1S4SA

Reaction intermediate in the photocycle of pyp, intermediate occupied between 100 micro-seconds to 5 milli-seconds
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Protein kinetics: Structures of intermediates and reaction mechanism from time-resolved x-ray data
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photosynthesis
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s4sA00
2JN7A 2W0NA 2VV7A 4HIAA 3UMEA 4XT2A 1DP9A 5DJTA 3MJQA 5F69A 5HDCA 2VV8A 2L4RA 1S66L 4HJ6A 2OWHA 4NXGA 1X0OA 1TS0A 4LRYC 4BBUA 3LIBA 2Z6DA 3CAXA 5F68A 5F5YA 3LIEA 2PR6A 3GDIA 3F1PA 2R78A 3BWLA 4L9GA 5AVEA 1Y28A 1V9YA 4K08A 4NXFA 4JGRA 5HSQA 2KX6A 3LI9A 4KUKA 1OTIA 4EERA 3IBRA 5G4YA 2PD8A 5HWVA 4HNBA 4WN5A 2L0WA 4I3JA 5IU1A 4BBTA 1LSVA 3NJAA 1OJ5A 3UB8A 1LSXA 3CWFA 4L9EA 3FG8A 5KIZA 4F3LA 3K3DA 3F1NB 3ZQ5A 2PHYA 3H9WA 1BYWA 5HD5A 1S4SA 1XJ6A 4HHDA 1N9OA 3P7NA 4DJ3A 2OOLA 1DP8A 4GS9B 4HP4A 2QKPA 5AVFA 4GHIA 2A24A 3UE6A 2B02A 5DKLA 1S4RA 1MZUA 4R38A 1S1YA 3K3CA 3MQQA 1P0ZA 4RQ9A 3F1NA 1EW0A 3RTYA 3ICYA 3MQOA 3EWKA 2ZOHA 1T1AA 3NOUC 2BASA 1P97A 3LI8A 2H28A 5DKKA 3VE4A 1N9NA 1OTEA 4R6LA 5EFWA 3ULFA 1GSXA 3KX0X 2V0UA 1TS8A 3F1OB 3MXQA 4PKYG 2K7SA 4GW9A 3T50A 5HDSA 2VEAA 3C2WA 1T1BA 1XJ2A 4EETB 1DP6A 2VLGA 2QHKA 4MN5A 2EA9A 3NOPC 1OTBA 1TS7A 3EEHA 2INWA 4HOIA 4M4XA 2OWJA 4WL9A 3LIAA 4EEUA 1T1CA 4I39A 5HWWA 3PHYA 1OJGA 3H82B 4LPZA 4I3AA 2V1BA 5IS1A 4NXEA 3A0RA 4JGQA 4R3AA 4WUJA 2GJ3A 4EXOA 2I9VA 3SW1A 4NXBA 4EW7A 2JHEA 1GSVA 1D7EA 4HJ3A 5HD3A 3A0SA 4JGOA 4B9OA 2PR5A 2QWSA 3FC7A 5DJUA 3IS2B 1D06A 2Z6CA 4HH3A 1XJ4A 2PDRA 1LSWA 3BY8A 1UWNX 1LL8A 4EQ1A 3G6OA 1VB6A 2CMNA 2W27A 3CLOA 1GSWA 2YKFA 1OTAA 2ZOIA 1DRMA 3RH8B 2M1CA 2HV1A 1OTDA 3E4OA 5TBMB 2D02A 4HI4A 4WLAA 3BY9A 5J3WA 5I5LA 3LICA 1V9ZA 2QJ5A 5HWTA 4LLOB 3NHQA 1XJ3A 3D72A 4XT2B 1S1ZA 2D01A 3PYPA 5F6AA 4KUOA 1XFQA 4GS9A 4H6JB 1G28A 3B33A 5HZHA 3UB9A 5TBMA 1XFNA 2WKQA 4HQAA 3UB7A 4PKYA 4I5SA 3VOLA 4GCZA 1TS6A 1NWZA 3LUQA 3E4QA 2KDKA 4EEPA 3OLOA 4KQDA 3F1PB 2V1AA 2WKPA 4DJ2A 4HY8A 1KOUA 4H6JA 3MR0A 4I38A 3NOTC 1ODVA 1UGUA 4LRZE 2PYRA 1OT6A 2V9AA 3F1OA 3UMDA 3MFXA 1S67L 1LT0A 1T18A 2V0WA 5J7EA 4F3LB 4LRXC 5A8BA 1UWPX 3LYXA 4HH2A 2WKRA 4BBVA 1F98A 4L9FA 5J4EA 2J80A 3A0VA 4JGPA 4HP9A 3UB6A 3H7WB 1JNUA 4GHIB 2A24B 4HJ4A 3H82A 4I3IA 3GECA 3VE3A 2PD7A 3LIDA 4WF0A 2P7JA 1OT9A 2PYPA 5HDDA 3HJIA 3LIFA 4MN6A 1WA9A 3IS2A 1N9LA 2ZBBA 1F9IA 2L1MA 2QJ7A 4R70A 3H7WA 5G4ZA 4YWZA 2YKHA 4EESA 1T19A 3E4PA 4E04A 2VV6A 3HJKA 3C8CA
chains in the Genus database with same CATH superfamily
4KZ5A 3B47A 4LCMA 3G2ZA 3UMEA 3ZFZA 3WS1A 4BMWA 4F94A 4OOLA 5F69A 3QNCA 3TRCA 2W3EA 2L4RA 2V1ZA 5DTTA 1S66L 1LI0A 4QWOA 1K0KA 2EX9A 3K2NA 2BLSA 3OPHA 3SZTA 3W4PA 3T1XA 2VGLS 3EQUA 5GHYA 4LRYC 2VJWA 2VGKA 2Z6DA 3I7JA 2JKTI 2PR6A 4X53A 3IH9A 3GDIA 4Y5FA 1KE0A 1CF0A 3CMZA 2R78A 1ESIA 5DTKA 2XA7S 1V9YA 3UO9A 2DRWA 4OOYA 4JGRA 1RGYA 4NK3A 5AQ7A 5HSQA 2EXBA 1GHIA 4KUKA 4P6ZM 1QMEA 5E43A 2FFFB 1G68A 3C30A 3KO6A 5EECA 1CK3A 5G4YA 4QJGA 4GZBA 2ZMAA 1GA9A 4EBNA 4HNBA 1Y4OA 2NUTC 4BBTA 2X71A 1LSVA 3V39A 1OJ5A 1WYBA 3ISGA 4PM7A 3H9WA 2HDQA 2HDSA 2XFSA 2ZC4B 5FQJA 3FWLA 3V3SA 4DKIA 3T4OA 4HBTA 2B95A 1MWTA 4DJ3A 2A3UA 5EM1A 3HL9A 3LGOA 3RXXA 3BRMA 2Y2IA 3Q7VA 1Y54A 5AVFA 4GHIA 5E2FA 2BG1A 4FTXA 3C7UA 3ZNYA 2V8CA 3R7WA 1PFLA 2W1TA 1VHMA 3KSGA 2Y2MA 5HL6A 5GLDA 3LEZA 3HUOA 4RQ9A 3F1NA 4UHUA 1L3LA 3GVBA 5AQAA 2ZM0A 2Q0OA 1YQSA 2K31A 2W3FA 2WYXA 4LV2A 2H0YA 2H28A 3IF6B 5DKKA 3A3FA 1KE4A 3VE4A 1OTEA 5A90A 4KQRA 2GNXA 2WK0A 3LEQA 2EX8A 1RP5A 3KYEA 4UAAA 2ZQDA 2OSUA 3BFFA 3MXQA 5EOEA 3IT9A 2K7SA 5HDSA 4NKPA 1SDEA 1DY6A 1VM1A 2QHKA 3BFGA 1BLCA 3C4PA 5KSHA 4MN5A 4QB8A 1PW1A 3S1YA 3ITAA 5DFYA 1TS7A 4ZJ3A 2INWA 2OWJA 3DWKA 4EEUA 2ZL1B 5HWWA 3PHYA 1ONHA 4LPZA 3T1QB 2V1BA 3C4OA 3MZEA 2VK3A 4ETZA 1YLTA 5FA7A 4X69A 4NXBA 4EW7A 4FOFA 4X55A 4HJ3A 4JGOA 3ZDJA 4B9OA 5EVEA 5GLBA 4Z9QA 2XEPA 1XJ4A 2PDRA 1VQQA 1W63M 4LCLA 3BY8A 3NI9A 1YLYA 4DDSA 2FFYA 4EQ1A 3G6OA 1VB6A 2CMNA 1YLWA 2YKFA 2HDUA 4ZJ1A 3OOVA 1NZUA 3RH8B 2E8IA 2Y2GA 2M1CA 4E3OA 2ZC5B 4PAUA 2D02A 1M40A 1NZOA 4FUWA 1NY0A 3IF6C 5EE8A 3MXRA 2DMWA 3LICA 1V9ZA 5E2EA 4YNRA 4LLOB 3Q07A 1YSQA 3ZG5A 4WEJA 3M6HA 2ZM8A 5CTNA 5CERA 2G7UA 1YPRA 2ZC3B 5F6AA 2CC1A 1HD8A 1TF1A 1H3QA 4GS9A 3IF5A 3W8KA 4IBRA 2PRFA 3IXGA 3UB9A 5TBMA 4R23A 4DXCA 3TSGA 3BJNA 1TEMA 5U47A 3SH8A 3PTEA 4HQAA 1DJBA 2Z2MB 4PKYA 3V67A 4S2LA 3S7NA 1W8YA 3IHBA 4FH2A 4S2NA 3VOLA 2XDMA 2ZC7A 1N4OA 3LUQA 1CEFA 3PAEA 2A2LA 4KENB 2WKPA 3ZCZA 3N8RA 4R4RA 1FSWA 2OAQ1 1XGIA 1FR1A 5TR7A 3EOIA 4JF4A 5HFOA 2JCHA 1UGUA 3MZDA 2IWDA 1VETA 4D60A 5JYOA 1OT6A 1H8YA 1H0MA 1S67L 4P85A 1LT0A 2V0WA 4IBXA 4OQHA 2QPNA 4QU3A 4GOGA 3IWIA 4LRXC 4Q0HA 4Y15A 4S2OA 4P87A 4OPRA 2XD1A 3KYZA 2Y55A 3MKEA 1ES5A 1XX2A 3MF0A 2Y2JA 3Q7VB 3H7WB 5CEDA 3G30A 4GHIB 4HJ4A 4E3MA 1TDGA 1BLHA 1YMSA 3OPLA 1KGEA 3B3XA 3VE3A 4S2PA 5GHZA 3UE0A 2ZQAA 3N4IA 1OT9A 2PYPA 5HDDA 2JKTM 3PBNA 3MXSA 1FR6A 1LHYA 4WZ5A 5M18A 3UB5P 1WA9A 4AFIA 5DF9A 1CI8A 3PBRA 1IFQA 1ONGA 3HLCA 1FCMA 2PBDP 2WAEA 5A92A 5K5BA 3HLDA 4EESA 5D3OA 1W8QA 3E4PA 3FYZA 2OLUA 1PI4A 4JPMA 5TFQA 5DFXA 5F82A 3VOYA 2Y2KA 1IYQA 4UQIS 3C8CA 3PBTA 5A91A 5KMWA 5EVID 1K56A 2JN7A 2RL3A 3JPUA 4Y17A 1W63Q 5HDCA 3D3OA 5FI6A 3UY6A 3BFEA 5LBRA 5HX9A 4HJ6A 4KQOA 4LFUA 1KDSA 1MY8A 3WRZA 4P6BA 3M6BA 3O5YA 1ZTUA 2QZ6A 4IVIA 4LV1A 3OCNA 4O8GA 1TS0A 2LB5A 1NYMA 2PT7A 4C6YA 2A49A 4EUZA 3CAXA 5F5YA 4N1HA 1M6KA 3ZVTA 3BQ8A 2PU4A 2HF6A 2MJ6A 1K55A 1IKIA 3F1PA 3BWLA 3C38A 4GD6A 4L9GA 1JWVA 4ETXA 2H10A 2QYBA 4K08A 4NXFA 4ESPA 2KX6A 4HEFA 2ZQCA 5J8XA 3C5AA 4GN2A 1K4EA 4MBFA 1SHVA 4WN5A 1XXMA 4PM9A 4MN7A 5JYPA 3UB8A 1LSXA 3FG8A 3LY3A 3K3DA 4FCFA 2PHYA 5HD5A 4JF6A 5TJJA 3S7PA 3WS2A 3NY4A 1XJ6A 4RX3A 1VEUA 4HHDA 3A3JA 1XP4A 4DMZA 1DP8A 1BZAA 4GS9B 3ZYTA 5DF8A 5CGXA 1FIKA 1XGJA 1G5UA 3UE6A 2Y2NA 3G2YA 3MKFA 1ZC2A 1PZPA 4MMNA 5FQ9A 2AVXA 3K3CA 2GZAA 1BLPA 1EW0A 3RTYA 4EQIA 5CGSA 3GMWA 3MQOA 1F2KA 2Y79A 3VSKA 3EWKA 3ZHHA 1E4DA 1RCJA 1J9MA 2BASA 4LGWA 1P97A 3Q7ZA 4E3KA 1N9NA 3PBQA 3QP8A 4OLGA 1VETB 5IT5A 1ACFA 1TVFA 2XRNA 4ZBEA 3EEAA 5HL1A 1TS8A 4IVKA 3UPPA 3T50A 2O0YA 1CJFA 3C2WA 3HBRA 1XJ2A 2ZQ9A 2Y2HA 2UV0E 1BSGA 4WBGA 5GLCA 3QP1A 3SOIA 1XA7A 3EEHA 4M4XA 5C5KA 3HLWA 3CUEA 3TG9A 4X6TA 4I39A 3BW6A 3B42A 4G3KA 1K25A 4I3AA 4EBPA 1NLZA 4WUJA 2WADA 4KZAA 5M19A 2FZ0A 3BLSA 3MMHA 1GSVA 1YAXA 3QP2A 1KGFA 4N1XA 3A0SA 3LY4A 2B18A 4KZ3A 2PR5A 3FC7A 3UPNA 1D06A 4GLQA 3GV9A 5EVLA 1S6RA 3V50A 4OPYA 1BULA 1ES3A 3HVFA 5FI7A 1UWNX 4OH0A 1LL8A 3NDEA 1G6OA 1FILA 3N8SA 2HP9A 4DF6A 4UEYA 4S2NC 4XUZA 4K0WA 1GSWA 1PW8A 3Q1FA 4GB7A 1E3UA 2PU2A 4GKUA 1OTAA 2ZOIA 5FSRA 3P98A 2XSSA 4C75A 1NYYA 4HI4A 4DE0A 1L2SA 2VKSA 4WLAA 1JVJA 1J3WA 5I5LA 5HWTA 1XJ3A 1S1ZA 2PBYA 5E2HA 3SS3A 2B5RA 4BD0A 1GHPA 3G31A 4U0TA 4H6JB 4EWFA 3NBLA 3MS6A 4BD1A 1E25A 5HZHA 3D4FA 4PPRA 5GLAA 3E98A 2WKQA 3UB7A 1FCNA 1LL9A 1PI5A 3QP5A 3L7HA 3O86A 4GCZA 1TS6A 4ARZA 1NLYA 3KYQA 3G32A 2KDKA 4Y7PA 4IHQA 1FCOA 3F1PB 5KSCA 2Y4AA 5L09A 3W2ZA 3ITBA 3N8LA 3LFVA 4KZ7A 1GA0A 4ZJ2A 3NOTC 3VMAA 4WZ5C 2I72A 3EGXC 4ZRRA 5FASA 3E2KA 3G34A 1K6RA 3MSHA 4CLCA 3NECA 2VGLM 5HAIA 4CJNA 3NCKA 1DJAA 1NRJA 4QY6A 2Y91A 4DXBA 2KOIA 1O7EA 5A8BA 3LYXA 4HH2A 1F5MA 2WKRA 1VEUB 5FQKA 1F98A 2J80A 2XA7M 2XF3A 3CITA 5AQ9A 3GTCA 3T4TA 2WUQA 2XD5A 4I3IA 2NUPC 3Q81A 2XR0A 5TGFA 4JKTA 2EFXA 4JF5A 5F1GA 4Y0OA 2PD7A 4X1MA 4GDBA 4JBFA 3IBJA 2JC7A 3TOIA 4DE2A 5GHXA 3HJIA 2HJEA 3IH8A 1QMFA 4S2KA 4DE3A 4HBUA 4EUVA 2ZM2A 2ZBBA 4EU0A 2QJ7A 5L8MA 5CX7A 4JXWA 4QPRA 4YWZA 4X68A 1SKOA 4OLDA 1T19A 2JE5A 4O01A 2WKEA 1K55C 4PHTA 3HJKA 2R9XA 3HUMA 2ZMFA 4IUHA 2X01A 2V20A 3MQ0A 3IX3A 4CLCE 3DAVA 3RXWA 2W0NA 2ZMVA 3MJQA 2VV8A 3OC2A 4JXGA 1ZKJA 2J7VA 4YOFA 2W3DA 2Y2LA 3TE8A 2DCFA 3HLGA 4D2OA 2OWHA 3IQAA 3SS5A 2ZQ8A 3DBAA 1YKDA 3PAGA 4PM6A 1X0OA 2O99A 2H5SA 2G2WA 4BBUA 3LIBA 2XLNA 4MCWA 4K0XA 2VX8A 1FSYA 3GSGA 4B88A 4PM5A 4FD8A 2LB9A 3DTMA 3ZG0A 1MWRA 2UWXA 3O87A 5AVEA 1Y28A 1U60A 2M7UA 4Y0UA 2J9PA 2W3HA 4OP5A 4EERA 4OP8A 5CHUA 5HWVA 2GX5A 2L0WA 3R7WB 2W1TB 2Y2QA 3ZG9B 5CECA 2HP6A 3NJAA 4Y13A 5L2FA 3CWFA 4KZ9A 2QMIA 5FAQA 4MEZA 4II7A 1WE4A 3F1NB 4S2JA 3ZQ5A 1NJ4A 1BYWA 2VGJA 3MBZA 1K57A 3DTIA 3W4OA 5CEBA 3P7NA 5EPHA 2OOLA 2J3TC 3TJZC 4GNUA 4WYYA 4R1GA 4HP4A 3CJMA 2HDRA 3GQZA 2B02A 2Q9NA 5CHMA 1S4RA 4E6WA 4R0QA 4JLFA 3IXHA 3BYDA 4R38A 3O88A 3N7WA 3IX8A 4WELA 4MBKA 3CUEC 3S22A 3MQQA 1P0ZA 1KE3A 3VSLA 3ICYA 3Q82A 2KLIA 4ARZB 5EM0A 1P9WA 3FKVA 4A5RA 2ZLYA 3G4PA 2V2FF 5FQMA 5HW3A 1STZA 1ERMA 3LI8A 3KSHA 1OPXA 5BOHA 3HUNA 4ME4A 2K2NA 4R6LA 5EOOA 3T12B 4CPKA 1EWZA 1A0KA 3KX0X 2V0UA 3IXDA 3IXBA 4CLCB 2E8JA 2C5WB 3N6IA 4G3WA 4MLLA 4OVDA 1PRQA 1T1BA 1DP6A 2VLGA 4UA9A 4MBHA 4CQHA 1EI5A 2ZD8A 1PYYA 3NOPC 1OTBA 4KZ4A 3E2LA 4PMAA 4WL9A 1ALQA 4P6ZS 2W1RA 5HAQA 1YT4A 5CHJA 1OJGA 4BJPA 2WZXA 2HJ9C 1L0EA 4KG6A 4JGQA 4R3AA 2GJ3A 3T1SA 2EWVA 3QHYA 4EXOA 3SW1A 4X56A 3VP2A 4KZBA 4DN0A 2JHEA 1ERQA 3S7QA 4Z1WA 1MWUA 4Y3IA 4OQIA 1HTZA 3IWQA 4BL2A 2WGIA 3BFCA 3HLFA 4XUXA 1K6SA 5DJUA 1D1JA 2Z6CA 3HLBA 4X25A 1LSWA 1NRFA 2GDNA 1K54A 3ZG8B 2Y2PA 5CGWA 3VP1A 1SKOB 4DDYA 2W27A 3VP0A 3CLOA 3KSFA 4OQGA 1DRMA 4U0XA 3LR0A 3NULA 3CZDA 1OTDA 3E4OA 5TBMB 3L9KA 1MKIA 5FI2A 2EX2A 3FV7A 1PIOA 3ZG7B 2QJ5A 3D72A 1MKMA 2WGWA 4G3VA 4CLCC 3PYPA 2J3WA 3WS4A 1SKFA 4LV3A 4KUOA 2XROA 1KDWA 2WAFA 1H5XA 5CRFA 4GJ4A 5FEFA 3U4LP 4FSFA 1G28A 4BLMA 3B33A 3GR2A 3V3RA 1L0FA 1MBLA 4IEDA 4UQIM 2G2UA 3LR4A 1FOFA 4I5SA 2IWCA 3UE3A 2HPBA 4WEKA 4U3TA 3E4QA 3OLOA 4KQDA 2V1AA 5FDHA 1HZOA 3UDFA 4OQ0A 3CI6A 3FPWA 4HY8A 3ZVWA 1N9BA 4I38A 1L0GA 2O9AA 4K91A 3DTEA 5FEGA 2ZC6B 4LRZE 1YSPA 1CEGA 2PYRA 2V9AA 3F1OA 3UMDA 3DWZA 3M2KA 3MFXA 3PXPA 1T18A 3OCLA 2EWWA 3FPVA 3MZFA 1SCWA 1FQGA 5L10A 1Z6FA 4UA6A 3PBSA 1UWPX 3UNWA 1O07A 4R4SA 1IOUA 4L9FA 1C3BA 4RA7A 4JGPA 2C6WB 1W79A 4HP9A 3A3IA 4S2IA 1KVLA 3NIAA 5KZHA 3H82A 3IWOA 1JTGA 5EVIA 2W3GA 1PZOA 2XH9A 4OPZA 3LCEA 4WF0A 3HREA 4E3NA 1XA1A 2XFTA 2VA0A 3FKWA 2Y8HA 2WKIA 3LR5A 2J8YA 1H8ZA 4Q0JA 3IS2A 3CHWP 1N9LA 1IYSA 4R70A 5A93A 1MXOA 3H7WA 5HARA 5G4ZA 4FH4A 3HCYA 5FL3A 4E04A 2JKRM 3C7VA 1JWPA 3IX4A 4N9LA 4JXVA 1S0WA 5CTMA 3S7OA 2IWBA 1PWCA 1K4FA 3BLMA 2WKHA 2Z2LB 4IJGA 1TD5A 2VV7A 4HIAA 4XT2A 1DP9A 5DJTA 4KQQA 4EV4A 1BUEA 2JKFA 2XGNA 2O9CA 1LI9A 5DTSA 4NXGA 1PWDA 4PM8A 1GHMA 1W5DA 2XQZA 1K57C 3VOZA 1PWGA 4E3IA 2P74A 5F68A 3LIEA 1IKGA 5FAPA 4ZAMA 1TDLA 4OONA 1XPBA 4LV0A 4NG2A 4X1LA 2HZ5A 3CPTA 4KG5A 2XK1A 3UPOA 5FQQA 4E3JA 4QHCA 2Y2OA 4KZ8A 3LI9A 5HPIA 1K56D 1OTIA 3IBRA 2PD8A 4C3QA 1K38A 2EXAA 5HPFA 1AXBA 1XKZA 4I3JA 5IU1A 5IHVA 1OMEA 3BM6A 2RCXA 1LLBA 1IYOA 3T1RA 4RYEA 4L9EA 5KIZA 4F3LA 3T4KA 4KZ6A 2Y59A 3FZCA 1S4SA 2R9WA 1YLJA 2WGWB 5CXWA 3RJUA 1N9OA 3HLEA 2HP5A 4H8RA 4L0LA 1YLPA 5M1AA 4NETA 3DW0A 2QKPA 1ESUA 3VP4A 2A24A 3A3DA 5EUAA 4B93A 5DKLA 2FH5A 4M3KA 5G18A 3IHAA 1MZUA 2P9VA 1SZVA 1S1YA 4B4XA 3M2JA 3T4LA 3OZHA 4S2MA 2ZOHA 4OPQA 1T1AA 3NOUC 1YLZA 4ZDXA 1EROA 4XXRA 4Q8IA 4BL3A 4YINA 5EFWA 3ULFA 3OPRA 1GSXA 2OV5A 3F1OB 4PKYG 5DF7A 3VP3A 3AGDA 4GW9A 3T4SA 4NEED 1K54C 2V8FA 2VEAA 5FATA 2JBFA 4Y2FA 4EETB 1G6AA 4WMCD 3G35A 3QNBA 2EA9A 1AWIA 4BQMA 1BLSA 5I94A 5GL9A 4HOIA 3PR6A 4O7DA 3LIAA 1T1CA 3WS0A 3D9YA 5AQBA 3GRJA 3H82B 4UA7A 5EVIB 1LL5A 1P9RA 3NC8A 4IUKA 1IELA 5IS1A 4YFMA 4MNRA 4NXEA 3A0RA 3JVUA 2HGVA 2JKGA 4GDNA 1ES4A 2I9VA 2JKRI 2EX6A 1D7EA 5HD3A 3LO7A 4HESA 3R4KA 1MWSA 4ZTKA 2PAVP 1WYCA 2QWSA 1BTLA 3IS2B 1DJCA 3SS4A 3TW8A 4HH3A 3T4JA 2J3TD 1I2WA 1GCEA 5FAOA 3UDIA 2IA2A 3EGDC 3UN7A 4RVAA 3BECA 3WS5A 4Y0TA 3ZGAB 1KVMA 1Z09A 2WGVA 4OOMA 5F1FA 1MC0A 3WWXA 3VV4A 2HV1A 4DE1A 3T4QA 3UE1A 4BENA 3JYIA 2ACGA 3NDGA 3VFHA 2ZJ9A 3BY9A 5J3WA 3BFDA 3E0YA 3NHQA 4XT2B 4RX2A 5DVAA 4DRTA 5L07A 2D01A 1XFQA 1IYPA 2BTFP 3CG5A 4E3LA 1MPLA 3OBFA 2J9OA 1I2SA 1XFNA 2X02A 4LENA 1ZG6A 1H8MA 3O3VA 3UDXA 1E3UD 1NXYA 3QP4A 1YMXA 3A3EA 2ZQ7A 1NWZA 5EVIC 2Q9MA 3ZNTA 4EEPA 3CPTB 3VFFA 1PNEA 3BEBA 1ZHHB 4DJ2A 1CI9A 1KOUA 1L0DA 3P09A 4H6JA 3IF6A 4WZ4A 3MR0A 3W4QA 4EBLA 2VZWA 3WRTA 3S4XA 4OKPA 1ODVA 1JWZA 2P08A 4N92A 2O9BA 3KSIA 1W7FA 1BT5A 1HLUP 2H0TA 4R3JA 1JTDA 5E2GA 3DTKA 4ID4A 5J7EA 4B4ZA 4E6XA 4F3LB 4BWIA 5EV0A 4QD4A 4N9KA 1SDNA 4JXSA 3SH7A 4BBVA 1I5QA 4WM9A 5J4EA 3P01A 4KG2A 2DNSA 3A0VA 5FDSA 3U2AA 3UB6A 2ZL1A 4R3BA 2M7VA 1JNUA 3RFBA 2A24B 1HVBA 3OPPA 1YM1A 3GECA 3AGEA 2OLVA 1RGZA 5FQIA 2P04A 2P9VB 3AGFA 1ES2A 3LIDA 3PBOA 2P7JA 3SH9A 5MC7A 4O0PA 3EQVA 3LIFA 3JVVA 4MN6A 1ZG4A 1IEMA 4Q0IA 5F83A 1Q2QA 4CLCD 1F9IA 2L1MA 4P0MA 2EFUA 2OAP1 4GD8A 2YKHA 4WMCA 3QP6A 4QY5A 2VV6A 3V5MA 5AJGA 3LR3A 3MFDA 1CQAA 5HAPA 1KGGA 3BQAA 2WZZA 4MDZA 1Q2PA
chains in the Genus database with same CATH topology
4CLCE 2JN7A 2W0NA 4IJGA 1TD5A 3B47A 2VV7A 4HIAA 3UMEA 2ZMVA 4XT2A 4BMWA 1DP9A 5DJTA 4OOLA 3MJQA 1W63Q 5F69A 2VV8A 5HDCA 3D3OA 3OC2A 3TRCA 4YOFA 2W3EA 2W3DA 2L4RA 3TE8A 5LBRA 1S66L 2O9CA 4HJ6A 3K2NA 4KQOA 2OWHA 4NXGA 3DBAA 3O5YA 1ZTUA 1YKDA 2VGLS 1X0OA 2O99A 3EQUA 3OCNA 4O8GA 1TS0A 2LB5A 4LRYC 2VJWA 2PT7A 4BBUA 3LIBA 2Z6DA 3CAXA 5F68A 5F5YA 4MCWA 2JKTI 2VX8A 3LIEA 2PR6A 3GDIA 2LB9A 3BQ8A 2HF6A 2MJ6A 4Y5FA 3F1PA 2R78A 3BWLA 3C38A 4L9GA 5AVEA 1Y28A 4ETXA 2XA7S 2QYBA 2M7UA 1V9YA 4K08A 4NXFA 4JGRA 5HSQA 2KX6A 3LI9A 4KUKA 2W3HA 4P6ZM 3KO6A 5HPIA 3C30A 1OTIA 4EERA 3IBRA 5G4YA 2PD8A 5HWVA 2GX5A 4HNBA 4WN5A 5HPFA 2NUTC 2L0WA 4I3JA 3R7WB 5IU1A 2W1TB 4BBTA 1LSVA 4MN7A 3NJAA 1OJ5A 3UB8A 1LSXA 3CWFA 4L9EA 3FG8A 5KIZA 4F3LA 4II7A 3K3DA 3F1NB 3T4KA 3ZQ5A 2PHYA 3H9WA 1BYWA 5HD5A 5TJJA 1S4SA 3S7PA 1XJ6A 4HHDA 3T4OA 1N9OA 3P7NA 4DJ3A 2OOLA 4DMZA 2J3TC 1DP8A 3TJZC 4L0LA 4GS9B 4HP4A 2QKPA 3ZYTA 5AVFA 4GHIA 2A24A 3UE6A 2B02A 4B93A 3R7WA 5DKLA 2W1TA 2FH5A 1S4RA 1VHMA 3KSGA 5HL6A 1MZUA 4R38A 4MMNA 4WELA 1S1YA 3CUEC 3K3CA 2GZAA 3MQQA 1P0ZA 4RQ9A 3F1NA 1EW0A 3RTYA 3T4LA 3ICYA 2KLIA 3MQOA 4ARZB 1P9WA 2Y79A 3EWKA 2ZOHA 2K31A 2W3FA 1T1AA 3NOUC 1STZA 2BASA 1P97A 3LI8A 3KSHA 1OPXA 2H28A 5DKKA 4ME4A 2K2NA 3VE4A 1N9NA 1OTEA 3PBQA 4R6LA 5EFWA 2GNXA 3ULFA 5IT5A 1GSXA 2XRNA 3KX0X 3EEAA 2V0UA 1TS8A 4CLCB 3F1OB 3MXQA 4PKYG 2K7SA 4GW9A 3T4SA 4G3WA 3T50A 2O0YA 4NEED 5HDSA 2VEAA 4NKPA 3C2WA 1T1BA 1XJ2A 4Y2FA 4EETB 1DP6A 2VLGA 2QHKA 4CQHA 5KSHA 4MN5A 2EA9A 3NOPC 1OTBA 5DFYA 1TS7A 3EEHA 2INWA 4HOIA 4M4XA 2OWJA 5C5KA 3CUEA 4WL9A 3PR6A 3LIAA 4EEUA 1T1CA 4I39A 3BW6A 5HWWA 4P6ZS 3PHYA 2W1RA 1OJGA 3H82B 4LPZA 3B42A 4BJPA 4G3KA 1P9RA 4IUKA 2HJ9C 4I3AA 2V1BA 5IS1A 1NLZA 4NXEA 4ETZA 3A0RA 3JVUA 2HGVA 4JGQA 4R3AA 4WUJA 2GJ3A 2EWVA 2FZ0A 4EXOA 2I9VA 3SW1A 4NXBA 2JKRI 4EW7A 3MMHA 4DN0A 2JHEA 1GSVA 1D7EA 1YAXA 3S7QA 4Z1WA 4FOFA 4Y3IA 4HJ3A 5HD3A 3A0SA 3R4KA 2B18A 4JGOA 4B9OA 2PR5A 2QWSA 3FC7A 5DJUA 3IS2B 1D06A 2Z6CA 4GLQA 3TW8A 4HH3A 1XJ4A 2J3TD 2PDRA 3T4JA 1LSWA 1W63M 3BY8A 2IA2A 3EGDC 1UWNX 1LL8A 1G6OA 4EQ1A 3G6OA 4UEYA 1VB6A 2CMNA 2W27A 3CLOA 1GSWA 2YKFA 3KSFA 1OTAA 2ZOIA 3OOVA 1DRMA 3RH8B 4OOMA 1MC0A 3LR0A 3VV4A 2M1CA 2HV1A 1OTDA 4PAUA 3E4OA 3T4QA 5TBMB 2D02A 2XSSA 4HI4A 2VKSA 4WLAA 3BY9A 5J3WA 5I5LA 2DMWA 3LICA 1V9ZA 3E0YA 4YNRA 2QJ5A 5HWTA 4LLOB 1YSQA 3NHQA 1XJ3A 4WEJA 3D72A 4XT2B 1S1ZA 1MKMA 4G3VA 4CLCC 2G7UA 2D01A 2J3WA 3PYPA 5F6AA 4KUOA 2XROA 1TF1A 1H3QA 1XFQA 4GS9A 4GJ4A 4H6JB 4FSFA 1G28A 3B33A 5HZHA 3OBFA 3UB9A 5TBMA 1XFNA 3BJNA 3E98A 2WKQA 4HQAA 3UB7A 4PKYA 3V67A 3S7NA 4UQIM 3LR4A 4I5SA 1H8MA 3UE3A 3VOLA 4GCZA 1TS6A 4WEKA 4ARZA 1NLYA 1NWZA 3KYQA 3LUQA 3E4QA 2KDKA 4EEPA 3OLOA 2A2LA 4KQDA 4IHQA 3F1PB 2V1AA 2WKPA 3CI6A 3W2ZA 1ZHHB 4DJ2A 2OAQ1 3FPWA 4HY8A 1KOUA 3LFVA 4H6JA 3MR0A 2VZWA 3EOIA 4I38A 3NOTC 1ODVA 2P08A 2O9AA 2O9BA 3KSIA 1UGUA 3EGXC 4LRZE 4ZRRA 1YSPA 2PYRA 4CLCA 1OT6A 2V9AA 3F1OA 2VGLM 3UMDA 3PXPA 3MFXA 1S67L 1LT0A 1T18A 2V0WA 3OCLA 2EWWA 1NRJA 5J7EA 3FPVA 4F3LB 4BWIA 2KOIA 4LRXC 4Q0HA 5A8BA 3PBSA 1UWPX 3LYXA 4HH2A 1F5MA 2WKRA 4BBVA 3KYZA 1F98A 1IOUA 4L9FA 5J4EA 2J80A 3P01A 3A0VA 2XA7M 4JGPA 3CITA 3MF0A 4HP9A 3U2AA 3UB6A 3H7WB 2M7VA 1JNUA 4GHIB 2A24B 4HJ4A 3RFBA 3H82A 3T4TA 4I3IA 2NUPC 2W3GA 3GECA 3VE3A 2P04A 2PD7A 3LIDA 3PBOA 4WF0A 2P7JA 1OT9A 3IBJA 2PYPA 5MC7A 5HDDA 2JKTM 3PBNA 4O0PA 3HJIA 3EQVA 2VA0A 3LIFA 3JVVA 4MN6A 2HJEA 2Y8HA 4Q0IA 3LR5A 1WA9A 4AFIA 4EUVA 4Q0JA 3IS2A 5DF9A 3PBRA 4CLCD 1N9LA 2ZBBA 1IFQA 4EU0A 1F9IA 2L1MA 2QJ7A 4R70A 5L8MA 3H7WA 2OAP1 5CX7A 5G4ZA 4QPRA 4YWZA 3HCYA 5K5BA 2YKHA 4EESA 1T19A 3E4PA 4O01A 5FL3A 4E04A 2JKRM 2VV6A 4PHTA 3HJKA 5DFXA 5AJGA 3LR3A 4UQIS 2ZMFA 3C8CA 3S7OA 4IUHA 3BQAA 3PBTA 4MDZA 3MQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JN7 A;  2W0N A;  2VV7 A;  4HIA A;  3UME A;  4XT2 A;  1DP9 A;  5DJT A;  3MJQ A;  5F69 A;  5HDC A;  2VV8 A;  2L4R A;  1S66 L;  4HJ6 A;  2OWH A;  4NXG A;  1X0O A;  1TS0 A;  4LRY C;  4BBU A;  3LIB A;  2Z6D A;  3CAX A;  5F68 A;  5F5Y A;  3LIE A;  2PR6 A;  3GDI A;  3F1P A;  2R78 A;  3BWL A;  4L9G A;  5AVE A;  1Y28 A;  1V9Y A;  4K08 A;  4NXF A;  4JGR A;  5HSQ A;  2KX6 A;  3LI9 A;  4KUK A;  1OTI A;  4EER A;  3IBR A;  5G4Y A;  2PD8 A;  5HWV A;  4HNB A;  4WN5 A;  2L0W A;  4I3J A;  5IU1 A;  4BBT A;  1LSV A;  3NJA A;  1OJ5 A;  3UB8 A;  1LSX A;  3CWF A;  4L9E A;  3FG8 A;  5KIZ A;  4F3L A;  3K3D A;  3F1N B;  3ZQ5 A;  2PHY A;  3H9W A;  1BYW A;  5HD5 A;  1S4S A;  1XJ6 A;  4HHD A;  1N9O A;  3P7N A;  4DJ3 A;  2OOL A;  1DP8 A;  4GS9 B;  4HP4 A;  2QKP A;  5AVF A;  4GHI A;  2A24 A;  3UE6 A;  2B02 A;  5DKL A;  1S4R A;  1MZU A;  4R38 A;  1S1Y A;  3K3C A;  3MQQ A;  1P0Z A;  4RQ9 A;  3F1N A;  1EW0 A;  3RTY A;  3ICY A;  3MQO A;  3EWK A;  2ZOH A;  1T1A A;  3NOU C;  2BAS A;  1P97 A;  3LI8 A;  2H28 A;  5DKK A;  3VE4 A;  1N9N A;  1OTE A;  4R6L A;  5EFW A;  3ULF A;  1GSX A;  3KX0 X;  2V0U A;  1TS8 A;  3F1O B;  3MXQ A;  4PKY G;  2K7S A;  4GW9 A;  3T50 A;  5HDS A;  2VEA A;  3C2W A;  1T1B A;  1XJ2 A;  4EET B;  1DP6 A;  2VLG A;  2QHK A;  4MN5 A;  2EA9 A;  3NOP C;  1OTB A;  1TS7 A;  3EEH A;  2INW A;  4HOI A;  4M4X A;  2OWJ A;  4WL9 A;  3LIA A;  4EEU A;  1T1C A;  4I39 A;  5HWW A;  3PHY A;  1OJG A;  3H82 B;  4LPZ A;  4I3A A;  2V1B A;  5IS1 A;  4NXE A;  3A0R A;  4JGQ A;  4R3A A;  4WUJ A;  2GJ3 A;  4EXO A;  2I9V A;  3SW1 A;  4NXB A;  4EW7 A;  2JHE A;  1GSV A;  1D7E A;  4HJ3 A;  5HD3 A;  3A0S A;  4JGO A;  4B9O A;  2PR5 A;  2QWS A;  3FC7 A;  5DJU A;  3IS2 B;  1D06 A;  2Z6C A;  4HH3 A;  1XJ4 A;  2PDR A;  1LSW A;  3BY8 A;  1UWN X;  1LL8 A;  4EQ1 A;  3G6O A;  1VB6 A;  2CMN A;  2W27 A;  3CLO A;  1GSW A;  2YKF A;  1OTA A;  2ZOI A;  1DRM A;  3RH8 B;  2M1C A;  2HV1 A;  1OTD A;  3E4O A;  5TBM B;  2D02 A;  4HI4 A;  4WLA A;  3BY9 A;  5J3W A;  5I5L A;  3LIC A;  1V9Z A;  2QJ5 A;  5HWT A;  4LLO B;  3NHQ A;  1XJ3 A;  3D72 A;  4XT2 B;  1S1Z A;  2D01 A;  3PYP A;  5F6A A;  4KUO A;  1XFQ A;  4GS9 A;  4H6J B;  1G28 A;  3B33 A;  5HZH A;  3UB9 A;  5TBM A;  1XFN A;  2WKQ A;  4HQA A;  3UB7 A;  4PKY A;  4I5S A;  3VOL A;  4GCZ A;  1TS6 A;  1NWZ A;  3LUQ A;  3E4Q A;  2KDK A;  4EEP A;  3OLO A;  4KQD A;  3F1P B;  2V1A A;  2WKP A;  4DJ2 A;  4HY8 A;  1KOU A;  4H6J A;  3MR0 A;  4I38 A;  3NOT C;  1ODV A;  1UGU A;  4LRZ E;  2PYR A;  1OT6 A;  2V9A A;  3F1O A;  3UMD A;  3MFX A;  1S67 L;  1LT0 A;  1T18 A;  2V0W A;  5J7E A;  4F3L B;  4LRX C;  5A8B A;  1UWP X;  3LYX A;  4HH2 A;  2WKR A;  4BBV A;  1F98 A;  4L9F A;  5J4E A;  2J80 A;  3A0V A;  4JGP A;  4HP9 A;  3UB6 A;  3H7W B;  1JNU A;  4GHI B;  2A24 B;  4HJ4 A;  3H82 A;  4I3I A;  3GEC A;  3VE3 A;  2PD7 A;  3LID A;  4WF0 A;  2P7J A;  1OT9 A;  2PYP A;  5HDD A;  3HJI A;  3LIF A;  4MN6 A;  1WA9 A;  3IS2 A;  1N9L A;  2ZBB A;  1F9I A;  2L1M A;  2QJ7 A;  4R70 A;  3H7W A;  5G4Z A;  4YWZ A;  2YKH A;  4EES A;  1T19 A;  3E4P A;  4E04 A;  2VV6 A;  3HJK A;  3C8C A; 
#chains in the Genus database with same CATH topology
 4KZ5 A;  3B47 A;  4LCM A;  3G2Z A;  3UME A;  3ZFZ A;  3WS1 A;  4BMW A;  4F94 A;  4OOL A;  5F69 A;  3QNC A;  3TRC A;  2W3E A;  2L4R A;  2V1Z A;  5DTT A;  1S66 L;  1LI0 A;  4QWO A;  1K0K A;  2EX9 A;  3K2N A;  2BLS A;  3OPH A;  3SZT A;  3W4P A;  3T1X A;  2VGL S;  3EQU A;  5GHY A;  4LRY C;  2VJW A;  2VGK A;  2Z6D A;  3I7J A;  2JKT I;  2PR6 A;  4X53 A;  3IH9 A;  3GDI A;  4Y5F A;  1KE0 A;  1CF0 A;  3CMZ A;  2R78 A;  1ESI A;  5DTK A;  2XA7 S;  1V9Y A;  3UO9 A;  2DRW A;  4OOY A;  4JGR A;  1RGY A;  4NK3 A;  5AQ7 A;  5HSQ A;  2EXB A;  1GHI A;  4KUK A;  4P6Z M;  1QME A;  5E43 A;  2FFF B;  1G68 A;  3C30 A;  3KO6 A;  5EEC A;  1CK3 A;  5G4Y A;  4QJG A;  4GZB A;  2ZMA A;  1GA9 A;  4EBN A;  4HNB A;  1Y4O A;  2NUT C;  4BBT A;  2X71 A;  1LSV A;  3V39 A;  1OJ5 A;  1WYB A;  3ISG A;  4PM7 A;  3H9W A;  2HDQ A;  2HDS A;  2XFS A;  2ZC4 B;  5FQJ A;  3FWL A;  3V3S A;  4DKI A;  3T4O A;  4HBT A;  2B95 A;  1MWT A;  4DJ3 A;  2A3U A;  5EM1 A;  3HL9 A;  3LGO A;  3RXX A;  3BRM A;  2Y2I A;  3Q7V A;  1Y54 A;  5AVF A;  4GHI A;  5E2F A;  2BG1 A;  4FTX A;  3C7U A;  3ZNY A;  2V8C A;  3R7W A;  1PFL A;  2W1T A;  1VHM A;  3KSG A;  2Y2M A;  5HL6 A;  5GLD A;  3LEZ A;  3HUO A;  4RQ9 A;  3F1N A;  4UHU A;  1L3L A;  3GVB A;  5AQA A;  2ZM0 A;  2Q0O A;  1YQS A;  2K31 A;  2W3F A;  2WYX A;  4LV2 A;  2H0Y A;  2H28 A;  3IF6 B;  5DKK A;  3A3F A;  1KE4 A;  3VE4 A;  1OTE A;  5A90 A;  4KQR A;  2GNX A;  2WK0 A;  3LEQ A;  2EX8 A;  1RP5 A;  3KYE A;  4UAA A;  2ZQD A;  2OSU A;  3BFF A;  3MXQ A;  5EOE A;  3IT9 A;  2K7S A;  5HDS A;  4NKP A;  1SDE A;  1DY6 A;  1VM1 A;  2QHK A;  3BFG A;  1BLC A;  3C4P A;  5KSH A;  4MN5 A;  4QB8 A;  1PW1 A;  3S1Y A;  3ITA A;  5DFY A;  1TS7 A;  4ZJ3 A;  2INW A;  2OWJ A;  3DWK A;  4EEU A;  2ZL1 B;  5HWW A;  3PHY A;  1ONH A;  4LPZ A;  3T1Q B;  2V1B A;  3C4O A;  3MZE A;  2VK3 A;  4ETZ A;  1YLT A;  5FA7 A;  4X69 A;  4NXB A;  4EW7 A;  4FOF A;  4X55 A;  4HJ3 A;  4JGO A;  3ZDJ A;  4B9O A;  5EVE A;  5GLB A;  4Z9Q A;  2XEP A;  1XJ4 A;  2PDR A;  1VQQ A;  1W63 M;  4LCL A;  3BY8 A;  3NI9 A;  1YLY A;  4DDS A;  2FFY A;  4EQ1 A;  3G6O A;  1VB6 A;  2CMN A;  1YLW A;  2YKF A;  2HDU A;  4ZJ1 A;  3OOV A;  1NZU A;  3RH8 B;  2E8I A;  2Y2G A;  2M1C A;  4E3O A;  2ZC5 B;  4PAU A;  2D02 A;  1M40 A;  1NZO A;  4FUW A;  1NY0 A;  3IF6 C;  5EE8 A;  3MXR A;  2DMW A;  3LIC A;  1V9Z A;  5E2E A;  4YNR A;  4LLO B;  3Q07 A;  1YSQ A;  3ZG5 A;  4WEJ A;  3M6H A;  2ZM8 A;  5CTN A;  5CER A;  2G7U A;  1YPR A;  2ZC3 B;  5F6A A;  2CC1 A;  1HD8 A;  1TF1 A;  1H3Q A;  4GS9 A;  3IF5 A;  3W8K A;  4IBR A;  2PRF A;  3IXG A;  3UB9 A;  5TBM A;  4R23 A;  4DXC A;  3TSG A;  3BJN A;  1TEM A;  5U47 A;  3SH8 A;  3PTE A;  4HQA A;  1DJB A;  2Z2M B;  4PKY A;  3V67 A;  4S2L A;  3S7N A;  1W8Y A;  3IHB A;  4FH2 A;  4S2N A;  3VOL A;  2XDM A;  2ZC7 A;  1N4O A;  3LUQ A;  1CEF A;  3PAE A;  2A2L A;  4KEN B;  2WKP A;  3ZCZ A;  3N8R A;  4R4R A;  1FSW A;  2OAQ 1;  1XGI A;  1FR1 A;  5TR7 A;  3EOI A;  4JF4 A;  5HFO A;  2JCH A;  1UGU A;  3MZD A;  2IWD A;  1VET A;  4D60 A;  5JYO A;  1OT6 A;  1H8Y A;  1H0M A;  1S67 L;  4P85 A;  1LT0 A;  2V0W A;  4IBX A;  4OQH A;  2QPN A;  4QU3 A;  4GOG A;  3IWI A;  4LRX C;  4Q0H A;  4Y15 A;  4S2O A;  4P87 A;  4OPR A;  2XD1 A;  3KYZ A;  2Y55 A;  3MKE A;  1ES5 A;  1XX2 A;  3MF0 A;  2Y2J A;  3Q7V B;  3H7W B;  5CED A;  3G30 A;  4GHI B;  4HJ4 A;  4E3M A;  1TDG A;  1BLH A;  1YMS A;  3OPL A;  1KGE A;  3B3X A;  3VE3 A;  4S2P A;  5GHZ A;  3UE0 A;  2ZQA A;  3N4I A;  1OT9 A;  2PYP A;  5HDD A;  2JKT M;  3PBN A;  3MXS A;  1FR6 A;  1LHY A;  4WZ5 A;  5M18 A;  3UB5 P;  1WA9 A;  4AFI A;  5DF9 A;  1CI8 A;  3PBR A;  1IFQ A;  1ONG A;  3HLC A;  1FCM A;  2PBD P;  2WAE A;  5A92 A;  5K5B A;  3HLD A;  4EES A;  5D3O A;  1W8Q A;  3E4P A;  3FYZ A;  2OLU A;  1PI4 A;  4JPM A;  5TFQ A;  5DFX A;  5F82 A;  3VOY A;  2Y2K A;  1IYQ A;  4UQI S;  3C8C A;  3PBT A;  5A91 A;  5KMW A;  5EVI D;  1K56 A;  2JN7 A;  2RL3 A;  3JPU A;  4Y17 A;  1W63 Q;  5HDC A;  3D3O A;  5FI6 A;  3UY6 A;  3BFE A;  5LBR A;  5HX9 A;  4HJ6 A;  4KQO A;  4LFU A;  1KDS A;  1MY8 A;  3WRZ A;  4P6B A;  3M6B A;  3O5Y A;  1ZTU A;  2QZ6 A;  4IVI A;  4LV1 A;  3OCN A;  4O8G A;  1TS0 A;  2LB5 A;  1NYM A;  2PT7 A;  4C6Y A;  2A49 A;  4EUZ A;  3CAX A;  5F5Y A;  4N1H A;  1M6K A;  3ZVT A;  3BQ8 A;  2PU4 A;  2HF6 A;  2MJ6 A;  1K55 A;  1IKI A;  3F1P A;  3BWL A;  3C38 A;  4GD6 A;  4L9G A;  1JWV A;  4ETX A;  2H10 A;  2QYB A;  4K08 A;  4NXF A;  4ESP A;  2KX6 A;  4HEF A;  2ZQC A;  5J8X A;  3C5A A;  4GN2 A;  1K4E A;  4MBF A;  1SHV A;  4WN5 A;  1XXM A;  4PM9 A;  4MN7 A;  5JYP A;  3UB8 A;  1LSX A;  3FG8 A;  3LY3 A;  3K3D A;  4FCF A;  2PHY A;  5HD5 A;  4JF6 A;  5TJJ A;  3S7P A;  3WS2 A;  3NY4 A;  1XJ6 A;  4RX3 A;  1VEU A;  4HHD A;  3A3J A;  1XP4 A;  4DMZ A;  1DP8 A;  1BZA A;  4GS9 B;  3ZYT A;  5DF8 A;  5CGX A;  1FIK A;  1XGJ A;  1G5U A;  3UE6 A;  2Y2N A;  3G2Y A;  3MKF A;  1ZC2 A;  1PZP A;  4MMN A;  5FQ9 A;  2AVX A;  3K3C A;  2GZA A;  1BLP A;  1EW0 A;  3RTY A;  4EQI A;  5CGS A;  3GMW A;  3MQO A;  1F2K A;  2Y79 A;  3VSK A;  3EWK A;  3ZHH A;  1E4D A;  1RCJ A;  1J9M A;  2BAS A;  4LGW A;  1P97 A;  3Q7Z A;  4E3K A;  1N9N A;  3PBQ A;  3QP8 A;  4OLG A;  1VET B;  5IT5 A;  1ACF A;  1TVF A;  2XRN A;  4ZBE A;  3EEA A;  5HL1 A;  1TS8 A;  4IVK A;  3UPP A;  3T50 A;  2O0Y A;  1CJF A;  3C2W A;  3HBR A;  1XJ2 A;  2ZQ9 A;  2Y2H A;  2UV0 E;  1BSG A;  4WBG A;  5GLC A;  3QP1 A;  3SOI A;  1XA7 A;  3EEH A;  4M4X A;  5C5K A;  3HLW A;  3CUE A;  3TG9 A;  4X6T A;  4I39 A;  3BW6 A;  3B42 A;  4G3K A;  1K25 A;  4I3A A;  4EBP A;  1NLZ A;  4WUJ A;  2WAD A;  4KZA A;  5M19 A;  2FZ0 A;  3BLS A;  3MMH A;  1GSV A;  1YAX A;  3QP2 A;  1KGF A;  4N1X A;  3A0S A;  3LY4 A;  2B18 A;  4KZ3 A;  2PR5 A;  3FC7 A;  3UPN A;  1D06 A;  4GLQ A;  3GV9 A;  5EVL A;  1S6R A;  3V50 A;  4OPY A;  1BUL A;  1ES3 A;  3HVF A;  5FI7 A;  1UWN X;  4OH0 A;  1LL8 A;  3NDE A;  1G6O A;  1FIL A;  3N8S A;  2HP9 A;  4DF6 A;  4UEY A;  4S2N C;  4XUZ A;  4K0W A;  1GSW A;  1PW8 A;  3Q1F A;  4GB7 A;  1E3U A;  2PU2 A;  4GKU A;  1OTA A;  2ZOI A;  5FSR A;  3P98 A;  2XSS A;  4C75 A;  1NYY A;  4HI4 A;  4DE0 A;  1L2S A;  2VKS A;  4WLA A;  1JVJ A;  1J3W A;  5I5L A;  5HWT A;  1XJ3 A;  1S1Z A;  2PBY A;  5E2H A;  3SS3 A;  2B5R A;  4BD0 A;  1GHP A;  3G31 A;  4U0T A;  4H6J B;  4EWF A;  3NBL A;  3MS6 A;  4BD1 A;  1E25 A;  5HZH A;  3D4F A;  4PPR A;  5GLA A;  3E98 A;  2WKQ A;  3UB7 A;  1FCN A;  1LL9 A;  1PI5 A;  3QP5 A;  3L7H A;  3O86 A;  4GCZ A;  1TS6 A;  4ARZ A;  1NLY A;  3KYQ A;  3G32 A;  2KDK A;  4Y7P A;  4IHQ A;  1FCO A;  3F1P B;  5KSC A;  2Y4A A;  5L09 A;  3W2Z A;  3ITB A;  3N8L A;  3LFV A;  4KZ7 A;  1GA0 A;  4ZJ2 A;  3NOT C;  3VMA A;  4WZ5 C;  2I72 A;  3EGX C;  4ZRR A;  5FAS A;  3E2K A;  3G34 A;  1K6R A;  3MSH A;  4CLC A;  3NEC A;  2VGL M;  5HAI A;  4CJN A;  3NCK A;  1DJA A;  1NRJ A;  4QY6 A;  2Y91 A;  4DXB A;  2KOI A;  1O7E A;  5A8B A;  3LYX A;  4HH2 A;  1F5M A;  2WKR A;  1VEU B;  5FQK A;  1F98 A;  2J80 A;  2XA7 M;  2XF3 A;  3CIT A;  5AQ9 A;  3GTC A;  3T4T A;  2WUQ A;  2XD5 A;  4I3I A;  2NUP C;  3Q81 A;  2XR0 A;  5TGF A;  4JKT A;  2EFX A;  4JF5 A;  5F1G A;  4Y0O A;  2PD7 A;  4X1M A;  4GDB A;  4JBF A;  3IBJ A;  2JC7 A;  3TOI A;  4DE2 A;  5GHX A;  3HJI A;  2HJE A;  3IH8 A;  1QMF A;  4S2K A;  4DE3 A;  4HBU A;  4EUV A;  2ZM2 A;  2ZBB A;  4EU0 A;  2QJ7 A;  5L8M A;  5CX7 A;  4JXW A;  4QPR A;  4YWZ A;  4X68 A;  1SKO A;  4OLD A;  1T19 A;  2JE5 A;  4O01 A;  2WKE A;  1K55 C;  4PHT A;  3HJK A;  2R9X A;  3HUM A;  2ZMF A;  4IUH A;  2X01 A;  2V20 A;  3MQ0 A;  3IX3 A;  4CLC E;  3DAV A;  3RXW A;  2W0N A;  2ZMV A;  3MJQ A;  2VV8 A;  3OC2 A;  4JXG A;  1ZKJ A;  2J7V A;  4YOF A;  2W3D A;  2Y2L A;  3TE8 A;  2DCF A;  3HLG A;  4D2O A;  2OWH A;  3IQA A;  3SS5 A;  2ZQ8 A;  3DBA A;  1YKD A;  3PAG A;  4PM6 A;  1X0O A;  2O99 A;  2H5S A;  2G2W A;  4BBU A;  3LIB A;  2XLN A;  4MCW A;  4K0X A;  2VX8 A;  1FSY A;  3GSG A;  4B88 A;  4PM5 A;  4FD8 A;  2LB9 A;  3DTM A;  3ZG0 A;  1MWR A;  2UWX A;  3O87 A;  5AVE A;  1Y28 A;  1U60 A;  2M7U A;  4Y0U A;  2J9P A;  2W3H A;  4OP5 A;  4EER A;  4OP8 A;  5CHU A;  5HWV A;  2GX5 A;  2L0W A;  3R7W B;  2W1T B;  2Y2Q A;  3ZG9 B;  5CEC A;  2HP6 A;  3NJA A;  4Y13 A;  5L2F A;  3CWF A;  4KZ9 A;  2QMI A;  5FAQ A;  4MEZ A;  4II7 A;  1WE4 A;  3F1N B;  4S2J A;  3ZQ5 A;  1NJ4 A;  1BYW A;  2VGJ A;  3MBZ A;  1K57 A;  3DTI A;  3W4O A;  5CEB A;  3P7N A;  5EPH A;  2OOL A;  2J3T C;  3TJZ C;  4GNU A;  4WYY A;  4R1G A;  4HP4 A;  3CJM A;  2HDR A;  3GQZ A;  2B02 A;  2Q9N A;  5CHM A;  1S4R A;  4E6W A;  4R0Q A;  4JLF A;  3IXH A;  3BYD A;  4R38 A;  3O88 A;  3N7W A;  3IX8 A;  4WEL A;  4MBK A;  3CUE C;  3S22 A;  3MQQ A;  1P0Z A;  1KE3 A;  3VSL A;  3ICY A;  3Q82 A;  2KLI A;  4ARZ B;  5EM0 A;  1P9W A;  3FKV A;  4A5R A;  2ZLY A;  3G4P A;  2V2F F;  5FQM A;  5HW3 A;  1STZ A;  1ERM A;  3LI8 A;  3KSH A;  1OPX A;  5BOH A;  3HUN A;  4ME4 A;  2K2N A;  4R6L A;  5EOO A;  3T12 B;  4CPK A;  1EWZ A;  1A0K A;  3KX0 X;  2V0U A;  3IXD A;  3IXB A;  4CLC B;  2E8J A;  2C5W B;  3N6I A;  4G3W A;  4MLL A;  4OVD A;  1PRQ A;  1T1B A;  1DP6 A;  2VLG A;  4UA9 A;  4MBH A;  4CQH A;  1EI5 A;  2ZD8 A;  1PYY A;  3NOP C;  1OTB A;  4KZ4 A;  3E2L A;  4PMA A;  4WL9 A;  1ALQ A;  4P6Z S;  2W1R A;  5HAQ A;  1YT4 A;  5CHJ A;  1OJG A;  4BJP A;  2WZX A;  2HJ9 C;  1L0E A;  4KG6 A;  4JGQ A;  4R3A A;  2GJ3 A;  3T1S A;  2EWV A;  3QHY A;  4EXO A;  3SW1 A;  4X56 A;  3VP2 A;  4KZB A;  4DN0 A;  2JHE A;  1ERQ A;  3S7Q A;  4Z1W A;  1MWU A;  4Y3I A;  4OQI A;  1HTZ A;  3IWQ A;  4BL2 A;  2WGI A;  3BFC A;  3HLF A;  4XUX A;  1K6S A;  5DJU A;  1D1J A;  2Z6C A;  3HLB A;  4X25 A;  1LSW A;  1NRF A;  2GDN A;  1K54 A;  3ZG8 B;  2Y2P A;  5CGW A;  3VP1 A;  1SKO B;  4DDY A;  2W27 A;  3VP0 A;  3CLO A;  3KSF A;  4OQG A;  1DRM A;  4U0X A;  3LR0 A;  3NUL A;  3CZD A;  1OTD A;  3E4O A;  5TBM B;  3L9K A;  1MKI A;  5FI2 A;  2EX2 A;  3FV7 A;  1PIO A;  3ZG7 B;  2QJ5 A;  3D72 A;  1MKM A;  2WGW A;  4G3V A;  4CLC C;  3PYP A;  2J3W A;  3WS4 A;  1SKF A;  4LV3 A;  4KUO A;  2XRO A;  1KDW A;  2WAF A;  1H5X A;  5CRF A;  4GJ4 A;  5FEF A;  3U4L P;  4FSF A;  1G28 A;  4BLM A;  3B33 A;  3GR2 A;  3V3R A;  1L0F A;  1MBL A;  4IED A;  4UQI M;  2G2U A;  3LR4 A;  1FOF A;  4I5S A;  2IWC A;  3UE3 A;  2HPB A;  4WEK A;  4U3T A;  3E4Q A;  3OLO A;  4KQD A;  2V1A A;  5FDH A;  1HZO A;  3UDF A;  4OQ0 A;  3CI6 A;  3FPW A;  4HY8 A;  3ZVW A;  1N9B A;  4I38 A;  1L0G A;  2O9A A;  4K91 A;  3DTE A;  5FEG A;  2ZC6 B;  4LRZ E;  1YSP A;  1CEG A;  2PYR A;  2V9A A;  3F1O A;  3UMD A;  3DWZ A;  3M2K A;  3MFX A;  3PXP A;  1T18 A;  3OCL A;  2EWW A;  3FPV A;  3MZF A;  1SCW A;  1FQG A;  5L10 A;  1Z6F A;  4UA6 A;  3PBS A;  1UWP X;  3UNW A;  1O07 A;  4R4S A;  1IOU A;  4L9F A;  1C3B A;  4RA7 A;  4JGP A;  2C6W B;  1W79 A;  4HP9 A;  3A3I A;  4S2I A;  1KVL A;  3NIA A;  5KZH A;  3H82 A;  3IWO A;  1JTG A;  5EVI A;  2W3G A;  1PZO A;  2XH9 A;  4OPZ A;  3LCE A;  4WF0 A;  3HRE A;  4E3N A;  1XA1 A;  2XFT A;  2VA0 A;  3FKW A;  2Y8H A;  2WKI A;  3LR5 A;  2J8Y A;  1H8Z A;  4Q0J A;  3IS2 A;  3CHW P;  1N9L A;  1IYS A;  4R70 A;  5A93 A;  1MXO A;  3H7W A;  5HAR A;  5G4Z A;  4FH4 A;  3HCY A;  5FL3 A;  4E04 A;  2JKR M;  3C7V A;  1JWP A;  3IX4 A;  4N9L A;  4JXV A;  1S0W A;  5CTM A;  3S7O A;  2IWB A;  1PWC A;  1K4F A;  3BLM A;  2WKH A;  2Z2L B;  4IJG A;  1TD5 A;  2VV7 A;  4HIA A;  4XT2 A;  1DP9 A;  5DJT A;  4KQQ A;  4EV4 A;  1BUE A;  2JKF A;  2XGN A;  2O9C A;  1LI9 A;  5DTS A;  4NXG A;  1PWD A;  4PM8 A;  1GHM A;  1W5D A;  2XQZ A;  1K57 C;  3VOZ A;  1PWG A;  4E3I A;  2P74 A;  5F68 A;  3LIE A;  1IKG A;  5FAP A;  4ZAM A;  1TDL A;  4OON A;  1XPB A;  4LV0 A;  4NG2 A;  4X1L A;  2HZ5 A;  3CPT A;  4KG5 A;  2XK1 A;  3UPO A;  5FQQ A;  4E3J A;  4QHC A;  2Y2O A;  4KZ8 A;  3LI9 A;  5HPI A;  1K56 D;  1OTI A;  3IBR A;  2PD8 A;  4C3Q A;  1K38 A;  2EXA A;  5HPF A;  1AXB A;  1XKZ A;  4I3J A;  5IU1 A;  5IHV A;  1OME A;  3BM6 A;  2RCX A;  1LLB A;  1IYO A;  3T1R A;  4RYE A;  4L9E A;  5KIZ A;  4F3L A;  3T4K A;  4KZ6 A;  2Y59 A;  3FZC A;  1S4S A;  2R9W A;  1YLJ A;  2WGW B;  5CXW A;  3RJU A;  1N9O A;  3HLE A;  2HP5 A;  4H8R A;  4L0L A;  1YLP A;  5M1A A;  4NET A;  3DW0 A;  2QKP A;  1ESU A;  3VP4 A;  2A24 A;  3A3D A;  5EUA A;  4B93 A;  5DKL A;  2FH5 A;  4M3K A;  5G18 A;  3IHA A;  1MZU A;  2P9V A;  1SZV A;  1S1Y A;  4B4X A;  3M2J A;  3T4L A;  3OZH A;  4S2M A;  2ZOH A;  4OPQ A;  1T1A A;  3NOU C;  1YLZ A;  4ZDX A;  1ERO A;  4XXR A;  4Q8I A;  4BL3 A;  4YIN A;  5EFW A;  3ULF A;  3OPR A;  1GSX A;  2OV5 A;  3F1O B;  4PKY G;  5DF7 A;  3VP3 A;  3AGD A;  4GW9 A;  3T4S A;  4NEE D;  1K54 C;  2V8F A;  2VEA A;  5FAT A;  2JBF A;  4Y2F A;  4EET B;  1G6A A;  4WMC D;  3G35 A;  3QNB A;  2EA9 A;  1AWI A;  4BQM A;  1BLS A;  5I94 A;  5GL9 A;  4HOI A;  3PR6 A;  4O7D A;  3LIA A;  1T1C A;  3WS0 A;  3D9Y A;  5AQB A;  3GRJ A;  3H82 B;  4UA7 A;  5EVI B;  1LL5 A;  1P9R A;  3NC8 A;  4IUK A;  1IEL A;  5IS1 A;  4YFM A;  4MNR A;  4NXE A;  3A0R A;  3JVU A;  2HGV A;  2JKG A;  4GDN A;  1ES4 A;  2I9V A;  2JKR I;  2EX6 A;  1D7E A;  5HD3 A;  3LO7 A;  4HES A;  3R4K A;  1MWS A;  4ZTK A;  2PAV P;  1WYC A;  2QWS A;  1BTL A;  3IS2 B;  1DJC A;  3SS4 A;  3TW8 A;  4HH3 A;  3T4J A;  2J3T D;  1I2W A;  1GCE A;  5FAO A;  3UDI A;  2IA2 A;  3EGD C;  3UN7 A;  4RVA A;  3BEC A;  3WS5 A;  4Y0T A;  3ZGA B;  1KVM A;  1Z09 A;  2WGV A;  4OOM A;  5F1F A;  1MC0 A;  3WWX A;  3VV4 A;  2HV1 A;  4DE1 A;  3T4Q A;  3UE1 A;  4BEN A;  3JYI A;  2ACG A;  3NDG A;  3VFH A;  2ZJ9 A;  3BY9 A;  5J3W A;  3BFD A;  3E0Y A;  3NHQ A;  4XT2 B;  4RX2 A;  5DVA A;  4DRT A;  5L07 A;  2D01 A;  1XFQ A;  1IYP A;  2BTF P;  3CG5 A;  4E3L A;  1MPL A;  3OBF A;  2J9O A;  1I2S A;  1XFN A;  2X02 A;  4LEN A;  1ZG6 A;  1H8M A;  3O3V A;  3UDX A;  1E3U D;  1NXY A;  3QP4 A;  1YMX A;  3A3E A;  2ZQ7 A;  1NWZ A;  5EVI C;  2Q9M A;  3ZNT A;  4EEP A;  3CPT B;  3VFF A;  1PNE A;  3BEB A;  1ZHH B;  4DJ2 A;  1CI9 A;  1KOU A;  1L0D A;  3P09 A;  4H6J A;  3IF6 A;  4WZ4 A;  3MR0 A;  3W4Q A;  4EBL A;  2VZW A;  3WRT A;  3S4X A;  4OKP A;  1ODV A;  1JWZ A;  2P08 A;  4N92 A;  2O9B A;  3KSI A;  1W7F A;  1BT5 A;  1HLU P;  2H0T A;  4R3J A;  1JTD A;  5E2G A;  3DTK A;  4ID4 A;  5J7E A;  4B4Z A;  4E6X A;  4F3L B;  4BWI A;  5EV0 A;  4QD4 A;  4N9K A;  1SDN A;  4JXS A;  3SH7 A;  4BBV A;  1I5Q A;  4WM9 A;  5J4E A;  3P01 A;  4KG2 A;  2DNS A;  3A0V A;  5FDS A;  3U2A A;  3UB6 A;  2ZL1 A;  4R3B A;  2M7V A;  1JNU A;  3RFB A;  2A24 B;  1HVB A;  3OPP A;  1YM1 A;  3GEC A;  3AGE A;  2OLV A;  1RGZ A;  5FQI A;  2P04 A;  2P9V B;  3AGF A;  1ES2 A;  3LID A;  3PBO A;  2P7J A;  3SH9 A;  5MC7 A;  4O0P A;  3EQV A;  3LIF A;  3JVV A;  4MN6 A;  1ZG4 A;  1IEM A;  4Q0I A;  5F83 A;  1Q2Q A;  4CLC D;  1F9I A;  2L1M A;  4P0M A;  2EFU A;  2OAP 1;  4GD8 A;  2YKH A;  4WMC A;  3QP6 A;  4QY5 A;  2VV6 A;  3V5M A;  5AJG A;  3LR3 A;  3MFD A;  1CQA A;  5HAP A;  1KGG A;  3BQA A;  2WZZ A;  4MDZ A;  1Q2P A; 
#chains in the Genus database with same CATH homology
 4CLC E;  2JN7 A;  2W0N A;  4IJG A;  1TD5 A;  3B47 A;  2VV7 A;  4HIA A;  3UME A;  2ZMV A;  4XT2 A;  4BMW A;  1DP9 A;  5DJT A;  4OOL A;  3MJQ A;  1W63 Q;  5F69 A;  2VV8 A;  5HDC A;  3D3O A;  3OC2 A;  3TRC A;  4YOF A;  2W3E A;  2W3D A;  2L4R A;  3TE8 A;  5LBR A;  1S66 L;  2O9C A;  4HJ6 A;  3K2N A;  4KQO A;  2OWH A;  4NXG A;  3DBA A;  3O5Y A;  1ZTU A;  1YKD A;  2VGL S;  1X0O A;  2O99 A;  3EQU A;  3OCN A;  4O8G A;  1TS0 A;  2LB5 A;  4LRY C;  2VJW A;  2PT7 A;  4BBU A;  3LIB A;  2Z6D A;  3CAX A;  5F68 A;  5F5Y A;  4MCW A;  2JKT I;  2VX8 A;  3LIE A;  2PR6 A;  3GDI A;  2LB9 A;  3BQ8 A;  2HF6 A;  2MJ6 A;  4Y5F A;  3F1P A;  2R78 A;  3BWL A;  3C38 A;  4L9G A;  5AVE A;  1Y28 A;  4ETX A;  2XA7 S;  2QYB A;  2M7U A;  1V9Y A;  4K08 A;  4NXF A;  4JGR A;  5HSQ A;  2KX6 A;  3LI9 A;  4KUK A;  2W3H A;  4P6Z M;  3KO6 A;  5HPI A;  3C30 A;  1OTI A;  4EER A;  3IBR A;  5G4Y A;  2PD8 A;  5HWV A;  2GX5 A;  4HNB A;  4WN5 A;  5HPF A;  2NUT C;  2L0W A;  4I3J A;  3R7W B;  5IU1 A;  2W1T B;  4BBT A;  1LSV A;  4MN7 A;  3NJA A;  1OJ5 A;  3UB8 A;  1LSX A;  3CWF A;  4L9E A;  3FG8 A;  5KIZ A;  4F3L A;  4II7 A;  3K3D A;  3F1N B;  3T4K A;  3ZQ5 A;  2PHY A;  3H9W A;  1BYW A;  5HD5 A;  5TJJ A;  1S4S A;  3S7P A;  1XJ6 A;  4HHD A;  3T4O A;  1N9O A;  3P7N A;  4DJ3 A;  2OOL A;  4DMZ A;  2J3T C;  1DP8 A;  3TJZ C;  4L0L A;  4GS9 B;  4HP4 A;  2QKP A;  3ZYT A;  5AVF A;  4GHI A;  2A24 A;  3UE6 A;  2B02 A;  4B93 A;  3R7W A;  5DKL A;  2W1T A;  2FH5 A;  1S4R A;  1VHM A;  3KSG A;  5HL6 A;  1MZU A;  4R38 A;  4MMN A;  4WEL A;  1S1Y A;  3CUE C;  3K3C A;  2GZA A;  3MQQ A;  1P0Z A;  4RQ9 A;  3F1N A;  1EW0 A;  3RTY A;  3T4L A;  3ICY A;  2KLI A;  3MQO A;  4ARZ B;  1P9W A;  2Y79 A;  3EWK A;  2ZOH A;  2K31 A;  2W3F A;  1T1A A;  3NOU C;  1STZ A;  2BAS A;  1P97 A;  3LI8 A;  3KSH A;  1OPX A;  2H28 A;  5DKK A;  4ME4 A;  2K2N A;  3VE4 A;  1N9N A;  1OTE A;  3PBQ A;  4R6L A;  5EFW A;  2GNX A;  3ULF A;  5IT5 A;  1GSX A;  2XRN A;  3KX0 X;  3EEA A;  2V0U A;  1TS8 A;  4CLC B;  3F1O B;  3MXQ A;  4PKY G;  2K7S A;  4GW9 A;  3T4S A;  4G3W A;  3T50 A;  2O0Y A;  4NEE D;  5HDS A;  2VEA A;  4NKP A;  3C2W A;  1T1B A;  1XJ2 A;  4Y2F A;  4EET B;  1DP6 A;  2VLG A;  2QHK A;  4CQH A;  5KSH A;  4MN5 A;  2EA9 A;  3NOP C;  1OTB A;  5DFY A;  1TS7 A;  3EEH A;  2INW A;  4HOI A;  4M4X A;  2OWJ A;  5C5K A;  3CUE A;  4WL9 A;  3PR6 A;  3LIA A;  4EEU A;  1T1C A;  4I39 A;  3BW6 A;  5HWW A;  4P6Z S;  3PHY A;  2W1R A;  1OJG A;  3H82 B;  4LPZ A;  3B42 A;  4BJP A;  4G3K A;  1P9R A;  4IUK A;  2HJ9 C;  4I3A A;  2V1B A;  5IS1 A;  1NLZ A;  4NXE A;  4ETZ A;  3A0R A;  3JVU A;  2HGV A;  4JGQ A;  4R3A A;  4WUJ A;  2GJ3 A;  2EWV A;  2FZ0 A;  4EXO A;  2I9V A;  3SW1 A;  4NXB A;  2JKR I;  4EW7 A;  3MMH A;  4DN0 A;  2JHE A;  1GSV A;  1D7E A;  1YAX A;  3S7Q A;  4Z1W A;  4FOF A;  4Y3I A;  4HJ3 A;  5HD3 A;  3A0S A;  3R4K A;  2B18 A;  4JGO A;  4B9O A;  2PR5 A;  2QWS A;  3FC7 A;  5DJU A;  3IS2 B;  1D06 A;  2Z6C A;  4GLQ A;  3TW8 A;  4HH3 A;  1XJ4 A;  2J3T D;  2PDR A;  3T4J A;  1LSW A;  1W63 M;  3BY8 A;  2IA2 A;  3EGD C;  1UWN X;  1LL8 A;  1G6O A;  4EQ1 A;  3G6O A;  4UEY A;  1VB6 A;  2CMN A;  2W27 A;  3CLO A;  1GSW A;  2YKF A;  3KSF A;  1OTA A;  2ZOI A;  3OOV A;  1DRM A;  3RH8 B;  4OOM A;  1MC0 A;  3LR0 A;  3VV4 A;  2M1C A;  2HV1 A;  1OTD A;  4PAU A;  3E4O A;  3T4Q A;  5TBM B;  2D02 A;  2XSS A;  4HI4 A;  2VKS A;  4WLA A;  3BY9 A;  5J3W A;  5I5L A;  2DMW A;  3LIC A;  1V9Z A;  3E0Y A;  4YNR A;  2QJ5 A;  5HWT A;  4LLO B;  1YSQ A;  3NHQ A;  1XJ3 A;  4WEJ A;  3D72 A;  4XT2 B;  1S1Z A;  1MKM A;  4G3V A;  4CLC C;  2G7U A;  2D01 A;  2J3W A;  3PYP A;  5F6A A;  4KUO A;  2XRO A;  1TF1 A;  1H3Q A;  1XFQ A;  4GS9 A;  4GJ4 A;  4H6J B;  4FSF A;  1G28 A;  3B33 A;  5HZH A;  3OBF A;  3UB9 A;  5TBM A;  1XFN A;  3BJN A;  3E98 A;  2WKQ A;  4HQA A;  3UB7 A;  4PKY A;  3V67 A;  3S7N A;  4UQI M;  3LR4 A;  4I5S A;  1H8M A;  3UE3 A;  3VOL A;  4GCZ A;  1TS6 A;  4WEK A;  4ARZ A;  1NLY A;  1NWZ A;  3KYQ A;  3LUQ A;  3E4Q A;  2KDK A;  4EEP A;  3OLO A;  2A2L A;  4KQD A;  4IHQ A;  3F1P B;  2V1A A;  2WKP A;  3CI6 A;  3W2Z A;  1ZHH B;  4DJ2 A;  2OAQ 1;  3FPW A;  4HY8 A;  1KOU A;  3LFV A;  4H6J A;  3MR0 A;  2VZW A;  3EOI A;  4I38 A;  3NOT C;  1ODV A;  2P08 A;  2O9A A;  2O9B A;  3KSI A;  1UGU A;  3EGX C;  4LRZ E;  4ZRR A;  1YSP A;  2PYR A;  4CLC A;  1OT6 A;  2V9A A;  3F1O A;  2VGL M;  3UMD A;  3PXP A;  3MFX A;  1S67 L;  1LT0 A;  1T18 A;  2V0W A;  3OCL A;  2EWW A;  1NRJ A;  5J7E A;  3FPV A;  4F3L B;  4BWI A;  2KOI A;  4LRX C;  4Q0H A;  5A8B A;  3PBS A;  1UWP X;  3LYX A;  4HH2 A;  1F5M A;  2WKR A;  4BBV A;  3KYZ A;  1F98 A;  1IOU A;  4L9F A;  5J4E A;  2J80 A;  3P01 A;  3A0V A;  2XA7 M;  4JGP A;  3CIT A;  3MF0 A;  4HP9 A;  3U2A A;  3UB6 A;  3H7W B;  2M7V A;  1JNU A;  4GHI B;  2A24 B;  4HJ4 A;  3RFB A;  3H82 A;  3T4T A;  4I3I A;  2NUP C;  2W3G A;  3GEC A;  3VE3 A;  2P04 A;  2PD7 A;  3LID A;  3PBO A;  4WF0 A;  2P7J A;  1OT9 A;  3IBJ A;  2PYP A;  5MC7 A;  5HDD A;  2JKT M;  3PBN A;  4O0P A;  3HJI A;  3EQV A;  2VA0 A;  3LIF A;  3JVV A;  4MN6 A;  2HJE A;  2Y8H A;  4Q0I A;  3LR5 A;  1WA9 A;  4AFI A;  4EUV A;  4Q0J A;  3IS2 A;  5DF9 A;  3PBR A;  4CLC D;  1N9L A;  2ZBB A;  1IFQ A;  4EU0 A;  1F9I A;  2L1M A;  2QJ7 A;  4R70 A;  5L8M A;  3H7W A;  2OAP 1;  5CX7 A;  5G4Z A;  4QPR A;  4YWZ A;  3HCY A;  5K5B A;  2YKH A;  4EES A;  1T19 A;  3E4P A;  4O01 A;  5FL3 A;  4E04 A;  2JKR M;  2VV6 A;  4PHT A;  3HJK A;  5DFX A;  5AJG A;  3LR3 A;  4UQI S;  2ZMF A;  3C8C A;  3S7O A;  4IUH A;  3BQA A;  3PBT A;  4MDZ A;  3MQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...