1JTDA

Crystal structure of beta-lactamase inhibitor protein-ii in complex with tem-1 beta-lactamase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
262
structure length
262
Chain Sequence
PETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords TEM-1 beta-lactamase
publication title Crystal structure and kinetic analysis of beta-lactamase inhibitor protein-II in complex with TEM-1 beta-lactamase.
pubmed doi rcsb
source organism Escherichia coli
total genus 94
structure length 262
sequence length 262
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jtdA00
5CEBA 1GHIA 4IBRA 2Z2LB 3Q82A 4EBLA 1HZOA 5EUAA 1W5DA 1HTZA 2Y2JA 4KG5A 3VP2A 4M3KA 3NI9A 3M6HA 4FSFA 2ZM0A 1YLYA 3MBZA 1CK3A 1G68A 4U0TA 1DJBA 2OLVA 2IWDA 4WELA 4BENA 3Q07A 1H8ZA 3ITBA 4WMCA 1PZPA 4P87A 3VP1A 4DDSA 4Q8IA 1FQGA 2ZQ7A 3OZHA 4JPMA 4KZ4A 5GLDA 3AGDA 3TG9A 3N8RA 4O7DA 3IF6A 1WE4A 4OPYA 3ZG8B 4KZAA 3SS4A 4LCMA 4DE3A 1ERQA 4JKTA 5CGXA 3FWLA 5EECA 2UWXA 4YFMA 1NYMA 4E3NA 3LEZA 3OPLA 4WZ5A 1K57C 4HBUA 4E6WA 4JF5A 2J7VA 1E4DA 1JWPA 4L0LA 1BT5A 1FCOA 1GHMA 5GLAA 2JC7A 3GV9A 1U60A 2HDSA 3BM6A 2WGVA 3GQZA 3FV7A 4E3OA 5HARA 2FFFB 4WEKA 5CHMA 3M2JA 4ZDXA 1TVFA 2JE5A 4KQRA 3HL9A 2ZM8A 1MPLA 1S6RA 4LV2A 4QY5A 1K54A 2XEPA 5E43A 1Z6FA 3EQUA 3UE0A 3E2KA 3ZNYA 1FSYA 3Q1FA 1ONHA 4QU3A 3DWZA 1BSGA 3BECA 5KMWA 4OQ0A 4X6TA 4UHUA 2HDQA 3V5MA 3IF6C 1PZOA 4OPRA 1L0GA 3C7VA 3IF6B 5FAPA 3E2LA 3FZCA 1NYYA 2ZQDA 1DY6A 3UO9A 3VP4A 3C4OA 4F94A 4JXGA 3HLGA 4Y0TA 3BFEA 5CHJA 3CJMA 4JXWA 1IYSA 4WZ5C 2J9OA 2ZQ8A 2R9XA 1WYBA 4KZ5A 4X56A 4NK3A 4BJPA 4DE0A 1PW8A 1KDWA 4KZ9A 1YM1A 1IYOA 1ONGA 5TR7A 3RXXA 1PI5A 2ZQCA 4RX3A 5EVLA 3N8SA 3JYIA 5CHUA 5AQAA 2A49A 4BL2A 2HP6A 4DF6A 1MKIA 1FSWA 3OCNA 4OOMA 1NY0A 4P0MA 4S2KA 4RYEA 3SH8A 1RP5A 3UDIA 1H5XA 4EWFA 5HL1A 3VP3A 2BG1A 1JWVA 5FQQA 1MBLA 1YT4A 2WZXA 3HLBA 1K56D 4B4ZA 3V3SA 3CZDA 5DTTA 3NDGA 3LCEA 4NETA 1I2WA 4PM7A 4R4SA 4Y0UA 3N6IA 3TSGA 1S0WA 5DF7A 4B4XA 3ZG0A 1KE3A 2WKEA 4HEFA 1BULA 5JYOA 3VMAA 4GKUA 4FH2A 4KZ7A 3LY4A 2IWCA 3HUMA 3A3FA 1PI4A 1H8YA 1ZG6A 3LO7A 3G30A 4OKPA 2ZLYA 2XFSA 5D3OA 4DE1A 2ZM2A 4GD6A 3WRTA 5CTMA 2RL3A 2XD5A 4DE2A 5HAIA 3ZHHA 3V50A 1YLZA 4JXVA 1YMSA 2EX8A 3B3XA 4KZBA 3SH9A 5A90A 4BD1A 1I5QA 2WK0A 1XX2A 2RCXA 2ZMAA 1XA7A 3DTMA 4ZJ2A 4KENB 3V39A 2VGJA 5CERA 2H0TA 3BFCA 3G32A 4KG2A 1Q2QA 3WS2A 3GRJA 5AQ9A 1K57A 2V1ZA 2Z2MB 1JVJA 4QB8A 3WS1A 3UY6A 1JTDA 3IXBA 3MXSA 1LL9A 4MEZA 1Q2PA 1ZG4A 3OC2A 3AGEA 1BTLA 4MNRA 1TEMA 5HX9A 3PBQA 1BLSA 5GHXA 5M19A 2J8YA 5CTNA 3GR2A 4OQGA 4DXCA 1PWGA 4IVKA 2PU4A 2Y2HA 4PM5A 3P09A 2XDMA 1K4EA 3BRMA 2Y2PA 1CI9A 3S22A 5FSRA 3W4OA 3CMZA 1GCEA 4EQIA 5FQMA 4FCFA 4WM9A 4S2NA 4RVAA 2EX6A 1TDGA 1W7FA 4JXSA 5CXWA 1LHYA 1MY8A 2EXAA 4CPKA 2I72A 2FFYA 3VSLA 4S2LA 4UA7A 2V20A 1PIOA 4PM9A 3WS0A 2Y2MA 1O7EA 3IF5A 5E2FA 3UPOA 1KVMA 4LENA 1HD8A 1ZKJA 2OSUA 5FQJA 4E3LA 1W79A 1W8YA 2DRWA 1N9BA 3ZGAB 2XLNA 3UN7A 3IWQA 5HAPA 1G6AA 2Y4AA 4K91A 4GD8A 2EFUA 4K0XA 5TGFA 3OPHA 3IXGA 3BEBA 4X53A 4QHCA 3HVFA 5HW3A 4HESA 4H8RA 2ZC5B 3HREA 3IXHA 4BQMA 2H5SA 4WMCD 3C7UA 5HAQA 1XP4A 5AQ7A 3UDFA 4S2NC 5FI6A 3HLEA 1XGIA 1JWZA 5FA7A 1XPBA 3IH9A 5J8XA 1WYCA 2C5WB 3ZG9B 1C3BA 5CEDA 1FR6A 5EVIC 4QY6A 4FD8A 5IHVA 3UE3A 4BLMA 2ZC7A 5EVIB 1ERMA 2OLUA 1MWRA 4N9KA 4R23A 4C75A 4ZBEA 4P85A 2QZ6A 1SCWA 5DVAA 4BD0A 5BOHA 5GHYA 3G2YA 2Y2OA 2Y2NA 4E3IA 4OLDA 1KGEA 1TDLA 1IKGA 5FQIA 3BLMA 5FQKA 3W8KA 4C6YA 3WS4A 2Q9MA 3GMWA 1M6KA 5GLBA 1EWZA 3C4PA 1KGFA 3M2KA 4OOLA 4D2OA 3MKEA 5A93A 3BFFA 5FQ9A 5FAOA 4ZTKA 3SS5A 2X71A 3MFDA 1XA1A 1K55C 2EXBA 5I94A 4OOYA 4OVDA 5GHZA 1PW1A 1E3UA 2BLSA 3PAGA 5F83A 3PTEA 4R3JA 2PBYA 1DJAA 4R0QA 3UPPA 3VSKA 3UE1A 4GDBA 1MWTA 4UAAA 5L2FA 5M18A 4OP8A 3VFFA 1KDSA 3NBLA 4QD4A 4WZ4A 1XKZA 5F82A 4C3QA 3VOZA 4RX2A 2E8IA 2WGIA 3SS3A 4S2MA 3GVBA 4IBXA 3S1YA 4IEDA 1K4FA 3PBRA 2P74A 5TFQA 4RA7A 2OV5A 4OQHA 4S2IA 2H0YA 3O88A 1FCNA 1PWDA 3BYDA 3O86A 3HLWA 3Q7ZA 1EROA 3N8LA 4EV4A 1BZAA 1QMFA 2ZC3B 3VOYA 4LCLA 5CGWA 1IELA 3O3VA 4PM8A 4JF6A 3BFDA 5FAQA 2ZD8A 2WZZA 2H10A 2A3UA 1W8QA 4OPQA 3QNBA 4N1HA 5FATA 3GSGA 4WYYA 3HLFA 2Q9NA 1K6SA 3VP0A 1M40A 2HDUA 3A3JA 1E25A 4DDYA 4ZJ1A 2WKIA 4R3BA 2X02A 2Y91A 5E2HA 3UDXA 1GHPA 4E6XA 5KSCA 4E3KA 5EE8A 1GA0A 2DCFA 2JCHA 2VGKA 2WUQA 3DW0A 4JF4A 1LI9A 3G31A 1YLPA 4PM6A 5FDHA 3IQAA 2EFXA 1NZOA 1RCJA 3EQVA 4IVIA 1VQQA 3UNWA 3ITAA 3W4QA 3HUNA 3UPNA 2XD1A 5GL9A 3MZDA 3MZFA 4LV0A 4S2PA 3FKVA 1SKFA 4Z9QA 4B88A 1O07A 2QPNA 1CI8A 1LLBA 3G35A 3NY4A 1KE4A 1ESUA 1RGZA 1QMEA 3SH7A 3TOIA 1HVBA 4S2OA 1Y54A 1K38A 5A91A 1ES4A 3QNCA 4KQQA 5EVIA 3FYZA 3OPPA 3PBOA 1SDNA 5DTSA 3IWIA 3PBNA 3IHBA 2DNSA 3PBTA 3MKFA 2EX9A 4LV1A 1K25A 4S2JA 2WAFA 3PBSA 3G34A 4WBGA 3ISGA 2C6WB 1OMEA 2ZC4B 3MZEA 5AQBA 3S4XA 2WYXA 1YMXA 1JTGA 2Y2IA 3AGFA 5E2EA 1RGYA 2ZQ9A 4OQIA 3NDEA 4ZJ3A 3HLDA 4U0XA 4U3TA 5F1GA 4XUXA 3W4PA 4EBPA 4DXBA 2JBFA 4X69A 1L0FA 4MLLA 2EX2A 5FI7A 2J9PA 3HLCA 4ID4A 2Y2GA 1K55A 3O87A 3ZDJA 5EOOA 3HUOA 5KZHA 3PAEA 4R4RA 4KZ3A 4E3MA 3I7JA 4DKIA 5CGSA 2WGWA 2ZQAA 2IWBA 4GDNA 3IHAA 5KSHA 1CEFA 2GDNA 3OCLA 4QJGA 2Y2LA 1MWSA 2HP9A 4KG6A 3ZVTA 3IWOA 5EVID 2P9VA 5CECA 1NRFA 1MWUA 1J9MA 5A92A 5GLCA 4N9LA 1IYPA 1XXMA 4HBTA 4N92A 5E2GA 1K56A 4GN2A 4X55A 3M6BA 3SOIA 5CRFA 1MXOA 4MBFA 1YLJA 4JBFA 2B5RA 3RJUA 1YLWA 4OONA 2ZJ9A 2Y55A 4XXRA 2R9WA 3ZCZA 2HP5A 3DWKA 5G18A 3IXDA 3Q7VA 4GOGA 1IKIA 3C5AA 3HBRA 4DRTA 1IYQA 1LI0A 2XH9A 4CJNA 4MBKA 4JLFA 4WEJA 4OH0A 4ZAMA 4OPZA 2ZC6B 4UA6A 3BFGA 2V2FF 2WAEA 3RXWA 3VFHA 2HDRA 4LV3A 1EI5A 4X68A 1L0DA 4YINA 1PYYA 3FKWA 3WRZA 3OPRA 1K54C 3IH8A 4GNUA 2WGWB 3BLSA 3GTCA 4GZBA 4N1XA 2WADA 3D4FA 5FASA 3V3RA 1NZUA 4P6BA 4MBHA 4PPRA 4E3JA 1NJ4A 3MXRA 1L2SA 2P9VB 5M1AA 1DJCA 2G2WA 5DF8A 1NXYA 4K0WA 3N7WA 3ZFZA 4OLGA 3LY3A 3A3IA 2Y59A 1BLPA 3WS5A 4A5RA 1XGJA 1FR1A 5FI2A 4Y7PA 1SHVA 1BLHA 1VM1A 2WKHA 4PMAA 2Y2KA 2XFTA 5U47A 3Q7VB 5DTKA 1KGGA 1YLTA 4FH4A 5EPHA 3CG5A 3IT9A 2XGNA 4Y0OA 5JYPA 1AXBA 4KZ6A 2XQZA 1IEMA 4EUZA 3G4PA 3WWXA 1BUEA 5DF9A 1E3UD 3A3DA 2Y2QA 4KQOA 4UA9A 2X01A 3Q81A 1GA9A 1PWCA 2PU2A 3NC8A 4KZ8A 1N4OA 3ZNTA 1ES3A 2HPBA 3QHYA 1SDEA 4R1GA 3ZVWA 4XUZA 3N4IA 4EBNA 1ES2A 1ZC2A 3A3EA 4OP5A 1ALQA 1LL5A 1ES5A 3ZG5A 2G2UA 2XR0A 3NCKA 5F1FA 2XF3A 1FCMA 2QMIA 1ESIA 3NIAA 1L0EA 3P98A 1K6RA 1CEGA 1BLCA 1KVLA 3ZG7B 5EOEA 1I2SA 1KE0A 2XK1A 5HFOA 4BL3A 4GB7A 3G2ZA 1YQSA 1FOFA 2CC1A
chains in the Genus database with same CATH superfamily
1DRMA 4EBLA 1HTZA 3VP2A 3M6HA 4FSFA 4Q0JA 2ZM0A 1UWPX 2Q0OA 1H8ZA 1T18A 3OZHA 3LR5A 3N8RA 4O7DA 3IF6A 1LSXA 2BTFP 4E6WA 4WZ5A 4BWIA 2J7VA 4I3AA 1JWPA 1BT5A 1GHMA 5GLAA 5AVEA 3BM6A 2JHEA 4E3OA 5HARA 2FFFB 1MPLA 5E43A 1TD5A 1YPRA 3TE8A 3LFVA 3DWZA 1BSGA 2YKFA 2PRFA 4EEPA 3IF6C 4KUKA 1PZOA 1L0GA 3E4PA 4Q0IA 3UO9A 3CJMA 4WZ5C 3LIDA 3CI6A 2R9XA 1WYBA 4BJPA 3H7WA 4ARZB 1KDWA 4YNRA 1IYOA 1S1ZA 1OTEA 5TR7A 3LGOA 1H0MA 5EVLA 1OTIA 2W3EA 4O0PA 4DF6A 2VZWA 5HD5A 4RYEA 3QP4A 3FPVA 2V8CA 1L3LA 3VP3A 2BG1A 1JWVA 1MBLA 1YT4A 2WZXA 3MQQA 2EWWA 3NDGA 5J3WA 1I2WA 4R4SA 5DKLA 2V1BA 1S0WA 5DF7A 3ZG0A 1KE3A 4HEFA 1BULA 1H8MA 3HUMA 1PI4A 3G30A 4DE1A 4DE2A 5HAIA 3UMDA 4KZBA 3SH9A 3NJAA 2ZMAA 1S4SA 4XT2B 4KENB 3V39A 2VGJA 5CERA 4Y2FA 1Q2QA 2LB5A 1G28A 3WS1A 3UY6A 2IA2A 3CHWP 3OC2A 1BTLA 4MNRA 1BLSA 5M19A 4OQGA 2Y2HA 3A0VA 3L7HA 1MC0A 3BRMA 2Y2PA 3S22A 5FSRA 3CMZA 4YWZA 1TDGA 4I38A 3EGDC 1MY8A 3VSLA 4S2LA 4HHDA 2J3TC 4PM9A 2OAQ1 2Y2MA 3LUQA 5E2FA 4LENA 3SZTA 5FQJA 2DRWA 1W8YA 3KYQA 2XLNA 1JNUA 3EEHA 2EFUA 4K0XA 4EW7A 3BEBA 4QHCA 3HVFA 3HREA 3LI9A 3JVUA 3PXPA 4X1MA 1JWZA 3H82B 5FA7A 3JVVA 3IH9A 2C5WB 1C3BA 3TW8A 3T4SA 1IOUA 3RTYA 4IJGA 4BLMA 4H6JA 4C75A 5L07A 1SCWA 2MJ6A 2QKPA 2GNXA 4OLDA 2E8JA 4MN6A 2Q9MA 3GMWA 1EWZA 4OOLA 5A93A 5FQ9A 4ZTKA 3SS5A 2ZL1A 1K55C 5I94A 4OOYA 1GSVA 5GHZA 2OAP1 3TJZC 1TS0A 4R0QA 3VSKA 3UE1A 4UAAA 5M18A 5HZHA 4OP8A 2W3FA 4QD4A 4C3QA 2QHKA 1OTDA 3S1YA 4IEDA 3PHYA 1BZAA 2ZC3B 5F68A 3E4QA 1IELA 2J80A 3EEAA 2A3UA 4OPQA 3IX8A 5FATA 2WKRA 2K7SA 4ZRRA 1K6SA 3E0YA 2Y8HA 4ZJ1A 1G6OA 3LYXA 5KSCA 1GHPA 2JCHA 3DW0A 1YLPA 3IQAA 1NZOA 4L9EA 3LI8A 2PR5A 3W4QA 3UPNA 3T4LA 2XD1A 3LR3A 2K31A 5IT5A 1KE4A 3OBFA 2P04A 3SH7A 4DN0A 1N9OA 5A91A 1ES4A 5EM1A 4KQQA 2ZOIA 1V9YA 2VKSA 3PBTA 1D06A 2EX9A 3PBSA 2PYRA 2ZC4B 3S4XA 3MZEA 3LEQA 1D7EA 2ZQ9A 3NDEA 2KX6A 4CLCB 1OTAA 4PAUA 4UQIS 4X69A 5DFXA 1L0FA 2WKQA 2J9PA 5EV0A 2QJ5A 5L8MA 3HUOA 4R4RA 4DKIA 4GDNA 3MFXA 3IHAA 5KSHA 2GDNA 4IHQA 5HL6A 3OCLA 4HH2A 1NRFA 2PD8A 5J7EA 5GLCA 4M4XA 1IYPA 5E2GA 3BQ8A 2LB9A 5CRFA 1XFNA 3ULFA 2ZJ9A 4XXRA 2V1AA 2HP5A 3DWKA 3T4KA 3HBRA 1LI0A 3NULA 4WEJA 4ZAMA 2PBDP 2ZC6B 4UA6A 3PR6A 5DJUA 4X68A 1PYYA 3FKWA 4EERA 1K54C 3IH8A 1OT6A 4GNUA 4GZBA 4N1XA 3V3RA 3MXRA 5DFYA 5M1AA 5DF8A 3N7WA 2CMNA 4I3IA 5AJGA 5HD3A 1SHVA 1P97A 3R7WB 4Y17A 2Y2KA 1YLTA 5EPHA 4EEUA 5DKKA 5TJJA 2ZMFA 4EUZA 1BUEA 5DF9A 4GLQA 3QP8A 2W0NA 3Q81A 2P08A 2PU2A 1ES3A 2HPBA 4I39A 1SDEA 5HWWA 1ZC2A 4OP5A 4HP4A 1ES5A 3NCKA 3NIAA 2G7UA 4HOIA 1KVLA 1BLCA 5F69A 2PDRA 4R3AA 3C8CA 2XK1A 1YQSA 5CEBA 1GHIA 3PYPA 1HZOA 4KG5A 1YLYA 4B9OA 3MBZA 1G68A 4U0TA 2VEAA 4WELA 3ITBA 4QPRA 4DDSA 4GHIA 4KZ4A 4WL9A 3CITA 3AGDA 3MXQA 4OPYA 4KZAA 1LL8A 3SS4A 1SZVA 1ERQA 4CLCD 3UMEA 3FWLA 3MQ0A 5EECA 2VV8A 4ARZA 3LEZA 4JF5A 4HIAA 2PD7A 2JC7A 3GV9A 3FV7A 4WEKA 5CHMA 1TVFA 3HL9A 1KOUA 4LV2A 3D3OA 3EQUA 5L09A 3ZNYA 5HSQA 4OQ0A 5AVFA 2HDQA 3V5MA 5TBMB 4NG2A 4OPRA 3C7VA 5FAPA 1DY6A 4F94A 3C4OA 4JXGA 3HLGA 4X1LA 5CHJA 1IYSA 3CWFA 1OTBA 1CQAA 1PW8A 3QP2A 4KZ9A 3RXXA 2W1RA 2VA0A 3GDIA 4RX3A 2HJ9C 3MMHA 1W63M 3HJKA 2A49A 1A0KA 1MKIA 1FSWA 4OOMA 4GW9A 4S2KA 1RP5A 1GSWA 1H5XA 2XA7M 4Y5FA 4XT2A 3QP6A 5DTTA 2L0WA 3S7QA 4B4XA 2WKEA 5HWTA 1NRJA 2PYPA 1WA9A 3LY4A 3FG8A 3A3FA 5D3OA 2ZLYA 2RL3A 2VGLM 3ZHHA 3V50A 3B3XA 1TS7A 3IS2B 3MQOA 4BD1A 3DTMA 2H0TA 4KG2A 3BY8A 2V1ZA 5HDSA 4Y15A 1GSXA 1LSWA 1JTDA 3IXBA 1VEUB 1LL9A 2HGVA 1YAXA 5HX9A 5GHXA 3D72A 4WUJA 3NOUC 5CX7A 3BW6A 3MF0A 1PWGA 4HP9A 2EWVA 4PM5A 1CI9A 3W4OA 1V9ZA 1GCEA 3H82A 5FQMA 4S2NA 1VETB 3UB5P 1W7FA 4JXSA 2EA9A 4DJ3A 1Z09A 2I72A 4LRXC 3K3DA 3VOLA 2K2NA 3UPOA 3ZQ5A 4E3LA 4YOFA 3T4QA 1S4RA 1G6AA 5TGFA 4X53A 3T50A 3IXHA 2Z6DA 3NECA 4S2NC 3HLEA 1XPBA 5J8XA 1WYCA 2B18A 1FR6A 4QY6A 3IX4A 2OOLA 5IHVA 3UE3A 2O0YA 5EVIB 1ERMA 2OLUA 4N9KA 4P85A 4BD0A 5BOHA 5GHYA 4ESPA 1KGEA 1IKGA 4O8GA 4C6YA 1LT0A 4X25A 3M2KA 1KGFA 3MKEA 3BFFA 2X71A 1XA1A 4HJ6A 4F3LB 2PBYA 1DJAA 3UPPA 5HWVA 3DTIA 4QWOA 4RX2A 2WGIA 4NXBA 4IBXA 1T1CA 2A24B 2O99A 4WLAA 2OV5A 3O88A 3Q7ZA 3N8LA 1QMFA 3OOVA 3NOPC 4LCLA 3VOYA 3O3VA 2O9CA 4JF6A 3BFDA 1W8QA 3T1XA 3F1NB 3HLFA 3A3JA 4L9GA 1E25A 2HZ5A 2XSSA 4R3BA 2X02A 2Y91A 5MC7A 4E6XA 4PKYG 2DCFA 1LI9A 3G31A 4PM6A 3MS6A 4ETZA 1XFQA 3BY9A 3HUNA 4Z9QA 3A0SA 1F2KA 3LIAA 1P0ZA 4EESA 2JKFA 3A0RA 5DTSA 3PBNA 3IHBA 2DNSA 5HDDA 3LIBA 1F9IA 1ZHHB 2C6WB 2VLGA 4CLCC 1JTGA 3AGFA 4OQIA 3VE4A 4DXBA 3CUEC 2HJEA 3MR0A 3HLCA 4B93A 1K55A 1S67L 3PAEA 2W3GA 4JGPA 2ZQAA 1FIKA 4GCZA 3K3CA 4QJGA 2V0WA 3E4OA 2HP9A 3SW1A 5EVID 4HI4A 3T1SA 4N92A 4X55A 4MBFA 4JBFA 1YLWA 4OONA 3ZCZA 4PHTA 3R7WA 3IXDA 2ZOHA 1IYQA 2XH9A 4IUHA 4CJNA 4JLFA 3U4LP 1X0OA 3BFGA 2HDRA 4HH3A 3HJIA 4LV3A 1EI5A 4JGQA 3CLOA 3B47A 1NZUA 4PPRA 3FPWA 4OLGA 3LY3A 4CQHA 3WS5A 4HQAA 4HY8A 2V0UA 3UE6A 4PMAA 2XFTA 4DJ2A 4FH4A 3IT9A 1P9RA 3O5YA 1AXBA 1E3UD 4KQOA 1P9WA 4UA9A 2M7UA 1AWIA 3NC8A 1N4OA 4BBVA 3QHYA 4XUZA 3N4IA 3T1RA 1ES2A 3A3EA 2G2UA 5F1FA 2JKRI 3ZG7B 2PT7A 5EVEA 1KE0A 1FOFA 2W3HA 2PR6A 2NUTC 4IBRA 2Z2LB 3Q82A 4G3KA 5EUAA 3T12B 4G3VA 5IU1A 3NI9A 1STZA 5IS1A 4R38A 1DJBA 2OLVA 1PZPA 3JPUA 3CAXA 3VP1A 1SKOB 1FQGA 2ZQ7A 3EGXC 1WE4A 3ZG8B 3IX3A 4DE3A 4JKTA 1VHMA 2JKGA 3L9KA 5CGXA 3E98A 2UWXA 3OPLA 1K57C 4HBUA 1E4DA 1K0KA 1FCOA 4L0LA 3EWKA 1U60A 2HDSA 2WGVA 3GQZA 4ZDXA 1YSPA 4KQRA 1S6RA 4QY5A 1K54A 2XEPA 1Z6FA 2HV1A 3IBRA 3Q1FA 4QU3A 5KMWA 3BECA 4X6TA 3LIFA 2WKPA 4UHUA 4G3WA 5FEGA 3FZCA 1NYYA 5HPFA 3VP4A 4JXWA 4DMZA 2J9OA 5EM0A 4X56A 4NK3A 4UEYA 3KX0X 1ONGA 1PI5A 2ZQCA 3N8SA 5CHUA 1T19A 5AQAA 4BL2A 2HP6A 3RH8B 4EETB 1NY0A 3H9WA 3IS2A 4P0MA 3KYEA 5FQQA 4I5SA 1S1YA 1K56D 3LICA 3V3SA 4B4ZA 2Z6CA 3CZDA 1DP8A 3P7NA 4PM7A 4P6ZM 4KQDA 5JYOA 3B42A 1T1BA 4FH2A 2BASA 1G5UA 1PFLA 1T1AA 1H8YA 4GD6A 5CTMA 4EQ1A 2Y79A 4I3JA 1N9NA 3FC7A 1YLZA 1VETA 1YMSA 2EX8A 4L9FA 5A90A 2WK0A 1XX2A 2VK3A 4ZJ2A 3WS2A 3BFCA 3GRJA 5AQ9A 2O9BA 3MXSA 5F6AA 1Q2PA 1TEMA 4DXCA 2XDMA 4EQIA 1UWNX 2ZMVA 4WM9A 2EX6A 5CXWA 1LHYA 5F5YA 2W1TB 4LLOB 3IF5A 2W3DA 1HD8A 2OSUA 4GS9B 3G6OA 3ZGAB 1OPXA 3UN7A 3IWQA 2Y4AA 4K91A 4GD8A 3IXGA 5HW3A 3QP5A 5KIZA 2QWSA 2ZC5B 2H5SA 4WMCD 3C7UA 5HAQA 1OJ5A 5AQ7A 3UDFA 5FI6A 1XGIA 4F3LA 4D60A 2QJ7A 3ZG9B 5EVIC 4FD8A 5LBRA 3OLOA 3LIEA 4Y13A 1MWRA 4R23A 4MN7A 4BBTA 2Y2NA 4E3IA 4NXEA 1TDLA 5FQIA 5FQKA 3BLMA 4LPZA 4MCWA 3WS4A 1XJ6A 3C4PA 4D2OA 5FAOA 3MFDA 2EXBA 4OVDA 1E3UA 2BLSA 2P7JA 2VJWA 3F1NA 3PTEA 2YKHA 5A8BA 5L2FA 1MWTA 3NBLA 5F82A 2E8IA 3VV4A 1F98A 3GVBA 3NOTC 3RFBA 1K4FA 2P74A 1NLZA 1PWDA 3O86A 3BYDA 4EV4A 4NXFA 3K2NA 1OJGA 4EUVA 4PM8A 3KYZA 1J3WA 3QNBA 3B33A 1M40A 4Q0HA 3UDXA 4E3KA 5EE8A 4JF4A 3DTKA 3NHQA 4IVIA 1IFQA 2D01A 2L1MA 3MZDA 4LV0A 2W27A 2AVXA 2QPNA 1CI8A 1LLBA 2JKRM 3G35A 2OWHA 1Y54A 2B02A 3OPPA 1SDNA 2XRNA 3IWIA 1K25A 4S2JA 2WAFA 1F5MA 3G34A 5AQBA 2WYXA 1YMXA 5E2EA 1RGYA 4ZJ3A 3W4PA 3HLDA 4U0XA 2JBFA 1S66L 5FI7A 1EW0A 2VV7A 2Y2GA 3O87A 3ZDJA 5EOOA 1Y4OA 5KZHA 2V8FA 4KZ3A 4E3MA 3I7JA 2VV6A 3DTEA 4WF0A 1CEFA 3S7OA 2Y2LA 1MWSA 5HDCA 5CECA 1MWUA 5A92A 3P01A 4HBTA 4GHIB 2ACGA 1K56A 3DBAA 4GN2A 3SOIA 1TS6A 3BQAA 1MXOA 1YLJA 2B5RA 3RJUA 2Y55A 2R9WA 3T4JA 5J4EA 4DRTA 1IKIA 1FILA 4MBKA 4K08A 4OH0A 4OPZA 3VFHA 2A2LA 3OPRA 1XJ3A 3T4OA 2WGWB 3F1PB 3HCYA 2I9VA 5FASA 4MBHA 2P9VB 1DJCA 2G2WA 3MJQA 1NXYA 4K0WA 3T4TA 4O01A 3A3IA 2Y59A 3CPTB 1BLPA 1PNEA 1VB6A 5FI2A 4Y7PA 4LFUA 5G4ZA 1VM1A 3W2ZA 2XROA 3Q7VB 2B95A 2OWJA 3CG5A 2XGNA 4KZ6A 2XQZA 1IEMA 3G4PA 3VE3A 3WWXA 2KDKA 2VX8A 3C30A 1GA9A 1PWCA 4KZ8A 1SKOA 4NKPA 5L10A 4EBNA 1ALQA 2FH5A 4CLCA 1Y28A 3P98A 1CEGA 1TF1A 5EOEA 1I2SA 3CUEA 1XJ4A 4GB7A 3G2ZA 4BL3A 1QMEA 2JKTI 3UB7A 4KUOA 1W5DA 2UV0E 2Y2JA 3UB9A 4M3KA 3UB8A 3F1OB 1CK3A 1UGUA 4IUKA 2IWDA 4BENA 3Q07A 4EU0A 5FL3A 1CF0A 4WMCA 4P87A 4Q8IA 4BMWA 4GJ4A 5GLDA 3TG9A 4JPMA 2GX5A 4LCMA 3S7PA 3DAVA 5FDSA 1DP9A 4YFMA 1NYMA 4E3NA 2FZ0A 1YKDA 2PAVP 3MSHA 4HJ4A 1HLUP 2HF6A 3M2JA 2JE5A 2ZM8A 3UE0A 2M7VA 2ZBBA 3E2KA 1FSYA 1ONHA 4FUWA 4WN5A 5HPIA 3IF6B 3E2LA 2ZQDA 4Y0TA 2J3WA 3BFEA 4LGWA 2ZQ8A 4AFIA 4KZ5A 4DE0A 4ETXA 4R70A 1PRQA 1YM1A 3JYIA 3OCNA 5I5LA 4MMNA 2INWA 3SH8A 3UDIA 3V67A 4EWFA 5HL1A 3HLBA 3LCEA 4NETA 4Y0UA 3N6IA 3TSGA 3H7WB 2KOIA 3VMAA 4GKUA 4KZ7A 4MN5A 2QYBA 2IWCA 3EOIA 1ZG6A 3LO7A 4OKPA 2XFSA 2ZM2A 3WRTA 2XD5A 3KSGA 3KO6A 4JXVA 4FOFA 3QP1A 4HJ3A 1I5QA 2PHYA 2RCXA 1XA7A 4PKYA 2W1TA 1CJFA 3G32A 4FTXA 1K57A 2Z2MB 1JVJA 4QB8A 4GS9A 4MEZA 1ZG4A 3AGEA 2H28A 3PBQA 2J8YA 5CTNA 4E04A 3GR2A 4IVKA 2PU4A 3P09A 4ME4A 4P6ZS 5TBMA 1K4EA 4BBUA 4FCFA 3LR0A 4RVAA 2D02A 2EXAA 4CPKA 2FFYA 3S7NA 4CLCE 4UA7A 1NLYA 1PIOA 2V20A 3WS0A 2DMWA 1O7EA 1KVMA 1ZKJA 1W79A 1N9BA 5HAPA 1XJ2A 3OPHA 3BWLA 4HESA 4H8RA 3KSIA 1MZUA 4BQMA 4Z1WA 1D1JA 1XP4A 3C38A 2NUPC 5CEDA 2ZC7A 2O9AA 4ZBEA 2QZ6A 5DVAA 3G2YA 2Y2OA 1DP6A 1TS8A 3W8KA 3IBJA 1M6KA 5GLBA 3GECA 4R6LA 1PW1A 3PAGA 5F83A 4Y3IA 1ACFA 4R3JA 3D9YA 1VEUA 4GDBA 3VFFA 1KDSA 4WZ4A 1XKZA 1YSQA 3VOZA 4II7A 3SS3A 4H6JB 4S2MA 1H3QA 4JGOA 3PBRA 5TFQA 4RA7A 4OQHA 4S2IA 2H0YA 1FCNA 3HLWA 1EROA 5CGWA 2M1CA 2ZL1B 5FAQA 2ZD8A 2WZZA 2H10A 4N1HA 3GSGA 4WYYA 2Q9NA 2JN7A 4UQIM 3VP0A 2HDUA 4DDYA 2WKIA 2XA7S 5E2HA 5K5BA 2V9AA 1GA0A 2VGKA 2WUQA 5FDHA 2EFXA 3KSFA 1ZTUA 1RCJA 3EQVA 1VQQA 3UNWA 3ITAA 5GL9A 4S2PA 3MZFA 3U2AA 3FKVA 1SKFA 4B88A 4NXGA 1O07A 1W63Q 3NY4A 1OT9A 1ESUA 1RGZA 3TOIA 1HVBA 1MKMA 4S2OA 1K38A 2JKTM 3QNCA 5EVIA 3PBOA 4HNBA 3FYZA 2VGLS 3T1QB 3MKFA 4LV1A 3C2WA 2J3TD 4WBGA 2KLIA 3ISGA 1OMEA 2Y2IA 4EBPA 2GZAA 4MDZA 4U3TA 4XUXA 5F1GA 4MLLA 2EX2A 4ID4A 3LR4A 5C5KA 3ICYA 5CGSA 2WGWA 2IWBA 1LSVA 3F1PA 5DJTA 1BYWA 5EFWA 4KG6A 3ZVTA 3IWOA 2L4RA 2P9VA 1J9MA 1N9LA 4N9LA 1XXMA 2A24A 3BJNA 2R78A 3CPTA 3M6BA 1ODVA 5G18A 3Q7VA 4GOGA 3C5AA 2V2FF 2WAEA 3RXWA 5G4YA 3KSHA 1L0DA 4YINA 3WRZA 3BLSA 3GTCA 3TRCA 2WADA 3D4FA 4P6BA 4E3JA 1NJ4A 1L2SA 3UB6A 3ZFZA 4A5RA 1XGJA 1FR1A 4LRZE 1BLHA 2WKHA 5U47A 5DTKA 1KGGA 3R4KA 4Y0OA 5JYPA 3F1OA 3A3DA 2Y2QA 2X01A 2GJ3A 5FEFA 3ZNTA 4NEED 4R1GA 3ZVWA 1LL5A 3ZG5A 2XR0A 2XF3A 1FCMA 2QMIA 1ESIA 4EXOA 1L0EA 1K6RA 4LRYC 1NWZA 5HFOA 4JGRA 3ZYTA 4RQ9A 2CC1A
chains in the Genus database with same CATH topology
5CEBA 1GHIA 4IBRA 2Z2LB 3Q82A 4EBLA 1HZOA 5EUAA 1W5DA 1HTZA 2Y2JA 4KG5A 3VP2A 4M3KA 3NI9A 3M6HA 4FSFA 2ZM0A 1YLYA 3MBZA 1CK3A 1G68A 4U0TA 1DJBA 2OLVA 2IWDA 4WELA 4BENA 3Q07A 1H8ZA 3ITBA 4WMCA 1PZPA 4P87A 3VP1A 4DDSA 4Q8IA 1FQGA 2ZQ7A 3OZHA 4JPMA 4KZ4A 5GLDA 3AGDA 3TG9A 3N8RA 4O7DA 3IF6A 1WE4A 4OPYA 3ZG8B 4KZAA 3SS4A 4LCMA 4DE3A 1ERQA 4JKTA 5CGXA 3FWLA 5EECA 2UWXA 4YFMA 1NYMA 4E3NA 3LEZA 3OPLA 4WZ5A 1K57C 4HBUA 4E6WA 4JF5A 2J7VA 1E4DA 1JWPA 4L0LA 1BT5A 1FCOA 1GHMA 5GLAA 2JC7A 3GV9A 1U60A 2HDSA 3BM6A 2WGVA 3GQZA 3FV7A 4E3OA 5HARA 2FFFB 4WEKA 5CHMA 3M2JA 4ZDXA 1TVFA 2JE5A 4KQRA 3HL9A 2ZM8A 1MPLA 1S6RA 4LV2A 4QY5A 1K54A 2XEPA 5E43A 1Z6FA 3EQUA 3UE0A 3E2KA 3ZNYA 1FSYA 3Q1FA 1ONHA 4QU3A 3DWZA 1BSGA 3BECA 5KMWA 4OQ0A 4X6TA 4UHUA 2HDQA 3V5MA 3IF6C 1PZOA 4OPRA 1L0GA 3C7VA 3IF6B 5FAPA 3E2LA 3FZCA 1NYYA 2ZQDA 1DY6A 3UO9A 3VP4A 3C4OA 4F94A 4JXGA 3HLGA 4Y0TA 3BFEA 5CHJA 3CJMA 4JXWA 1IYSA 4WZ5C 2J9OA 2ZQ8A 2R9XA 1WYBA 4KZ5A 4X56A 4NK3A 4BJPA 4DE0A 1PW8A 1KDWA 4KZ9A 1YM1A 1IYOA 1ONGA 5TR7A 3RXXA 1PI5A 2ZQCA 4RX3A 5EVLA 3N8SA 3JYIA 5CHUA 5AQAA 2A49A 4BL2A 2HP6A 4DF6A 1MKIA 1FSWA 3OCNA 4OOMA 1NY0A 4P0MA 4S2KA 4RYEA 3SH8A 1RP5A 3UDIA 1H5XA 4EWFA 5HL1A 3VP3A 2BG1A 1JWVA 5FQQA 1MBLA 1YT4A 2WZXA 3HLBA 1K56D 4B4ZA 3V3SA 3CZDA 5DTTA 3NDGA 3LCEA 4NETA 1I2WA 4PM7A 4R4SA 4Y0UA 3N6IA 3TSGA 1S0WA 5DF7A 4B4XA 3ZG0A 1KE3A 2WKEA 4HEFA 1BULA 5JYOA 3VMAA 4GKUA 4FH2A 4KZ7A 3LY4A 2IWCA 3HUMA 3A3FA 1PI4A 1H8YA 1ZG6A 3LO7A 3G30A 4OKPA 2ZLYA 2XFSA 5D3OA 4DE1A 2ZM2A 4GD6A 3WRTA 5CTMA 2RL3A 2XD5A 4DE2A 5HAIA 3ZHHA 3V50A 1YLZA 4JXVA 1YMSA 2EX8A 3B3XA 4KZBA 3SH9A 5A90A 4BD1A 1I5QA 2WK0A 1XX2A 2RCXA 2ZMAA 1XA7A 3DTMA 4ZJ2A 4KENB 3V39A 2VGJA 5CERA 2H0TA 3BFCA 3G32A 4KG2A 1Q2QA 3WS2A 3GRJA 5AQ9A 1K57A 2V1ZA 2Z2MB 1JVJA 4QB8A 3WS1A 3UY6A 1JTDA 3IXBA 3MXSA 1LL9A 4MEZA 1Q2PA 1ZG4A 3OC2A 3AGEA 1BTLA 4MNRA 1TEMA 5HX9A 3PBQA 1BLSA 5GHXA 5M19A 2J8YA 5CTNA 3GR2A 4OQGA 4DXCA 1PWGA 4IVKA 2PU4A 2Y2HA 4PM5A 3P09A 2XDMA 1K4EA 3BRMA 2Y2PA 1CI9A 3S22A 5FSRA 3W4OA 3CMZA 1GCEA 4EQIA 5FQMA 4FCFA 4WM9A 4S2NA 4RVAA 2EX6A 1TDGA 1W7FA 4JXSA 5CXWA 1LHYA 1MY8A 2EXAA 4CPKA 2I72A 2FFYA 3VSLA 4S2LA 4UA7A 2V20A 1PIOA 4PM9A 3WS0A 2Y2MA 1O7EA 3IF5A 5E2FA 3UPOA 1KVMA 4LENA 1HD8A 1ZKJA 2OSUA 5FQJA 4E3LA 1W79A 1W8YA 2DRWA 1N9BA 3ZGAB 2XLNA 3UN7A 3IWQA 5HAPA 1G6AA 2Y4AA 4K91A 4GD8A 2EFUA 4K0XA 5TGFA 3OPHA 3IXGA 3BEBA 4X53A 4QHCA 3HVFA 5HW3A 4HESA 4H8RA 2ZC5B 3HREA 3IXHA 4BQMA 2H5SA 4WMCD 3C7UA 5HAQA 1XP4A 5AQ7A 3UDFA 4S2NC 5FI6A 3HLEA 1XGIA 1JWZA 5FA7A 1XPBA 3IH9A 5J8XA 1WYCA 2C5WB 3ZG9B 1C3BA 5CEDA 1FR6A 5EVIC 4QY6A 4FD8A 5IHVA 3UE3A 4BLMA 2ZC7A 5EVIB 1ERMA 2OLUA 1MWRA 4N9KA 4R23A 4C75A 4ZBEA 4P85A 2QZ6A 1SCWA 5DVAA 4BD0A 5BOHA 5GHYA 3G2YA 2Y2OA 2Y2NA 4E3IA 4OLDA 1KGEA 1TDLA 1IKGA 5FQIA 3BLMA 5FQKA 3W8KA 4C6YA 3WS4A 2Q9MA 3GMWA 1M6KA 5GLBA 1EWZA 3C4PA 1KGFA 3M2KA 4OOLA 4D2OA 3MKEA 5A93A 3BFFA 5FQ9A 5FAOA 4ZTKA 3SS5A 2X71A 3MFDA 1XA1A 1K55C 2EXBA 5I94A 4OOYA 4OVDA 5GHZA 1PW1A 1E3UA 2BLSA 3PAGA 5F83A 3PTEA 4R3JA 2PBYA 1DJAA 4R0QA 3UPPA 3VSKA 3UE1A 4GDBA 1MWTA 4UAAA 5L2FA 5M18A 4OP8A 3VFFA 1KDSA 3NBLA 4QD4A 4WZ4A 1XKZA 5F82A 4C3QA 3VOZA 4RX2A 2E8IA 2WGIA 3SS3A 4S2MA 3GVBA 4IBXA 3S1YA 4IEDA 1K4FA 3PBRA 2P74A 5TFQA 4RA7A 2OV5A 4OQHA 4S2IA 2H0YA 3O88A 1FCNA 1PWDA 3BYDA 3O86A 3HLWA 3Q7ZA 1EROA 3N8LA 4EV4A 1BZAA 1QMFA 2ZC3B 3VOYA 4LCLA 5CGWA 1IELA 3O3VA 4PM8A 4JF6A 3BFDA 5FAQA 2ZD8A 2WZZA 2H10A 2A3UA 1W8QA 4OPQA 3QNBA 4N1HA 5FATA 3GSGA 4WYYA 3HLFA 2Q9NA 1K6SA 3VP0A 1M40A 2HDUA 3A3JA 1E25A 4DDYA 4ZJ1A 2WKIA 4R3BA 2X02A 2Y91A 5E2HA 3UDXA 1GHPA 4E6XA 5KSCA 4E3KA 5EE8A 1GA0A 2DCFA 2JCHA 2VGKA 2WUQA 3DW0A 4JF4A 1LI9A 3G31A 1YLPA 4PM6A 5FDHA 3IQAA 2EFXA 1NZOA 1RCJA 3EQVA 4IVIA 1VQQA 3UNWA 3ITAA 3W4QA 3HUNA 3UPNA 2XD1A 5GL9A 3MZDA 3MZFA 4LV0A 4S2PA 3FKVA 1SKFA 4Z9QA 4B88A 1O07A 2QPNA 1CI8A 1LLBA 3G35A 3NY4A 1KE4A 1ESUA 1RGZA 1QMEA 3SH7A 3TOIA 1HVBA 4S2OA 1Y54A 1K38A 5A91A 1ES4A 3QNCA 4KQQA 5EVIA 3FYZA 3OPPA 3PBOA 1SDNA 5DTSA 3IWIA 3PBNA 3IHBA 2DNSA 3PBTA 3MKFA 2EX9A 4LV1A 1K25A 4S2JA 2WAFA 3PBSA 3G34A 4WBGA 3ISGA 2C6WB 1OMEA 2ZC4B 3MZEA 5AQBA 3S4XA 2WYXA 1YMXA 1JTGA 2Y2IA 3AGFA 5E2EA 1RGYA 2ZQ9A 4OQIA 3NDEA 4ZJ3A 3HLDA 4U0XA 4U3TA 5F1GA 4XUXA 3W4PA 4EBPA 4DXBA 2JBFA 4X69A 1L0FA 4MLLA 2EX2A 5FI7A 2J9PA 3HLCA 4ID4A 2Y2GA 1K55A 3O87A 3ZDJA 5EOOA 3HUOA 5KZHA 3PAEA 4R4RA 4KZ3A 4E3MA 3I7JA 4DKIA 5CGSA 2WGWA 2ZQAA 2IWBA 4GDNA 3IHAA 5KSHA 1CEFA 2GDNA 3OCLA 4QJGA 2Y2LA 1MWSA 2HP9A 4KG6A 3ZVTA 3IWOA 5EVID 2P9VA 5CECA 1NRFA 1MWUA 1J9MA 5A92A 5GLCA 4N9LA 1IYPA 1XXMA 4HBTA 4N92A 5E2GA 1K56A 4GN2A 4X55A 3M6BA 3SOIA 5CRFA 1MXOA 4MBFA 1YLJA 4JBFA 2B5RA 3RJUA 1YLWA 4OONA 2ZJ9A 2Y55A 4XXRA 2R9WA 3ZCZA 2HP5A 3DWKA 5G18A 3IXDA 3Q7VA 4GOGA 1IKIA 3C5AA 3HBRA 4DRTA 1IYQA 1LI0A 2XH9A 4CJNA 4MBKA 4JLFA 4WEJA 4OH0A 4ZAMA 4OPZA 2ZC6B 4UA6A 3BFGA 2V2FF 2WAEA 3RXWA 3VFHA 2HDRA 4LV3A 1EI5A 4X68A 1L0DA 4YINA 1PYYA 3FKWA 3WRZA 3OPRA 1K54C 3IH8A 4GNUA 2WGWB 3BLSA 3GTCA 4GZBA 4N1XA 2WADA 3D4FA 5FASA 3V3RA 1NZUA 4P6BA 4MBHA 4PPRA 4E3JA 1NJ4A 3MXRA 1L2SA 2P9VB 5M1AA 1DJCA 2G2WA 5DF8A 1NXYA 4K0WA 3N7WA 3ZFZA 4OLGA 3LY3A 3A3IA 2Y59A 1BLPA 3WS5A 4A5RA 1XGJA 1FR1A 5FI2A 4Y7PA 1SHVA 1BLHA 1VM1A 2WKHA 4PMAA 2Y2KA 2XFTA 5U47A 3Q7VB 5DTKA 1KGGA 1YLTA 4FH4A 5EPHA 3CG5A 3IT9A 2XGNA 4Y0OA 5JYPA 1AXBA 4KZ6A 2XQZA 1IEMA 4EUZA 3G4PA 3WWXA 1BUEA 5DF9A 1E3UD 3A3DA 2Y2QA 4KQOA 4UA9A 2X01A 3Q81A 1GA9A 1PWCA 2PU2A 3NC8A 4KZ8A 1N4OA 3ZNTA 1ES3A 2HPBA 3QHYA 1SDEA 4R1GA 3ZVWA 4XUZA 3N4IA 4EBNA 1ES2A 1ZC2A 3A3EA 4OP5A 1ALQA 1LL5A 1ES5A 3ZG5A 2G2UA 2XR0A 3NCKA 5F1FA 2XF3A 1FCMA 2QMIA 1ESIA 3NIAA 1L0EA 3P98A 1K6RA 1CEGA 1BLCA 1KVLA 3ZG7B 5EOEA 1I2SA 1KE0A 2XK1A 5HFOA 4BL3A 4GB7A 3G2ZA 1YQSA 1FOFA 2CC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CEB A;  1GHI A;  4IBR A;  2Z2L B;  3Q82 A;  4EBL A;  1HZO A;  5EUA A;  1W5D A;  1HTZ A;  2Y2J A;  4KG5 A;  3VP2 A;  4M3K A;  3NI9 A;  3M6H A;  4FSF A;  2ZM0 A;  1YLY A;  3MBZ A;  1CK3 A;  1G68 A;  4U0T A;  1DJB A;  2OLV A;  2IWD A;  4WEL A;  4BEN A;  3Q07 A;  1H8Z A;  3ITB A;  4WMC A;  1PZP A;  4P87 A;  3VP1 A;  4DDS A;  4Q8I A;  1FQG A;  2ZQ7 A;  3OZH A;  4JPM A;  4KZ4 A;  5GLD A;  3AGD A;  3TG9 A;  3N8R A;  4O7D A;  3IF6 A;  1WE4 A;  4OPY A;  3ZG8 B;  4KZA A;  3SS4 A;  4LCM A;  4DE3 A;  1ERQ A;  4JKT A;  5CGX A;  3FWL A;  5EEC A;  2UWX A;  4YFM A;  1NYM A;  4E3N A;  3LEZ A;  3OPL A;  4WZ5 A;  1K57 C;  4HBU A;  4E6W A;  4JF5 A;  2J7V A;  1E4D A;  1JWP A;  4L0L A;  1BT5 A;  1FCO A;  1GHM A;  5GLA A;  2JC7 A;  3GV9 A;  1U60 A;  2HDS A;  3BM6 A;  2WGV A;  3GQZ A;  3FV7 A;  4E3O A;  5HAR A;  2FFF B;  4WEK A;  5CHM A;  3M2J A;  4ZDX A;  1TVF A;  2JE5 A;  4KQR A;  3HL9 A;  2ZM8 A;  1MPL A;  1S6R A;  4LV2 A;  4QY5 A;  1K54 A;  2XEP A;  5E43 A;  1Z6F A;  3EQU A;  3UE0 A;  3E2K A;  3ZNY A;  1FSY A;  3Q1F A;  1ONH A;  4QU3 A;  3DWZ A;  1BSG A;  3BEC A;  5KMW A;  4OQ0 A;  4X6T A;  4UHU A;  2HDQ A;  3V5M A;  3IF6 C;  1PZO A;  4OPR A;  1L0G A;  3C7V A;  3IF6 B;  5FAP A;  3E2L A;  3FZC A;  1NYY A;  2ZQD A;  1DY6 A;  3UO9 A;  3VP4 A;  3C4O A;  4F94 A;  4JXG A;  3HLG A;  4Y0T A;  3BFE A;  5CHJ A;  3CJM A;  4JXW A;  1IYS A;  4WZ5 C;  2J9O A;  2ZQ8 A;  2R9X A;  1WYB A;  4KZ5 A;  4X56 A;  4NK3 A;  4BJP A;  4DE0 A;  1PW8 A;  1KDW A;  4KZ9 A;  1YM1 A;  1IYO A;  1ONG A;  5TR7 A;  3RXX A;  1PI5 A;  2ZQC A;  4RX3 A;  5EVL A;  3N8S A;  3JYI A;  5CHU A;  5AQA A;  2A49 A;  4BL2 A;  2HP6 A;  4DF6 A;  1MKI A;  1FSW A;  3OCN A;  4OOM A;  1NY0 A;  4P0M A;  4S2K A;  4RYE A;  3SH8 A;  1RP5 A;  3UDI A;  1H5X A;  4EWF A;  5HL1 A;  3VP3 A;  2BG1 A;  1JWV A;  5FQQ A;  1MBL A;  1YT4 A;  2WZX A;  3HLB A;  1K56 D;  4B4Z A;  3V3S A;  3CZD A;  5DTT A;  3NDG A;  3LCE A;  4NET A;  1I2W A;  4PM7 A;  4R4S A;  4Y0U A;  3N6I A;  3TSG A;  1S0W A;  5DF7 A;  4B4X A;  3ZG0 A;  1KE3 A;  2WKE A;  4HEF A;  1BUL A;  5JYO A;  3VMA A;  4GKU A;  4FH2 A;  4KZ7 A;  3LY4 A;  2IWC A;  3HUM A;  3A3F A;  1PI4 A;  1H8Y A;  1ZG6 A;  3LO7 A;  3G30 A;  4OKP A;  2ZLY A;  2XFS A;  5D3O A;  4DE1 A;  2ZM2 A;  4GD6 A;  3WRT A;  5CTM A;  2RL3 A;  2XD5 A;  4DE2 A;  5HAI A;  3ZHH A;  3V50 A;  1YLZ A;  4JXV A;  1YMS A;  2EX8 A;  3B3X A;  4KZB A;  3SH9 A;  5A90 A;  4BD1 A;  1I5Q A;  2WK0 A;  1XX2 A;  2RCX A;  2ZMA A;  1XA7 A;  3DTM A;  4ZJ2 A;  4KEN B;  3V39 A;  2VGJ A;  5CER A;  2H0T A;  3BFC A;  3G32 A;  4KG2 A;  1Q2Q A;  3WS2 A;  3GRJ A;  5AQ9 A;  1K57 A;  2V1Z A;  2Z2M B;  1JVJ A;  4QB8 A;  3WS1 A;  3UY6 A;  1JTD A;  3IXB A;  3MXS A;  1LL9 A;  4MEZ A;  1Q2P A;  1ZG4 A;  3OC2 A;  3AGE A;  1BTL A;  4MNR A;  1TEM A;  5HX9 A;  3PBQ A;  1BLS A;  5GHX A;  5M19 A;  2J8Y A;  5CTN A;  3GR2 A;  4OQG A;  4DXC A;  1PWG A;  4IVK A;  2PU4 A;  2Y2H A;  4PM5 A;  3P09 A;  2XDM A;  1K4E A;  3BRM A;  2Y2P A;  1CI9 A;  3S22 A;  5FSR A;  3W4O A;  3CMZ A;  1GCE A;  4EQI A;  5FQM A;  4FCF A;  4WM9 A;  4S2N A;  4RVA A;  2EX6 A;  1TDG A;  1W7F A;  4JXS A;  5CXW A;  1LHY A;  1MY8 A;  2EXA A;  4CPK A;  2I72 A;  2FFY A;  3VSL A;  4S2L A;  4UA7 A;  2V20 A;  1PIO A;  4PM9 A;  3WS0 A;  2Y2M A;  1O7E A;  3IF5 A;  5E2F A;  3UPO A;  1KVM A;  4LEN A;  1HD8 A;  1ZKJ A;  2OSU A;  5FQJ A;  4E3L A;  1W79 A;  1W8Y A;  2DRW A;  1N9B A;  3ZGA B;  2XLN A;  3UN7 A;  3IWQ A;  5HAP A;  1G6A A;  2Y4A A;  4K91 A;  4GD8 A;  2EFU A;  4K0X A;  5TGF A;  3OPH A;  3IXG A;  3BEB A;  4X53 A;  4QHC A;  3HVF A;  5HW3 A;  4HES A;  4H8R A;  2ZC5 B;  3HRE A;  3IXH A;  4BQM A;  2H5S A;  4WMC D;  3C7U A;  5HAQ A;  1XP4 A;  5AQ7 A;  3UDF A;  4S2N C;  5FI6 A;  3HLE A;  1XGI A;  1JWZ A;  5FA7 A;  1XPB A;  3IH9 A;  5J8X A;  1WYC A;  2C5W B;  3ZG9 B;  1C3B A;  5CED A;  1FR6 A;  5EVI C;  4QY6 A;  4FD8 A;  5IHV A;  3UE3 A;  4BLM A;  2ZC7 A;  5EVI B;  1ERM A;  2OLU A;  1MWR A;  4N9K A;  4R23 A;  4C75 A;  4ZBE A;  4P85 A;  2QZ6 A;  1SCW A;  5DVA A;  4BD0 A;  5BOH A;  5GHY A;  3G2Y A;  2Y2O A;  2Y2N A;  4E3I A;  4OLD A;  1KGE A;  1TDL A;  1IKG A;  5FQI A;  3BLM A;  5FQK A;  3W8K A;  4C6Y A;  3WS4 A;  2Q9M A;  3GMW A;  1M6K A;  5GLB A;  1EWZ A;  3C4P A;  1KGF A;  3M2K A;  4OOL A;  4D2O A;  3MKE A;  5A93 A;  3BFF A;  5FQ9 A;  5FAO A;  4ZTK A;  3SS5 A;  2X71 A;  3MFD A;  1XA1 A;  1K55 C;  2EXB A;  5I94 A;  4OOY A;  4OVD A;  5GHZ A;  1PW1 A;  1E3U A;  2BLS A;  3PAG A;  5F83 A;  3PTE A;  4R3J A;  2PBY A;  1DJA A;  4R0Q A;  3UPP A;  3VSK A;  3UE1 A;  4GDB A;  1MWT A;  4UAA A;  5L2F A;  5M18 A;  4OP8 A;  3VFF A;  1KDS A;  3NBL A;  4QD4 A;  4WZ4 A;  1XKZ A;  5F82 A;  4C3Q A;  3VOZ A;  4RX2 A;  2E8I A;  2WGI A;  3SS3 A;  4S2M A;  3GVB A;  4IBX A;  3S1Y A;  4IED A;  1K4F A;  3PBR A;  2P74 A;  5TFQ A;  4RA7 A;  2OV5 A;  4OQH A;  4S2I A;  2H0Y A;  3O88 A;  1FCN A;  1PWD A;  3BYD A;  3O86 A;  3HLW A;  3Q7Z A;  1ERO A;  3N8L A;  4EV4 A;  1BZA A;  1QMF A;  2ZC3 B;  3VOY A;  4LCL A;  5CGW A;  1IEL A;  3O3V A;  4PM8 A;  4JF6 A;  3BFD A;  5FAQ A;  2ZD8 A;  2WZZ A;  2H10 A;  2A3U A;  1W8Q A;  4OPQ A;  3QNB A;  4N1H A;  5FAT A;  3GSG A;  4WYY A;  3HLF A;  2Q9N A;  1K6S A;  3VP0 A;  1M40 A;  2HDU A;  3A3J A;  1E25 A;  4DDY A;  4ZJ1 A;  2WKI A;  4R3B A;  2X02 A;  2Y91 A;  5E2H A;  3UDX A;  1GHP A;  4E6X A;  5KSC A;  4E3K A;  5EE8 A;  1GA0 A;  2DCF A;  2JCH A;  2VGK A;  2WUQ A;  3DW0 A;  4JF4 A;  1LI9 A;  3G31 A;  1YLP A;  4PM6 A;  5FDH A;  3IQA A;  2EFX A;  1NZO A;  1RCJ A;  3EQV A;  4IVI A;  1VQQ A;  3UNW A;  3ITA A;  3W4Q A;  3HUN A;  3UPN A;  2XD1 A;  5GL9 A;  3MZD A;  3MZF A;  4LV0 A;  4S2P A;  3FKV A;  1SKF A;  4Z9Q A;  4B88 A;  1O07 A;  2QPN A;  1CI8 A;  1LLB A;  3G35 A;  3NY4 A;  1KE4 A;  1ESU A;  1RGZ A;  1QME A;  3SH7 A;  3TOI A;  1HVB A;  4S2O A;  1Y54 A;  1K38 A;  5A91 A;  1ES4 A;  3QNC A;  4KQQ A;  5EVI A;  3FYZ A;  3OPP A;  3PBO A;  1SDN A;  5DTS A;  3IWI A;  3PBN A;  3IHB A;  2DNS A;  3PBT A;  3MKF A;  2EX9 A;  4LV1 A;  1K25 A;  4S2J A;  2WAF A;  3PBS A;  3G34 A;  4WBG A;  3ISG A;  2C6W B;  1OME A;  2ZC4 B;  3MZE A;  5AQB A;  3S4X A;  2WYX A;  1YMX A;  1JTG A;  2Y2I A;  3AGF A;  5E2E A;  1RGY A;  2ZQ9 A;  4OQI A;  3NDE A;  4ZJ3 A;  3HLD A;  4U0X A;  4U3T A;  5F1G A;  4XUX A;  3W4P A;  4EBP A;  4DXB A;  2JBF A;  4X69 A;  1L0F A;  4MLL A;  2EX2 A;  5FI7 A;  2J9P A;  3HLC A;  4ID4 A;  2Y2G A;  1K55 A;  3O87 A;  3ZDJ A;  5EOO A;  3HUO A;  5KZH A;  3PAE A;  4R4R A;  4KZ3 A;  4E3M A;  3I7J A;  4DKI A;  5CGS A;  2WGW A;  2ZQA A;  2IWB A;  4GDN A;  3IHA A;  5KSH A;  1CEF A;  2GDN A;  3OCL A;  4QJG A;  2Y2L A;  1MWS A;  2HP9 A;  4KG6 A;  3ZVT A;  3IWO A;  5EVI D;  2P9V A;  5CEC A;  1NRF A;  1MWU A;  1J9M A;  5A92 A;  5GLC A;  4N9L A;  1IYP A;  1XXM A;  4HBT A;  4N92 A;  5E2G A;  1K56 A;  4GN2 A;  4X55 A;  3M6B A;  3SOI A;  5CRF A;  1MXO A;  4MBF A;  1YLJ A;  4JBF A;  2B5R A;  3RJU A;  1YLW A;  4OON A;  2ZJ9 A;  2Y55 A;  4XXR A;  2R9W A;  3ZCZ A;  2HP5 A;  3DWK A;  5G18 A;  3IXD A;  3Q7V A;  4GOG A;  1IKI A;  3C5A A;  3HBR A;  4DRT A;  1IYQ A;  1LI0 A;  2XH9 A;  4CJN A;  4MBK A;  4JLF A;  4WEJ A;  4OH0 A;  4ZAM A;  4OPZ A;  2ZC6 B;  4UA6 A;  3BFG A;  2V2F F;  2WAE A;  3RXW A;  3VFH A;  2HDR A;  4LV3 A;  1EI5 A;  4X68 A;  1L0D A;  4YIN A;  1PYY A;  3FKW A;  3WRZ A;  3OPR A;  1K54 C;  3IH8 A;  4GNU A;  2WGW B;  3BLS A;  3GTC A;  4GZB A;  4N1X A;  2WAD A;  3D4F A;  5FAS A;  3V3R A;  1NZU A;  4P6B A;  4MBH A;  4PPR A;  4E3J A;  1NJ4 A;  3MXR A;  1L2S A;  2P9V B;  5M1A A;  1DJC A;  2G2W A;  5DF8 A;  1NXY A;  4K0W A;  3N7W A;  3ZFZ A;  4OLG A;  3LY3 A;  3A3I A;  2Y59 A;  1BLP A;  3WS5 A;  4A5R A;  1XGJ A;  1FR1 A;  5FI2 A;  4Y7P A;  1SHV A;  1BLH A;  1VM1 A;  2WKH A;  4PMA A;  2Y2K A;  2XFT A;  5U47 A;  3Q7V B;  5DTK A;  1KGG A;  1YLT A;  4FH4 A;  5EPH A;  3CG5 A;  3IT9 A;  2XGN A;  4Y0O A;  5JYP A;  1AXB A;  4KZ6 A;  2XQZ A;  1IEM A;  4EUZ A;  3G4P A;  3WWX A;  1BUE A;  5DF9 A;  1E3U D;  3A3D A;  2Y2Q A;  4KQO A;  4UA9 A;  2X01 A;  3Q81 A;  1GA9 A;  1PWC A;  2PU2 A;  3NC8 A;  4KZ8 A;  1N4O A;  3ZNT A;  1ES3 A;  2HPB A;  3QHY A;  1SDE A;  4R1G A;  3ZVW A;  4XUZ A;  3N4I A;  4EBN A;  1ES2 A;  1ZC2 A;  3A3E A;  4OP5 A;  1ALQ A;  1LL5 A;  1ES5 A;  3ZG5 A;  2G2U A;  2XR0 A;  3NCK A;  5F1F A;  2XF3 A;  1FCM A;  2QMI A;  1ESI A;  3NIA A;  1L0E A;  3P98 A;  1K6R A;  1CEG A;  1BLC A;  1KVL A;  3ZG7 B;  5EOE A;  1I2S A;  1KE0 A;  2XK1 A;  5HFO A;  4BL3 A;  4GB7 A;  3G2Z A;  1YQS A;  1FOF A;  2CC1 A; 
#chains in the Genus database with same CATH topology
 1DRM A;  4EBL A;  1HTZ A;  3VP2 A;  3M6H A;  4FSF A;  4Q0J A;  2ZM0 A;  1UWP X;  2Q0O A;  1H8Z A;  1T18 A;  3OZH A;  3LR5 A;  3N8R A;  4O7D A;  3IF6 A;  1LSX A;  2BTF P;  4E6W A;  4WZ5 A;  4BWI A;  2J7V A;  4I3A A;  1JWP A;  1BT5 A;  1GHM A;  5GLA A;  5AVE A;  3BM6 A;  2JHE A;  4E3O A;  5HAR A;  2FFF B;  1MPL A;  5E43 A;  1TD5 A;  1YPR A;  3TE8 A;  3LFV A;  3DWZ A;  1BSG A;  2YKF A;  2PRF A;  4EEP A;  3IF6 C;  4KUK A;  1PZO A;  1L0G A;  3E4P A;  4Q0I A;  3UO9 A;  3CJM A;  4WZ5 C;  3LID A;  3CI6 A;  2R9X A;  1WYB A;  4BJP A;  3H7W A;  4ARZ B;  1KDW A;  4YNR A;  1IYO A;  1S1Z A;  1OTE A;  5TR7 A;  3LGO A;  1H0M A;  5EVL A;  1OTI A;  2W3E A;  4O0P A;  4DF6 A;  2VZW A;  5HD5 A;  4RYE A;  3QP4 A;  3FPV A;  2V8C A;  1L3L A;  3VP3 A;  2BG1 A;  1JWV A;  1MBL A;  1YT4 A;  2WZX A;  3MQQ A;  2EWW A;  3NDG A;  5J3W A;  1I2W A;  4R4S A;  5DKL A;  2V1B A;  1S0W A;  5DF7 A;  3ZG0 A;  1KE3 A;  4HEF A;  1BUL A;  1H8M A;  3HUM A;  1PI4 A;  3G30 A;  4DE1 A;  4DE2 A;  5HAI A;  3UMD A;  4KZB A;  3SH9 A;  3NJA A;  2ZMA A;  1S4S A;  4XT2 B;  4KEN B;  3V39 A;  2VGJ A;  5CER A;  4Y2F A;  1Q2Q A;  2LB5 A;  1G28 A;  3WS1 A;  3UY6 A;  2IA2 A;  3CHW P;  3OC2 A;  1BTL A;  4MNR A;  1BLS A;  5M19 A;  4OQG A;  2Y2H A;  3A0V A;  3L7H A;  1MC0 A;  3BRM A;  2Y2P A;  3S22 A;  5FSR A;  3CMZ A;  4YWZ A;  1TDG A;  4I38 A;  3EGD C;  1MY8 A;  3VSL A;  4S2L A;  4HHD A;  2J3T C;  4PM9 A;  2OAQ 1;  2Y2M A;  3LUQ A;  5E2F A;  4LEN A;  3SZT A;  5FQJ A;  2DRW A;  1W8Y A;  3KYQ A;  2XLN A;  1JNU A;  3EEH A;  2EFU A;  4K0X A;  4EW7 A;  3BEB A;  4QHC A;  3HVF A;  3HRE A;  3LI9 A;  3JVU A;  3PXP A;  4X1M A;  1JWZ A;  3H82 B;  5FA7 A;  3JVV A;  3IH9 A;  2C5W B;  1C3B A;  3TW8 A;  3T4S A;  1IOU A;  3RTY A;  4IJG A;  4BLM A;  4H6J A;  4C75 A;  5L07 A;  1SCW A;  2MJ6 A;  2QKP A;  2GNX A;  4OLD A;  2E8J A;  4MN6 A;  2Q9M A;  3GMW A;  1EWZ A;  4OOL A;  5A93 A;  5FQ9 A;  4ZTK A;  3SS5 A;  2ZL1 A;  1K55 C;  5I94 A;  4OOY A;  1GSV A;  5GHZ A;  2OAP 1;  3TJZ C;  1TS0 A;  4R0Q A;  3VSK A;  3UE1 A;  4UAA A;  5M18 A;  5HZH A;  4OP8 A;  2W3F A;  4QD4 A;  4C3Q A;  2QHK A;  1OTD A;  3S1Y A;  4IED A;  3PHY A;  1BZA A;  2ZC3 B;  5F68 A;  3E4Q A;  1IEL A;  2J80 A;  3EEA A;  2A3U A;  4OPQ A;  3IX8 A;  5FAT A;  2WKR A;  2K7S A;  4ZRR A;  1K6S A;  3E0Y A;  2Y8H A;  4ZJ1 A;  1G6O A;  3LYX A;  5KSC A;  1GHP A;  2JCH A;  3DW0 A;  1YLP A;  3IQA A;  1NZO A;  4L9E A;  3LI8 A;  2PR5 A;  3W4Q A;  3UPN A;  3T4L A;  2XD1 A;  3LR3 A;  2K31 A;  5IT5 A;  1KE4 A;  3OBF A;  2P04 A;  3SH7 A;  4DN0 A;  1N9O A;  5A91 A;  1ES4 A;  5EM1 A;  4KQQ A;  2ZOI A;  1V9Y A;  2VKS A;  3PBT A;  1D06 A;  2EX9 A;  3PBS A;  2PYR A;  2ZC4 B;  3S4X A;  3MZE A;  3LEQ A;  1D7E A;  2ZQ9 A;  3NDE A;  2KX6 A;  4CLC B;  1OTA A;  4PAU A;  4UQI S;  4X69 A;  5DFX A;  1L0F A;  2WKQ A;  2J9P A;  5EV0 A;  2QJ5 A;  5L8M A;  3HUO A;  4R4R A;  4DKI A;  4GDN A;  3MFX A;  3IHA A;  5KSH A;  2GDN A;  4IHQ A;  5HL6 A;  3OCL A;  4HH2 A;  1NRF A;  2PD8 A;  5J7E A;  5GLC A;  4M4X A;  1IYP A;  5E2G A;  3BQ8 A;  2LB9 A;  5CRF A;  1XFN A;  3ULF A;  2ZJ9 A;  4XXR A;  2V1A A;  2HP5 A;  3DWK A;  3T4K A;  3HBR A;  1LI0 A;  3NUL A;  4WEJ A;  4ZAM A;  2PBD P;  2ZC6 B;  4UA6 A;  3PR6 A;  5DJU A;  4X68 A;  1PYY A;  3FKW A;  4EER A;  1K54 C;  3IH8 A;  1OT6 A;  4GNU A;  4GZB A;  4N1X A;  3V3R A;  3MXR A;  5DFY A;  5M1A A;  5DF8 A;  3N7W A;  2CMN A;  4I3I A;  5AJG A;  5HD3 A;  1SHV A;  1P97 A;  3R7W B;  4Y17 A;  2Y2K A;  1YLT A;  5EPH A;  4EEU A;  5DKK A;  5TJJ A;  2ZMF A;  4EUZ A;  1BUE A;  5DF9 A;  4GLQ A;  3QP8 A;  2W0N A;  3Q81 A;  2P08 A;  2PU2 A;  1ES3 A;  2HPB A;  4I39 A;  1SDE A;  5HWW A;  1ZC2 A;  4OP5 A;  4HP4 A;  1ES5 A;  3NCK A;  3NIA A;  2G7U A;  4HOI A;  1KVL A;  1BLC A;  5F69 A;  2PDR A;  4R3A A;  3C8C A;  2XK1 A;  1YQS A;  5CEB A;  1GHI A;  3PYP A;  1HZO A;  4KG5 A;  1YLY A;  4B9O A;  3MBZ A;  1G68 A;  4U0T A;  2VEA A;  4WEL A;  3ITB A;  4QPR A;  4DDS A;  4GHI A;  4KZ4 A;  4WL9 A;  3CIT A;  3AGD A;  3MXQ A;  4OPY A;  4KZA A;  1LL8 A;  3SS4 A;  1SZV A;  1ERQ A;  4CLC D;  3UME A;  3FWL A;  3MQ0 A;  5EEC A;  2VV8 A;  4ARZ A;  3LEZ A;  4JF5 A;  4HIA A;  2PD7 A;  2JC7 A;  3GV9 A;  3FV7 A;  4WEK A;  5CHM A;  1TVF A;  3HL9 A;  1KOU A;  4LV2 A;  3D3O A;  3EQU A;  5L09 A;  3ZNY A;  5HSQ A;  4OQ0 A;  5AVF A;  2HDQ A;  3V5M A;  5TBM B;  4NG2 A;  4OPR A;  3C7V A;  5FAP A;  1DY6 A;  4F94 A;  3C4O A;  4JXG A;  3HLG A;  4X1L A;  5CHJ A;  1IYS A;  3CWF A;  1OTB A;  1CQA A;  1PW8 A;  3QP2 A;  4KZ9 A;  3RXX A;  2W1R A;  2VA0 A;  3GDI A;  4RX3 A;  2HJ9 C;  3MMH A;  1W63 M;  3HJK A;  2A49 A;  1A0K A;  1MKI A;  1FSW A;  4OOM A;  4GW9 A;  4S2K A;  1RP5 A;  1GSW A;  1H5X A;  2XA7 M;  4Y5F A;  4XT2 A;  3QP6 A;  5DTT A;  2L0W A;  3S7Q A;  4B4X A;  2WKE A;  5HWT A;  1NRJ A;  2PYP A;  1WA9 A;  3LY4 A;  3FG8 A;  3A3F A;  5D3O A;  2ZLY A;  2RL3 A;  2VGL M;  3ZHH A;  3V50 A;  3B3X A;  1TS7 A;  3IS2 B;  3MQO A;  4BD1 A;  3DTM A;  2H0T A;  4KG2 A;  3BY8 A;  2V1Z A;  5HDS A;  4Y15 A;  1GSX A;  1LSW A;  1JTD A;  3IXB A;  1VEU B;  1LL9 A;  2HGV A;  1YAX A;  5HX9 A;  5GHX A;  3D72 A;  4WUJ A;  3NOU C;  5CX7 A;  3BW6 A;  3MF0 A;  1PWG A;  4HP9 A;  2EWV A;  4PM5 A;  1CI9 A;  3W4O A;  1V9Z A;  1GCE A;  3H82 A;  5FQM A;  4S2N A;  1VET B;  3UB5 P;  1W7F A;  4JXS A;  2EA9 A;  4DJ3 A;  1Z09 A;  2I72 A;  4LRX C;  3K3D A;  3VOL A;  2K2N A;  3UPO A;  3ZQ5 A;  4E3L A;  4YOF A;  3T4Q A;  1S4R A;  1G6A A;  5TGF A;  4X53 A;  3T50 A;  3IXH A;  2Z6D A;  3NEC A;  4S2N C;  3HLE A;  1XPB A;  5J8X A;  1WYC A;  2B18 A;  1FR6 A;  4QY6 A;  3IX4 A;  2OOL A;  5IHV A;  3UE3 A;  2O0Y A;  5EVI B;  1ERM A;  2OLU A;  4N9K A;  4P85 A;  4BD0 A;  5BOH A;  5GHY A;  4ESP A;  1KGE A;  1IKG A;  4O8G A;  4C6Y A;  1LT0 A;  4X25 A;  3M2K A;  1KGF A;  3MKE A;  3BFF A;  2X71 A;  1XA1 A;  4HJ6 A;  4F3L B;  2PBY A;  1DJA A;  3UPP A;  5HWV A;  3DTI A;  4QWO A;  4RX2 A;  2WGI A;  4NXB A;  4IBX A;  1T1C A;  2A24 B;  2O99 A;  4WLA A;  2OV5 A;  3O88 A;  3Q7Z A;  3N8L A;  1QMF A;  3OOV A;  3NOP C;  4LCL A;  3VOY A;  3O3V A;  2O9C A;  4JF6 A;  3BFD A;  1W8Q A;  3T1X A;  3F1N B;  3HLF A;  3A3J A;  4L9G A;  1E25 A;  2HZ5 A;  2XSS A;  4R3B A;  2X02 A;  2Y91 A;  5MC7 A;  4E6X A;  4PKY G;  2DCF A;  1LI9 A;  3G31 A;  4PM6 A;  3MS6 A;  4ETZ A;  1XFQ A;  3BY9 A;  3HUN A;  4Z9Q A;  3A0S A;  1F2K A;  3LIA A;  1P0Z A;  4EES A;  2JKF A;  3A0R A;  5DTS A;  3PBN A;  3IHB A;  2DNS A;  5HDD A;  3LIB A;  1F9I A;  1ZHH B;  2C6W B;  2VLG A;  4CLC C;  1JTG A;  3AGF A;  4OQI A;  3VE4 A;  4DXB A;  3CUE C;  2HJE A;  3MR0 A;  3HLC A;  4B93 A;  1K55 A;  1S67 L;  3PAE A;  2W3G A;  4JGP A;  2ZQA A;  1FIK A;  4GCZ A;  3K3C A;  4QJG A;  2V0W A;  3E4O A;  2HP9 A;  3SW1 A;  5EVI D;  4HI4 A;  3T1S A;  4N92 A;  4X55 A;  4MBF A;  4JBF A;  1YLW A;  4OON A;  3ZCZ A;  4PHT A;  3R7W A;  3IXD A;  2ZOH A;  1IYQ A;  2XH9 A;  4IUH A;  4CJN A;  4JLF A;  3U4L P;  1X0O A;  3BFG A;  2HDR A;  4HH3 A;  3HJI A;  4LV3 A;  1EI5 A;  4JGQ A;  3CLO A;  3B47 A;  1NZU A;  4PPR A;  3FPW A;  4OLG A;  3LY3 A;  4CQH A;  3WS5 A;  4HQA A;  4HY8 A;  2V0U A;  3UE6 A;  4PMA A;  2XFT A;  4DJ2 A;  4FH4 A;  3IT9 A;  1P9R A;  3O5Y A;  1AXB A;  1E3U D;  4KQO A;  1P9W A;  4UA9 A;  2M7U A;  1AWI A;  3NC8 A;  1N4O A;  4BBV A;  3QHY A;  4XUZ A;  3N4I A;  3T1R A;  1ES2 A;  3A3E A;  2G2U A;  5F1F A;  2JKR I;  3ZG7 B;  2PT7 A;  5EVE A;  1KE0 A;  1FOF A;  2W3H A;  2PR6 A;  2NUT C;  4IBR A;  2Z2L B;  3Q82 A;  4G3K A;  5EUA A;  3T12 B;  4G3V A;  5IU1 A;  3NI9 A;  1STZ A;  5IS1 A;  4R38 A;  1DJB A;  2OLV A;  1PZP A;  3JPU A;  3CAX A;  3VP1 A;  1SKO B;  1FQG A;  2ZQ7 A;  3EGX C;  1WE4 A;  3ZG8 B;  3IX3 A;  4DE3 A;  4JKT A;  1VHM A;  2JKG A;  3L9K A;  5CGX A;  3E98 A;  2UWX A;  3OPL A;  1K57 C;  4HBU A;  1E4D A;  1K0K A;  1FCO A;  4L0L A;  3EWK A;  1U60 A;  2HDS A;  2WGV A;  3GQZ A;  4ZDX A;  1YSP A;  4KQR A;  1S6R A;  4QY5 A;  1K54 A;  2XEP A;  1Z6F A;  2HV1 A;  3IBR A;  3Q1F A;  4QU3 A;  5KMW A;  3BEC A;  4X6T A;  3LIF A;  2WKP A;  4UHU A;  4G3W A;  5FEG A;  3FZC A;  1NYY A;  5HPF A;  3VP4 A;  4JXW A;  4DMZ A;  2J9O A;  5EM0 A;  4X56 A;  4NK3 A;  4UEY A;  3KX0 X;  1ONG A;  1PI5 A;  2ZQC A;  3N8S A;  5CHU A;  1T19 A;  5AQA A;  4BL2 A;  2HP6 A;  3RH8 B;  4EET B;  1NY0 A;  3H9W A;  3IS2 A;  4P0M A;  3KYE A;  5FQQ A;  4I5S A;  1S1Y A;  1K56 D;  3LIC A;  3V3S A;  4B4Z A;  2Z6C A;  3CZD A;  1DP8 A;  3P7N A;  4PM7 A;  4P6Z M;  4KQD A;  5JYO A;  3B42 A;  1T1B A;  4FH2 A;  2BAS A;  1G5U A;  1PFL A;  1T1A A;  1H8Y A;  4GD6 A;  5CTM A;  4EQ1 A;  2Y79 A;  4I3J A;  1N9N A;  3FC7 A;  1YLZ A;  1VET A;  1YMS A;  2EX8 A;  4L9F A;  5A90 A;  2WK0 A;  1XX2 A;  2VK3 A;  4ZJ2 A;  3WS2 A;  3BFC A;  3GRJ A;  5AQ9 A;  2O9B A;  3MXS A;  5F6A A;  1Q2P A;  1TEM A;  4DXC A;  2XDM A;  4EQI A;  1UWN X;  2ZMV A;  4WM9 A;  2EX6 A;  5CXW A;  1LHY A;  5F5Y A;  2W1T B;  4LLO B;  3IF5 A;  2W3D A;  1HD8 A;  2OSU A;  4GS9 B;  3G6O A;  3ZGA B;  1OPX A;  3UN7 A;  3IWQ A;  2Y4A A;  4K91 A;  4GD8 A;  3IXG A;  5HW3 A;  3QP5 A;  5KIZ A;  2QWS A;  2ZC5 B;  2H5S A;  4WMC D;  3C7U A;  5HAQ A;  1OJ5 A;  5AQ7 A;  3UDF A;  5FI6 A;  1XGI A;  4F3L A;  4D60 A;  2QJ7 A;  3ZG9 B;  5EVI C;  4FD8 A;  5LBR A;  3OLO A;  3LIE A;  4Y13 A;  1MWR A;  4R23 A;  4MN7 A;  4BBT A;  2Y2N A;  4E3I A;  4NXE A;  1TDL A;  5FQI A;  5FQK A;  3BLM A;  4LPZ A;  4MCW A;  3WS4 A;  1XJ6 A;  3C4P A;  4D2O A;  5FAO A;  3MFD A;  2EXB A;  4OVD A;  1E3U A;  2BLS A;  2P7J A;  2VJW A;  3F1N A;  3PTE A;  2YKH A;  5A8B A;  5L2F A;  1MWT A;  3NBL A;  5F82 A;  2E8I A;  3VV4 A;  1F98 A;  3GVB A;  3NOT C;  3RFB A;  1K4F A;  2P74 A;  1NLZ A;  1PWD A;  3O86 A;  3BYD A;  4EV4 A;  4NXF A;  3K2N A;  1OJG A;  4EUV A;  4PM8 A;  3KYZ A;  1J3W A;  3QNB A;  3B33 A;  1M40 A;  4Q0H A;  3UDX A;  4E3K A;  5EE8 A;  4JF4 A;  3DTK A;  3NHQ A;  4IVI A;  1IFQ A;  2D01 A;  2L1M A;  3MZD A;  4LV0 A;  2W27 A;  2AVX A;  2QPN A;  1CI8 A;  1LLB A;  2JKR M;  3G35 A;  2OWH A;  1Y54 A;  2B02 A;  3OPP A;  1SDN A;  2XRN A;  3IWI A;  1K25 A;  4S2J A;  2WAF A;  1F5M A;  3G34 A;  5AQB A;  2WYX A;  1YMX A;  5E2E A;  1RGY A;  4ZJ3 A;  3W4P A;  3HLD A;  4U0X A;  2JBF A;  1S66 L;  5FI7 A;  1EW0 A;  2VV7 A;  2Y2G A;  3O87 A;  3ZDJ A;  5EOO A;  1Y4O A;  5KZH A;  2V8F A;  4KZ3 A;  4E3M A;  3I7J A;  2VV6 A;  3DTE A;  4WF0 A;  1CEF A;  3S7O A;  2Y2L A;  1MWS A;  5HDC A;  5CEC A;  1MWU A;  5A92 A;  3P01 A;  4HBT A;  4GHI B;  2ACG A;  1K56 A;  3DBA A;  4GN2 A;  3SOI A;  1TS6 A;  3BQA A;  1MXO A;  1YLJ A;  2B5R A;  3RJU A;  2Y55 A;  2R9W A;  3T4J A;  5J4E A;  4DRT A;  1IKI A;  1FIL A;  4MBK A;  4K08 A;  4OH0 A;  4OPZ A;  3VFH A;  2A2L A;  3OPR A;  1XJ3 A;  3T4O A;  2WGW B;  3F1P B;  3HCY A;  2I9V A;  5FAS A;  4MBH A;  2P9V B;  1DJC A;  2G2W A;  3MJQ A;  1NXY A;  4K0W A;  3T4T A;  4O01 A;  3A3I A;  2Y59 A;  3CPT B;  1BLP A;  1PNE A;  1VB6 A;  5FI2 A;  4Y7P A;  4LFU A;  5G4Z A;  1VM1 A;  3W2Z A;  2XRO A;  3Q7V B;  2B95 A;  2OWJ A;  3CG5 A;  2XGN A;  4KZ6 A;  2XQZ A;  1IEM A;  3G4P A;  3VE3 A;  3WWX A;  2KDK A;  2VX8 A;  3C30 A;  1GA9 A;  1PWC A;  4KZ8 A;  1SKO A;  4NKP A;  5L10 A;  4EBN A;  1ALQ A;  2FH5 A;  4CLC A;  1Y28 A;  3P98 A;  1CEG A;  1TF1 A;  5EOE A;  1I2S A;  3CUE A;  1XJ4 A;  4GB7 A;  3G2Z A;  4BL3 A;  1QME A;  2JKT I;  3UB7 A;  4KUO A;  1W5D A;  2UV0 E;  2Y2J A;  3UB9 A;  4M3K A;  3UB8 A;  3F1O B;  1CK3 A;  1UGU A;  4IUK A;  2IWD A;  4BEN A;  3Q07 A;  4EU0 A;  5FL3 A;  1CF0 A;  4WMC A;  4P87 A;  4Q8I A;  4BMW A;  4GJ4 A;  5GLD A;  3TG9 A;  4JPM A;  2GX5 A;  4LCM A;  3S7P A;  3DAV A;  5FDS A;  1DP9 A;  4YFM A;  1NYM A;  4E3N A;  2FZ0 A;  1YKD A;  2PAV P;  3MSH A;  4HJ4 A;  1HLU P;  2HF6 A;  3M2J A;  2JE5 A;  2ZM8 A;  3UE0 A;  2M7V A;  2ZBB A;  3E2K A;  1FSY A;  1ONH A;  4FUW A;  4WN5 A;  5HPI A;  3IF6 B;  3E2L A;  2ZQD A;  4Y0T A;  2J3W A;  3BFE A;  4LGW A;  2ZQ8 A;  4AFI A;  4KZ5 A;  4DE0 A;  4ETX A;  4R70 A;  1PRQ A;  1YM1 A;  3JYI A;  3OCN A;  5I5L A;  4MMN A;  2INW A;  3SH8 A;  3UDI A;  3V67 A;  4EWF A;  5HL1 A;  3HLB A;  3LCE A;  4NET A;  4Y0U A;  3N6I A;  3TSG A;  3H7W B;  2KOI A;  3VMA A;  4GKU A;  4KZ7 A;  4MN5 A;  2QYB A;  2IWC A;  3EOI A;  1ZG6 A;  3LO7 A;  4OKP A;  2XFS A;  2ZM2 A;  3WRT A;  2XD5 A;  3KSG A;  3KO6 A;  4JXV A;  4FOF A;  3QP1 A;  4HJ3 A;  1I5Q A;  2PHY A;  2RCX A;  1XA7 A;  4PKY A;  2W1T A;  1CJF A;  3G32 A;  4FTX A;  1K57 A;  2Z2M B;  1JVJ A;  4QB8 A;  4GS9 A;  4MEZ A;  1ZG4 A;  3AGE A;  2H28 A;  3PBQ A;  2J8Y A;  5CTN A;  4E04 A;  3GR2 A;  4IVK A;  2PU4 A;  3P09 A;  4ME4 A;  4P6Z S;  5TBM A;  1K4E A;  4BBU A;  4FCF A;  3LR0 A;  4RVA A;  2D02 A;  2EXA A;  4CPK A;  2FFY A;  3S7N A;  4CLC E;  4UA7 A;  1NLY A;  1PIO A;  2V20 A;  3WS0 A;  2DMW A;  1O7E A;  1KVM A;  1ZKJ A;  1W79 A;  1N9B A;  5HAP A;  1XJ2 A;  3OPH A;  3BWL A;  4HES A;  4H8R A;  3KSI A;  1MZU A;  4BQM A;  4Z1W A;  1D1J A;  1XP4 A;  3C38 A;  2NUP C;  5CED A;  2ZC7 A;  2O9A A;  4ZBE A;  2QZ6 A;  5DVA A;  3G2Y A;  2Y2O A;  1DP6 A;  1TS8 A;  3W8K A;  3IBJ A;  1M6K A;  5GLB A;  3GEC A;  4R6L A;  1PW1 A;  3PAG A;  5F83 A;  4Y3I A;  1ACF A;  4R3J A;  3D9Y A;  1VEU A;  4GDB A;  3VFF A;  1KDS A;  4WZ4 A;  1XKZ A;  1YSQ A;  3VOZ A;  4II7 A;  3SS3 A;  4H6J B;  4S2M A;  1H3Q A;  4JGO A;  3PBR A;  5TFQ A;  4RA7 A;  4OQH A;  4S2I A;  2H0Y A;  1FCN A;  3HLW A;  1ERO A;  5CGW A;  2M1C A;  2ZL1 B;  5FAQ A;  2ZD8 A;  2WZZ A;  2H10 A;  4N1H A;  3GSG A;  4WYY A;  2Q9N A;  2JN7 A;  4UQI M;  3VP0 A;  2HDU A;  4DDY A;  2WKI A;  2XA7 S;  5E2H A;  5K5B A;  2V9A A;  1GA0 A;  2VGK A;  2WUQ A;  5FDH A;  2EFX A;  3KSF A;  1ZTU A;  1RCJ A;  3EQV A;  1VQQ A;  3UNW A;  3ITA A;  5GL9 A;  4S2P A;  3MZF A;  3U2A A;  3FKV A;  1SKF A;  4B88 A;  4NXG A;  1O07 A;  1W63 Q;  3NY4 A;  1OT9 A;  1ESU A;  1RGZ A;  3TOI A;  1HVB A;  1MKM A;  4S2O A;  1K38 A;  2JKT M;  3QNC A;  5EVI A;  3PBO A;  4HNB A;  3FYZ A;  2VGL S;  3T1Q B;  3MKF A;  4LV1 A;  3C2W A;  2J3T D;  4WBG A;  2KLI A;  3ISG A;  1OME A;  2Y2I A;  4EBP A;  2GZA A;  4MDZ A;  4U3T A;  4XUX A;  5F1G A;  4MLL A;  2EX2 A;  4ID4 A;  3LR4 A;  5C5K A;  3ICY A;  5CGS A;  2WGW A;  2IWB A;  1LSV A;  3F1P A;  5DJT A;  1BYW A;  5EFW A;  4KG6 A;  3ZVT A;  3IWO A;  2L4R A;  2P9V A;  1J9M A;  1N9L A;  4N9L A;  1XXM A;  2A24 A;  3BJN A;  2R78 A;  3CPT A;  3M6B A;  1ODV A;  5G18 A;  3Q7V A;  4GOG A;  3C5A A;  2V2F F;  2WAE A;  3RXW A;  5G4Y A;  3KSH A;  1L0D A;  4YIN A;  3WRZ A;  3BLS A;  3GTC A;  3TRC A;  2WAD A;  3D4F A;  4P6B A;  4E3J A;  1NJ4 A;  1L2S A;  3UB6 A;  3ZFZ A;  4A5R A;  1XGJ A;  1FR1 A;  4LRZ E;  1BLH A;  2WKH A;  5U47 A;  5DTK A;  1KGG A;  3R4K A;  4Y0O A;  5JYP A;  3F1O A;  3A3D A;  2Y2Q A;  2X01 A;  2GJ3 A;  5FEF A;  3ZNT A;  4NEE D;  4R1G A;  3ZVW A;  1LL5 A;  3ZG5 A;  2XR0 A;  2XF3 A;  1FCM A;  2QMI A;  1ESI A;  4EXO A;  1L0E A;  1K6R A;  4LRY C;  1NWZ A;  5HFO A;  4JGR A;  3ZYT A;  4RQ9 A;  2CC1 A; 
#chains in the Genus database with same CATH homology
 5CEB A;  1GHI A;  4IBR A;  2Z2L B;  3Q82 A;  4EBL A;  1HZO A;  5EUA A;  1W5D A;  1HTZ A;  2Y2J A;  4KG5 A;  3VP2 A;  4M3K A;  3NI9 A;  3M6H A;  4FSF A;  2ZM0 A;  1YLY A;  3MBZ A;  1CK3 A;  1G68 A;  4U0T A;  1DJB A;  2OLV A;  2IWD A;  4WEL A;  4BEN A;  3Q07 A;  1H8Z A;  3ITB A;  4WMC A;  1PZP A;  4P87 A;  3VP1 A;  4DDS A;  4Q8I A;  1FQG A;  2ZQ7 A;  3OZH A;  4JPM A;  4KZ4 A;  5GLD A;  3AGD A;  3TG9 A;  3N8R A;  4O7D A;  3IF6 A;  1WE4 A;  4OPY A;  3ZG8 B;  4KZA A;  3SS4 A;  4LCM A;  4DE3 A;  1ERQ A;  4JKT A;  5CGX A;  3FWL A;  5EEC A;  2UWX A;  4YFM A;  1NYM A;  4E3N A;  3LEZ A;  3OPL A;  4WZ5 A;  1K57 C;  4HBU A;  4E6W A;  4JF5 A;  2J7V A;  1E4D A;  1JWP A;  4L0L A;  1BT5 A;  1FCO A;  1GHM A;  5GLA A;  2JC7 A;  3GV9 A;  1U60 A;  2HDS A;  3BM6 A;  2WGV A;  3GQZ A;  3FV7 A;  4E3O A;  5HAR A;  2FFF B;  4WEK A;  5CHM A;  3M2J A;  4ZDX A;  1TVF A;  2JE5 A;  4KQR A;  3HL9 A;  2ZM8 A;  1MPL A;  1S6R A;  4LV2 A;  4QY5 A;  1K54 A;  2XEP A;  5E43 A;  1Z6F A;  3EQU A;  3UE0 A;  3E2K A;  3ZNY A;  1FSY A;  3Q1F A;  1ONH A;  4QU3 A;  3DWZ A;  1BSG A;  3BEC A;  5KMW A;  4OQ0 A;  4X6T A;  4UHU A;  2HDQ A;  3V5M A;  3IF6 C;  1PZO A;  4OPR A;  1L0G A;  3C7V A;  3IF6 B;  5FAP A;  3E2L A;  3FZC A;  1NYY A;  2ZQD A;  1DY6 A;  3UO9 A;  3VP4 A;  3C4O A;  4F94 A;  4JXG A;  3HLG A;  4Y0T A;  3BFE A;  5CHJ A;  3CJM A;  4JXW A;  1IYS A;  4WZ5 C;  2J9O A;  2ZQ8 A;  2R9X A;  1WYB A;  4KZ5 A;  4X56 A;  4NK3 A;  4BJP A;  4DE0 A;  1PW8 A;  1KDW A;  4KZ9 A;  1YM1 A;  1IYO A;  1ONG A;  5TR7 A;  3RXX A;  1PI5 A;  2ZQC A;  4RX3 A;  5EVL A;  3N8S A;  3JYI A;  5CHU A;  5AQA A;  2A49 A;  4BL2 A;  2HP6 A;  4DF6 A;  1MKI A;  1FSW A;  3OCN A;  4OOM A;  1NY0 A;  4P0M A;  4S2K A;  4RYE A;  3SH8 A;  1RP5 A;  3UDI A;  1H5X A;  4EWF A;  5HL1 A;  3VP3 A;  2BG1 A;  1JWV A;  5FQQ A;  1MBL A;  1YT4 A;  2WZX A;  3HLB A;  1K56 D;  4B4Z A;  3V3S A;  3CZD A;  5DTT A;  3NDG A;  3LCE A;  4NET A;  1I2W A;  4PM7 A;  4R4S A;  4Y0U A;  3N6I A;  3TSG A;  1S0W A;  5DF7 A;  4B4X A;  3ZG0 A;  1KE3 A;  2WKE A;  4HEF A;  1BUL A;  5JYO A;  3VMA A;  4GKU A;  4FH2 A;  4KZ7 A;  3LY4 A;  2IWC A;  3HUM A;  3A3F A;  1PI4 A;  1H8Y A;  1ZG6 A;  3LO7 A;  3G30 A;  4OKP A;  2ZLY A;  2XFS A;  5D3O A;  4DE1 A;  2ZM2 A;  4GD6 A;  3WRT A;  5CTM A;  2RL3 A;  2XD5 A;  4DE2 A;  5HAI A;  3ZHH A;  3V50 A;  1YLZ A;  4JXV A;  1YMS A;  2EX8 A;  3B3X A;  4KZB A;  3SH9 A;  5A90 A;  4BD1 A;  1I5Q A;  2WK0 A;  1XX2 A;  2RCX A;  2ZMA A;  1XA7 A;  3DTM A;  4ZJ2 A;  4KEN B;  3V39 A;  2VGJ A;  5CER A;  2H0T A;  3BFC A;  3G32 A;  4KG2 A;  1Q2Q A;  3WS2 A;  3GRJ A;  5AQ9 A;  1K57 A;  2V1Z A;  2Z2M B;  1JVJ A;  4QB8 A;  3WS1 A;  3UY6 A;  1JTD A;  3IXB A;  3MXS A;  1LL9 A;  4MEZ A;  1Q2P A;  1ZG4 A;  3OC2 A;  3AGE A;  1BTL A;  4MNR A;  1TEM A;  5HX9 A;  3PBQ A;  1BLS A;  5GHX A;  5M19 A;  2J8Y A;  5CTN A;  3GR2 A;  4OQG A;  4DXC A;  1PWG A;  4IVK A;  2PU4 A;  2Y2H A;  4PM5 A;  3P09 A;  2XDM A;  1K4E A;  3BRM A;  2Y2P A;  1CI9 A;  3S22 A;  5FSR A;  3W4O A;  3CMZ A;  1GCE A;  4EQI A;  5FQM A;  4FCF A;  4WM9 A;  4S2N A;  4RVA A;  2EX6 A;  1TDG A;  1W7F A;  4JXS A;  5CXW A;  1LHY A;  1MY8 A;  2EXA A;  4CPK A;  2I72 A;  2FFY A;  3VSL A;  4S2L A;  4UA7 A;  2V20 A;  1PIO A;  4PM9 A;  3WS0 A;  2Y2M A;  1O7E A;  3IF5 A;  5E2F A;  3UPO A;  1KVM A;  4LEN A;  1HD8 A;  1ZKJ A;  2OSU A;  5FQJ A;  4E3L A;  1W79 A;  1W8Y A;  2DRW A;  1N9B A;  3ZGA B;  2XLN A;  3UN7 A;  3IWQ A;  5HAP A;  1G6A A;  2Y4A A;  4K91 A;  4GD8 A;  2EFU A;  4K0X A;  5TGF A;  3OPH A;  3IXG A;  3BEB A;  4X53 A;  4QHC A;  3HVF A;  5HW3 A;  4HES A;  4H8R A;  2ZC5 B;  3HRE A;  3IXH A;  4BQM A;  2H5S A;  4WMC D;  3C7U A;  5HAQ A;  1XP4 A;  5AQ7 A;  3UDF A;  4S2N C;  5FI6 A;  3HLE A;  1XGI A;  1JWZ A;  5FA7 A;  1XPB A;  3IH9 A;  5J8X A;  1WYC A;  2C5W B;  3ZG9 B;  1C3B A;  5CED A;  1FR6 A;  5EVI C;  4QY6 A;  4FD8 A;  5IHV A;  3UE3 A;  4BLM A;  2ZC7 A;  5EVI B;  1ERM A;  2OLU A;  1MWR A;  4N9K A;  4R23 A;  4C75 A;  4ZBE A;  4P85 A;  2QZ6 A;  1SCW A;  5DVA A;  4BD0 A;  5BOH A;  5GHY A;  3G2Y A;  2Y2O A;  2Y2N A;  4E3I A;  4OLD A;  1KGE A;  1TDL A;  1IKG A;  5FQI A;  3BLM A;  5FQK A;  3W8K A;  4C6Y A;  3WS4 A;  2Q9M A;  3GMW A;  1M6K A;  5GLB A;  1EWZ A;  3C4P A;  1KGF A;  3M2K A;  4OOL A;  4D2O A;  3MKE A;  5A93 A;  3BFF A;  5FQ9 A;  5FAO A;  4ZTK A;  3SS5 A;  2X71 A;  3MFD A;  1XA1 A;  1K55 C;  2EXB A;  5I94 A;  4OOY A;  4OVD A;  5GHZ A;  1PW1 A;  1E3U A;  2BLS A;  3PAG A;  5F83 A;  3PTE A;  4R3J A;  2PBY A;  1DJA A;  4R0Q A;  3UPP A;  3VSK A;  3UE1 A;  4GDB A;  1MWT A;  4UAA A;  5L2F A;  5M18 A;  4OP8 A;  3VFF A;  1KDS A;  3NBL A;  4QD4 A;  4WZ4 A;  1XKZ A;  5F82 A;  4C3Q A;  3VOZ A;  4RX2 A;  2E8I A;  2WGI A;  3SS3 A;  4S2M A;  3GVB A;  4IBX A;  3S1Y A;  4IED A;  1K4F A;  3PBR A;  2P74 A;  5TFQ A;  4RA7 A;  2OV5 A;  4OQH A;  4S2I A;  2H0Y A;  3O88 A;  1FCN A;  1PWD A;  3BYD A;  3O86 A;  3HLW A;  3Q7Z A;  1ERO A;  3N8L A;  4EV4 A;  1BZA A;  1QMF A;  2ZC3 B;  3VOY A;  4LCL A;  5CGW A;  1IEL A;  3O3V A;  4PM8 A;  4JF6 A;  3BFD A;  5FAQ A;  2ZD8 A;  2WZZ A;  2H10 A;  2A3U A;  1W8Q A;  4OPQ A;  3QNB A;  4N1H A;  5FAT A;  3GSG A;  4WYY A;  3HLF A;  2Q9N A;  1K6S A;  3VP0 A;  1M40 A;  2HDU A;  3A3J A;  1E25 A;  4DDY A;  4ZJ1 A;  2WKI A;  4R3B A;  2X02 A;  2Y91 A;  5E2H A;  3UDX A;  1GHP A;  4E6X A;  5KSC A;  4E3K A;  5EE8 A;  1GA0 A;  2DCF A;  2JCH A;  2VGK A;  2WUQ A;  3DW0 A;  4JF4 A;  1LI9 A;  3G31 A;  1YLP A;  4PM6 A;  5FDH A;  3IQA A;  2EFX A;  1NZO A;  1RCJ A;  3EQV A;  4IVI A;  1VQQ A;  3UNW A;  3ITA A;  3W4Q A;  3HUN A;  3UPN A;  2XD1 A;  5GL9 A;  3MZD A;  3MZF A;  4LV0 A;  4S2P A;  3FKV A;  1SKF A;  4Z9Q A;  4B88 A;  1O07 A;  2QPN A;  1CI8 A;  1LLB A;  3G35 A;  3NY4 A;  1KE4 A;  1ESU A;  1RGZ A;  1QME A;  3SH7 A;  3TOI A;  1HVB A;  4S2O A;  1Y54 A;  1K38 A;  5A91 A;  1ES4 A;  3QNC A;  4KQQ A;  5EVI A;  3FYZ A;  3OPP A;  3PBO A;  1SDN A;  5DTS A;  3IWI A;  3PBN A;  3IHB A;  2DNS A;  3PBT A;  3MKF A;  2EX9 A;  4LV1 A;  1K25 A;  4S2J A;  2WAF A;  3PBS A;  3G34 A;  4WBG A;  3ISG A;  2C6W B;  1OME A;  2ZC4 B;  3MZE A;  5AQB A;  3S4X A;  2WYX A;  1YMX A;  1JTG A;  2Y2I A;  3AGF A;  5E2E A;  1RGY A;  2ZQ9 A;  4OQI A;  3NDE A;  4ZJ3 A;  3HLD A;  4U0X A;  4U3T A;  5F1G A;  4XUX A;  3W4P A;  4EBP A;  4DXB A;  2JBF A;  4X69 A;  1L0F A;  4MLL A;  2EX2 A;  5FI7 A;  2J9P A;  3HLC A;  4ID4 A;  2Y2G A;  1K55 A;  3O87 A;  3ZDJ A;  5EOO A;  3HUO A;  5KZH A;  3PAE A;  4R4R A;  4KZ3 A;  4E3M A;  3I7J A;  4DKI A;  5CGS A;  2WGW A;  2ZQA A;  2IWB A;  4GDN A;  3IHA A;  5KSH A;  1CEF A;  2GDN A;  3OCL A;  4QJG A;  2Y2L A;  1MWS A;  2HP9 A;  4KG6 A;  3ZVT A;  3IWO A;  5EVI D;  2P9V A;  5CEC A;  1NRF A;  1MWU A;  1J9M A;  5A92 A;  5GLC A;  4N9L A;  1IYP A;  1XXM A;  4HBT A;  4N92 A;  5E2G A;  1K56 A;  4GN2 A;  4X55 A;  3M6B A;  3SOI A;  5CRF A;  1MXO A;  4MBF A;  1YLJ A;  4JBF A;  2B5R A;  3RJU A;  1YLW A;  4OON A;  2ZJ9 A;  2Y55 A;  4XXR A;  2R9W A;  3ZCZ A;  2HP5 A;  3DWK A;  5G18 A;  3IXD A;  3Q7V A;  4GOG A;  1IKI A;  3C5A A;  3HBR A;  4DRT A;  1IYQ A;  1LI0 A;  2XH9 A;  4CJN A;  4MBK A;  4JLF A;  4WEJ A;  4OH0 A;  4ZAM A;  4OPZ A;  2ZC6 B;  4UA6 A;  3BFG A;  2V2F F;  2WAE A;  3RXW A;  3VFH A;  2HDR A;  4LV3 A;  1EI5 A;  4X68 A;  1L0D A;  4YIN A;  1PYY A;  3FKW A;  3WRZ A;  3OPR A;  1K54 C;  3IH8 A;  4GNU A;  2WGW B;  3BLS A;  3GTC A;  4GZB A;  4N1X A;  2WAD A;  3D4F A;  5FAS A;  3V3R A;  1NZU A;  4P6B A;  4MBH A;  4PPR A;  4E3J A;  1NJ4 A;  3MXR A;  1L2S A;  2P9V B;  5M1A A;  1DJC A;  2G2W A;  5DF8 A;  1NXY A;  4K0W A;  3N7W A;  3ZFZ A;  4OLG A;  3LY3 A;  3A3I A;  2Y59 A;  1BLP A;  3WS5 A;  4A5R A;  1XGJ A;  1FR1 A;  5FI2 A;  4Y7P A;  1SHV A;  1BLH A;  1VM1 A;  2WKH A;  4PMA A;  2Y2K A;  2XFT A;  5U47 A;  3Q7V B;  5DTK A;  1KGG A;  1YLT A;  4FH4 A;  5EPH A;  3CG5 A;  3IT9 A;  2XGN A;  4Y0O A;  5JYP A;  1AXB A;  4KZ6 A;  2XQZ A;  1IEM A;  4EUZ A;  3G4P A;  3WWX A;  1BUE A;  5DF9 A;  1E3U D;  3A3D A;  2Y2Q A;  4KQO A;  4UA9 A;  2X01 A;  3Q81 A;  1GA9 A;  1PWC A;  2PU2 A;  3NC8 A;  4KZ8 A;  1N4O A;  3ZNT A;  1ES3 A;  2HPB A;  3QHY A;  1SDE A;  4R1G A;  3ZVW A;  4XUZ A;  3N4I A;  4EBN A;  1ES2 A;  1ZC2 A;  3A3E A;  4OP5 A;  1ALQ A;  1LL5 A;  1ES5 A;  3ZG5 A;  2G2U A;  2XR0 A;  3NCK A;  5F1F A;  2XF3 A;  1FCM A;  2QMI A;  1ESI A;  3NIA A;  1L0E A;  3P98 A;  1K6R A;  1CEG A;  1BLC A;  1KVL A;  3ZG7 B;  5EOE A;  1I2S A;  1KE0 A;  2XK1 A;  5HFO A;  4BL3 A;  4GB7 A;  3G2Z A;  1YQS A;  1FOF A;  2CC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...