1S4SA

Reaction intermediate in the photocycle of pyp, intermediate occupied between 100 micro-seconds to 5 milli-seconds
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein kinetics: Structures of intermediates and reaction mechanism from time-resolved x-ray data
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photosynthesis
molecule keywords Photoactive yellow protein
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s4sA00
4I5SA 1OT9A 3EWKA 4I3JA 4NXFA 1V9ZA 1DP6A 3MR0A 2Z6CA 4PKYA 3FC7A 3K3DA 4EERA 4F3LA 3H7WA 4WL9A 3PYPA 1T1BA 4BBTA 4WN5A 2QHKA 3K3CA 3F1PB 3IS2B 3NJAA 1XJ4A 3MJQA 3NHQA 2KX6A 2B02A 4BBVA 3F1NB 2BASA 1LSWA 2JN7A 4M4XA 4GS9A 2WKQA 5HZHA 2M1CA 2ZOIA 4EETB 3KX0X 3IBRA 2OOLA 2D01A 3LI8A 4HY8A 5F68A 2INWA 4KUOA 5F5YA 3UB8A 3UB9A 2OWHA 3MQOA 4HP4A 4JGRA 2W0NA 4L9EA 2A24A 1P0ZA 2P7JA 1UGUA 1VB6A 4XT2B 3ICYA 2H28A 2KDKA 4I38A 4HNBA 2V9AA 4JGPA 5HWVA 3VE3A 2PR5A 5HD5A 2W27A 3C2WA 1UWNX 5HDDA 5HD3A 1OJGA 3CAXA 2YKHA 4WUJA 2PD7A 1GSXA 3E4QA 1MZUA 1XFNA 3H82A 4HJ6A 4JGQA 4LLOB 1T1CA 2VV6A 1N9OA 1S1YA 4GHIA 3VE4A 4DJ2A 1D06A 1LSXA 4HQAA 1TS7A 2V1AA 3FG8A 1F9IA 3OLOA 4HOIA 2V0UA 5G4YA 5EFWA 3A0RA 3LIAA 2V1BA 3F1OA 5AVFA 4LRXC 4MN5A 1XJ6A 4HJ4A 4PKYG 4WLAA 4R70A 1OTIA 1Y28A 3BY8A 3E4PA 4GS9B 2PDRA 5G4ZA 4E04A 5I5LA 3HJIA 3RTYA 4L9FA 2PD8A 2ZOHA 2PR6A 2PYRA 4B9OA 4EXOA 4LRZE 3LUQA 2R78A 2VLGA 4LPZA 5AVEA 3NOTC 1S1ZA 1D7EA 2HV1A 1EW0A 1BYWA 1DP9A 3E4OA 1P97A 3B33A 1UWPX 3GDIA 3H9WA 2L1MA 1S4SA 1GSWA 3BWLA 4GCZA 3VOLA 1OTBA 3EEHA 2J80A 4R6LA 1LL8A 3RH8B 3UE6A 4HHDA 2VV7A 3UMDA 1X0OA 4EQ1A 1ODVA 2V0WA 5HWWA 5DKKA 4L9GA 3F1OB 3NOUC 5TBMA 3CLOA 1LSVA 4WF0A 1DRMA 2ZBBA 5DKLA 1OT6A 4GHIB 3UMEA 1OJ5A 2K7SA 4H6JA 2QKPA 1OTEA 5F69A 5HDCA 4I3IA 3T50A 3LYXA 4K08A 3UB7A 4EEUA 1F98A 4JGOA 3G6OA 2QJ7A 4LRYC 3MFXA 4NXBA 2L4RA 4R38A 1S67L 3LI9A 2WKRA 1LT0A 3HJKA 2VV8A 4HJ3A 3SW1A 1OTDA 2JHEA 2Z6DA 1TS8A 3MXQA 4GW9A 4HP9A 4KQDA 5IU1A 1XJ3A 3LIBA 1N9NA 2WKPA 3BY9A 4I3AA 4KUKA 5DJUA 1DP8A 1S4RA 4HIAA 4BBUA 4I39A 5HWTA 4EW7A 3MQQA 1T18A 4EEPA 4F3LB 2EA9A 3A0VA 1G28A 1NWZA 1TS0A 1OTAA 1XFQA 4YWZA 5HSQA 5IS1A 4DJ3A 5J4EA 2QWSA 2I9VA 4HI4A 1N9LA 1XJ2A 5DJTA 4EESA 3LIEA 1KOUA 3LICA 3P7NA 2OWJA 2VEAA 3NOPC 3H7WB 1T1AA 3GECA 3CWFA 1V9YA 1GSVA 3ULFA 1TS6A 2L0WA 2GJ3A 3C8CA 3LIDA 4XT2A 5J3WA 4MN6A 3A0SA 3F1NA 4HH2A 1WA9A 4H6JB 4NXGA 3F1PA 2D02A 2PHYA 3IS2A 5TBMB 5F6AA 4NXEA 5HDSA 5A8BA 1T19A 5J7EA 4HH3A 3D72A 3H82B 2PYPA 2QJ5A 3UB6A 3LIFA 5KIZA 2CMNA 1S66L 3PHYA 2A24B 3ZQ5A 4RQ9A 2YKFA 1JNUA 4R3AA
chains in the Genus database with same CATH superfamily
4KZ3A 1V9ZA 2Z6CA 3H7WA 2J8YA 4WN5A 3QP6A 3MJQA 4KENB 4GKUA 1A0KA 5JYPA 5C5KA 1BTLA 4GJ4A 3LI8A 2JKTM 5FATA 4GZBA 2Y91A 1O07A 4S2NC 3LY4A 2HJ9C 3OPPA 3OPHA 1DJBA 3L7HA 2PD7A 4P85A 1N9OA 1D06A 3BECA 2V1AA 1CF0A 3VSLA 1DJCA 1PNEA 5G4ZA 2Y2KA 4S2KA 2PD8A 1BYWA 3HLBA 1TVFA 3CITA 3UE6A 5M18A 2WGWB 5E2HA 1LSVA 3LFVA 5FQJA 5DKLA 5HDCA 3T50A 4N92A 4GDNA 1L0FA 2VV8A 4HJ3A 3SH7A 1N9NA 3ZVTA 3QP2A 3UNWA 4L0LA 4F3LB 2XH9A 5KSCA 4S2MA 4EBLA 2BLSA 3KO6A 2WGVA 2ZC5B 3IH8A 1YLTA 4E3IA 5EVIA 4XUZA 5MC7A 2RL3A 2IWBA 3DAVA 4B93A 4MCWA 3UPOA 2V8FA 1LHYA 5KZHA 3F1PA 4RA7A 3JYIA 5TGFA 1T19A 2MJ6A 4OOYA 1FOFA 3BQAA 4Y0TA 3GVBA 1W63Q 2Y4AA 3CHWP 4OLGA 3E98A 3IBRA 4MLLA 2W0NA 5EE8A 3G34A 4I38A 2XF3A 4JGPA 3A3EA 2W27A 1W5DA 4KZ5A 3HLDA 3QP4A 4WUJA 2WADA 4NETA 4KZ6A 2E8IA 4HOIA 4ETXA 4WZ4A 2XLNA 5EVID 3B42A 4AFIA 1ESIA 4L9FA 4BD1A 3ZCZA 3IBJA 3CMZA 4LFUA 4XUXA 4Y0UA 4GD6A 3HLCA 3OPRA 1TDGA 4K0XA 1AWIA 1BULA 2JC7A 1X0OA 3MZFA 4WF0A 1CEFA 1OT6A 3BFDA 5CGXA 1DJAA 5D3OA 3FZCA 3SS3A 4R3BA 2NUTC 5GLBA 1LT0A 3CPTA 4WMCA 3VOYA 2WKHA 1M40A 4S2OA 3LIBA 1Y54A 2EWVA 4QU3A 3LY3A 2DCFA 5CHJA 3AGEA 3MQQA 4OONA 3T4KA 4OQ0A 3MZDA 4QPRA 4E6XA 3QNCA 3H7WB 1S0WA 4EBPA 1GCEA 3C8CA 3IWIA 3T4LA 1P9RA 3A0SA 4S2PA 4H6JB 1MC0A 5EVEA 2V8CA 2PBDP 3KSGA 2JKFA 3EQUA 4O7DA 3PHYA 4RQ9A 2YKFA 1ES3A 2V2FF 1K6SA 1YPRA 2ZQ9A 3RJUA 5AQ9A 1YMSA 1XJ4A 2JE5A 2OAQ1 5AQAA 1JWPA 1LSWA 1MY8A 3Q7ZA 5HAIA 4IBXA 3CJMA 3SOIA 4MN7A 4DF6A 2EX2A 2B95A 2KDKA 3PR6A 1STZA 3NULA 2WK0A 5M19A 4ZDXA 3UY6A 5EOOA 1ESUA 2Y2GA 1XGIA 2QZ6A 3A0RA 5AVFA 3ITAA 3IF6C 1SCWA 3VMAA 3Q1FA 3CZDA 5GLCA 1Y4OA 2ZQ7A 4JBFA 4R6LA 1RCJA 3SS5A 4R1GA 1ODVA 2Q9NA 2BTFP 2WZZA 1XX2A 2ZBBA 4BMWA 3OZHA 2XSSA 3P01A 4UQIM 4E3KA 5CEBA 4KQDA 2Z6DA 2ZC4B 5IU1A 2WKPA 3BY9A 1S4RA 5TJJA 1KDWA 2EA9A 3UN7A 4EESA 1Q2QA 1CK3A 1IFQA 4XXRA 3V67A 1T1AA 4OQGA 2GJ3A 2J3WA 2XROA 4HH2A 1L0GA 1ES2A 3T1QB 4GB7A 2J9OA 1XGJA 3UB6A 1S66L 1TD5A 1BLCA 2VK3A 4GOGA 4I5SA 4ZJ1A 2X71A 4CLCD 1IKGA 4BBTA 2ZC3B 3K3CA 4DE1A 3IQAA 5GL9A 3UDXA 2H5SA 2JKRM 5F5YA 1YSPA 3IF5A 2A24A 5GLDA 3ICYA 3V3SA 4GD8A 3HLFA 1NLYA 5GHXA 3BM6A 5HD3A 3TSGA 4R23A 5HPIA 3HUOA 1XKZA 1S1YA 3NIAA 3IXDA 4QB8A 5I5LA 3RTYA 4QWOA 4NK3A 3NOTC 2HV1A 3BFGA 3E4OA 1P97A 4X69A 2W3HA 3HLGA 4RVAA 5FEFA 3G2YA 2VV7A 4HHDA 3UMDA 2Y2NA 5CTNA 2A3UA 2OLVA 3MKEA 1HVBA 1PI5A 3VSKA 4JGOA 3PTEA 1VETB 1OTDA 3PAEA 5DFYA 1M6KA 3N8RA 2R9XA 5DJUA 3C30A 4EEPA 5FQ9A 2J3TC 5HSQA 4Y7PA 2GDNA 4X68A 4GN2A 2XEPA 1XA7A 3CWFA 3JVVA 4OQHA 4CJNA 2EX9A 2D02A 5TBMB 4Y2FA 4X6TA 5J7EA 1ES5A 1HLUP 3N8LA 4OP5A 5U47A 5CGWA 1RGZA 3KSHA 4EERA 3HL9A 2Y79A 2FH5A 3TG9A 1CI8A 2JKRI 3ITBA 3MFDA 1YMXA 5A90A 2M1CA 4DE3A 2G2UA 3UB9A 3WS5A 4HESA 2H0TA 3SH8A 3VFFA 3UDFA 2VGKA 3O86A 3Q7VB 1H8ZA 3CAXA 4JGQA 3H82A 1XFNA 3FWLA 3LEZA 4HJ6A 3DWZA 1T1CA 2AVXA 4UAAA 2ZQ8A 2V1BA 4PKYG 1OTIA 5DTSA 3MKFA 5L2FA 4Y3IA 4LPZA 1ZC2A 2L1MA 1GSWA 1NZOA 5F82A 1PZPA 1FSYA 2V0WA 2K31A 3W4PA 1ZKJA 3U4LP 4E3NA 3NY4A 3M6HA 5F69A 3N6IA 3T4TA 3IX4A 3M6BA 1MKIA 3UB5P 1S6RA 4HP9A 4NG2A 3ZG8B 3PAGA 3IHAA 4A5RA 4KUKA 4M3KA 3O3VA 3A0VA 4YNRA 1E3UA 4EU0A 2I9VA 2Y2MA 4KG2A 4LV3A 4IVIA 1NYMA 3ULFA 2IA2A 3UE0A 5CX7A 4Q8IA 2PRFA 5FQQA 1K4FA 4S2LA 1FCNA 4NXEA 4ESPA 3E2LA 4E3MA 1YLJA 3C38A 2O99A 2ZL1B 2VJWA 5CRFA 5EPHA 1KGFA 2GX5A 3UPNA 2QYBA 3FV7A 1SZVA 3LGOA 5A91A 4LV2A 2O9BA 5EVLA 4BJPA 1T1BA 3BRMA 2XGNA 3NHQA 2KX6A 3F1NB 3S7NA 5HZHA 4Z9QA 2C5WB 3UDIA 3V5MA 1P0ZA 4OKPA 1FR6A 4HNBA 3UO9A 3G35A 5HDDA 1PWDA 2W1TA 3QNBA 1OJGA 5E2GA 4EWFA 1NZUA 1PFLA 2H10A 5HAPA 3NBLA 2G7UA 3ZG0A 3GQZA 1I2WA 3T4QA 1PZOA 4GLQA 4X1LA 1XJ6A 3IXHA 1SDEA 4R0QA 2PAVP 2A49A 4Q0HA 1SKFA 4PM5A 1KVLA 3LUQA 3BFEA 3OCNA 4KZ7A 5I94A 1H8MA 5E43A 1UWPX 2VGLM 4WMCD 1IYQA 3ZGAB 4N9KA 3V39A 5DKKA 3CLOA 1GA9A 4O8GA 4R4RA 4JKTA 3UMEA 1TS8A 5HAQA 4BBUA 4I39A 1TS0A 2W1RA 1H5XA 2ZM0A 4MDZA 4B88A 4WZ5A 3HREA 4EV4A 4KQQA 5J3WA 4MN6A 1PW1A 3D72A 2WYXA 2PYPA 1ZTUA 3T4SA 4R4SA 1BLPA 2XQZA 5AJGA 5HPFA 5FA7A 2IWCA 3KX0X 1GHIA 5F68A 1K54A 3Q81A 4BQMA 2ZD8A 3OC2A 3VE3A 5HD5A 4LLOB 4U3TA 2W3EA 2VV6A 4DJ2A 3KSIA 4PM9A 5DF7A 3WS1A 2OAP1 3IX8A 3HVFA 4G3KA 1IYSA 4B4ZA 4WLAA 4GS9B 3Q07A 2ZOHA 2PYRA 1WYCA 3ZNTA 1NRFA 1D7EA 1KE4A 4CLCA 1J9MA 3C4PA 3EGXC 5E2FA 3FKVA 5CTMA 4C75A 5CERA 2K7SA 3MXRA 4PM6A 1SHVA 4I3IA 1QMEA 1W8YA 3PBTA 4R38A 2C6WB 3B3XA 1J3WA 2J7VA 1ZG6A 5FQMA 1JTGA 2ZM8A 2M7VA 5LBRA 2J3TD 3DWKA 3LICA 2EX6A 4XT2A 1PWGA 3GTCA 3F1NA 3C4OA 1YAXA 5HDSA 4OPRA 4S2IA 1G68A 3GMWA 4KG6A 2ZQDA 1OPXA 3MQ0A 5EVIB 2PU2A 2ZM2A 2X01A 4BD0A 3N8SA 1FCMA 4X25A 2ZQCA 3VP0A 3TE8A 4MBHA 5AQ7A 2ZOIA 4H8RA 1E4DA 5DF8A 4FSFA 2P7JA 1YLPA 1VB6A 4MEZA 3C7UA 4JXGA 5M1AA 1JWVA 3EGDC 1LSXA 2J9PA 4JF6A 5FAQA 3VV4A 2V0UA 1Z09A 5EFWA 4ME4A 1VETA 2EFXA 1EROA 4Y17A 1MWUA 1K0KA 5HL6A 4ZTKA 1IYPA 1JWZA 3H9WA 4GDBA 5CGSA 3C7VA 3VOLA 4ARZB 4LV0A 5HWWA 4ZRRA 4L9GA 3NOUC 2R9WA 2Q9MA 3L9KA 4K08A 3LR0A 4P6ZM 4WZ5C 1IOUA 3SH9A 1KVMA 3B47A 3M2KA 1OTAA 4FUWA 1KDSA 4DJ3A 5FSRA 1V9YA 1G6AA 1TS6A 1ZG4A 4C6YA 2OV5A 1FIKA 3PBQA 3OPLA 1L3LA 3G31A 3LIFA 2KOIA 3FPVA 4JXVA 1N9BA 4I3JA 1C3BA 4ZJ2A 3T4OA 1VM1A 3K3DA 1OMEA 3ZNYA 2XR0A 3NJAA 4RX2A 4IHQA 3UPPA 4M4XA 5KMWA 3NI9A 1HD8A 4DDYA 4IUKA 1KE3A 3LR5A 2OLUA 3FYZA 5TR7A 2XD5A 1NJ4A 2ZMAA 4KZAA 3DTIA 1KGEA 3E4QA 5HX9A 1NYYA 2ZL1A 4O01A 5BOHA 4G3VA 5HW3A 3LO7A 1PRQA 5E2EA 1BLSA 4OH0A 4Q0IA 4E04A 5EUAA 4DDSA 1MWTA 2VLGA 1MPLA 3RXWA 4CLCE 2WZXA 3GDIA 4DE0A 3QP1A 2GZAA 3WRZA 3RXXA 1K4EA 1SDNA 1CQAA 1G5UA 5CXWA 2HDSA 4GHIB 1OTEA 5K5BA 4FD8A 1WE4A 3LR3A 4LENA 1PWCA 4CLCB 2XRNA 2EWWA 4HIAA 1W7FA 3V50A 1YT4A 2Y2IA 3ZG5A 3LIEA 3R7WA 3LR4A 1TEMA 4P87A 2WGIA 2PHYA 3E0YA 4WBGA 3H82B 4MMNA 2Z2LB 4C3QA 1YM1A 2A24B 4RYEA 3FC7A 3PYPA 3A3DA 1YLYA 4DXBA 2HJEA 4OPYA 4WEKA 3MQOA 4L9EA 1FSWA 5L10A 2JCHA 1YQSA 5FDSA 3S7PA 2QMIA 2YKHA 1MZUA 1K25A 4MBFA 4ARZA 1JVJA 3E2KA 3V3RA 4D60A 2W3DA 2XFTA 4HJ4A 3CUEC 5DFXA 4R70A 3BFCA 3NCKA 3KYEA 3FKWA 5CEDA 1XA1A 2WKEA 3PBSA 4BENA 3N7WA 1LL5A 3VP4A 2Y2LA 2E8JA 1DP9A 4OP8A 4U0XA 4DKIA 3B33A 1PIOA 3BWLA 4GCZA 1VQQA 4O0PA 3EEHA 4QY6A 4FH4A 1RP5A 2V1ZA 4KG5A 1HTZA 4UHUA 4H6JA 3G6OA 1AXBA 4LRYC 4ZBEA 3T4JA 3QHYA 2EX8A 5G18A 4YWZA 4OOLA 3PBNA 1XJ2A 3O88A 3AGFA 3HLEA 3KYQA 4E3JA 4PM7A 2FFYA 3OOVA 4NXGA 3CUEA 3MBZA 3IS2A 4KZBA 3W4OA 2HP6A 3DTMA 4DE2A 1ERQA 2WUQA 3NDEA 2Q0OA 3ZQ5A 3T1RA 5J4EA 1DP6A 2DMWA 1N4OA 2V20A 2Y2PA 4MBKA 4Y5FA 3M2JA 2QHKA 3IXGA 4IBRA 5EVIC 4BBVA 4N1HA 1L2SA 1LLBA 1NXYA 4OQIA 1NRJA 4KUOA 2ZC7A 2OWHA 3MSHA 4KQOA 4XT2B 1PW8A 2HDRA 4NKPA 2PR5A 1BLHA 4BL2A 5FQKA 4PHTA 2K2NA 4F94A 3OLOA 3SZTA 3LIAA 4DRTA 4MN5A 2JKTI 3JVUA 3E4PA 4HBTA 4B9OA 2G2WA 2HDUA 4UA7A 1LL8A 2HPBA 3IX3A 1Z6FA 1W8QA 4OPQA 2O0YA 2P04A 4HBUA 4JPMA 4WELA 1K57C 2QJ7A 5HARA 4LV1A 1P9WA 2WAEA 3PBRA 2JHEA 3MXQA 5EM0A 4I3AA 1DP8A 1K6RA 3IF6B 3ZDJA 1XFQA 3S7QA 3O87A 4LCLA 1K57A 4FCFA 3P98A 4JXWA 2VEAA 3HUMA 2UV0E 2W3FA 4X53A 3VP1A 4JF4A 3W4QA 5DF9A 4R3JA 1WA9A 2Y2OA 1EI5A 1PI4A 5EM1A 3G2ZA 4QHCA 4U0TA 3R7WB 4R3AA 4NXFA 3MR0A 1XP4A 3VP3A 3F1PB 2Y8HA 2JKGA 4OPZA 2JN7A 2P9VA 1XPBA 3DW0A 2RCXA 3PXPA 4IVKA 2D01A 2VX8A 1VHMA 1BZAA 1JTDA 1GA0A 1QMFA 3BQ8A 1IELA 2Z2MB 5FDHA 3A3JA 1VEUA 1BT5A 3ZHHA 4HQAA 3FG8A 4BWIA 4QD4A 3ZFZA 2O9CA 2ZMFA 2DRWA 2VZWA 4LRZE 4CPKA 5AVEA 4YINA 2HGVA 3T1SA 3IWQA 3RH8B 3VFHA 1ALQA 4KZ9A 1IKIA 3OCLA 1OJ5A 2QKPA 3SS4A 1YSQA 4Y15A 4UQIS 4EEUA 3P09A 1K54C 3UB7A 2L4RA 1S67L 1PYYA 1XJ3A 4S2NA 3G4PA 2DNSA 5CECA 5GHZA 3DTKA 1T18A 3NDGA 1CI9A 5DJTA 4HI4A 4Z1WA 4X55A 4QJGA 1IYOA 5F1GA 3LIDA 4QY5A 2B18A 5DTKA 4B4XA 5F6AA 3IT9A 2H0YA 3RFBA 1JNUA 4DXCA 3Q82A 1OT9A 4N9LA 3ZG7B 3QP8A 1ACFA 4PKYA 4EBNA 4WYYA 3HUNA 4E3OA 3IS2B 2CC1A 2QPNA 2ZMVA 5GHYA 3ISGA 2P74A 5FI6A 4JGRA 2ACGA 2A2LA 5CHUA 4PMAA 3C2WA 1UWNX 2Y2HA 3I7JA 2Y2JA 1GHPA 3ZVWA 2BG1A 5L09A 5IHVA 4GHIA 3VE4A 5AQBA 2GNXA 1I2SA 1FILA 1FCOA 3G32A 5HL1A 3WWXA 3T12B 1Y28A 5JYOA 3VOZA 3HJIA 2HF6A 4KZ4A 4IEDA 1S1ZA 2ZLYA 3S22A 1S4SA 2J80A 4E6WA 4EUVA 3LEQA 5TBMA 1SKOB 1BSGA 5A93A 4X56A 5EECA 4II7A 3WRTA 2PU4A 3EQVA 1TF1A 2WKRA 3C5AA 5EOEA 4GW9A 4PM8A 2HP9A 2EFUA 4D2OA 5HWTA 1NWZA 5FL3A 3PBOA 2Y59A 3NECA 1F5MA 5FASA 3GECA 3W2ZA 1SKOA 3G30A 2PBYA 2P9VB 1NY0A 5A8BA 5J8XA 2XDMA 2QJ5A 4GNUA 4ID4A 3WS4A 3EWKA 5F1FA 3BEBA 4BL3A 4Y13A 5TFQA 4F3LA 3TW8A 2P08A 2WKIA 2BASA 4BLMA 4ETZA 2XFSA 3S4XA 3S7OA 3K2NA 3UB8A 4S2JA 1ZHHB 5GLAA 5FAOA 1GHMA 2XD1A 3IH9A 2Y2QA 5FEGA 4JXSA 1GSXA 2EXAA 2HZ5A 3CG5A 2VGJA 3MMHA 1L0DA 1KGGA 4KZ8A 3HBRA 1DY6A 3TJZC 1MWRA 4K91A 2HP5A 5L8MA 1HZOA 2IWDA 1G6OA 3BLSA 3T1XA 4EQ1A 1RGYA 3IHBA 3W8KA 3F1OB 4RX3A 1D1JA 1DRMA 4EUZA 4IJGA 4FH2A 4NXBA 1ES4A 3ZYTA 5CHMA 2LB9A 1ERMA 1O7EA 3GRJA 1ONGA 5A92A 4EW7A 3DTEA 2O9AA 5F83A 1XXMA 1E25A 1N9LA 3P7NA 1GSVA 2L0WA 3A3FA 3KYZA 2W1TB 2VKSA 4X1MA 3BW6A 3S1YA 5KIZA 2CMNA 4P6BA 2I72A 5FI2A 3LCEA 3D9YA 2UWXA 1NLZA 2FZ0A 2XA7S 1YLWA 3QP5A 2HDQA 4N1XA 2B02A 2Y55A 4GS9A 4WM9A 1FQGA 3HLWA 2OOLA 4EETB 2INWA 2ZC6B 2PT7A 1UGUA 4FOFA 4WEJA 1K38A 2H28A 1W79A 2V9AA 5HWVA 4PPRA 4HEFA 1H0MA 1Q2PA 3BLMA 4FTXA 4YOFA 2XA7M 1H8YA 3OBFA 3GR2A 4UA9A 1TS7A 5HFOA 5IT5A 5DVAA 3O5YA 3CI6A 3BY8A 2JBFA 1K56A 3IF6A 4UA6A 3Q7VA 3KSFA 2R78A 3HCYA 1EW0A 2VGLS 4IUHA 1ONHA 3UE1A 1OTBA 2LB5A 3EOIA 3DBAA 3WS2A 1L0EA 3VP2A 1EWZA 4E3LA 1BUEA 4P6ZS 3MFXA 3MXSA 3SW1A 3HJKA 5DTTA 2ZQAA 3GSGA 3IXBA 1CJFA 1MXOA 1G28A 2WGWA 2QWSA 4OLDA 2B5RA 4UEYA 3MZEA 1WYBA 3N4IA 1MWSA 1KOUA 1I5QA 2OWJA 3NOPC 4P0MA 5KSHA 1YKDA 3TOIA 1K56D 3R4KA 3U2AA 3MF0A 1F2KA 2KLIA 4HH3A 2ZJ9A 1VEUB 4YFMA 1FR1A 3D3OA 4JLFA 3BYDA 2X02A 4JF5A 1LI9A 4WL9A 1K55A 2WKQA 4Q0JA 4HY8A 5L07A 4HP4A 4CQHA 3NC8A 4LCMA 1U60A 3MS6A 2EXBA 4LGWA 1YLZA 5EV0A 1F9IA 4ZAMA 5G4YA 2WAFA 3F1OA 2XK1A 4LRXC 3GV9A 4K0WA 2OSUA 2PDRA 5FI7A 3BJNA 4G3WA 4DMZA 2PR6A 4EXOA 1LI0A 1CEGA 1W63M 5FQIA 2M7UA 4PAUA 5FAPA 3ZG9B 4ZJ3A 1IEMA 1MKMA 3A3IA 2FFFB 3D4FA 1MBLA 3LYXA 3TRCA 1F98A 4Y0OA 4OVDA 3WS0A 3EEAA 3LI9A 4DN0A 3AGDA 5IS1A 1E3UD 4CLCC 3IWOA 3JPUA 4OOMA 4NEED 1K55C 4MNRA 1H3QA 1KE0A 4EQIA 3CPTB 1TDLA 2NUPC 3UE3A 2VA0A 3BFFA 2W3GA 4KQRA 1LL9A 3FPWA
chains in the Genus database with same CATH topology
1OT9A 4I3JA 3T4OA 1V9ZA 3KSHA 2Z6CA 4PKYA 4EERA 3K3DA 3H7WA 2Y79A 2FH5A 4WN5A 2JKRI 3IS2B 3NJAA 4IHQA 3MJQA 4M4XA 2M1CA 2ZMVA 5C5KA 4IUKA 4GJ4A 3LI8A 3LR5A 3UB9A 4JGRA 2JKTM 2A2LA 2HJ9C 3C2WA 1UWNX 3CAXA 2PD7A 3E4QA 3H82A 1XFNA 4HJ6A 4JGQA 1T1CA 1N9OA 4GHIA 4O01A 3VE4A 1D06A 4G3VA 2V1AA 2GNXA 2V1BA 4PKYG 4Q0IA 1OTIA 1Y28A 4E04A 5G4ZA 3HJIA 2HF6A 2PD8A 4Y3IA 2VLGA 4LPZA 1S1ZA 4CLCE 1BYWA 3GDIA 2L1MA 1S4SA 1GSWA 2GZAA 2J80A 3CITA 3UE6A 4EUVA 2V0WA 2K31A 5TBMA 1LSVA 3LFVA 5DKLA 4GHIB 1OTEA 5F69A 5HDCA 3T50A 4II7A 3T4TA 5K5BA 3EQVA 1TF1A 2WKRA 2VV8A 3LR3A 4HJ3A 4GW9A 4HP9A 1N9NA 4CLCB 2XRNA 2EWWA 4KUKA 4HIAA 5HWTA 4L0LA 4F3LB 3A0VA 1NWZA 4YNRA 5FL3A 4EU0A 3PBOA 2I9VA 3KO6A 3LIEA 1F5MA 5MC7A 3R7WA 3LR4A 3GECA 3ULFA 2IA2A 4B93A 4MCWA 5CX7A 3W2ZA 3F1PA 2PHYA 4NXEA 5A8BA 1T19A 3E0YA 3H82B 3C38A 2MJ6A 2QJ5A 4MMNA 2O99A 2A24B 2VJWA 3BQAA 2GX5A 2QYBA 3EWKA 3FC7A 4F3LA 2O9BA 4BJPA 3PYPA 1T1BA 1W63Q 3TW8A 2P08A 3NHQA 2KX6A 3F1NB 2BASA 3S7NA 5HZHA 2HJEA 4ETZA 3E98A 3IBRA 4WEKA 3S7OA 3K2NA 3UB8A 1ZHHB 3MQOA 2W0NA 4L9EA 1P0ZA 4I38A 4HNBA 4JGPA 2W27A 5HDDA 2W1TA 3S7PA 1OJGA 2YKHA 4WUJA 1GSXA 1MZUA 4ARZA 3MMHA 4HOIA 4ETXA 2G7UA 3T4QA 4GLQA 2W3DA 3B42A 1XJ6A 4HJ4A 3CUEC 5DFXA 4R70A 4AFIA 4Q0HA 4L9FA 3PBSA 3IBJA 3TJZC 3LUQA 3OCNA 5L8MA 1DP9A 1H8MA 3B33A 1UWPX 2VGLM 1G6OA 3BWLA 4GCZA 4O0PA 3EEHA 1X0OA 4EQ1A 5DKKA 3F1OB 3CLOA 4WF0A 1DRMA 1OT6A 4H6JA 4O8GA 4IJGA 2NUTC 3G6OA 4LRYC 4NXBA 1LT0A 3UMEA 3T4JA 1TS8A 3ZYTA 3LIBA 2EWVA 2LB9A 4BBUA 4I39A 4EW7A 3MQQA 2O9AA 4YWZA 1TS0A 4OOLA 2W1RA 3PBNA 3T4KA 4MDZA 1N9LA 1XJ2A 4QPRA 3KYQA 3P7NA 3H7WB 1JNUA 1GSVA 2L0WA 3C8CA 3T4LA 5J3WA 1P9RA 4MN6A 3A0SA 3KYZA 3OOVA 1MC0A 3CUEA 4H6JB 3IS2A 4NXGA 2W1TB 2VKSA 3KSGA 3EQUA 3BW6A 3D72A 2PYPA 5KIZA 2CMNA 1ZTUA 3PHYA 3ZQ5A 4RQ9A 3T4SA 2YKFA 5J4EA 1DP6A 2DMWA 1NLZA 2FZ0A 4Y5FA 2XA7S 2QHKA 1XJ4A 2OAQ1 2B02A 5AJGA 4BBVA 5HPFA 1LSWA 4GS9A 3KX0X 2OOLA 4EETB 5F68A 1NRJA 2INWA 4KUOA 2OWHA 2PT7A 4MN7A 4KQOA 1UGUA 4FOFA 4WEJA 4XT2B 3OC2A 2H28A 2KDKA 2V9AA 4NKPA 5HWVA 3PR6A 3VE3A 1STZA 2PR5A 5HD5A 4LLOB 4PHTA 2K2NA 4YOFA 2XA7M 2W3EA 2VV6A 3OBFA 4DJ2A 3KSIA 2OAP1 1TS7A 3OLOA 5IT5A 4G3KA 3A0RA 3LIAA 3O5YA 3CI6A 5AVFA 4MN5A 4WLAA 2JKTI 3JVUA 3BY8A 3E4PA 4GS9B 2ZOHA 2PYRA 4B9OA 3KSFA 2R78A 3HCYA 1D7EA 1EW0A 2VGLS 4IUHA 4CLCA 1OTBA 4R6LA 3EGXC 1LL8A 2LB5A 3EOIA 1ODVA 3DBAA 2ZBBA 4BMWA 2O0YA 2K7SA 2XSSA 3P01A 2P04A 4I3IA 4UQIM 4WELA 4P6ZS 2QJ7A 3MFXA 3PBTA 4R38A 3SW1A 1P9WA 3HJKA 3PBRA 2JHEA 3MXQA 2Z6DA 4KQDA 5IU1A 2WKPA 3BY9A 4I3AA 1DP8A 1S4RA 5TJJA 2EA9A 1G28A 1XFQA 3S7QA 2QWSA 5LBRA 2M7VA 4UEYA 4EESA 2J3TD 1KOUA 3LICA 2OWJA 1IFQA 2VEAA 3NOPC 3V67A 1T1AA 5KSHA 2W3FA 1YKDA 2GJ3A 4XT2A 3R4KA 3U2AA 2J3WA 2XROA 5DF9A 3MF0A 3F1NA 4HH2A 1WA9A 1YAXA 5HDSA 2KLIA 4HH3A 3UB6A 1S66L 1TD5A 3R7WB 4R3AA 4I5SA 3D3OA 4NXFA 1OPXA 3MR0A 3MQ0A 4WL9A 4CLCD 4BBTA 3K3CA 3F1PB 2Y8HA 2JN7A 3TE8A 2WKQA 4Q0JA 2ZOIA 3PXPA 4HY8A 2D01A 2VX8A 2JKRM 1VHMA 5F5YA 1YSPA 4HP4A 4CQHA 4FSFA 2A24A 2P7JA 1VB6A 3ICYA 3BQ8A 1NLYA 5HD3A 5HPIA 1S1YA 3EGDC 1LSXA 4HQAA 3FG8A 1F9IA 3VV4A 4BWIA 2V0UA 5G4YA 5EFWA 4ME4A 3F1OA 4LRXC 2O9CA 2ZMFA 2PDRA 5I5LA 3RTYA 3BJNA 4G3WA 4DMZA 2PR6A 4EXOA 2VZWA 1W63M 4LRZE 5HL6A 5AVEA 2M7UA 3NOTC 4PAUA 2HGVA 3E4OA 2HV1A 3H9WA 1P97A 2W3HA 3VOLA 4ARZB 1MKMA 3RH8B 4HHDA 2VV7A 3UMDA 5HWWA 4ZRRA 4L9GA 3NOUC 3OCLA 1OJ5A 2QKPA 1YSQA 4EEUA 4UQIS 3LYXA 4K08A 3UB7A 3LR0A 4P6ZM 1F98A 3TRCA 4JGOA 3EEAA 2L4RA 1IOUA 1S67L 3LI9A 1OTDA 1XJ3A 4DN0A 5DFYA 3B47A 5DJUA 3C30A 1T18A 4EEPA 5IS1A 2J3TC 1OTAA 5HSQA 4DJ3A 5DJTA 4HI4A 4CLCC 4Z1WA 4OOMA 4NEED 3CWFA 1V9YA 3JVVA 1H3QA 1TS6A 3LIDA 2B18A 2NUPC 2D02A 3PBQA 5TBMB 4Y2FA 5F6AA 3UE3A 2VA0A 2W3GA 5J7EA 3LIFA 2KOIA 3FPVA 3RFBA 3FPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5S A;  1OT9 A;  3EWK A;  4I3J A;  4NXF A;  1V9Z A;  1DP6 A;  3MR0 A;  2Z6C A;  4PKY A;  3FC7 A;  3K3D A;  4EER A;  4F3L A;  3H7W A;  4WL9 A;  3PYP A;  1T1B A;  4BBT A;  4WN5 A;  2QHK A;  3K3C A;  3F1P B;  3IS2 B;  3NJA A;  1XJ4 A;  3MJQ A;  3NHQ A;  2KX6 A;  2B02 A;  4BBV A;  3F1N B;  2BAS A;  1LSW A;  2JN7 A;  4M4X A;  4GS9 A;  2WKQ A;  5HZH A;  2M1C A;  2ZOI A;  4EET B;  3KX0 X;  3IBR A;  2OOL A;  2D01 A;  3LI8 A;  4HY8 A;  5F68 A;  2INW A;  4KUO A;  5F5Y A;  3UB8 A;  3UB9 A;  2OWH A;  3MQO A;  4HP4 A;  4JGR A;  2W0N A;  4L9E A;  2A24 A;  1P0Z A;  2P7J A;  1UGU A;  1VB6 A;  4XT2 B;  3ICY A;  2H28 A;  2KDK A;  4I38 A;  4HNB A;  2V9A A;  4JGP A;  5HWV A;  3VE3 A;  2PR5 A;  5HD5 A;  2W27 A;  3C2W A;  1UWN X;  5HDD A;  5HD3 A;  1OJG A;  3CAX A;  2YKH A;  4WUJ A;  2PD7 A;  1GSX A;  3E4Q A;  1MZU A;  1XFN A;  3H82 A;  4HJ6 A;  4JGQ A;  4LLO B;  1T1C A;  2VV6 A;  1N9O A;  1S1Y A;  4GHI A;  3VE4 A;  4DJ2 A;  1D06 A;  1LSX A;  4HQA A;  1TS7 A;  2V1A A;  3FG8 A;  1F9I A;  3OLO A;  4HOI A;  2V0U A;  5G4Y A;  5EFW A;  3A0R A;  3LIA A;  2V1B A;  3F1O A;  5AVF A;  4LRX C;  4MN5 A;  1XJ6 A;  4HJ4 A;  4PKY G;  4WLA A;  4R70 A;  1OTI A;  1Y28 A;  3BY8 A;  3E4P A;  4GS9 B;  2PDR A;  5G4Z A;  4E04 A;  5I5L A;  3HJI A;  3RTY A;  4L9F A;  2PD8 A;  2ZOH A;  2PR6 A;  2PYR A;  4B9O A;  4EXO A;  4LRZ E;  3LUQ A;  2R78 A;  2VLG A;  4LPZ A;  5AVE A;  3NOT C;  1S1Z A;  1D7E A;  2HV1 A;  1EW0 A;  1BYW A;  1DP9 A;  3E4O A;  1P97 A;  3B33 A;  1UWP X;  3GDI A;  3H9W A;  2L1M A;  1S4S A;  1GSW A;  3BWL A;  4GCZ A;  3VOL A;  1OTB A;  3EEH A;  2J80 A;  4R6L A;  1LL8 A;  3RH8 B;  3UE6 A;  4HHD A;  2VV7 A;  3UMD A;  1X0O A;  4EQ1 A;  1ODV A;  2V0W A;  5HWW A;  5DKK A;  4L9G A;  3F1O B;  3NOU C;  5TBM A;  3CLO A;  1LSV A;  4WF0 A;  1DRM A;  2ZBB A;  5DKL A;  1OT6 A;  4GHI B;  3UME A;  1OJ5 A;  2K7S A;  4H6J A;  2QKP A;  1OTE A;  5F69 A;  5HDC A;  4I3I A;  3T50 A;  3LYX A;  4K08 A;  3UB7 A;  4EEU A;  1F98 A;  4JGO A;  3G6O A;  2QJ7 A;  4LRY C;  3MFX A;  4NXB A;  2L4R A;  4R38 A;  1S67 L;  3LI9 A;  2WKR A;  1LT0 A;  3HJK A;  2VV8 A;  4HJ3 A;  3SW1 A;  1OTD A;  2JHE A;  2Z6D A;  1TS8 A;  3MXQ A;  4GW9 A;  4HP9 A;  4KQD A;  5IU1 A;  1XJ3 A;  3LIB A;  1N9N A;  2WKP A;  3BY9 A;  4I3A A;  4KUK A;  5DJU A;  1DP8 A;  1S4R A;  4HIA A;  4BBU A;  4I39 A;  5HWT A;  4EW7 A;  3MQQ A;  1T18 A;  4EEP A;  4F3L B;  2EA9 A;  3A0V A;  1G28 A;  1NWZ A;  1TS0 A;  1OTA A;  1XFQ A;  4YWZ A;  5HSQ A;  5IS1 A;  4DJ3 A;  5J4E A;  2QWS A;  2I9V A;  4HI4 A;  1N9L A;  1XJ2 A;  5DJT A;  4EES A;  3LIE A;  1KOU A;  3LIC A;  3P7N A;  2OWJ A;  2VEA A;  3NOP C;  3H7W B;  1T1A A;  3GEC A;  3CWF A;  1V9Y A;  1GSV A;  3ULF A;  1TS6 A;  2L0W A;  2GJ3 A;  3C8C A;  3LID A;  4XT2 A;  5J3W A;  4MN6 A;  3A0S A;  3F1N A;  4HH2 A;  1WA9 A;  4H6J B;  4NXG A;  3F1P A;  2D02 A;  2PHY A;  3IS2 A;  5TBM B;  5F6A A;  4NXE A;  5HDS A;  5A8B A;  1T19 A;  5J7E A;  4HH3 A;  3D72 A;  3H82 B;  2PYP A;  2QJ5 A;  3UB6 A;  3LIF A;  5KIZ A;  2CMN A;  1S66 L;  3PHY A;  2A24 B;  3ZQ5 A;  4RQ9 A;  2YKF A;  1JNU A;  4R3A A; 
#chains in the Genus database with same CATH topology
 4KZ3 A;  1V9Z A;  2Z6C A;  3H7W A;  2J8Y A;  4WN5 A;  3QP6 A;  3MJQ A;  4KEN B;  4GKU A;  1A0K A;  5JYP A;  5C5K A;  1BTL A;  4GJ4 A;  3LI8 A;  2JKT M;  5FAT A;  4GZB A;  2Y91 A;  1O07 A;  4S2N C;  3LY4 A;  2HJ9 C;  3OPP A;  3OPH A;  1DJB A;  3L7H A;  2PD7 A;  4P85 A;  1N9O A;  1D06 A;  3BEC A;  2V1A A;  1CF0 A;  3VSL A;  1DJC A;  1PNE A;  5G4Z A;  2Y2K A;  4S2K A;  2PD8 A;  1BYW A;  3HLB A;  1TVF A;  3CIT A;  3UE6 A;  5M18 A;  2WGW B;  5E2H A;  1LSV A;  3LFV A;  5FQJ A;  5DKL A;  5HDC A;  3T50 A;  4N92 A;  4GDN A;  1L0F A;  2VV8 A;  4HJ3 A;  3SH7 A;  1N9N A;  3ZVT A;  3QP2 A;  3UNW A;  4L0L A;  4F3L B;  2XH9 A;  5KSC A;  4S2M A;  4EBL A;  2BLS A;  3KO6 A;  2WGV A;  2ZC5 B;  3IH8 A;  1YLT A;  4E3I A;  5EVI A;  4XUZ A;  5MC7 A;  2RL3 A;  2IWB A;  3DAV A;  4B93 A;  4MCW A;  3UPO A;  2V8F A;  1LHY A;  5KZH A;  3F1P A;  4RA7 A;  3JYI A;  5TGF A;  1T19 A;  2MJ6 A;  4OOY A;  1FOF A;  3BQA A;  4Y0T A;  3GVB A;  1W63 Q;  2Y4A A;  3CHW P;  4OLG A;  3E98 A;  3IBR A;  4MLL A;  2W0N A;  5EE8 A;  3G34 A;  4I38 A;  2XF3 A;  4JGP A;  3A3E A;  2W27 A;  1W5D A;  4KZ5 A;  3HLD A;  3QP4 A;  4WUJ A;  2WAD A;  4NET A;  4KZ6 A;  2E8I A;  4HOI A;  4ETX A;  4WZ4 A;  2XLN A;  5EVI D;  3B42 A;  4AFI A;  1ESI A;  4L9F A;  4BD1 A;  3ZCZ A;  3IBJ A;  3CMZ A;  4LFU A;  4XUX A;  4Y0U A;  4GD6 A;  3HLC A;  3OPR A;  1TDG A;  4K0X A;  1AWI A;  1BUL A;  2JC7 A;  1X0O A;  3MZF A;  4WF0 A;  1CEF A;  1OT6 A;  3BFD A;  5CGX A;  1DJA A;  5D3O A;  3FZC A;  3SS3 A;  4R3B A;  2NUT C;  5GLB A;  1LT0 A;  3CPT A;  4WMC A;  3VOY A;  2WKH A;  1M40 A;  4S2O A;  3LIB A;  1Y54 A;  2EWV A;  4QU3 A;  3LY3 A;  2DCF A;  5CHJ A;  3AGE A;  3MQQ A;  4OON A;  3T4K A;  4OQ0 A;  3MZD A;  4QPR A;  4E6X A;  3QNC A;  3H7W B;  1S0W A;  4EBP A;  1GCE A;  3C8C A;  3IWI A;  3T4L A;  1P9R A;  3A0S A;  4S2P A;  4H6J B;  1MC0 A;  5EVE A;  2V8C A;  2PBD P;  3KSG A;  2JKF A;  3EQU A;  4O7D A;  3PHY A;  4RQ9 A;  2YKF A;  1ES3 A;  2V2F F;  1K6S A;  1YPR A;  2ZQ9 A;  3RJU A;  5AQ9 A;  1YMS A;  1XJ4 A;  2JE5 A;  2OAQ 1;  5AQA A;  1JWP A;  1LSW A;  1MY8 A;  3Q7Z A;  5HAI A;  4IBX A;  3CJM A;  3SOI A;  4MN7 A;  4DF6 A;  2EX2 A;  2B95 A;  2KDK A;  3PR6 A;  1STZ A;  3NUL A;  2WK0 A;  5M19 A;  4ZDX A;  3UY6 A;  5EOO A;  1ESU A;  2Y2G A;  1XGI A;  2QZ6 A;  3A0R A;  5AVF A;  3ITA A;  3IF6 C;  1SCW A;  3VMA A;  3Q1F A;  3CZD A;  5GLC A;  1Y4O A;  2ZQ7 A;  4JBF A;  4R6L A;  1RCJ A;  3SS5 A;  4R1G A;  1ODV A;  2Q9N A;  2BTF P;  2WZZ A;  1XX2 A;  2ZBB A;  4BMW A;  3OZH A;  2XSS A;  3P01 A;  4UQI M;  4E3K A;  5CEB A;  4KQD A;  2Z6D A;  2ZC4 B;  5IU1 A;  2WKP A;  3BY9 A;  1S4R A;  5TJJ A;  1KDW A;  2EA9 A;  3UN7 A;  4EES A;  1Q2Q A;  1CK3 A;  1IFQ A;  4XXR A;  3V67 A;  1T1A A;  4OQG A;  2GJ3 A;  2J3W A;  2XRO A;  4HH2 A;  1L0G A;  1ES2 A;  3T1Q B;  4GB7 A;  2J9O A;  1XGJ A;  3UB6 A;  1S66 L;  1TD5 A;  1BLC A;  2VK3 A;  4GOG A;  4I5S A;  4ZJ1 A;  2X71 A;  4CLC D;  1IKG A;  4BBT A;  2ZC3 B;  3K3C A;  4DE1 A;  3IQA A;  5GL9 A;  3UDX A;  2H5S A;  2JKR M;  5F5Y A;  1YSP A;  3IF5 A;  2A24 A;  5GLD A;  3ICY A;  3V3S A;  4GD8 A;  3HLF A;  1NLY A;  5GHX A;  3BM6 A;  5HD3 A;  3TSG A;  4R23 A;  5HPI A;  3HUO A;  1XKZ A;  1S1Y A;  3NIA A;  3IXD A;  4QB8 A;  5I5L A;  3RTY A;  4QWO A;  4NK3 A;  3NOT C;  2HV1 A;  3BFG A;  3E4O A;  1P97 A;  4X69 A;  2W3H A;  3HLG A;  4RVA A;  5FEF A;  3G2Y A;  2VV7 A;  4HHD A;  3UMD A;  2Y2N A;  5CTN A;  2A3U A;  2OLV A;  3MKE A;  1HVB A;  1PI5 A;  3VSK A;  4JGO A;  3PTE A;  1VET B;  1OTD A;  3PAE A;  5DFY A;  1M6K A;  3N8R A;  2R9X A;  5DJU A;  3C30 A;  4EEP A;  5FQ9 A;  2J3T C;  5HSQ A;  4Y7P A;  2GDN A;  4X68 A;  4GN2 A;  2XEP A;  1XA7 A;  3CWF A;  3JVV A;  4OQH A;  4CJN A;  2EX9 A;  2D02 A;  5TBM B;  4Y2F A;  4X6T A;  5J7E A;  1ES5 A;  1HLU P;  3N8L A;  4OP5 A;  5U47 A;  5CGW A;  1RGZ A;  3KSH A;  4EER A;  3HL9 A;  2Y79 A;  2FH5 A;  3TG9 A;  1CI8 A;  2JKR I;  3ITB A;  3MFD A;  1YMX A;  5A90 A;  2M1C A;  4DE3 A;  2G2U A;  3UB9 A;  3WS5 A;  4HES A;  2H0T A;  3SH8 A;  3VFF A;  3UDF A;  2VGK A;  3O86 A;  3Q7V B;  1H8Z A;  3CAX A;  4JGQ A;  3H82 A;  1XFN A;  3FWL A;  3LEZ A;  4HJ6 A;  3DWZ A;  1T1C A;  2AVX A;  4UAA A;  2ZQ8 A;  2V1B A;  4PKY G;  1OTI A;  5DTS A;  3MKF A;  5L2F A;  4Y3I A;  4LPZ A;  1ZC2 A;  2L1M A;  1GSW A;  1NZO A;  5F82 A;  1PZP A;  1FSY A;  2V0W A;  2K31 A;  3W4P A;  1ZKJ A;  3U4L P;  4E3N A;  3NY4 A;  3M6H A;  5F69 A;  3N6I A;  3T4T A;  3IX4 A;  3M6B A;  1MKI A;  3UB5 P;  1S6R A;  4HP9 A;  4NG2 A;  3ZG8 B;  3PAG A;  3IHA A;  4A5R A;  4KUK A;  4M3K A;  3O3V A;  3A0V A;  4YNR A;  1E3U A;  4EU0 A;  2I9V A;  2Y2M A;  4KG2 A;  4LV3 A;  4IVI A;  1NYM A;  3ULF A;  2IA2 A;  3UE0 A;  5CX7 A;  4Q8I A;  2PRF A;  5FQQ A;  1K4F A;  4S2L A;  1FCN A;  4NXE A;  4ESP A;  3E2L A;  4E3M A;  1YLJ A;  3C38 A;  2O99 A;  2ZL1 B;  2VJW A;  5CRF A;  5EPH A;  1KGF A;  2GX5 A;  3UPN A;  2QYB A;  3FV7 A;  1SZV A;  3LGO A;  5A91 A;  4LV2 A;  2O9B A;  5EVL A;  4BJP A;  1T1B A;  3BRM A;  2XGN A;  3NHQ A;  2KX6 A;  3F1N B;  3S7N A;  5HZH A;  4Z9Q A;  2C5W B;  3UDI A;  3V5M A;  1P0Z A;  4OKP A;  1FR6 A;  4HNB A;  3UO9 A;  3G35 A;  5HDD A;  1PWD A;  2W1T A;  3QNB A;  1OJG A;  5E2G A;  4EWF A;  1NZU A;  1PFL A;  2H10 A;  5HAP A;  3NBL A;  2G7U A;  3ZG0 A;  3GQZ A;  1I2W A;  3T4Q A;  1PZO A;  4GLQ A;  4X1L A;  1XJ6 A;  3IXH A;  1SDE A;  4R0Q A;  2PAV P;  2A49 A;  4Q0H A;  1SKF A;  4PM5 A;  1KVL A;  3LUQ A;  3BFE A;  3OCN A;  4KZ7 A;  5I94 A;  1H8M A;  5E43 A;  1UWP X;  2VGL M;  4WMC D;  1IYQ A;  3ZGA B;  4N9K A;  3V39 A;  5DKK A;  3CLO A;  1GA9 A;  4O8G A;  4R4R A;  4JKT A;  3UME A;  1TS8 A;  5HAQ A;  4BBU A;  4I39 A;  1TS0 A;  2W1R A;  1H5X A;  2ZM0 A;  4MDZ A;  4B88 A;  4WZ5 A;  3HRE A;  4EV4 A;  4KQQ A;  5J3W A;  4MN6 A;  1PW1 A;  3D72 A;  2WYX A;  2PYP A;  1ZTU A;  3T4S A;  4R4S A;  1BLP A;  2XQZ A;  5AJG A;  5HPF A;  5FA7 A;  2IWC A;  3KX0 X;  1GHI A;  5F68 A;  1K54 A;  3Q81 A;  4BQM A;  2ZD8 A;  3OC2 A;  3VE3 A;  5HD5 A;  4LLO B;  4U3T A;  2W3E A;  2VV6 A;  4DJ2 A;  3KSI A;  4PM9 A;  5DF7 A;  3WS1 A;  2OAP 1;  3IX8 A;  3HVF A;  4G3K A;  1IYS A;  4B4Z A;  4WLA A;  4GS9 B;  3Q07 A;  2ZOH A;  2PYR A;  1WYC A;  3ZNT A;  1NRF A;  1D7E A;  1KE4 A;  4CLC A;  1J9M A;  3C4P A;  3EGX C;  5E2F A;  3FKV A;  5CTM A;  4C75 A;  5CER A;  2K7S A;  3MXR A;  4PM6 A;  1SHV A;  4I3I A;  1QME A;  1W8Y A;  3PBT A;  4R38 A;  2C6W B;  3B3X A;  1J3W A;  2J7V A;  1ZG6 A;  5FQM A;  1JTG A;  2ZM8 A;  2M7V A;  5LBR A;  2J3T D;  3DWK A;  3LIC A;  2EX6 A;  4XT2 A;  1PWG A;  3GTC A;  3F1N A;  3C4O A;  1YAX A;  5HDS A;  4OPR A;  4S2I A;  1G68 A;  3GMW A;  4KG6 A;  2ZQD A;  1OPX A;  3MQ0 A;  5EVI B;  2PU2 A;  2ZM2 A;  2X01 A;  4BD0 A;  3N8S A;  1FCM A;  4X25 A;  2ZQC A;  3VP0 A;  3TE8 A;  4MBH A;  5AQ7 A;  2ZOI A;  4H8R A;  1E4D A;  5DF8 A;  4FSF A;  2P7J A;  1YLP A;  1VB6 A;  4MEZ A;  3C7U A;  4JXG A;  5M1A A;  1JWV A;  3EGD C;  1LSX A;  2J9P A;  4JF6 A;  5FAQ A;  3VV4 A;  2V0U A;  1Z09 A;  5EFW A;  4ME4 A;  1VET A;  2EFX A;  1ERO A;  4Y17 A;  1MWU A;  1K0K A;  5HL6 A;  4ZTK A;  1IYP A;  1JWZ A;  3H9W A;  4GDB A;  5CGS A;  3C7V A;  3VOL A;  4ARZ B;  4LV0 A;  5HWW A;  4ZRR A;  4L9G A;  3NOU C;  2R9W A;  2Q9M A;  3L9K A;  4K08 A;  3LR0 A;  4P6Z M;  4WZ5 C;  1IOU A;  3SH9 A;  1KVM A;  3B47 A;  3M2K A;  1OTA A;  4FUW A;  1KDS A;  4DJ3 A;  5FSR A;  1V9Y A;  1G6A A;  1TS6 A;  1ZG4 A;  4C6Y A;  2OV5 A;  1FIK A;  3PBQ A;  3OPL A;  1L3L A;  3G31 A;  3LIF A;  2KOI A;  3FPV A;  4JXV A;  1N9B A;  4I3J A;  1C3B A;  4ZJ2 A;  3T4O A;  1VM1 A;  3K3D A;  1OME A;  3ZNY A;  2XR0 A;  3NJA A;  4RX2 A;  4IHQ A;  3UPP A;  4M4X A;  5KMW A;  3NI9 A;  1HD8 A;  4DDY A;  4IUK A;  1KE3 A;  3LR5 A;  2OLU A;  3FYZ A;  5TR7 A;  2XD5 A;  1NJ4 A;  2ZMA A;  4KZA A;  3DTI A;  1KGE A;  3E4Q A;  5HX9 A;  1NYY A;  2ZL1 A;  4O01 A;  5BOH A;  4G3V A;  5HW3 A;  3LO7 A;  1PRQ A;  5E2E A;  1BLS A;  4OH0 A;  4Q0I A;  4E04 A;  5EUA A;  4DDS A;  1MWT A;  2VLG A;  1MPL A;  3RXW A;  4CLC E;  2WZX A;  3GDI A;  4DE0 A;  3QP1 A;  2GZA A;  3WRZ A;  3RXX A;  1K4E A;  1SDN A;  1CQA A;  1G5U A;  5CXW A;  2HDS A;  4GHI B;  1OTE A;  5K5B A;  4FD8 A;  1WE4 A;  3LR3 A;  4LEN A;  1PWC A;  4CLC B;  2XRN A;  2EWW A;  4HIA A;  1W7F A;  3V50 A;  1YT4 A;  2Y2I A;  3ZG5 A;  3LIE A;  3R7W A;  3LR4 A;  1TEM A;  4P87 A;  2WGI A;  2PHY A;  3E0Y A;  4WBG A;  3H82 B;  4MMN A;  2Z2L B;  4C3Q A;  1YM1 A;  2A24 B;  4RYE A;  3FC7 A;  3PYP A;  3A3D A;  1YLY A;  4DXB A;  2HJE A;  4OPY A;  4WEK A;  3MQO A;  4L9E A;  1FSW A;  5L10 A;  2JCH A;  1YQS A;  5FDS A;  3S7P A;  2QMI A;  2YKH A;  1MZU A;  1K25 A;  4MBF A;  4ARZ A;  1JVJ A;  3E2K A;  3V3R A;  4D60 A;  2W3D A;  2XFT A;  4HJ4 A;  3CUE C;  5DFX A;  4R70 A;  3BFC A;  3NCK A;  3KYE A;  3FKW A;  5CED A;  1XA1 A;  2WKE A;  3PBS A;  4BEN A;  3N7W A;  1LL5 A;  3VP4 A;  2Y2L A;  2E8J A;  1DP9 A;  4OP8 A;  4U0X A;  4DKI A;  3B33 A;  1PIO A;  3BWL A;  4GCZ A;  1VQQ A;  4O0P A;  3EEH A;  4QY6 A;  4FH4 A;  1RP5 A;  2V1Z A;  4KG5 A;  1HTZ A;  4UHU A;  4H6J A;  3G6O A;  1AXB A;  4LRY C;  4ZBE A;  3T4J A;  3QHY A;  2EX8 A;  5G18 A;  4YWZ A;  4OOL A;  3PBN A;  1XJ2 A;  3O88 A;  3AGF A;  3HLE A;  3KYQ A;  4E3J A;  4PM7 A;  2FFY A;  3OOV A;  4NXG A;  3CUE A;  3MBZ A;  3IS2 A;  4KZB A;  3W4O A;  2HP6 A;  3DTM A;  4DE2 A;  1ERQ A;  2WUQ A;  3NDE A;  2Q0O A;  3ZQ5 A;  3T1R A;  5J4E A;  1DP6 A;  2DMW A;  1N4O A;  2V20 A;  2Y2P A;  4MBK A;  4Y5F A;  3M2J A;  2QHK A;  3IXG A;  4IBR A;  5EVI C;  4BBV A;  4N1H A;  1L2S A;  1LLB A;  1NXY A;  4OQI A;  1NRJ A;  4KUO A;  2ZC7 A;  2OWH A;  3MSH A;  4KQO A;  4XT2 B;  1PW8 A;  2HDR A;  4NKP A;  2PR5 A;  1BLH A;  4BL2 A;  5FQK A;  4PHT A;  2K2N A;  4F94 A;  3OLO A;  3SZT A;  3LIA A;  4DRT A;  4MN5 A;  2JKT I;  3JVU A;  3E4P A;  4HBT A;  4B9O A;  2G2W A;  2HDU A;  4UA7 A;  1LL8 A;  2HPB A;  3IX3 A;  1Z6F A;  1W8Q A;  4OPQ A;  2O0Y A;  2P04 A;  4HBU A;  4JPM A;  4WEL A;  1K57 C;  2QJ7 A;  5HAR A;  4LV1 A;  1P9W A;  2WAE A;  3PBR A;  2JHE A;  3MXQ A;  5EM0 A;  4I3A A;  1DP8 A;  1K6R A;  3IF6 B;  3ZDJ A;  1XFQ A;  3S7Q A;  3O87 A;  4LCL A;  1K57 A;  4FCF A;  3P98 A;  4JXW A;  2VEA A;  3HUM A;  2UV0 E;  2W3F A;  4X53 A;  3VP1 A;  4JF4 A;  3W4Q A;  5DF9 A;  4R3J A;  1WA9 A;  2Y2O A;  1EI5 A;  1PI4 A;  5EM1 A;  3G2Z A;  4QHC A;  4U0T A;  3R7W B;  4R3A A;  4NXF A;  3MR0 A;  1XP4 A;  3VP3 A;  3F1P B;  2Y8H A;  2JKG A;  4OPZ A;  2JN7 A;  2P9V A;  1XPB A;  3DW0 A;  2RCX A;  3PXP A;  4IVK A;  2D01 A;  2VX8 A;  1VHM A;  1BZA A;  1JTD A;  1GA0 A;  1QMF A;  3BQ8 A;  1IEL A;  2Z2M B;  5FDH A;  3A3J A;  1VEU A;  1BT5 A;  3ZHH A;  4HQA A;  3FG8 A;  4BWI A;  4QD4 A;  3ZFZ A;  2O9C A;  2ZMF A;  2DRW A;  2VZW A;  4LRZ E;  4CPK A;  5AVE A;  4YIN A;  2HGV A;  3T1S A;  3IWQ A;  3RH8 B;  3VFH A;  1ALQ A;  4KZ9 A;  1IKI A;  3OCL A;  1OJ5 A;  2QKP A;  3SS4 A;  1YSQ A;  4Y15 A;  4UQI S;  4EEU A;  3P09 A;  1K54 C;  3UB7 A;  2L4R A;  1S67 L;  1PYY A;  1XJ3 A;  4S2N A;  3G4P A;  2DNS A;  5CEC A;  5GHZ A;  3DTK A;  1T18 A;  3NDG A;  1CI9 A;  5DJT A;  4HI4 A;  4Z1W A;  4X55 A;  4QJG A;  1IYO A;  5F1G A;  3LID A;  4QY5 A;  2B18 A;  5DTK A;  4B4X A;  5F6A A;  3IT9 A;  2H0Y A;  3RFB A;  1JNU A;  4DXC A;  3Q82 A;  1OT9 A;  4N9L A;  3ZG7 B;  3QP8 A;  1ACF A;  4PKY A;  4EBN A;  4WYY A;  3HUN A;  4E3O A;  3IS2 B;  2CC1 A;  2QPN A;  2ZMV A;  5GHY A;  3ISG A;  2P74 A;  5FI6 A;  4JGR A;  2ACG A;  2A2L A;  5CHU A;  4PMA A;  3C2W A;  1UWN X;  2Y2H A;  3I7J A;  2Y2J A;  1GHP A;  3ZVW A;  2BG1 A;  5L09 A;  5IHV A;  4GHI A;  3VE4 A;  5AQB A;  2GNX A;  1I2S A;  1FIL A;  1FCO A;  3G32 A;  5HL1 A;  3WWX A;  3T12 B;  1Y28 A;  5JYO A;  3VOZ A;  3HJI A;  2HF6 A;  4KZ4 A;  4IED A;  1S1Z A;  2ZLY A;  3S22 A;  1S4S A;  2J80 A;  4E6W A;  4EUV A;  3LEQ A;  5TBM A;  1SKO B;  1BSG A;  5A93 A;  4X56 A;  5EEC A;  4II7 A;  3WRT A;  2PU4 A;  3EQV A;  1TF1 A;  2WKR A;  3C5A A;  5EOE A;  4GW9 A;  4PM8 A;  2HP9 A;  2EFU A;  4D2O A;  5HWT A;  1NWZ A;  5FL3 A;  3PBO A;  2Y59 A;  3NEC A;  1F5M A;  5FAS A;  3GEC A;  3W2Z A;  1SKO A;  3G30 A;  2PBY A;  2P9V B;  1NY0 A;  5A8B A;  5J8X A;  2XDM A;  2QJ5 A;  4GNU A;  4ID4 A;  3WS4 A;  3EWK A;  5F1F A;  3BEB A;  4BL3 A;  4Y13 A;  5TFQ A;  4F3L A;  3TW8 A;  2P08 A;  2WKI A;  2BAS A;  4BLM A;  4ETZ A;  2XFS A;  3S4X A;  3S7O A;  3K2N A;  3UB8 A;  4S2J A;  1ZHH B;  5GLA A;  5FAO A;  1GHM A;  2XD1 A;  3IH9 A;  2Y2Q A;  5FEG A;  4JXS A;  1GSX A;  2EXA A;  2HZ5 A;  3CG5 A;  2VGJ A;  3MMH A;  1L0D A;  1KGG A;  4KZ8 A;  3HBR A;  1DY6 A;  3TJZ C;  1MWR A;  4K91 A;  2HP5 A;  5L8M A;  1HZO A;  2IWD A;  1G6O A;  3BLS A;  3T1X A;  4EQ1 A;  1RGY A;  3IHB A;  3W8K A;  3F1O B;  4RX3 A;  1D1J A;  1DRM A;  4EUZ A;  4IJG A;  4FH2 A;  4NXB A;  1ES4 A;  3ZYT A;  5CHM A;  2LB9 A;  1ERM A;  1O7E A;  3GRJ A;  1ONG A;  5A92 A;  4EW7 A;  3DTE A;  2O9A A;  5F83 A;  1XXM A;  1E25 A;  1N9L A;  3P7N A;  1GSV A;  2L0W A;  3A3F A;  3KYZ A;  2W1T B;  2VKS A;  4X1M A;  3BW6 A;  3S1Y A;  5KIZ A;  2CMN A;  4P6B A;  2I72 A;  5FI2 A;  3LCE A;  3D9Y A;  2UWX A;  1NLZ A;  2FZ0 A;  2XA7 S;  1YLW A;  3QP5 A;  2HDQ A;  4N1X A;  2B02 A;  2Y55 A;  4GS9 A;  4WM9 A;  1FQG A;  3HLW A;  2OOL A;  4EET B;  2INW A;  2ZC6 B;  2PT7 A;  1UGU A;  4FOF A;  4WEJ A;  1K38 A;  2H28 A;  1W79 A;  2V9A A;  5HWV A;  4PPR A;  4HEF A;  1H0M A;  1Q2P A;  3BLM A;  4FTX A;  4YOF A;  2XA7 M;  1H8Y A;  3OBF A;  3GR2 A;  4UA9 A;  1TS7 A;  5HFO A;  5IT5 A;  5DVA A;  3O5Y A;  3CI6 A;  3BY8 A;  2JBF A;  1K56 A;  3IF6 A;  4UA6 A;  3Q7V A;  3KSF A;  2R78 A;  3HCY A;  1EW0 A;  2VGL S;  4IUH A;  1ONH A;  3UE1 A;  1OTB A;  2LB5 A;  3EOI A;  3DBA A;  3WS2 A;  1L0E A;  3VP2 A;  1EWZ A;  4E3L A;  1BUE A;  4P6Z S;  3MFX A;  3MXS A;  3SW1 A;  3HJK A;  5DTT A;  2ZQA A;  3GSG A;  3IXB A;  1CJF A;  1MXO A;  1G28 A;  2WGW A;  2QWS A;  4OLD A;  2B5R A;  4UEY A;  3MZE A;  1WYB A;  3N4I A;  1MWS A;  1KOU A;  1I5Q A;  2OWJ A;  3NOP C;  4P0M A;  5KSH A;  1YKD A;  3TOI A;  1K56 D;  3R4K A;  3U2A A;  3MF0 A;  1F2K A;  2KLI A;  4HH3 A;  2ZJ9 A;  1VEU B;  4YFM A;  1FR1 A;  3D3O A;  4JLF A;  3BYD A;  2X02 A;  4JF5 A;  1LI9 A;  4WL9 A;  1K55 A;  2WKQ A;  4Q0J A;  4HY8 A;  5L07 A;  4HP4 A;  4CQH A;  3NC8 A;  4LCM A;  1U60 A;  3MS6 A;  2EXB A;  4LGW A;  1YLZ A;  5EV0 A;  1F9I A;  4ZAM A;  5G4Y A;  2WAF A;  3F1O A;  2XK1 A;  4LRX C;  3GV9 A;  4K0W A;  2OSU A;  2PDR A;  5FI7 A;  3BJN A;  4G3W A;  4DMZ A;  2PR6 A;  4EXO A;  1LI0 A;  1CEG A;  1W63 M;  5FQI A;  2M7U A;  4PAU A;  5FAP A;  3ZG9 B;  4ZJ3 A;  1IEM A;  1MKM A;  3A3I A;  2FFF B;  3D4F A;  1MBL A;  3LYX A;  3TRC A;  1F98 A;  4Y0O A;  4OVD A;  3WS0 A;  3EEA A;  3LI9 A;  4DN0 A;  3AGD A;  5IS1 A;  1E3U D;  4CLC C;  3IWO A;  3JPU A;  4OOM A;  4NEE D;  1K55 C;  4MNR A;  1H3Q A;  1KE0 A;  4EQI A;  3CPT B;  1TDL A;  2NUP C;  3UE3 A;  2VA0 A;  3BFF A;  2W3G A;  4KQR A;  1LL9 A;  3FPW A; 
#chains in the Genus database with same CATH homology
 1OT9 A;  4I3J A;  3T4O A;  1V9Z A;  3KSH A;  2Z6C A;  4PKY A;  4EER A;  3K3D A;  3H7W A;  2Y79 A;  2FH5 A;  4WN5 A;  2JKR I;  3IS2 B;  3NJA A;  4IHQ A;  3MJQ A;  4M4X A;  2M1C A;  2ZMV A;  5C5K A;  4IUK A;  4GJ4 A;  3LI8 A;  3LR5 A;  3UB9 A;  4JGR A;  2JKT M;  2A2L A;  2HJ9 C;  3C2W A;  1UWN X;  3CAX A;  2PD7 A;  3E4Q A;  3H82 A;  1XFN A;  4HJ6 A;  4JGQ A;  1T1C A;  1N9O A;  4GHI A;  4O01 A;  3VE4 A;  1D06 A;  4G3V A;  2V1A A;  2GNX A;  2V1B A;  4PKY G;  4Q0I A;  1OTI A;  1Y28 A;  4E04 A;  5G4Z A;  3HJI A;  2HF6 A;  2PD8 A;  4Y3I A;  2VLG A;  4LPZ A;  1S1Z A;  4CLC E;  1BYW A;  3GDI A;  2L1M A;  1S4S A;  1GSW A;  2GZA A;  2J80 A;  3CIT A;  3UE6 A;  4EUV A;  2V0W A;  2K31 A;  5TBM A;  1LSV A;  3LFV A;  5DKL A;  4GHI B;  1OTE A;  5F69 A;  5HDC A;  3T50 A;  4II7 A;  3T4T A;  5K5B A;  3EQV A;  1TF1 A;  2WKR A;  2VV8 A;  3LR3 A;  4HJ3 A;  4GW9 A;  4HP9 A;  1N9N A;  4CLC B;  2XRN A;  2EWW A;  4KUK A;  4HIA A;  5HWT A;  4L0L A;  4F3L B;  3A0V A;  1NWZ A;  4YNR A;  5FL3 A;  4EU0 A;  3PBO A;  2I9V A;  3KO6 A;  3LIE A;  1F5M A;  5MC7 A;  3R7W A;  3LR4 A;  3GEC A;  3ULF A;  2IA2 A;  4B93 A;  4MCW A;  5CX7 A;  3W2Z A;  3F1P A;  2PHY A;  4NXE A;  5A8B A;  1T19 A;  3E0Y A;  3H82 B;  3C38 A;  2MJ6 A;  2QJ5 A;  4MMN A;  2O99 A;  2A24 B;  2VJW A;  3BQA A;  2GX5 A;  2QYB A;  3EWK A;  3FC7 A;  4F3L A;  2O9B A;  4BJP A;  3PYP A;  1T1B A;  1W63 Q;  3TW8 A;  2P08 A;  3NHQ A;  2KX6 A;  3F1N B;  2BAS A;  3S7N A;  5HZH A;  2HJE A;  4ETZ A;  3E98 A;  3IBR A;  4WEK A;  3S7O A;  3K2N A;  3UB8 A;  1ZHH B;  3MQO A;  2W0N A;  4L9E A;  1P0Z A;  4I38 A;  4HNB A;  4JGP A;  2W27 A;  5HDD A;  2W1T A;  3S7P A;  1OJG A;  2YKH A;  4WUJ A;  1GSX A;  1MZU A;  4ARZ A;  3MMH A;  4HOI A;  4ETX A;  2G7U A;  3T4Q A;  4GLQ A;  2W3D A;  3B42 A;  1XJ6 A;  4HJ4 A;  3CUE C;  5DFX A;  4R70 A;  4AFI A;  4Q0H A;  4L9F A;  3PBS A;  3IBJ A;  3TJZ C;  3LUQ A;  3OCN A;  5L8M A;  1DP9 A;  1H8M A;  3B33 A;  1UWP X;  2VGL M;  1G6O A;  3BWL A;  4GCZ A;  4O0P A;  3EEH A;  1X0O A;  4EQ1 A;  5DKK A;  3F1O B;  3CLO A;  4WF0 A;  1DRM A;  1OT6 A;  4H6J A;  4O8G A;  4IJG A;  2NUT C;  3G6O A;  4LRY C;  4NXB A;  1LT0 A;  3UME A;  3T4J A;  1TS8 A;  3ZYT A;  3LIB A;  2EWV A;  2LB9 A;  4BBU A;  4I39 A;  4EW7 A;  3MQQ A;  2O9A A;  4YWZ A;  1TS0 A;  4OOL A;  2W1R A;  3PBN A;  3T4K A;  4MDZ A;  1N9L A;  1XJ2 A;  4QPR A;  3KYQ A;  3P7N A;  3H7W B;  1JNU A;  1GSV A;  2L0W A;  3C8C A;  3T4L A;  5J3W A;  1P9R A;  4MN6 A;  3A0S A;  3KYZ A;  3OOV A;  1MC0 A;  3CUE A;  4H6J B;  3IS2 A;  4NXG A;  2W1T B;  2VKS A;  3KSG A;  3EQU A;  3BW6 A;  3D72 A;  2PYP A;  5KIZ A;  2CMN A;  1ZTU A;  3PHY A;  3ZQ5 A;  4RQ9 A;  3T4S A;  2YKF A;  5J4E A;  1DP6 A;  2DMW A;  1NLZ A;  2FZ0 A;  4Y5F A;  2XA7 S;  2QHK A;  1XJ4 A;  2OAQ 1;  2B02 A;  5AJG A;  4BBV A;  5HPF A;  1LSW A;  4GS9 A;  3KX0 X;  2OOL A;  4EET B;  5F68 A;  1NRJ A;  2INW A;  4KUO A;  2OWH A;  2PT7 A;  4MN7 A;  4KQO A;  1UGU A;  4FOF A;  4WEJ A;  4XT2 B;  3OC2 A;  2H28 A;  2KDK A;  2V9A A;  4NKP A;  5HWV A;  3PR6 A;  3VE3 A;  1STZ A;  2PR5 A;  5HD5 A;  4LLO B;  4PHT A;  2K2N A;  4YOF A;  2XA7 M;  2W3E A;  2VV6 A;  3OBF A;  4DJ2 A;  3KSI A;  2OAP 1;  1TS7 A;  3OLO A;  5IT5 A;  4G3K A;  3A0R A;  3LIA A;  3O5Y A;  3CI6 A;  5AVF A;  4MN5 A;  4WLA A;  2JKT I;  3JVU A;  3BY8 A;  3E4P A;  4GS9 B;  2ZOH A;  2PYR A;  4B9O A;  3KSF A;  2R78 A;  3HCY A;  1D7E A;  1EW0 A;  2VGL S;  4IUH A;  4CLC A;  1OTB A;  4R6L A;  3EGX C;  1LL8 A;  2LB5 A;  3EOI A;  1ODV A;  3DBA A;  2ZBB A;  4BMW A;  2O0Y A;  2K7S A;  2XSS A;  3P01 A;  2P04 A;  4I3I A;  4UQI M;  4WEL A;  4P6Z S;  2QJ7 A;  3MFX A;  3PBT A;  4R38 A;  3SW1 A;  1P9W A;  3HJK A;  3PBR A;  2JHE A;  3MXQ A;  2Z6D A;  4KQD A;  5IU1 A;  2WKP A;  3BY9 A;  4I3A A;  1DP8 A;  1S4R A;  5TJJ A;  2EA9 A;  1G28 A;  1XFQ A;  3S7Q A;  2QWS A;  5LBR A;  2M7V A;  4UEY A;  4EES A;  2J3T D;  1KOU A;  3LIC A;  2OWJ A;  1IFQ A;  2VEA A;  3NOP C;  3V67 A;  1T1A A;  5KSH A;  2W3F A;  1YKD A;  2GJ3 A;  4XT2 A;  3R4K A;  3U2A A;  2J3W A;  2XRO A;  5DF9 A;  3MF0 A;  3F1N A;  4HH2 A;  1WA9 A;  1YAX A;  5HDS A;  2KLI A;  4HH3 A;  3UB6 A;  1S66 L;  1TD5 A;  3R7W B;  4R3A A;  4I5S A;  3D3O A;  4NXF A;  1OPX A;  3MR0 A;  3MQ0 A;  4WL9 A;  4CLC D;  4BBT A;  3K3C A;  3F1P B;  2Y8H A;  2JN7 A;  3TE8 A;  2WKQ A;  4Q0J A;  2ZOI A;  3PXP A;  4HY8 A;  2D01 A;  2VX8 A;  2JKR M;  1VHM A;  5F5Y A;  1YSP A;  4HP4 A;  4CQH A;  4FSF A;  2A24 A;  2P7J A;  1VB6 A;  3ICY A;  3BQ8 A;  1NLY A;  5HD3 A;  5HPI A;  1S1Y A;  3EGD C;  1LSX A;  4HQA A;  3FG8 A;  1F9I A;  3VV4 A;  4BWI A;  2V0U A;  5G4Y A;  5EFW A;  4ME4 A;  3F1O A;  4LRX C;  2O9C A;  2ZMF A;  2PDR A;  5I5L A;  3RTY A;  3BJN A;  4G3W A;  4DMZ A;  2PR6 A;  4EXO A;  2VZW A;  1W63 M;  4LRZ E;  5HL6 A;  5AVE A;  2M7U A;  3NOT C;  4PAU A;  2HGV A;  3E4O A;  2HV1 A;  3H9W A;  1P97 A;  2W3H A;  3VOL A;  4ARZ B;  1MKM A;  3RH8 B;  4HHD A;  2VV7 A;  3UMD A;  5HWW A;  4ZRR A;  4L9G A;  3NOU C;  3OCL A;  1OJ5 A;  2QKP A;  1YSQ A;  4EEU A;  4UQI S;  3LYX A;  4K08 A;  3UB7 A;  3LR0 A;  4P6Z M;  1F98 A;  3TRC A;  4JGO A;  3EEA A;  2L4R A;  1IOU A;  1S67 L;  3LI9 A;  1OTD A;  1XJ3 A;  4DN0 A;  5DFY A;  3B47 A;  5DJU A;  3C30 A;  1T18 A;  4EEP A;  5IS1 A;  2J3T C;  1OTA A;  5HSQ A;  4DJ3 A;  5DJT A;  4HI4 A;  4CLC C;  4Z1W A;  4OOM A;  4NEE D;  3CWF A;  1V9Y A;  3JVV A;  1H3Q A;  1TS6 A;  3LID A;  2B18 A;  2NUP C;  2D02 A;  3PBQ A;  5TBM B;  4Y2F A;  5F6A A;  3UE3 A;  2VA0 A;  2W3G A;  5J7E A;  3LIF A;  2KOI A;  3FPV A;  3RFB A;  3FPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...