1S4SA

Reaction intermediate in the photocycle of pyp, intermediate occupied between 100 micro-seconds to 5 milli-seconds
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photoactive yellow protein
publication title Protein kinetics: Structures of intermediates and reaction mechanism from time-resolved x-ray data
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s4sA00
4EQ1A 5KIZA 4HH2A 4WLAA 2PYPA 1KOUA 3HJKA 2YKFA 3H9WA 1OJ5A 3A0VA 5HDDA 1D7EA 4HHDA 3BY8A 1P97A 3PHYA 3NJAA 4HJ4A 4L9EA 3MXQA 4NXGA 4DJ2A 5HDCA 1DRMA 3ULFA 3LI8A 4LLOB 2WKRA 3BY9A 2ZBBA 1OT6A 1T1BA 1XFNA 2J80A 2V0WA 3GECA 3UB7A 1EW0A 1OTAA 1S1YA 3GDIA 1VB6A 5J7EA 3F1PA 4RQ9A 3UB9A 3K3CA 2PHYA 3E4OA 4JGRA 5I5LA 3ICYA 1X0OA 4HQAA 3F1OB 1MZUA 2JN7A 2W27A 2L1MA 4EETB 4K08A 3B33A 1GSVA 1T19A 1T18A 1GSXA 2V0UA 4HY8A 5DJTA 4MN5A 2GJ3A 4EXOA 2KDKA 4I5SA 1LT0A 2HV1A 2M1CA 2CMNA 3OLOA 4HI4A 4EEUA 5HD5A 4F3LB 3FC7A 1LSXA 3H7WA 3H82A 1V9YA 4H6JB 1WA9A 4NXBA 1S67L 1N9NA 5HSQA 3CAXA 4HOIA 1DP6A 3VE4A 3ZQ5A 3UB8A 3LIBA 3IS2A 1UWNX 4GHIB 1XJ6A 2WKQA 5HWWA 4KUKA 4B9OA 3MJQA 2EA9A 2JHEA 3PYPA 2I9VA 2BASA 5DKLA 3CWFA 3CLOA 5HD3A 4HH3A 5F6AA 4HJ3A 5J3WA 1N9OA 4L9GA 3E4QA 2PD8A 1TS7A 1BYWA 5F5YA 3VOLA 2WKPA 2ZOHA 3LIEA 2L4RA 4WL9A 3C8CA 1OTDA 3G6OA 4HIAA 2Z6CA 4GW9A 1P0ZA 4EERA 3F1OA 2VV6A 2L0WA 3NHQA 5IS1A 4E04A 1XJ4A 3MQOA 1DP9A 1NWZA 3LI9A 4GS9A 2V1AA 3F1NA 2INWA 2YKHA 4I3IA 3D72A 3FG8A 4YWZA 3MR0A 5EFWA 4LPZA 5G4YA 4R3AA 2K7SA 4NXFA 1T1AA 3BWLA 2VV8A 3NOTC 5AVFA 2VEAA 4EESA 1V9ZA 2R78A 4XT2A 4GCZA 5F69A 2P7JA 1D06A 2QWSA 1OT9A 2QJ5A 4DJ3A 2A24A 3K3DA 5DKKA 2V9AA 2VLGA 4BBUA 5HDSA 1F98A 3C2WA 4EW7A 1S66L 3H7WB 2KX6A 4GHIA 3T50A 3A0RA 3H82B 2OWHA 1XJ2A 2B02A 1S4SA 5HZHA 1T1CA 3E4PA 4NXEA 4I38A 1TS6A 4R70A 2D01A 2W0NA 4PKYA 3KX0X 3NOUC 5TBMB 1LL8A 4WUJA 3IS2B 3RTYA 2ZOIA 4MN6A 3MFXA 4I3JA 1F9IA 4BBVA 3LIAA 1TS8A 2PDRA 5IU1A 2OOLA 5A8BA 3LYXA 2H28A 3IBRA 1S4RA 2PR5A 1DP8A 2OWJA 4I3AA 3LUQA 3LICA 4LRZE 2D02A 3UMEA 3MQQA 4BBTA 2V1BA 4HP4A 3VE3A 1TS0A 4LRYC 1OTBA 1XFQA 2QKPA 2VV7A 4JGQA 2QJ7A 5HWVA 3UMDA 4M4XA 1XJ3A 3F1PB 3RH8B 4L9FA 4HP9A 5F68A 4I39A 2PYRA 4WF0A 5AVEA 4LRXC 1LSVA 4F3LA 4JGPA 3LIDA 1LSWA 4GS9B 1OTIA 4H6JA 3F1NB 4R6LA 3UE6A 4KUOA 4WN5A 2QHKA 3HJIA 5G4ZA 3A0SA 3EWKA 4PKYG 5J4EA 4HJ6A 1N9LA 3SW1A 4KQDA 2PR6A 1Y28A 3P7NA 5HWTA 4XT2B 5DJUA 4EEPA 2Z6DA 4HNBA 2PD7A 3LIFA 3UB6A 1JNUA 2A24B 1UWPX 4R38A 1OTEA 1G28A 4JGOA 1S1ZA 1ODVA 1UGUA 1GSWA 3EEHA 5TBMA 3NOPC 1OJGA
chains in the Genus database with same CATH superfamily
3LO7A 4UHUA 2HJEA 2PYPA 2C5WB 4OPYA 2YKFA 3BJNA 1AXBA 3H9WA 4NK3A 3V39A 4KZ5A 2Y2IA 5HDDA 4Y15A 1IFQA 2JKFA 4X6TA 5CTNA 2ZJ9A 4MEZA 3NJAA 2P9VA 3GV9A 4HJ4A 1W5DA 2ZMVA 4NXGA 4Z1WA 4DJ2A 3LY4A 1ONGA 1DRMA 1K54A 3LI8A 4PMAA 2WKRA 5CGSA 2J80A 5GLBA 2V0WA 1E3UA 2JE5A 3MQ0A 3O5YA 3CUEA 5J7EA 4H8RA 3AGDA 5E2EA 1U60A 1X0OA 3T4JA 3MXSA 5L09A 1IYOA 3CMZA 5FL3A 4YFMA 3ZG5A 1K6SA 2Y2JA 1W8YA 3CZDA 1PI4A 2ZMFA 4EETB 2V1ZA 3HLEA 3ZDJA 5DTKA 4OQHA 1VEUB 1PW1A 1JVJA 3B33A 4OKPA 1GSVA 1C3BA 1J3WA 1GSXA 4R4RA 1XX2A 2WUQA 2XR0A 1NLYA 4MN5A 4KZ7A 4QY5A 3FKWA 2VA0A 2HV1A 3O88A 5HL1A 1ZKJA 3BW6A 4HESA 3ZNTA 3PXPA 3TE8A 3G32A 2HF6A 4IBXA 1JTGA 2DMWA 4C75A 1S6RA 3BQ8A 3ZQ5A 3E2KA 5HPIA 3N8LA 3IS2A 2XDMA 2NUTC 3WS5A 1XJ6A 4LV3A 1CI8A 1ZTUA 2XGNA 4PM9A 2PBDP 2WZXA 1P9WA 3UPPA 1P9RA 5FQ9A 2HP6A 4JXGA 1EI5A 5HD3A 3N7WA 4HJ3A 1W63M 1NXYA 2WKIA 5J3WA 3CI6A 3E4QA 4FTXA 2G2UA 1TS7A 3G34A 4S2MA 5CGXA 2WKPA 1BZAA 5CGWA 2P04A 3G4PA 3T12B 1Z6FA 3OCNA 2L4RA 1LI0A 3IXBA 1TF1A 3R7WA 1ES5A 2ZC5B 2Y2KA 1CQAA 3WRTA 5L8MA 4UA9A 3IXGA 4JF4A 3DTIA 5M18A 2XD1A 1N9BA 3PBSA 3S22A 2IWDA 3MQOA 3IWQA 4DE3A 1NWZA 5KSCA 2V1AA 1H5XA 3M6BA 3BFDA 3T1SA 4Y17A 4JLFA 3SOIA 4Y13A 1ERMA 2W3GA 4CLCB 2WK0A 4WEKA 5FATA 2Y2NA 3NOTC 2VEAA 1V9ZA 2R78A 4XT2A 5FAPA 3MKEA 5F69A 3UDFA 2QWSA 1OT9A 2HGVA 2IA2A 3BECA 3WS1A 5M1AA 4PAUA 3V3SA 1WYBA 2GX5A 2VLGA 4OONA 5HDSA 1NRJA 2J3TD 3SS3A 1FQGA 1PRQA 3BEBA 3EQUA 4EW7A 3W4OA 3T50A 3VOYA 1XJ2A 2B02A 3SS5A 3UO9A 4S2JA 5CEBA 2J9OA 2GNXA 4R1GA 3NCKA 2W0NA 4PKYA 3KX0X 2P74A 4ZJ3A 2Y2LA 4OQ0A 3QHYA 1NZUA 5F1FA 3OPPA 1ES2A 1BLCA 4CPKA 2W3FA 4BBVA 1DJCA 2ZQ8A 4KZ6A 2PDRA 3HVFA 4MBHA 3CITA 3LYXA 1ERQA 2UV0E 1PYYA 4KQRA 4BL3A 3HCYA 3LR0A 1K55C 2RCXA 3PBRA 3IBRA 4U3TA 1YKDA 2PR5A 1IKIA 1NZOA 5G18A 1DP8A 4I3AA 4OQGA 3MZEA 5FQMA 1H3QA 4BBTA 4RX3A 1L2SA 2QPNA 1OTBA 1XFQA 1ESUA 1Y4OA 3PR6A 1CEGA 1BSGA 3KYZA 1FOFA 1SZVA 1MWRA 4ETXA 2ZQ9A 3ZYTA 3P01A 3AGEA 4OPQA 1K38A 5AVEA 3MF0A 3S4XA 1YT4A 4EQIA 3IH9A 1LSWA 1VHMA 2FH5A 4H6JA 3UN7A 3CHWP 5EM1A 3HL9A 4KUOA 3MBZA 4DE2A 1PFLA 1YLJA 2XH9A 1N9LA 2EX6A 3SW1A 5F1GA 1Y28A 2OSUA 5HWTA 4FOFA 3ZGAB 2KOIA 5DJUA 3M2KA 3JVUA 3T4QA 4OOLA 3HLBA 3RFBA 3D3OA 4GB7A 1OTEA 2OV5A 1ODVA 3EEHA 1OJGA 2Y8HA 4DE1A 3IXDA 5KIZA 2PAVP 3O86A 1PIOA 2DNSA 3N8SA 2V8CA 3GMWA 3NULA 3ZVTA 1YLPA 4ME4A 3C4OA 5HAQA 4FSFA 2PU4A 5L07A 5FQQA 4S2NA 2Y59A 4FUWA 3GTCA 3NECA 4S2PA 3ULFA 3LR3A 1PZOA 1YLYA 4JBFA 1HVBA 4QB8A 2XK1A 2NUPC 2Y4AA 1OT6A 2VK3A 3DWKA 2B5RA 3V5MA 4C6YA 3GECA 2ZM0A 3UB7A 4ZJ1A 4HBTA 3OZHA 1OTAA 3OPHA 4PM6A 4R3BA 1BT5A 3QP2A 1ONHA 1YSPA 5EM0A 4II7A 4HQAA 3BM6A 4O0PA 2GDNA 3T1RA 3MZDA 2Q9MA 3NY4A 1HTZA 1RGYA 5U47A 3B47A 3UPOA 5EVIB 1W79A 4K08A 5AQAA 4N9KA 2QYBA 1T18A 2H10A 1CF0A 3U4LP 5DJTA 2GJ3A 2XD5A 1H8ZA 2CMNA 1JWZA 4MBKA 5E2HA 4HI4A 4EEUA 1K56A 4ARZA 3DAVA 3T4TA 3H82A 1V9YA 1WA9A 4IVIA 4X69A 4O01A 3WRZA 4KZ9A 2ZMAA 2C6WB 5CHJA 3Q82A 2Z2MB 3QP4A 2W3DA 4FH2A 4GLQA 3FWLA 3JVVA 2VGKA 3CAXA 1Q2QA 1FSWA 3VE4A 3VSLA 1H8MA 5EVLA 2EX9A 1K6RA 5CHUA 1RCJA 1EWZA 4GD8A 4WYYA 1UWNX 3WS2A 4GHIB 2WKQA 2Y91A 4KUKA 4RA7A 2VKSA 1AWIA 3ZFZA 4OOYA 5JYOA 2Y2HA 3ZCZA 3G2ZA 2XFTA 3BFEA 3GR2A 5DKLA 2Y2GA 3FV7A 1YLZA 5HAPA 4WEJA 1N9OA 2OLUA 2M7UA 4HEFA 1KGFA 2WYXA 2JC7A 3GVBA 5F83A 2K2NA 3W4PA 2HDRA 5A93A 4QHCA 4ID4A 2W1RA 5DF9A 2ZC6B 3G6OA 5CTMA 2JKTM 3OPLA 2I72A 3KYEA 1XPBA 1KE4A 1M6KA 3S7PA 2VV6A 1O7EA 4Y0TA 3LEZA 1CI9A 1BUEA 2XLNA 3FKVA 4BLMA 2JKRI 2L0WA 3NHQA 4IUHA 4MN7A 4UA6A 4BJPA 1YAXA 3T1XA 4E04A 1XJ4A 3P09A 4LCLA 2H0TA 2GZAA 2V2FF 3F1NA 2E8IA 3CPTB 4I3IA 2ZL1B 5GLDA 4QU3A 4JPMA 3D72A 3FG8A 2WGWA 1MC0A 1VM1A 3PBOA 4IHQA 3BLMA 1ZG6A 3BWLA 2VV8A 5AVFA 3ZG9B 1YMSA 3G31A 4OQIA 3N6IA 4DDSA 4IVKA 3FZCA 4MCWA 1D06A 1DY6A 4Y2FA 2RL3A 1RP5A 4GDNA 3UY6A 2P08A 4WZ4A 2A24A 2CC1A 5EPHA 3L7HA 5DKKA 3Q1FA 2V9AA 4LV2A 3IF6B 5FSRA 3ISGA 2XRNA 4JF5A 3OC2A 4G3KA 3C2WA 5FQJA 2PU2A 1G68A 3SH8A 4X68A 3H7WB 2QMIA 1STZA 3MXRA 4GHIA 3A0RA 4GNUA 1YLWA 2OWHA 3UNWA 5EOOA 4NXEA 3KSIA 3EGXC 1TS6A 4R70A 4JXVA 2FFYA 3PTEA 3S7OA 2H5SA 4BD0A 4NEED 1IOUA 3DTKA 3EGDC 3RTYA 2ZOIA 4O7DA 4ZDXA 1PZPA 3CJMA 5HARA 1K57C 4MN6A 4P6ZM 5FQKA 3VP3A 4WM9A 1CK3A 5KZHA 5HL6A 4UQIM 5IU1A 5DTSA 5FAOA 5A8BA 4P6ZS 3EOIA 3MMHA 3LR5A 4UQIS 1RGZA 2AVXA 4R4SA 2OWJA 3IT9A 4LRZE 3VOZA 2HZ5A 2ZQDA 4PM8A 3MQQA 5CEDA 1SKOB 5GHYA 3VE3A 1GHPA 4G3VA 1TS0A 2QKPA 1VEUA 4JGQA 2XFSA 3KSHA 3UMDA 4P0MA 1XJ3A 3F1PB 3PBNA 3RH8B 4D60A 4BENA 4YOFA 5F68A 4I39A 3VP4A 3ZHHA 4WF0A 5KSHA 5I94A 2Y79A 5FASA 4GS9B 1OTIA 5FAQA 1K57A 3UE6A 4NETA 1MBLA 2XQZA 2HDQA 1IKGA 3IF6A 5G4ZA 4DF6A 4PKYG 5J4EA 4HJ6A 2KLIA 3VFFA 1PWGA 5E43A 4KQDA 1LL5A 1QMFA 4KENB 3TJZC 3QP6A 1E4DA 3V67A 4RVAA 1SDEA 2EX2A 1N4OA 4XXRA 4R3JA 3IWIA 2EFUA 4EEPA 2PD7A 3UB6A 5TGFA 1F5MA 4UEYA 1JNUA 1UWPX 4LENA 4CLCC 4JGOA 3C7UA 3TSGA 4EUVA 1GSWA 5K5BA 1L0FA 3Q7VB 3ZG7B 5F82A 5EE8A 2WGVA 4QJGA 1VETB 4DKIA 4C3QA 1DJBA 4G3WA 1KOUA 2ZD8A 3HJKA 4BMWA 2DCFA 3SS4A 2Q9NA 1OJ5A 3HUOA 3A0VA 2B95A 3A3FA 4ZAMA 1SHVA 3V3RA 1CJFA 1I2WA 1BULA 2ZLYA 4NKPA 1P97A 4ZBEA 4ESPA 4JKTA 2JKTI 3E98A 5EOEA 4S2LA 3W4QA 2W3EA 5HDCA 2VGJA 3MSHA 3A3IA 1FILA 4KG2A 3BY9A 2ZBBA 2BG1A 3K2NA 2Y55A 4L0LA 4MNRA 4CQHA 1ZHHB 4ZJ2A 3GDIA 3OBFA 1IELA 4BWIA 3F1PA 1KGGA 3DBAA 4RQ9A 3UB9A 4EBNA 2PHYA 3A3DA 5EUAA 4GDBA 4JGRA 2XF3A 1KDSA 3ICYA 5AQ9A 4CLCA 5FA7A 3PAEA 4LV0A 2FFFB 4DDYA 2A49A 2JN7A 4E3IA 3QNBA 2L1MA 3HLDA 1K56D 4ZTKA 4WZ5C 1SDNA 3HLFA 3TW8A 1FR1A 1YSQA 5IHVA 5BOHA 4S2NC 3SH9A 2EXAA 1G6OA 4I5SA 4GOGA 1LT0A 2E8JA 3OLOA 4F3LB 1FIKA 1KVLA 3TG9A 4M3KA 1BLHA 2UWXA 3HREA 3DTEA 2DRWA 4P85A 1ESIA 4NXBA 3E2LA 3FPWA 1D1JA 3LR4A 3HUNA 5A90A 2EWWA 3M2JA 1N9NA 1J9MA 2K31A 3G35A 4B93A 4HOIA 3C7VA 1DP6A 3BFCA 3QP8A 2VZWA 1XGJA 3SH7A 3G30A 4B9OA 5HFOA 1W7FA 3B3XA 3MJQA 4KQQA 4MDZA 3IHAA 1Q2PA 3O87A 2I9VA 2ZM8A 4E3JA 2BASA 4N1XA 1A0KA 2Z2LB 4WZ5A 3RXWA 1W63Q 5DFYA 1E3UD 3CWFA 2ZQCA 4NG2A 1LLBA 4K91A 3VP2A 2X71A 1FR6A 4L9GA 1GA9A 4DXBA 4YNRA 1BYWA 1PI5A 5F5YA 1H8YA 3Q81A 4O8GA 3HUMA 2PBYA 2A3UA 3OCLA 2Y2QA 4LGWA 3KYQA 2ZOHA 3LIEA 4N92A 2P9VB 4N1HA 1L0GA 2Z6CA 4JXSA 4EERA 3T4OA 1M40A 3HLWA 4XUXA 2LB9A 3HLGA 3Q07A 1LHYA 3W8KA 5HPFA 5IS1A 1E25A 1DP9A 2YKHA 4S2KA 3S1YA 5E2FA 4UAAA 3MR0A 5EFWA 4E3MA 3EQVA 4LPZA 2O9BA 4R3AA 3ZG0A 2K7SA 5LBRA 1GHMA 3WWXA 4DN0A 4K0WA 2IWBA 2P7JA 4R23A 3BYDA 2QJ5A 3S7NA 2V20A 1GCEA 1TVFA 1SCWA 4Y3IA 4BBUA 2WADA 3W2ZA 5GL9A 1F98A 5EVEA 3NC8A 4DXCA 2XEPA 4LCMA 5CECA 3IX4A 5A91A 5EVIC 2IWCA 3JYIA 4B88A 3IH8A 1L3LA 4FCFA 1S4SA 4WELA 5FI6A 1JWVA 1FSYA 2WAEA 1SKFA 4I38A 2G7UA 3PAGA 3WS0A 4E6XA 4IBRA 5FEFA 4GJ4A 4FD8A 1VQQA 3FPVA 1IYSA 3IS2B 5AJGA 1PNEA 5AQBA 5FI7A 1O07A 3MFXA 3P98A 4BD1A 1F9IA 1PWCA 3LIAA 2X02A 3MKFA 5FDHA 3TRCA 3GQZA 3KSFA 2ACGA 2O9AA 1XP4A 2ZC4B 3HBRA 5HX9A 5FDSA 4CLCE 2WKEA 4R0QA 3NBLA 1YPRA 3BFGA 4ETZA 2V1BA 3PBTA 4Y5FA 2HP9A 4QPRA 5D3OA 2W3HA 1NY0A 2A2LA 4OPRA 5EVIA 2VV7A 4KZ8A 2QJ7A 3Q7ZA 5HWVA 4WMCA 3NDGA 1K25A 4L9FA 3R7WB 1BTLA 2OAQ1 4MLLA 2LB5A 2PYRA 2O99A 1LSVA 4JGPA 1L0EA 4EWFA 3LIDA 3IXHA 1I2SA 4X25A 2ZM2A 2W1TB 4R6LA 3KO6A 3T4LA 1XA1A 1KE0A 4WN5A 3V50A 1MKIA 2QHKA 3HJIA 3EWKA 1ES3A 5EECA 1IYQA 1ALQA 4LV1A 2PR6A 2O9CA 4X1LA 3T1QB 3P7NA 1OMEA 2Y2PA 4KG5A 5TR7A 2X01A 3HLCA 4XT2B 4P6BA 4K0XA 1I5QA 1JWPA 4OVDA 3RJUA 4HNBA 1YQSA 4Q8IA 1K0KA 3D4FA 4KZBA 1TDGA 5MC7A 3JPUA 4P87A 1S1ZA 1UGUA 4BQMA 4GZBA 3QP5A 3U2AA 1TEMA 5DTTA 4EQ1A 4HH2A 4WLAA 1WYCA 3KSGA 1D7EA 1QMEA 4OPZA 1L0DA 4HHDA 3BY8A 3IF6C 3PHYA 4E3OA 1G5UA 2Y2MA 5AQ7A 3GSGA 4L9EA 3MXQA 5FI2A 3L9KA 4PPRA 4X55A 4E3LA 2J8YA 5L2FA 5C5KA 4Q0HA 4LLOB 4CLCD 4JXWA 1MWUA 1T1BA 4IUKA 1XFNA 1KDWA 1GA0A 1EW0A 1S1YA 5DF7A 3CPTA 2Y2OA 1VB6A 1NLZA 2ZL1A 2JCHA 2OLVA 3K3CA 3BQAA 4B4XA 1YLTA 3E4OA 1MXOA 4IEDA 5I5LA 1H0MA 2OAP1 3F1OB 5DFXA 2ZC7A 4X53A 1IEMA 3R4KA 1MZUA 2W27A 3O3VA 2W1TA 4F94A 5HAIA 2PT7A 4QWOA 2BLSA 1T19A 4MMNA 3I7JA 1BLSA 1NYYA 3ITAA 3B42A 2V0UA 4HY8A 1XKZA 4EXOA 2KDKA 4E6WA 4Y0UA 4EUZA 2M1CA 1ACFA 4GD6A 3RXXA 3N8RA 1HZOA 3UB5P 5HD5A 1S0WA 3A3EA 3DW0A 3FC7A 1LSXA 3H7WA 4WBGA 4OP5A 4H6JB 3GRJA 1NYMA 2WZZA 2Q0OA 3EEAA 3OOVA 1S67L 1W8QA 5FEGA 5HSQA 3C4PA 1NJ4A 3NDEA 4OOMA 1XGIA 3DTMA 4OLGA 4D2OA 3UB8A 1Y54A 2EXBA 3LIBA 2XA7M 3C5AA 1IYPA 4DE0A 5IT5A 5HWWA 3QP1A 4Y0OA 3T4SA 2HDUA 2ZC3B 3LGOA 4PM5A 1BLPA 4Q0IA 2EA9A 4B4ZA 2JHEA 4JF6A 2JKGA 1XXMA 1YM1A 3PYPA 4EU0A 5M19A 5CXWA 2XA7S 1EROA 3SZTA 3UDXA 4PHTA 1ZG4A 2EX8A 1LL9A 3CLOA 3M6HA 4N9LA 2ZQ7A 4HH3A 5F6AA 3VFHA 3PBQA 2H0YA 3C38A 4X56A 5L10A 2PD8A 1SKOA 3VOLA 1TD5A 2V8FA 4S2IA 4QY6A 4EBLA 4WL9A 3C8CA 1OTDA 5CRFA 2PRFA 3UE1A 3MFDA 2VGLM 4HIAA 3IBJA 4GW9A 1P0ZA 3ZVWA 3F1OA 2HDSA 3UE3A 1FCMA 3LCEA 5DF8A 5GHZA 3N4IA 2VGLS 2EFXA 4FH4A 1KGEA 3BFFA 2J3TC 3LI9A 4GS9A 3FYZA 2INWA 1MPLA 2HPBA 3UDIA 4QD4A 2ZQAA 4YWZA 2XROA 5GLCA 1OPXA 5G4YA 3CG5A 4NXFA 1T1AA 2JKRM 3OPRA 4EESA 4IJGA 4AFIA 3D9YA 1HD8A 4GCZA 5JYPA 2VJWA 4OLDA 2J3WA 3BLSA 4A5RA 1WE4A 3VSKA 4GN2A 3VV4A 2JBFA 4DJ3A 3K3DA 3C30A 1TDLA 3S7QA 4KG6A 4KZAA 2EWVA 3Q7VA 1K55A 5A92A 2XSSA 2B18A 2M7VA 3UE0A 4ARZB 1S66L 1VETA 2KX6A 3LEQA 5CERA 3H82B 3IHBA 2BTFP 3QNCA 3ZG8B 3UPNA 5HZHA 5HW3A 1T1CA 5CHMA 4E3KA 3E4PA 5EV0A 4DRTA 4KZ4A 3NI9A 2D01A 2R9XA 3ZNYA 4ZRRA 3NOUC 3MS6A 2QZ6A 5TBMB 1NRFA 2J9PA 1LL8A 4RX2A 2HP5A 3WS4A 4WUJA 1KVMA 1F2KA 3VP0A 2MJ6A 4BL2A 3A3JA 4X1MA 4I3JA 3IWOA 4KQOA 4S2OA 1TS8A 3MZFA 3T4KA 2OOLA 4YINA 1Z09A 2H28A 5EVID 4U0TA 5GHXA 2VX8A 4GKUA 4PM7A 4WMCD 1S4RA 3LUQA 3LICA 2D02A 4U0XA 3UMEA 1XA7A 5E2GA 2HJ9C 4CJNA 4HP4A 1PWDA 3VP1A 1CEFA 3ITBA 4LRYC 5J8XA 1MKMA 3NIAA 3VMAA 3LFVA 4M4XA 4RYEA 2WGIA 4HBUA 3E0YA 2O0YA 4OH0A 3IX8A 3LY3A 3IF5A 5FQIA 4HP9A 1YMXA 1PW8A 4LRXC 4F3LA 3IQAA 4Y7PA 1LI9A 3G2YA 1ES4A 3F1NB 3DWZA 1G6AA 1GHIA 4XUZA 1K4EA 3BRMA 2WGWB 1K4FA 3A0SA 1JTDA 1KE3A 3AGFA 1K54C 2G2WA 4Z9QA 5GLAA 1FCOA 4E3NA 4KZ3A 4EBPA 1HLUP 4EV4A 5CX7A 4DMZA 3CUEC 2J7VA 2WAFA 2Z6DA 3IX3A 5TFQA 3LIFA 1MWTA 2FZ0A 2A24B 1DJAA 2WKHA 4OP8A 4R38A 1G28A 5KMWA 4Q0JA 3TOIA 4UA7A 1ZC2A 5TBMA 4MBFA 5DVAA 3NOPC 1MY8A 1MWSA 1FCNA 2R9WA 4LFUA 5TJJA
chains in the Genus database with same CATH topology
4EQ1A 5KIZA 4HH2A 4WLAA 2HJEA 2PYPA 4G3WA 1KOUA 3HJKA 2YKFA 4BMWA 3BJNA 3H9WA 4ME4A 1OJ5A 3KSGA 3A0VA 5HDDA 1D7EA 4FSFA 4HHDA 1IFQA 3BY8A 4NKPA 1P97A 3PHYA 3NJAA 2JKTI 3E98A 4HJ4A 4L9EA 3MXQA 2ZMVA 4NXGA 4Z1WA 4DJ2A 2W3EA 5HDCA 1DRMA 3ULFA 3LI8A 3LR3A 5C5KA 4Q0HA 4LLOB 2WKRA 2NUPC 3BY9A 4CLCD 2ZBBA 1OT6A 1T1BA 4IUKA 1XFNA 2J80A 3K2NA 2V0WA 4L0LA 3GECA 3UB7A 3MQ0A 3O5YA 3CUEA 4CQHA 1EW0A 1ZHHB 1OTAA 1S1YA 3GDIA 3OBFA 1VB6A 1NLZA 5J7EA 4BWIA 3F1PA 4RQ9A 3DBAA 3UB9A 3K3CA 2PHYA 1YSPA 3BQAA 3E4OA 4JGRA 5I5LA 3ICYA 1X0OA 4II7A 3T4JA 4CLCA 4HQAA 2OAP1 4O0PA 3F1OB 5DFXA 5FL3A 3R4KA 1MZUA 2JN7A 2W27A 2W1TA 3B47A 2L1MA 2ZMFA 4EETB 2PT7A 4K08A 3B33A 1GSVA 1T19A 2QYBA 1T18A 1YSQA 1GSXA 3TW8A 4MMNA 3B42A 2V0UA 4HY8A 5DJTA 1NLYA 4MN5A 2GJ3A 4EXOA 1G6OA 2KDKA 2VA0A 4I5SA 1LT0A 2HV1A 2M1CA 2CMNA 3OLOA 3BW6A 4HI4A 4EEUA 5HD5A 4F3LB 4ARZA 3FC7A 1LSXA 3H7WA 3PXPA 3T4TA 3H82A 1V9YA 3TE8A 4H6JB 1WA9A 2HF6A 4O01A 4NXBA 2DMWA 3FPWA 3EEAA 3OOVA 1S67L 2W3DA 3LR4A 4GLQA 2EWWA 3JVVA 1N9NA 5HSQA 3CAXA 2K31A 3BQ8A 4OOMA 4B93A 4HOIA 1DP6A 3VE4A 3ZQ5A 1H8MA 3UB8A 3LIBA 5HPIA 3IS2A 2NUTC 2VZWA 2XA7M 1UWNX 4GHIB 1XJ6A 5IT5A 2WKQA 5HWWA 3T4SA 4KUKA 4B9OA 3MJQA 1ZTUA 2EA9A 4MDZA 4Q0IA 2JHEA 3PYPA 4EU0A 2VKSA 2I9VA 2BASA 2XA7S 1W63Q 1P9WA 4PHTA 5DFYA 1P9RA 5DKLA 3CWFA 3CLOA 5HD3A 4HH3A 5F6AA 4HJ3A 1W63M 5J3WA 3CI6A 3PBQA 4WEJA 1N9OA 4L9GA 3C38A 3E4QA 2M7UA 4YNRA 2PD8A 1TS7A 1BYWA 2K2NA 5F5YA 4O8GA 3VOLA 2WKPA 1TD5A 2P04A 3OCLA 3KYQA 2ZOHA 2W1RA 3OCNA 3LIEA 2L4RA 4WL9A 5DF9A 3C8CA 1OTDA 3G6OA 2JKTM 2VGLM 4HIAA 3IBJA 1TF1A 2Z6CA 3R7WA 4GW9A 1P0ZA 4EERA 3F1OA 3T4OA 3UE3A 3S7PA 2VV6A 5L8MA 2LB9A 2VGLS 2JKRI 2L0WA 3NHQA 4IUHA 5HPFA 4MN7A 4BJPA 5IS1A 1YAXA 3PBSA 4E04A 1XJ4A 3MQOA 2J3TC 1DP9A 1NWZA 3LI9A 4GS9A 2GZAA 2V1AA 3F1NA 2INWA 2YKHA 4I3IA 3D72A 3FG8A 4YWZA 1MC0A 2XROA 3PBOA 3MR0A 5EFWA 1OPXA 3EQVA 4LPZA 5G4YA 2O9BA 2W3GA 4IHQA 4R3AA 4CLCB 2K7SA 4WEKA 5LBRA 4NXFA 1T1AA 3BWLA 2VV8A 3NOTC 5AVFA 2JKRM 2VEAA 4EESA 1V9ZA 4IJGA 4AFIA 2R78A 4DN0A 4XT2A 4GCZA 4MCWA 2VJWA 5F69A 2P7JA 2J3WA 1D06A 2QWSA 4Y2FA 1OT9A 3VV4A 2HGVA 2QJ5A 3S7NA 2IA2A 4PAUA 2P08A 4DJ3A 2A24A 4Y3IA 3K3DA 5DKKA 2GX5A 3C30A 2V9AA 2VLGA 4BBUA 3W2ZA 3S7QA 5HDSA 1F98A 1NRJA 2XRNA 2J3TD 3OC2A 4G3KA 3C2WA 2EWVA 3EQUA 2XSSA 4EW7A 2B18A 2M7VA 4ARZB 1S66L 3H7WB 2KX6A 1STZA 4GHIA 3T50A 3A0RA 3H82B 2OWHA 1XJ2A 2B02A 1S4SA 4WELA 5HZHA 1T1CA 3E4PA 4NXEA 3KSIA 2GNXA 3EGXC 4I38A 1TS6A 4R70A 2D01A 2W0NA 4PKYA 2G7UA 3KX0X 3NOUC 4ZRRA 3S7OA 4NEED 1IOUA 4GJ4A 5TBMB 3EGDC 1LL8A 3FPVA 4WUJA 3IS2B 5AJGA 2ZOIA 3RTYA 2MJ6A 4MN6A 4P6ZM 3MFXA 4I3JA 1F9IA 2W3FA 4BBVA 4KQOA 5HL6A 3LIAA 1TS8A 2PDRA 3T4KA 4UQIM 5IU1A 2OOLA 3TRCA 5A8BA 3CITA 3LYXA 3KSFA 4P6ZS 2H28A 3EOIA 2O9AA 2VX8A 3MMHA 3HCYA 3LR0A 3LR5A 4UQIS 3PBRA 3IBRA 1YKDA 1S4RA 2PR5A 1DP8A 2OWJA 4I3AA 3LUQA 3LICA 4CLCE 4LRZE 2D02A 3UMEA 2HJ9C 3MQQA 4ETZA 1H3QA 4BBTA 2V1BA 4HP4A 3VE3A 3PBTA 4G3VA 4Y5FA 1TS0A 4LRYC 4QPRA 2W3HA 1MKMA 1OTBA 1XFQA 2A2LA 2QKPA 2VV7A 4JGQA 3PR6A 2QJ7A 3KSHA 3KYZA 5HWVA 3UMDA 3LFVA 4M4XA 1XJ3A 4ETXA 3F1PB 3E0YA 2O0YA 3PBNA 3ZYTA 3RH8B 4L9FA 3R7WB 3P01A 4YOFA 4HP9A 2OAQ1 5F68A 4I39A 2LB5A 2PYRA 2O99A 4WF0A 5AVEA 5KSHA 3MF0A 4LRXC 1LSVA 4F3LA 4JGPA 3LIDA 1LSWA 2Y79A 1VHMA 2FH5A 2W1TB 1OTIA 4GS9B 4H6JA 3F1NB 4R6LA 3KO6A 3T4LA 3UE6A 4KUOA 4WN5A 2QHKA 3HJIA 5G4ZA 3A0SA 3EWKA 4PKYG 5J4EA 4HJ6A 2KLIA 1N9LA 3SW1A 4KQDA 2PR6A 1Y28A 2O9CA 3TJZC 3P7NA 3V67A 5HWTA 4XT2B 5CX7A 4FOFA 3CUEC 4DMZA 2KOIA 5DJUA 3JVUA 4EEPA 2Z6DA 4HNBA 2PD7A 3LIFA 3UB6A 1F5MA 3T4QA 4OOLA 4UEYA 1JNUA 2FZ0A 2A24B 3RFBA 1UWPX 3D3OA 1OTEA 4R38A 1G28A 5MC7A 4CLCC 4JGOA 4Q0JA 4EUVA 1S1ZA 1ODVA 1UGUA 1GSWA 3EEHA 5K5BA 5TBMA 3NOPC 1OJGA 2Y8HA 3U2AA 5TJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQ1 A;  5KIZ A;  4HH2 A;  4WLA A;  2PYP A;  1KOU A;  3HJK A;  2YKF A;  3H9W A;  1OJ5 A;  3A0V A;  5HDD A;  1D7E A;  4HHD A;  3BY8 A;  1P97 A;  3PHY A;  3NJA A;  4HJ4 A;  4L9E A;  3MXQ A;  4NXG A;  4DJ2 A;  5HDC A;  1DRM A;  3ULF A;  3LI8 A;  4LLO B;  2WKR A;  3BY9 A;  2ZBB A;  1OT6 A;  1T1B A;  1XFN A;  2J80 A;  2V0W A;  3GEC A;  3UB7 A;  1EW0 A;  1OTA A;  1S1Y A;  3GDI A;  1VB6 A;  5J7E A;  3F1P A;  4RQ9 A;  3UB9 A;  3K3C A;  2PHY A;  3E4O A;  4JGR A;  5I5L A;  3ICY A;  1X0O A;  4HQA A;  3F1O B;  1MZU A;  2JN7 A;  2W27 A;  2L1M A;  4EET B;  4K08 A;  3B33 A;  1GSV A;  1T19 A;  1T18 A;  1GSX A;  2V0U A;  4HY8 A;  5DJT A;  4MN5 A;  2GJ3 A;  4EXO A;  2KDK A;  4I5S A;  1LT0 A;  2HV1 A;  2M1C A;  2CMN A;  3OLO A;  4HI4 A;  4EEU A;  5HD5 A;  4F3L B;  3FC7 A;  1LSX A;  3H7W A;  3H82 A;  1V9Y A;  4H6J B;  1WA9 A;  4NXB A;  1S67 L;  1N9N A;  5HSQ A;  3CAX A;  4HOI A;  1DP6 A;  3VE4 A;  3ZQ5 A;  3UB8 A;  3LIB A;  3IS2 A;  1UWN X;  4GHI B;  1XJ6 A;  2WKQ A;  5HWW A;  4KUK A;  4B9O A;  3MJQ A;  2EA9 A;  2JHE A;  3PYP A;  2I9V A;  2BAS A;  5DKL A;  3CWF A;  3CLO A;  5HD3 A;  4HH3 A;  5F6A A;  4HJ3 A;  5J3W A;  1N9O A;  4L9G A;  3E4Q A;  2PD8 A;  1TS7 A;  1BYW A;  5F5Y A;  3VOL A;  2WKP A;  2ZOH A;  3LIE A;  2L4R A;  4WL9 A;  3C8C A;  1OTD A;  3G6O A;  4HIA A;  2Z6C A;  4GW9 A;  1P0Z A;  4EER A;  3F1O A;  2VV6 A;  2L0W A;  3NHQ A;  5IS1 A;  4E04 A;  1XJ4 A;  3MQO A;  1DP9 A;  1NWZ A;  3LI9 A;  4GS9 A;  2V1A A;  3F1N A;  2INW A;  2YKH A;  4I3I A;  3D72 A;  3FG8 A;  4YWZ A;  3MR0 A;  5EFW A;  4LPZ A;  5G4Y A;  4R3A A;  2K7S A;  4NXF A;  1T1A A;  3BWL A;  2VV8 A;  3NOT C;  5AVF A;  2VEA A;  4EES A;  1V9Z A;  2R78 A;  4XT2 A;  4GCZ A;  5F69 A;  2P7J A;  1D06 A;  2QWS A;  1OT9 A;  2QJ5 A;  4DJ3 A;  2A24 A;  3K3D A;  5DKK A;  2V9A A;  2VLG A;  4BBU A;  5HDS A;  1F98 A;  3C2W A;  4EW7 A;  1S66 L;  3H7W B;  2KX6 A;  4GHI A;  3T50 A;  3A0R A;  3H82 B;  2OWH A;  1XJ2 A;  2B02 A;  1S4S A;  5HZH A;  1T1C A;  3E4P A;  4NXE A;  4I38 A;  1TS6 A;  4R70 A;  2D01 A;  2W0N A;  4PKY A;  3KX0 X;  3NOU C;  5TBM B;  1LL8 A;  4WUJ A;  3IS2 B;  3RTY A;  2ZOI A;  4MN6 A;  3MFX A;  4I3J A;  1F9I A;  4BBV A;  3LIA A;  1TS8 A;  2PDR A;  5IU1 A;  2OOL A;  5A8B A;  3LYX A;  2H28 A;  3IBR A;  1S4R A;  2PR5 A;  1DP8 A;  2OWJ A;  4I3A A;  3LUQ A;  3LIC A;  4LRZ E;  2D02 A;  3UME A;  3MQQ A;  4BBT A;  2V1B A;  4HP4 A;  3VE3 A;  1TS0 A;  4LRY C;  1OTB A;  1XFQ A;  2QKP A;  2VV7 A;  4JGQ A;  2QJ7 A;  5HWV A;  3UMD A;  4M4X A;  1XJ3 A;  3F1P B;  3RH8 B;  4L9F A;  4HP9 A;  5F68 A;  4I39 A;  2PYR A;  4WF0 A;  5AVE A;  4LRX C;  1LSV A;  4F3L A;  4JGP A;  3LID A;  1LSW A;  4GS9 B;  1OTI A;  4H6J A;  3F1N B;  4R6L A;  3UE6 A;  4KUO A;  4WN5 A;  2QHK A;  3HJI A;  5G4Z A;  3A0S A;  3EWK A;  4PKY G;  5J4E A;  4HJ6 A;  1N9L A;  3SW1 A;  4KQD A;  2PR6 A;  1Y28 A;  3P7N A;  5HWT A;  4XT2 B;  5DJU A;  4EEP A;  2Z6D A;  4HNB A;  2PD7 A;  3LIF A;  3UB6 A;  1JNU A;  2A24 B;  1UWP X;  4R38 A;  1OTE A;  1G28 A;  4JGO A;  1S1Z A;  1ODV A;  1UGU A;  1GSW A;  3EEH A;  5TBM A;  3NOP C;  1OJG A; 
#chains in the Genus database with same CATH topology
 3LO7 A;  4UHU A;  2HJE A;  2PYP A;  2C5W B;  4OPY A;  2YKF A;  3BJN A;  1AXB A;  3H9W A;  4NK3 A;  3V39 A;  4KZ5 A;  2Y2I A;  5HDD A;  4Y15 A;  1IFQ A;  2JKF A;  4X6T A;  5CTN A;  2ZJ9 A;  4MEZ A;  3NJA A;  2P9V A;  3GV9 A;  4HJ4 A;  1W5D A;  2ZMV A;  4NXG A;  4Z1W A;  4DJ2 A;  3LY4 A;  1ONG A;  1DRM A;  1K54 A;  3LI8 A;  4PMA A;  2WKR A;  5CGS A;  2J80 A;  5GLB A;  2V0W A;  1E3U A;  2JE5 A;  3MQ0 A;  3O5Y A;  3CUE A;  5J7E A;  4H8R A;  3AGD A;  5E2E A;  1U60 A;  1X0O A;  3T4J A;  3MXS A;  5L09 A;  1IYO A;  3CMZ A;  5FL3 A;  4YFM A;  3ZG5 A;  1K6S A;  2Y2J A;  1W8Y A;  3CZD A;  1PI4 A;  2ZMF A;  4EET B;  2V1Z A;  3HLE A;  3ZDJ A;  5DTK A;  4OQH A;  1VEU B;  1PW1 A;  1JVJ A;  3B33 A;  4OKP A;  1GSV A;  1C3B A;  1J3W A;  1GSX A;  4R4R A;  1XX2 A;  2WUQ A;  2XR0 A;  1NLY A;  4MN5 A;  4KZ7 A;  4QY5 A;  3FKW A;  2VA0 A;  2HV1 A;  3O88 A;  5HL1 A;  1ZKJ A;  3BW6 A;  4HES A;  3ZNT A;  3PXP A;  3TE8 A;  3G32 A;  2HF6 A;  4IBX A;  1JTG A;  2DMW A;  4C75 A;  1S6R A;  3BQ8 A;  3ZQ5 A;  3E2K A;  5HPI A;  3N8L A;  3IS2 A;  2XDM A;  2NUT C;  3WS5 A;  1XJ6 A;  4LV3 A;  1CI8 A;  1ZTU A;  2XGN A;  4PM9 A;  2PBD P;  2WZX A;  1P9W A;  3UPP A;  1P9R A;  5FQ9 A;  2HP6 A;  4JXG A;  1EI5 A;  5HD3 A;  3N7W A;  4HJ3 A;  1W63 M;  1NXY A;  2WKI A;  5J3W A;  3CI6 A;  3E4Q A;  4FTX A;  2G2U A;  1TS7 A;  3G34 A;  4S2M A;  5CGX A;  2WKP A;  1BZA A;  5CGW A;  2P04 A;  3G4P A;  3T12 B;  1Z6F A;  3OCN A;  2L4R A;  1LI0 A;  3IXB A;  1TF1 A;  3R7W A;  1ES5 A;  2ZC5 B;  2Y2K A;  1CQA A;  3WRT A;  5L8M A;  4UA9 A;  3IXG A;  4JF4 A;  3DTI A;  5M18 A;  2XD1 A;  1N9B A;  3PBS A;  3S22 A;  2IWD A;  3MQO A;  3IWQ A;  4DE3 A;  1NWZ A;  5KSC A;  2V1A A;  1H5X A;  3M6B A;  3BFD A;  3T1S A;  4Y17 A;  4JLF A;  3SOI A;  4Y13 A;  1ERM A;  2W3G A;  4CLC B;  2WK0 A;  4WEK A;  5FAT A;  2Y2N A;  3NOT C;  2VEA A;  1V9Z A;  2R78 A;  4XT2 A;  5FAP A;  3MKE A;  5F69 A;  3UDF A;  2QWS A;  1OT9 A;  2HGV A;  2IA2 A;  3BEC A;  3WS1 A;  5M1A A;  4PAU A;  3V3S A;  1WYB A;  2GX5 A;  2VLG A;  4OON A;  5HDS A;  1NRJ A;  2J3T D;  3SS3 A;  1FQG A;  1PRQ A;  3BEB A;  3EQU A;  4EW7 A;  3W4O A;  3T50 A;  3VOY A;  1XJ2 A;  2B02 A;  3SS5 A;  3UO9 A;  4S2J A;  5CEB A;  2J9O A;  2GNX A;  4R1G A;  3NCK A;  2W0N A;  4PKY A;  3KX0 X;  2P74 A;  4ZJ3 A;  2Y2L A;  4OQ0 A;  3QHY A;  1NZU A;  5F1F A;  3OPP A;  1ES2 A;  1BLC A;  4CPK A;  2W3F A;  4BBV A;  1DJC A;  2ZQ8 A;  4KZ6 A;  2PDR A;  3HVF A;  4MBH A;  3CIT A;  3LYX A;  1ERQ A;  2UV0 E;  1PYY A;  4KQR A;  4BL3 A;  3HCY A;  3LR0 A;  1K55 C;  2RCX A;  3PBR A;  3IBR A;  4U3T A;  1YKD A;  2PR5 A;  1IKI A;  1NZO A;  5G18 A;  1DP8 A;  4I3A A;  4OQG A;  3MZE A;  5FQM A;  1H3Q A;  4BBT A;  4RX3 A;  1L2S A;  2QPN A;  1OTB A;  1XFQ A;  1ESU A;  1Y4O A;  3PR6 A;  1CEG A;  1BSG A;  3KYZ A;  1FOF A;  1SZV A;  1MWR A;  4ETX A;  2ZQ9 A;  3ZYT A;  3P01 A;  3AGE A;  4OPQ A;  1K38 A;  5AVE A;  3MF0 A;  3S4X A;  1YT4 A;  4EQI A;  3IH9 A;  1LSW A;  1VHM A;  2FH5 A;  4H6J A;  3UN7 A;  3CHW P;  5EM1 A;  3HL9 A;  4KUO A;  3MBZ A;  4DE2 A;  1PFL A;  1YLJ A;  2XH9 A;  1N9L A;  2EX6 A;  3SW1 A;  5F1G A;  1Y28 A;  2OSU A;  5HWT A;  4FOF A;  3ZGA B;  2KOI A;  5DJU A;  3M2K A;  3JVU A;  3T4Q A;  4OOL A;  3HLB A;  3RFB A;  3D3O A;  4GB7 A;  1OTE A;  2OV5 A;  1ODV A;  3EEH A;  1OJG A;  2Y8H A;  4DE1 A;  3IXD A;  5KIZ A;  2PAV P;  3O86 A;  1PIO A;  2DNS A;  3N8S A;  2V8C A;  3GMW A;  3NUL A;  3ZVT A;  1YLP A;  4ME4 A;  3C4O A;  5HAQ A;  4FSF A;  2PU4 A;  5L07 A;  5FQQ A;  4S2N A;  2Y59 A;  4FUW A;  3GTC A;  3NEC A;  4S2P A;  3ULF A;  3LR3 A;  1PZO A;  1YLY A;  4JBF A;  1HVB A;  4QB8 A;  2XK1 A;  2NUP C;  2Y4A A;  1OT6 A;  2VK3 A;  3DWK A;  2B5R A;  3V5M A;  4C6Y A;  3GEC A;  2ZM0 A;  3UB7 A;  4ZJ1 A;  4HBT A;  3OZH A;  1OTA A;  3OPH A;  4PM6 A;  4R3B A;  1BT5 A;  3QP2 A;  1ONH A;  1YSP A;  5EM0 A;  4II7 A;  4HQA A;  3BM6 A;  4O0P A;  2GDN A;  3T1R A;  3MZD A;  2Q9M A;  3NY4 A;  1HTZ A;  1RGY A;  5U47 A;  3B47 A;  3UPO A;  5EVI B;  1W79 A;  4K08 A;  5AQA A;  4N9K A;  2QYB A;  1T18 A;  2H10 A;  1CF0 A;  3U4L P;  5DJT A;  2GJ3 A;  2XD5 A;  1H8Z A;  2CMN A;  1JWZ A;  4MBK A;  5E2H A;  4HI4 A;  4EEU A;  1K56 A;  4ARZ A;  3DAV A;  3T4T A;  3H82 A;  1V9Y A;  1WA9 A;  4IVI A;  4X69 A;  4O01 A;  3WRZ A;  4KZ9 A;  2ZMA A;  2C6W B;  5CHJ A;  3Q82 A;  2Z2M B;  3QP4 A;  2W3D A;  4FH2 A;  4GLQ A;  3FWL A;  3JVV A;  2VGK A;  3CAX A;  1Q2Q A;  1FSW A;  3VE4 A;  3VSL A;  1H8M A;  5EVL A;  2EX9 A;  1K6R A;  5CHU A;  1RCJ A;  1EWZ A;  4GD8 A;  4WYY A;  1UWN X;  3WS2 A;  4GHI B;  2WKQ A;  2Y91 A;  4KUK A;  4RA7 A;  2VKS A;  1AWI A;  3ZFZ A;  4OOY A;  5JYO A;  2Y2H A;  3ZCZ A;  3G2Z A;  2XFT A;  3BFE A;  3GR2 A;  5DKL A;  2Y2G A;  3FV7 A;  1YLZ A;  5HAP A;  4WEJ A;  1N9O A;  2OLU A;  2M7U A;  4HEF A;  1KGF A;  2WYX A;  2JC7 A;  3GVB A;  5F83 A;  2K2N A;  3W4P A;  2HDR A;  5A93 A;  4QHC A;  4ID4 A;  2W1R A;  5DF9 A;  2ZC6 B;  3G6O A;  5CTM A;  2JKT M;  3OPL A;  2I72 A;  3KYE A;  1XPB A;  1KE4 A;  1M6K A;  3S7P A;  2VV6 A;  1O7E A;  4Y0T A;  3LEZ A;  1CI9 A;  1BUE A;  2XLN A;  3FKV A;  4BLM A;  2JKR I;  2L0W A;  3NHQ A;  4IUH A;  4MN7 A;  4UA6 A;  4BJP A;  1YAX A;  3T1X A;  4E04 A;  1XJ4 A;  3P09 A;  4LCL A;  2H0T A;  2GZA A;  2V2F F;  3F1N A;  2E8I A;  3CPT B;  4I3I A;  2ZL1 B;  5GLD A;  4QU3 A;  4JPM A;  3D72 A;  3FG8 A;  2WGW A;  1MC0 A;  1VM1 A;  3PBO A;  4IHQ A;  3BLM A;  1ZG6 A;  3BWL A;  2VV8 A;  5AVF A;  3ZG9 B;  1YMS A;  3G31 A;  4OQI A;  3N6I A;  4DDS A;  4IVK A;  3FZC A;  4MCW A;  1D06 A;  1DY6 A;  4Y2F A;  2RL3 A;  1RP5 A;  4GDN A;  3UY6 A;  2P08 A;  4WZ4 A;  2A24 A;  2CC1 A;  5EPH A;  3L7H A;  5DKK A;  3Q1F A;  2V9A A;  4LV2 A;  3IF6 B;  5FSR A;  3ISG A;  2XRN A;  4JF5 A;  3OC2 A;  4G3K A;  3C2W A;  5FQJ A;  2PU2 A;  1G68 A;  3SH8 A;  4X68 A;  3H7W B;  2QMI A;  1STZ A;  3MXR A;  4GHI A;  3A0R A;  4GNU A;  1YLW A;  2OWH A;  3UNW A;  5EOO A;  4NXE A;  3KSI A;  3EGX C;  1TS6 A;  4R70 A;  4JXV A;  2FFY A;  3PTE A;  3S7O A;  2H5S A;  4BD0 A;  4NEE D;  1IOU A;  3DTK A;  3EGD C;  3RTY A;  2ZOI A;  4O7D A;  4ZDX A;  1PZP A;  3CJM A;  5HAR A;  1K57 C;  4MN6 A;  4P6Z M;  5FQK A;  3VP3 A;  4WM9 A;  1CK3 A;  5KZH A;  5HL6 A;  4UQI M;  5IU1 A;  5DTS A;  5FAO A;  5A8B A;  4P6Z S;  3EOI A;  3MMH A;  3LR5 A;  4UQI S;  1RGZ A;  2AVX A;  4R4S A;  2OWJ A;  3IT9 A;  4LRZ E;  3VOZ A;  2HZ5 A;  2ZQD A;  4PM8 A;  3MQQ A;  5CED A;  1SKO B;  5GHY A;  3VE3 A;  1GHP A;  4G3V A;  1TS0 A;  2QKP A;  1VEU A;  4JGQ A;  2XFS A;  3KSH A;  3UMD A;  4P0M A;  1XJ3 A;  3F1P B;  3PBN A;  3RH8 B;  4D60 A;  4BEN A;  4YOF A;  5F68 A;  4I39 A;  3VP4 A;  3ZHH A;  4WF0 A;  5KSH A;  5I94 A;  2Y79 A;  5FAS A;  4GS9 B;  1OTI A;  5FAQ A;  1K57 A;  3UE6 A;  4NET A;  1MBL A;  2XQZ A;  2HDQ A;  1IKG A;  3IF6 A;  5G4Z A;  4DF6 A;  4PKY G;  5J4E A;  4HJ6 A;  2KLI A;  3VFF A;  1PWG A;  5E43 A;  4KQD A;  1LL5 A;  1QMF A;  4KEN B;  3TJZ C;  3QP6 A;  1E4D A;  3V67 A;  4RVA A;  1SDE A;  2EX2 A;  1N4O A;  4XXR A;  4R3J A;  3IWI A;  2EFU A;  4EEP A;  2PD7 A;  3UB6 A;  5TGF A;  1F5M A;  4UEY A;  1JNU A;  1UWP X;  4LEN A;  4CLC C;  4JGO A;  3C7U A;  3TSG A;  4EUV A;  1GSW A;  5K5B A;  1L0F A;  3Q7V B;  3ZG7 B;  5F82 A;  5EE8 A;  2WGV A;  4QJG A;  1VET B;  4DKI A;  4C3Q A;  1DJB A;  4G3W A;  1KOU A;  2ZD8 A;  3HJK A;  4BMW A;  2DCF A;  3SS4 A;  2Q9N A;  1OJ5 A;  3HUO A;  3A0V A;  2B95 A;  3A3F A;  4ZAM A;  1SHV A;  3V3R A;  1CJF A;  1I2W A;  1BUL A;  2ZLY A;  4NKP A;  1P97 A;  4ZBE A;  4ESP A;  4JKT A;  2JKT I;  3E98 A;  5EOE A;  4S2L A;  3W4Q A;  2W3E A;  5HDC A;  2VGJ A;  3MSH A;  3A3I A;  1FIL A;  4KG2 A;  3BY9 A;  2ZBB A;  2BG1 A;  3K2N A;  2Y55 A;  4L0L A;  4MNR A;  4CQH A;  1ZHH B;  4ZJ2 A;  3GDI A;  3OBF A;  1IEL A;  4BWI A;  3F1P A;  1KGG A;  3DBA A;  4RQ9 A;  3UB9 A;  4EBN A;  2PHY A;  3A3D A;  5EUA A;  4GDB A;  4JGR A;  2XF3 A;  1KDS A;  3ICY A;  5AQ9 A;  4CLC A;  5FA7 A;  3PAE A;  4LV0 A;  2FFF B;  4DDY A;  2A49 A;  2JN7 A;  4E3I A;  3QNB A;  2L1M A;  3HLD A;  1K56 D;  4ZTK A;  4WZ5 C;  1SDN A;  3HLF A;  3TW8 A;  1FR1 A;  1YSQ A;  5IHV A;  5BOH A;  4S2N C;  3SH9 A;  2EXA A;  1G6O A;  4I5S A;  4GOG A;  1LT0 A;  2E8J A;  3OLO A;  4F3L B;  1FIK A;  1KVL A;  3TG9 A;  4M3K A;  1BLH A;  2UWX A;  3HRE A;  3DTE A;  2DRW A;  4P85 A;  1ESI A;  4NXB A;  3E2L A;  3FPW A;  1D1J A;  3LR4 A;  3HUN A;  5A90 A;  2EWW A;  3M2J A;  1N9N A;  1J9M A;  2K31 A;  3G35 A;  4B93 A;  4HOI A;  3C7V A;  1DP6 A;  3BFC A;  3QP8 A;  2VZW A;  1XGJ A;  3SH7 A;  3G30 A;  4B9O A;  5HFO A;  1W7F A;  3B3X A;  3MJQ A;  4KQQ A;  4MDZ A;  3IHA A;  1Q2P A;  3O87 A;  2I9V A;  2ZM8 A;  4E3J A;  2BAS A;  4N1X A;  1A0K A;  2Z2L B;  4WZ5 A;  3RXW A;  1W63 Q;  5DFY A;  1E3U D;  3CWF A;  2ZQC A;  4NG2 A;  1LLB A;  4K91 A;  3VP2 A;  2X71 A;  1FR6 A;  4L9G A;  1GA9 A;  4DXB A;  4YNR A;  1BYW A;  1PI5 A;  5F5Y A;  1H8Y A;  3Q81 A;  4O8G A;  3HUM A;  2PBY A;  2A3U A;  3OCL A;  2Y2Q A;  4LGW A;  3KYQ A;  2ZOH A;  3LIE A;  4N92 A;  2P9V B;  4N1H A;  1L0G A;  2Z6C A;  4JXS A;  4EER A;  3T4O A;  1M40 A;  3HLW A;  4XUX A;  2LB9 A;  3HLG A;  3Q07 A;  1LHY A;  3W8K A;  5HPF A;  5IS1 A;  1E25 A;  1DP9 A;  2YKH A;  4S2K A;  3S1Y A;  5E2F A;  4UAA A;  3MR0 A;  5EFW A;  4E3M A;  3EQV A;  4LPZ A;  2O9B A;  4R3A A;  3ZG0 A;  2K7S A;  5LBR A;  1GHM A;  3WWX A;  4DN0 A;  4K0W A;  2IWB A;  2P7J A;  4R23 A;  3BYD A;  2QJ5 A;  3S7N A;  2V20 A;  1GCE A;  1TVF A;  1SCW A;  4Y3I A;  4BBU A;  2WAD A;  3W2Z A;  5GL9 A;  1F98 A;  5EVE A;  3NC8 A;  4DXC A;  2XEP A;  4LCM A;  5CEC A;  3IX4 A;  5A91 A;  5EVI C;  2IWC A;  3JYI A;  4B88 A;  3IH8 A;  1L3L A;  4FCF A;  1S4S A;  4WEL A;  5FI6 A;  1JWV A;  1FSY A;  2WAE A;  1SKF A;  4I38 A;  2G7U A;  3PAG A;  3WS0 A;  4E6X A;  4IBR A;  5FEF A;  4GJ4 A;  4FD8 A;  1VQQ A;  3FPV A;  1IYS A;  3IS2 B;  5AJG A;  1PNE A;  5AQB A;  5FI7 A;  1O07 A;  3MFX A;  3P98 A;  4BD1 A;  1F9I A;  1PWC A;  3LIA A;  2X02 A;  3MKF A;  5FDH A;  3TRC A;  3GQZ A;  3KSF A;  2ACG A;  2O9A A;  1XP4 A;  2ZC4 B;  3HBR A;  5HX9 A;  5FDS A;  4CLC E;  2WKE A;  4R0Q A;  3NBL A;  1YPR A;  3BFG A;  4ETZ A;  2V1B A;  3PBT A;  4Y5F A;  2HP9 A;  4QPR A;  5D3O A;  2W3H A;  1NY0 A;  2A2L A;  4OPR A;  5EVI A;  2VV7 A;  4KZ8 A;  2QJ7 A;  3Q7Z A;  5HWV A;  4WMC A;  3NDG A;  1K25 A;  4L9F A;  3R7W B;  1BTL A;  2OAQ 1;  4MLL A;  2LB5 A;  2PYR A;  2O99 A;  1LSV A;  4JGP A;  1L0E A;  4EWF A;  3LID A;  3IXH A;  1I2S A;  4X25 A;  2ZM2 A;  2W1T B;  4R6L A;  3KO6 A;  3T4L A;  1XA1 A;  1KE0 A;  4WN5 A;  3V50 A;  1MKI A;  2QHK A;  3HJI A;  3EWK A;  1ES3 A;  5EEC A;  1IYQ A;  1ALQ A;  4LV1 A;  2PR6 A;  2O9C A;  4X1L A;  3T1Q B;  3P7N A;  1OME A;  2Y2P A;  4KG5 A;  5TR7 A;  2X01 A;  3HLC A;  4XT2 B;  4P6B A;  4K0X A;  1I5Q A;  1JWP A;  4OVD A;  3RJU A;  4HNB A;  1YQS A;  4Q8I A;  1K0K A;  3D4F A;  4KZB A;  1TDG A;  5MC7 A;  3JPU A;  4P87 A;  1S1Z A;  1UGU A;  4BQM A;  4GZB A;  3QP5 A;  3U2A A;  1TEM A;  5DTT A;  4EQ1 A;  4HH2 A;  4WLA A;  1WYC A;  3KSG A;  1D7E A;  1QME A;  4OPZ A;  1L0D A;  4HHD A;  3BY8 A;  3IF6 C;  3PHY A;  4E3O A;  1G5U A;  2Y2M A;  5AQ7 A;  3GSG A;  4L9E A;  3MXQ A;  5FI2 A;  3L9K A;  4PPR A;  4X55 A;  4E3L A;  2J8Y A;  5L2F A;  5C5K A;  4Q0H A;  4LLO B;  4CLC D;  4JXW A;  1MWU A;  1T1B A;  4IUK A;  1XFN A;  1KDW A;  1GA0 A;  1EW0 A;  1S1Y A;  5DF7 A;  3CPT A;  2Y2O A;  1VB6 A;  1NLZ A;  2ZL1 A;  2JCH A;  2OLV A;  3K3C A;  3BQA A;  4B4X A;  1YLT A;  3E4O A;  1MXO A;  4IED A;  5I5L A;  1H0M A;  2OAP 1;  3F1O B;  5DFX A;  2ZC7 A;  4X53 A;  1IEM A;  3R4K A;  1MZU A;  2W27 A;  3O3V A;  2W1T A;  4F94 A;  5HAI A;  2PT7 A;  4QWO A;  2BLS A;  1T19 A;  4MMN A;  3I7J A;  1BLS A;  1NYY A;  3ITA A;  3B42 A;  2V0U A;  4HY8 A;  1XKZ A;  4EXO A;  2KDK A;  4E6W A;  4Y0U A;  4EUZ A;  2M1C A;  1ACF A;  4GD6 A;  3RXX A;  3N8R A;  1HZO A;  3UB5 P;  5HD5 A;  1S0W A;  3A3E A;  3DW0 A;  3FC7 A;  1LSX A;  3H7W A;  4WBG A;  4OP5 A;  4H6J B;  3GRJ A;  1NYM A;  2WZZ A;  2Q0O A;  3EEA A;  3OOV A;  1S67 L;  1W8Q A;  5FEG A;  5HSQ A;  3C4P A;  1NJ4 A;  3NDE A;  4OOM A;  1XGI A;  3DTM A;  4OLG A;  4D2O A;  3UB8 A;  1Y54 A;  2EXB A;  3LIB A;  2XA7 M;  3C5A A;  1IYP A;  4DE0 A;  5IT5 A;  5HWW A;  3QP1 A;  4Y0O A;  3T4S A;  2HDU A;  2ZC3 B;  3LGO A;  4PM5 A;  1BLP A;  4Q0I A;  2EA9 A;  4B4Z A;  2JHE A;  4JF6 A;  2JKG A;  1XXM A;  1YM1 A;  3PYP A;  4EU0 A;  5M19 A;  5CXW A;  2XA7 S;  1ERO A;  3SZT A;  3UDX A;  4PHT A;  1ZG4 A;  2EX8 A;  1LL9 A;  3CLO A;  3M6H A;  4N9L A;  2ZQ7 A;  4HH3 A;  5F6A A;  3VFH A;  3PBQ A;  2H0Y A;  3C38 A;  4X56 A;  5L10 A;  2PD8 A;  1SKO A;  3VOL A;  1TD5 A;  2V8F A;  4S2I A;  4QY6 A;  4EBL A;  4WL9 A;  3C8C A;  1OTD A;  5CRF A;  2PRF A;  3UE1 A;  3MFD A;  2VGL M;  4HIA A;  3IBJ A;  4GW9 A;  1P0Z A;  3ZVW A;  3F1O A;  2HDS A;  3UE3 A;  1FCM A;  3LCE A;  5DF8 A;  5GHZ A;  3N4I A;  2VGL S;  2EFX A;  4FH4 A;  1KGE A;  3BFF A;  2J3T C;  3LI9 A;  4GS9 A;  3FYZ A;  2INW A;  1MPL A;  2HPB A;  3UDI A;  4QD4 A;  2ZQA A;  4YWZ A;  2XRO A;  5GLC A;  1OPX A;  5G4Y A;  3CG5 A;  4NXF A;  1T1A A;  2JKR M;  3OPR A;  4EES A;  4IJG A;  4AFI A;  3D9Y A;  1HD8 A;  4GCZ A;  5JYP A;  2VJW A;  4OLD A;  2J3W A;  3BLS A;  4A5R A;  1WE4 A;  3VSK A;  4GN2 A;  3VV4 A;  2JBF A;  4DJ3 A;  3K3D A;  3C30 A;  1TDL A;  3S7Q A;  4KG6 A;  4KZA A;  2EWV A;  3Q7V A;  1K55 A;  5A92 A;  2XSS A;  2B18 A;  2M7V A;  3UE0 A;  4ARZ B;  1S66 L;  1VET A;  2KX6 A;  3LEQ A;  5CER A;  3H82 B;  3IHB A;  2BTF P;  3QNC A;  3ZG8 B;  3UPN A;  5HZH A;  5HW3 A;  1T1C A;  5CHM A;  4E3K A;  3E4P A;  5EV0 A;  4DRT A;  4KZ4 A;  3NI9 A;  2D01 A;  2R9X A;  3ZNY A;  4ZRR A;  3NOU C;  3MS6 A;  2QZ6 A;  5TBM B;  1NRF A;  2J9P A;  1LL8 A;  4RX2 A;  2HP5 A;  3WS4 A;  4WUJ A;  1KVM A;  1F2K A;  3VP0 A;  2MJ6 A;  4BL2 A;  3A3J A;  4X1M A;  4I3J A;  3IWO A;  4KQO A;  4S2O A;  1TS8 A;  3MZF A;  3T4K A;  2OOL A;  4YIN A;  1Z09 A;  2H28 A;  5EVI D;  4U0T A;  5GHX A;  2VX8 A;  4GKU A;  4PM7 A;  4WMC D;  1S4R A;  3LUQ A;  3LIC A;  2D02 A;  4U0X A;  3UME A;  1XA7 A;  5E2G A;  2HJ9 C;  4CJN A;  4HP4 A;  1PWD A;  3VP1 A;  1CEF A;  3ITB A;  4LRY C;  5J8X A;  1MKM A;  3NIA A;  3VMA A;  3LFV A;  4M4X A;  4RYE A;  2WGI A;  4HBU A;  3E0Y A;  2O0Y A;  4OH0 A;  3IX8 A;  3LY3 A;  3IF5 A;  5FQI A;  4HP9 A;  1YMX A;  1PW8 A;  4LRX C;  4F3L A;  3IQA A;  4Y7P A;  1LI9 A;  3G2Y A;  1ES4 A;  3F1N B;  3DWZ A;  1G6A A;  1GHI A;  4XUZ A;  1K4E A;  3BRM A;  2WGW B;  1K4F A;  3A0S A;  1JTD A;  1KE3 A;  3AGF A;  1K54 C;  2G2W A;  4Z9Q A;  5GLA A;  1FCO A;  4E3N A;  4KZ3 A;  4EBP A;  1HLU P;  4EV4 A;  5CX7 A;  4DMZ A;  3CUE C;  2J7V A;  2WAF A;  2Z6D A;  3IX3 A;  5TFQ A;  3LIF A;  1MWT A;  2FZ0 A;  2A24 B;  1DJA A;  2WKH A;  4OP8 A;  4R38 A;  1G28 A;  5KMW A;  4Q0J A;  3TOI A;  4UA7 A;  1ZC2 A;  5TBM A;  4MBF A;  5DVA A;  3NOP C;  1MY8 A;  1MWS A;  1FCN A;  2R9W A;  4LFU A;  5TJJ A; 
#chains in the Genus database with same CATH homology
 4EQ1 A;  5KIZ A;  4HH2 A;  4WLA A;  2HJE A;  2PYP A;  4G3W A;  1KOU A;  3HJK A;  2YKF A;  4BMW A;  3BJN A;  3H9W A;  4ME4 A;  1OJ5 A;  3KSG A;  3A0V A;  5HDD A;  1D7E A;  4FSF A;  4HHD A;  1IFQ A;  3BY8 A;  4NKP A;  1P97 A;  3PHY A;  3NJA A;  2JKT I;  3E98 A;  4HJ4 A;  4L9E A;  3MXQ A;  2ZMV A;  4NXG A;  4Z1W A;  4DJ2 A;  2W3E A;  5HDC A;  1DRM A;  3ULF A;  3LI8 A;  3LR3 A;  5C5K A;  4Q0H A;  4LLO B;  2WKR A;  2NUP C;  3BY9 A;  4CLC D;  2ZBB A;  1OT6 A;  1T1B A;  4IUK A;  1XFN A;  2J80 A;  3K2N A;  2V0W A;  4L0L A;  3GEC A;  3UB7 A;  3MQ0 A;  3O5Y A;  3CUE A;  4CQH A;  1EW0 A;  1ZHH B;  1OTA A;  1S1Y A;  3GDI A;  3OBF A;  1VB6 A;  1NLZ A;  5J7E A;  4BWI A;  3F1P A;  4RQ9 A;  3DBA A;  3UB9 A;  3K3C A;  2PHY A;  1YSP A;  3BQA A;  3E4O A;  4JGR A;  5I5L A;  3ICY A;  1X0O A;  4II7 A;  3T4J A;  4CLC A;  4HQA A;  2OAP 1;  4O0P A;  3F1O B;  5DFX A;  5FL3 A;  3R4K A;  1MZU A;  2JN7 A;  2W27 A;  2W1T A;  3B47 A;  2L1M A;  2ZMF A;  4EET B;  2PT7 A;  4K08 A;  3B33 A;  1GSV A;  1T19 A;  2QYB A;  1T18 A;  1YSQ A;  1GSX A;  3TW8 A;  4MMN A;  3B42 A;  2V0U A;  4HY8 A;  5DJT A;  1NLY A;  4MN5 A;  2GJ3 A;  4EXO A;  1G6O A;  2KDK A;  2VA0 A;  4I5S A;  1LT0 A;  2HV1 A;  2M1C A;  2CMN A;  3OLO A;  3BW6 A;  4HI4 A;  4EEU A;  5HD5 A;  4F3L B;  4ARZ A;  3FC7 A;  1LSX A;  3H7W A;  3PXP A;  3T4T A;  3H82 A;  1V9Y A;  3TE8 A;  4H6J B;  1WA9 A;  2HF6 A;  4O01 A;  4NXB A;  2DMW A;  3FPW A;  3EEA A;  3OOV A;  1S67 L;  2W3D A;  3LR4 A;  4GLQ A;  2EWW A;  3JVV A;  1N9N A;  5HSQ A;  3CAX A;  2K31 A;  3BQ8 A;  4OOM A;  4B93 A;  4HOI A;  1DP6 A;  3VE4 A;  3ZQ5 A;  1H8M A;  3UB8 A;  3LIB A;  5HPI A;  3IS2 A;  2NUT C;  2VZW A;  2XA7 M;  1UWN X;  4GHI B;  1XJ6 A;  5IT5 A;  2WKQ A;  5HWW A;  3T4S A;  4KUK A;  4B9O A;  3MJQ A;  1ZTU A;  2EA9 A;  4MDZ A;  4Q0I A;  2JHE A;  3PYP A;  4EU0 A;  2VKS A;  2I9V A;  2BAS A;  2XA7 S;  1W63 Q;  1P9W A;  4PHT A;  5DFY A;  1P9R A;  5DKL A;  3CWF A;  3CLO A;  5HD3 A;  4HH3 A;  5F6A A;  4HJ3 A;  1W63 M;  5J3W A;  3CI6 A;  3PBQ A;  4WEJ A;  1N9O A;  4L9G A;  3C38 A;  3E4Q A;  2M7U A;  4YNR A;  2PD8 A;  1TS7 A;  1BYW A;  2K2N A;  5F5Y A;  4O8G A;  3VOL A;  2WKP A;  1TD5 A;  2P04 A;  3OCL A;  3KYQ A;  2ZOH A;  2W1R A;  3OCN A;  3LIE A;  2L4R A;  4WL9 A;  5DF9 A;  3C8C A;  1OTD A;  3G6O A;  2JKT M;  2VGL M;  4HIA A;  3IBJ A;  1TF1 A;  2Z6C A;  3R7W A;  4GW9 A;  1P0Z A;  4EER A;  3F1O A;  3T4O A;  3UE3 A;  3S7P A;  2VV6 A;  5L8M A;  2LB9 A;  2VGL S;  2JKR I;  2L0W A;  3NHQ A;  4IUH A;  5HPF A;  4MN7 A;  4BJP A;  5IS1 A;  1YAX A;  3PBS A;  4E04 A;  1XJ4 A;  3MQO A;  2J3T C;  1DP9 A;  1NWZ A;  3LI9 A;  4GS9 A;  2GZA A;  2V1A A;  3F1N A;  2INW A;  2YKH A;  4I3I A;  3D72 A;  3FG8 A;  4YWZ A;  1MC0 A;  2XRO A;  3PBO A;  3MR0 A;  5EFW A;  1OPX A;  3EQV A;  4LPZ A;  5G4Y A;  2O9B A;  2W3G A;  4IHQ A;  4R3A A;  4CLC B;  2K7S A;  4WEK A;  5LBR A;  4NXF A;  1T1A A;  3BWL A;  2VV8 A;  3NOT C;  5AVF A;  2JKR M;  2VEA A;  4EES A;  1V9Z A;  4IJG A;  4AFI A;  2R78 A;  4DN0 A;  4XT2 A;  4GCZ A;  4MCW A;  2VJW A;  5F69 A;  2P7J A;  2J3W A;  1D06 A;  2QWS A;  4Y2F A;  1OT9 A;  3VV4 A;  2HGV A;  2QJ5 A;  3S7N A;  2IA2 A;  4PAU A;  2P08 A;  4DJ3 A;  2A24 A;  4Y3I A;  3K3D A;  5DKK A;  2GX5 A;  3C30 A;  2V9A A;  2VLG A;  4BBU A;  3W2Z A;  3S7Q A;  5HDS A;  1F98 A;  1NRJ A;  2XRN A;  2J3T D;  3OC2 A;  4G3K A;  3C2W A;  2EWV A;  3EQU A;  2XSS A;  4EW7 A;  2B18 A;  2M7V A;  4ARZ B;  1S66 L;  3H7W B;  2KX6 A;  1STZ A;  4GHI A;  3T50 A;  3A0R A;  3H82 B;  2OWH A;  1XJ2 A;  2B02 A;  1S4S A;  4WEL A;  5HZH A;  1T1C A;  3E4P A;  4NXE A;  3KSI A;  2GNX A;  3EGX C;  4I38 A;  1TS6 A;  4R70 A;  2D01 A;  2W0N A;  4PKY A;  2G7U A;  3KX0 X;  3NOU C;  4ZRR A;  3S7O A;  4NEE D;  1IOU A;  4GJ4 A;  5TBM B;  3EGD C;  1LL8 A;  3FPV A;  4WUJ A;  3IS2 B;  5AJG A;  2ZOI A;  3RTY A;  2MJ6 A;  4MN6 A;  4P6Z M;  3MFX A;  4I3J A;  1F9I A;  2W3F A;  4BBV A;  4KQO A;  5HL6 A;  3LIA A;  1TS8 A;  2PDR A;  3T4K A;  4UQI M;  5IU1 A;  2OOL A;  3TRC A;  5A8B A;  3CIT A;  3LYX A;  3KSF A;  4P6Z S;  2H28 A;  3EOI A;  2O9A A;  2VX8 A;  3MMH A;  3HCY A;  3LR0 A;  3LR5 A;  4UQI S;  3PBR A;  3IBR A;  1YKD A;  1S4R A;  2PR5 A;  1DP8 A;  2OWJ A;  4I3A A;  3LUQ A;  3LIC A;  4CLC E;  4LRZ E;  2D02 A;  3UME A;  2HJ9 C;  3MQQ A;  4ETZ A;  1H3Q A;  4BBT A;  2V1B A;  4HP4 A;  3VE3 A;  3PBT A;  4G3V A;  4Y5F A;  1TS0 A;  4LRY C;  4QPR A;  2W3H A;  1MKM A;  1OTB A;  1XFQ A;  2A2L A;  2QKP A;  2VV7 A;  4JGQ A;  3PR6 A;  2QJ7 A;  3KSH A;  3KYZ A;  5HWV A;  3UMD A;  3LFV A;  4M4X A;  1XJ3 A;  4ETX A;  3F1P B;  3E0Y A;  2O0Y A;  3PBN A;  3ZYT A;  3RH8 B;  4L9F A;  3R7W B;  3P01 A;  4YOF A;  4HP9 A;  2OAQ 1;  5F68 A;  4I39 A;  2LB5 A;  2PYR A;  2O99 A;  4WF0 A;  5AVE A;  5KSH A;  3MF0 A;  4LRX C;  1LSV A;  4F3L A;  4JGP A;  3LID A;  1LSW A;  2Y79 A;  1VHM A;  2FH5 A;  2W1T B;  1OTI A;  4GS9 B;  4H6J A;  3F1N B;  4R6L A;  3KO6 A;  3T4L A;  3UE6 A;  4KUO A;  4WN5 A;  2QHK A;  3HJI A;  5G4Z A;  3A0S A;  3EWK A;  4PKY G;  5J4E A;  4HJ6 A;  2KLI A;  1N9L A;  3SW1 A;  4KQD A;  2PR6 A;  1Y28 A;  2O9C A;  3TJZ C;  3P7N A;  3V67 A;  5HWT A;  4XT2 B;  5CX7 A;  4FOF A;  3CUE C;  4DMZ A;  2KOI A;  5DJU A;  3JVU A;  4EEP A;  2Z6D A;  4HNB A;  2PD7 A;  3LIF A;  3UB6 A;  1F5M A;  3T4Q A;  4OOL A;  4UEY A;  1JNU A;  2FZ0 A;  2A24 B;  3RFB A;  1UWP X;  3D3O A;  1OTE A;  4R38 A;  1G28 A;  5MC7 A;  4CLC C;  4JGO A;  4Q0J A;  4EUV A;  1S1Z A;  1ODV A;  1UGU A;  1GSW A;  3EEH A;  5K5B A;  5TBM A;  3NOP C;  1OJG A;  2Y8H A;  3U2A A;  5TJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...