  3VFH A;  4FD8 A;  1TDL A;  4OQI A;  4DJ2 A;  4ZJ2 A;  3UB6 A;  5GLA A;  2K31 A;  1K4E A;  3CUE C;  1Z6F A;  1PYY A;  3NCK A;  3BM6 A;  2A24 A;  2OWH A;  3BLS A;  3LR0 A;  1H8Z A;  3VOL A;  1D1J A;  5FA7 A;  4MBF A;  2XR0 A;  4WF0 A;  3VP0 A;  3ZCZ A;  2GZA A;  5BOH A;  1T1A A;  2JE5 A;  4EBP A;  2Y2I A;  3BWL A;  4L9F A;  4H8R A;  5EVI D;  5KIZ A;  1CQA A;  5DF8 A;  1ACF A;  3NEC A;  4FCF A;  3TOI A;  3IS2 A;  3LEZ A;  3QNC A;  2HV1 A;  2M1C A;  4IVI A;  4I3I A;  5G18 A;  3PYP A;  4X6T A;  1DP8 A;  3A0V A;  3N6I A;  1CEG A;  1H8Y A;  3LI8 A;  3T4L A;  3S7N A;  3QP8 A;  2XDM A;  2VA0 A;  3ITA A;  1KE4 A;  4OH0 A;  3RH8 B;  5AVE A;  5HWW A;  3WS5 A;  4BBV A;  1K6S A;  2VLG A;  2KLI A;  5AQ7 A;  2ZQ7 A;  5J7E A;  1W63 Q;  5EVI C;  4LFU A;  2JKF A;  1K57 A;  4I3J A;  3T1X A;  1DJA A;  1STZ A;  3RXW A;  3C7U A;  4E6W A;  3R4K A;  4LLO B;  3RJU A;  1CF0 A;  2J8Y A;  3TW8 A;  4R3J A;  5FI7 A;  3UB9 A;  3FC7 A;  2VK3 A;  1GHP A;  2Y2M A;  2P7J A;  2WAF A;  3V3R A;  1CK3 A;  3GQZ A;  4II7 A;  1G28 A;  1LHY A;  1W8Q A;  4GHI B;  4FSF A;  4N92 A;  1NLY A;  3O5Y A;  3MS6 A;  2FZ0 A;  3VOY A;  1S0W A;  1N9O A;  4U3T A;  3ZHH A;  5I5L A;  3OC2 A;  4ARZ B;  2RCX A;  1WA9 A;  4HY8 A;  3ZG0 A;  2HGV A;  1YLZ A;  4HH3 A;  4ZJ3 A;  5HDD A;  4YIN A;  2PDR A;  4FH4 A;  4FUW A;  3T1S A;  5E2F A;  1K4F A;  2Z6D A;  4O7D A;  5JYP A;  4M4X A;  3LYX A;  1IYQ A;  4GDN A;  1PIO A;  1HD8 A;  2D01 A;  2Z2M B;  1KGG A;  3A3J A;  3G34 A;  1E3U A;  2NUP C;  4OQH A;  4E3J A;  3Q07 A;  4E6X A;  3N8L A;  1PFL A;  3C5A A;  1F98 A;  2HP9 A;  1FIL A;  5FAO A;  3ZVT A;  1F2K A;  3OPR A;  4P85 A;  5EUA A;  1KGE A;  2XF3 A;  2WKI A;  3TE8 A;  2ZOI A;  3H7W B;  5FAT A;  4PMA A;  1LSV A;  4JXS A;  3MF0 A;  2VV7 A;  1XGJ A;  5HFO A;  1BUL A;  2P9V B;  3M6H A;  4FOF A;  2J3T C;  4DMZ A;  4MNR A;  4UHU A;  1OTE A;  1YMS A;  4LV2 A;  1SKF A;  1W63 M;  3IH8 A;  3I7J A;  5GL9 A;  4ETZ A;  4LV1 A;  3V5M A;  3LEQ A;  5CEB A;  3CLO A;  4WMC D;  5KMW A;  2JKT I;  2FFY A;  3LUQ A;  2M7V A;  1XFQ A;  3MQ0 A;  1JTD A;  4R3B A;  3IHA A;  3PBQ A;  4HHD A;  3KX0 X;  2L1M A;  3W4O A;  4XXR A;  3HUM A;  3B47 A;  4L0L A;  4HIA A;  4HBT A;  4P6Z M;  3PBS A;  4R6L A;  1ALQ A;  2WZX A;  2HDS A;  4GS9 A;  4WUJ A;  3WS2 A;  3MKE A;  4OPZ A;  3S22 A;  3D72 A;  3BQ8 A;  1K57 C;  3MZF A;  1XA7 A;  3PXP A;  4Y2F A;  3O3V A;  3U4L P;  3ICY A;  1UGU A;  1W8Y A;  1SZV A;  3O87 A;  1PI4 A;  4AFI A;  2EX6 A;  1XJ3 A;  1LSX A;  1G6O A;  4NET A;  4LV0 A;  4LGW A;  2WGW B;  4JGP A;  2B5R A;  5EM0 A;  1OJ5 A;  3BFC A;  5E2G A;  3IF6 A;  4MBK A;  2BTF P;  3G32 A;  3U2A A;  3S1Y A;  2W27 A;  4P87 A;  4ZAM A;  1E3U D;  3UDX A;  1IKI A;  2Y79 A;  2ZM0 A;  4GW9 A;  3IT9 A;  3VE3 A;  4Y0U A;  3IXG A;  3PBR A;  3QP5 A;  4RVA A;  5FQJ A;  3WRT A;  1MXO A;  3UPO A;  4DF6 A;  2ZOH A;  4JGR A;  2H5S A;  4R38 A;  1IKG A;  2QMI A;  3TRC A;  4BQM A;  4WEL A;  5MC7 A;  2PU2 A;  4ETX A;  1FOF A;  2ACG A;  4N1H A;  4DE2 A;  4CJN A;  4E3K A;  3W4Q A;  1YM1 A;  4HJ4 A;  2PT7 A;  3MXR A;  1RCJ A;  3EQU A;  4QPR A;  3DTE A;  3VP3 A;  2Y2H A;  3DWK A;  5FEG A;  2FH5 A;  2CMN A;  4K0X A;  2Y2J A;  1W5D A;  1X0O A;  1CJF A;  4OLD A;  5EV0 A;  5HL6 A;  5L2F A;  1EW0 A;  1RP5 A;  5A90 A;  4G3W A;  1PWC A;  4IBX A;  4MN7 A;  4WL9 A;  3T4K A;  1G68 A;  1S4R A;  1LL5 A;  4WYY A;  5GLB A;  4LPZ A;  1MWT A;  4GN2 A;  2J9P A;  1OT9 A;  2OWJ A;  3T50 A;  1YT4 A;  5EFW A;  3CPT B;  5TGF A;  3LI9 A;  1TDG A;  4NG2 A;  1N9N A;  3BFG A;  5DKK A;  1TD5 A;  3UO9 A;  3O88 A;  3VSL A;  4EEP A;  1JWP A;  5F1F A;  3A0S A;  4B4X A;  1ZG6 A;  4I3A A;  3FPV A;  3L7H A;  4PM9 A;  1BZA A;  3F1O B;  2XQZ A;  3EOI A;  2BLS A;  2ZC4 B;  3CUE A;  3MXQ A;  3UPP A;  1NRF A;  2L0W A;  4X53 A;  4OLG A;  4S2N A;  4PM8 A;  3UME A;  4S2L A;  4IVK A;  3AGD A;  4PKY A;  4C75 A;  3ZDJ A;  3D3O A;  2WGV A;  5LBR A;  4YNR A;  4Y15 A;  5FQM A;  5F69 A;  4MN6 A;  4QY6 A;  2UWX A;  4HJ3 A;  3ZGA B;  1BLS A;  5A93 A;  1YLY A;  4Y5F A;  5GHY A;  3H82 B;  1AXB A;  2OAQ 1;  3QP2 A;  3M2J A;  3F1P A;  5L09 A;  3DW0 A;  4JXG A;  1PRQ A;  4B4Z A;  3V50 A;  3WRZ A;  3HBR A;  4DE1 A;  3IXB A;  3B33 A;  1BTL A;  3IF6 C;  4EEU A;  2HP6 A;  5TJJ A;  2ZQD A;  3VV4 A;  2W3F A;  2WAD A;  1SKO B;  2JHE A;  1ESU A;  1SCW A;  4WN5 A;  1D7E A;  1G5U A;  3ZG8 B;  2JCH A;  3IHB A;  4PM5 A;  3T12 B;  2P04 A;  5EVI A;  4NEE D;  4GHI A;  2ZBB A;  2I72 A;  3T4O A;  3MJQ A;  4E3L A;  2Z2L B;  4K0W A;  3KSG A;  4ZBE A;  3NIA A;  1PZP A;  1J3W A;  3Q81 A;  2L4R A;  2WUQ A;  5EEC A;  4YWZ A;  2H28 A;  5FDH A;  3Q7Z A;  1K56 A;  4E3N A;  3HLF A;  1YQS A;  3W8K A;  4C3Q A;  3IQA A;  1NY0 A;  1VEU A;  2V8C A;  4NXG A;  4LRX C;  2AVX A;  1S6R A;  2EFX A;  1ERQ A;  3HUO A;  3HL9 A;  2V2F F;  1KE0 A;  2GNX A;  1YLJ A;  4DN0 A;  1TEM A;  3EWK A;  2EFU A;  3LO7 A;  3NI9 A;  5TR7 A;  3CAX A;  4OPR A;  4P6B A;  5IS1 A;  3LIA A;  2DRW A;  3BEB A;  1W79 A;  5A8B A;  4MCW A;  2W1T B;  5CRF A;  3EGX C;  2XD5 A;  3ZVW A;  4Q0H A;  2ZC3 B;  4PAU A;  4HI4 A;  3OBF A;  2W1R A;  3SZT A;  5FQK A;  3ZNT A;  3QP4 A;  4NKP A;  5CXW A;  5KSC A;  1KVM A;  4JBF A;  3F1N B;  1BUE A;  3DTM A;  5HX9 A;  2Y2Q A;  2WK0 A;  3EEA A;  1VQQ A;  2V9A A;  3IWQ A;  5GLC A;  4XUZ A;  4S2N C;  3MBZ A;  3CMZ A;  4ZJ1 A;  2XSS A;  4EQ1 A;  3V3S A;  4KQQ A;  3CJM A;  4LRZ E;  1ONG A;  3ZG9 B;  2A2L A;  1KDS A;  4LV3 A;  1P97 A;  5F1G A;  3G30 A;  1MWU A;  4H6J B;  4S2J A;  1L0E A;  3NOP C;  4EES A;  3HJI A;  2O99 A;  2ZMA A;  1T19 A;  4GD6 A;  1I5Q A;  4KZ5 A;  2G2W A;  1BT5 A;  1PNE A;  4DXB A;  3GRJ A;  3E98 A;  1ERO A;  5EVE A;  3SS4 A;  3HJK A;  2W3E A;  4HEF A;  4R4S A;  4KQR A;  3NHQ A;  3C2W A;  4E3M A;  4O8G A;  3O86 A;  1K56 D;  3PR6 A;  3NDE A;  3GSG A;  2WKH A;  1P0Z A;  3KSH A;  2JKR M;  3CIT A;  5CX7 A;  3RFB A;  4Z9Q A;  4WMC A;  3SS3 A;  1ZHH B;  1TS8 A;  5FEF A;  3B42 A;  2ZC5 B;  4DE3 A;  3VMA A;  4KZA A;  1VM1 A;  3V67 A;  2Z6C A;  1MPL A;  3JVV A;  5HSQ A;  3Q7V B;  4HQA A;  4E04 A;  2ZL1 B;  3P01 A;  5FQQ A;  2EA9 A;  4BL3 A;  2BG1 A;  3G4P A;  5M18 A;  3VFF A;  3TSG A;  3UE3 A;  3IXD A;  1GA0 A;  2GDN A;  4OPQ A;  4RX2 A;  5FAS A;  2IWD A;  4O01 A;  3LGO A;  3WS0 A;  3CWF A;  1ZC2 A;  1QME A;  2O9A A;  4Y0O A;  3IBJ A;  4F3L B;  4IUK A;  4KZ9 A;  5A92 A;  2A49 A;  1O07 A;  4Y17 A;  2FFF B;  4CPK A;  2E8I A; 
#chains in the Genus database with same CATH homology
 1KVL A;  4R0Q A;  1L0D A;  2WGW B;  2C5W B;  4LCM A;  3N8S A;  2OLV A;  2B5R A;  5EOE A;  2ZQA A;  4RYE A;  2EX2 A;  3BFC A;  1FCN A;  3OCL A;  5E2G A;  5FSR A;  2WYX A;  3A3E A;  2ZM8 A;  3N8R A;  3IF6 A;  4JXV A;  1YLW A;  4MBK A;  5FAP A;  1KE3 A;  5CHJ A;  4Y7P A;  4KZ3 A;  3G32 A;  2WKE A;  3GTC A;  3S1Y A;  3MFD A;  3N7W A;  3BFF A;  4N1X A;  2Y91 A;  4P87 A;  3HVF A;  2X02 A;  4ZAM A;  1E3U D;  1PZO A;  1C3B A;  3ZNY A;  1JWV A;  4KZ4 A;  3UDX A;  1IKI A;  2HDQ A;  4DRT A;  4DKI A;  3SH9 A;  3IWO A;  2ZM0 A;  3C7V A;  4NK3 A;  5HAR A;  1NXY A;  3IT9 A;  1MWS A;  4Y0U A;  3BRM A;  2Y59 A;  2OSU A;  2JC7 A;  3IXG A;  2ZLY A;  3PBR A;  4RVA A;  1RGY A;  1FR1 A;  2V20 A;  5FQJ A;  5IHV A;  3ZG5 A;  5DTS A;  3WRT A;  1MXO A;  4PPR A;  3RXX A;  3LCE A;  3QHY A;  4OP8 A;  2HDU A;  3SH7 A;  1U60 A;  4DF6 A;  4EBL A;  4F94 A;  3UPO A;  4QY5 A;  2HPB A;  3N4I A;  3PBN A;  5F83 A;  2H5S A;  4S2M A;  2ZD8 A;  5GLD A;  3BYD A;  1PW1 A;  2ZQC A;  3Q82 A;  1IKG A;  2QMI A;  5EOO A;  4B88 A;  3SS5 A;  4BQM A;  2OLU A;  1GA9 A;  2ZC6 B;  4WEL A;  3NBL A;  1ES4 A;  2PU2 A;  1FOF A;  5FI2 A;  4OOM A;  4K91 A;  3DWZ A;  1WE4 A;  4N1H A;  3MZE A;  1LI0 A;  2XGN A;  1G6A A;  3FYZ A;  4UAA A;  4DE2 A;  5FQ9 A;  5D3O A;  2XH9 A;  4CJN A;  3OPP A;  4Y0T A;  1QMF A;  3G31 A;  4E3K A;  2H0Y A;  5JYO A;  3W4Q A;  4KEN B;  1YM1 A;  4JLF A;  2OV5 A;  1HZO A;  4DXC A;  1FSY A;  4R1G A;  3MXR A;  4YFM A;  1RCJ A;  4BLM A;  2WGW A;  3EQU A;  4X55 A;  4E3O A;  1NJ4 A;  2XFS A;  5CGX A;  1LLB A;  3FWL A;  3BFE A;  4RX3 A;  4JF4 A;  3VP3 A;  2Y2H A;  2EX8 A;  3DWK A;  3HLE A;  1N9B A;  2PU4 A;  5E43 A;  1Q2Q A;  3FKW A;  2Y55 A;  1ERM A;  4K0X A;  4JXW A;  4WBG A;  4EUZ A;  2Y2J A;  1W5D A;  4UA9 A;  2C6W B;  3LY3 A;  4OLD A;  4OVD A;  1H5X A;  5TFQ A;  3ZG7 B;  5L2F A;  1RP5 A;  1SDN A;  2Q9M A;  4OQ0 A;  3D4F A;  1NZU A;  5A90 A;  2VGJ A;  2Y2P A;  1PWC A;  1FSW A;  4IBX A;  4QHC A;  1K55 C;  3SOI A;  4S2K A;  1CI9 A;  4GDB A;  1G68 A;  2ZQ9 A;  5M19 A;  5GHX A;  1LL5 A;  4WYY A;  5GLB A;  5CER A;  5CHM A;  1KGF A;  1MWT A;  1LL9 A;  4GN2 A;  2J9P A;  1YT4 A;  5TGF A;  3GMW A;  1IYO A;  3TG9 A;  1TDG A;  5DF7 A;  3BFG A;  3UO9 A;  5J8X A;  3O88 A;  2V1Z A;  4C6Y A;  3BLM A;  4GNU A;  2J9O A;  2X01 A;  1BLH A;  3VSL A;  4X68 A;  1YMX A;  1JWP A;  3A3I A;  4R23 A;  1BLC A;  5CTM A;  5FQI A;  5F1F A;  4B4X A;  1ZG6 A;  4IED A;  4PM9 A;  1BZA A;  1MKI A;  1E25 A;  3BFD A;  3C4P A;  4KQO A;  4OPY A;  4WZ4 A;  1I2W A;  4S2O A;  2XQZ A;  3MZD A;  5HW3 A;  4ZDX A;  5KSH A;  2BLS A;  2ZC4 B;  4OON A;  3S4X A;  3MKF A;  3UPP A;  5DTK A;  1NRF A;  4BD1 A;  4MLL A;  2ZQ8 A;  4OOL A;  4X53 A;  3UN7 A;  4OLG A;  1FR6 A;  2Y2G A;  4DDY A;  4OOY A;  4S2N A;  4PM8 A;  3UDI A;  4KZ8 A;  4S2L A;  4IVK A;  2Y2L A;  3AGD A;  5EVI B;  4GKU A;  3SH8 A;  4C75 A;  3A3D A;  4X56 A;  3ZDJ A;  1LI9 A;  3P09 A;  1CEF A;  4EV4 A;  2WGV A;  5FQM A;  2Y2N A;  3CG5 A;  2R9X A;  5CED A;  1IYP A;  1FCO A;  4QY6 A;  1GHI A;  4PM7 A;  1RGZ A;  3PBO A;  3NDG A;  3VFH A;  4BD0 A;  4EQI A;  4QJG A;  3HRE A;  3VP2 A;  2R9W A;  1K6R A;  4FD8 A;  2UWX A;  1TDL A;  3ZGA B;  1BLS A;  1DY6 A;  2WAE A;  4OQI A;  4E3I A;  4ZJ2 A;  4LEN A;  5A93 A;  1YLY A;  1PW8 A;  1XXM A;  5GHY A;  3G2Z A;  4WZ5 C;  5GLA A;  1K4E A;  4KG5 A;  2PBY A;  1AXB A;  3VOZ A;  4LCL A;  3M2J A;  5CGS A;  1Z6F A;  1YLP A;  3DW0 A;  1O7E A;  1PYY A;  1ZKJ A;  3NCK A;  3UE1 A;  4OKP A;  4GD8 A;  4JXG A;  2JBF A;  1K38 A;  5E2H A;  4B4Z A;  1N4O A;  2EXB A;  3BM6 A;  3BLS A;  3V50 A;  4GOG A;  3WRZ A;  4JF6 A;  3HBR A;  4DE1 A;  3IXB A;  1K54 A;  1BTL A;  3IF6 C;  1ONH A;  1M6K A;  1H8Z A;  4BL2 A;  2HP6 A;  4UA6 A;  3FV7 A;  2ZQD A;  3HLW A;  1E4D A;  4M3K A;  3UDF A;  3HLB A;  5FA7 A;  2WAD A;  3PAE A;  4MBF A;  4PM6 A;  2Q9N A;  2XR0 A;  5U47 A;  2WGI A;  2XEP A;  3FZC A;  3HLG A;  3W4P A;  1ESU A;  1SCW A;  3VP0 A;  3UNW A;  3ZCZ A;  5BOH A;  2CC1 A;  2JE5 A;  1TVF A;  4EBP A;  3ZG8 B;  2JCH A;  2Y2I A;  3BEC A;  4H8R A;  3IHB A;  4PM5 A;  4HES A;  2ZM2 A;  5EVI D;  4IBR A;  5EVI A;  5DF8 A;  3VP1 A;  4FCF A;  2XD1 A;  3TOI A;  2I72 A;  3LEZ A;  3EQV A;  3QNC A;  2EX9 A;  1W7F A;  1ES5 A;  4E3L A;  2Z2L B;  4ID4 A;  4IVI A;  5HAI A;  4K0W A;  3A3F A;  4ZBE A;  3NIA A;  1PZP A;  3Q81 A;  4Q8I A;  4S2P A;  5G18 A;  3Q1F A;  3C4O A;  4N9L A;  4X6T A;  2WUQ A;  3N6I A;  1CEG A;  5EEC A;  4BEN A;  4BJP A;  1H8Y A;  5FDH A;  3Q7Z A;  4GB7 A;  1K56 A;  4E3N A;  3HLF A;  2XDM A;  3ITA A;  1KE4 A;  4OH0 A;  1YQS A;  2G2U A;  3W8K A;  3WS5 A;  1K6S A;  3IQA A;  1NY0 A;  3AGE A;  3FKV A;  4C3Q A;  5AQ7 A;  2ZQ7 A;  4EWF A;  1IEL A;  3V39 A;  3IXH A;  5EVI C;  2A3U A;  1HVB A;  4KZ6 A;  1HTZ A;  1MWR A;  3AGF A;  4S2I A;  1K57 A;  1S6R A;  2EFX A;  1ERQ A;  3HUO A;  2ZC7 A;  4KG2 A;  3HL9 A;  1DJA A;  3M2K A;  4U0X A;  2V2F F;  3RXW A;  1KE0 A;  1YLJ A;  2XLN A;  5CGW A;  3C7U A;  1TEM A;  4FH2 A;  4E6W A;  2EFU A;  3LO7 A;  5DTT A;  3NI9 A;  5TR7 A;  1PWD A;  3RJU A;  4OQG A;  4OPR A;  4P6B A;  2J8Y A;  2H10 A;  3P98 A;  1L0G A;  2DRW A;  4R3J A;  5FI7 A;  3BEB A;  1W79 A;  5DVA A;  1XA1 A;  3IH9 A;  1ES3 A;  1GHP A;  5CTN A;  2Y2M A;  5CRF A;  2XD5 A;  2WAF A;  4R4R A;  3V3R A;  3ZVW A;  1CK3 A;  2ZC3 B;  2DCF A;  3GQZ A;  3JYI A;  4ZTK A;  1LHY A;  1W8Q A;  4QD4 A;  4FSF A;  2QZ6 A;  3G35 A;  4N92 A;  1XX2 A;  1CI8 A;  2VGK A;  3VOY A;  4WEJ A;  5FQK A;  3ZNT A;  1EI5 A;  1S0W A;  3E2K A;  4U3T A;  3ZHH A;  1KDW A;  1FQG A;  5DF9 A;  5CXW A;  5KSC A;  3VSK A;  3UPN A;  3OC2 A;  1KVM A;  2RCX A;  3CZD A;  1YLT A;  3UE0 A;  4JBF A;  5KZH A;  5F82 A;  3ZG0 A;  1Q2P A;  1BUE A;  1YLZ A;  4ZJ3 A;  3DTM A;  5HX9 A;  1JTG A;  1L0F A;  2WK0 A;  2Y2Q A;  3GVB A;  3WS1 A;  3LY4 A;  5HAP A;  4YIN A;  4FH4 A;  1VQQ A;  4QU3 A;  3IWQ A;  5GLC A;  4XUZ A;  4S2N C;  3ISG A;  3MBZ A;  4MBH A;  3CMZ A;  5E2F A;  4ZJ1 A;  1K4F A;  1XGI A;  3OPL A;  4O7D A;  5A91 A;  5JYP A;  1IYQ A;  4GDN A;  1PI5 A;  1EWZ A;  1JVJ A;  1PIO A;  5HAQ A;  1HD8 A;  5CHU A;  2Z2M B;  2ZJ9 A;  1KGG A;  1Y54 A;  3A3J A;  4WEK A;  3G34 A;  4KQQ A;  5AQA A;  3V3S A;  3CJM A;  1NZO A;  1E3U A;  4E3J A;  4OQH A;  1OME A;  3Q07 A;  3E2L A;  4E6X A;  3N8L A;  3C5A A;  3Q7V A;  2J7V A;  2X71 A;  3ITB A;  3NC8 A;  2HP9 A;  1ONG A;  5FAO A;  4MEZ A;  5EVL A;  3ZVT A;  3ZG9 B;  4LV3 A;  1KDS A;  2P74 A;  3MXS A;  4P0M A;  5F1G A;  3G30 A;  1MWU A;  3OPR A;  4P85 A;  5M1A A;  2QPN A;  5EUA A;  4N9K A;  3VP4 A;  1KGE A;  2XF3 A;  3QNB A;  2XFT A;  4S2J A;  1L0E A;  4U0T A;  2WKI A;  5AQB A;  4KG6 A;  1WYC A;  2HDR A;  2H0T A;  2ZMA A;  1GCE A;  5FAT A;  1SHV A;  3GR2 A;  4GD6 A;  4RA7 A;  4PMA A;  5FI6 A;  3WS4 A;  4GZB A;  4JXS A;  1I5Q A;  4KZ5 A;  2G2W A;  1BT5 A;  4UA7 A;  1XGJ A;  5HFO A;  4DXB A;  1K54 C;  1BUL A;  2P9V B;  3M6H A;  5CEC A;  3GRJ A;  3IF5 A;  4MNR A;  4HBU A;  4UHU A;  1ERO A;  1YMS A;  4LV2 A;  3SS4 A;  3OCN A;  1SKF A;  1K55 A;  4DDS A;  5EPH A;  2Y2K A;  4HEF A;  1BSG A;  2EXA A;  4R4S A;  4KQR A;  4KZB A;  4EBN A;  4KZ7 A;  3IH8 A;  4E3M A;  4A5R A;  1L2S A;  3O86 A;  1K56 D;  2IWC A;  3NDE A;  3GSG A;  3I7J A;  3PTE A;  5GL9 A;  4QB8 A;  2WKH A;  3HLD A;  4LV1 A;  4JF5 A;  3V5M A;  3HUN A;  5CEB A;  1DJB A;  1WYB A;  1PWG A;  3PBT A;  4WMC D;  5HL1 A;  5KMW A;  4Z9Q A;  5I94 A;  4WMC A;  3OPH A;  3IF6 B;  2FFY A;  3SS3 A;  4OP5 A;  3PAG A;  1SDE A;  2ZC5 B;  1FCM A;  1JTD A;  4DE3 A;  1J9M A;  4KZA A;  3VMA A;  3OZH A;  1BLP A;  1VM1 A;  1XP4 A;  4R3B A;  3IHA A;  3PBQ A;  5AQ9 A;  4XUX A;  1MPL A;  4WM9 A;  3W4O A;  1MBL A;  3Q7V B;  4XXR A;  3HUM A;  2RL3 A;  4L0L A;  4X69 A;  1NYM A;  1ES2 A;  1MY8 A;  3IWI A;  5FQQ A;  1K25 A;  3WWX A;  5GHZ A;  4HBT A;  3GV9 A;  3PBS A;  2Y2O A;  1ALQ A;  2WZX A;  2IWB A;  4BL3 A;  2BG1 A;  2HDS A;  3G4P A;  3UY6 A;  2WZZ A;  2DNS A;  3WS2 A;  5M18 A;  3HLC A;  3VFF A;  5FAQ A;  3MKE A;  4OPZ A;  3TSG A;  2HP5 A;  1IEM A;  3S22 A;  3NY4 A;  1JWZ A;  3IXD A;  1GA0 A;  4JKT A;  3UE3 A;  2GDN A;  4OPQ A;  1NYY A;  1XKZ A;  4RX2 A;  1K57 C;  5FAS A;  2IWD A;  3MZF A;  1XPB A;  3WS0 A;  1ZC2 A;  1XA7 A;  4JPM A;  3O3V A;  1QME A;  2P9V A;  1IYS A;  1GHM A;  3ZFZ A;  4Y0O A;  1ZG4 A;  1M40 A;  3G2Y A;  4WZ5 A;  3B3X A;  3M6B A;  1W8Y A;  4D2O A;  2Y4A A;  5E2E A;  4KZ9 A;  5A92 A;  2XK1 A;  2A49 A;  1DJC A;  3O87 A;  1PI4 A;  5EE8 A;  1O07 A;  2EX6 A;  1ESI A;  2FFF B;  4DE0 A;  4CPK A;  1I2S A;  4NET A;  2E8I A;  4LV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...