1S4SA

Reaction intermediate in the photocycle of pyp, intermediate occupied between 100 micro-seconds to 5 milli-seconds
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Protein kinetics: Structures of intermediates and reaction mechanism from time-resolved x-ray data
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photosynthesis
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s4sA00
1ODVA 1TS7A 4LRXC 3E4PA 3LI9A 1XFQA 4K08A 1LL8A 1D06A 4I3JA 3EWKA 1GSXA 3MR0A 4NXGA 4GHIB 1BYWA 2R78A 3NOPC 4R6LA 5HDSA 4JGRA 2Z6DA 2V9AA 4B9OA 2D02A 1G28A 2OOLA 2WKQA 2B02A 3E4OA 1OTEA 5HWTA 1NWZA 2KDKA 4EETB 2VV8A 2L0WA 1LSXA 1T19A 4LRYC 4WF0A 4XT2B 2M1CA 1UWNX 3FC7A 3NHQA 2PR6A 1OJGA 3MFXA 5KIZA 3UB8A 4HH2A 4R38A 1VB6A 4EXOA 2J80A 1V9ZA 1UWPX 4H6JA 2WKPA 3ZQ5A 5J4EA 2YKFA 2KX6A 3VE3A 1XJ6A 1DP9A 3UB9A 2INWA 3EEHA 5DKLA 1F9IA 4HQAA 2BASA 4MN5A 2WKRA 5HDCA 1MZUA 3MXQA 4HJ6A 4I38A 1X0OA 4I3AA 4HOIA 4YWZA 3H82B 1D7EA 2PYPA 1KOUA 5HD5A 3G6OA 3CAXA 3E4QA 4EEPA 4M4XA 2PDRA 2ZOHA 1DRMA 1XJ2A 3IS2A 3NOUC 3MQQA 4HH3A 2PD7A 4JGPA 4BBTA 5DJTA 1TS8A 2EA9A 4L9GA 4PKYG 2PYRA 1GSWA 3F1PA 4DJ2A 4HI4A 1LSVA 3IBRA 2QWSA 5DJUA 3A0RA 1OT6A 1T18A 4NXEA 5IU1A 2VV7A 4EQ1A 2ZBBA 4I5SA 1N9LA 3LYXA 4HJ3A 3LI8A 3CWFA 3C8CA 3CLOA 4EERA 5HSQA 1V9YA 4LLOB 1N9OA 1DP8A 2VV6A 3F1NA 1GSVA 2YKHA 1OTDA 3BY8A 1WA9A 5A8BA 2V1AA 4H6JB 1P0ZA 2HV1A 4GCZA 4I39A 3K3CA 1OTBA 2JN7A 2W0NA 4HP4A 5TBMA 5AVEA 2A24A 2VEAA 5AVFA 3T50A 2D01A 2H28A 4F3LA 4F3LB 3VE4A 2PD8A 3LIBA 3H7WA 4HJ4A 3H7WB 1P97A 3FG8A 4HIAA 3UB7A 1JNUA 2OWHA 1LSWA 1XFNA 3NOTC 3LICA 2VLGA 5G4ZA 5F6AA 3UMDA 2Z6CA 1TS6A 4BBUA 1T1AA 1XJ4A 2GJ3A 3H9WA 3IS2B 3BY9A 3F1OA 2K7SA 4HHDA 4R3AA 4GW9A 5G4YA 3A0VA 3LIFA 4L9EA 2V0WA 3RTYA 3LIDA 4I3IA 3LIAA 4KQDA 2W27A 4L9FA 2V1BA 4HNBA 2V0UA 3PYPA 3ULFA 5I5LA 5J7EA 2QJ7A 1Y28A 2QJ5A 4KUKA 4WLAA 5HWVA 4HY8A 3F1PB 4GHIA 1S4RA 5HWWA 1EW0A 5IS1A 5EFWA 3B33A 3BWLA 1DP6A 2QKPA 1OTIA 2L1MA 3D72A 4NXBA 2P7JA 2I9VA 3LUQA 1OTAA 4BBVA 4R70A 3SW1A 1S66L 3GDIA 1OJ5A 5HZHA 4WN5A 3LIEA 5HD3A 3UB6A 1OT9A 3GECA 1XJ3A 3F1NB 3UMEA 3VOLA 4WUJA 3C2WA 4LRZE 4XT2A 1S1ZA 3PHYA 4LPZA 4WL9A 4PKYA 3UE6A 3MJQA 3RH8B 3ICYA 5HDDA 4EW7A 4JGQA 5TBMB 2PR5A 4HP9A 2A24B 2QHKA 1N9NA 4E04A 5F5YA 1LT0A 2PHYA 2ZOIA 4NXFA 3MQOA 4MN6A 2CMNA 5F69A 5J3WA 1UGUA 4JGOA 5DKKA 1T1BA 3HJIA 1TS0A 5F68A 4KUOA 2JHEA 1T1CA 1S4SA 1F98A 3A0SA 4RQ9A 3HJKA 2OWJA 4GS9A 3KX0X 3NJAA 4GS9B 3K3DA 3P7NA 4EESA 3OLOA 1S1YA 4DJ3A 1S67L 2L4RA 4EEUA 3F1OB 3H82A
chains in the Genus database with same CATH superfamily
1TS7A 3LR0A 1H8ZA 4FCFA 3B42A 4QPRA 3PBNA 3E4PA 1MWUA 5HX9A 5EV0A 3P98A 4X1LA 2RL3A 3IX4A 4JXVA 3WS5A 2WKEA 2Z2MB 4GHIB 2Y2HA 3UE0A 2GX5A 3NOPC 5HDSA 2Z6DA 2VZWA 3GRJA 1KGEA 5GL9A 3JVVA 4EBPA 1VM1A 2B95A 2Y4AA 2VGLS 4OH0A 4X53A 2Y2KA 2J7VA 2DCFA 2WKQA 3E4OA 5EM0A 4OPRA 2G2UA 4H8RA 2KDKA 2EXAA 4LFUA 3A3EA 1FCMA 4LRYC 2P9VA 4JXWA 2V8FA 2P9VB 3MZDA 4XT2B 4EBLA 2V20A 2WZXA 5E2GA 1QMFA 3UPNA 3O86A 1XX2A 3FC7A 3NHQA 4EWFA 3ZFZA 5LBRA 3ZG7B 3CUEC 4BL3A 3MFXA 4R38A 1H5XA 2X71A 2OAQ1 2WGWB 1KE3A 3RXWA 1FR1A 4H6JA 5EVIB 4AFIA 2XDMA 3IXDA 4PPRA 2YKFA 5HAPA 4FH4A 1XA7A 4LENA 3T4JA 1FCNA 1LI9A 1YLWA 5DKLA 2G7UA 2JKRI 1I2SA 2Y2IA 2BASA 2Y2MA 4MN5A 5FAOA 5CGXA 1MKIA 4HJ6A 1FSYA 3HLEA 3VOYA 5GLCA 3PR6A 1NZUA 2ZQCA 3PAEA 3N4IA 4CLCC 3EQUA 1KDWA 4A5RA 2OSUA 3E4QA 4Y13A 1KGGA 4JBFA 4M4XA 1K56D 4X68A 3FYZA 1TD5A 1RGZA 4EQIA 4RX2A 1DRMA 3N8SA 3IS2A 3NOUC 4S2KA 4HH3A 1SCWA 2PD7A 4JGPA 4K91A 3Q7VB 3R7WA 4L9GA 3R7WB 3MFDA 4PKYG 4UAAA 3ZGAB 5L8MA 5AQBA 1J9MA 5TR7A 1CJFA 2XFSA 4Y15A 4DJ2A 1MPLA 4HI4A 4ZTKA 3GTCA 4BWIA 1IFQA 1U60A 4EV4A 3MF0A 3HCYA 2PRFA 3IXGA 3JYIA 3NCKA 4JF5A 3FPWA 3S7OA 3M2KA 4C3QA 2ZJ9A 4I5SA 3TJZC 2FFFB 3G4PA 4HJ3A 4GNUA 2Y2OA 4RYEA 4X56A 1EWZA 4OLGA 4R23A 4CQHA 3CLOA 1W8YA 4EERA 2JKTM 4GZBA 5HSQA 1SHVA 3D4FA 1OPXA 1KE0A 3O3VA 3T4OA 1N9OA 4B88A 2O99A 3T1SA 4MNRA 5K5BA 4XXRA 3NBLA 5A8BA 1VETA 3TSGA 2HV1A 3V3RA 4GCZA 2Y2LA 4I39A 3K3CA 3IHAA 2JN7A 2R9XA 1ONHA 4Y3IA 3UDFA 1CF0A 4GD6A 5A91A 1YKDA 3LR4A 1KVLA 3IQAA 2XF3A 3UB5P 2XK1A 3O88A 1PNEA 3HLBA 3DTMA 2HGVA 3FPVA 3UB7A 1KDSA 1DY6A 1L2SA 4R3BA 1LL5A 3W4PA 3NOTC 1DJAA 3WWXA 2Y2GA 4JF4A 5G4ZA 5F6AA 4G3KA 3SZTA 3C38A 3UO9A 2BG1A 1TS6A 2QMIA 5F83A 2ZQ9A 3H9WA 2K7SA 1L0DA 3A0VA 3HL9A 3IH9A 4PM7A 1F2KA 4I3IA 2ZC4B 4OKPA 5TJJA 2W27A 4L9FA 1TDGA 3CHWP 4U3TA 2V0UA 4OPYA 3PYPA 1VEUB 5FQ9A 5I5LA 5DFYA 3UE1A 5EPHA 5J7EA 2QJ7A 1Y28A 4KUKA 1KVMA 4MN7A 3V3SA 3LO7A 4C6YA 3HUNA 3NI9A 2VK3A 1BLPA 2K31A 5IS1A 5EFWA 1YLPA 1DP6A 2QKPA 1OTIA 1EROA 1AWIA 1ZTUA 4KZ9A 2I9VA 4Y2FA 4BBVA 1TF1A 1K55C 4ZJ2A 1OJ5A 4ZAMA 3T4QA 3GECA 1MXOA 5HL6A 5DTSA 1IYQA 4UEYA 3T1QB 3OPLA 2J9OA 4RA7A 4HESA 3VMAA 5FEGA 2Q9MA 3PHYA 1FILA 3OC2A 2EX6A 4Q8IA 4WL9A 4PKYA 1JWZA 3MQ0A 4KZAA 3UE6A 4CPKA 3RH8B 4WEKA 3DWZA 5TBMB 2PR5A 4HP9A 2QHKA 4E3NA 5HAQA 2H0YA 5CGWA 1ES2A 1LT0A 5HFOA 4MBFA 5HPIA 2CMNA 1BULA 4DN0A 3BFCA 1FIKA 1G68A 2XEPA 4KQQA 4KUOA 2JHEA 5GLAA 1S4SA 1F98A 3A0SA 4OONA 4RQ9A 3R4KA 4WELA 4GS9A 1YT4A 2A3UA 4GS9B 4U0TA 3P7NA 3VFFA 4EESA 3OLOA 1ZG6A 1LI0A 1I5QA 2PT7A 3S4XA 4P0MA 3ZHHA 3IF6B 5GHZA 4S2NA 1ODVA 4FD8A 4K0WA 1QMEA 1K57A 2V2FF 4WBGA 3UDIA 4K08A 2J3TC 5F1FA 1NLZA 1XXMA 1C3BA 1NZOA 2IA2A 5A92A 3WS4A 5CEDA 5CTMA 4YNRA 2PAVP 3KSGA 4DMZA 3BFFA 3T4TA 3E0YA 4N9LA 5IT5A 1PI4A 3C4PA 1DJBA 3IWQA 2D02A 3IWIA 3LCEA 1G28A 4CJNA 4UA7A 1YLTA 3OZHA 1OMEA 1ZC2A 5E43A 1E3UD 5HWTA 1NWZA 3W4QA 4EETB 2VV8A 2H10A 1LSXA 3A3DA 4IVIA 1XPBA 3QP4A 3LFVA 2M1CA 1E25A 3LY3A 5M18A 2WGIA 1OJGA 1HLUP 2GDNA 2HDRA 3IX8A 5KIZA 2PBYA 4HH2A 4WZ5A 4KZ7A 5DF7A 2J80A 3A3IA 4KG6A 1BZAA 1UWPX 4FOFA 2WKPA 4K0XA 4DE1A 5FQMA 4BMWA 2KX6A 1XJ6A 4LCLA 1CEFA 4NG2A 2INWA 3DBAA 1MBLA 4S2LA 1F9IA 4HQAA 3C4OA 3N7WA 4IUKA 2WKRA 3DTKA 5HDCA 5DTKA 2CC1A 4KZ6A 3MXQA 4ETZA 2B18A 3S7NA 1X0OA 1RP5A 4HOIA 4BENA 4GN2A 4NEED 4FSFA 2C5WB 3PBRA 3IXBA 1D7EA 2EWWA 2M7VA 1ERQA 3IXHA 2FH5A 4EEPA 5HAIA 1H8MA 2PDRA 3IH8A 3BRMA 2ZOHA 3W2ZA 5FDHA 4JPMA 1O7EA 3PBOA 1AXBA 2UV0E 3HBRA 1N9BA 2X02A 2M7UA 2J9PA 4DE3A 1BLCA 2EX9A 3UE3A 1GSWA 5M1AA 5I94A 2ZC6B 3QP1A 3F1PA 3WS0A 2XSSA 1LSVA 4GDBA 3IBRA 4OVDA 5EVIC 2HP9A 2P08A 3A0RA 4LV1A 2XGNA 3P09A 1T18A 3LEQA 5L2FA 2ZMFA 4KG2A 5IU1A 4ME4A 2ZBBA 1FSWA 1N9LA 2XD5A 4PAUA 3BQ8A 1BLHA 2O9AA 3C8CA 4Y17A 2XD1A 4ZJ1A 2HZ5A 4LLOB 4G3WA 2HJEA 4ARZA 4ARZB 5FI7A 4B4XA 4E3KA 3F1NA 2EWVA 2Z2LB 5FSRA 1IYOA 1NYYA 2UWXA 1YLJA 4P6BA 3A3FA 3BY8A 1M6KA 2A2LA 4PM5A 2E8JA 2EX2A 1MWSA 4H6JB 1LHYA 3RXXA 2WKIA 3M6HA 4IJGA 1OTBA 2W0NA 3CITA 1ZG4A 4OQ0A 1VHMA 2OV5A 4R4SA 4S2JA 5AVFA 3WRTA 2EFUA 3T50A 1JVJA 1E3UA 2O9BA 3NDGA 4HBTA 5FI2A 5E2EA 3VOZA 4UQIM 1GHIA 4E6XA 3LGOA 2HDSA 3B47A 3DWKA 1P97A 1SKOA 4HIAA 1SKOB 3C7VA 3UY6A 2Y91A 5JYOA 3VV4A 2QYBA 3CJMA 3LICA 2XFTA 4UA9A 4R0QA 2WZZA 3CUEA 4KQOA 4GJ4A 4Q0HA 1IEMA 2NUPC 3IS2B 3TOIA 4R1GA 4HHDA 4R3AA 1PZPA 4GW9A 5G4YA 4JKTA 4L9EA 1GA9A 1G5UA 3SS3A 3RTYA 1ES4A 3LIAA 4KQDA 3MXSA 5CHMA 4HNBA 4N1XA 3V50A 3TE8A 4M3KA 2IWCA 1KE4A 2ZD8A 1XKZA 5U47A 3LY4A 1SDEA 4HY8A 3D9YA 3DTIA 5AJGA 1Q2PA 2ZC3B 2DRWA 5HWWA 1CI9A 3UNWA 3CPTA 1BUEA 3BWLA 2WK0A 1ACFA 2L1MA 3HLFA 3VFHA 2H5SA 3D72A 4NXBA 3LR3A 3T12B 3T4SA 4CLCA 4IHQA 4S2IA 1OTAA 1MKMA 4ZRRA 2XH9A 1S66L 3GDIA 3VP3A 3SS5A 5HZHA 2V1ZA 1OT9A 3DAVA 2ZM0A 3ZG5A 3RFBA 5KMWA 2EX8A 3BLMA 4WUJA 3HLWA 4IVKA 3UDXA 3IHBA 4LRZE 1O07A 1VETB 1F5MA 4LPZA 3WRZA 1GHPA 1D1JA 5IHVA 2K2NA 2W1TA 2W1RA 4HBUA 1MY8A 1N9NA 5F5YA 4MLLA 1WYCA 5F69A 4QD4A 3UPOA 5FQIA 2QZ6A 1T1BA 3Q7ZA 3V39A 3HJIA 4DDSA 4N92A 3HUMA 3JPUA 1S0WA 4DRTA 2HDQA 2PU2A 2R9WA 3ITBA 3KX0X 3NJAA 4JLFA 3K3DA 2JKGA 4R3JA 4DKIA 1S67L 4XUXA 4D60A 3G34A 4RX3A 4EEUA 4U0XA 3H82A 1YAXA 2JKRM 5A90A 4KZBA 2HP5A 2KOIA 4S2MA 1CQAA 3FZCA 3MXRA 1PW1A 3M6BA 1K38A 4LRXC 1XFQA 1D06A 3N6IA 1ONGA 3QNCA 3EWKA 2Y2NA 2VX8A 3VP0A 5EM1A 1ESUA 2JC7A 3N8LA 1TEMA 4O8GA 1BYWA 4PM6A 3IF5A 3ZYTA 4R6LA 1IYPA 3HLGA 4DXCA 3MMHA 2AVXA 3E2LA 2VA0A 4OQIA 4QB8A 4FUWA 3T4LA 3NIAA 1FQGA 2OOLA 1PFLA 4LV3A 2B02A 2H0TA 4P85A 1OTEA 3OOVA 5F1GA 2L0WA 4E3IA 4EUZA 4PHTA 2LB9A 1T19A 4WF0A 4QU3A 3EQVA 1L0FA 4EU0A 1K25A 3BFEA 3ZDJA 5F82A 4MCWA 5GLDA 2PR6A 2HP6A 5E2HA 4GDNA 3UB8A 4GLQA 1TDLA 3BJNA 4JXSA 3L9KA 2J8YA 3BM6A 1H3QA 3IF6C 2OLVA 2Y55A 5CXWA 4EUVA 3E98A 4X1MA 4Y5FA 1K57C 4KENB 3MKEA 5EOOA 3EEHA 1K55A 4FH2A 3HVFA 2XROA 3BECA 5GHYA 3OBFA 1MZUA 1W63Q 3S7QA 2W3GA 2LB5A 4QY6A 1JTDA 3K2NA 2HJ9C 4DE0A 2Y2QA 3ZG9B 2Y8HA 2Q9NA 4OPQA 1GA0A 5EVLA 4YWZA 2E8IA 3HREA 2Q0OA 1G6AA 5HD5A 4ZDXA 3CAXA 4YFMA 4WZ4A 3HUOA 1MC0A 5D3OA 4CLCE 1XJ2A 4F94A 2MJ6A 3QHYA 3MQQA 1TS8A 1YMSA 4OPZA 2PYRA 4WM9A 3G32A 4OOMA 3BQAA 4BL2A 1WE4A 4UA6A 2QWSA 1P9RA 5DJUA 2XRNA 1EI5A 4NXEA 4EQ1A 1HD8A 4GD8A 4IEDA 5FI6A 3LI8A 4E3JA 3I7JA 4Y7PA 1CK3A 2P04A 1Y54A 4OP8A 3UN7A 1BT5A 3T1RA 3SH9A 4QHCA 5GLBA 3FV7A 2Y59A 1DP8A 4S2PA 4KZ8A 2VV6A 3A3JA 2WAFA 5J8XA 1OTDA 4NETA 3OPRA 2V1AA 4PM9A 1P0ZA 3PTEA 4QY5A 3UPPA 1XP4A 3FKWA 3ZCZA 1K54A 5FQKA 3M2JA 2W3EA 4HP4A 2A24A 5CGSA 2JE5A 3G2ZA 2D01A 5AQ7A 2VJWA 2W3HA 3KSFA 3JVUA 3MS6A 3VE4A 1HTZA 2ZMAA 3H7WA 4HJ4A 3H7WB 2HDUA 4OQHA 3O5YA 1PWCA 3OCLA 4X69A 2DNSA 3FG8A 3VP1A 2RCXA 2PBDP 1JNUA 4UQIS 4ESPA 1ERMA 1LSWA 1XFNA 1YLZA 4Z1WA 1YMXA 4E3LA 1YLYA 3GVBA 2VGJA 4EBNA 2FZ0A 3BLSA 4CLCD 3UMDA 2ZC7A 5CECA 2A49A 4DXBA 3MSHA 2GZAA 3G2YA 3F1OA 4L0LA 4BD1A 3LIFA 1YM1A 2Y79A 2DMWA 2V0WA 4BJPA 2JKFA 2V1BA 5DVAA 1BLSA 3ULFA 3S7PA 1Q2QA 1IKGA 2P74A 3W8KA 4YOFA 3VP4A 4HEFA 3F1PB 2JKTI 3FWLA 4GHIA 3KSIA 1S4RA 5EE8A 2XR0A 3BFDA 4Q0IA 5FAQA 4N1HA 1P9WA 5KSCA 3Q1FA 1CI8A 5FDSA 4P6ZM 3QNBA 4B4ZA 2P7JA 3LUQA 4FTXA 1SZVA 3G35A 3G31A 1RGYA 1RCJA 3ZVTA 1BSGA 1YSPA 4UHUA 4DF6A 3SW1A 3BFGA 3EGDC 3GMWA 4WEJA 3C5AA 1K0KA 2KLIA 1PW8A 4WN5A 3LIEA 3TG9A 1YQSA 3UB6A 1PZOA 1XJ3A 3F1NB 3CG5A 3NY4A 3GR2A 5FL3A 1MWTA 3C2WA 4GB7A 4X55A 4XT2A 4Y0TA 1ES5A 4LV2A 3TRCA 3Q07A 3C7UA 4II7A 1LLBA 4ZBEA 2VGKA 3MJQA 1KGFA 3ICYA 2WGWA 1A0KA 3MZFA 4KG5A 2EXBA 1NLYA 5CTNA 4E04A 1NRFA 5EVIA 2ZL1A 1LL9A 1FR6A 2ZL1B 4E3MA 2PHYA 2ZOIA 1VQQA 3PBQA 4NXFA 3V5MA 1UGUA 4JGOA 3QP6A 4OQGA 5F68A 2ZLYA 1XGIA 5HW3A 1T1CA 2EFXA 5FEFA 2XA7M 3HJKA 4O0PA 5MC7A 2ZQDA 3RJUA 1ZHHB 1S1YA 4DJ3A 4KQRA 2L4RA 4Q0JA 3SH8A 1Y4OA 3BYDA 4O7DA 3DW0A 1H0MA 4JF6A 5FATA 4BD0A 1FCOA 3IT9A 4Z9QA 2OAP1 4E3OA 2QPNA 5CRFA 3HLDA 3LI9A 4XUZA 2XQZA 1LL8A 4I3JA 3KYEA 1W79A 4E6WA 1GSXA 3MR0A 1S6RA 4NXGA 4LCMA 3Q7VA 4NK3A 4WMCA 4ETXA 3T1XA 2R78A 4QJGA 2VGLM 3ITAA 2WAEA 1M40A 1ZKJA 3CPTB 1GCEA 3EOIA 4JGRA 5G18A 2V9AA 4B9OA 5GHXA 3AGEA 4CLCB 2ACGA 5A93A 5L10A 3ISGA 2WUQA 3Q82A 4R4RA 1IYSA 2ZQ8A 1K4EA 1K6RA 3PBSA 4O01A 1SDNA 2W3FA 3PBTA 4OLDA 3GV9A 3GSGA 1UWNX 3KSHA 4KZ3A 3AGDA 3C30A 1VB6A 2W1TB 4EXOA 3ZVWA 1PWDA 1V9ZA 2BTFP 1K6SA 3CI6A 3ZQ5A 5HL1A 5J4EA 3O87A 3VE3A 1DP9A 2WGVA 3UB9A 3S1YA 1W5DA 1PRQA 1ESIA 5EECA 4OOLA 1DJCA 3BW6A 5CHJA 4DDYA 4N9KA 4LGWA 4BLMA 1NRJA 1GHMA 1PYYA 2VKSA 5KZHA 5HPFA 1L0EA 3T4KA 3FKVA 1HVBA 1YPRA 4I38A 4I3AA 5FA7A 3DTEA 2V8CA 3G30A 1FOFA 2ZQAA 1N4OA 2ZM8A 3H82B 2PYPA 1KOUA 3G6OA 3NC8A 3QP2A 3EEAA 3U2AA 2J3TD 3OPPA 3VSKA 5AQAA 1H8YA 4Y0UA 2BLSA 4MEZA 4BBTA 5DJTA 1VEUA 2EA9A 2NUTC 2IWDA 3SS4A 1W7FA 2JBFA 3TW8A 4DE2A 4ID4A 2JCHA 3SOIA 1NXYA 2WADA 3PAGA 1TVFA 4OP5A 3IWOA 4IBRA 3Q81A 1OT6A 1E4DA 3S22A 1ALQA 4IBXA 2VV7A 3VSLA 4OOYA 3PXPA 3LYXA 2Y2JA 3BEBA 3CWFA 3IX3A 3QP8A 2Y2PA 1K56A 3ZG8B 1V9YA 2OLUA 5DF9A 1GSVA 1PWGA 2YKHA 3CMZA 3CZDA 4GKUA 1WA9A 5FQQA 5BOHA 1J3WA 3NECA 5CHUA 3ZNYA 4S2NC 3AGFA 4WYYA 5TBMA 5AVEA 1Z09A 3SH7A 2VEAA 4X6TA 2FFYA 2HPBA 1IOUA 5E2FA 2ZMVA 2H28A 4F3LA 1STZA 3W4OA 4F3LB 2PD8A 1Z6FA 4RVAA 1JWVA 3LIBA 3LEZA 4MBKA 3VP2A 3MKFA 3N8RA 1L3LA 3D3OA 5L07A 2G2WA 2OWHA 3V67A 5AQ9A 1WYBA 2VLGA 4NKPA 1JWPA 1SKFA 1HZOA 2Z6CA 4MMNA 1XA1A 5JYPA 5M19A 4BBUA 1T1AA 1YSQA 3ZG0A 5FASA 1XJ4A 2GJ3A 2HF6A 4D2OA 3BY9A 5DF8A 1PI5A 3IF6A 4JXGA 4KZ4A 1MWRA 3EGXC 2ZC5B 5L09A 3LIDA 3KO6A 5HARA 3HLCA 2O9CA 3KYZA 1IKIA 1I2WA 4LV0A 5C5KA 2PU4A 5DFXA 2QJ5A 2J3WA 3P01A 4WLAA 3KYQA 4WZ5C 5HWVA 4S2OA 3B3XA 5CEBA 5TFQA 3NDEA 4BQMA 1EW0A 4PM8A 4QWOA 3E2KA 5EVID 4MBHA 1K54C 3B33A 1K4FA 1JTGA 4ZJ3A 5TGFA 4C75A 3GQZA 4YINA 5EOEA 5CX7A 5DTTA 4GOGA 4R70A 1NY0A 1G6OA 4P6ZS 2W3DA 1NYMA 2O0YA 4X25A 1W8QA 5HD3A 3QP5A 2GNXA 3UMEA 2X01A 3VOLA 4PMAA 5EVEA 4B93A 3OCNA 1S1ZA 5EUAA 4Y0OA 3IBJA 3LR5A 1PIOA 2B5RA 3ZNTA 1XGJA 1IELA 3MZEA 5KSHA 2WYXA 5HDDA 4EW7A 4JGQA 1L0GA 1ES3A 3WS1A 2A24B 2C6WB 4P87A 3OPHA 1CEGA 2ZM2A 3MQOA 4G3VA 4MN6A 1BTLA 2IWBA 2I72A 3L7HA 3WS2A 5J3WA 5FQJA 5DKKA 1TS0A 2XLNA 4WMCD 2WKHA 5FAPA 4IUHA 1W63M 2OWJA 4KZ5A 2ZQ7A 3MBZA 5CERA 1NJ4A 2XA7S 3U4LP 3NULA 3F1OB 4MDZA
chains in the Genus database with same CATH topology
1ODVA 1TS7A 2KOIA 3LR0A 2OAP1 3B42A 4LRXC 4QPRA 3PBNA 3E4PA 3LI9A 1XFQA 4K08A 1LL8A 2J3TC 1D06A 1NLZA 4I3JA 2IA2A 3EWKA 1GSXA 2VX8A 3MR0A 4YNRA 3KSGA 4DMZA 4NXGA 4GHIB 3T4TA 4ETXA 2GX5A 3E0YA 4O8GA 1BYWA 2R78A 2VGLM 3NOPC 3ZYTA 4R6LA 5IT5A 3EOIA 5HDSA 4JGRA 2Z6DA 2V9AA 3MMHA 2VZWA 4B9OA 3JVVA 2VA0A 3T4LA 4CLCB 2D02A 2VGLS 1G28A 2OOLA 2WKQA 2B02A 3E4OA 1OTEA 5HWTA 1NWZA 3OOVA 2KDKA 3PBSA 4EETB 2VV8A 2L0WA 4PHTA 2LB9A 4O01A 1LSXA 1T19A 4LRYC 4WF0A 2W3FA 3PBTA 3EQVA 3LFVA 4XT2B 4EU0A 2M1CA 1UWNX 3FC7A 3NHQA 4MCWA 5LBRA 3KSHA 2PR6A 1OJGA 3CUEC 3C30A 3MFXA 5KIZA 3UB8A 4HH2A 4R38A 1VB6A 4GLQA 2W1TB 4EXOA 2J80A 2OAQ1 3BJNA 1V9ZA 1UWPX 4H6JA 4FOFA 4AFIA 2WKPA 1H3QA 3CI6A 3ZQ5A 5J4EA 4BMWA 2YKFA 2KX6A 3VE3A 1XJ6A 4EUVA 3E98A 1DP9A 3UB9A 4Y5FA 2INWA 3T4JA 3DBAA 3EEHA 5DKLA 2G7UA 4OOLA 1F9IA 2JKRI 4HQAA 3BW6A 2BASA 2XROA 4IUKA 4MN5A 2WKRA 3OBFA 5HDCA 1MZUA 1NRJA 1W63Q 3S7QA 3MXQA 4ETZA 4HJ6A 2W3GA 2LB5A 2VKSA 5HPFA 2B18A 3S7NA 3K2NA 2HJ9C 3T4KA 4I38A 1X0OA 3PR6A 4I3AA 4HOIA 2Y8HA 4NEED 4FSFA 4CLCC 3PBRA 3H82B 4YWZA 3EQUA 1D7EA 2EWWA 2M7VA 2PYPA 1KOUA 5HD5A 3G6OA 2FH5A 3CAXA 3E4QA 4EEPA 4M4XA 1H8MA 2PDRA 3EEAA 1TD5A 1MC0A 4CLCE 2ZOHA 1DRMA 1XJ2A 3U2AA 3IS2A 2MJ6A 2J3TD 3W2ZA 3NOUC 3PBOA 3MQQA 4HH3A 2PD7A 4JGPA 4BBTA 5DJTA 1TS8A 3R7WA 2M7UA 2EA9A 2NUTC 4L9GA 3R7WB 4PKYG 3TW8A 2PYRA 5L8MA 3UE3A 1GSWA 3F1PA 4DJ2A 4OOMA 3BQAA 2XSSA 4HI4A 1LSVA 3IBRA 4BWIA 1IFQA 2P08A 3MF0A 2QWSA 3HCYA 1P9RA 5DJUA 2XRNA 3A0RA 1OT6A 1T18A 3FPWA 4NXEA 2ZMFA 3S7OA 5IU1A 2VV7A 4ME4A 4EQ1A 2ZBBA 4I5SA 1N9LA 3PXPA 3TJZC 3LYXA 4HJ3A 3LI8A 4PAUA 2P04A 3BQ8A 3CWFA 4CQHA 2O9AA 3C8CA 3CLOA 4EERA 2JKTM 5HSQA 1V9YA 1OPXA 4LLOB 4G3WA 2HJEA 4ARZA 3T4OA 1N9OA 5DF9A 4ARZB 2O99A 1DP8A 2VV6A 3F1NA 1GSVA 2EWVA 2YKHA 5K5BA 1OTDA 3BY8A 1WA9A 2A2LA 5A8BA 2V1AA 4H6JB 1P0ZA 2HV1A 4GCZA 4I39A 3K3CA 4IJGA 1OTBA 2JN7A 2W0NA 4Y3IA 3CITA 2W3EA 4HP4A 5TBMA 5AVEA 1VHMA 2A24A 1YKDA 2VEAA 5AVFA 3LR4A 3T50A 1IOUA 2D01A 2ZMVA 2H28A 2VJWA 1STZA 2W3HA 3KSFA 2O9BA 3JVUA 4F3LA 4F3LB 3VE4A 2PD8A 3LIBA 3H7WA 4HJ4A 3H7WB 3O5YA 4UQIM 3OCLA 3B47A 1P97A 3FG8A 4HIAA 2HGVA 3FPVA 3D3OA 3UB7A 1JNUA 4UQIS 2OWHA 3VV4A 1LSWA 1XFNA 2QYBA 3NOTC 4Z1WA 3V67A 3LICA 2VLGA 4NKPA 2FZ0A 5F6AA 5G4ZA 4CLCD 3UMDA 3CUEA 4G3KA 3C38A 2Z6CA 4MMNA 4KQOA 4GJ4A 4Q0HA 1TS6A 2NUPC 4BBUA 2GZAA 1T1AA 1YSQA 1XJ4A 2GJ3A 2HF6A 3H9WA 3IS2B 3BY9A 3F1OA 4L0LA 2K7SA 4HHDA 4R3AA 4GW9A 5G4YA 3A0VA 3LIFA 4L9EA 3EGXC 2Y79A 2DMWA 2V0WA 3LIDA 3RTYA 4BJPA 4I3IA 3LIAA 4KQDA 5TJJA 2W27A 4L9FA 3KO6A 2V1BA 4HNBA 2V0UA 3PYPA 3ULFA 2O9CA 3KYZA 5I5LA 3S7PA 5DFYA 3TE8A 5C5KA 5J7EA 5DFXA 2QJ7A 1Y28A 2QJ5A 4KUKA 2J3WA 3P01A 4YOFA 4WLAA 3KYQA 5HWVA 4MN7A 4HY8A 3F1PB 2JKTI 5AJGA 4GHIA 3KSIA 1S4RA 2K31A 4Q0IA 5HWWA 1EW0A 5IS1A 1P9WA 5EFWA 3B33A 3BWLA 1DP6A 2QKPA 1OTIA 2L1MA 4P6ZM 3D72A 4NXBA 1ZTUA 3LR3A 3T4SA 4CLCA 2P7JA 2I9VA 5CX7A 4IHQA 3LUQA 4Y2FA 1OTAA 4BBVA 1MKMA 1TF1A 4ZRRA 4R70A 1YSPA 4P6ZS 1G6OA 3EGDC 3SW1A 4WEJA 1S66L 2W3DA 3GDIA 1OJ5A 5HZHA 2KLIA 4WN5A 3LIEA 2O0YA 5HD3A 3T4QA 3UB6A 1OT9A 3GECA 5HL6A 1XJ3A 2GNXA 3F1NB 3RFBA 3UMEA 4UEYA 3VOLA 4WUJA 5FL3A 3C2WA 4LRZE 4XT2A 3TRCA 4B93A 3OCNA 1S1ZA 3IBJA 3PHYA 1F5MA 3OC2A 4LPZA 4WL9A 3LR5A 4II7A 4PKYA 3MQ0A 3MJQA 3UE6A 5KSHA 3RH8B 3ICYA 5HDDA 4EW7A 4WEKA 4JGQA 5TBMB 2K2NA 2PR5A 2W1TA 4HP9A 2A24B 2QHKA 2W1RA 1NLYA 1N9NA 4E04A 5F5YA 1LT0A 2PHYA 2ZOIA 3PBQA 4NXFA 3MQOA 4G3VA 5HPIA 4MN6A 2CMNA 5F69A 5J3WA 1UGUA 4DN0A 4JGOA 5DKKA 1T1BA 3HJIA 1TS0A 5F68A 4KUOA 2JHEA 4IUHA 1T1CA 1S4SA 1F98A 1W63M 3A0SA 4RQ9A 2XA7M 3R4KA 3HJKA 2OWJA 4WELA 4GS9A 3KX0X 3NJAA 4GS9B 4O0PA 5MC7A 3K3DA 3P7NA 4EESA 1ZHHB 3OLOA 1S1YA 4DJ3A 1S67L 2XA7S 2L4RA 2PT7A 4Q0JA 4EEUA 3F1OB 1YAXA 2JKRM 3H82A 4MDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ODV A;  1TS7 A;  4LRX C;  3E4P A;  3LI9 A;  1XFQ A;  4K08 A;  1LL8 A;  1D06 A;  4I3J A;  3EWK A;  1GSX A;  3MR0 A;  4NXG A;  4GHI B;  1BYW A;  2R78 A;  3NOP C;  4R6L A;  5HDS A;  4JGR A;  2Z6D A;  2V9A A;  4B9O A;  2D02 A;  1G28 A;  2OOL A;  2WKQ A;  2B02 A;  3E4O A;  1OTE A;  5HWT A;  1NWZ A;  2KDK A;  4EET B;  2VV8 A;  2L0W A;  1LSX A;  1T19 A;  4LRY C;  4WF0 A;  4XT2 B;  2M1C A;  1UWN X;  3FC7 A;  3NHQ A;  2PR6 A;  1OJG A;  3MFX A;  5KIZ A;  3UB8 A;  4HH2 A;  4R38 A;  1VB6 A;  4EXO A;  2J80 A;  1V9Z A;  1UWP X;  4H6J A;  2WKP A;  3ZQ5 A;  5J4E A;  2YKF A;  2KX6 A;  3VE3 A;  1XJ6 A;  1DP9 A;  3UB9 A;  2INW A;  3EEH A;  5DKL A;  1F9I A;  4HQA A;  2BAS A;  4MN5 A;  2WKR A;  5HDC A;  1MZU A;  3MXQ A;  4HJ6 A;  4I38 A;  1X0O A;  4I3A A;  4HOI A;  4YWZ A;  3H82 B;  1D7E A;  2PYP A;  1KOU A;  5HD5 A;  3G6O A;  3CAX A;  3E4Q A;  4EEP A;  4M4X A;  2PDR A;  2ZOH A;  1DRM A;  1XJ2 A;  3IS2 A;  3NOU C;  3MQQ A;  4HH3 A;  2PD7 A;  4JGP A;  4BBT A;  5DJT A;  1TS8 A;  2EA9 A;  4L9G A;  4PKY G;  2PYR A;  1GSW A;  3F1P A;  4DJ2 A;  4HI4 A;  1LSV A;  3IBR A;  2QWS A;  5DJU A;  3A0R A;  1OT6 A;  1T18 A;  4NXE A;  5IU1 A;  2VV7 A;  4EQ1 A;  2ZBB A;  4I5S A;  1N9L A;  3LYX A;  4HJ3 A;  3LI8 A;  3CWF A;  3C8C A;  3CLO A;  4EER A;  5HSQ A;  1V9Y A;  4LLO B;  1N9O A;  1DP8 A;  2VV6 A;  3F1N A;  1GSV A;  2YKH A;  1OTD A;  3BY8 A;  1WA9 A;  5A8B A;  2V1A A;  4H6J B;  1P0Z A;  2HV1 A;  4GCZ A;  4I39 A;  3K3C A;  1OTB A;  2JN7 A;  2W0N A;  4HP4 A;  5TBM A;  5AVE A;  2A24 A;  2VEA A;  5AVF A;  3T50 A;  2D01 A;  2H28 A;  4F3L A;  4F3L B;  3VE4 A;  2PD8 A;  3LIB A;  3H7W A;  4HJ4 A;  3H7W B;  1P97 A;  3FG8 A;  4HIA A;  3UB7 A;  1JNU A;  2OWH A;  1LSW A;  1XFN A;  3NOT C;  3LIC A;  2VLG A;  5G4Z A;  5F6A A;  3UMD A;  2Z6C A;  1TS6 A;  4BBU A;  1T1A A;  1XJ4 A;  2GJ3 A;  3H9W A;  3IS2 B;  3BY9 A;  3F1O A;  2K7S A;  4HHD A;  4R3A A;  4GW9 A;  5G4Y A;  3A0V A;  3LIF A;  4L9E A;  2V0W A;  3RTY A;  3LID A;  4I3I A;  3LIA A;  4KQD A;  2W27 A;  4L9F A;  2V1B A;  4HNB A;  2V0U A;  3PYP A;  3ULF A;  5I5L A;  5J7E A;  2QJ7 A;  1Y28 A;  2QJ5 A;  4KUK A;  4WLA A;  5HWV A;  4HY8 A;  3F1P B;  4GHI A;  1S4R A;  5HWW A;  1EW0 A;  5IS1 A;  5EFW A;  3B33 A;  3BWL A;  1DP6 A;  2QKP A;  1OTI A;  2L1M A;  3D72 A;  4NXB A;  2P7J A;  2I9V A;  3LUQ A;  1OTA A;  4BBV A;  4R70 A;  3SW1 A;  1S66 L;  3GDI A;  1OJ5 A;  5HZH A;  4WN5 A;  3LIE A;  5HD3 A;  3UB6 A;  1OT9 A;  3GEC A;  1XJ3 A;  3F1N B;  3UME A;  3VOL A;  4WUJ A;  3C2W A;  4LRZ E;  4XT2 A;  1S1Z A;  3PHY A;  4LPZ A;  4WL9 A;  4PKY A;  3UE6 A;  3MJQ A;  3RH8 B;  3ICY A;  5HDD A;  4EW7 A;  4JGQ A;  5TBM B;  2PR5 A;  4HP9 A;  2A24 B;  2QHK A;  1N9N A;  4E04 A;  5F5Y A;  1LT0 A;  2PHY A;  2ZOI A;  4NXF A;  3MQO A;  4MN6 A;  2CMN A;  5F69 A;  5J3W A;  1UGU A;  4JGO A;  5DKK A;  1T1B A;  3HJI A;  1TS0 A;  5F68 A;  4KUO A;  2JHE A;  1T1C A;  1S4S A;  1F98 A;  3A0S A;  4RQ9 A;  3HJK A;  2OWJ A;  4GS9 A;  3KX0 X;  3NJA A;  4GS9 B;  3K3D A;  3P7N A;  4EES A;  3OLO A;  1S1Y A;  4DJ3 A;  1S67 L;  2L4R A;  4EEU A;  3F1O B;  3H82 A; 
#chains in the Genus database with same CATH topology
 1TS7 A;  3LR0 A;  1H8Z A;  4FCF A;  3B42 A;  4QPR A;  3PBN A;  3E4P A;  1MWU A;  5HX9 A;  5EV0 A;  3P98 A;  4X1L A;  2RL3 A;  3IX4 A;  4JXV A;  3WS5 A;  2WKE A;  2Z2M B;  4GHI B;  2Y2H A;  3UE0 A;  2GX5 A;  3NOP C;  5HDS A;  2Z6D A;  2VZW A;  3GRJ A;  1KGE A;  5GL9 A;  3JVV A;  4EBP A;  1VM1 A;  2B95 A;  2Y4A A;  2VGL S;  4OH0 A;  4X53 A;  2Y2K A;  2J7V A;  2DCF A;  2WKQ A;  3E4O A;  5EM0 A;  4OPR A;  2G2U A;  4H8R A;  2KDK A;  2EXA A;  4LFU A;  3A3E A;  1FCM A;  4LRY C;  2P9V A;  4JXW A;  2V8F A;  2P9V B;  3MZD A;  4XT2 B;  4EBL A;  2V20 A;  2WZX A;  5E2G A;  1QMF A;  3UPN A;  3O86 A;  1XX2 A;  3FC7 A;  3NHQ A;  4EWF A;  3ZFZ A;  5LBR A;  3ZG7 B;  3CUE C;  4BL3 A;  3MFX A;  4R38 A;  1H5X A;  2X71 A;  2OAQ 1;  2WGW B;  1KE3 A;  3RXW A;  1FR1 A;  4H6J A;  5EVI B;  4AFI A;  2XDM A;  3IXD A;  4PPR A;  2YKF A;  5HAP A;  4FH4 A;  1XA7 A;  4LEN A;  3T4J A;  1FCN A;  1LI9 A;  1YLW A;  5DKL A;  2G7U A;  2JKR I;  1I2S A;  2Y2I A;  2BAS A;  2Y2M A;  4MN5 A;  5FAO A;  5CGX A;  1MKI A;  4HJ6 A;  1FSY A;  3HLE A;  3VOY A;  5GLC A;  3PR6 A;  1NZU A;  2ZQC A;  3PAE A;  3N4I A;  4CLC C;  3EQU A;  1KDW A;  4A5R A;  2OSU A;  3E4Q A;  4Y13 A;  1KGG A;  4JBF A;  4M4X A;  1K56 D;  4X68 A;  3FYZ A;  1TD5 A;  1RGZ A;  4EQI A;  4RX2 A;  1DRM A;  3N8S A;  3IS2 A;  3NOU C;  4S2K A;  4HH3 A;  1SCW A;  2PD7 A;  4JGP A;  4K91 A;  3Q7V B;  3R7W A;  4L9G A;  3R7W B;  3MFD A;  4PKY G;  4UAA A;  3ZGA B;  5L8M A;  5AQB A;  1J9M A;  5TR7 A;  1CJF A;  2XFS A;  4Y15 A;  4DJ2 A;  1MPL A;  4HI4 A;  4ZTK A;  3GTC A;  4BWI A;  1IFQ A;  1U60 A;  4EV4 A;  3MF0 A;  3HCY A;  2PRF A;  3IXG A;  3JYI A;  3NCK A;  4JF5 A;  3FPW A;  3S7O A;  3M2K A;  4C3Q A;  2ZJ9 A;  4I5S A;  3TJZ C;  2FFF B;  3G4P A;  4HJ3 A;  4GNU A;  2Y2O A;  4RYE A;  4X56 A;  1EWZ A;  4OLG A;  4R23 A;  4CQH A;  3CLO A;  1W8Y A;  4EER A;  2JKT M;  4GZB A;  5HSQ A;  1SHV A;  3D4F A;  1OPX A;  1KE0 A;  3O3V A;  3T4O A;  1N9O A;  4B88 A;  2O99 A;  3T1S A;  4MNR A;  5K5B A;  4XXR A;  3NBL A;  5A8B A;  1VET A;  3TSG A;  2HV1 A;  3V3R A;  4GCZ A;  2Y2L A;  4I39 A;  3K3C A;  3IHA A;  2JN7 A;  2R9X A;  1ONH A;  4Y3I A;  3UDF A;  1CF0 A;  4GD6 A;  5A91 A;  1YKD A;  3LR4 A;  1KVL A;  3IQA A;  2XF3 A;  3UB5 P;  2XK1 A;  3O88 A;  1PNE A;  3HLB A;  3DTM A;  2HGV A;  3FPV A;  3UB7 A;  1KDS A;  1DY6 A;  1L2S A;  4R3B A;  1LL5 A;  3W4P A;  3NOT C;  1DJA A;  3WWX A;  2Y2G A;  4JF4 A;  5G4Z A;  5F6A A;  4G3K A;  3SZT A;  3C38 A;  3UO9 A;  2BG1 A;  1TS6 A;  2QMI A;  5F83 A;  2ZQ9 A;  3H9W A;  2K7S A;  1L0D A;  3A0V A;  3HL9 A;  3IH9 A;  4PM7 A;  1F2K A;  4I3I A;  2ZC4 B;  4OKP A;  5TJJ A;  2W27 A;  4L9F A;  1TDG A;  3CHW P;  4U3T A;  2V0U A;  4OPY A;  3PYP A;  1VEU B;  5FQ9 A;  5I5L A;  5DFY A;  3UE1 A;  5EPH A;  5J7E A;  2QJ7 A;  1Y28 A;  4KUK A;  1KVM A;  4MN7 A;  3V3S A;  3LO7 A;  4C6Y A;  3HUN A;  3NI9 A;  2VK3 A;  1BLP A;  2K31 A;  5IS1 A;  5EFW A;  1YLP A;  1DP6 A;  2QKP A;  1OTI A;  1ERO A;  1AWI A;  1ZTU A;  4KZ9 A;  2I9V A;  4Y2F A;  4BBV A;  1TF1 A;  1K55 C;  4ZJ2 A;  1OJ5 A;  4ZAM A;  3T4Q A;  3GEC A;  1MXO A;  5HL6 A;  5DTS A;  1IYQ A;  4UEY A;  3T1Q B;  3OPL A;  2J9O A;  4RA7 A;  4HES A;  3VMA A;  5FEG A;  2Q9M A;  3PHY A;  1FIL A;  3OC2 A;  2EX6 A;  4Q8I A;  4WL9 A;  4PKY A;  1JWZ A;  3MQ0 A;  4KZA A;  3UE6 A;  4CPK A;  3RH8 B;  4WEK A;  3DWZ A;  5TBM B;  2PR5 A;  4HP9 A;  2QHK A;  4E3N A;  5HAQ A;  2H0Y A;  5CGW A;  1ES2 A;  1LT0 A;  5HFO A;  4MBF A;  5HPI A;  2CMN A;  1BUL A;  4DN0 A;  3BFC A;  1FIK A;  1G68 A;  2XEP A;  4KQQ A;  4KUO A;  2JHE A;  5GLA A;  1S4S A;  1F98 A;  3A0S A;  4OON A;  4RQ9 A;  3R4K A;  4WEL A;  4GS9 A;  1YT4 A;  2A3U A;  4GS9 B;  4U0T A;  3P7N A;  3VFF A;  4EES A;  3OLO A;  1ZG6 A;  1LI0 A;  1I5Q A;  2PT7 A;  3S4X A;  4P0M A;  3ZHH A;  3IF6 B;  5GHZ A;  4S2N A;  1ODV A;  4FD8 A;  4K0W A;  1QME A;  1K57 A;  2V2F F;  4WBG A;  3UDI A;  4K08 A;  2J3T C;  5F1F A;  1NLZ A;  1XXM A;  1C3B A;  1NZO A;  2IA2 A;  5A92 A;  3WS4 A;  5CED A;  5CTM A;  4YNR A;  2PAV P;  3KSG A;  4DMZ A;  3BFF A;  3T4T A;  3E0Y A;  4N9L A;  5IT5 A;  1PI4 A;  3C4P A;  1DJB A;  3IWQ A;  2D02 A;  3IWI A;  3LCE A;  1G28 A;  4CJN A;  4UA7 A;  1YLT A;  3OZH A;  1OME A;  1ZC2 A;  5E43 A;  1E3U D;  5HWT A;  1NWZ A;  3W4Q A;  4EET B;  2VV8 A;  2H10 A;  1LSX A;  3A3D A;  4IVI A;  1XPB A;  3QP4 A;  3LFV A;  2M1C A;  1E25 A;  3LY3 A;  5M18 A;  2WGI A;  1OJG A;  1HLU P;  2GDN A;  2HDR A;  3IX8 A;  5KIZ A;  2PBY A;  4HH2 A;  4WZ5 A;  4KZ7 A;  5DF7 A;  2J80 A;  3A3I A;  4KG6 A;  1BZA A;  1UWP X;  4FOF A;  2WKP A;  4K0X A;  4DE1 A;  5FQM A;  4BMW A;  2KX6 A;  1XJ6 A;  4LCL A;  1CEF A;  4NG2 A;  2INW A;  3DBA A;  1MBL A;  4S2L A;  1F9I A;  4HQA A;  3C4O A;  3N7W A;  4IUK A;  2WKR A;  3DTK A;  5HDC A;  5DTK A;  2CC1 A;  4KZ6 A;  3MXQ A;  4ETZ A;  2B18 A;  3S7N A;  1X0O A;  1RP5 A;  4HOI A;  4BEN A;  4GN2 A;  4NEE D;  4FSF A;  2C5W B;  3PBR A;  3IXB A;  1D7E A;  2EWW A;  2M7V A;  1ERQ A;  3IXH A;  2FH5 A;  4EEP A;  5HAI A;  1H8M A;  2PDR A;  3IH8 A;  3BRM A;  2ZOH A;  3W2Z A;  5FDH A;  4JPM A;  1O7E A;  3PBO A;  1AXB A;  2UV0 E;  3HBR A;  1N9B A;  2X02 A;  2M7U A;  2J9P A;  4DE3 A;  1BLC A;  2EX9 A;  3UE3 A;  1GSW A;  5M1A A;  5I94 A;  2ZC6 B;  3QP1 A;  3F1P A;  3WS0 A;  2XSS A;  1LSV A;  4GDB A;  3IBR A;  4OVD A;  5EVI C;  2HP9 A;  2P08 A;  3A0R A;  4LV1 A;  2XGN A;  3P09 A;  1T18 A;  3LEQ A;  5L2F A;  2ZMF A;  4KG2 A;  5IU1 A;  4ME4 A;  2ZBB A;  1FSW A;  1N9L A;  2XD5 A;  4PAU A;  3BQ8 A;  1BLH A;  2O9A A;  3C8C A;  4Y17 A;  2XD1 A;  4ZJ1 A;  2HZ5 A;  4LLO B;  4G3W A;  2HJE A;  4ARZ A;  4ARZ B;  5FI7 A;  4B4X A;  4E3K A;  3F1N A;  2EWV A;  2Z2L B;  5FSR A;  1IYO A;  1NYY A;  2UWX A;  1YLJ A;  4P6B A;  3A3F A;  3BY8 A;  1M6K A;  2A2L A;  4PM5 A;  2E8J A;  2EX2 A;  1MWS A;  4H6J B;  1LHY A;  3RXX A;  2WKI A;  3M6H A;  4IJG A;  1OTB A;  2W0N A;  3CIT A;  1ZG4 A;  4OQ0 A;  1VHM A;  2OV5 A;  4R4S A;  4S2J A;  5AVF A;  3WRT A;  2EFU A;  3T50 A;  1JVJ A;  1E3U A;  2O9B A;  3NDG A;  4HBT A;  5FI2 A;  5E2E A;  3VOZ A;  4UQI M;  1GHI A;  4E6X A;  3LGO A;  2HDS A;  3B47 A;  3DWK A;  1P97 A;  1SKO A;  4HIA A;  1SKO B;  3C7V A;  3UY6 A;  2Y91 A;  5JYO A;  3VV4 A;  2QYB A;  3CJM A;  3LIC A;  2XFT A;  4UA9 A;  4R0Q A;  2WZZ A;  3CUE A;  4KQO A;  4GJ4 A;  4Q0H A;  1IEM A;  2NUP C;  3IS2 B;  3TOI A;  4R1G A;  4HHD A;  4R3A A;  1PZP A;  4GW9 A;  5G4Y A;  4JKT A;  4L9E A;  1GA9 A;  1G5U A;  3SS3 A;  3RTY A;  1ES4 A;  3LIA A;  4KQD A;  3MXS A;  5CHM A;  4HNB A;  4N1X A;  3V50 A;  3TE8 A;  4M3K A;  2IWC A;  1KE4 A;  2ZD8 A;  1XKZ A;  5U47 A;  3LY4 A;  1SDE A;  4HY8 A;  3D9Y A;  3DTI A;  5AJG A;  1Q2P A;  2ZC3 B;  2DRW A;  5HWW A;  1CI9 A;  3UNW A;  3CPT A;  1BUE A;  3BWL A;  2WK0 A;  1ACF A;  2L1M A;  3HLF A;  3VFH A;  2H5S A;  3D72 A;  4NXB A;  3LR3 A;  3T12 B;  3T4S A;  4CLC A;  4IHQ A;  4S2I A;  1OTA A;  1MKM A;  4ZRR A;  2XH9 A;  1S66 L;  3GDI A;  3VP3 A;  3SS5 A;  5HZH A;  2V1Z A;  1OT9 A;  3DAV A;  2ZM0 A;  3ZG5 A;  3RFB A;  5KMW A;  2EX8 A;  3BLM A;  4WUJ A;  3HLW A;  4IVK A;  3UDX A;  3IHB A;  4LRZ E;  1O07 A;  1VET B;  1F5M A;  4LPZ A;  3WRZ A;  1GHP A;  1D1J A;  5IHV A;  2K2N A;  2W1T A;  2W1R A;  4HBU A;  1MY8 A;  1N9N A;  5F5Y A;  4MLL A;  1WYC A;  5F69 A;  4QD4 A;  3UPO A;  5FQI A;  2QZ6 A;  1T1B A;  3Q7Z A;  3V39 A;  3HJI A;  4DDS A;  4N92 A;  3HUM A;  3JPU A;  1S0W A;  4DRT A;  2HDQ A;  2PU2 A;  2R9W A;  3ITB A;  3KX0 X;  3NJA A;  4JLF A;  3K3D A;  2JKG A;  4R3J A;  4DKI A;  1S67 L;  4XUX A;  4D60 A;  3G34 A;  4RX3 A;  4EEU A;  4U0X A;  3H82 A;  1YAX A;  2JKR M;  5A90 A;  4KZB A;  2HP5 A;  2KOI A;  4S2M A;  1CQA A;  3FZC A;  3MXR A;  1PW1 A;  3M6B A;  1K38 A;  4LRX C;  1XFQ A;  1D06 A;  3N6I A;  1ONG A;  3QNC A;  3EWK A;  2Y2N A;  2VX8 A;  3VP0 A;  5EM1 A;  1ESU A;  2JC7 A;  3N8L A;  1TEM A;  4O8G A;  1BYW A;  4PM6 A;  3IF5 A;  3ZYT A;  4R6L A;  1IYP A;  3HLG A;  4DXC A;  3MMH A;  2AVX A;  3E2L A;  2VA0 A;  4OQI A;  4QB8 A;  4FUW A;  3T4L A;  3NIA A;  1FQG A;  2OOL A;  1PFL A;  4LV3 A;  2B02 A;  2H0T A;  4P85 A;  1OTE A;  3OOV A;  5F1G A;  2L0W A;  4E3I A;  4EUZ A;  4PHT A;  2LB9 A;  1T19 A;  4WF0 A;  4QU3 A;  3EQV A;  1L0F A;  4EU0 A;  1K25 A;  3BFE A;  3ZDJ A;  5F82 A;  4MCW A;  5GLD A;  2PR6 A;  2HP6 A;  5E2H A;  4GDN A;  3UB8 A;  4GLQ A;  1TDL A;  3BJN A;  4JXS A;  3L9K A;  2J8Y A;  3BM6 A;  1H3Q A;  3IF6 C;  2OLV A;  2Y55 A;  5CXW A;  4EUV A;  3E98 A;  4X1M A;  4Y5F A;  1K57 C;  4KEN B;  3MKE A;  5EOO A;  3EEH A;  1K55 A;  4FH2 A;  3HVF A;  2XRO A;  3BEC A;  5GHY A;  3OBF A;  1MZU A;  1W63 Q;  3S7Q A;  2W3G A;  2LB5 A;  4QY6 A;  1JTD A;  3K2N A;  2HJ9 C;  4DE0 A;  2Y2Q A;  3ZG9 B;  2Y8H A;  2Q9N A;  4OPQ A;  1GA0 A;  5EVL A;  4YWZ A;  2E8I A;  3HRE A;  2Q0O A;  1G6A A;  5HD5 A;  4ZDX A;  3CAX A;  4YFM A;  4WZ4 A;  3HUO A;  1MC0 A;  5D3O A;  4CLC E;  1XJ2 A;  4F94 A;  2MJ6 A;  3QHY A;  3MQQ A;  1TS8 A;  1YMS A;  4OPZ A;  2PYR A;  4WM9 A;  3G32 A;  4OOM A;  3BQA A;  4BL2 A;  1WE4 A;  4UA6 A;  2QWS A;  1P9R A;  5DJU A;  2XRN A;  1EI5 A;  4NXE A;  4EQ1 A;  1HD8 A;  4GD8 A;  4IED A;  5FI6 A;  3LI8 A;  4E3J A;  3I7J A;  4Y7P A;  1CK3 A;  2P04 A;  1Y54 A;  4OP8 A;  3UN7 A;  1BT5 A;  3T1R A;  3SH9 A;  4QHC A;  5GLB A;  3FV7 A;  2Y59 A;  1DP8 A;  4S2P A;  4KZ8 A;  2VV6 A;  3A3J A;  2WAF A;  5J8X A;  1OTD A;  4NET A;  3OPR A;  2V1A A;  4PM9 A;  1P0Z A;  3PTE A;  4QY5 A;  3UPP A;  1XP4 A;  3FKW A;  3ZCZ A;  1K54 A;  5FQK A;  3M2J A;  2W3E A;  4HP4 A;  2A24 A;  5CGS A;  2JE5 A;  3G2Z A;  2D01 A;  5AQ7 A;  2VJW A;  2W3H A;  3KSF A;  3JVU A;  3MS6 A;  3VE4 A;  1HTZ A;  2ZMA A;  3H7W A;  4HJ4 A;  3H7W B;  2HDU A;  4OQH A;  3O5Y A;  1PWC A;  3OCL A;  4X69 A;  2DNS A;  3FG8 A;  3VP1 A;  2RCX A;  2PBD P;  1JNU A;  4UQI S;  4ESP A;  1ERM A;  1LSW A;  1XFN A;  1YLZ A;  4Z1W A;  1YMX A;  4E3L A;  1YLY A;  3GVB A;  2VGJ A;  4EBN A;  2FZ0 A;  3BLS A;  4CLC D;  3UMD A;  2ZC7 A;  5CEC A;  2A49 A;  4DXB A;  3MSH A;  2GZA A;  3G2Y A;  3F1O A;  4L0L A;  4BD1 A;  3LIF A;  1YM1 A;  2Y79 A;  2DMW A;  2V0W A;  4BJP A;  2JKF A;  2V1B A;  5DVA A;  1BLS A;  3ULF A;  3S7P A;  1Q2Q A;  1IKG A;  2P74 A;  3W8K A;  4YOF A;  3VP4 A;  4HEF A;  3F1P B;  2JKT I;  3FWL A;  4GHI A;  3KSI A;  1S4R A;  5EE8 A;  2XR0 A;  3BFD A;  4Q0I A;  5FAQ A;  4N1H A;  1P9W A;  5KSC A;  3Q1F A;  1CI8 A;  5FDS A;  4P6Z M;  3QNB A;  4B4Z A;  2P7J A;  3LUQ A;  4FTX A;  1SZV A;  3G35 A;  3G31 A;  1RGY A;  1RCJ A;  3ZVT A;  1BSG A;  1YSP A;  4UHU A;  4DF6 A;  3SW1 A;  3BFG A;  3EGD C;  3GMW A;  4WEJ A;  3C5A A;  1K0K A;  2KLI A;  1PW8 A;  4WN5 A;  3LIE A;  3TG9 A;  1YQS A;  3UB6 A;  1PZO A;  1XJ3 A;  3F1N B;  3CG5 A;  3NY4 A;  3GR2 A;  5FL3 A;  1MWT A;  3C2W A;  4GB7 A;  4X55 A;  4XT2 A;  4Y0T A;  1ES5 A;  4LV2 A;  3TRC A;  3Q07 A;  3C7U A;  4II7 A;  1LLB A;  4ZBE A;  2VGK A;  3MJQ A;  1KGF A;  3ICY A;  2WGW A;  1A0K A;  3MZF A;  4KG5 A;  2EXB A;  1NLY A;  5CTN A;  4E04 A;  1NRF A;  5EVI A;  2ZL1 A;  1LL9 A;  1FR6 A;  2ZL1 B;  4E3M A;  2PHY A;  2ZOI A;  1VQQ A;  3PBQ A;  4NXF A;  3V5M A;  1UGU A;  4JGO A;  3QP6 A;  4OQG A;  5F68 A;  2ZLY A;  1XGI A;  5HW3 A;  1T1C A;  2EFX A;  5FEF A;  2XA7 M;  3HJK A;  4O0P A;  5MC7 A;  2ZQD A;  3RJU A;  1ZHH B;  1S1Y A;  4DJ3 A;  4KQR A;  2L4R A;  4Q0J A;  3SH8 A;  1Y4O A;  3BYD A;  4O7D A;  3DW0 A;  1H0M A;  4JF6 A;  5FAT A;  4BD0 A;  1FCO A;  3IT9 A;  4Z9Q A;  2OAP 1;  4E3O A;  2QPN A;  5CRF A;  3HLD A;  3LI9 A;  4XUZ A;  2XQZ A;  1LL8 A;  4I3J A;  3KYE A;  1W79 A;  4E6W A;  1GSX A;  3MR0 A;  1S6R A;  4NXG A;  4LCM A;  3Q7V A;  4NK3 A;  4WMC A;  4ETX A;  3T1X A;  2R78 A;  4QJG A;  2VGL M;  3ITA A;  2WAE A;  1M40 A;  1ZKJ A;  3CPT B;  1GCE A;  3EOI A;  4JGR A;  5G18 A;  2V9A A;  4B9O A;  5GHX A;  3AGE A;  4CLC B;  2ACG A;  5A93 A;  5L10 A;  3ISG A;  2WUQ A;  3Q82 A;  4R4R A;  1IYS A;  2ZQ8 A;  1K4E A;  1K6R A;  3PBS A;  4O01 A;  1SDN A;  2W3F A;  3PBT A;  4OLD A;  3GV9 A;  3GSG A;  1UWN X;  3KSH A;  4KZ3 A;  3AGD A;  3C30 A;  1VB6 A;  2W1T B;  4EXO A;  3ZVW A;  1PWD A;  1V9Z A;  2BTF P;  1K6S A;  3CI6 A;  3ZQ5 A;  5HL1 A;  5J4E A;  3O87 A;  3VE3 A;  1DP9 A;  2WGV A;  3UB9 A;  3S1Y A;  1W5D A;  1PRQ A;  1ESI A;  5EEC A;  4OOL A;  1DJC A;  3BW6 A;  5CHJ A;  4DDY A;  4N9K A;  4LGW A;  4BLM A;  1NRJ A;  1GHM A;  1PYY A;  2VKS A;  5KZH A;  5HPF A;  1L0E A;  3T4K A;  3FKV A;  1HVB A;  1YPR A;  4I38 A;  4I3A A;  5FA7 A;  3DTE A;  2V8C A;  3G30 A;  1FOF A;  2ZQA A;  1N4O A;  2ZM8 A;  3H82 B;  2PYP A;  1KOU A;  3G6O A;  3NC8 A;  3QP2 A;  3EEA A;  3U2A A;  2J3T D;  3OPP A;  3VSK A;  5AQA A;  1H8Y A;  4Y0U A;  2BLS A;  4MEZ A;  4BBT A;  5DJT A;  1VEU A;  2EA9 A;  2NUT C;  2IWD A;  3SS4 A;  1W7F A;  2JBF A;  3TW8 A;  4DE2 A;  4ID4 A;  2JCH A;  3SOI A;  1NXY A;  2WAD A;  3PAG A;  1TVF A;  4OP5 A;  3IWO A;  4IBR A;  3Q81 A;  1OT6 A;  1E4D A;  3S22 A;  1ALQ A;  4IBX A;  2VV7 A;  3VSL A;  4OOY A;  3PXP A;  3LYX A;  2Y2J A;  3BEB A;  3CWF A;  3IX3 A;  3QP8 A;  2Y2P A;  1K56 A;  3ZG8 B;  1V9Y A;  2OLU A;  5DF9 A;  1GSV A;  1PWG A;  2YKH A;  3CMZ A;  3CZD A;  4GKU A;  1WA9 A;  5FQQ A;  5BOH A;  1J3W A;  3NEC A;  5CHU A;  3ZNY A;  4S2N C;  3AGF A;  4WYY A;  5TBM A;  5AVE A;  1Z09 A;  3SH7 A;  2VEA A;  4X6T A;  2FFY A;  2HPB A;  1IOU A;  5E2F A;  2ZMV A;  2H28 A;  4F3L A;  1STZ A;  3W4O A;  4F3L B;  2PD8 A;  1Z6F A;  4RVA A;  1JWV A;  3LIB A;  3LEZ A;  4MBK A;  3VP2 A;  3MKF A;  3N8R A;  1L3L A;  3D3O A;  5L07 A;  2G2W A;  2OWH A;  3V67 A;  5AQ9 A;  1WYB A;  2VLG A;  4NKP A;  1JWP A;  1SKF A;  1HZO A;  2Z6C A;  4MMN A;  1XA1 A;  5JYP A;  5M19 A;  4BBU A;  1T1A A;  1YSQ A;  3ZG0 A;  5FAS A;  1XJ4 A;  2GJ3 A;  2HF6 A;  4D2O A;  3BY9 A;  5DF8 A;  1PI5 A;  3IF6 A;  4JXG A;  4KZ4 A;  1MWR A;  3EGX C;  2ZC5 B;  5L09 A;  3LID A;  3KO6 A;  5HAR A;  3HLC A;  2O9C A;  3KYZ A;  1IKI A;  1I2W A;  4LV0 A;  5C5K A;  2PU4 A;  5DFX A;  2QJ5 A;  2J3W A;  3P01 A;  4WLA A;  3KYQ A;  4WZ5 C;  5HWV A;  4S2O A;  3B3X A;  5CEB A;  5TFQ A;  3NDE A;  4BQM A;  1EW0 A;  4PM8 A;  4QWO A;  3E2K A;  5EVI D;  4MBH A;  1K54 C;  3B33 A;  1K4F A;  1JTG A;  4ZJ3 A;  5TGF A;  4C75 A;  3GQZ A;  4YIN A;  5EOE A;  5CX7 A;  5DTT A;  4GOG A;  4R70 A;  1NY0 A;  1G6O A;  4P6Z S;  2W3D A;  1NYM A;  2O0Y A;  4X25 A;  1W8Q A;  5HD3 A;  3QP5 A;  2GNX A;  3UME A;  2X01 A;  3VOL A;  4PMA A;  5EVE A;  4B93 A;  3OCN A;  1S1Z A;  5EUA A;  4Y0O A;  3IBJ A;  3LR5 A;  1PIO A;  2B5R A;  3ZNT A;  1XGJ A;  1IEL A;  3MZE A;  5KSH A;  2WYX A;  5HDD A;  4EW7 A;  4JGQ A;  1L0G A;  1ES3 A;  3WS1 A;  2A24 B;  2C6W B;  4P87 A;  3OPH A;  1CEG A;  2ZM2 A;  3MQO A;  4G3V A;  4MN6 A;  1BTL A;  2IWB A;  2I72 A;  3L7H A;  3WS2 A;  5J3W A;  5FQJ A;  5DKK A;  1TS0 A;  2XLN A;  4WMC D;  2WKH A;  5FAP A;  4IUH A;  1W63 M;  2OWJ A;  4KZ5 A;  2ZQ7 A;  3MBZ A;  5CER A;  1NJ4 A;  2XA7 S;  3U4L P;  3NUL A;  3F1O B;  4MDZ A; 
#chains in the Genus database with same CATH homology
 1ODV A;  1TS7 A;  2KOI A;  3LR0 A;  2OAP 1;  3B42 A;  4LRX C;  4QPR A;  3PBN A;  3E4P A;  3LI9 A;  1XFQ A;  4K08 A;  1LL8 A;  2J3T C;  1D06 A;  1NLZ A;  4I3J A;  2IA2 A;  3EWK A;  1GSX A;  2VX8 A;  3MR0 A;  4YNR A;  3KSG A;  4DMZ A;  4NXG A;  4GHI B;  3T4T A;  4ETX A;  2GX5 A;  3E0Y A;  4O8G A;  1BYW A;  2R78 A;  2VGL M;  3NOP C;  3ZYT A;  4R6L A;  5IT5 A;  3EOI A;  5HDS A;  4JGR A;  2Z6D A;  2V9A A;  3MMH A;  2VZW A;  4B9O A;  3JVV A;  2VA0 A;  3T4L A;  4CLC B;  2D02 A;  2VGL S;  1G28 A;  2OOL A;  2WKQ A;  2B02 A;  3E4O A;  1OTE A;  5HWT A;  1NWZ A;  3OOV A;  2KDK A;  3PBS A;  4EET B;  2VV8 A;  2L0W A;  4PHT A;  2LB9 A;  4O01 A;  1LSX A;  1T19 A;  4LRY C;  4WF0 A;  2W3F A;  3PBT A;  3EQV A;  3LFV A;  4XT2 B;  4EU0 A;  2M1C A;  1UWN X;  3FC7 A;  3NHQ A;  4MCW A;  5LBR A;  3KSH A;  2PR6 A;  1OJG A;  3CUE C;  3C30 A;  3MFX A;  5KIZ A;  3UB8 A;  4HH2 A;  4R38 A;  1VB6 A;  4GLQ A;  2W1T B;  4EXO A;  2J80 A;  2OAQ 1;  3BJN A;  1V9Z A;  1UWP X;  4H6J A;  4FOF A;  4AFI A;  2WKP A;  1H3Q A;  3CI6 A;  3ZQ5 A;  5J4E A;  4BMW A;  2YKF A;  2KX6 A;  3VE3 A;  1XJ6 A;  4EUV A;  3E98 A;  1DP9 A;  3UB9 A;  4Y5F A;  2INW A;  3T4J A;  3DBA A;  3EEH A;  5DKL A;  2G7U A;  4OOL A;  1F9I A;  2JKR I;  4HQA A;  3BW6 A;  2BAS A;  2XRO A;  4IUK A;  4MN5 A;  2WKR A;  3OBF A;  5HDC A;  1MZU A;  1NRJ A;  1W63 Q;  3S7Q A;  3MXQ A;  4ETZ A;  4HJ6 A;  2W3G A;  2LB5 A;  2VKS A;  5HPF A;  2B18 A;  3S7N A;  3K2N A;  2HJ9 C;  3T4K A;  4I38 A;  1X0O A;  3PR6 A;  4I3A A;  4HOI A;  2Y8H A;  4NEE D;  4FSF A;  4CLC C;  3PBR A;  3H82 B;  4YWZ A;  3EQU A;  1D7E A;  2EWW A;  2M7V A;  2PYP A;  1KOU A;  5HD5 A;  3G6O A;  2FH5 A;  3CAX A;  3E4Q A;  4EEP A;  4M4X A;  1H8M A;  2PDR A;  3EEA A;  1TD5 A;  1MC0 A;  4CLC E;  2ZOH A;  1DRM A;  1XJ2 A;  3U2A A;  3IS2 A;  2MJ6 A;  2J3T D;  3W2Z A;  3NOU C;  3PBO A;  3MQQ A;  4HH3 A;  2PD7 A;  4JGP A;  4BBT A;  5DJT A;  1TS8 A;  3R7W A;  2M7U A;  2EA9 A;  2NUT C;  4L9G A;  3R7W B;  4PKY G;  3TW8 A;  2PYR A;  5L8M A;  3UE3 A;  1GSW A;  3F1P A;  4DJ2 A;  4OOM A;  3BQA A;  2XSS A;  4HI4 A;  1LSV A;  3IBR A;  4BWI A;  1IFQ A;  2P08 A;  3MF0 A;  2QWS A;  3HCY A;  1P9R A;  5DJU A;  2XRN A;  3A0R A;  1OT6 A;  1T18 A;  3FPW A;  4NXE A;  2ZMF A;  3S7O A;  5IU1 A;  2VV7 A;  4ME4 A;  4EQ1 A;  2ZBB A;  4I5S A;  1N9L A;  3PXP A;  3TJZ C;  3LYX A;  4HJ3 A;  3LI8 A;  4PAU A;  2P04 A;  3BQ8 A;  3CWF A;  4CQH A;  2O9A A;  3C8C A;  3CLO A;  4EER A;  2JKT M;  5HSQ A;  1V9Y A;  1OPX A;  4LLO B;  4G3W A;  2HJE A;  4ARZ A;  3T4O A;  1N9O A;  5DF9 A;  4ARZ B;  2O99 A;  1DP8 A;  2VV6 A;  3F1N A;  1GSV A;  2EWV A;  2YKH A;  5K5B A;  1OTD A;  3BY8 A;  1WA9 A;  2A2L A;  5A8B A;  2V1A A;  4H6J B;  1P0Z A;  2HV1 A;  4GCZ A;  4I39 A;  3K3C A;  4IJG A;  1OTB A;  2JN7 A;  2W0N A;  4Y3I A;  3CIT A;  2W3E A;  4HP4 A;  5TBM A;  5AVE A;  1VHM A;  2A24 A;  1YKD A;  2VEA A;  5AVF A;  3LR4 A;  3T50 A;  1IOU A;  2D01 A;  2ZMV A;  2H28 A;  2VJW A;  1STZ A;  2W3H A;  3KSF A;  2O9B A;  3JVU A;  4F3L A;  4F3L B;  3VE4 A;  2PD8 A;  3LIB A;  3H7W A;  4HJ4 A;  3H7W B;  3O5Y A;  4UQI M;  3OCL A;  3B47 A;  1P97 A;  3FG8 A;  4HIA A;  2HGV A;  3FPV A;  3D3O A;  3UB7 A;  1JNU A;  4UQI S;  2OWH A;  3VV4 A;  1LSW A;  1XFN A;  2QYB A;  3NOT C;  4Z1W A;  3V67 A;  3LIC A;  2VLG A;  4NKP A;  2FZ0 A;  5F6A A;  5G4Z A;  4CLC D;  3UMD A;  3CUE A;  4G3K A;  3C38 A;  2Z6C A;  4MMN A;  4KQO A;  4GJ4 A;  4Q0H A;  1TS6 A;  2NUP C;  4BBU A;  2GZA A;  1T1A A;  1YSQ A;  1XJ4 A;  2GJ3 A;  2HF6 A;  3H9W A;  3IS2 B;  3BY9 A;  3F1O A;  4L0L A;  2K7S A;  4HHD A;  4R3A A;  4GW9 A;  5G4Y A;  3A0V A;  3LIF A;  4L9E A;  3EGX C;  2Y79 A;  2DMW A;  2V0W A;  3LID A;  3RTY A;  4BJP A;  4I3I A;  3LIA A;  4KQD A;  5TJJ A;  2W27 A;  4L9F A;  3KO6 A;  2V1B A;  4HNB A;  2V0U A;  3PYP A;  3ULF A;  2O9C A;  3KYZ A;  5I5L A;  3S7P A;  5DFY A;  3TE8 A;  5C5K A;  5J7E A;  5DFX A;  2QJ7 A;  1Y28 A;  2QJ5 A;  4KUK A;  2J3W A;  3P01 A;  4YOF A;  4WLA A;  3KYQ A;  5HWV A;  4MN7 A;  4HY8 A;  3F1P B;  2JKT I;  5AJG A;  4GHI A;  3KSI A;  1S4R A;  2K31 A;  4Q0I A;  5HWW A;  1EW0 A;  5IS1 A;  1P9W A;  5EFW A;  3B33 A;  3BWL A;  1DP6 A;  2QKP A;  1OTI A;  2L1M A;  4P6Z M;  3D72 A;  4NXB A;  1ZTU A;  3LR3 A;  3T4S A;  4CLC A;  2P7J A;  2I9V A;  5CX7 A;  4IHQ A;  3LUQ A;  4Y2F A;  1OTA A;  4BBV A;  1MKM A;  1TF1 A;  4ZRR A;  4R70 A;  1YSP A;  4P6Z S;  1G6O A;  3EGD C;  3SW1 A;  4WEJ A;  1S66 L;  2W3D A;  3GDI A;  1OJ5 A;  5HZH A;  2KLI A;  4WN5 A;  3LIE A;  2O0Y A;  5HD3 A;  3T4Q A;  3UB6 A;  1OT9 A;  3GEC A;  5HL6 A;  1XJ3 A;  2GNX A;  3F1N B;  3RFB A;  3UME A;  4UEY A;  3VOL A;  4WUJ A;  5FL3 A;  3C2W A;  4LRZ E;  4XT2 A;  3TRC A;  4B93 A;  3OCN A;  1S1Z A;  3IBJ A;  3PHY A;  1F5M A;  3OC2 A;  4LPZ A;  4WL9 A;  3LR5 A;  4II7 A;  4PKY A;  3MQ0 A;  3MJQ A;  3UE6 A;  5KSH A;  3RH8 B;  3ICY A;  5HDD A;  4EW7 A;  4WEK A;  4JGQ A;  5TBM B;  2K2N A;  2PR5 A;  2W1T A;  4HP9 A;  2A24 B;  2QHK A;  2W1R A;  1NLY A;  1N9N A;  4E04 A;  5F5Y A;  1LT0 A;  2PHY A;  2ZOI A;  3PBQ A;  4NXF A;  3MQO A;  4G3V A;  5HPI A;  4MN6 A;  2CMN A;  5F69 A;  5J3W A;  1UGU A;  4DN0 A;  4JGO A;  5DKK A;  1T1B A;  3HJI A;  1TS0 A;  5F68 A;  4KUO A;  2JHE A;  4IUH A;  1T1C A;  1S4S A;  1F98 A;  1W63 M;  3A0S A;  4RQ9 A;  2XA7 M;  3R4K A;  3HJK A;  2OWJ A;  4WEL A;  4GS9 A;  3KX0 X;  3NJA A;  4GS9 B;  4O0P A;  5MC7 A;  3K3D A;  3P7N A;  4EES A;  1ZHH B;  3OLO A;  1S1Y A;  4DJ3 A;  1S67 L;  2XA7 S;  2L4R A;  2PT7 A;  4Q0J A;  4EEU A;  3F1O B;  1YAX A;  2JKR M;  3H82 A;  4MDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...