5CXWA

Structure of the pona1 protein from mycobacterium tuberculosis in complex with penicillin v
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
380
structure length
376
Chain Sequence
b'KGPNGLIERQVTRELLELFNIDEQTLNTQGLVVTTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSIDPHNGAVRAYYGGDNANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDGIKITNVEGEGCGTCNIAEALKMSLNTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVAHTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGIYHPPHFVQKVVSANGQVLFDASTGDQRIPKAVADNVTAAMEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANKDAWMVGYTPSLSTAVWVGTVKGDEPLVTASGAAIYGSGLPSDIWKATMDGALKGTSNETFPKPTEVGGYAGVPPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 1A
publication title Crystal structures of the transpeptidase domain of the Mycobacterium tuberculosis penicillin-binding protein PonA1 reveal potential mechanisms of antibiotic resistance.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Penicillin-binding protein/antibiotic
total genus 119
structure length 376
sequence length 380
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5cxwA00
1ALQA 2EXAA 1PW1A 1MXOA 4M3KA 2WGIA 4RYEA 3N7WA 4JPMA 4S2NA 3NDEA 2WYXA 1IYOA 3LY4A 4JLFA 2EX8A 2XFTA 4GD8A 3VMAA 2J7VA 4IVKA 4PM9A 1FSWA 3NY4A 1N9BA 3TG9A 2EFUA 4E3LA 5JYPA 1HVBA 1J9MA 3HLGA 4EQIA 4UHUA 3N4IA 4PMAA 3GRJA 4OONA 1FCOA 1BT5A 4DDSA 2DCFA 5EUAA 3OPHA 4EBPA 5TR7A 1W7FA 5EVIA 3A3DA 3GTCA 3HUMA 3IXBA 5FA7A 3O3VA 2OSUA 4S2NC 3ZDJA 1KVMA 4OQIA 2A49A 4XUXA 4KQOA 2XQZA 5TGFA 3MXSA 2WKHA 3G34A 4R23A 5M19A 4X68A 3IHBA 4PPRA 2ZD8A 4WBGA 3QNCA 4PM8A 4BQMA 4OQGA 3Q07A 3BFEA 5GLDA 2X01A 2WZZA 2WK0A 1BTLA 3HREA 1L2SA 3UPPA 2JE5A 2XH9A 2ZC4B 4R0QA 1MY8A 4ZTKA 3BECA 5U47A 4KZ3A 5D3OA 4FH4A 5FSRA 3NIAA 4GDNA 3VFFA 3RJUA 5EVID 3UDXA 5I94A 3VP1A 1Q2QA 1WYBA 2ZM8A 4B4XA 2HP5A 2XGNA 3HLFA 4JF5A 4RX3A 2Y2LA 1GHMA 2R9WA 4RVAA 3I7JA 1TVFA 4QY6A 3OCNA 1FR6A 2DNSA 3VFHA 3OZHA 1KGFA 1MPLA 2FFFB 3SS5A 2R9XA 3Q7VB 1YLPA 3QHYA 4Y0UA 3W4QA 1GHIA 4JXSA 1KGEA 5CERA 3HBRA 4GKUA 5E2EA 3G31A 2Z2LB 4LV2A 4OLGA 5A91A 3SS3A 5E43A 5EECA 4P0MA 2XLNA 3G32A 4OOYA 2PU2A 4DE3A 1ES2A 4WEJA 4XXRA 5E2HA 2H0YA 3SOIA 3BYDA 3OPRA 5AQ7A 4E6XA 1EI5A 2EX9A 4OVDA 3LEZA 5DF9A 3GV9A 5EOEA 3VP0A 4MNRA 4K0WA 1EROA 3E2KA 5FI2A 1YM1A 3HUNA 4LV0A 4QU3A 3VOZA 1K54C 5IHVA 1JTGA 3ISGA 3CG5A 2IWDA 3IT9A 5AQ9A 2BG1A 4OOMA 5FDHA 3ZG8B 3UN7A 4HBUA 4IEDA 4UA6A 1YLZA 5GHYA 3W4OA 4E3OA 2V2FF 3M6BA 3P09A 1DJBA 2OV5A 5L2FA 1NYYA 2XR0A 3ZHHA 1KE3A 1RP5A 1BULA 1TDGA 5CEBA 1I5QA 1NZOA 1TDLA 2V20A 3ITBA 4GNUA 4JF6A 1W5DA 4S2KA 1K4FA 4OQ0A 3VP2A 3IF6A 2V1ZA 2JC7A 1L0DA 3G2ZA 3IHAA 2A3UA 4U0XA 4E3MA 4DE1A 1SHVA 4MLLA 1K4EA 3PBTA 4WZ4A 1G6AA 1K6RA 1ZG4A 3C5AA 1W79A 2GDNA 4NETA 4Z9QA 1L0EA 3HL9A 4S2MA 5CHUA 5FI6A 1GHPA 2EXBA 5A92A 2ZQCA 1VQQA 1ESIA 1VM1A 2C5WB 3Q7VA 1H8YA 4X56A 1W8QA 1PZPA 3IF6C 3ZCZA 3PBNA 4DXCA 4KZ9A 1NXYA 3HUOA 4EUZA 2HP9A 1ES5A 4GDBA 1ZC2A 1HD8A 2ZM0A 3HLBA 1FQGA 4QB8A 5M18A 4U3TA 2XD1A 1ERMA 2X71A 4EWFA 3CZDA 3OC2A 4EBNA 1JTDA 3BFDA 1K57A 3UY6A 1DJCA 3FWLA 1MBLA 1PYYA 5DF8A 5CGSA 5EVLA 3UDIA 3VP4A 1H8ZA 5F1FA 3IH8A 2Y2NA 2IWCA 1BLSA 3GMWA 3HLEA 4UAAA 3TSGA 4LCLA 3JYIA 4WEKA 5M1AA 3DWZA 2I72A 3WWXA 3BFFA 1NYMA 3BEBA 4MBHA 4KG5A 5FQMA 3M2JA 5F1GA 2WAFA 1JWPA 2ZC7A 3V50A 2DRWA 4E3IA 5FI7A 1GCEA 5F83A 2Z2MB 3RXXA 1YMSA 1FR1A 4GOGA 5DF7A 2Y2KA 1K56A 3Q82A 2CC1A 3WS4A 3D4FA 2WKIA 4X6TA 3O86A 3SH8A 1CEFA 1M6KA 1MKIA 1NZUA 4XUZA 4QY5A 1JWVA 4WYYA 1MWUA 3IXDA 2B5RA 1YT4A 1IKGA 2H5SA 4L0LA 4OP5A 4OOLA 3PBSA 5EVIC 3DTMA 2XF3A 5CECA 2P9VB 3ITAA 5AQAA 5HX9A 5CRFA 3N8RA 3ZG0A 2J9PA 4S2OA 4HEFA 1K56D 4OH0A 3WS2A 1DY6A 1XKZA 1Y54A 3UO9A 3IH9A 1PWDA 1K6SA 1NY0A 4OPRA 3BFGA 4IBRA 4DKIA 3ZVWA 1AXBA 3C7UA 3G2YA 3VSKA 1JVJA 2H0TA 3BRMA 4KZBA 1G68A 3MKEA 3IXHA 4D2OA 1BLPA 5CXWA 2IWBA 2EX2A 3LO7A 4FD8A 1WE4A 1O07A 4DXBA 3UPOA 1WYCA 2Y2IA 3OPLA 4RA7A 4U0TA 3ZFZA 1BLHA 1RGYA 3MFDA 5FATA 4E3KA 1S6RA 4R3BA 5A90A 2Q9NA 4NK3A 4CJNA 2WUQA 5KZHA 1PI4A 4CPKA 4UA9A 4YINA 5BOHA 4JKTA 1CI8A 1KE4A 3VSLA 1PIOA 1S0WA 5EOOA 4ZBEA 4Q8IA 1ONGA 3V3RA 3NDGA 1ONHA 1E3UA 3N6IA 4GN2A 4OP8A 3V3SA 3P98A 3ZG7B 3LCEA 3CJMA 3BM6A 4JXWA 3A3IA 1ZKJA 2G2WA 3O88A 1O7EA 2JBFA 5DTSA 3WRZA 2PU4A 5JYOA 4OQHA 1JWZA 1LL5A 3PBRA 3PAGA 4R1GA 4N92A 3ZG5A 3E2LA 2Y2PA 5E2GA 5F82A 4A5RA 3NC8A 2PBYA 2ZQAA 4BD1A 5HAPA 1SKFA 3MKFA 4ZJ2A 2P9VA 5HAQA 5FQIA 3WRTA 1LI9A 1PWGA 3ZGAB 1E25A 1E3UD 1XA1A 1BSGA 3AGFA 3CMZA 4MBFA 5AQBA 1U60A 2OLVA 3W4PA 1CEGA 5DVAA 3UE0A 3Q81A 4KZAA 2XEPA 1SDNA 3MZEA 4KZ5A 1M40A 4KZ4A 1K25A 1BUEA 5TFQA 5HL1A 1K38A 5EVIB 2HPBA 4Y7PA 1EWZA 2Y2QA 3MBZA 4FCFA 4BL2A 5DTTA 1ERQA 2XK1A 3GR2A 3HVFA 4QHCA 1RGZA 3UE1A 3OCLA 1GA9A 1N4OA 4S2JA 2OLUA 3GSGA 4WZ5A 5HARA 4K0XA 2ZQ7A 1HZOA 1H5XA 3MZDA 4KQQA 4YFMA 4ZJ3A 3UPNA 3B3XA 1NJ4A 3FKVA 5GHXA 2WKEA 3O87A 2WGVA 3GVBA 2G2UA 4ZJ1A 4DE2A 5GLBA 4O7DA 1PW8A 3UNWA 2J9OA 2XD5A 4PM7A 4OPYA 2ZC3B 4R4SA 5EPHA 3M6HA 4C75A 2ZQ9A 3A3JA 4EBLA 3V5MA 1E4DA 4WZ5C 4OPQA 4QJGA 4N1HA 4E3JA 2BLSA 3WS1A 1K57C 4B4ZA 4EV4A 1DJAA 3N8LA 1Z6FA 3AGDA 4X69A 3HLWA 3W8KA 1SDEA 1YLTA 2ZM2A 3AGEA 4ZDXA 1CI9A 5GLAA 5FAOA 4KQRA 1LLBA 3A3EA 3FKWA 3VP3A 2Y2JA 3NCKA 1PWCA 2RL3A 3IF5A 4PM6A 4LENA 2ZLYA 4N9KA 4S2IA 3OPPA 5FQJA 4BLMA 2VGJA 4IVIA 2ZC6B 3C7VA 1IKIA 1PI5A 5G18A 4E3NA 5CHMA 1K55A 2XFSA 3IWIA 3N8SA 5GHZA 3S4XA 1BZAA 1OMEA 5E2FA 4KENB 4C6YA 4GZBA 2WGWB 3MZFA 3UDFA 4Y0TA 4OKPA 3RXWA 3G35A 4QD4A 4B88A 5CEDA 4BL3A 4PM5A 3WS0A 1FOFA 5FQ9A 5CGWA 3ZG9B 1LI0A 3IXGA 4MEZA 3IWQA 1K55C 1KVLA 4P85A 4KG2A 4JXGA 3EQVA 5FAQA 4DF6A 4E6WA 3FV7A 2Y4AA 2QPNA 4RX2A 4FH2A 3IF6B 2J8YA 5KSHA 2EX6A 3HLDA 3FYZA 5KMWA 4LV3A 3M2KA 1XPBA 5EE8A 1ZG6A 2ZMAA 1MWSA 1ES4A 1L0GA 1PZOA 1IYQA 1LHYA 1YMXA 2FFYA 4P6BA 4OPZA 4HESA 2ZQ8A 3SH9A 1YLWA 2WAEA 3PAEA 1YQSA 4DDYA 1KGGA 4H8RA 4GD6A 1FSYA 4R3JA 2Y59A 3ZNTA 1MWTA 4ID4A 3G4PA 3IQAA 5FASA 2P74A 5FQKA 1XP4A 5DTKA 3DWKA 1K54A 3BLSA 1LL9A 3C4PA 3GQZA 4LV1A 2HP6A 4BD0A 2UWXA 3G30A 3DW0A 4N1XA 5HAIA 2E8IA 3NI9A 5CGXA 4OLDA 1IELA 3SH7A 4GB7A 5FAPA 1QMEA 3NBLA 1Q2PA 1I2SA 3PBOA 1RCJA 2QMIA 4DRTA 3A3FA 4WMCA 1KDWA 2ZQDA 4Y0OA 5CTNA 4X55A 4BJPA 4WELA 2Y2MA 2ZC5B 2JCHA 4FSFA 1IYSA 2EFXA 3IWOA 1KDSA 4X53A 2HDSA 1XX2A 3ZVTA 5A93A 5KSCA 4C3QA 4JBFA 1SCWA 2RCXA 4S2PA 2WGWA 1BLCA 1TEMA 3S1YA 1YLYA 2QZ6A 1IYPA 4IBXA 3Q7ZA 2XDMA 2HDRA 4JF4A 1KE0A 2WADA 4F94A 1QMFA 2VGKA 4KG6A 4KZ8A 2X02A 3HLCA 4WMCD 1XGIA 1XA7A 4MBKA 5HW3A 1FCNA 5CHJA 1ESUA 3TOIA 2WZXA 3QNBA 5GLCA 3UE3A 3PBQA 3SS4A 4KZ7A 5HFOA 2ZJ9A 4WM9A 4S2LA 1YLJA 2Y2HA 4UA7A 1C3BA 2C6WB 1ES3A 4R4RA 1CK3A 3C4OA 3VOYA 3BLMA 2Y55A 2H10A 4N9LA 3Q1FA 1I2WA 4ZAMA 1XXMA 1GA0A 3MXRA 1MWRA 3LY3A 4DE0A 4K91A 4JXVA 1XGJA 5GL9A 2Q9MA 4LCMA 2Y2GA 3WS5A 3BFCA 1NRFA 2HDQA 2Y91A 5FQQA 1HTZA 1L0FA 1FCMA 1W8YA 2HDUA 2Y2OA 5J8XA 3EQUA 4KZ6A 5CTMA 3S22A 1IEMA 4HBTA 3FZCA 4P87A 3V39A 4BENA 3ZNYA 3PTEA
chains in the Genus database with same CATH superfamily
2O9BA 2EXAA 3PHYA 4XT2B 2L4RA 5EV0A 2W3GA 1F5MA 4L9EA 4S2NA 3HJIA 4Y3IA 2XFTA 4GD8A 1MKMA 3NY4A 4E3LA 4O0PA 4ARZB 4OONA 4GCZA 2LB9A 1YKDA 5EVIA 2V9AA 3ZDJA 2A49A 3MXSA 4R23A 3G34A 3IHBA 3IX8A 4WBGA 3CI6A 4PM8A 3FPVA 2WZZA 2WK0A 1BTLA 1STZA 2XH9A 4DJ3A 4CQHA 3VFFA 2DMWA 3KSFA 5I94A 3VP1A 1Q2QA 2ZM8A 1L3LA 4P6ZM 4WN5A 2R9WA 2W1RA 4F3LA 1ACFA 3SS5A 2G7UA 4Y0UA 1GHIA 1KGEA 3G31A 2Z2LB 4LV2A 3MF0A 5K5BA 3G32A 2PU2A 4E04A 4WEJA 5E2HA 2H0YA 3SOIA 3MR0A 2OOLA 4MNRA 5FI2A 4PAUA 4QU3A 1CF0A 5AQ9A 2BG1A 1NWZA 4EW7A 3ZG8B 3UN7A 3W4OA 3P09A 1NYYA 2XR0A 5CEBA 1NZOA 1Z09A 2V20A 4JF6A 4S2KA 3UE6A 1GSXA 3K3CA 4YWZA 4HJ3A 1G6AA 1K6RA 1ZG4A 4Y5FA 3C5AA 2GDNA 2ZL1B 4Z9QA 3U2AA 1L0EA 3HL9A 5CHUA 2Z6DA 3LYXA 5FI6A 1VM1A 3IF6C 3PBNA 4DXCA 3RH8B 2V1AA 2HP9A 4II7A 3FC7A 3CITA 3E98A 3MQQA 2KLIA 1DJCA 2JKRM 3F1OA 1YAXA 2Y2NA 1BLSA 3HLEA 2QJ5A 3KO6A 3LIEA 4MBHA 3LI8A 5FQMA 3UB6A 5TBMA 2VK3A 1ZHHB 4E3IA 2Z2MB 3QP2A 3T50A 2WKQA 2WKRA 1S4RA 4GOGA 4L9GA 2Y2KA 3BY9A 1NZUA 4WYYA 4I3JA 2B5RA 5F69A 5EVIC 3DTMA 5CECA 4IHQA 5DKLA 1IFQA 4LRXC 4H6JA 5CRFA 3N8RA 3A0SA 3ZG0A 4S2OA 4HEFA 1K56D 3WS2A 1Y54A 3IH9A 1EW0A 4DKIA 1AXBA 3MJQA 2H0TA 5CXWA 5HDDA 5HL6A 1KOUA 1WYCA 3OPLA 2XROA 4R3BA 1DP9A 2Q9NA 3PYPA 2WUQA 4CPKA 4UA9A 2QWSA 1PIOA 4Y17A 4Q8IA 4JGRA 1TS6A 3FG8A 4I3AA 3P98A 3ZG7B 3T4KA 5AVEA 4M4XA 1ZKJA 3LICA 3IS2A 3O88A 4LRYC 4PHTA 3E2LA 5E2GA 5F82A 3CUEA 4ZJ2A 5HAQA 3ZGAB 3WRTA 1LI9A 1XA1A 3JPUA 1U60A 3NOPC 5AJGA 3QP6A 5EVIB 5KIZA 5HD3A 1GSVA 2HGVA 3OCLA 3T4JA 3DBAA 2IA2A 3UPNA 3B3XA 1NJ4A 3O87A 2WGVA 2J3TC 4Y2FA 3EWKA 3UNWA 4PM7A 1E4DA 4F3LB 1DRMA 4OPQA 3MFXA 3WS1A 1OTAA 2BTFP 1DJAA 1Z6FA 3AGDA 3UB5P 1YLTA 3IBJA 1T1BA 1PWCA 3IF5A 4LENA 5FQJA 4EERA 1V9ZA 2XFSA 5GHZA 3S4XA 1BZAA 2K7SA 2WGWB 3EEHA 3G6OA 4OKPA 3G35A 4B88A 5IU1A 2QHKA 1FOFA 3BQAA 3IXGA 1H8MA 5MC7A 3HLDA 2J3WA 5EE8A 4HJ6A 5L10A 4HESA 2ZQ8A 1YLWA 1YQSA 4GD6A 3G4PA 2PD7A 3IQAA 5FASA 3C4PA 1NLYA 3G30A 3NI9A 4CLCB 2EWVA 4HOIA 2V8CA 1Q2PA 1MC0A 2QMIA 2Q0OA 3F1OB 4WELA 2ZC5B 2JCHA 1IYSA 1LT0A 1XX2A 5IS1A 3S1YA 1YLYA 5TBMB 1IYPA 4JF4A 4BBVA 2VGKA 4KG6A 2X02A 3CUEC 1TS8A 2GZAA 4MBKA 4MN5A 3TOIA 1S4SA 3MS6A 3QP5A 3QNBA 4EETB 2O9AA 3UE3A 4KZ7A 1DP8A 3F1PA 4WM9A 4S2LA 4UA7A 4K08A 1ES3A 4N9LA 4ZAMA 1OTIA 4IUHA 1IOUA 3ULFA 3KYEA 4LCMA 3CPTA 1NRFA 2HDQA 5FQQA 4EEPA 1L0FA 2HDUA 5J8XA 5CTMA 4BENA 3V39A 2GJ3A 1ALQA 4NXFA 1D06A 3HJKA 1PW1A 1MXOA 2W3FA 3ICYA 2WGIA 5L8MA 4JPMA 3NDEA 2WYXA 3LY4A 3VMAA 2QYBA 4DJ2A 2KDKA 4R6LA 1FSWA 3TG9A 5JYPA 4EQIA 3N4IA 1Y28A 1BT5A 2ZMVA 2DCFA 5EUAA 3LI9A 5TR7A 1W7FA 5FA7A 3A3DA 2GX5A 3ZYTA 4OQIA 1F98A 3IS2B 3Q07A 2X01A 1H3QA 4R0QA 2ZC4B 4ZTKA 1MY8A 3LIBA 3R4KA 5FSRA 3NIAA 3BY8A 5HD5A 1WYBA 4B4XA 1AWIA 2Y2LA 1GHMA 4RVAA 3KSIA 3I7JA 1OJ5A 1TVFA 4QY6A 3OZHA 2FFFB 3Q7VB 3QHYA 3HBRA 3UB8A 5A91A 4P0MA 1NLZA 1ES2A 4QWOA 3BYDA 1LSWA 3OPRA 4O8GA 5AQ7A 3GECA 1VEUA 5TJJA 3LEZA 3E2KA 3A0VA 1YM1A 3B47A 3ISGA 4O01A 3TRCA 3LR5A 4OOMA 5FDHA 2JKTM 4HBUA 5GHYA 4E3OA 5L2FA 5FL3A 3ZHHA 1RP5A 3A0RA 1I5QA 1TDLA 4GLQA 2UV0E 1W5DA 3IF6A 2JC7A 5FEGA 3NOTC 1XJ3A 2A3UA 4U0XA 4DE1A 1SHVA 4MCWA 4NETA 1ESIA 1PZPA 4KZ9A 3HUOA 4EUZA 4GDBA 1ZC2A 3HLBA 4U3TA 1ERMA 2X71A 2KOIA 4EBNA 3C30A 1K57A 3FWLA 5J7EA 4IJGA 3B33A 1H8ZA 2IWCA 3GMWA 4UAAA 2R78A 2I72A 3BFFA 4BMWA 3BEBA 1P97A 4BBTA 3M2JA 1JWPA 3V50A 1YPRA 2VGLS 5FI7A 5F83A 3NJAA 1WA9A 3S7PA 4PKYA 2ACGA 3S7OA 1K56A 2D02A 2K31A 3Q82A 3WS4A 3NHQA 4EQ1A 2J80A 3IXDA 4NEED 1YT4A 4L0LA 4I5SA 3ITAA 4GW9A 5AQAA 5HX9A 2ZOIA 2J9PA 3TW8A 1DY6A 3UO9A 1TF1A 3G2YA 3R7WA 2PRFA 1JVJA 1OJGA 1XJ4A 1MZUA 4D2OA 3LO7A 4FD8A 4PKYG 4ZRRA 3UPOA 2Y2IA 4U0TA 2KX6A 1N9LA 1RGYA 4E3KA 5A90A 2W27A 4CJNA 5BOHA 2EA9A 3HCYA 3V3RA 3CPTB 3NDGA 3DTEA 1ZTUA 1X0OA 3CJMA 4JXWA 4WLAA 3A3IA 2G2WA 1O7EA 5DTSA 3WRZA 2PU4A 3VV4A 4A5RA 3UMDA 2QKPA 3C8CA 3NC8A 2ZQAA 5HAPA 3BQ8A 4Y13A 2P9VA 1V9YA 1E25A 1E3UD 1BSGA 2OWJA 3RTYA 4MBFA 2EWWA 1UGUA 2OLVA 3W4PA 1CEGA 3UE0A 3Q81A 5IT5A 4KZAA 3T1XA 4KZ4A 1K25A 5HL1A 3LR4A 2XRNA 1K38A 2HPBA 4Y7PA 3MBZA 2Y2QA 5DFXA 3GR2A 3HVFA 1RGZA 4NG2A 1GA9A 3OBFA 2ZQ7A 4YFMA 2D01A 3GVBA 4Q0JA 4C75A 2ZQ9A 4HIAA 4NXEA 3TJZC 2BLSA 1K57C 3KSGA 1PNEA 1CJFA 2ZM2A 4ZDXA 1CI9A 2XA7S 1T1AA 3PR6A 1LLBA 2FH5A 3A3EA 3VP3A 2Y2JA 4FTXA 4PM6A 2RL3A 4N9KA 3OPPA 4BLMA 2ZC6B 1VEUB 3C7VA 1PI5A 5G18A 5F68A 5HDCA 1OMEA 4C6YA 4GZBA 2VX8A 5CGWA 4MEZA 4P85A 4GJ4A 2YKHA 3EQVA 1W63Q 3FV7A 4BWIA 2QPNA 4RX2A 4FH2A 3IF6B 2EX6A 3VE3A 5KMWA 1S67L 1MWSA 4I38A 2ZMFA 1YMXA 1LHYA 2FFYA 4P6BA 3SH9A 2ZBBA 3ZQ5A 2GNXA 4DDYA 4LFUA 1FSYA 4R3JA 3ZNTA 4HI4A 1MWTA 3LFVA 5DTKA 1LL9A 3GQZA 4LV1A 3DW0A 5HAIA 2E8IA 3S7NA 2JKRI 3V67A 2E8JA 4GB7A 1RCJA 1KDSA 5KSCA 5A93A 1TEMA 4BBUA 4F94A 3HLCA 3FPWA 1XA7A 2PR5A 2HZ5A 1FCNA 2WZXA 5GLCA 4MN6A 3SS4A 2ZJ9A 4CLCE 1YLJA 2Y2HA 1S1YA 1C3BA 2C6WB 2JHEA 4R4RA 1CK3A 3BLMA 2Y55A 2H10A 3T4TA 1XXMA 3NOUC 3LY3A 2HJ9C 1XGJA 5GL9A 2Q9MA 3WS5A 2Y91A 2PYPA 1D7EA 4HBTA 3FZCA 3ZNYA 3R7WB 2PYRA 3PTEA 2PR6A 1T1CA 2M7VA 4M3KA 4ETXA 4JLFA 2EX8A 4IVKA 4PM9A 1N9BA 2EFUA 3HLGA 1J9MA 4UHUA 4CLCD 4PMAA 3GRJA 4DDSA 2FZ0A 3OPHA 1A0KA 3GTCA 2VZWA 3HUMA 2OSUA 3C38A 1KVMA 4XUXA 5TGFA 5M19A 4KQOA 2XQZA 3EGDC 3F1NA 3QNCA 3LIDA 3BFEA 5GLDA 3HREA 3MQ0A 1LL8A 2JE5A 5U47A 3BECA 5D3OA 4FH4A 2MJ6A 4GDNA 3RJUA 3UDXA 2HP5A 2XGNA 4JF5A 4B93A 1FR6A 2DNSA 3VFHA 1KGFA 2R9XA 1YLPA 3W4QA 4JXSA 1DP6A 2PAVP 3B42A 5CERA 4OLGA 5E43A 5EECA 2XLNA 5HWTA 4XXRA 2B18A 1EI5A 2EX9A 4OVDA 5DF9A 5EOEA 1N9NA 4ESPA 1EROA 5LBRA 4LV0A 5IHVA 2IWDA 3CAXA 3BW6A 1F9IA 3IX4A 4UA6A 1YLZA 1G6OA 1K0KA 2V2FF 2XSSA 3M6BA 2W1TA 2OV5A 3VOLA 4X1LA 1KE3A 3D72A 1TDGA 5HPFA 1NRJA 2V1ZA 3G2ZA 1S66L 2VA0A 1K4EA 4WZ4A 3DTIA 3D9YA 5HPIA 5EM1A 4WF0A 4UEYA 2EXBA 5A92A 4H6JB 2ZQCA 1VQQA 1YSPA 2BASA 1H8YA 4X56A 1W8QA 2ZM0A 4QB8A 1FQGA 4KQDA 1H0MA 5M18A 2XD1A 4EWFA 4NXGA 3KYQA 3UY6A 5CGSA 5F1FA 3IH8A 1OT6A 3JYIA 2AVXA 3KX0X 4KG5A 5F1GA 2WAFA 2ZC7A 2DRWA 4HQAA 1GCEA 2B02A 3RXXA 5DF7A 4Q0HA 3D4FA 2WKIA 3SH8A 1MKIA 4XUZA 4QY5A 1JWVA 1IKGA 2H5SA 4OOLA 3H82A 3PBSA 3E4OA 2ZL1A 2VV8A 1VETA 2HF6A 3H9WA 4EESA 1P0ZA 3RFBA 4OH0A 1XKZA 1PWDA 1K6SA 1NY0A 4OPRA 3BFGA 2PBDP 3LGOA 3LR0A 3VSKA 2HJEA 4KZBA 4GHIA 3IXHA 2IWBA 2EX2A 1O07A 4RQ9A 3IX3A 3SZTA 3JVUA 5C5KA 5FATA 1S6RA 4NK3A 5KZHA 1VHMA 4YINA 3MMHA 4JKTA 3VSLA 1J3WA 2JKFA 4G3KA 1ONGA 4LGWA 1ONHA 1E3UA 3N6IA 1YSQA 3LCEA 4OQHA 1JWZA 1LL5A 3OOVA 3PAGA 4N92A 1PFLA 3ZG5A 1OTDA 1FILA 2PBYA 1W63M 4BD1A 3SW1A 5FQIA 1PWGA 4E6XA 5AQBA 2XEPA 3MZEA 4LPZA 1M40A 1BUEA 1EWZA 4FCFA 3H7WA 1BYWA 2P08A 4BL2A 4QHCA 4FUWA 3F1NB 1GSWA 2OLUA 3GSGA 3D3OA 1LSVA 1HZOA 1H5XA 2K2NA 4ZJ3A 3FKVA 5DFYA 2WKEA 5J3WA 4ZJ1A 4DE2A 5GLBA 4O7DA 1PW8A 1UWPX 2J9OA 5EPHA 4OPYA 2ZC3B 3M6HA 4EBLA 3V5MA 4WZ5C 4QJGA 4N1HA 3VE4A 4HH2A 4QPRA 4X69A 2VEAA 3W8KA 4R3AA 4I3IA 4JGPA 4IVIA 1IKIA 5CHMA 3BWLA 5E2FA 3U4LP 2JKTI 3UDFA 2PHYA 1OTEA 1XJ6A 2W1TB 4PM5A 3WS0A 2JN7A 4Q0IA 3ZG9B 1K55C 5L07A 4E6WA 3PXPA 4EXOA 2J8YA 2W3HA 3M2KA 3F1PB 1ZG6A 1ES4A 1L0GA 1IYQA 3IBRA 2WAEA 3PAEA 3MXQA 2Y59A 4HP4A 2P74A 5FQKA 1XP4A 2HV1A 3T1QB 2NUTC 1K54A 3BLSA 2HP6A 2UWXA 1TD5A 1P9RA 5CGXA 4OLDA 1IELA 5FAPA 4DMZA 1HLUP 3A3FA 5CTNA 4FSFA 4X53A 3CWFA 2W3EA 1SCWA 4S2PA 2WGWA 1BLCA 4IBXA 2XDMA 2HDRA 1KE0A 1T18A 1QMFA 4WMCD 1XGIA 3S7QA 5I5LA 5HW3A 2Z6CA 4NXBA 4ME4A 5HFOA 3LIFA 4UQIS 5AVFA 3H82B 3UMEA 1I2WA 3DTKA 1LSXA 1VETB 1GA0A 3MXRA 4DE0A 4AFIA 4JXVA 3DAVA 3TE8A 3CHWP 3BFCA 1XJ2A 1HTZA 5DKKA 5F5YA 2H28A 2OAQ1 4CLCA 4GS9A 1S1ZA 4JGQA 4GHIB 2O9CA 5CX7A 4RYEA 3N7WA 1IYOA 2J7VA 3EEAA 1HVBA 2O0YA 4IUKA 1T19A 1FCOA 4EBPA 3IXBA 5DJTA 3O3VA 4S2NC 3T4OA 2WKHA 4HHDA 4X68A 4I39A 4PPRA 3UB9A 2ZD8A 4BQMA 4OQGA 1N9OA 3UPPA 1L2SA 3E4PA 4YNRA 4KZ3A 4LLOB 5EVID 3HLFA 4RX3A 3T4QA 3LEQA 3OCNA 1MPLA 3H7WB 2A24A 4GKUA 4WUJA 5E2EA 2L0WA 3SS3A 4NKPA 4OOYA 1OTBA 4DE3A 3P01A 5HWVA 3T1SA 3GV9A 3VP0A 5HSQA 2VV6A 4K0WA 4KUKA 3HUNA 4Z1WA 3VOZA 1K54C 1JTGA 3CG5A 2VLGA 3T4SA 3IT9A 2PT7A 5J4EA 4P6ZS 4IEDA 3O5YA 3EOIA 1DJBA 3EGXC 1BULA 4GNUA 3ITBA 2V8FA 1G5UA 1ODVA 1K4FA 4OQ0A 3VP2A 2A2LA 1L0DA 3IHAA 3P7NA 4E3MA 4MLLA 3PBTA 3NECA 3T4LA 2LB5A 1W79A 2I9VA 3KYZA 4S2MA 1GHPA 2PDRA 2C5WB 3Q7VA 3ZCZA 1NXYA 1ES5A 1SKOA 4X25A 3MQOA 1HD8A 5HDSA 2ZOHA 3CZDA 3OC2A 3T12B 2OWHA 2V0WA 1JTDA 3BFDA 1JNUA 1MBLA 1PYYA 5DF8A 5EVLA 3UDIA 3VP4A 3TSGA 1FIKA 4LCLA 2M7UA 4WEKA 5M1AA 3DWZA 3LR3A 2J3TD 5EVEA 5G4YA 3WWXA 1NYMA 3T1RA 4CLCC 1YMSA 1FR1A 1P9WA 4HY8A 2CC1A 4X6TA 3O86A 1CEFA 1M6KA 1G28A 5FEFA 2JKGA 1MWUA 4OP5A 2XF3A 4JGOA 2P9VB 3LIAA 4DN0A 4MDZA 5DJUA 2PD8A 4IBRA 3ZVWA 3C7UA 3OLOA 2L1MA 3GDIA 3BRMA 1G68A 3MKEA 1BLPA 4XT2A 2CMNA 1WE4A 4DXBA 3MSHA 4WL9A 3BJNA 1SZVA 2WKPA 4RA7A 3ZFZA 2NUPC 1BLHA 3MFDA 4B9OA 1TS0A 1PI4A 1CI8A 1KE4A 4ARZA 1S0WA 5EOOA 4ZBEA 4GN2A 4OP8A 3V3SA 3JVVA 3BM6A 2JBFA 2M1CA 4GS9B 5JYOA 3PBRA 4R1GA 1F2KA 4D60A 2W3DA 1OT9A 2Y2PA 4ETZA 4EU0A 1SKFA 3MKFA 1XFNA 3L7HA 3AGFA 3CMZA 5DVAA 2VGLM 1SDNA 4KZ5A 5TFQA 5DTTA 1ERQA 2XK1A 1PRQA 3UE1A 2P7JA 1N4OA 4S2JA 3K3DA 1OPXA 4WZ5A 5HARA 4K0XA 3MZDA 4KQQA 5GHXA 2V0UA 5HWWA 5A8BA 1XFQA 2G2UA 3E4QA 2XD5A 4R4SA 3A3JA 4E3JA 5F6AA 2A24B 2P04A 2Y8HA 4YOFA 4B4ZA 4EEUA 4EV4A 3N8LA 3HLWA 2VKSA 2B95A 1SDEA 4R70A 3AGEA 3CLOA 1D1JA 2VV7A 5GLAA 5FAOA 4KQRA 1VB6A 3FKWA 3NCKA 4S2IA 2ZLYA 2VGJA 3E0YA 4E3NA 5FDSA 1K55A 3IWIA 3N8SA 2VJWA 4KENB 2Y79A 3MZFA 3QP1A 4Y0TA 3RXWA 4QD4A 5CEDA 3QP8A 4BL3A 5HZHA 5FQ9A 1LI0A 3QP4A 3IWQA 1KVLA 4HJ4A 4KG2A 4JXGA 5FAQA 4DF6A 2Y4AA 1Y4OA 5KSHA 3FYZA 4KUOA 4LV3A 3L9KA 1XPBA 2ZMAA 1PZOA 3LUQA 4OPZA 4FOFA 1KGGA 4H8RA 3NULA 5L09A 4HH3A 2O99A 4ID4A 3DWKA 4HP9A 1SKOB 4BD0A 4UQIM 4N1XA 5EM0A 3SH7A 1QMEA 3NBLA 1I2SA 3PBOA 4HNBA 4DRTA 4L9FA 3UB7A 4WMCA 1KDWA 2ZQDA 4Y0OA 3W2ZA 2QJ7A 4X55A 4BJPA 2Y2MA 4Y15A 2EFXA 3IWOA 2OAP1 4G3VA 2HDSA 3ZVTA 4C3QA 4JBFA 2INWA 2RCXA 2QZ6A 3Q7ZA 2WADA 4LRZE 4KZ8A 3C2WA 2XA7M 2YKFA 4EUVA 2W0NA 5CHJA 1ESUA 4R38A 1TS7A 1UWNX 3KSHA 3PBQA 5EFWA 4MN7A 1CQAA 5G4ZA 3VOYA 3C4OA 4X1MA 3Q1FA 1MWRA 4K91A 4MMNA 3K2NA 2Y2GA 4G3WA 2V1BA 1FCMA 1W8YA 2Y2OA 3EQUA 4KZ6A 3S22A 1IEMA 4P87A
chains in the Genus database with same CATH topology
1ALQA 2EXAA 1PW1A 1MXOA 4M3KA 2WGIA 4RYEA 3N7WA 4JPMA 4S2NA 3NDEA 2WYXA 1IYOA 3LY4A 4JLFA 2EX8A 2XFTA 4GD8A 3VMAA 2J7VA 4IVKA 4PM9A 1FSWA 3NY4A 1N9BA 3TG9A 2EFUA 4E3LA 5JYPA 1HVBA 1J9MA 3HLGA 4EQIA 4UHUA 3N4IA 4PMAA 3GRJA 4OONA 1FCOA 1BT5A 4DDSA 2DCFA 5EUAA 3OPHA 4EBPA 5TR7A 1W7FA 5EVIA 3A3DA 3GTCA 3HUMA 3IXBA 5FA7A 3O3VA 2OSUA 4S2NC 3ZDJA 1KVMA 4OQIA 2A49A 4XUXA 4KQOA 2XQZA 5TGFA 3MXSA 2WKHA 3G34A 4R23A 5M19A 4X68A 3IHBA 4PPRA 2ZD8A 4WBGA 3QNCA 4PM8A 4BQMA 4OQGA 3Q07A 3BFEA 5GLDA 2X01A 2WZZA 2WK0A 1BTLA 3HREA 1L2SA 3UPPA 2JE5A 2XH9A 2ZC4B 4R0QA 1MY8A 4ZTKA 3BECA 5U47A 4KZ3A 5D3OA 4FH4A 5FSRA 3NIAA 4GDNA 3VFFA 3RJUA 5EVID 3UDXA 5I94A 3VP1A 1Q2QA 1WYBA 2ZM8A 4B4XA 2HP5A 2XGNA 3HLFA 4JF5A 4RX3A 2Y2LA 1GHMA 2R9WA 4RVAA 3I7JA 1TVFA 4QY6A 3OCNA 1FR6A 2DNSA 3VFHA 3OZHA 1KGFA 1MPLA 2FFFB 3SS5A 2R9XA 3Q7VB 1YLPA 3QHYA 4Y0UA 3W4QA 1GHIA 4JXSA 1KGEA 5CERA 3HBRA 4GKUA 5E2EA 3G31A 2Z2LB 4LV2A 4OLGA 5A91A 3SS3A 5E43A 5EECA 4P0MA 2XLNA 3G32A 4OOYA 2PU2A 4DE3A 1ES2A 4WEJA 4XXRA 5E2HA 2H0YA 3SOIA 3BYDA 3OPRA 5AQ7A 4E6XA 1EI5A 2EX9A 4OVDA 3LEZA 5DF9A 3GV9A 5EOEA 3VP0A 4MNRA 4K0WA 1EROA 3E2KA 5FI2A 1YM1A 3HUNA 4LV0A 4QU3A 3VOZA 1K54C 5IHVA 1JTGA 3ISGA 3CG5A 2IWDA 3IT9A 5AQ9A 2BG1A 4OOMA 5FDHA 3ZG8B 3UN7A 4HBUA 4IEDA 4UA6A 1YLZA 5GHYA 3W4OA 4E3OA 2V2FF 3M6BA 3P09A 1DJBA 2OV5A 5L2FA 1NYYA 2XR0A 3ZHHA 1KE3A 1RP5A 1BULA 1TDGA 5CEBA 1I5QA 1NZOA 1TDLA 2V20A 3ITBA 4GNUA 4JF6A 1W5DA 4S2KA 1K4FA 4OQ0A 3VP2A 3IF6A 2V1ZA 2JC7A 1L0DA 3G2ZA 3IHAA 2A3UA 4U0XA 4E3MA 4DE1A 1SHVA 4MLLA 1K4EA 3PBTA 4WZ4A 1G6AA 1K6RA 1ZG4A 3C5AA 1W79A 2GDNA 4NETA 4Z9QA 1L0EA 3HL9A 4S2MA 5CHUA 5FI6A 1GHPA 2EXBA 5A92A 2ZQCA 1VQQA 1ESIA 1VM1A 2C5WB 3Q7VA 1H8YA 4X56A 1W8QA 1PZPA 3IF6C 3ZCZA 3PBNA 4DXCA 4KZ9A 1NXYA 3HUOA 4EUZA 2HP9A 1ES5A 4GDBA 1ZC2A 1HD8A 2ZM0A 3HLBA 1FQGA 4QB8A 5M18A 4U3TA 2XD1A 1ERMA 2X71A 4EWFA 3CZDA 3OC2A 4EBNA 1JTDA 3BFDA 1K57A 3UY6A 1DJCA 3FWLA 1MBLA 1PYYA 5DF8A 5CGSA 5EVLA 3UDIA 3VP4A 1H8ZA 5F1FA 3IH8A 2Y2NA 2IWCA 1BLSA 3GMWA 3HLEA 4UAAA 3TSGA 4LCLA 3JYIA 4WEKA 5M1AA 3DWZA 2I72A 3WWXA 3BFFA 1NYMA 3BEBA 4MBHA 4KG5A 5FQMA 3M2JA 5F1GA 2WAFA 1JWPA 2ZC7A 3V50A 2DRWA 4E3IA 5FI7A 1GCEA 5F83A 2Z2MB 3RXXA 1YMSA 1FR1A 4GOGA 5DF7A 2Y2KA 1K56A 3Q82A 2CC1A 3WS4A 3D4FA 2WKIA 4X6TA 3O86A 3SH8A 1CEFA 1M6KA 1MKIA 1NZUA 4XUZA 4QY5A 1JWVA 4WYYA 1MWUA 3IXDA 2B5RA 1YT4A 1IKGA 2H5SA 4L0LA 4OP5A 4OOLA 3PBSA 5EVIC 3DTMA 2XF3A 5CECA 2P9VB 3ITAA 5AQAA 5HX9A 5CRFA 3N8RA 3ZG0A 2J9PA 4S2OA 4HEFA 1K56D 4OH0A 3WS2A 1DY6A 1XKZA 1Y54A 3UO9A 3IH9A 1PWDA 1K6SA 1NY0A 4OPRA 3BFGA 4IBRA 4DKIA 3ZVWA 1AXBA 3C7UA 3G2YA 3VSKA 1JVJA 2H0TA 3BRMA 4KZBA 1G68A 3MKEA 3IXHA 4D2OA 1BLPA 5CXWA 2IWBA 2EX2A 3LO7A 4FD8A 1WE4A 1O07A 4DXBA 3UPOA 1WYCA 2Y2IA 3OPLA 4RA7A 4U0TA 3ZFZA 1BLHA 1RGYA 3MFDA 5FATA 4E3KA 1S6RA 4R3BA 5A90A 2Q9NA 4NK3A 4CJNA 2WUQA 5KZHA 1PI4A 4CPKA 4UA9A 4YINA 5BOHA 4JKTA 1CI8A 1KE4A 3VSLA 1PIOA 1S0WA 5EOOA 4ZBEA 4Q8IA 1ONGA 3V3RA 3NDGA 1ONHA 1E3UA 3N6IA 4GN2A 4OP8A 3V3SA 3P98A 3ZG7B 3LCEA 3CJMA 3BM6A 4JXWA 3A3IA 1ZKJA 2G2WA 3O88A 1O7EA 2JBFA 5DTSA 3WRZA 2PU4A 5JYOA 4OQHA 1JWZA 1LL5A 3PBRA 3PAGA 4R1GA 4N92A 3ZG5A 3E2LA 2Y2PA 5E2GA 5F82A 4A5RA 3NC8A 2PBYA 2ZQAA 4BD1A 5HAPA 1SKFA 3MKFA 4ZJ2A 2P9VA 5HAQA 5FQIA 3WRTA 1LI9A 1PWGA 3ZGAB 1E25A 1E3UD 1XA1A 1BSGA 3AGFA 3CMZA 4MBFA 5AQBA 1U60A 2OLVA 3W4PA 1CEGA 5DVAA 3UE0A 3Q81A 4KZAA 2XEPA 1SDNA 3MZEA 4KZ5A 1M40A 4KZ4A 1K25A 1BUEA 5TFQA 5HL1A 1K38A 5EVIB 2HPBA 4Y7PA 1EWZA 2Y2QA 3MBZA 4FCFA 4BL2A 5DTTA 1ERQA 2XK1A 3GR2A 3HVFA 4QHCA 1RGZA 3UE1A 3OCLA 1GA9A 1N4OA 4S2JA 2OLUA 3GSGA 4WZ5A 5HARA 4K0XA 2ZQ7A 1HZOA 1H5XA 3MZDA 4KQQA 4YFMA 4ZJ3A 3UPNA 3B3XA 1NJ4A 3FKVA 5GHXA 2WKEA 3O87A 2WGVA 3GVBA 2G2UA 4ZJ1A 4DE2A 5GLBA 4O7DA 1PW8A 3UNWA 2J9OA 2XD5A 4PM7A 4OPYA 2ZC3B 4R4SA 5EPHA 3M6HA 4C75A 2ZQ9A 3A3JA 4EBLA 3V5MA 1E4DA 4WZ5C 4OPQA 4QJGA 4N1HA 4E3JA 2BLSA 3WS1A 1K57C 4B4ZA 4EV4A 1DJAA 3N8LA 1Z6FA 3AGDA 4X69A 3HLWA 3W8KA 1SDEA 1YLTA 2ZM2A 3AGEA 4ZDXA 1CI9A 5GLAA 5FAOA 4KQRA 1LLBA 3A3EA 3FKWA 3VP3A 2Y2JA 3NCKA 1PWCA 2RL3A 3IF5A 4PM6A 4LENA 2ZLYA 4N9KA 4S2IA 3OPPA 5FQJA 4BLMA 2VGJA 4IVIA 2ZC6B 3C7VA 1IKIA 1PI5A 5G18A 4E3NA 5CHMA 1K55A 2XFSA 3IWIA 3N8SA 5GHZA 3S4XA 1BZAA 1OMEA 5E2FA 4KENB 4C6YA 4GZBA 2WGWB 3MZFA 3UDFA 4Y0TA 4OKPA 3RXWA 3G35A 4QD4A 4B88A 5CEDA 4BL3A 4PM5A 3WS0A 1FOFA 5FQ9A 5CGWA 3ZG9B 1LI0A 3IXGA 4MEZA 3IWQA 1K55C 1KVLA 4P85A 4KG2A 4JXGA 3EQVA 5FAQA 4DF6A 4E6WA 3FV7A 2Y4AA 2QPNA 4RX2A 4FH2A 3IF6B 2J8YA 5KSHA 2EX6A 3HLDA 3FYZA 5KMWA 4LV3A 3M2KA 1XPBA 5EE8A 1ZG6A 2ZMAA 1MWSA 1ES4A 1L0GA 1PZOA 1IYQA 1LHYA 1YMXA 2FFYA 4P6BA 4OPZA 4HESA 2ZQ8A 3SH9A 1YLWA 2WAEA 3PAEA 1YQSA 4DDYA 1KGGA 4H8RA 4GD6A 1FSYA 4R3JA 2Y59A 3ZNTA 1MWTA 4ID4A 3G4PA 3IQAA 5FASA 2P74A 5FQKA 1XP4A 5DTKA 3DWKA 1K54A 3BLSA 1LL9A 3C4PA 3GQZA 4LV1A 2HP6A 4BD0A 2UWXA 3G30A 3DW0A 4N1XA 5HAIA 2E8IA 3NI9A 5CGXA 4OLDA 1IELA 3SH7A 4GB7A 5FAPA 1QMEA 3NBLA 1Q2PA 1I2SA 3PBOA 1RCJA 2QMIA 4DRTA 3A3FA 4WMCA 1KDWA 2ZQDA 4Y0OA 5CTNA 4X55A 4BJPA 4WELA 2Y2MA 2ZC5B 2JCHA 4FSFA 1IYSA 2EFXA 3IWOA 1KDSA 4X53A 2HDSA 1XX2A 3ZVTA 5A93A 5KSCA 4C3QA 4JBFA 1SCWA 2RCXA 4S2PA 2WGWA 1BLCA 1TEMA 3S1YA 1YLYA 2QZ6A 1IYPA 4IBXA 3Q7ZA 2XDMA 2HDRA 4JF4A 1KE0A 2WADA 4F94A 1QMFA 2VGKA 4KG6A 4KZ8A 2X02A 3HLCA 4WMCD 1XGIA 1XA7A 4MBKA 5HW3A 1FCNA 5CHJA 1ESUA 3TOIA 2WZXA 3QNBA 5GLCA 3UE3A 3PBQA 3SS4A 4KZ7A 5HFOA 2ZJ9A 4WM9A 4S2LA 1YLJA 2Y2HA 4UA7A 1C3BA 2C6WB 1ES3A 4R4RA 1CK3A 3C4OA 3VOYA 3BLMA 2Y55A 2H10A 4N9LA 3Q1FA 1I2WA 4ZAMA 1XXMA 1GA0A 3MXRA 1MWRA 3LY3A 4DE0A 4K91A 4JXVA 1XGJA 5GL9A 2Q9MA 4LCMA 2Y2GA 3WS5A 3BFCA 1NRFA 2HDQA 2Y91A 5FQQA 1HTZA 1L0FA 1FCMA 1W8YA 2HDUA 2Y2OA 5J8XA 3EQUA 4KZ6A 5CTMA 3S22A 1IEMA 4HBTA 3FZCA 4P87A 3V39A 4BENA 3ZNYA 3PTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALQ A;  2EXA A;  1PW1 A;  1MXO A;  4M3K A;  2WGI A;  4RYE A;  3N7W A;  4JPM A;  4S2N A;  3NDE A;  2WYX A;  1IYO A;  3LY4 A;  4JLF A;  2EX8 A;  2XFT A;  4GD8 A;  3VMA A;  2J7V A;  4IVK A;  4PM9 A;  1FSW A;  3NY4 A;  1N9B A;  3TG9 A;  2EFU A;  4E3L A;  5JYP A;  1HVB A;  1J9M A;  3HLG A;  4EQI A;  4UHU A;  3N4I A;  4PMA A;  3GRJ A;  4OON A;  1FCO A;  1BT5 A;  4DDS A;  2DCF A;  5EUA A;  3OPH A;  4EBP A;  5TR7 A;  1W7F A;  5EVI A;  3A3D A;  3GTC A;  3HUM A;  3IXB A;  5FA7 A;  3O3V A;  2OSU A;  4S2N C;  3ZDJ A;  1KVM A;  4OQI A;  2A49 A;  4XUX A;  4KQO A;  2XQZ A;  5TGF A;  3MXS A;  2WKH A;  3G34 A;  4R23 A;  5M19 A;  4X68 A;  3IHB A;  4PPR A;  2ZD8 A;  4WBG A;  3QNC A;  4PM8 A;  4BQM A;  4OQG A;  3Q07 A;  3BFE A;  5GLD A;  2X01 A;  2WZZ A;  2WK0 A;  1BTL A;  3HRE A;  1L2S A;  3UPP A;  2JE5 A;  2XH9 A;  2ZC4 B;  4R0Q A;  1MY8 A;  4ZTK A;  3BEC A;  5U47 A;  4KZ3 A;  5D3O A;  4FH4 A;  5FSR A;  3NIA A;  4GDN A;  3VFF A;  3RJU A;  5EVI D;  3UDX A;  5I94 A;  3VP1 A;  1Q2Q A;  1WYB A;  2ZM8 A;  4B4X A;  2HP5 A;  2XGN A;  3HLF A;  4JF5 A;  4RX3 A;  2Y2L A;  1GHM A;  2R9W A;  4RVA A;  3I7J A;  1TVF A;  4QY6 A;  3OCN A;  1FR6 A;  2DNS A;  3VFH A;  3OZH A;  1KGF A;  1MPL A;  2FFF B;  3SS5 A;  2R9X A;  3Q7V B;  1YLP A;  3QHY A;  4Y0U A;  3W4Q A;  1GHI A;  4JXS A;  1KGE A;  5CER A;  3HBR A;  4GKU A;  5E2E A;  3G31 A;  2Z2L B;  4LV2 A;  4OLG A;  5A91 A;  3SS3 A;  5E43 A;  5EEC A;  4P0M A;  2XLN A;  3G32 A;  4OOY A;  2PU2 A;  4DE3 A;  1ES2 A;  4WEJ A;  4XXR A;  5E2H A;  2H0Y A;  3SOI A;  3BYD A;  3OPR A;  5AQ7 A;  4E6X A;  1EI5 A;  2EX9 A;  4OVD A;  3LEZ A;  5DF9 A;  3GV9 A;  5EOE A;  3VP0 A;  4MNR A;  4K0W A;  1ERO A;  3E2K A;  5FI2 A;  1YM1 A;  3HUN A;  4LV0 A;  4QU3 A;  3VOZ A;  1K54 C;  5IHV A;  1JTG A;  3ISG A;  3CG5 A;  2IWD A;  3IT9 A;  5AQ9 A;  2BG1 A;  4OOM A;  5FDH A;  3ZG8 B;  3UN7 A;  4HBU A;  4IED A;  4UA6 A;  1YLZ A;  5GHY A;  3W4O A;  4E3O A;  2V2F F;  3M6B A;  3P09 A;  1DJB A;  2OV5 A;  5L2F A;  1NYY A;  2XR0 A;  3ZHH A;  1KE3 A;  1RP5 A;  1BUL A;  1TDG A;  5CEB A;  1I5Q A;  1NZO A;  1TDL A;  2V20 A;  3ITB A;  4GNU A;  4JF6 A;  1W5D A;  4S2K A;  1K4F A;  4OQ0 A;  3VP2 A;  3IF6 A;  2V1Z A;  2JC7 A;  1L0D A;  3G2Z A;  3IHA A;  2A3U A;  4U0X A;  4E3M A;  4DE1 A;  1SHV A;  4MLL A;  1K4E A;  3PBT A;  4WZ4 A;  1G6A A;  1K6R A;  1ZG4 A;  3C5A A;  1W79 A;  2GDN A;  4NET A;  4Z9Q A;  1L0E A;  3HL9 A;  4S2M A;  5CHU A;  5FI6 A;  1GHP A;  2EXB A;  5A92 A;  2ZQC A;  1VQQ A;  1ESI A;  1VM1 A;  2C5W B;  3Q7V A;  1H8Y A;  4X56 A;  1W8Q A;  1PZP A;  3IF6 C;  3ZCZ A;  3PBN A;  4DXC A;  4KZ9 A;  1NXY A;  3HUO A;  4EUZ A;  2HP9 A;  1ES5 A;  4GDB A;  1ZC2 A;  1HD8 A;  2ZM0 A;  3HLB A;  1FQG A;  4QB8 A;  5M18 A;  4U3T A;  2XD1 A;  1ERM A;  2X71 A;  4EWF A;  3CZD A;  3OC2 A;  4EBN A;  1JTD A;  3BFD A;  1K57 A;  3UY6 A;  1DJC A;  3FWL A;  1MBL A;  1PYY A;  5DF8 A;  5CGS A;  5EVL A;  3UDI A;  3VP4 A;  1H8Z A;  5F1F A;  3IH8 A;  2Y2N A;  2IWC A;  1BLS A;  3GMW A;  3HLE A;  4UAA A;  3TSG A;  4LCL A;  3JYI A;  4WEK A;  5M1A A;  3DWZ A;  2I72 A;  3WWX A;  3BFF A;  1NYM A;  3BEB A;  4MBH A;  4KG5 A;  5FQM A;  3M2J A;  5F1G A;  2WAF A;  1JWP A;  2ZC7 A;  3V50 A;  2DRW A;  4E3I A;  5FI7 A;  1GCE A;  5F83 A;  2Z2M B;  3RXX A;  1YMS A;  1FR1 A;  4GOG A;  5DF7 A;  2Y2K A;  1K56 A;  3Q82 A;  2CC1 A;  3WS4 A;  3D4F A;  2WKI A;  4X6T A;  3O86 A;  3SH8 A;  1CEF A;  1M6K A;  1MKI A;  1NZU A;  4XUZ A;  4QY5 A;  1JWV A;  4WYY A;  1MWU A;  3IXD A;  2B5R A;  1YT4 A;  1IKG A;  2H5S A;  4L0L A;  4OP5 A;  4OOL A;  3PBS A;  5EVI C;  3DTM A;  2XF3 A;  5CEC A;  2P9V B;  3ITA A;  5AQA A;  5HX9 A;  5CRF A;  3N8R A;  3ZG0 A;  2J9P A;  4S2O A;  4HEF A;  1K56 D;  4OH0 A;  3WS2 A;  1DY6 A;  1XKZ A;  1Y54 A;  3UO9 A;  3IH9 A;  1PWD A;  1K6S A;  1NY0 A;  4OPR A;  3BFG A;  4IBR A;  4DKI A;  3ZVW A;  1AXB A;  3C7U A;  3G2Y A;  3VSK A;  1JVJ A;  2H0T A;  3BRM A;  4KZB A;  1G68 A;  3MKE A;  3IXH A;  4D2O A;  1BLP A;  5CXW A;  2IWB A;  2EX2 A;  3LO7 A;  4FD8 A;  1WE4 A;  1O07 A;  4DXB A;  3UPO A;  1WYC A;  2Y2I A;  3OPL A;  4RA7 A;  4U0T A;  3ZFZ A;  1BLH A;  1RGY A;  3MFD A;  5FAT A;  4E3K A;  1S6R A;  4R3B A;  5A90 A;  2Q9N A;  4NK3 A;  4CJN A;  2WUQ A;  5KZH A;  1PI4 A;  4CPK A;  4UA9 A;  4YIN A;  5BOH A;  4JKT A;  1CI8 A;  1KE4 A;  3VSL A;  1PIO A;  1S0W A;  5EOO A;  4ZBE A;  4Q8I A;  1ONG A;  3V3R A;  3NDG A;  1ONH A;  1E3U A;  3N6I A;  4GN2 A;  4OP8 A;  3V3S A;  3P98 A;  3ZG7 B;  3LCE A;  3CJM A;  3BM6 A;  4JXW A;  3A3I A;  1ZKJ A;  2G2W A;  3O88 A;  1O7E A;  2JBF A;  5DTS A;  3WRZ A;  2PU4 A;  5JYO A;  4OQH A;  1JWZ A;  1LL5 A;  3PBR A;  3PAG A;  4R1G A;  4N92 A;  3ZG5 A;  3E2L A;  2Y2P A;  5E2G A;  5F82 A;  4A5R A;  3NC8 A;  2PBY A;  2ZQA A;  4BD1 A;  5HAP A;  1SKF A;  3MKF A;  4ZJ2 A;  2P9V A;  5HAQ A;  5FQI A;  3WRT A;  1LI9 A;  1PWG A;  3ZGA B;  1E25 A;  1E3U D;  1XA1 A;  1BSG A;  3AGF A;  3CMZ A;  4MBF A;  5AQB A;  1U60 A;  2OLV A;  3W4P A;  1CEG A;  5DVA A;  3UE0 A;  3Q81 A;  4KZA A;  2XEP A;  1SDN A;  3MZE A;  4KZ5 A;  1M40 A;  4KZ4 A;  1K25 A;  1BUE A;  5TFQ A;  5HL1 A;  1K38 A;  5EVI B;  2HPB A;  4Y7P A;  1EWZ A;  2Y2Q A;  3MBZ A;  4FCF A;  4BL2 A;  5DTT A;  1ERQ A;  2XK1 A;  3GR2 A;  3HVF A;  4QHC A;  1RGZ A;  3UE1 A;  3OCL A;  1GA9 A;  1N4O A;  4S2J A;  2OLU A;  3GSG A;  4WZ5 A;  5HAR A;  4K0X A;  2ZQ7 A;  1HZO A;  1H5X A;  3MZD A;  4KQQ A;  4YFM A;  4ZJ3 A;  3UPN A;  3B3X A;  1NJ4 A;  3FKV A;  5GHX A;  2WKE A;  3O87 A;  2WGV A;  3GVB A;  2G2U A;  4ZJ1 A;  4DE2 A;  5GLB A;  4O7D A;  1PW8 A;  3UNW A;  2J9O A;  2XD5 A;  4PM7 A;  4OPY A;  2ZC3 B;  4R4S A;  5EPH A;  3M6H A;  4C75 A;  2ZQ9 A;  3A3J A;  4EBL A;  3V5M A;  1E4D A;  4WZ5 C;  4OPQ A;  4QJG A;  4N1H A;  4E3J A;  2BLS A;  3WS1 A;  1K57 C;  4B4Z A;  4EV4 A;  1DJA A;  3N8L A;  1Z6F A;  3AGD A;  4X69 A;  3HLW A;  3W8K A;  1SDE A;  1YLT A;  2ZM2 A;  3AGE A;  4ZDX A;  1CI9 A;  5GLA A;  5FAO A;  4KQR A;  1LLB A;  3A3E A;  3FKW A;  3VP3 A;  2Y2J A;  3NCK A;  1PWC A;  2RL3 A;  3IF5 A;  4PM6 A;  4LEN A;  2ZLY A;  4N9K A;  4S2I A;  3OPP A;  5FQJ A;  4BLM A;  2VGJ A;  4IVI A;  2ZC6 B;  3C7V A;  1IKI A;  1PI5 A;  5G18 A;  4E3N A;  5CHM A;  1K55 A;  2XFS A;  3IWI A;  3N8S A;  5GHZ A;  3S4X A;  1BZA A;  1OME A;  5E2F A;  4KEN B;  4C6Y A;  4GZB A;  2WGW B;  3MZF A;  3UDF A;  4Y0T A;  4OKP A;  3RXW A;  3G35 A;  4QD4 A;  4B88 A;  5CED A;  4BL3 A;  4PM5 A;  3WS0 A;  1FOF A;  5FQ9 A;  5CGW A;  3ZG9 B;  1LI0 A;  3IXG A;  4MEZ A;  3IWQ A;  1K55 C;  1KVL A;  4P85 A;  4KG2 A;  4JXG A;  3EQV A;  5FAQ A;  4DF6 A;  4E6W A;  3FV7 A;  2Y4A A;  2QPN A;  4RX2 A;  4FH2 A;  3IF6 B;  2J8Y A;  5KSH A;  2EX6 A;  3HLD A;  3FYZ A;  5KMW A;  4LV3 A;  3M2K A;  1XPB A;  5EE8 A;  1ZG6 A;  2ZMA A;  1MWS A;  1ES4 A;  1L0G A;  1PZO A;  1IYQ A;  1LHY A;  1YMX A;  2FFY A;  4P6B A;  4OPZ A;  4HES A;  2ZQ8 A;  3SH9 A;  1YLW A;  2WAE A;  3PAE A;  1YQS A;  4DDY A;  1KGG A;  4H8R A;  4GD6 A;  1FSY A;  4R3J A;  2Y59 A;  3ZNT A;  1MWT A;  4ID4 A;  3G4P A;  3IQA A;  5FAS A;  2P74 A;  5FQK A;  1XP4 A;  5DTK A;  3DWK A;  1K54 A;  3BLS A;  1LL9 A;  3C4P A;  3GQZ A;  4LV1 A;  2HP6 A;  4BD0 A;  2UWX A;  3G30 A;  3DW0 A;  4N1X A;  5HAI A;  2E8I A;  3NI9 A;  5CGX A;  4OLD A;  1IEL A;  3SH7 A;  4GB7 A;  5FAP A;  1QME A;  3NBL A;  1Q2P A;  1I2S A;  3PBO A;  1RCJ A;  2QMI A;  4DRT A;  3A3F A;  4WMC A;  1KDW A;  2ZQD A;  4Y0O A;  5CTN A;  4X55 A;  4BJP A;  4WEL A;  2Y2M A;  2ZC5 B;  2JCH A;  4FSF A;  1IYS A;  2EFX A;  3IWO A;  1KDS A;  4X53 A;  2HDS A;  1XX2 A;  3ZVT A;  5A93 A;  5KSC A;  4C3Q A;  4JBF A;  1SCW A;  2RCX A;  4S2P A;  2WGW A;  1BLC A;  1TEM A;  3S1Y A;  1YLY A;  2QZ6 A;  1IYP A;  4IBX A;  3Q7Z A;  2XDM A;  2HDR A;  4JF4 A;  1KE0 A;  2WAD A;  4F94 A;  1QMF A;  2VGK A;  4KG6 A;  4KZ8 A;  2X02 A;  3HLC A;  4WMC D;  1XGI A;  1XA7 A;  4MBK A;  5HW3 A;  1FCN A;  5CHJ A;  1ESU A;  3TOI A;  2WZX A;  3QNB A;  5GLC A;  3UE3 A;  3PBQ A;  3SS4 A;  4KZ7 A;  5HFO A;  2ZJ9 A;  4WM9 A;  4S2L A;  1YLJ A;  2Y2H A;  4UA7 A;  1C3B A;  2C6W B;  1ES3 A;  4R4R A;  1CK3 A;  3C4O A;  3VOY A;  3BLM A;  2Y55 A;  2H10 A;  4N9L A;  3Q1F A;  1I2W A;  4ZAM A;  1XXM A;  1GA0 A;  3MXR A;  1MWR A;  3LY3 A;  4DE0 A;  4K91 A;  4JXV A;  1XGJ A;  5GL9 A;  2Q9M A;  4LCM A;  2Y2G A;  3WS5 A;  3BFC A;  1NRF A;  2HDQ A;  2Y91 A;  5FQQ A;  1HTZ A;  1L0F A;  1FCM A;  1W8Y A;  2HDU A;  2Y2O A;  5J8X A;  3EQU A;  4KZ6 A;  5CTM A;  3S22 A;  1IEM A;  4HBT A;  3FZC A;  4P87 A;  3V39 A;  4BEN A;  3ZNY A;  3PTE A; 
#chains in the Genus database with same CATH topology
 2O9B A;  2EXA A;  3PHY A;  4XT2 B;  2L4R A;  5EV0 A;  2W3G A;  1F5M A;  4L9E A;  4S2N A;  3HJI A;  4Y3I A;  2XFT A;  4GD8 A;  1MKM A;  3NY4 A;  4E3L A;  4O0P A;  4ARZ B;  4OON A;  4GCZ A;  2LB9 A;  1YKD A;  5EVI A;  2V9A A;  3ZDJ A;  2A49 A;  3MXS A;  4R23 A;  3G34 A;  3IHB A;  3IX8 A;  4WBG A;  3CI6 A;  4PM8 A;  3FPV A;  2WZZ A;  2WK0 A;  1BTL A;  1STZ A;  2XH9 A;  4DJ3 A;  4CQH A;  3VFF A;  2DMW A;  3KSF A;  5I94 A;  3VP1 A;  1Q2Q A;  2ZM8 A;  1L3L A;  4P6Z M;  4WN5 A;  2R9W A;  2W1R A;  4F3L A;  1ACF A;  3SS5 A;  2G7U A;  4Y0U A;  1GHI A;  1KGE A;  3G31 A;  2Z2L B;  4LV2 A;  3MF0 A;  5K5B A;  3G32 A;  2PU2 A;  4E04 A;  4WEJ A;  5E2H A;  2H0Y A;  3SOI A;  3MR0 A;  2OOL A;  4MNR A;  5FI2 A;  4PAU A;  4QU3 A;  1CF0 A;  5AQ9 A;  2BG1 A;  1NWZ A;  4EW7 A;  3ZG8 B;  3UN7 A;  3W4O A;  3P09 A;  1NYY A;  2XR0 A;  5CEB A;  1NZO A;  1Z09 A;  2V20 A;  4JF6 A;  4S2K A;  3UE6 A;  1GSX A;  3K3C A;  4YWZ A;  4HJ3 A;  1G6A A;  1K6R A;  1ZG4 A;  4Y5F A;  3C5A A;  2GDN A;  2ZL1 B;  4Z9Q A;  3U2A A;  1L0E A;  3HL9 A;  5CHU A;  2Z6D A;  3LYX A;  5FI6 A;  1VM1 A;  3IF6 C;  3PBN A;  4DXC A;  3RH8 B;  2V1A A;  2HP9 A;  4II7 A;  3FC7 A;  3CIT A;  3E98 A;  3MQQ A;  2KLI A;  1DJC A;  2JKR M;  3F1O A;  1YAX A;  2Y2N A;  1BLS A;  3HLE A;  2QJ5 A;  3KO6 A;  3LIE A;  4MBH A;  3LI8 A;  5FQM A;  3UB6 A;  5TBM A;  2VK3 A;  1ZHH B;  4E3I A;  2Z2M B;  3QP2 A;  3T50 A;  2WKQ A;  2WKR A;  1S4R A;  4GOG A;  4L9G A;  2Y2K A;  3BY9 A;  1NZU A;  4WYY A;  4I3J A;  2B5R A;  5F69 A;  5EVI C;  3DTM A;  5CEC A;  4IHQ A;  5DKL A;  1IFQ A;  4LRX C;  4H6J A;  5CRF A;  3N8R A;  3A0S A;  3ZG0 A;  4S2O A;  4HEF A;  1K56 D;  3WS2 A;  1Y54 A;  3IH9 A;  1EW0 A;  4DKI A;  1AXB A;  3MJQ A;  2H0T A;  5CXW A;  5HDD A;  5HL6 A;  1KOU A;  1WYC A;  3OPL A;  2XRO A;  4R3B A;  1DP9 A;  2Q9N A;  3PYP A;  2WUQ A;  4CPK A;  4UA9 A;  2QWS A;  1PIO A;  4Y17 A;  4Q8I A;  4JGR A;  1TS6 A;  3FG8 A;  4I3A A;  3P98 A;  3ZG7 B;  3T4K A;  5AVE A;  4M4X A;  1ZKJ A;  3LIC A;  3IS2 A;  3O88 A;  4LRY C;  4PHT A;  3E2L A;  5E2G A;  5F82 A;  3CUE A;  4ZJ2 A;  5HAQ A;  3ZGA B;  3WRT A;  1LI9 A;  1XA1 A;  3JPU A;  1U60 A;  3NOP C;  5AJG A;  3QP6 A;  5EVI B;  5KIZ A;  5HD3 A;  1GSV A;  2HGV A;  3OCL A;  3T4J A;  3DBA A;  2IA2 A;  3UPN A;  3B3X A;  1NJ4 A;  3O87 A;  2WGV A;  2J3T C;  4Y2F A;  3EWK A;  3UNW A;  4PM7 A;  1E4D A;  4F3L B;  1DRM A;  4OPQ A;  3MFX A;  3WS1 A;  1OTA A;  2BTF P;  1DJA A;  1Z6F A;  3AGD A;  3UB5 P;  1YLT A;  3IBJ A;  1T1B A;  1PWC A;  3IF5 A;  4LEN A;  5FQJ A;  4EER A;  1V9Z A;  2XFS A;  5GHZ A;  3S4X A;  1BZA A;  2K7S A;  2WGW B;  3EEH A;  3G6O A;  4OKP A;  3G35 A;  4B88 A;  5IU1 A;  2QHK A;  1FOF A;  3BQA A;  3IXG A;  1H8M A;  5MC7 A;  3HLD A;  2J3W A;  5EE8 A;  4HJ6 A;  5L10 A;  4HES A;  2ZQ8 A;  1YLW A;  1YQS A;  4GD6 A;  3G4P A;  2PD7 A;  3IQA A;  5FAS A;  3C4P A;  1NLY A;  3G30 A;  3NI9 A;  4CLC B;  2EWV A;  4HOI A;  2V8C A;  1Q2P A;  1MC0 A;  2QMI A;  2Q0O A;  3F1O B;  4WEL A;  2ZC5 B;  2JCH A;  1IYS A;  1LT0 A;  1XX2 A;  5IS1 A;  3S1Y A;  1YLY A;  5TBM B;  1IYP A;  4JF4 A;  4BBV A;  2VGK A;  4KG6 A;  2X02 A;  3CUE C;  1TS8 A;  2GZA A;  4MBK A;  4MN5 A;  3TOI A;  1S4S A;  3MS6 A;  3QP5 A;  3QNB A;  4EET B;  2O9A A;  3UE3 A;  4KZ7 A;  1DP8 A;  3F1P A;  4WM9 A;  4S2L A;  4UA7 A;  4K08 A;  1ES3 A;  4N9L A;  4ZAM A;  1OTI A;  4IUH A;  1IOU A;  3ULF A;  3KYE A;  4LCM A;  3CPT A;  1NRF A;  2HDQ A;  5FQQ A;  4EEP A;  1L0F A;  2HDU A;  5J8X A;  5CTM A;  4BEN A;  3V39 A;  2GJ3 A;  1ALQ A;  4NXF A;  1D06 A;  3HJK A;  1PW1 A;  1MXO A;  2W3F A;  3ICY A;  2WGI A;  5L8M A;  4JPM A;  3NDE A;  2WYX A;  3LY4 A;  3VMA A;  2QYB A;  4DJ2 A;  2KDK A;  4R6L A;  1FSW A;  3TG9 A;  5JYP A;  4EQI A;  3N4I A;  1Y28 A;  1BT5 A;  2ZMV A;  2DCF A;  5EUA A;  3LI9 A;  5TR7 A;  1W7F A;  5FA7 A;  3A3D A;  2GX5 A;  3ZYT A;  4OQI A;  1F98 A;  3IS2 B;  3Q07 A;  2X01 A;  1H3Q A;  4R0Q A;  2ZC4 B;  4ZTK A;  1MY8 A;  3LIB A;  3R4K A;  5FSR A;  3NIA A;  3BY8 A;  5HD5 A;  1WYB A;  4B4X A;  1AWI A;  2Y2L A;  1GHM A;  4RVA A;  3KSI A;  3I7J A;  1OJ5 A;  1TVF A;  4QY6 A;  3OZH A;  2FFF B;  3Q7V B;  3QHY A;  3HBR A;  3UB8 A;  5A91 A;  4P0M A;  1NLZ A;  1ES2 A;  4QWO A;  3BYD A;  1LSW A;  3OPR A;  4O8G A;  5AQ7 A;  3GEC A;  1VEU A;  5TJJ A;  3LEZ A;  3E2K A;  3A0V A;  1YM1 A;  3B47 A;  3ISG A;  4O01 A;  3TRC A;  3LR5 A;  4OOM A;  5FDH A;  2JKT M;  4HBU A;  5GHY A;  4E3O A;  5L2F A;  5FL3 A;  3ZHH A;  1RP5 A;  3A0R A;  1I5Q A;  1TDL A;  4GLQ A;  2UV0 E;  1W5D A;  3IF6 A;  2JC7 A;  5FEG A;  3NOT C;  1XJ3 A;  2A3U A;  4U0X A;  4DE1 A;  1SHV A;  4MCW A;  4NET A;  1ESI A;  1PZP A;  4KZ9 A;  3HUO A;  4EUZ A;  4GDB A;  1ZC2 A;  3HLB A;  4U3T A;  1ERM A;  2X71 A;  2KOI A;  4EBN A;  3C30 A;  1K57 A;  3FWL A;  5J7E A;  4IJG A;  3B33 A;  1H8Z A;  2IWC A;  3GMW A;  4UAA A;  2R78 A;  2I72 A;  3BFF A;  4BMW A;  3BEB A;  1P97 A;  4BBT A;  3M2J A;  1JWP A;  3V50 A;  1YPR A;  2VGL S;  5FI7 A;  5F83 A;  3NJA A;  1WA9 A;  3S7P A;  4PKY A;  2ACG A;  3S7O A;  1K56 A;  2D02 A;  2K31 A;  3Q82 A;  3WS4 A;  3NHQ A;  4EQ1 A;  2J80 A;  3IXD A;  4NEE D;  1YT4 A;  4L0L A;  4I5S A;  3ITA A;  4GW9 A;  5AQA A;  5HX9 A;  2ZOI A;  2J9P A;  3TW8 A;  1DY6 A;  3UO9 A;  1TF1 A;  3G2Y A;  3R7W A;  2PRF A;  1JVJ A;  1OJG A;  1XJ4 A;  1MZU A;  4D2O A;  3LO7 A;  4FD8 A;  4PKY G;  4ZRR A;  3UPO A;  2Y2I A;  4U0T A;  2KX6 A;  1N9L A;  1RGY A;  4E3K A;  5A90 A;  2W27 A;  4CJN A;  5BOH A;  2EA9 A;  3HCY A;  3V3R A;  3CPT B;  3NDG A;  3DTE A;  1ZTU A;  1X0O A;  3CJM A;  4JXW A;  4WLA A;  3A3I A;  2G2W A;  1O7E A;  5DTS A;  3WRZ A;  2PU4 A;  3VV4 A;  4A5R A;  3UMD A;  2QKP A;  3C8C A;  3NC8 A;  2ZQA A;  5HAP A;  3BQ8 A;  4Y13 A;  2P9V A;  1V9Y A;  1E25 A;  1E3U D;  1BSG A;  2OWJ A;  3RTY A;  4MBF A;  2EWW A;  1UGU A;  2OLV A;  3W4P A;  1CEG A;  3UE0 A;  3Q81 A;  5IT5 A;  4KZA A;  3T1X A;  4KZ4 A;  1K25 A;  5HL1 A;  3LR4 A;  2XRN A;  1K38 A;  2HPB A;  4Y7P A;  3MBZ A;  2Y2Q A;  5DFX A;  3GR2 A;  3HVF A;  1RGZ A;  4NG2 A;  1GA9 A;  3OBF A;  2ZQ7 A;  4YFM A;  2D01 A;  3GVB A;  4Q0J A;  4C75 A;  2ZQ9 A;  4HIA A;  4NXE A;  3TJZ C;  2BLS A;  1K57 C;  3KSG A;  1PNE A;  1CJF A;  2ZM2 A;  4ZDX A;  1CI9 A;  2XA7 S;  1T1A A;  3PR6 A;  1LLB A;  2FH5 A;  3A3E A;  3VP3 A;  2Y2J A;  4FTX A;  4PM6 A;  2RL3 A;  4N9K A;  3OPP A;  4BLM A;  2ZC6 B;  1VEU B;  3C7V A;  1PI5 A;  5G18 A;  5F68 A;  5HDC A;  1OME A;  4C6Y A;  4GZB A;  2VX8 A;  5CGW A;  4MEZ A;  4P85 A;  4GJ4 A;  2YKH A;  3EQV A;  1W63 Q;  3FV7 A;  4BWI A;  2QPN A;  4RX2 A;  4FH2 A;  3IF6 B;  2EX6 A;  3VE3 A;  5KMW A;  1S67 L;  1MWS A;  4I38 A;  2ZMF A;  1YMX A;  1LHY A;  2FFY A;  4P6B A;  3SH9 A;  2ZBB A;  3ZQ5 A;  2GNX A;  4DDY A;  4LFU A;  1FSY A;  4R3J A;  3ZNT A;  4HI4 A;  1MWT A;  3LFV A;  5DTK A;  1LL9 A;  3GQZ A;  4LV1 A;  3DW0 A;  5HAI A;  2E8I A;  3S7N A;  2JKR I;  3V67 A;  2E8J A;  4GB7 A;  1RCJ A;  1KDS A;  5KSC A;  5A93 A;  1TEM A;  4BBU A;  4F94 A;  3HLC A;  3FPW A;  1XA7 A;  2PR5 A;  2HZ5 A;  1FCN A;  2WZX A;  5GLC A;  4MN6 A;  3SS4 A;  2ZJ9 A;  4CLC E;  1YLJ A;  2Y2H A;  1S1Y A;  1C3B A;  2C6W B;  2JHE A;  4R4R A;  1CK3 A;  3BLM A;  2Y55 A;  2H10 A;  3T4T A;  1XXM A;  3NOU C;  3LY3 A;  2HJ9 C;  1XGJ A;  5GL9 A;  2Q9M A;  3WS5 A;  2Y91 A;  2PYP A;  1D7E A;  4HBT A;  3FZC A;  3ZNY A;  3R7W B;  2PYR A;  3PTE A;  2PR6 A;  1T1C A;  2M7V A;  4M3K A;  4ETX A;  4JLF A;  2EX8 A;  4IVK A;  4PM9 A;  1N9B A;  2EFU A;  3HLG A;  1J9M A;  4UHU A;  4CLC D;  4PMA A;  3GRJ A;  4DDS A;  2FZ0 A;  3OPH A;  1A0K A;  3GTC A;  2VZW A;  3HUM A;  2OSU A;  3C38 A;  1KVM A;  4XUX A;  5TGF A;  5M19 A;  4KQO A;  2XQZ A;  3EGD C;  3F1N A;  3QNC A;  3LID A;  3BFE A;  5GLD A;  3HRE A;  3MQ0 A;  1LL8 A;  2JE5 A;  5U47 A;  3BEC A;  5D3O A;  4FH4 A;  2MJ6 A;  4GDN A;  3RJU A;  3UDX A;  2HP5 A;  2XGN A;  4JF5 A;  4B93 A;  1FR6 A;  2DNS A;  3VFH A;  1KGF A;  2R9X A;  1YLP A;  3W4Q A;  4JXS A;  1DP6 A;  2PAV P;  3B42 A;  5CER A;  4OLG A;  5E43 A;  5EEC A;  2XLN A;  5HWT A;  4XXR A;  2B18 A;  1EI5 A;  2EX9 A;  4OVD A;  5DF9 A;  5EOE A;  1N9N A;  4ESP A;  1ERO A;  5LBR A;  4LV0 A;  5IHV A;  2IWD A;  3CAX A;  3BW6 A;  1F9I A;  3IX4 A;  4UA6 A;  1YLZ A;  1G6O A;  1K0K A;  2V2F F;  2XSS A;  3M6B A;  2W1T A;  2OV5 A;  3VOL A;  4X1L A;  1KE3 A;  3D72 A;  1TDG A;  5HPF A;  1NRJ A;  2V1Z A;  3G2Z A;  1S66 L;  2VA0 A;  1K4E A;  4WZ4 A;  3DTI A;  3D9Y A;  5HPI A;  5EM1 A;  4WF0 A;  4UEY A;  2EXB A;  5A92 A;  4H6J B;  2ZQC A;  1VQQ A;  1YSP A;  2BAS A;  1H8Y A;  4X56 A;  1W8Q A;  2ZM0 A;  4QB8 A;  1FQG A;  4KQD A;  1H0M A;  5M18 A;  2XD1 A;  4EWF A;  4NXG A;  3KYQ A;  3UY6 A;  5CGS A;  5F1F A;  3IH8 A;  1OT6 A;  3JYI A;  2AVX A;  3KX0 X;  4KG5 A;  5F1G A;  2WAF A;  2ZC7 A;  2DRW A;  4HQA A;  1GCE A;  2B02 A;  3RXX A;  5DF7 A;  4Q0H A;  3D4F A;  2WKI A;  3SH8 A;  1MKI A;  4XUZ A;  4QY5 A;  1JWV A;  1IKG A;  2H5S A;  4OOL A;  3H82 A;  3PBS A;  3E4O A;  2ZL1 A;  2VV8 A;  1VET A;  2HF6 A;  3H9W A;  4EES A;  1P0Z A;  3RFB A;  4OH0 A;  1XKZ A;  1PWD A;  1K6S A;  1NY0 A;  4OPR A;  3BFG A;  2PBD P;  3LGO A;  3LR0 A;  3VSK A;  2HJE A;  4KZB A;  4GHI A;  3IXH A;  2IWB A;  2EX2 A;  1O07 A;  4RQ9 A;  3IX3 A;  3SZT A;  3JVU A;  5C5K A;  5FAT A;  1S6R A;  4NK3 A;  5KZH A;  1VHM A;  4YIN A;  3MMH A;  4JKT A;  3VSL A;  1J3W A;  2JKF A;  4G3K A;  1ONG A;  4LGW A;  1ONH A;  1E3U A;  3N6I A;  1YSQ A;  3LCE A;  4OQH A;  1JWZ A;  1LL5 A;  3OOV A;  3PAG A;  4N92 A;  1PFL A;  3ZG5 A;  1OTD A;  1FIL A;  2PBY A;  1W63 M;  4BD1 A;  3SW1 A;  5FQI A;  1PWG A;  4E6X A;  5AQB A;  2XEP A;  3MZE A;  4LPZ A;  1M40 A;  1BUE A;  1EWZ A;  4FCF A;  3H7W A;  1BYW A;  2P08 A;  4BL2 A;  4QHC A;  4FUW A;  3F1N B;  1GSW A;  2OLU A;  3GSG A;  3D3O A;  1LSV A;  1HZO A;  1H5X A;  2K2N A;  4ZJ3 A;  3FKV A;  5DFY A;  2WKE A;  5J3W A;  4ZJ1 A;  4DE2 A;  5GLB A;  4O7D A;  1PW8 A;  1UWP X;  2J9O A;  5EPH A;  4OPY A;  2ZC3 B;  3M6H A;  4EBL A;  3V5M A;  4WZ5 C;  4QJG A;  4N1H A;  3VE4 A;  4HH2 A;  4QPR A;  4X69 A;  2VEA A;  3W8K A;  4R3A A;  4I3I A;  4JGP A;  4IVI A;  1IKI A;  5CHM A;  3BWL A;  5E2F A;  3U4L P;  2JKT I;  3UDF A;  2PHY A;  1OTE A;  1XJ6 A;  2W1T B;  4PM5 A;  3WS0 A;  2JN7 A;  4Q0I A;  3ZG9 B;  1K55 C;  5L07 A;  4E6W A;  3PXP A;  4EXO A;  2J8Y A;  2W3H A;  3M2K A;  3F1P B;  1ZG6 A;  1ES4 A;  1L0G A;  1IYQ A;  3IBR A;  2WAE A;  3PAE A;  3MXQ A;  2Y59 A;  4HP4 A;  2P74 A;  5FQK A;  1XP4 A;  2HV1 A;  3T1Q B;  2NUT C;  1K54 A;  3BLS A;  2HP6 A;  2UWX A;  1TD5 A;  1P9R A;  5CGX A;  4OLD A;  1IEL A;  5FAP A;  4DMZ A;  1HLU P;  3A3F A;  5CTN A;  4FSF A;  4X53 A;  3CWF A;  2W3E A;  1SCW A;  4S2P A;  2WGW A;  1BLC A;  4IBX A;  2XDM A;  2HDR A;  1KE0 A;  1T18 A;  1QMF A;  4WMC D;  1XGI A;  3S7Q A;  5I5L A;  5HW3 A;  2Z6C A;  4NXB A;  4ME4 A;  5HFO A;  3LIF A;  4UQI S;  5AVF A;  3H82 B;  3UME A;  1I2W A;  3DTK A;  1LSX A;  1VET B;  1GA0 A;  3MXR A;  4DE0 A;  4AFI A;  4JXV A;  3DAV A;  3TE8 A;  3CHW P;  3BFC A;  1XJ2 A;  1HTZ A;  5DKK A;  5F5Y A;  2H28 A;  2OAQ 1;  4CLC A;  4GS9 A;  1S1Z A;  4JGQ A;  4GHI B;  2O9C A;  5CX7 A;  4RYE A;  3N7W A;  1IYO A;  2J7V A;  3EEA A;  1HVB A;  2O0Y A;  4IUK A;  1T19 A;  1FCO A;  4EBP A;  3IXB A;  5DJT A;  3O3V A;  4S2N C;  3T4O A;  2WKH A;  4HHD A;  4X68 A;  4I39 A;  4PPR A;  3UB9 A;  2ZD8 A;  4BQM A;  4OQG A;  1N9O A;  3UPP A;  1L2S A;  3E4P A;  4YNR A;  4KZ3 A;  4LLO B;  5EVI D;  3HLF A;  4RX3 A;  3T4Q A;  3LEQ A;  3OCN A;  1MPL A;  3H7W B;  2A24 A;  4GKU A;  4WUJ A;  5E2E A;  2L0W A;  3SS3 A;  4NKP A;  4OOY A;  1OTB A;  4DE3 A;  3P01 A;  5HWV A;  3T1S A;  3GV9 A;  3VP0 A;  5HSQ A;  2VV6 A;  4K0W A;  4KUK A;  3HUN A;  4Z1W A;  3VOZ A;  1K54 C;  1JTG A;  3CG5 A;  2VLG A;  3T4S A;  3IT9 A;  2PT7 A;  5J4E A;  4P6Z S;  4IED A;  3O5Y A;  3EOI A;  1DJB A;  3EGX C;  1BUL A;  4GNU A;  3ITB A;  2V8F A;  1G5U A;  1ODV A;  1K4F A;  4OQ0 A;  3VP2 A;  2A2L A;  1L0D A;  3IHA A;  3P7N A;  4E3M A;  4MLL A;  3PBT A;  3NEC A;  3T4L A;  2LB5 A;  1W79 A;  2I9V A;  3KYZ A;  4S2M A;  1GHP A;  2PDR A;  2C5W B;  3Q7V A;  3ZCZ A;  1NXY A;  1ES5 A;  1SKO A;  4X25 A;  3MQO A;  1HD8 A;  5HDS A;  2ZOH A;  3CZD A;  3OC2 A;  3T12 B;  2OWH A;  2V0W A;  1JTD A;  3BFD A;  1JNU A;  1MBL A;  1PYY A;  5DF8 A;  5EVL A;  3UDI A;  3VP4 A;  3TSG A;  1FIK A;  4LCL A;  2M7U A;  4WEK A;  5M1A A;  3DWZ A;  3LR3 A;  2J3T D;  5EVE A;  5G4Y A;  3WWX A;  1NYM A;  3T1R A;  4CLC C;  1YMS A;  1FR1 A;  1P9W A;  4HY8 A;  2CC1 A;  4X6T A;  3O86 A;  1CEF A;  1M6K A;  1G28 A;  5FEF A;  2JKG A;  1MWU A;  4OP5 A;  2XF3 A;  4JGO A;  2P9V B;  3LIA A;  4DN0 A;  4MDZ A;  5DJU A;  2PD8 A;  4IBR A;  3ZVW A;  3C7U A;  3OLO A;  2L1M A;  3GDI A;  3BRM A;  1G68 A;  3MKE A;  1BLP A;  4XT2 A;  2CMN A;  1WE4 A;  4DXB A;  3MSH A;  4WL9 A;  3BJN A;  1SZV A;  2WKP A;  4RA7 A;  3ZFZ A;  2NUP C;  1BLH A;  3MFD A;  4B9O A;  1TS0 A;  1PI4 A;  1CI8 A;  1KE4 A;  4ARZ A;  1S0W A;  5EOO A;  4ZBE A;  4GN2 A;  4OP8 A;  3V3S A;  3JVV A;  3BM6 A;  2JBF A;  2M1C A;  4GS9 B;  5JYO A;  3PBR A;  4R1G A;  1F2K A;  4D60 A;  2W3D A;  1OT9 A;  2Y2P A;  4ETZ A;  4EU0 A;  1SKF A;  3MKF A;  1XFN A;  3L7H A;  3AGF A;  3CMZ A;  5DVA A;  2VGL M;  1SDN A;  4KZ5 A;  5TFQ A;  5DTT A;  1ERQ A;  2XK1 A;  1PRQ A;  3UE1 A;  2P7J A;  1N4O A;  4S2J A;  3K3D A;  1OPX A;  4WZ5 A;  5HAR A;  4K0X A;  3MZD A;  4KQQ A;  5GHX A;  2V0U A;  5HWW A;  5A8B A;  1XFQ A;  2G2U A;  3E4Q A;  2XD5 A;  4R4S A;  3A3J A;  4E3J A;  5F6A A;  2A24 B;  2P04 A;  2Y8H A;  4YOF A;  4B4Z A;  4EEU A;  4EV4 A;  3N8L A;  3HLW A;  2VKS A;  2B95 A;  1SDE A;  4R70 A;  3AGE A;  3CLO A;  1D1J A;  2VV7 A;  5GLA A;  5FAO A;  4KQR A;  1VB6 A;  3FKW A;  3NCK A;  4S2I A;  2ZLY A;  2VGJ A;  3E0Y A;  4E3N A;  5FDS A;  1K55 A;  3IWI A;  3N8S A;  2VJW A;  4KEN B;  2Y79 A;  3MZF A;  3QP1 A;  4Y0T A;  3RXW A;  4QD4 A;  5CED A;  3QP8 A;  4BL3 A;  5HZH A;  5FQ9 A;  1LI0 A;  3QP4 A;  3IWQ A;  1KVL A;  4HJ4 A;  4KG2 A;  4JXG A;  5FAQ A;  4DF6 A;  2Y4A A;  1Y4O A;  5KSH A;  3FYZ A;  4KUO A;  4LV3 A;  3L9K A;  1XPB A;  2ZMA A;  1PZO A;  3LUQ A;  4OPZ A;  4FOF A;  1KGG A;  4H8R A;  3NUL A;  5L09 A;  4HH3 A;  2O99 A;  4ID4 A;  3DWK A;  4HP9 A;  1SKO B;  4BD0 A;  4UQI M;  4N1X A;  5EM0 A;  3SH7 A;  1QME A;  3NBL A;  1I2S A;  3PBO A;  4HNB A;  4DRT A;  4L9F A;  3UB7 A;  4WMC A;  1KDW A;  2ZQD A;  4Y0O A;  3W2Z A;  2QJ7 A;  4X55 A;  4BJP A;  2Y2M A;  4Y15 A;  2EFX A;  3IWO A;  2OAP 1;  4G3V A;  2HDS A;  3ZVT A;  4C3Q A;  4JBF A;  2INW A;  2RCX A;  2QZ6 A;  3Q7Z A;  2WAD A;  4LRZ E;  4KZ8 A;  3C2W A;  2XA7 M;  2YKF A;  4EUV A;  2W0N A;  5CHJ A;  1ESU A;  4R38 A;  1TS7 A;  1UWN X;  3KSH A;  3PBQ A;  5EFW A;  4MN7 A;  1CQA A;  5G4Z A;  3VOY A;  3C4O A;  4X1M A;  3Q1F A;  1MWR A;  4K91 A;  4MMN A;  3K2N A;  2Y2G A;  4G3W A;  2V1B A;  1FCM A;  1W8Y A;  2Y2O A;  3EQU A;  4KZ6 A;  3S22 A;  1IEM A;  4P87 A; 
#chains in the Genus database with same CATH homology
 1ALQ A;  2EXA A;  1PW1 A;  1MXO A;  4M3K A;  2WGI A;  4RYE A;  3N7W A;  4JPM A;  4S2N A;  3NDE A;  2WYX A;  1IYO A;  3LY4 A;  4JLF A;  2EX8 A;  2XFT A;  4GD8 A;  3VMA A;  2J7V A;  4IVK A;  4PM9 A;  1FSW A;  3NY4 A;  1N9B A;  3TG9 A;  2EFU A;  4E3L A;  5JYP A;  1HVB A;  1J9M A;  3HLG A;  4EQI A;  4UHU A;  3N4I A;  4PMA A;  3GRJ A;  4OON A;  1FCO A;  1BT5 A;  4DDS A;  2DCF A;  5EUA A;  3OPH A;  4EBP A;  5TR7 A;  1W7F A;  5EVI A;  3A3D A;  3GTC A;  3HUM A;  3IXB A;  5FA7 A;  3O3V A;  2OSU A;  4S2N C;  3ZDJ A;  1KVM A;  4OQI A;  2A49 A;  4XUX A;  4KQO A;  2XQZ A;  5TGF A;  3MXS A;  2WKH A;  3G34 A;  4R23 A;  5M19 A;  4X68 A;  3IHB A;  4PPR A;  2ZD8 A;  4WBG A;  3QNC A;  4PM8 A;  4BQM A;  4OQG A;  3Q07 A;  3BFE A;  5GLD A;  2X01 A;  2WZZ A;  2WK0 A;  1BTL A;  3HRE A;  1L2S A;  3UPP A;  2JE5 A;  2XH9 A;  2ZC4 B;  4R0Q A;  1MY8 A;  4ZTK A;  3BEC A;  5U47 A;  4KZ3 A;  5D3O A;  4FH4 A;  5FSR A;  3NIA A;  4GDN A;  3VFF A;  3RJU A;  5EVI D;  3UDX A;  5I94 A;  3VP1 A;  1Q2Q A;  1WYB A;  2ZM8 A;  4B4X A;  2HP5 A;  2XGN A;  3HLF A;  4JF5 A;  4RX3 A;  2Y2L A;  1GHM A;  2R9W A;  4RVA A;  3I7J A;  1TVF A;  4QY6 A;  3OCN A;  1FR6 A;  2DNS A;  3VFH A;  3OZH A;  1KGF A;  1MPL A;  2FFF B;  3SS5 A;  2R9X A;  3Q7V B;  1YLP A;  3QHY A;  4Y0U A;  3W4Q A;  1GHI A;  4JXS A;  1KGE A;  5CER A;  3HBR A;  4GKU A;  5E2E A;  3G31 A;  2Z2L B;  4LV2 A;  4OLG A;  5A91 A;  3SS3 A;  5E43 A;  5EEC A;  4P0M A;  2XLN A;  3G32 A;  4OOY A;  2PU2 A;  4DE3 A;  1ES2 A;  4WEJ A;  4XXR A;  5E2H A;  2H0Y A;  3SOI A;  3BYD A;  3OPR A;  5AQ7 A;  4E6X A;  1EI5 A;  2EX9 A;  4OVD A;  3LEZ A;  5DF9 A;  3GV9 A;  5EOE A;  3VP0 A;  4MNR A;  4K0W A;  1ERO A;  3E2K A;  5FI2 A;  1YM1 A;  3HUN A;  4LV0 A;  4QU3 A;  3VOZ A;  1K54 C;  5IHV A;  1JTG A;  3ISG A;  3CG5 A;  2IWD A;  3IT9 A;  5AQ9 A;  2BG1 A;  4OOM A;  5FDH A;  3ZG8 B;  3UN7 A;  4HBU A;  4IED A;  4UA6 A;  1YLZ A;  5GHY A;  3W4O A;  4E3O A;  2V2F F;  3M6B A;  3P09 A;  1DJB A;  2OV5 A;  5L2F A;  1NYY A;  2XR0 A;  3ZHH A;  1KE3 A;  1RP5 A;  1BUL A;  1TDG A;  5CEB A;  1I5Q A;  1NZO A;  1TDL A;  2V20 A;  3ITB A;  4GNU A;  4JF6 A;  1W5D A;  4S2K A;  1K4F A;  4OQ0 A;  3VP2 A;  3IF6 A;  2V1Z A;  2JC7 A;  1L0D A;  3G2Z A;  3IHA A;  2A3U A;  4U0X A;  4E3M A;  4DE1 A;  1SHV A;  4MLL A;  1K4E A;  3PBT A;  4WZ4 A;  1G6A A;  1K6R A;  1ZG4 A;  3C5A A;  1W79 A;  2GDN A;  4NET A;  4Z9Q A;  1L0E A;  3HL9 A;  4S2M A;  5CHU A;  5FI6 A;  1GHP A;  2EXB A;  5A92 A;  2ZQC A;  1VQQ A;  1ESI A;  1VM1 A;  2C5W B;  3Q7V A;  1H8Y A;  4X56 A;  1W8Q A;  1PZP A;  3IF6 C;  3ZCZ A;  3PBN A;  4DXC A;  4KZ9 A;  1NXY A;  3HUO A;  4EUZ A;  2HP9 A;  1ES5 A;  4GDB A;  1ZC2 A;  1HD8 A;  2ZM0 A;  3HLB A;  1FQG A;  4QB8 A;  5M18 A;  4U3T A;  2XD1 A;  1ERM A;  2X71 A;  4EWF A;  3CZD A;  3OC2 A;  4EBN A;  1JTD A;  3BFD A;  1K57 A;  3UY6 A;  1DJC A;  3FWL A;  1MBL A;  1PYY A;  5DF8 A;  5CGS A;  5EVL A;  3UDI A;  3VP4 A;  1H8Z A;  5F1F A;  3IH8 A;  2Y2N A;  2IWC A;  1BLS A;  3GMW A;  3HLE A;  4UAA A;  3TSG A;  4LCL A;  3JYI A;  4WEK A;  5M1A A;  3DWZ A;  2I72 A;  3WWX A;  3BFF A;  1NYM A;  3BEB A;  4MBH A;  4KG5 A;  5FQM A;  3M2J A;  5F1G A;  2WAF A;  1JWP A;  2ZC7 A;  3V50 A;  2DRW A;  4E3I A;  5FI7 A;  1GCE A;  5F83 A;  2Z2M B;  3RXX A;  1YMS A;  1FR1 A;  4GOG A;  5DF7 A;  2Y2K A;  1K56 A;  3Q82 A;  2CC1 A;  3WS4 A;  3D4F A;  2WKI A;  4X6T A;  3O86 A;  3SH8 A;  1CEF A;  1M6K A;  1MKI A;  1NZU A;  4XUZ A;  4QY5 A;  1JWV A;  4WYY A;  1MWU A;  3IXD A;  2B5R A;  1YT4 A;  1IKG A;  2H5S A;  4L0L A;  4OP5 A;  4OOL A;  3PBS A;  5EVI C;  3DTM A;  2XF3 A;  5CEC A;  2P9V B;  3ITA A;  5AQA A;  5HX9 A;  5CRF A;  3N8R A;  3ZG0 A;  2J9P A;  4S2O A;  4HEF A;  1K56 D;  4OH0 A;  3WS2 A;  1DY6 A;  1XKZ A;  1Y54 A;  3UO9 A;  3IH9 A;  1PWD A;  1K6S A;  1NY0 A;  4OPR A;  3BFG A;  4IBR A;  4DKI A;  3ZVW A;  1AXB A;  3C7U A;  3G2Y A;  3VSK A;  1JVJ A;  2H0T A;  3BRM A;  4KZB A;  1G68 A;  3MKE A;  3IXH A;  4D2O A;  1BLP A;  5CXW A;  2IWB A;  2EX2 A;  3LO7 A;  4FD8 A;  1WE4 A;  1O07 A;  4DXB A;  3UPO A;  1WYC A;  2Y2I A;  3OPL A;  4RA7 A;  4U0T A;  3ZFZ A;  1BLH A;  1RGY A;  3MFD A;  5FAT A;  4E3K A;  1S6R A;  4R3B A;  5A90 A;  2Q9N A;  4NK3 A;  4CJN A;  2WUQ A;  5KZH A;  1PI4 A;  4CPK A;  4UA9 A;  4YIN A;  5BOH A;  4JKT A;  1CI8 A;  1KE4 A;  3VSL A;  1PIO A;  1S0W A;  5EOO A;  4ZBE A;  4Q8I A;  1ONG A;  3V3R A;  3NDG A;  1ONH A;  1E3U A;  3N6I A;  4GN2 A;  4OP8 A;  3V3S A;  3P98 A;  3ZG7 B;  3LCE A;  3CJM A;  3BM6 A;  4JXW A;  3A3I A;  1ZKJ A;  2G2W A;  3O88 A;  1O7E A;  2JBF A;  5DTS A;  3WRZ A;  2PU4 A;  5JYO A;  4OQH A;  1JWZ A;  1LL5 A;  3PBR A;  3PAG A;  4R1G A;  4N92 A;  3ZG5 A;  3E2L A;  2Y2P A;  5E2G A;  5F82 A;  4A5R A;  3NC8 A;  2PBY A;  2ZQA A;  4BD1 A;  5HAP A;  1SKF A;  3MKF A;  4ZJ2 A;  2P9V A;  5HAQ A;  5FQI A;  3WRT A;  1LI9 A;  1PWG A;  3ZGA B;  1E25 A;  1E3U D;  1XA1 A;  1BSG A;  3AGF A;  3CMZ A;  4MBF A;  5AQB A;  1U60 A;  2OLV A;  3W4P A;  1CEG A;  5DVA A;  3UE0 A;  3Q81 A;  4KZA A;  2XEP A;  1SDN A;  3MZE A;  4KZ5 A;  1M40 A;  4KZ4 A;  1K25 A;  1BUE A;  5TFQ A;  5HL1 A;  1K38 A;  5EVI B;  2HPB A;  4Y7P A;  1EWZ A;  2Y2Q A;  3MBZ A;  4FCF A;  4BL2 A;  5DTT A;  1ERQ A;  2XK1 A;  3GR2 A;  3HVF A;  4QHC A;  1RGZ A;  3UE1 A;  3OCL A;  1GA9 A;  1N4O A;  4S2J A;  2OLU A;  3GSG A;  4WZ5 A;  5HAR A;  4K0X A;  2ZQ7 A;  1HZO A;  1H5X A;  3MZD A;  4KQQ A;  4YFM A;  4ZJ3 A;  3UPN A;  3B3X A;  1NJ4 A;  3FKV A;  5GHX A;  2WKE A;  3O87 A;  2WGV A;  3GVB A;  2G2U A;  4ZJ1 A;  4DE2 A;  5GLB A;  4O7D A;  1PW8 A;  3UNW A;  2J9O A;  2XD5 A;  4PM7 A;  4OPY A;  2ZC3 B;  4R4S A;  5EPH A;  3M6H A;  4C75 A;  2ZQ9 A;  3A3J A;  4EBL A;  3V5M A;  1E4D A;  4WZ5 C;  4OPQ A;  4QJG A;  4N1H A;  4E3J A;  2BLS A;  3WS1 A;  1K57 C;  4B4Z A;  4EV4 A;  1DJA A;  3N8L A;  1Z6F A;  3AGD A;  4X69 A;  3HLW A;  3W8K A;  1SDE A;  1YLT A;  2ZM2 A;  3AGE A;  4ZDX A;  1CI9 A;  5GLA A;  5FAO A;  4KQR A;  1LLB A;  3A3E A;  3FKW A;  3VP3 A;  2Y2J A;  3NCK A;  1PWC A;  2RL3 A;  3IF5 A;  4PM6 A;  4LEN A;  2ZLY A;  4N9K A;  4S2I A;  3OPP A;  5FQJ A;  4BLM A;  2VGJ A;  4IVI A;  2ZC6 B;  3C7V A;  1IKI A;  1PI5 A;  5G18 A;  4E3N A;  5CHM A;  1K55 A;  2XFS A;  3IWI A;  3N8S A;  5GHZ A;  3S4X A;  1BZA A;  1OME A;  5E2F A;  4KEN B;  4C6Y A;  4GZB A;  2WGW B;  3MZF A;  3UDF A;  4Y0T A;  4OKP A;  3RXW A;  3G35 A;  4QD4 A;  4B88 A;  5CED A;  4BL3 A;  4PM5 A;  3WS0 A;  1FOF A;  5FQ9 A;  5CGW A;  3ZG9 B;  1LI0 A;  3IXG A;  4MEZ A;  3IWQ A;  1K55 C;  1KVL A;  4P85 A;  4KG2 A;  4JXG A;  3EQV A;  5FAQ A;  4DF6 A;  4E6W A;  3FV7 A;  2Y4A A;  2QPN A;  4RX2 A;  4FH2 A;  3IF6 B;  2J8Y A;  5KSH A;  2EX6 A;  3HLD A;  3FYZ A;  5KMW A;  4LV3 A;  3M2K A;  1XPB A;  5EE8 A;  1ZG6 A;  2ZMA A;  1MWS A;  1ES4 A;  1L0G A;  1PZO A;  1IYQ A;  1LHY A;  1YMX A;  2FFY A;  4P6B A;  4OPZ A;  4HES A;  2ZQ8 A;  3SH9 A;  1YLW A;  2WAE A;  3PAE A;  1YQS A;  4DDY A;  1KGG A;  4H8R A;  4GD6 A;  1FSY A;  4R3J A;  2Y59 A;  3ZNT A;  1MWT A;  4ID4 A;  3G4P A;  3IQA A;  5FAS A;  2P74 A;  5FQK A;  1XP4 A;  5DTK A;  3DWK A;  1K54 A;  3BLS A;  1LL9 A;  3C4P A;  3GQZ A;  4LV1 A;  2HP6 A;  4BD0 A;  2UWX A;  3G30 A;  3DW0 A;  4N1X A;  5HAI A;  2E8I A;  3NI9 A;  5CGX A;  4OLD A;  1IEL A;  3SH7 A;  4GB7 A;  5FAP A;  1QME A;  3NBL A;  1Q2P A;  1I2S A;  3PBO A;  1RCJ A;  2QMI A;  4DRT A;  3A3F A;  4WMC A;  1KDW A;  2ZQD A;  4Y0O A;  5CTN A;  4X55 A;  4BJP A;  4WEL A;  2Y2M A;  2ZC5 B;  2JCH A;  4FSF A;  1IYS A;  2EFX A;  3IWO A;  1KDS A;  4X53 A;  2HDS A;  1XX2 A;  3ZVT A;  5A93 A;  5KSC A;  4C3Q A;  4JBF A;  1SCW A;  2RCX A;  4S2P A;  2WGW A;  1BLC A;  1TEM A;  3S1Y A;  1YLY A;  2QZ6 A;  1IYP A;  4IBX A;  3Q7Z A;  2XDM A;  2HDR A;  4JF4 A;  1KE0 A;  2WAD A;  4F94 A;  1QMF A;  2VGK A;  4KG6 A;  4KZ8 A;  2X02 A;  3HLC A;  4WMC D;  1XGI A;  1XA7 A;  4MBK A;  5HW3 A;  1FCN A;  5CHJ A;  1ESU A;  3TOI A;  2WZX A;  3QNB A;  5GLC A;  3UE3 A;  3PBQ A;  3SS4 A;  4KZ7 A;  5HFO A;  2ZJ9 A;  4WM9 A;  4S2L A;  1YLJ A;  2Y2H A;  4UA7 A;  1C3B A;  2C6W B;  1ES3 A;  4R4R A;  1CK3 A;  3C4O A;  3VOY A;  3BLM A;  2Y55 A;  2H10 A;  4N9L A;  3Q1F A;  1I2W A;  4ZAM A;  1XXM A;  1GA0 A;  3MXR A;  1MWR A;  3LY3 A;  4DE0 A;  4K91 A;  4JXV A;  1XGJ A;  5GL9 A;  2Q9M A;  4LCM A;  2Y2G A;  3WS5 A;  3BFC A;  1NRF A;  2HDQ A;  2Y91 A;  5FQQ A;  1HTZ A;  1L0F A;  1FCM A;  1W8Y A;  2HDU A;  2Y2O A;  5J8X A;  3EQU A;  4KZ6 A;  5CTM A;  3S22 A;  1IEM A;  4HBT A;  3FZC A;  4P87 A;  3V39 A;  4BEN A;  3ZNY A;  3PTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...