2EWVA

Crystal structure of the pilus retraction motor pilt and bound adp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
350
structure length
343
Chain Sequence
ELKILEIIKEAIELGASDIHLTAGAPPAVRIDGYIKFLKDFPRLTPEDTQKLAYSVMSEKHRQKLEENGQVDFSFGVRGVGRFRANVFYQRGSVAAALRSLPAEIPEFKKLGLPDKVLELCHRKMGLILVTGPTGSGKSTTIASMIDYINQTKSYHIITIEDPIEYVFKHKKSIVNQREVGEDTKSFADALRAALREDPDVIFVGEMRDLETVETALRAAETGHLVFGTLHTNTAIDTIHRIVDIFPLNQQEQVRIVLSFILQGIISQRLLPKIGGGRVLAYELLIPNTAIRNLIRENKLQQVYSLMQMQTMNQTLYKLYKQGLITLEDAMEASPDPKELERM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords twitching motility protein PilT
publication title Crystal structures of the pilus retraction motor PilT suggest large domain movements and subunit cooperation drive motility.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Protein transport
total genus 74
structure length 343
sequence length 350
ec nomenclature
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ewvA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ewvA02
1XD2B 2N1BA 1OHHA 3B5JA 3IILA 1G20E 4PZZA 5DNYB 3ZD6A 1C1YA 1KI2A 3FWYA 2PX0A 1RYFA 2VF7A 2XB2A 4RFVA 3CRQA 4IDQA 1KI6A 1EG7A 2XTMA 2XGJA 4V0NA 1YJ5A 3DEFA 5LD2C 2IXGA 2ZRDA 2VP2A 1VG0B 1RZ3A 1KNXA 5EUQB 5JWHA 2MMCA 1U94A 1YR9A 2JEOA 2Y8EA 4OI2A 4D4JA 4QJ3A 3ADBA 2JAQA 1LF5A 1ZM3A 1Z08A 3P1JA 3PUYA 3QBTA 3KKOA 2GHIA 2GJKA 2REXB 3SYNA 3VR4A 2KI5A 2ZJ5A 3C8UA 1XFAA 2XEXA 2ZYWX 2JJ2A 2QL6A 5IT5A 3EW9A 1E1RD 4KU4A 4NCNA 4POAA 3S1AA 4QC2A 1FMJA 2FSFA 2NGRA 2QE7D 4OHXA 4W5WA 3LV8A 2PMKA 4ZIRA 2BMDA 3ZVRA 1RC8A 2AR7A 3NH9A 3QPVA 1ETUA 1LV7A 3HR7A 4B75A 2NO9A 1BYUA 3IHWA 1IN4A 1E6CA 1DEKA 4EFMA 1N0UA 3ZDQA 3AGQA 4DDWA 2XXAB 2VSFA 4F4IA 3HR8A 1FOEB 1FX0A 2CVFA 3GMTA 1X1SA 1E0SA 2YWHA 4O0MA 4GOJA 5KNCA 1GNQA 1KMHB 3R7WA 3RC8A 1YKSA 2H16A 4RCYA 1XCGB 3W3AA 3L43A 1RVDA 3WMEA 1UM8A 1A1VA 4EJSB 4B3GA 4B71A 4Q9KA 4TLBA 3KQNA 1NN0A 1T3LA 3VR5A 1X6VA 2OCYC 1KDRA 4F93B 1XF9A 1ESNA 5JWOA 6Q21A 1Y3AA 1UBFA 4HZIA 4Q4JB 4KXFB 5EE1A 4Z54A 5IDVA 1G8GA 3CRW1 4PAMA 3IUYA 3IBGA 1NY5A 2CVHA 2H7VA 1II8A 4RFSB 2QBYA 3MWJA 3AVUA 4LV5B 4BPBA 2YC4C 1GAJA 4FWIB 3QBVA 5CB6A 4OQXA 4W7SA 2RGGA 3LRPA 2AX4A 4LYJA 1W47A 3QSYA 4TYYA 3FE2A 4D25A 4C3ZA 5EUMA 3THWB 3VNUA 3VU9A 3RS7A 4MUBA 2WSMA 4KV9A 3D6TB 1QG2A 5BXQC 3Q3JB 2C03A 2J0SA 2VPPA 1NBME 4UNSA 5SZJA 1WCV1 2GJ8A 1XJQA 2Q6TA 3KJHA 2VO1A 5AK0A 5KPDA 3OAAA 1RFLA 2LWIA 2QPAA 1TUEA 3X1YA 5JCPA 2EU8A 1ODFA 1XMVA 4AURA 3Q85A 1IONA 4LUCA 1QHNA 3FFBA 2FNAA 3LX8A 2QTHA 3MJRA 2ZSBA 1JR3D 4TL9A 3MWKA 1N6NA 3RSLA 5DI9A 2HCBA 3C14C 2WWYA 4B35A 3A37A 1WXQA 2W6ID 2ZE7A 4HAYA 5BN4A 2JA1A 2ZVQX 4KHZA 1RYHA 4KSCA 4UJ3A 5EZ6B 3Q7QA 5CLQA 4DLSA 3GLFA 4R2HA 1MO3A 2DCUA 2NO6A 1U0HC 3QKUA 5FR1A 2QUZA 4CEIA 3KB1A 1UEIA 4EAQA 2WOJA 1F3OA 3L0OA 3L82B 3W5JA 4ZI3A 1M7GA 2V7QA 2AWNA 3VX3A 4TYWA 5EE5B 1MH1A 3L0PA 3TSWA 1E3MA 3I72A 4PSKA 4JKIA 4B34A 3W6OA 2QM7A 4US1R 1DBSA 1AA9A 4DCUA 3LLUA 3U3OA 1S8FA 4DC9A 4NYIQ 5IHPA 4M1YA 1MO4A 2NO1A 4CGZA 3FB4A 3ZZTA 2DY1A 1XTQA 4Q00A 5DHAA 3CX7A 2QNRA 2OO7A 3B6EA 3QKTA 4ZDIA 2J59A 3Q8XB 4MUAA 4LYAA 4C2UA 4MRNA 1H8HA 4E5UA 4FMCF 5HKKD 1E0KA 4QG7A 1OIXA 5EP2A 1W0JD 2V9PA 4HZUB 3O8CA 1NI3A 3GFTA 1XDBA 2GTPA 2CLDX 3OIWA 5EQTA 1GITA 4Q47A 4BQSA 2R6CA 3OESA 3MAAC 2KBFA 1PUJA 3PVSA 1A2KC 1NN3A 4HAWA 2QRNA 5CM9C 3C5CA 2QRZA 5CJPA 4C0QC 1TTTA 2OT3B 1QHXA 2WJHA 2GVDC 4MRRA 5JHGB 1G17A 1OXXK 4BEJA 1GKYA 4YDHB 4HAZA 2HCJB 3K0AB 2NIPA 3DKPA 4C0LA 2C9YA 4LCBA 4LV8B 3IPXA 1A5TA 4JL6A 1EGAA 4MYTA 2ZRGA 2WJGA 2DR3A 1CRQA 1J7KA 3ZH9B 4ASUD 4E09A 3REFA 4JVLA 1B0UA 5FTKA 2ZR9A 4C7OA 1XD9A 1OXUA 3CF0A 5CB8A 1EWQA 3I5YA 2ZSEA 3IHLA 1LS1A 1CEEA 3HU1A 1V43A 1TADA 2QEQA 1LTQA 2HUPA 1OH8A 1XTSA 1HY3A 1N6IA 2BCJQ 4UJ5A 4X8MA 5GVRA 1OHHD 1ZD1A 4PAOA 4V0KA 4LC0A 3VNVA 2WZQA 2IYXA 5HTKA 3EPKA 2QG6A 5KDLA 3DO6A 1UPTA 2OE2A 3E2IA 4XWOA 2HLDA 1E9SA 2Q3HA 4FD2A 1GOTA 2GXQA 1CP2A 3BFVA 5LDDC 2EFCB 2H18A 5BN5A 1JR3E 2ZS8A 1F5NA 4UKDA 4U5XA 4WZAE 1CKEA 4IXMA 2ZR0A 4CZ2A 1XD8A 2Q21A 4DKXA 4RCZA 2J0UB 1AS0A 2QMUA 4ZCLA 4IEIA 2WMNB 3OHMA 1LB1B 2CCGA 1IM2A 2GZAA 3MSXA 1ZNYA 1HE8B 2JJ2D 3ZJYA 3BORA 2JLQA 3R9XA 4DSUA 3SQWA 1QHIA 3NC0C 2IS2A 2W0SA 3A1WA 4OQLA 3QXSA 2RHDA 421PA 2AXNA 3VKWA 3T1TA 5M04A 2DWQA 2BWJA 3R9WA 3KZ1E 4URVR 3QF4A 4P4TA 3AVWA 1R5NA 2J41A 2W0MA 3HYRA 1GTVA 1B23P 1LF0A 1SKQA 4B73A 4JLOA 1XD2A 3B13B 4BUJA 1TU4A 2RGCA 2C95A 1FP7A 4KO8A 4N0EA 1VYTA 4KBFA 4ZDWA 2ZETA 1ZIOA 5G41A 4KJZA 2XZPA 1Z6YA 1BH2A 521PA 5DLQC 1JXOA 1MV5A 1LW7A 1P7CA 2CJWB 3HPQA 1EX7A 1R0YA 3T35A 2WWXA 1G8HA 3NH6A 1EFRA 5A4JA 1G7RA 4TTRA 5KNBA 4NCIA 3EZFA 3AVYA 2BIFA 3VKHA 1Z0FA 4ZCMA 5TDHA 1EX6A 4LPKA 1HYQA 3NEJA 4L8GA 5K8IA 4DLXA 1N2CE 1IN7A 2XOKD 4TMXA 3QKRB 2V3CC 1G1MA 4ARZB 2WPDD 2WWGA 1VPLA 3RAPR 3WXMA 1Z3IX 3CNOA 4MH0R 2WIAA 2YZ2A 4FINA 1NG1A 3CPHA 1VG9B 2AN9A 4GMXA 3EIHA 4GL2A 2IK8A 3SHWA 5KOYA 1N25A 3F5FA 3I1FA 3P32A 4Q18A 2P5SA 3REGA 4CT5A 1GRQA 2UKDA 1CRPA 5EXPA 3B1ZA 2B7BA 1UADA 1IOZA 3FGNA 3GCGA 5E7MA 1CF4A 3LDAA 3BE4A 2HV8A 3WMFA 3DHWC 1GL9B 1R8SA 1TEVA 1KMHA 2AFIE 3NEYA 4Z51A 1KK0A 1E69A 1TU3A 4QKQA 1IY0A 3X2SA 3ZQJA 4TLEA 2A78A 4EJSA 2FPLA 2YOGA 3BH7A 1G64A 1D9ZA 4ZKDA 1NP6A 1G5PA 3VTKA 2A7QA 2ZAOA 3K70D 2J87A 3MCAA 1CXZA 3GP8A 4Q1AA 1Z83A 4IDHA 1GUAA 1BMFA 1QG4A 4Q4JA 2ZI7A 4ACBA 2BKEA 2OCBA 3JVVA 1MKYA 3DMDA 2GNOA 4G0NA 4RFSA 2R44A 1RRCA 3AKYA 4MA4A 3FKQA 4DRZA 2GVZC 1KO1A 1XCPA 4FCWA 5KNDA 4EFNA 5FBRB 2V8OA 4I99A 4Y0AA 3OIVA 2GAOA 2NQ2C 4B2LA 4I1OA 1YZKA 2ZITA 3Q5DA 4QFMA 5E95A 2A5JA 3RRNA 3THWA 4NTZA 3CZQA 2J0VA 4P0TA 5BYJA 1DOAA 4IW3B 3RC3A 2ZYTX 4WXPA 1AS2A 1JJVA 2XSZA 4M9QA 4URUR 3AEZA 1UKYA 4Q7KA 4XD7D 5EP1A 2ZTSA 3GJ6A 2JJ1D 1E2GA 2R6AA 1N5LA 3TR5A 4V02A 2H5EA 1QHGA 3GEHA 1KSHA 4B44A 5E3HA 4QBFA 1KKMA 1KY3A 3OIUA 3DPUA 1ZMXA 4CVNA 2ZRIA 3VR1A 4AC9A 3H4MA 5TMPA 4PQFA 1H8HD 2IEZA 3NIBA 4JLPA 1AKEA 4MGYR 5JS8A 2CE2X 1VG1A 2G9NA 2VEDA 1GSIA 4AI6A 2ZUCA 1SULA 3FTQA 2HYIC 4JLKA 3H84A 1OFHA 4IVRA 1Z6XA 4IOLA 1Z47A 3IPYA 2V4ZA 5FTNA 2ZRPA 3CH4B 3OIYA 2JGNA 1GNPA 1U8AA 2WIBA 5DISB 3GLIA 3SR0A 1E1RA 4HUTA 4DCVA 4Q21A 3VKGA 1II8B 5EP3A 2X77A 2OV2A 4XIGS 4DXAA 2QE7A 5CLLA 4KSBA 2IF2A 3M6AA 2G0TA 4DHEA 2FPKA 2Q9CA 4NCHA 2JJ8A 4YLGA 1L4UA 2RGEA 3H1TA 4D26A 2HEIA 5CIWA 2ZI3A 3W6PA 5BN3A 4M9XA 2QTVB 3F3YA 1ZUHA 1UKZA 5UKDA 4LX0A 4HZUA 3GJ5A 2V55B 5BWMA 3QVVA 5FI1B 4OQMA 3X1XA 2HT6A 4V0OA 3H0KA 2P6RA 1PZNA 4D6PA 3K0EA 2IYWA 1QF9A 3M4YA 3IQWA 1CJVC 2R8RA 2A5DA 3J81k 3UIEA 4A4DA 1W5TA 2V1UA 1OFIA 5HZHA 1DAMA 3CF2A 2JIZD 2VL7A 4Q03A 2VQSA 2YV5A 4OK6A 2GF9A 2XNSA 1FNNA 3B9QA 1SKYE 2ZVPX 3K0AA 4DSOA 4QGGA 3GLFE 1JQLB 3WNBA 1W4AA 4HLUC 2RMKA 4OI1A 1R7RA 2VBCA 3O8BA 1LY1A 3EZ2A 1NMZA 4OQNA 2P65A 3NXSA 2GXAA 4RD0A 3NHAA 3R8CA 2G77B 4F4JA 3AF0A 1I2DA 4RZ3A 1QVAA 3N70A 3R9IA 2F1IA 2CNWD 4A15A 5CYOA 1ZCAA 1Z06A 4II7A 4PC2A 2JCSA 4I1UA 1KI8A 4XWKA 1DELA 1DPFA 4JVSB 4AKEA 4Q4LA 5E7JA 2ORVA 5KSOA 3AKEA 1XZPA 2IUTA 1W5SA 1YHNA 5HZKA 5L3QB 4Q7JB 3OE7A 3HDTA 4AG5A 2FA9A 3KDSE 4PAQA 4X8LA 2JLXA 3K9HA 1W2GA 1NF3A 1EFRD 2CK3D 1JR3A 3TGPA 5JRZA 4RZXA 1J8YF 2ZM5A 4YMVA 2ZE8A 1OB5A 2DFNA 1CS4C 2W6IA 2J0UA 1XCMA 3CW2A 4H1UA 3AM1A 3BJIC 3B85A 5EJEA 2VH5R 2A30A 2WVJA 3LNCA 3QKSB 4PSVA 1TEXA 4V0LA 4D4LA 4BFVA 2Q3FA 2VHQA 1W46A 2FE4A 5GVSA 2QPTA 2YKGA 3TH5A 3KB2A 4A6XA 3ADCA 1XPUA 2IXFA 2OFOA 1VKJA 3DOEA 2ASEA 3IIJA 1Z2CA 1J2JA 2O8BB 1MRNA 3PUWA 4B3BA 3MUFA 4PHTA 4X8HA 2IC5A 1AIPA 2W2VA 5DYIA 4QNMA 2ZYUX 3NKVA 4RZ2A 3RYTC 1OXVA 1L4YA 5J4HA 3WNCA 4KFTA 1SGWA 5CK4A 2CJWA 2ZJAA 3BD9A 4IJMA 4PHGA 4GBMA 4O3MA 2Q9AA 1CJMA 3CB4A 1T5LA 4AYTA 3UANA 2QI9C 2WOOA 4QHYA 3ICQB 4Q02A 4TZ6A 1M8PA 2V54A 5FTMA 2G88A 3QF7A 4XSHA 3VR6A 4Z8XA 1JI0A 1ZW6A 1RPZA 1CLUA 1JNYA 1W0JA 2X19A 1BMFD 5EXTA 4M1SA 5GJBA 2FWRA 4Q48A 2L0XA 2BBOA 5KO2A 2X1VA 3QKRA 1E0AA 4ARZA 1G9XA 2O8FB 1L2TA 2LCFA 1WF3A 1U98A 2GJSA 121PA 2WV9A 1CJKC 3JZMA 4O2LA 2PJZA 1QZXA 5KTYA 3NBXX 4US0R 4AKIA 5TXGA 4NKRA 3TUZC 1R0WA 2YC2C 1P9RA 2ZI4A 3RRZA 2I1VB 1GZSA 1UDWA 4P33A 4P3YA 3VHLB 4GNKA 3SJZA 2HF9A 3OF5A 4LGMA 2F43A 4PHHA 3C41J 2O5VA 4ASUA 1NSFA 2PEYA 2ZRNA 4Q4HA 1FNMA 1XWIA 3KUCA 3LXRA 2F9LA 3GJ3A 3CNNA 2KSQA 1SXJC 2C98A 2FGJA 4ESHA 4ZPXA 1RJ9B 1Z2AA 1Q3HA 2R6DA 5SZIA 3ZIAD 2IHYA 4MKHA 1CU1A 5F2EA 1Q12A 4FXPA 3U60B 3UMSA 1NLZA 1IAQA 3MRSA 4FMDB 3W8RA 1IHUA 1XTKA 3K9GA 4C0HA 3UK6A 3K8YA 2P6NA 4DDUA 1AKYA 1RW4A 3K0CC 1I4LD 2C9OA 3PUVA 1XMSA 4Q9HA 4A2WA 2F3RA 3F0TA 2IYUA 5BYKA 4XTRA 1OW3B 1GIAA 4DCTA 1KY2A 1G8YA 2CDNA 2GBLC 1FZQA 3IIKA 1OE0A 4D2IA 5JJIA 1DADA 3X1ZA 5B64A 2A5YB 3QNUA 3LWNA 2PCJA 1TX4B 4RY2A 4B3CA 1HURA 1YRBA 2QPOA 4HUQB 4TTPA 4AG6A 3JZAA 3DM9B 4QHTA 3KJGA 2QROA 1NMYA 1OT3A 2ZU6A 2HXYA 3U7GA 1O87A 4Q5IA 3RVBA 1E2KA 1P3JA 2G6BA 2PT7A 2RB4A 3ZD7A 2IS1A 3DOFA 4DLTA 4QRHA 4ZKEA 2NZ8A 4IDPA 1MABB 3FMOB 3GLGB 5FPHA 3OEHD 2FFBA 5JSZA 2W2XA 4WIAA 4OHZA 5JWRA 1T8UA 1OLOA 1KMQA 4LJAA 3D7MA 4MGZR 1NSTA 1VYUA 2C8VA 4GP6A 3GQBA 3LVRE 4P4UA 1KI4A 3THYB 4YONB 3TR0A 2B8WA 3K53A 1XX6A 4D0LB 2CHGA 3LAWA 4BFZA 1Q21A 4A6PA 3EPLA 1A7JA 1T5IA 5BW8A 3CX8A 4DB2A 4PPNA 3I5XA 2C9CA 5JS7A 1GNRA 2AXPA 2ZIAA 5AJZA 3FMIA 2N46A 2ONKA 1A4RA 3HU3A 3TQFA 5ELXA 2XOKA 3O8DA 3FFAA 3PJRA 3QXJA 2WPDA 1G6OA 3LLMA 3AUYA 4QGHA 5L3RA 3LXXA 5KYKA 4B6EA 1CBUA 4QGAA 1N6OA 2F1JA 2WWFA 3E70C 2OSBA 4JL8A 4JL5A 2GZHA 3WP1B 1KI9A 5L3SB 3K09C 3N2EA 2FH5B 4LOAA 4JVMA 4CEJB 1OJLA 2W00A 1Z63A 2FSGA 4A0HA 1TQ2A 1HT2E 1AN0A 3IBYA 1HTWA 3DZDA 1TQDA 4HLUA 4PO9A 5B30A 2PX3A 2ZRCA 3LO5A 4JLVA 1AJEA 2DHRA 1YR7A 1NRJB 2FV8A 2QT1A 1IXRC 3KJEA 5FOXA 3JVUA 4P31A 1S2MA 1Z22A 2KB0A 1E9BA 2GETA 2IT1A 1E2MA 1KJWA 2I1QA 3OE7D 4LJ9A 1W36C 2GDJA 4OK5A 4C0AC 5DI3B 4WVFA 1OPXA 2ZPTX 4HB0A 1GRRA 1EESA 2BKUA 1XMIA 4LZZA 4DLYA 1G16A 1OXTA 3SFZA 4U02A 4BLQA 1GL7A 3T1QA 2ZRHA 1LNZA 3V00A 3PXGA 1GILA 3EWAA 2ZJ8A 4ABYA 2XNDD 1JJ7A 2YOFA 1N6LA 2OAP1 3LD9A 4W5JA 3TBKA 2R6GA 3C15C 3ZVNA 1KJZA 5HE9A 3BWDD 3D3QA 4Q1DA 4NYMQ 3WYFA 3B9PA 4FN5A 4IOMA 1E2LA 1Z6AA 4LJ5A 3MGCA 2ODNA 1XB2A 1WB9A 1E2JA 3GLIE 1ZU5A 5B2ZA 4YXWD 2QSZA 2N42A 4WXRA 3GLIB 5J4KA 2OG2A 2D06A 2E9SA 4XD7A 1ZC4A 4DZZA 2JJ1A 4EQ6B 1COWD 2CBZA 5L3QA 1R5OA 2MSEB 2QGZA 4KI0A 4DSNA 4OK3A 3WYGA 3VFDA 5SZKB 3W8NA 4LWZA 4PZYA 3UKDA 2GXUA 2ZRFA 2EWVA 3FVQA 1PJRA 1RRPA 2A2ZA 1TF7A 4R2IA 4U7DA 2KWIA 4G01B 3WY9A 1EWRA 4BRUA 1E2DA 2XITA 4Q19A 5EE3A 2VSOA 2ATVA 4QJ5A 3QKSA 3QVUA 3P20A 4QL3A 1CIPA 2JLYA 2RH5A 4PXAA 2O0JA 2VHUA 5CIQA 1U81A 2VYFA 1YZQA 2Q3MA 2ZUBA 2KBEA 2O0KA 2GEDA 3WBJA 2PLRA 2P3SA 4N1AA 1OXSC 4D80A 5EE9A 4E03A 1ANKA 1VIAA 4C0KA 2O8BA 1HUQA 3SNHA 2H1LA 4W5HA 2YYZA 1E2PA 5JLJA 4W9MC 4ON9A 5BQ5A 1P2VA 2QMOA 5K8UA 5AJYA 1S3SA 1E4YA 3MFYA 3P26A 5DIFA 4DSTA 2ZS7A 1PUIA 4N3NA 3X1DA 4XVUA 1N5IA 2Z83A 2A5FA 2BEKA 1UFQA 4XJXA 4JBXA 3AVVA 1KO4A 1NIPA 3GJ8A 4C0JA 3ZVLA 3AF3A 1NY6A 1US8B 4BE7B 5FBVB 2NG1A 5JMTA 1IQPA 1KYIA 4E07A 1XJ0A 3RS0A 4TL6A 2BV3A 3AQ4A 2FN4A 3THOA 2FU5C 3U44B 3OEED 4YDSA 3MD0A 4IVPA 2GA8A 5FBLB 3AP3A 3KKQA 2O8FA 4C2TA 5LPNA 2J7PA 3NHBA 3I32A 1E1QD 2NO0A 1XTIA 3E5HA 4LJ7A 2ZU0C 4GFDA 1JAIA 1S1MA 4URYR 2DFLA 2JIZA 4HB4A 4MRPA 3KJIA 5J4VA 2FMXA 3EAQA 2OLKA 4Q7MB 2ZRBA 1FW6A 2IYZA 3WBKA 3BK7A 1E2IA 4A0RA 1IN6A 1YZLA 1SVOA 3IO5A 1P2SA 4YMTA 3Q72A 4QJ4A 5IRCD 2VP6A 2F55A 2ZQ5A 1E79D 1TF2A 3EASA 2XX3A 3GLHE 3SZRA 4C0SA 1FQJA 3GLHB 4Q1EA 3U4QB 4BLTA 4YMUA 4B32A 4O25A 2CNWA 2ECKA 4WA7A 4PC3A 4EUNA 2GBLA 2ZRKA 1KDOA 1DG3A 1ZJ6A 2JLSA 1K6MA 2YWGA 1RJ9A 4M2LA 4JZKA 5TVKA 1CULC 1YZNA 2LKDA 3CH5A 4BFWA 5EP4A 3BH0A 4BZXA 2VP4A 1HA3A 1QVRA 3AH8A 1G7TA 2KE5A 4FI3C 3PG5A 1S9HA 1VDZA 2GZDA 1Q22A 3QQ5A 1WA5A 2G3YA 3EWSA 4DDTA 4DIEA 3AV0B 4LSGA 3O47A 1T91A 5KSPA 5FH9A 4HATA 2GILA 2CK3A 2ATXA 3GD7A 3KFVA 5FOUA 1JEDA 2FPMA 2ZANA 3B1VA 2OCPA 4UXJA 2AKAB 3PQCA 4PR0A 3CF6R 3FPAA 1W2HA 1JXMA 3NTUA 5DHFA 4M1TA 1W7AA 3P27A 2FEMA 2RGNC 4LJYA 4PANA 3AVOA 2HF8A 4I81A 4B47A 2O8EB 4HUQA 4ILEA 4BGDA 3FHTA 4LBWA 5L3VA 3K0SA 1XPOA 4QM6A 3QEJA 5TY0A 3A1VA 2VA8A 3B1XA 2JLVA 4OYHA 4BWYA 1CR1A 1FMLA 2GKSA 1OFTA 2FSIA 2R2AA 3IQXA 5G40A 1FPMA 3U7FB 4BFTA 3P4YA 1WE2A 3A4NA 1E98A 5AUOB 1MABA 1Q1QA 2D7DA 3GLGA 1G21E 1YZUA 2HXSA 1J8MF 1KJYA 1JQJC 4ITRC 2EVWX 3CPJB 4DBLC 4HDQB 2F43B 3PFIA 3U3RA 1P60A 3TK1A 4AWXA 4Q4HB 3DKVA 2IWHA 1OH5A 2OXRA 4Q9JA 1J90A 2ZROA 3BXZA 3K09A 2VTKA 2VHTA 2CE7A 4B3FX 3THYA 4EPRA 3TIFA 4LHZA 2IHBA 5F98A 3QENA 4G1UC 1XTRA 2ZUDA 2JLZA 1FUKA 5FPYA 4CW7A 2Z0MA 4FCTA 4WZBE 4IEEA 2WJIA 1N5JA 2OUKA 1M7BA 2AHOA 4IKEA 4LJ8A 1SVSA 5F9FA 3MMPA 3B1YA 5FPKA 2IWRA 1L8QA 4CYMA 2ZAMA 4C4PA 4TTQA 4BLOA 1O3YA 5FBQB 5L3SA 3RRYA 3NC1C 2OZEA 2QT0A 1OKKD 1M34E 2MSCB 4YQFA 1II0A 1PLJA 4CEJA 2Z43A 4MKIA 1EFUA 3AVPA 4JSYA 3SJBA 3K9NA 4QXAA 3ZZ0A 3G0HA 3L0SA 1SVLA 3ND9A 1MO5A 3MG9A 1OIVA 1N0WA 1G3RA 4O2RA 3GJ7A 4K46A 4EDHA 3SE0A 3IGFA 1ZCBA 2CLSA 3DL0A 3T1OA 1NVUQ 2BMJA 2JASA 4CT4B 5DI3A 2ZRMA 3G82C 4RD2A 1X8KA 1IJEA 4Q7LA 2QAGB 4ERNA 3ZIAA 1F2UB 4DLVA 5JSZB 1KTVA 2WSSA 3GFPA 3DVLA 1FFHA 4TYNA 4IFEA 2C5LA 4BLRA 1GVNB 3KXKA 1G7SA 2OCAA 2V1XA 4F4CA 4PC6A 2Q9BA 1BKDR 1E9RA 5CK5A 4CF7A 1K5GA 1IY1A 4MGKR 1TMKA 2FFAA 1U0LA 3TE6A 4MKFA 1FQKA 4DJTA 1GRNA 1XBTA 3RDPA 3PEYA 3QUSA 3RRMA 3U2QA 3HU2A 1YR8A 4L9WA 1H8EA 1ZNWA 4J0QA 2QM8A 5H68A 1JALA 2PZFA 4WBSA 4NONA 2QAGC 1SVKA 4QGFA 3OZXA 3ICEA 2WWHA 4A8JB 3PCRB 1UBCA 4GOXA 2WHXA 1LFDB 2PZEA 3SI7A 4EQ6A 4OHYA 4A0GA 1XPRA 5FOWA 1WRBA 3NWJA 3QXHA 3I4LA 4PPGA 3W6NA 3ZGXA 1P6XA 1KK2A 4LHXA 4NP6A 4B76A 3FYHA 1G3IA 2E1RA 2HYDA 3FDIA 3OEHA 4FIDA 3TJZA 2ZSDA 4B43A 5GADl 2C2HA 1KI3A 1LVGA 3KKNA 1VHLA 3SN6A 1Z5ZA 2EW1A 3GJ0A 3PENA 4M22A 4M1KA 4CRWB 1JAHA 5JI2E 4LK2A 1OF1A 2IBMA 5D3QA 3P4XA 2PJRA 4B3DA 2NZJA 2ZRLA 3PUZA 4JLAA 3ASYA 4DLWA 1Q3TA 2J7PD 3CUEF 1SXJD 5FR2A 2BJVA 2O52A 3KXLA 1G4UR 2R6FA 3EZ7A 2ODWA 1T3HA 4PX9A 4ZCIA 5A5GA 4Q9LA 3A1UA 2GCOA 1P2TA 3EPJA 3H86A 2ZSFA 4UNRA 2C99A 2IYSA 1YVDA 4TL8A 2P5TB 4G3XA 1I4DD 1D9XA 3PEWA 2MMGA 2ZREA 3AP2A 2EFGA 3TVDA 3EZ6A 2GK7A 4ESVA 3AVTA 1Z0DA 4V03A 3CONA 1DAIA 1KZGB 3BB1A 4NMMA 2CLCX 4F38A 2C77A 1NVWQ 2PL3A 1PV4A 1US8A 4OKSA 5LB2A 3FMPB 3UWOA 4JYCA 3B8HA 1U8ZA 2QU8A 1XEWY 1P9NA 2ZJOA 3BERA 2ZR7A 4M9SA 2QQEA 4AKHA 1BOFA 1YZGA 3I92A 1NN1A 4HDOB 8OHMA 3U44A 1K5DA 1MT0A 4H9GA 5CITA 1WBDA 5EXXA 2J45A 3VAAA 4F7WA 1U99A 2ZE5A 4Q1FA 2DFKB 1PLLA 4LPSA 4OI4A 4RD6A 2I4IA 1DAGA 1ZM2A 3SBDA 1NVXQ 2JLRA 1T0JB 2GAAA 4IDNA 4XH9B 4NYMR 2RAPA 3A1TA 4OJQA 1TPZA 3BOSA 4U00A 4PO8A 1GM5A 3F8TA 1Z0AA 5FUVA 2XNDA 4JT4A 4RD4A 1KNQA 2QAJA 2VP0A 1ZC3A 4FCVA 3GLHA 3Q9LA 3TAHA 3U3JA 3U4QA 4EPTA 4Z8YA 3GJ4A 5HCIA 1KOFA 1JR6A 1E94E 1NJFA 1HT1E 3CRVA 3BBPA 5KU1A 1D2EA 1MOZA 3B60A 4YXWA 4BASA 4AY2A 1RRFA 3HPRA 1XNJA 4KFSA 1MR3F 2KJQA 4L4UA 5JJKA 2RGNA 5K8TA 1G5TA 2BCGY 1Z07A 2UZ3A 1COWA 3CNLA 3W5IA 2D7CA 4A36A 2QY9A 4K8OA 1CJTC 1NVVQ 3I8SA 3M0EA 4PZLA 5G3YA 3CR7A 2LKCA 2B21A 1T0HB 4MKGA 1Q1BA 2FSHA 1M7HA 3WRYC 1XJCA 1N6RA 3AVQA 1DARA 3HYTA 2DPXA 1OB2A 3ZYCA 4D0GA 1I4TD 1ZP6A 2OM2A 2QP9X 3ADKA 1NL3A 4A9AA 1GG2A 3EC1A 4TMWA 1CJUC 1IN5A 1FP6A 1MRSA 1XXHE 4JVNA 1FTSA 1XXHB 2FGKA 4I4LA 3TW4A 3UWKA 3NBYC 2O8EA 1FTNA 1W36D 4LI0A 4AK9A 1BS1A 4DCNA 2I3BA 1SXJE 2YVUA 1U0JA 2C96A 2AWOA 3RNLA 1SXJB 3RWMB 4A8JC 3QIAA 4NH0A 2ZS9A 3T06B 2IS6A 1W48A 3QEOA 2HDNB 3EX7C 4GDFA 4XVRA 4HAVA 4A1FA 1X3SA 1Q44A 2DFTA 3BB4A 4H1VA 2ZEJA 4F92B 1V5WA 5CYPA 2H92A 3CR8A 3KX2A 1XRJA 4BLSA 4HEJA 1DO0A 4PSAA 2Z4RA 3X1WA 4EPWA 5J5CA 3G5UA 3QXCA 4L5BA 2D74A 4HSEA 4LJ6A 3KQKA 2FX3A 2A3RA 2FFHA 2HJVA 4LC1A 4WOPA 5GJVC 1JECA 2RGXA 1NIJA 2PBRA 4IDOA 5JZVA 5FTLA 4GMDA 2W6JD 3WNDA 1NN5A 5DN6A 3NDPA 2WSSD 1NG9A 5DE3A 2GEUA 4E22A 5B58C 4L16A 2OFXA 4LYFA 2V6IA 4CEHB 4FMCB 4M21A 2EFDB 3OEEA 1C4OA 1NBMD 4MGIR 4MRVA 3AKCA 1E1QA 3MWYW 4BFXA 4LDJA 3RSOA 1UEJA 3A8TA 1WBBA 4RVCA 3UMRA 1R5BA 1Z6GA 2SHKA 1G3MA 2G83A 2WJYA 4HDCA 2IXEA 2QP4A 4LBYA 2PZGA 1UDXA 2OXCA 4RKFA 1H8ED 2YWEA 2JATA 3KQLA 3C7KA 2YWFA 4BZPA 1M74A 5F3WB 3NBZC 3L8ZA 4P4SB 4B48A 5JEEA 1E79A 3VR3A 2ZI6A 1SVMA 1KO7A 4TSFD 1TF5A 3TAUA 1K8RA 2GK6A 3QPUA 1DVRA 4Z1MA 4NU0A 5A0FA 1G6HA 3NG1A 2GEVA 4AD8A 2RGBA 3ETLA 4C30A 4TWZA 3K0FB 2ONJA 5AJVB 3CZPA 5CM8B 4BFUA 3GLGE 1BO6A 1D5CA 1E2NA 3TVTA 2QMHA 3I8XA 2QAGA 4JKYA 4A92A 4ZDKA 4GSYA 2BBWA 4OHVA 2NTYC 1F2UA 4Q01A 2B6HA 4DLZA 5KPJA 2O8CA 2PLFA 2YOHA 4DCSA 3IEVA 1RRGA 4QBIA 5G53C 3LY5A 3M1IA 5C18A 1G41A 2FF7A 2WJVA 2OLJA 4PPQA 1OYWA 1UBEA 4HYYA 3TUIC 3U61B 4DB4A 3T12A 3EIQA 1XZQA 3SHFA 2EWWA 2D62A 1ZAKA 3QY0A 1P61B 1Z29A 3SJCA 2H17A 2DWPA 4GT1A 1GDDA 1OV4A 2E87A 2B92A 4JLNA 1S4QA 3FHCB 4DEXA 4KFUA 5H1YA 2BDTA 4LRWA 4TMKA 3T15A 3W90A 1W36B 1DAEA 1T4GA 3VR2A 4BLPA 4GZMA 3QI2A 4R98A 2F6RA 3GFOA 2O8DB 1S3GA 1E96A 3GEIA 5J47A 3QG5A 5EE0A 4EPXA 1ZD8A 2XTNA 2P2LA 1AQUA 1IXZA 1D6JA 3IDQA 4KBGA 5J4LA 2XZLA 2FZ4A 2ANBA 1DTSA 4JBWA 3AUXA 2HJGA 5JCZA 3QE0A 4QM7A 4QBHA 4B3XA 2Z6VA 4G5QA 1VECA 5FL7A 3FKSD 2PEZA 3AF1A 3ZS8A 1NKTA 3HJNA 3UMFA 3U6KA 2P67A 1X8JA 2IA5A 5B57C 2ZRJA 1P75A 4Q9IA 3C4JA 3LBIA 4X8OA 2J5XA 1UBGA 1ZM7A 2D2EA 2IYVA 1U8YA 4EJSC 1J70A 3SOPA 3T61A 2MSDB 4OHWA 1OFUX 1W4CA 3VMFA 3CKLA 4L9SA 5AWFC 4HLDA 1XU4A 4ACAA 1R6BX 1GFIA 1G291 4G5GA 4UXIA 2ORIA 3KFXA 4LBVA 5SZHB 4F91B 3U5ZB 1CR4A 3ZZUA 1E9EA 3LBHA 3QXXA 3TSZA 1G18A 1TUIA 5P21A 4D4KA 1AM4D 1OKKA 3CWZA 1II9A 2UZIR 3U6BA 1NJGA 5FUYA 1Q57A 3LW8A 1S1CA 1E99A 4V0ME 4RJLA 4TN1A 2EYUA 2ZXUA 5DGXA 4DWJA 1UAAA 4KCGA 2ZI5A 1FUUA 4PC1A 3ZQ6A 1ZUIA 5C2JB 4RKEA 4EIWA 5HE8A 4UXHA 2YJTD 4M4SA 1N5KA 3AF4A 2D4HA 4M53A 3TW8B 2AK3A 4PTLA 1IY2A 4LV6A 4JLJA 3RS4A 2REOA 1DS6A 3BB3A 1VYVA 3CLVA 3B1WA 1CR0A 5FTJA 3EARA 1ZNXA 2OBMA 4QNRA 5JRJA 4G5SA 2BM0A 1G4AE 1SHZA 2WWWA 1VCMA 1AS3A 5JHHB 2AL7A 2OESA 2GCNA 1QHHB 4DEYA 2QGNA 2XTZA 3KUDA 1R8QA 4MQBA 4NYJQ 5LBIA 1R0XA 4JJKA 2RGAA 1VCOA 1KGDA 2OBNA 2Q0HA 1VTKA 1W1WA 3THXB 3D8BA 4HB2A 1XTJA 2ZRAA 2PMDA 1Z8FA 2GESA 5KUTA 2GCOB 4FMDF 1VCNA 3PEUA 3V9PA 4YMWA 3R20A 3U7HB 3KQUA 2QTFA 2X8AA 2IYRA 3CO5A 4EFLA 5CDFE 1PLKA 2IF0A 5JEDA 1G7CA 1MO6A 1SQ5A 1ZRHA 1UKVY 2G1KA 4I1VA 4TQUS 4TMZA 5GJWC 4HI0E 3RHFA 3W34A 4A8JA 3A6PC 1Z0KA 1EK0A 1P2UA 5AR1A 5KHOC 4JLMA 4TLAA 5FOTA 4AYXA 4B33A 2RKOA 4QOSA 4S2EA 1WDTA 2BVNA 2TMKA 1D2MA 2IYYA 4HAUA 5D3MB 5J40A 4DUGA 3FMFA 3V4FA 2NO7A 2ODEA 2BMEA 4S35A 5DN6D 2A9KA 2OEPA 2RHMA 2ERYA 4NHOA 1IBRA 4KLZA 1XXHA 2OAQ1 4UNQA 1SHKA 3U3KA 3I61A 1JBKA 1XEXB 2Z4SA 2B8TA 3TNFA 1SXJA 1E9AA 5LB4A 1ZIPA 1QDEA 2ERXA 4OL0A 5E7IA 5JJLA 3FOZA 3KTAB 4M0LA 4N0DA 2UVQA 3BS4A 1XEFA 3OFNA 4FMBB 1ZYUA 4NDZA 1SVWA 2V6JA 4OJKA 4DT1B 1KDPA 5IF9A 4A0FA 3ZS9A 1GP2A 3K0CA 3CX6A 4LHWA 4P32A 2NMVA 1W4BA 1G5RA 2J1LA 2A5GA 1E9FA 1ZINA 4Q4AB 4MYHA 2IUUA 1AK2A 3BRWD 1A82A 4Z1MD 3T5GA 2VHJA 3ADDA 2W2TA 3HP1A 1CTQA 3T1VA 3SBEA 5H70A 4D82A 5J4YA 4AKGA 1ZVQA 2REBA 1UJ2A 3BFXA 5FOSA 3VQTA 2Z5FA 5FI0B 2OBLA 1ZD9A 3IEUA 4I1SA 4IHQA 5ANRB 3QJYA 2FEOA 1DAHA 1W4RA 4L15A 4JYBA 4C9BA 3AVXA 1X8LA 3SYKA 4G5RA 1DAKA 2F1HA 2ORWA 3BIFA 5DYGA 3NVAA 4CEHA 1HV8A 2IEYA 2YHSA 2BOVA 3GEEA 3CPEA 1W44A 4R71A 1A2BA 4TQ9A 3U7EB 1T6NA 2FZLA 2QENA 1E9CA 1VMAA 4WZ6A 3BAFA 1KSFX 2EYQA 1F48A 3BC1A 2ODBA 1GKUB 2NPFA 3LQRA 4BRWA 5TV2A 4IOJA 1M6NA 3PV0A 1AZSC 3WHLA 2BJWA 3CBQA 4M8NE 4TLCA 1R4AA 2NPIA 1KO8A 4JBYA 4P4SA 3EG5A 4LBZA 3SDZA 3WMGA 3WRXC 1PVOA 1QHYA 3UPUA 4RD3A 1GWNA 2F3TA 2ZSAA 2XAUA 1ZUNB 2CL0X 2QSYA 2VF8A 4M1OA 4GOKA 2IYLD 4URXR 3K0FA 4PQRA 5JECA 5FBWB 1NVVR 3T5DA 5FUWA 1HQCA 1UKEA 4JMPA 2ZJYA 3UATA 4GI7A 2IUSA 4GPTA 5HR5A 3WHKA 3WP0A 2PCLA 2JDIA 2WKPA 3CRRA 1LS6A 1RIFA 1U9IC 3TRFA 4MYUA 2OILA 4WW0A 1KZ7B 2AKYA 1NLYA 3SU8A 1F60A 4AIIA 5FL7D 4DVGA 1OH7A 2XZOA 2ZYVX 4NZYA 4EPVA 3EA0A 4OBEA 3T34A 1Z0JA 4NPHA 1KAGA 1CR2A 5C46F 2WWIA 1E9DA 3UG6A 2QZ4A 3CIOA 3W3ZB 5KSZA 5H8WA 4NBSA 1KHTA 4G5OA 4MDFA 1R0ZA 2G0NA 1YRAA 4JJZA 2D2FA 2QORA 3AKDA 1HEIA 2AK2A 2XXAA 2WBLC 3DMNA 821PA 1NKSA 5TARA 5KDOA 4PQYA 4IVQA 1T9HA 1F2TB 4CIDA 2VP9A 4LHVA 3UXMA 2WTUA 3OAAD 5JFGA 3LQQA 2O8DA 5EZ5A 2PT5A 4B74A 1U2RA 5FOVA 3TUJC 4UNNA 3GPLA 3EXAA 4KVAA 1E2HA 2D3WA 2QN6A 5KDDA 2O8CB 2QP3A 2GF0A 5IK2A 4TMVA 1P4SA 4EPYA 2CHQA 1G8PA 1KDTA 1Z0IA 3CM0A 3TSOA 5EXSA 3QPWA 3BFKA 1N3BA 3ONWA 1KI6B 3I3SR 5CJ2A 3PUXA 4A2PA 1TAGA 1J99A 4AYWA 3QG1A 1YR6A 4LY6A 4KAXA 4BECA 2WKRA 3RABA 4CDGA 2J3EA 1GKIA 3DM5A 2RCNA 1JB1A 4M1MA 1EFCA 2JLWA 3WYAA 2J0QA 2J7KA 1VCIA 2EQBA 4TT3A 2V7QD 3A1SA 1HQYE 2W6JA 3I62A 5FPTA 1T8TA 3RS3A 4DDVA 3KKMA 4JLDA 5C1BA 1W0KA 2BC9A 3LA6A 4JSTA 4RD1A 5DO9A 2BEJA 1R2QA 4DLRA 4GZLA 5TB5A 3S1AB 1NBMA 3HWSA 4DIDA 4XSGA 2IL1A 4HAXA 5DSZA 1W49A 1ZM4A 4HLQB 4C0BA 4ZIRB 2WAYA 2QA5A 4XVQA 4KFRA 3RLFA 1Q20A 3EPHA 2BHRA 3E1SA 5K8LA 1XP8A 1WQ1R 1T3SA 2FJUA 1G3UA 3LX5A 4OI0A 1N0VC 2P6UA 2XJ4A 1EFTA 3B7GA 2RGDA 5AJXA 4PC7A 2X2EA 1UF9A 1FX0B 1JPNA 2WJJA 3LBNA 4XWAA 3VX4A 3FHOA 5FL3A 1SVIA 3K1JA 4PO1A 3KL4A 4V0MA 4TSFA 2GJAA 3R7WB 3N5CA 2GWHA 4JLBA 3PR1A 1BYIA 2CL6X 3V4RA 1KKLA 2VHCA 1OSNA 4XOIA 1KSGA 2JLUA 3DZ8A 3SFVA 4KITB 3UG7A 1XMJA 2GJ9A 5GJCA 3TMKA 3TQCA 3SJAA 4D81A 1RKBA 4Q1BA 2GXSA 3GJXC 3RS2A 4TLDA 3LW7A 1G19A 4DLUA 2O0HA 2BBSA 1HH4A 2ANCA 2P0EA 1M1YE 1DG1G 4DUGD 5E4FA 2C78A 3IKJA 3KKPA 3LFUA 4KYIB 1L7VC 5KSYA 1KI1A 2QBYB 3MLEA 1QHHA 1SZPA 3A58B 3EIEA 1TNDA 1IN8A 1M2OB 4Q1CA 2IYQA 4IFBA 1P73A 2VRWA 4NCKA 4MRSA 3Q7PA 4A82A 4NL4H 3THXA 1WP9A 3ECCA 4KYUA 4URZR 4KODA 3H2YA 1ONBA 3VU9B 2C04A 2IW3A 3RANA 4BFSA 3OFND 1RE0A 3L0IB 4A2QA 4MITA 3DDCA 3B2EA 2F9MA 3I73A 4M9ZA 4OQFA 4R7ZA 4ZO4A 5FUXA 5L8VA 2BMFA 1H65A 2VLIA 2HLDD 3SS8A 3R8FA 3C5HA 2DB3A 721PA 1IJFA 5CDFA 1Q1EA 4TYQA 3SQXA 2R65A 4FWTA 1E4VA 5AUPB 2W58A 1E2QA 3L2OB 1QRAA 3ZLJA 3K70B 3KQHA 3KXIA 3PITA 1P72A 1Q0UA 3ASZA 2WICA 5D3MA 4TYPA 1Q1ZA 1SKYB 2XJ9A 1Y63A 5JI3E 5G3ZA 1XEWX 2DYKA 1TQ4A 3A4LA 2QMEA 1IXSB 2CCJA 3FKSA 3GLFB 2DWOA 4IXNA 4TQAA 4ZI2A 2J46A 4R9UC 2B7CA 1Z6TA 1N6HA 4M1WA 4D4MA 4Q66C 4BEBA 4CEIB 1QBKC 1X86B 1AGPA 3L8YA 1ZM9A 2F1RA 1XEXA 2CMKA 4PFSA 1ZBDA 4UNPA 4MYCA 2AD5A 3RS5A 3ZVMA 3B78A 5FPSA 2HT1A 1ELOA 4BFYA 3KTAA 5AUNB 1DAFA 3K70C 2K5UA 4K81B 2IYTA 1KK1A 1ZU4A 1QHSA 3CWQA 1Z28A 2GRJA 1S0UA 2ZI9A 4DT1A 1BIFA 2AFHE 1D2NA 4PHFA 2FDCA 4TZ0A 1D8TA 2BBTA 2OHFA 4Q4AA 1EFHA 1AQYA 3PEVA 3TKLA 1NNEA 1P9WA 1N6KA 1YZTA 1FL9A 3Q5EA 4GP7A 3AP1A 2ZJBA 4YC7A 3SEAA 4KLNA 1DE0A 1YU9A 2H57A 1OYYA 3AGPA 3ND8A 4LJ4A 2JDID 3O8RA 1WMSA 1P5ZB 3CRMA 4BZQA 4UQOA 2WKQA 5F9HA 4Y0VA 2AD1A 3N2IA 4GRAA 3MJHA 2FOLA 2CHVA 5JBQA 2VSXA 3D31A 5HCNA 1G3QA 4MDEA 4B2IA 1HE1C 4NYJR 3C16C 5FFMA 1GL6A 4IRUB 4NYIR 1N6PA 4PPFA 4EKDA 4US2R 4NCJA 1U9IA 1S96A 4WAUA 4YMSA 1NMXA 4JT2A 1VHTA 4KVGA 2WAXA 4URWR 221PA 4ZV4A 2XB4A 3QOFA 2G1JA 2H8KA 5DH9A 2FG5A 2GCPA 2FFQA 4TL7A 4TMTA 2PH1A 3NDBB 2BM1A 4C7OB 2ZE6A 1TQ6A 2CL7X 2VIIA 4LYHA 3SYLA 3SC3A 1JPJA 1U90A 1DO2A 1TL7C 2R9VA 1YQTA 5AJWA 2EFHB 4D0NA 4ZDJA 5C4MA 1G8FA 1KAOA 5IK2D 1VIYA 5HKKA 2OFWA 621PA 1E0JA 4QHSA 3MWLA 1I2MA 4HB3A 1E2FA 3A36A 1KIMA 1ESMA 1OIWA 3LVQE 1F6BA 2NOAA 3IIMA 3EZ9A 4NE2A 3BH6A 1KSJA 2X2FA 2CXXA 3NBFA 1ZNZA 3PIRA 4QBGB 4RSGA 4XTCS 3W9YA 2EFEB 3BGWA 3IO3A 2WMOB 1C9KA 4B6FA 4TT3D 2QQ0A 3AF2A 2IX3A 2CEAA 5C4GB 1JEEA 2DBYA 4RZUA 2YNMA 3AB3A 3EC2A 3A4MA 1AZTA 5AUQA 1W0KD 3K9LA 1KO5A 4IOKA 1S9DA 3LH5A 2F7SA 5LD2B 1R10A 2XSZD 1KK3A 1P62B 2J9RA 4LHYA 1F2TA 1AGRA 4JS0A 3VHXA 4JIMA 2YINC 2VP5A 2ZJ2A 3TLXA 1NLFA 1YE8A 1X1RA 2CCKA 2ZJZA 3RWOA 5HPYB 4B2PA 2IS4A 1E2EA 3B82A 3QF4B 1EXMA 1KI7A 3EA5A 2W83A 2WM9B 4FW9A 4HLCA 3U3MA 1VG8A 2R62A 1E32A 1OH6A
chains in the Genus database with same CATH superfamily
5HHTA 1VJCA 3D4OA 4Y2SA 1Y1PA 5EUQB 1PFKA 1TVEA 3BYZA 3RIMA 2JLBA 4TXNA 3MLBA 4QD4A 4PO3X 3ZXYA 4E04A 4JLSA 2WVAA 1DLIA 2WUWE 2GS9A 2V5UA 5EPEA 1MF7A 1B0PA 1KDVA 4RTKA 1BKSB 1DWPA 4DIMA 4OQQA 4X62B 2R00A 3FWHA 3PC8A 4P2BA 2PMFA 5CHEA 2HLNA 1K9VF 1XCBA 5ECGC 4IEFB 3VRHA 4BD0A 3CZCA 5JWOA 3HGMA 4G0OA 3UGKA 4PAMA 1ZHHA 4X93A 3DHEA 2X9NA 2VDKB 4JBIA 3A6DA 3EXHA 2K7SA 2WT8A 2VCHA 3OOEA 1U2TA 1Y7LA 4P84A 4WXYB 1A9PA 4P5PA 4M8SA 1RFLA 5E4TA 1DRMA 1ODFA 3L6EA 2HGZA 1IFQA 4PZAA 2HCBA 3ESYA 1WXQA 5EZ6B 1SZCA 4R2HA 5K6AA 3KV3O 4EHLA 4G65A 2P0AA 2J85A 2ZCUA 5JS6A 3K0HA 4ZI3A 3TSWA 3I72A 3ON5A 1L1RA 1XUOA 3T0FA 5JPIA 4R1SA 1Y7HA 3DV9A 4NYIQ 1T10A 5DHAA 3CX7A 4F3LB 1EK5A 3B6EA 4CQLB 2FFRA 1L9KA 1P45A 2Z08A 2BHNA 2Y2PA 1H8HA 3G23A 3JAWA 1TAHA 5I9MA 1U7HA 2IXDA 5H3LA 3HA5A 4ZGBA 3ZDYB 2OT3B 2PSFA 5K9ZA 3MZ0A 3GV9A 3IPXA 4PR3A 3DWGA 5JSYA 3NR2A 4QLOA 4YRNA 3DDNA 4JVLA 4KAFA 4OHOA 3BTUA 4OP1A 3CPTA 3CF0A 1PJ2A 2A3NA 1XTSA 4DLLA 1P7ZA 4EY3A 2IIBA 3VNVA 3NEAA 1HMPA 3IEKA 2F8MA 4JT9A 2PQMA 2VQFB 2H18A 1T4CB 4HWSA 2R8ZA 4FR2A 1W4LA 1DPGA 4UARA 3O9VA 3PJGA 3IT1A 4ZU3A 2G04A 4JEMA 4G3KA 3R7LA 1WULS 4X24A 3DEHA 1UIMA 3BMOB 1KKUA 3IAS1 4DE3A 1TU4A 3ZY3A 2PYDA 1Q14A 1FZTA 4LRZE 1BH2A 3IX4A 2IY7A 3Q87B 1R0YA 2RK6A 2H7CA 1G7RA 5KNBA 3UJNA 1VGQA 3WDSA 2C59A 4YJFA 4COOA 2C92A 3I5MA 1HYQA 2NQTA 5K8IA 3AZOA 3A06A 3ADPA 5CFMA 1GG9A 2IQIA 3GMDA 3KHKA 2D8AA 5DW0A 4E12A 4R0QA 5EMKA 3UPPA 1G55A 4PNPA 1RC0A 1EB8A 4HWPA 3GI1A 3N59A 2B99A 4MGHA 1RM3A 1J42A 2Q1XA 3Q3GE 1X87A 1YF3A 2FPLA 5A9SB 2VXCA 1TT5B 4WY2A 1Z83A 2ONZA 1RI1A 1V6AA 4B7AA 1RXWA 3JVVA 5T8KA 3AKYA 3QJ5A 3HUDA 1RQ7A 3THRA 2B1JA 3MHTA 2AQIA 3Q5DA 1IVSA 3THWA 2RHGB 4P0TA 4XD7D 4YLEA 4XWGA 1VP3A 4F2DA 5KQSA 3SVTA 3BW6A 2JAWA 1TCBA 3OC2A 5F52A 1FFXA 3FTCA 4UAGA 5GGYA 2L69A 2CSUA 4BNHA 1Z6XA 2KPOA 4R1PA 1OY1A 3JSAA 1XQYA 3GA5A 1QU3A 2FRVA 4OXNA 2DHEA 3VKGA 5GAJA 2IF2A 3DONA 1DC5A 3HO6A 3X1JA 4GGOA 5ALFA 3UJHA 2VZ9A 3H5TA 2RGEA 3U4AA 3DUFA 1YCDA 5AKEA 2NTVA 2YTZA 2CZCA 3O88A 1YRHA 3ZXIA 3CF2A 2XAAA 1SKYE 1P18A 1HLDA 2BI4A 1AKQA 4ONEA 1FFYA 3AESB 4RY8A 3NVKI 1EEXB 3I04A 3R9IA 4NPAA 4PGMA 4V39A 3OM8A 3OLYA 3PNMA 1QR6A 3E5MA 3VMAA 2FA9A 3NHRA 3OWXA 2QSJA 3BXEA 1NF3A 1YDWA 3VPCA 1M6WA 2COEA 5CPFA 3BF7A 4GIBA 3SF0A 5FSRA 3SHVA 2G67A 2A30A 1K55C 1CRLA 1Q6YA 2AA3A 1DC4A 2Y2OA 2CDAA 2GAIA 4OXXA 4DQKA 3LCVB 5TS2A 3SQLA 2IXFA 2JGRA 4B6OA 4UZSA 4QPJC 1Z2CA 3PUWA 2CBGA 1AVTA 4YY3B 1AIPA 3GLQA 3HADA 2BTQB 3CUYA 5C5EA 2ALJA 1S3IA 2Z56A 2ROQA 1PWXA 4AYTA 3UANA 2P4UA 4QHYA 1IMJA 4HPXB 4R8RA 1YQSA 1JI0A 1AHNA 2Y77A 3DOUA 4PGFA 2X1VA 2YL2A 3BGSA 4JYAB 2GJSA 3P9SA 1E89A 5CLIA 1D2GA 4O2LA 4L9EA 4JKOA 2DE0X 4LAFA 4PLCA 1HQDA 5ALXA 1PW1A 4X60A 3QX7A 3H1BA 4ZVLA 3NDEA 3INYA 2W3HA 1SUEA 1RJ9B 2YYYA 3GFFA 4F46A 5C8YB 4JJFA 1Q12A 4FMDB 2DPLA 3MMZA 4YCMA 3DBIA 1D0SA 4A2WA 4NNJA 3L4JA 4EMSA 1B1AA 1M2FA 4D2IA 4OSEA 2W2LD 3N0VA 5FI6A 2JH9A 4OPMA 1C1DB 5AXDA 1A71A 1U8FO 3JZAA 3KJGA 5HIMA 1W87A 5BP7A 5JH7A 3PU6A 4RGVA 4DLTA 4R3BA 4Q6WA 1U3GA 2PK3A 3D3WA 4TWJA 2W2XA 1KEZA 3D7KA 5AOAA 4JA0A 3D43A 3LVRE 3CLTC 4BFZA 2JGIA 3EEFA 1UIRA 1IPFA 2BRUC 5FWXA 1JLHA 1KEEB 1S8AA 2FDXA 3N2GB 2EAUA 1N6OA 3KSDO 4CUKA 3WP1B 3UJDA 1AHPA 3PVCA 4LZAA 1V5FA 2ZRCA 2H1CA 1NRJB 4JAVC 4M49A 2JFYA 1S2MA 2KB0A 1E9BA 1E2MA 1KJWA 4F2HA 3MKEA 2J4DA 1A0OA 1AMOA 4NBNA 1GRRA 3EZNA 3NTQA 4PG8A 1GL7A 1Y1SA 2GM5A 1DZ3A 1GILA 4IV5A 2OAP1 3AETA 4XYBA 1WXEA 3VSKA 4D8XA 5J4KA 4PU0A 2G6TA 4XD7A 2B6NA 4OPZA 1IE3A 3OY7A 3O31A 3BN3A 1QTNA 3WI7A 2XITA 4L4SA 3LT4A 1RWVA 5EJIA 3QKSA 1CIPA 2RH5A 4PXAA 4AN4A 3OBIA 1QK3A 1FMFA 3PPVA 5E6SA 4YPFA 1CZHA 1L4EA 2Q99A 1YGYA 4MRAA 3E22A 4ON9A 1P2VA 3NFYA 4RELA 1Y7IA 4UTZA 2P9VB 4MN6A 3I64A 4W5QA 5LMZA 4MW0A 4R51A 4Z4HA 2Q9UA 3NHZA 3H0CA 1NY6A 1US8B 3K5IA 4P08A 3A9CA 5IULC 2V3VA 2Z9BA 4JUCA 3D6MA 3O4IA 2FU5C 1S8NA 3STXA 4M87A 4C2TA 4GFDA 4HB4A 4DG5A 3KJIA 1LPSA 2V20A 2E6KA 4QYIB 5ALJA 3V5MA 2HUNA 1E79D 4DWVA 4FE3A 4Q1EA 3GLHB 4LYEA 4Y0NA 5E8RA 1AN9A 4M2LA 1R88A 1U28A 3S3TA 1GR1A 3AH8A 3U3DA 3AK4A 4UPDA 2YXEA 4JGQA 1N1EA 1PAUA 2YJNA 2Q41A 3O1HB 1RXUA 2FZGA 1JEDA 3CF6R 1MWRA 2GN1A 2IKSA 3G1WA 3KSGA 2C2YA 4AUNA 3VPDA 1FXWA 4MUKA 4C7MA 3AU8A 1D0IA 2A1UA 2WA1A 3BGOS 2MYNA 4KE6A 1M2VB 2VATA 3JQ7A 3EMVA 1KJYA 2EVWX 2DRWA 3WQQA 2OXRA 5LCXA 1ML3A 3BXZA 1BLHA 1PTKA 2CE7A 3KL2A 2I3GA 2IHBA 4GHWA 2JLZA 3QWFA 1KJIA 4Y1EA 1NBAA 5BRJA 1JLSA 1N5JA 2AHOA 5IN4A 1WG8A 2BMAA 2G76A 1Z5VA 1ORRA 2H00A 2YKFA 1KU6A 3M6IA 1VM6A 3WGYA 2QTTA 1TYDE 3UUGA 3U4DA 5REQA 1OIVA 5BSFA 4NRDA 3GJ7A 4AG3A 1USUA 1RWMA 4C7BA 2ZIGA 2BF4A 1CVRA 2HF6A 4Y9DA 3ENNA 4HJ4A 1RBYA 2W3GA 2W71A 3D0QA 4R3NA 3TLBA 1GRNA 4DMUB 2PZFA 2W2LA 3KAPA 4WBSA 1GGJA 3NM6B 3KYEA 4I6GA 2EKBA 4EUZA 3FPHA 2C7QA 4G0YA 3EBLA 3A1EA 1TTHA 3KTFA 3BKXA 5DHTA 4R0NA 2W6ZA 1KI3A 3IHKA 4INOA 2EW1A 1W4ZA 3SIXA 2JFXA 3CF4G 1TOAA 2J3WA 3T4EA 2EBFX 2J7PD 4L28A 1BDIA 5FR2A 3I58A 4WLAA 1TYBE 5ER6A 2PR5A 4U3JB 1Z0DA 1YO6A 1X1QA 3ICWA 1I7PA 3GSGA 4NK4A 6ADHA 1IEQA 4XEHA 3WGIA 5CDSA 3UUWA 1JVNA 1ZKDA 5B2EA 4NYMR 5FPPA 1Z8NA 3TGLA 1O4VA 1Y1LA 2ZZNA 3K2EA 5HM6A 1G5FA 3UPDA 1FQGA 1KOFA 3CRVA 2JFFA 3TQIA 2JCGA 1ZDMA 2L4RA 2CF5A 1D7EA 4A36A 3I8SA 5ENVA 1EVZA 1ZVMA 4MKGA 5KZMB 4HQFA 3ZYCA 4EBFA 3OFSA 3C4VA 4LJLA 5JH7F 1SBQA 2OLVA 2CUZA 2Q4TA 5DRTA 3PGXA 2HLPA 2RAUA 1RMTA 1Y28A 3OFJA 3WOHA 1ODVA 1HLFA 5LZ8A 4UASA 2QD1A 2C5BA 3JAKA 1Z4IA 1T5SA 3NDPA 1W88B 1JTFA 4M9CA 3ZW7A 4WOJA 3C7TA 4M21A 1P97A 4FCCA 1GGMA 1EJ2A 1B1CA 5C1OA 3VZPA 2H9AA 4DUYB 1T26A 5HWSA 2W9XA 3ZDEA 1NPTO 3NBZC 1LW6E 4IDGA 1E79A 1E18A 1DVRA 5K01A 3HRIA 3IWIA 4MOWA 2P35A 3I8XA 2B6HA 1M1XB 1OA0A 4B9EA 3IPRA 4EJMA 3OA0A 1ZKMA 4UMVA 1M1NA 3EUEA 5BV0A 1PZEA 2EWWA 4C4OA 1KZ4A 1Q0LA 3MCVA 3L8HA 1MZVA 3L7KA 1DAEA 1JS1X 2YIMA 4BLPA 5A7FA 3TLAA 3OT1B 2HFKA 4P3KA 1CUHA 1OXBB 3P2EA 4MJXA 4BO8A 2DTDA 3RD5A 3FF1A 3GA7A 2Q5JA 5HIKA 1GR0A 4HLDA 2QXYA 1TDJA 4J9VA 1DBPA 3E53A 4R16A 1DBVO 3U5ZB 1CR4A 3R3XA 3DVRX 2H06A 4IILA 4DF3A 1Q57A 5CCEA 3UZUA 4QUIA 5AI9A 4EIWA 3BQ9A 1XOIA 4B3TB 4ALLA 3H5RA 4TT8A 4LSZA 4U39A 2YYAA 3J81A 1THGA 5CYFA 4UUBA 2QLTA 1X19A 4KRXA 4UDXX 1Y9DA 2HJHA 4OX9B 2DSTA 2YWDA 4ZZ1A 4QELA 1UQRA 1VBFA 2I72A 5CBPA 5J5VA 3V42A 4BCBA 3F5QA 3HVFA 5LQJA 2QTMA 5HQ3B 1Q0SA 2CLMB 4M7OA 2PYPA 1UBTS 4J3FA 2QRVA 4A8JA 4K9SA 1EK0A 5KVAA 5AR1A 4GC9A 3D6NB 1WDTA 3CLHA 4D8YA 3HLBA 2YNMD 3ZY6A 2YFHA 4WGGA 3CSUA 1FXWF 4ARVA 1SQ0A 3REQA 2H9IA 4BVHA 4FB4A 1DBRA 2ERXA 3OLVA 3UC5A 2A9FA 1XEFA 1ILEA 5TR7A 5JVDA 1RCUA 1M10A 4OXKA 3C45A 1DY6A 4Z1MD 1VKRA 3ECAA 5L53A 3BFJA 4RA6A 4I1SA 2FEOA 4GHIA 2BR3A 4L15A 1X0OA 4Z1OA 4G5RA 1ERQA 3KR9A 3LQ2A 4PZPA 2QENA 1J0XO 1PYDA 3RYIB 4M6WB 3LQRA 4ZMSA 2GX6A 4X7PA 5PGMA 1E1LA 4YYEA 2ZAGA 1Q0RA 4M1OA 3AHHA 4LY3A 3LS2A 1NVVR 1IATA 3TN7A 5IFKA 5U9CA 1QV6A 2FPIA 1KZ7B 2EJVA 1TDGA 1PT8A 4HQ6A 4KIGA 2C7RA 1I0ZA 4YQZA 2EX1A 2OFPA 3GO4A 3HN2A 1OTEA 2QORA 2WBLC 3KP1A 4YAFA 4K2HA 4LHVA 4EEKA 3PKJA 4RXMA 4B74A 3B3GA 4NBKA 3BZWA 5ARDA 5KDDA 1WB4A 3BD6A 3TSOA 3BFKA 1N3BA 4AYWA 3QG1A 3D1LA 3O8OB 1TI7A 3OCVA 4OTZA 1G5IA 1MA0A 3IHBA 3C6BA 3VO8A 4ZC8A 3DH0A 1EFCA 3HXTA 3KHTA 1AWIA 3P94A 2Z2ZA 1NWCA 1DWUA 4JSTA 3BE6A 3PIIA 4DLRA 1PL0A 4DIDA 1GCUA 3CVOA 2QA5A 4Y5FA 4PSDA 2P6UA 3FHJA 1EFTA 1JPNA 3FBGA 2P68A 5JDIC 2QD3A 3IP6A 1ZS9A 4ZOAA 4FFBA 4LTNA 4MTLA 1FFGA 1U3DA 4CMAA 1XMJA 3BKWA 3DP7A 4X6UA 2GYVA 1K8ZB 1P8JA 2FFFB 1Y8RA 2C78A 3RVPA 2E48A 2FMIA 5EOVA 3IT3A 1FDVA 1BMTA 4Q34A 4A82A 5FOQA 3V1TC 3IAUA 4IWXA 5KNBH 1BAPA 1RWOA 3O82A 3R8FA 5CDFA 4KDEA 4R2MA 1IL0A 1N1MA 2WICA 3EVDA 1XX2A 2DYKA 3RRXA 1HI9A 2B7CA 1ECBA 2FP4B 2Q1WA 1ZM9A 2YYSA 2Y0BA 3WS2A 1MFPA 2P8SA 1E6LA 1N9ZA 3SIWA 3QMVA 5BXYA 1BIFA 2AFHB 4DNQA 1VKNA 1N6KA 5ECYA 1FL9A 2FLKA 4D5EA 3IE0A 2H57A 2FW8A 2P41A 3V97A 3M82A 2WKQA 4KR2A 1Z0SA 3OMXA 3DMGA 5KQLA 4Y2XA 4OQGA 3BXPA 4LK3A 3KXDA 4ZVPA 3ZQ4A 4F12A 4DEVA 1PEDA 2PH1A 2W4MA 2B9VA 3GMIA 1AGYA 2QW1A 1IY8A 5I45A 4IUCS 3OEWA 1Y42X 3A36A 1EAMA 2DQ4A 1PIWA 3EZ9A 1ZLYA 4LXQA 2X2FA 4PZEA 4A0QA 5BSRA 2HRBA 1PHRA 2EFEB 2J3MA 3BGWA 1C9KA 1F2DA 1YUNA 2GN6A 3TJRA 5C4GB 4RZUA 2YNMA 2I99A 1W0KD 4IOKA 3U7IA 4NJOA 1KIAA 1CVIA 3VHXA 3A6GA 1NLFA 3DTVA 3ODPA 2J3JA 1E32A 4WNYA 1ZA1A 1D5WA 2IOYA 1UWPX 2VJLA 3PE4A 4MO9A 5A92A 3CRQA 3O86A 1U3WA 3IIEA 4L3WA 1U94A 3WK6A 1LF5A 3VSBA 3CLUD 5AHXA 2C2MA 1C9DB 1PU2A 1VE9A 2CHFA 2ZYWX 2O7SA 5IT5A 4JWTA 4WBXC 5TX7A 4QC2A 2BMDA 1PR2A 3IHWA 2HA3A 4DDWA 5EZYF 2JEZA 1O4WA 1KH3A 1H6AA 1QP0A 3L0BA 3HVUA 4QQ8A 4PX5A 2ONCA 5DTRA 2R751 2H7VA 2IPMA 2I67A 2P79A 5CB6A 5T3YA 1L5HA 2X58A 3SLKA 1WHSB 4AKSA 4NU5A 1F12A 1M72A 2QUKA 1K25A 1U7WA 4EVIA 2AE1A 2QPAA 1I4OA 4QO7A 1QVVA 1OBHA 3JATB 4EHDA 3M2JA 2G08A 5FR1A 3PQ5A 1PJBA 1ULHA 2Y2QA 3L82B 4OVKA 3A3YA 2VT6A 3BMQA 2O2JA 5JVDF 2FMFA 4PSKA 2ZRQA 4JF5A 3E84A 3LLUA 2WSBA 2IDKA 2C4HA 3VP4A 4J3NA 4MUAA 1TGVA 2GNPA 1Y5NA 4S3MA 4FMCF 1XP4A 2Z6AA 3JQ8A 2QD4A 3TLYA 1J07A 1MD9A 1DKNA 4UFNA 3GFTA 1GSAA 1GITA 5JCJD 4I3AA 2Q7DA 4R54A 1HM5A 1O0BA 1ST3A 2O2ZA 3IOYA 2L19A 2ZSJA 1V8PA 1X7YB 1XJ2A 4PLZA 1WPRA 3LE8A 4NBRA 2ZRGA 1J7KA 4ASUD 1JAZA 3I09A 3IHLA 3O87A 4RH1A 3L6OO 4LC0A 1RXVA 5CFOA 2CXTA 2IYXA 2W1RA 1O57A 5IVDA 3GR6A 1E8DA 4DBZA 1A04A 2Y1DA 1CKEA 1P9OA 3QVGB 1MX3A 2A3UA 4WPGA 4J2OA 4YH1A 5BSGA 1VGRA 4URVR 2VHVA 3TOSA 2VSNA 4ALJA 4IIUA 3FWPA 4HDNB 5JAUA 1V45E 3OZ7A 2VBFA 5JU6A 5MC7A 2WWXA 3EZFA 3VKHA 5IWAB 2FZ5A 5DNDA 3DJFA 3O4HA 5EJFA 2ZC3B 1NSYA 2Q4BA 2QQGA 4NK3A 3UFBA 2A24A 3AERB 1NR5A 1HNXB 2NQ8A 1Z3IX 5HX7A 3TAXA 4GMXA 4Q3CA 2XBMA 4CM7A 3REGA 4HDKA 2YICA 3D1JA 3BE4A 4PM5A 1GA9A 3S2EA 4AZSA 2WSYB 4HNQA 3HJRA 3ZQJA 1SY7A 3BH7A 1D9ZA 3V55A 3B6JA 3K70D 2A57A 4U2GA 1QG4A 1BMFA 1C4XA 5ALLA 1QU2A 2A0UA 2GCEA 4MI1A 2GVZC 4KQEA 5THKA 4AMYA 3N4IA 1PW8A 2OZLA 1G98A 2I7XA 3E5RA 1TZKA 4ID3A 4KN9S 3KEGA 3MJFA 4YQEA 2JJ1D 3IBJA 3KOOA 2PMBA 2IEBA 1RKUA 4U8GA 2VNJA 3CZ5A 4AY5A 4RMHA 1V16B 1FC0A 5BQ3A 2VEDA 3ROFA 1SULA 4GSLA 5I8ZA 2O05A 2PZBA 4IVRA 1DQYA 1UWLA 1HYBA 3ETJA 2BGMA 3C3KA 2BFCB 4IMRA 3RAFC 3DZKA 4J4BA 1IG0A 4MQFB 3V2IA 3ES9A 1EROA 4ZVNA 3UBMA 3N39C 2CNLA 3VC3A 3SOZA 4RH0A 4K0XA 3W6PA 2VDLB 1YQQA 1EHYA 3GFGA 2V55B 1LTHR 2O1WA 4V0OA 5AI4A 3HFJA 4AJ2A 1FW8A 1QF9A 1V7PC 1GSOA 2ST1A 4JODA 4KWEA 1FCNA 3VM6A 1LK0A 3MGBA 2ZVPX 4MHOA 4DSOA 4JB2A 1FDIA 4B17A 1J6UA 1W4AA 1QO9A 3EZ2A 1X80B 4BNYA 4WEJA 5CYOA 1C7EA 1WMBA 1LA2A 2AI3A 4G8DA 1A98A 2PKQO 2FB9A 6CHYA 1W5SA 5EAIA 4RL6A 5C51B 3M4JA 4EUKA 4BYGA 3KBBA 4EX6A 1LRJA 5CCBA 3LR3A 5CGQB 4WZAA 4UHUA 4E4YA 4H1UA 1JG2A 3GT4A 4Z7OB 2Q3BA 1C14A 4V0LA 3DVAA 2Q3FA 2WE8A 5LQCA 3TEMA 4OF4A 4ALKA 3TIIA 3RS9A 4FEGA 2M1XA 2XCSB 4H0CA 5CK4A 4NZPA 4PFJA 1HDGO 3C3EA 1S1YA 1OTXA 4JYZA 2P4EA 2XCIA 3E4DA 3IS2B 5EMHA 3OPMA 1GLGA 2XE7A 4CUJA 2V7TA 1JQKA 2IEAA 5JCJA 2BBOA 1P1FA 1T9BA 4OFXA 1SKOA 3EY4A 5CEDA 121PA 4YWJA 2VZ0A 4XIJA 3NBXX 1MDFA 2ZWVA 5CVVA 1QHEA 3GUYA 4ZEOA 4ASUA 2L42A 1N4AA 5K5EA 2GSWA 2OMEA 4FB5A 3EWNA 4C21A 3EGXA 5C5DA 1Q92A 2QT9A 1I5QA 3URMA 4TWBA 2JKTM 4JDUA 5F2EA 1LX6A 4XAQA 1DJNA 1GVHA 1SWVA 4ED9A 3W8RA 3QP6A 4MLPA 2P6NA 1ZOPA 1RW4A 2V6BA 2FSVA 1M6VB 4ND5A 2REQA 1GN8A 3VYTB 3AYZB 4X1YB 4CF6A 3WL4A 4H15A 2F4VB 1TKBA 1MUUA 3PCXA 1OT3A 3RNOA 3DD5A 1O87A 4MMYB 1OJ5A 2R68A 3BULA 5EUAA 1U4OA 3JARB 4LE2A 4RK4A 4MV4A 4WI1A 3BILA 3HCFA 2UWXA 2AJDA 3JQGB 2GJ3A 1ULBA 3P19A 2VNAA 4GVPA 1Q21A 4ZJ3A 5BW8A 3I5XA 1GNRA 3ZNPA 5ITVA 3WAJA 4UHFA 1B15A 4HP4A 3CZ9A 4BDSA 2W00A 3KYCB 2Y66A 3PXBA 3DZDA 3R6WA 4TTJA 5HP4A 3MINB 1CSEE 5KYUA 3AWDA 4WVFA 3UB5P 1RBMA 4FOTA 4Y1RA 1CEYA 3JQEA 1OXTA 2VYQA 3ZG0A 3ZWNA 3OWHA 2OWDA 1B74A 4DJJA 4MS1B 1YUBA 1J0AA 4HWGA 4KPUB 4PTZA 2RONA 1JGTA 1K98A 1RR6A 5HFJA 1NY0A 5ERYA 4KUOA 1WB9A 2I4RA 5B2FA 3GLIE 1ZIYA 3UOAB 2QG4A 1EE2A 1XZCA 2JJ1A 1R5OA 2MSEB 4O4LB 1WTAA 3A3IA 1HNZB 3RIEA 1PJRA 2V7PA 2QF7A 1GYQA 4Y6LA 2JLYA 5CIQA 1H0SA 5K05A 2ZYGA 4JGRA 2R5NA 3TEJA 3NDIA 4KXMA 1F6WA 2O6LA 4V2IA 3TJZC 3Q0IA 4LRYC 3CEAA 4MVJI 5CX1B 1R9GA 2R47A 1UFQA 4XJXA 2XEDA 4JBXA 4R31A 4BB0A 3ZVLA 3HE3A 4FS3A 5JMTA 3NC4A 2BV3A 3KKQA 3CT6A 4KYTA 2PD3A 5L51A 4LCLA 2ACWA 5FHRA 3TZ6A 2HMWA 4ZI7A 4JUFA 2LBPA 3RYFB 2Y4AA 3TLJA 1X9IA 2W43A 3M2TA 4YV7A 4YROA 3VP0A 1Q22A 4EHIA 2VT3A 4BVKA 4UTOA 4RA9A 3P5BA 4NJMB 1JXMA 3RYHB 4KH1A 4FDTA 2VA8A 1FMLA 2GKSA 3QTLA 2FPPB 5C8VA 1NHGA 3B47A 3PIDA 1ESZA 4MCHA 3OSUA 1O9HA 2NYAA 4U2FA 1KAMA 3IPAA 5ALWA 3ILSA 4K9PA 4YUWA 2ZJ1A 4P1ZA 2WAAA 3U4CA 4MWEA 2YKHA 1FUKA 3DEZA 3N8RA 5HX9A 5JAPA 3K96A 2PZLA 1I6KA 4FGJA 2G06A 2WZDA 1ACLA 3IJEB 4WXEA 3DB1A 3AL2A 2BFFB 1G2OA 3NQ41 2D01A 3RR2A 4P87A 4MPJA 4CT4B 4XXRA 4GM0A 4FT2A 2VPTA 5HK8A 4IUBS 2WSSA 2CLLB 4JEHA 4DM7A 3KXKA 2OCAA 2VYNA 4N48A 1DQNA 3F2IA 1TMKA 2FFAA 3OF2A 1KGGA 1OBOA 4TXMA 3DMFA 1H8EA 5H68A 1MBZA 1Q7CA 2Z8XA 3OZXA 5K8JB 3ANSA 1XO1A 3A9RA 3SI7A 4A0GA 1U0OC 3EXEA 5FOWA 4QAJA 2OVBA 1GQ2A 1KK2A 4F9FA 3NTOA 5F1PA 2QLLA 5D3QA 2VUIB 3M6XA 4I5IA 4PSCA 2H4YA 3LPLA 1PNQA 3CUEF 3WRVA 3RHSA 3TSGA 3MQQA 4ZZIA 1T3HA 2GCOA 4E1AA 2NUBA 2X5KO 4OIMA 4UNRA 2R96A 4ZQGA 1UK8A 5BV1A 3L7JA 2RHRA 1NKVA 1VLJA 4J76A 2PLWA 2ZMFA 3E35A 3COVA 3FROA 3UWOA 4UPVA 2DH5A 5EIBD 1XEWY 5K3FA 4GOGA 4RNDB 4ILKA 2IODA 3BOSA 4DA8A 4L4RA 1NOIA 1XIVA 4A3SA 2CXSA 5E2IA 1KNQA 2PR2A 2CFOA 2WEKA 4TV9A 3VNRA 2X15A 3WISA 1UXJA 3GX1A 1KVRA 4BASA 4V3CA 4L4UA 5KNDH 3EDQA 1DQRA 5AQ9A 2SECE 4P80A 1EP1B 2B21A 1T0HB 5TQ0B 4FSHA 4D0GA 2C84A 2QP9X 4PLGA 3BQAA 4HH0A 1FSPA 1NVAA 3R3WA 4LI0A 1G66A 3RNLA 3DP9A 1CQIA 4LOKA 2IS6A 1Y8AA 4NFSA 2PDAA 3A6ZA 4FFPA 2YIJA 2ZYAA 1RHMA 3QXCA 4KV7A 2FYTA 2D74A 3NT2A 4OQEA 4GD8A 2RGXA 4QREA 2HDQA 3E3OA 4YPOA 3PZRA 3WNDA 4HNGA 3KWLA 3RT7A 4E3WA 5ALUA 1DT3A 3EMKA 1WBBA 2BGKA 4RVCA 2WFZA 3EQ7A 3NAQA 3CN7A 2YFYA 4BZPA 3BFDA 1KO7A 3R5SA 3IEMA 4JEUA 5LP6A 5EI5A 1NJ2A 4J75A 5KB3A 1GNTA 4ZDKA 4OHVA 3CX4A 3AW9A 1L4MA 1NW5A 4QJIA 2K2NA 2G71A 5G53C 4FE7A 1QO0D 4G1VA 3IA7A 1ZAKA 1ZK4A 1PK9A 1PFWA 4JLNA 2EX0A 3UJ9A 5G0TA 1HL3A 3H8SA 2BDTA 4G0MA 3LECA 3J80A 3URKA 3W90A 1BCRA 2FPWA 3T7TA 1LLDA 1PR1A 3GEPA 2Q1UA 1T8RA 4TS1A 1Z4QA 3ABSB 4PYIA 2O8DB 5AIAA 3H2ZA 5EE0A 1SK8A 3WA7A 2ZQ9A 3DGFC 4QBHA 3VSAA 2BEVB 1LEHA 4KQ9A 3JYHA 3C4JA 3DZFA 3T61A 1GG8A 4L9SA 4JGPA 2I0FA 1UBSB 2IDZA 4OLDA 2Y2KA 4D98A 2WTMA 2ZSHA 3CZ4A 1OZGA 1KE1A 1S1CA 3WNQA 3LY9A 3HDJA 4EUEA 2ZI5A 3RWBA 5EUBA 4AJJA 2FX5A 1PJ4A 1QFJA 2DC1A 3CI6A 4KREA 4JJ4A 4QNRA 4WCFC 5DPMA 4C0XA 1O77A 4ZI7F 4LQ4A 1FA9A 3WRYA 3P9RA 1KGDA 1XAHA 2Q0HA 5CA0A 1VETA 4IMPA 4F11A 5EHQA 3WK4A 3L7IA 3U7HB 1DT5A 2PLAA 4EFLA 3ANLA 1UKVY 1WXGA 4AZ3B 4ZOQI 1N2IA 1YH3A 1DKUA 2ZD8A 2BMEA 2F59A 3GU3A 1DKOA 1UOPA 4UNQA 2QVXX 5DF7A 4B45A 1J97A 4YRQA 4WZZA 4Y0OA 1BROA 1OI2A 2VOEA 3BCUA 5TMEA 3K0CA 4HS4A 1JEJA 5FYDA 2X14A 3WQHA 4XR9A 2QJ7A 1ZD9A 1EHIA 1V95A 3EIFA 3R3UA 1EFDN 2WAEA 3EOAI 4DE1A 1T6NA 3WLRA 2QZ9A 1R4AA 4LFUA 2I6XA 3U31A 4AZTA 5B6IA 4J91A 5IKOA 3W2TA 5TF4A 4E0BA 3T5DA 1XVUA 1VSUA 1RIFA 2WDPA 1QLHA 4WW0A 5FL7D 2XZOA 4EPVA 2NW6A 3EA0A 1BHSA 5U4XA 3B6IA 5JDCC 4RPKA 1GGHA 4KC0A 3FHLA 3DMNA 3KX0X 1GTL1 2LV8A 1T9HA 2OZPA 2XYPA 3K0BA 4XB6B 5D6OA 1AK9A 2Z98A 2ZULA 1E2HA 3Q6IA 3KD3A 4QQFA 4RVGA 5CGSA 1SKBA 1RWKA 3GZJA 4DKJA 1TAGA 5IANA 5GWXA 3RUHA 5C52B 2V3WA 4I8IA 5FPTA 3RS3A 3SZMA 5B1DA 4IRMA 5GMOA 2OGSA 4N49A 3JS5A 3E1SA 1T18A 1RQXA 1XTTA 3IF6A 2VAXA 1ZJ4A 2ZB7A 3UAWA 1FX0B 2WJJA 3VX4A 3QWIA 3K1JA 3ZE1B 3U5TA 2ZT8A 1OSNA 3H75A 3KZNA 2JKZA 4TV8B 2TYSB 3EG9A 3QNMA 1Z37A 3IKJA 3RIYA 1RI2A 1VBKA 4TV9F 3GEGA 1SZPA 1QO0A 4KQXA 3CSSA 4NL4H 2JBFA 4OGWA 3VU9B 2H29A 4BMWA 1L7AA 4MITA 3W79A 3WLTA 4Y6RA 1HEUA 5HQTA 3BDAA 3V8VA 3AR3A 1A2OA 4UVHA 2QYSA 3S68A 5HMMA 4IUDS 5D3MA 4BDTA 3EXIB 3CWCA 1YR2A 2LGJA 2C9ZA 2RCXA 3O84A 3GLFB 1N6HA 4GNRA 1H2AS 1L3CA 2Z6CA 1XEXA 3ED1A 5AUNB 1EFVB 1S0UA 4HGNA 4CJXA 3BL8A 4JBFA 1XA4A 3PEVA 1Z33A 1ZTUA 4S2PA 2FLWA 5DYYA 1YRYE 1XHLA 3JVIA 5F9HA 2XMZA 1BS9A 3OTIA 2VSXA 2Y76A 4MS3A 4DL9A 1N6PA 4EKDA 2ZWAA 4WAUA 2OBXA 3IQDB 4KZ9A 4ARBA 2XB4A 1PFUA 2FFQA 3E9NA 5LP6F 1C9NA 3K9FC 5FWYA 5AVUA 4RE6A 4D0NA 4DLKA 4KPFC 3SF8A 1V8DA 3H82B 2XBLA 1NRXA 4A6DA 3C8ZA 4ENQA 1KSJA 1J09A 3C6XA 3IO3A 1RQPA 2CEAA 1SBZA 3R9XB 4MEBA 1C8VB 5EVIB 1QHFA 5LZ4A 2BKAA 1UP6A 1OI7A 4LHYA 1AGRA 3DC7A 1ACMA 3RWOA 4R40A 1KI7A 4JLFA 3B5JA 5DKFA 3UHPA 5DNYB 3PT9A 4LOHA 3ZD6A 5AK3A 4B3RB 5I4KA 5ESXA 4NZOA 3TD6A 1TJ3A 1RCTE 4NXNB 1YLYA 3JPWA 3H9UA 3X1MA 1T25A 3LLSA 1X1AA 1VQQA 2PGOA 1PSDA 1P1IA 2WADA 1K7EB 1IJKA 3DL2A 4W5WA 4M8KA 4GH5A 2I3DA 3ZVRA 1PZHA 5AYVA 4O8GA 1FRZA 1VJGA 3NV9A 3Q88A 4EFMA 3BA1A 2O2HA 4F4IA 5HOQA 2CVFA 3LCMA 1QG0A 4MAFA 1YVEI 3D8SA 2EP8A 1YS9A 1XCGB 1UM8A 3M5DA 4YUZA 2OCYC 4K8RB 3OZDA 3LZDA 5DB4A 4HZIA 5CLGA 3BK2A 3CRW1 2XQGA 2QI9F 5DM70 3QBVA 5CA0F 1KU0A 3RU2A 2WFLB 3N74A 2R60A 1OJ7A 2C20A 2J0SA 2EP5A 3DXXA 3KK0A 3OCXA 4WBNB 1QHNA 2KHZA 1P2FA 4TUYB 1JIIA 2PO7A 1MTZA 4G85A 5EY5B 3K6SA 4D9MA 1RYHA 4MS4B 3Q7QA 1FQOA 4RQBA 3IVRA 2O06A 5I94A 2XGNA 2AWNA 3I2KA 4B9OA 4PN3A 3L7DA 1OLSB 4QYXA 1BDJA 1W5FA 3U16A 3QOYA 1VMKA 1NW9B 4KG2A 3W8DA 1YZFA 3QVJA 4DCUA 5EQJB 2CKMA 2C4WA 4M1YA 1WQ4A 3K8OE 3UFXA 2J59A 1RRKA 3SIPA 2QJFA 5GP1A 5HKKD 1RQLA 3IE2A 1FNBA 2AG8A 3GP5A 4D99A 2DQYA 2DBRA 1NN3A 4C0QC 3G85A 4BBUA 1A5TA 1XJ5A 4QUEA 3UOGA 3F1LA 1M67A 4RHUA 3L7MA 2FE1A 1IYZA 3TSAA 1TADA 4X8MA 2W6CX 4HHDA 3L18A 3TG8A 3S7PA 4OHCA 5HTKA 2NU9B 4GEGA 4QATA 2XFTA 2Q3HA 1AKVA 1UGUA 4M86A 4OBWA 2PPVA 3JYQA 5LDDC 4RKQA 2BASA 1F5NA 2XQKA 2ZBGA 1T6YA 3H42B 3GLKA 3G7UA 3HCRA 3WDLA 1ZNYA 2D5BA 2JLQA 2QTWB 4PVCA 4O6VA 1BJTA 2WTXA 4XFDA 1BRTA 3R7NA 2J3QA 4P4TA 1RYZA 4AM8A 3OWOA 2P90A 1VIVA 521PA 1P7CA 2CNOA 2RGWA 1S66L 2D1FA 2YVLA 3VR5D 3I30X 1M76A 3VJLA 3SW1A 2OHVA 2WHQA 2NXCA 3GVBA 3JU3A 5JD3A 3CE6A 1G1MA 2VJDA 1SHUX 3RAPR 4H3SA 4BMCA 3CNOA 1WZEA 1M0EA 1F4LA 2BH2A 3K6KA 1ND5A 4CT0A 1EX9A 2OCGA 3SYRA 2EQAA 4PZDA 5I9NA 3DHWC 1FYVA 3NEYA