2EWVA

Crystal structure of the pilus retraction motor pilt and bound adp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
350
structure length
343
Chain Sequence
b'ELKILEIIKEAIELGASDIHLTAGAPPAVRIDGYIKFLKDFPRLTPEDTQKLAYSVMSEKHRQKLEENGQVDFSFGVRGVGRFRANVFYQRGSVAAALRSLPAEIPEFKKLGLPDKVLELCHRKMGLILVTGPTGSGKSTTIASMIDYINQTKSYHIITIEDPIEYVFKHKKSIVNQREVGEDTKSFADALRAALREDPDVIFVGEMRDLETVETALRAAETGHLVFGTLHTNTAIDTIHRIVDIFPLNQQEQVRIVLSFILQGIISQRLLPKIGGGRVLAYELLIPNTAIRNLIRENKLQQVYSLMQMQTMNQTLYKLYKQGLITLEDAMEASPDPKELERM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords twitching motility protein PilT
publication title Crystal structures of the pilus retraction motor PilT suggest large domain movements and subunit cooperation drive motility.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Protein transport
total genus 74
structure length 343
sequence length 350
ec nomenclature
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ewvA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ewvA02
4LJAA 1E79A 2OLKA 1F2TA 2JDIA 1WCV1 4OQNA 2WSMA 3KKNA 5FFMA 4NE2A 4Q1FA 4XWKA 3HU3A 5DSZA 4HLCA 4LZZA 2REBA 3VR6A 1KKMA 1G21E 1VCNA 2PLRA 5HE8A 3QF4A 1XEWY 2TMKA 2WM9B 4L5BA 1EX6A 3SYKA 4PAQA 1QG4A 1KJZA 4ZPXA 2NO1A 1UKZA 1NMYA 4RFSA 4BLRA 2Q9CA 4JLMA 4YXWA 2IS4A 2V6IA 4F92B 3VQTA 2VIIA 2Z4SA 3L2OB 4ERNA 5GJWC 2JLVA 2RGAA 1E9EA 2VSFA 4KJZA 4URZR 4D0NA 4LHZA 4JYBA 4XSHA 2OFWA 2O8CA 1E1RA 4BEJA 4MUBA 2HF9A 4IFBA 4LYFA 4OI4A 1D2NA 2OT3B 3EPJA 2ZITA 4LHVA 4RY2A 4TT3A 4Q1BA 1DVRA 2ANCA 1OH6A 4JL6A 5E7MA 4B2PA 2ZRNA 3TIFA 5KSZA 2MSCB 4HI0E 3W6OA 5BW8A 1SKYE 3KUDA 4P4SA 1ESNA 2Q9BA 3RS0A 4ILEA 3E70C 1R5BA 1YZNA 3PQCA 2A7QA 2YC4C 4IDOA 2HCBA 2Q3FA 5J40A 3ZJYA 4JVSB 1R8QA 2CLDX 5EE1A 2ZUBA 3K8YA 2DFKB 2FFAA 4QBHA 3CM0A 4M21A 1XPRA 1UDXA 4QHSA 1Q3HA 1CS4C 1QHHB 2FNAA 2PH1A 1AS3A 2DFLA 4JVMA 3ZS8A 4B3CA 4V0KA 1EFTA 1CR0A 1TPZA 3DOFA 1W0KA 4BGDA 1HURA 5KO2A 2PJRA 5J5CA 4GFDA 4KYUA 2EQBA 1CKEA 3KQUA 3V9PA 4HB4A 4S35A 3GQBA 1IJEA 3W3AA 2WJHA 2R2AA 1ZMXA 1Z28A 1XU4A 1II8B 2VTKA 5IK2D 5AWFC 2CHQA 4DLXA 1P5ZB 1TADA 1D2EA 3JZAA 3VR5A 4Z54A 3PEYA 4DDVA 4ZO4A 3A6PC 3R7WB 3OEHD 1FW6A 1DELA 3LBNA 1KSJA 1MH1A 4RZUA 1Q22A 2OSBA 2YWHA 4HUQA 3QG5A 1OXVA 4Q9LA 4XJXA 1CJVC 2QE7D 1XD2B 3EA5A 1ZUNB 1YR8A 4D4JA 1M2OB 3GD7A 3BS4A 2YHSA 4FCVA 2GEDA 4HLUA 3X1ZA 1SKYB 2CEAA 2CHVA 3KZ1E 3I61A 3NC1C 3VU9A 3MMPA 1US8A 2QTFA 3D8BA 3G0HA 3U6KA 1P2VA 1OHHA 4O0MA 5IT5A 2GEVA 4BQSA 2J7PA 4R2HA 2XEXA 1YZKA 3LD9A 4V03A 3M0EA 2F7SA 1OE0A 1OW3B 2ZRPA 4OQMA 3GLHA 4KFTA 1W4AA 4U02A 1EFRD 2FA9A 3AGPA 3VNUA 2ZR9A 1WMSA 3K0AB 2F9MA 3H84A 4UQOA 4M4SA 1DS6A 5G40A 1WXQA 5EP1A 2QPTA 3X1XA 4II7A 4DLRA 1KI8A 4DB4A 4TLAA 1CJMA 1OH7A 2O0KA 4EQ6A 2WKRA 4B34A 1U2RA 1IXZA 2IF2A 3UK6A 2H18A 1ZM2A 2HT1A 3KKPA 4H1UA 1G6OA 4PO1A 5L3SA 3S1AA 4BUJA 5FTKA 1F5NA 1YRBA 1G5PA 1DPFA 821PA 1AJEA 4JLOA 2JJ1A 4PFSA 2PMKA 2XJ4A 3GJ5A 1KO8A 5JJIA 2HYDA 2PCJA 4GP7A 4BLQA 2C99A 2QAJA 4U5XA 4XTCS 2R65A 1II9A 2FPMA 1EX7A 2X8AA 1Q21A 2NO9A 1UBFA 2VHUA 2OFXA 4MRVA 2O52A 4M9XA 3TAHA 2FSIA 4WOPA 3GEEA 1PVOA 3CKLA 3OE7D 2PEZA 4Q66C 4W5WA 3RSOA 1R8SA 1VG0B 3LBHA 1NI3A 3NVAA 4Q21A 3SU8A 4HLUC 1XNJA 4D80A 2EVWX 4Q5IA 3BB1A 3U6BA 4OQFA 1JJ7A 4JL8A 1T5IA 4YMWA 1KOFA 4E03A 1KZGB 2ZI5A 2VPPA 4ON9A 3U5ZB 3GPLA 5JMTA 4KLNA 4DT1A 1ONBA 4I4LA 2IUUA 4QFMA 3CUEF 3THXB 2W2TA 1G64A 3AVWA 1XD9A 3TRFA 3N5CA 4Q1CA 3N2EA 4KVAA 2ZM5A 3EZ6A 2IUSA 2LKDA 4DDWA 4NCNA 3V00A 2FGKA 1NVVQ 4JLNA 3PR1A 1E0KA 5EZ6B 4PSKA 2QBYB 3L0OA 1AGPA 4LDJA 3K09C 5G3ZA 3GLIB 3AM1A 2F1IA 3EZFA 4NKRA 2EFEB 2IYZA 1JR3D 5DISB 4HDOB 2V4ZA 4IDPA 4A0RA 1IJFA 3AVPA 3I32A 5DE3A 2HXYA 1AZSC 1D9XA 2B8WA 1NG1A 2ODEA 1U0JA 3SQWA 1COWD 3MCAA 4LCBA 4LYHA 4NMMA 4MQBA 3SYLA 4ARZB 1AZTA 3DO6A 5M04A 5F3WB 2HLDD 3U44A 4URYR 1KI3A 2KBEA 4X8HA 4AY2A 1Z07A 4KBFA 5GVRA 1DAGA 1C9KA 1NJGA 1UBGA 2ZANA 4LPKA 1Q1BA 2Q21A 2GJ9A 2R62A 1KMHB 5GJVC 2XOKA 5HPYB 4XVQA 4DVGA 1HQYE 1G5RA 2F43A 4TYPA 1S1CA 4P33A 4I1OA 1X1RA 2NMVA 1QHGA 4W7SA 4G1UC 5HKKD 4UNPA 2P5SA 2ZS8A 1O3YA 2DR3A 2VHQA 4GI7A 4LJ7A 4R98A 4CEJA 4Q4AB 2ZRAA 4IHQA 5LD2B 4KI0A 5LB2A 2FFHA 3RS7A 1UKEA 2B92A 5B30A 5KPJA 1VCOA 2ZJAA 1YZGA 2P5TB 2P6RA 3K53A 4M1TA 4M1YA 4JSYA 2FPLA 2C9CA 1Z83A 5L8VA 4L15A 1U0LA 1OXUA 3MD0A 3EPKA 3B13B 1ZU4A 1FL9A 3CWQA 2RGGA 2G0TA 1JEDA 1S9HA 3NBZC 4M9QA 3DM9B 2RHMA 1W46A 1VMAA 1ZC3A 1CF4A 2C5LA 1LFDB 3LFUA 1G6HA 1BYIA 2VEDA 2ZI6A 2ZSBA 5FOUA 1G41A 2E87A 2G77B 2PBRA 2QMHA 3EZ9A 3LO5A 5FI0B 721PA 3ZGXA 1XTRA 4EPRA 1UF9A 3AH8A 1F2UB 2IWRA 4IXMA 1E32A 4Q4JA 2V54A 3C5HA 4ZI2A 3A1SA 3FGNA 2XXAB 1ZNZA 2KSQA 3OAAD 2HXSA 1RFLA 3DVLA 3UMRA 1KO4A 2KWIA 2XSZD 3OEED 4HATA 1YR7A 4OK6A 2WSSA 3H2YA 3M6AA 4M9ZA 3KJGA 4Z8YA 1UKYA 1ZD9A 521PA 2Z5FA 1XFAA 2H7VA 2O8BA 5BWMA 3FKSA 2CLCX 3BD9A 3BBPA 1G7SA 3SBDA 3LH5A 3EC1A 2ONJA 3QVVA 2JLYA 2ZVQX 3SHFA 5KTYA 1K8RA 2VP9A 5EXSA 2OEPA 1MR3F 2XZOA 5H70A 4D0LB 3LX8A 2R6FA 5H68A 1J2JA 2F3TA 2J87A 3T15A 3ND8A 1VYVA 4DCUA 4D6PA 5IRCD 5FPYA 4C7OA 2G9NA 1P6XA 2W6JA 3PG5A 2WIBA 4UJ5A 1IN4A 2KB0A 3IBYA 3ADCA 5CLLA 3C14C 5E7JA 1DAIA 1Q0UA 1ZCBA 2HT6A 2WBLC 4RD3A 1XP8A 4JYCA 4MDFA 2WOJA 2GXQA 1NVWQ 3CRQA 3QXHA 5JS8A 2GCNA 5AK0A 1KDRA 1SVSA 3PXGA 4GOJA 2QTHA 3D31A 1NNEA 3U7EB 4OBEA 1JI0A 1T8UA 4NYIR 4M1SA 2GAAA 4B73A 2CLSA 3LX5A 3RRYA 4B2LA 4DUGD 3P4XA 4A36A 3KJEA 1DADA 1XTSA 2QTVB 5FTLA 3EC2A 4TYNA 4HUTA 2JASA 3HYTA 4ABYA 4HAXA 2YJTD 1GRRA 1KKLA 4HZUA 5EZ5A 4D2IA 5EUMA 1WBBA 1ZW6A 2ERYA 1OYYA 3V4RA 4WVFA 4UNRA 1J8YF 4PZYA 1W48A 2QSYA 4XD7D 3DZDA 4LRWA 1J90A 4JIMA 2NTYC 2ODBA 2QP9X 1E2LA 1P9RA 2L0XA 2WAXA 3FMOB 4IOLA 3W90A 4IVQA 4Q47A 4ZCMA 2CE2X 4GZLA 4RD6A 2ERXA 3T35A 4PHGA 4Q1EA 1AQYA 3CRW1 3RDPA 2BKUA 3KB1A 3K0SA 3U3RA 1ANKA 2VBCA 3TKLA 3W9YA 3O8RA 3QPUA 5SZHB 3LQQA 3CBQA 3IIMA 3G82C 4RZ3A 2GJSA 3TVTA 4BFXA 2NZJA 2QMUA 3VHLB 1AIPA 3TR0A 4DB2A 4C0LA 1E96A 1BS1A 3FVQA 4U00A 1TUIA 4JVNA 3F0TA 4DCVA 3NKVA 3I73A 2XTMA 5G3YA 1VG9B 1GKIA 3W5IA 1ZAKA 4KFSA 2PMDA 5CB6A 3WMFA 4AKIA 3AP1A 1Q1ZA 2NPFA 5DYIA 3TW8B 4PPNA 4TZ6A 2HJGA 3GLGB 4MKFA 4NYJR 4YMUA 5LPNA 1UJ2A 1TU4A 4OI2A 4TLBA 2HJVA 2WJJA 1CBUA 1ZNWA 3ZQ6A 1KK0A 1NBMA 2IS1A 1KSGA 3RWMB 2YOGA 2ZROA 2IYWA 4KFRA 1HTWA 1KAOA 1FUKA 4G3XA 2AXNA 2IHYA 3RNLA 1CEEA 4LJ6A 1JNYA 1R5NA 3L82B 3A4LA 1E2NA 2ZU6A 4P32A 3K70B 4KCGA 5FBWB 2VSXA 4KODA 1GRNA 3IEUA 3OIVA 2V1XA 4MGKR 5HE9A 1KY3A 1T5LA 1VPLA 2QPAA 1G3QA 4HDCA 3GEIA 3AKEA 3K0FB 4C0AC 1ETUA 1H8HA 4LJ9A 3CNLA 3IILA 1A7JA 2OBNA 1H8EA 2W58A 5JHHB 3NDBB 2C98A 5FPKA 1NBME 5D3MA 1G4UR 3CNOA 1LNZA 3PUVA 2VF8A 2R6AA 3LAWA 2ZI9A 4IFEA 3OIWA 4QGGA 1SVOA 3FKQA 5DO9A 5KSOA 4B3GA 3R8FA 3B6EA 1M34E 1P2UA 1YU9A 1KO7A 3JVVA 1JAHA 2WICA 5JJLA 4BPBA 3CX7A 2VYFA 2QQEA 2ZJ2A 1Z0AA 2FSGA 1W5SA 3H0KA 4JT4A 4RKEA 2QAGB 1K5DA 2P6UA 1F60A 1I4DD 2JLRA 4RZ2A 4A2QA 3LBIA 3VR2A 4TYQA 1XEWX 2WKPA 1G16A 1DE0A 2CJWB 5KNBA 1SXJB 2G3YA 4JLDA 4QXAA 1GL6A 4GOKA 5F9FA 3Q3JB 1XEXA 2GK7A 5FBRB 2YKGA 2O8EA 2NZ8A 3AVTA 2ZRBA 5A0FA 1JPJA 1N5LA 2OFOA 3AKYA 1Z5ZA 3ZVLA 2GXUA 3AVVA 5JSZA 4JKYA 4O2RA 2QM8A 8OHMA 1AK2A 2ZRKA 2MMGA 2QNRA 3ASZA 4C0KA 3D3QA 5FR2A 2QM7A 2DPXA 2CL0X 3RS3A 4HAYA 4WZAE 1NF3A 5EE3A 1E98A 1W7AA 2Z83A 1S2MA 1N6RA 3GJ4A 4DRZA 5J4LA 4RVCA 5E7IA 1CP2A 3VX3A 2FE4A 2ZAMA 3EW9A 3W3ZB 1KSHA 3WBKA 3RANA 4TTRA 4NP6A 3SN6A 1CR1A 4GBMA 2VLIA 2FPKA 4XH9B 1DAFA 1G20E 2IT1A 2ZRIA 3DKVA 4TL8A 1YQTA 2G88A 5JFGA 3PJRA 1GITA 1QVAA 2CCGA 3I5YA 5L3QA 4B3XA 3AUXA 4URUR 4NCJA 1E9DA 4EJSA 2IBMA 4J0QA 2A5FA 3PVSA 2J0UA 3PEWA 3ONWA 1QRAA 2E1RA 3QG1A 1Y3AA 4C0QC 2XNDD 1IBRA 1TTTA 1N25A 2EFHB 2WJYA 1COWA 1R0XA 3C4JA 1KAGA 4R7ZA 4NPHA 5CYPA 4CF7A 3BH6A 1YE8A 4ASUA 2WOOA 1NVUQ 2QT1A 4GPTA 3MUFA 4CYMA 3KFVA 1EFHA 4MGYR 1G1MA 3ZZTA 3CLVA 1JAIA 2CNWD 3MG9A 4C0HA 3D7MA 3PEUA 4JT2A 4B75A 1KZ7B 4BWYA 2ONKA 2YINC 4QGHA 1HV8A 4KO8A 1IN6A 4MUAA 4B76A 1IN8A 3LW7A 4JKIA 2C03A 2ZIAA 3EASA 5J4YA 1KI9A 2V1UA 3VR3A 3WXMA 1NLZA 2WKQA 4B43A 1SVKA 4A1FA 2FFQA 1HY3A 4DLYA 1XMVA 1OF1A 1HT2E 2B8TA 3SE0A 1NVVR 1OFIA 1N0WA 4BFTA 3THWA 2C77A 2NO0A 4PHFA 1XEXB 5FTNA 3NBXX 3DKPA 5FOVA 2V6JA 4KAXA 1MO4A 2OCAA 2OZEA 4B3DA 1M8PA 1JQJC 2EYQA 4IW3B 1OB5A 4C3ZA 4NYIQ 1VECA 4L9WA 2Q0HA 4PC2A 3QBVA 4EJSC 5JHGB 1EGAA 4UNQA 5KDOA 4Q4HB 2VP4A 4LC1A 4Q01A 4C30A 1G7RA 4WXRA 2H92A 4HAZA 5BN4A 5DI3A 4AYWA 1OFHA 3LQRA 4FINA 4UXIA 2V8OA 4D4LA 4I81A 4AKGA 3RRNA 1KIMA 1QHNA 3RS5A 4DCSA 5JEEA 4LWZA 5KNDA 1XDBA 4NDZA 3U2QA 2FFBA 3K9HA 4YMTA 2BMFA 1BO6A 1Z6GA 3CRRA 2A2ZA 3BORA 4V0OA 4JJZA 3B8HA 3OEEA 2J46A 5FL7D 4M1OA 1NG9A 1G18A 5ANRB 3KJIA 4O25A 5G53C 3U3MA 4Q9JA 2I1QA 3I72A 2D62A 3UKDA 4CZ2A 4D0GA 3VHXA 4MKHA 3PUYA 4RJLA 1R10A 3KXLA 2J1LA 4FWIB 3C41J 1LVGA 4LV6A 2YOHA 4OQLA 1OXTA 2FOLA 1L4UA 2H57A 5FPSA 4IDHA 2IXGA 5BYJA 2BMEA 1AQUA 4FMBB 1QDEA 4WXPA 1U98A 4ITRC 4URXR 4CEIB 2RCNA 4A8JA 2WWFA 2AL7A 3TVDA 4BFZA 4BEBA 3C8UA 4H1VA 4DHEA 1NN1A 2JLQA 4NYJQ 2B21A 1M7BA 2OE2A 1VYTA 2A78A 3K70D 2ZS7A 3U4QB 3CW2A 3K9NA 3KKOA 3SJZA 1EXMA 2MSEB 2GK6A 2ZSFA 1PJRA 2BCGY 5C4GB 2NG1A 4ZDIA 4DZZA 3AP3A 4YC7A 2BBWA 1XMJA 2H16A 2YWFA 5FBVB 1T3HA 2LKCA 1P3JA 5BYKA 3THYB 4PTLA 3ZQJA 3TQFA 2VA8A 1WA5A 1SVLA 4D4KA 2J5XA 4PANA 4ZIRA 4A15A 2OBLA 3X1DA 1KY2A 2OXCA 3TW4A 1JQLB 3E2IA 3R9XA 1JALA 5CJ2A 1Z6XA 3T34A 4JLAA 1XJQA 4YQFA 5E3HA 2QSZA 2GESA 3HWSA 4HAUA 4DUGA 1XCMA 4LC0A 1CTQA 2RGNA 2FSFA 1XMSA 2AXPA 3EG5A 3PUXA 4R9UC 1KI6B 3PUWA 2O8DB 1LS6A 2AWOA 3MWYW 4FW9A 1IQPA 2O8FA 4QGFA 1WBDA 5DGXA 4Q7JB 4AIIA 4LBYA 1E1QD 3MFYA 2DFNA 4DLSA 4OHWA 2FU5C 4NHOA 1SXJD 4XD7A 3UANA 1F2TB 1KGDA 1CJUC 3R20A 4G5SA 4ZCLA 1G9XA 3FE2A 1OKKD 1Z6TA 2YWEA 3FPAA 2A9KA 1KTVA 3FHTA 1BH2A 4BFSA 5CK4A 2VQSA 3QF4B 2IHBA 5BN3A 1DBSA 1ELOA 2BWJA 4W5JA 4RFSB 1OYWA 2D7DA 2DWPA 4V0NA 3QIAA 1I2MA 3WMGA 1XCGB 1NP6A 2GJ8A 4OHVA 3VAAA 1D8TA 2CXXA 2EFDB 3FTQA 1FTNA 2O8CB 5B64A 1W4CA 4PXAA 2OUKA 2WWHA 1XTJA 1NIJA 4DEYA 2IYQA 1KI7A 1X8KA 3AV0B 1DEKA 2G6BA 4V0MA 2R6CA 3WYGA 1RC8A 2V7QD 2X2FA 4EAQA 3LVQE 1G5TA 2IF0A 3HR7A 2ZJ8A 1S8FA 1TAGA 3CRVA 5KSYA 1H65A 2F1RA 2NPIA 1GVNB 2XTZA 1LTQA 1TQDA 5K8IA 2IEYA 3U61B 4NONA 3QKSA 4P4SB 1Z0IA 3CZQA 1KO5A 2ZYVX 2RGNC 4B3BA 5HTKA 1XTKA 1W36C 1U8AA 2C9YA 2QG6A 3OIYA 3VTKA 3HP1A 1GRQA 1E2QA 1S96A 1T4GA 1FQKA 3P26A 4Y0AA 4A6PA 4GDFA 2VHCA 1P62B 3BOSA 4LJ8A 4R2IA 4JMPA 4RKFA 2W0MA 3P32A 2NO6A 3ZZ0A 3GLHE 3BH7A 4F93B 5SZIA 3CRMA 1RYHA 2OV2A 3ND9A 1D2MA 3T1VA 3X2SA 3GJ3A 5JECA 2R44A 5F9HA 4V0ME 1UBCA 4RCYA 1PUIA 4OQXA 4TWZA 1CIPA 1XB2A 3AEZA 4URVR 1W4RA 2AK2A 2Z0MA 3GJ0A 4IEIA 1IONA 4TQUS 1W4BA 1TMKA 2BHRA 1S4QA 1U81A 1DO2A 3B7GA 4BZPA 5JI3E 2NGRA 4G5OA 1TQ2A 2JA1A 1SVWA 3KFXA 2ZYTX 3Q72A 1EESA 3DMNA 4UNNA 3RHFA 1K6MA 4GP6A 3FYHA 5SZKB 2EFGA 4GT1A 5CIQA 3RVBA 1CXZA 1O87A 3WNCA 1P60A 3U3OA 2ZYWX 3Q85A 3WNBA 1NLYA 1E2FA 1YR9A 1E4VA 4HUQB 2CK3D 3RRMA 3K0CA 5KUTA 4GL2A 3ZZUA 2JIZD 3CWZA 2CDNA 5P21A 3FB4A 2DFTA 1CRPA 2WJVA 4ZDWA 1K5GA 3T61A 4Z51A 2JJ2A 4BZXA 1S0UA 1LS1A 3SEAA 3OFND 1D9ZA 4JLBA 4TN1A 2UZ3A 4Q9KA 3LV8A 4EFLA 4KBGA 3TGPA 2FMXA 1YZLA 1US8B 1Z06A 1R6BX 1U94A 2BBSA 2REXB 3CR8A 2ZSEA 4LK2A 4LOAA 3BWDD 4OYHA 2RGDA 4ZV4A 5C1BA 3OIUA 2C96A 3B5JA 5CDFA 2JEOA 3QXSA 1YZQA 2V55B 3DHWC 4B2IA 1J70A 1RW4A 3GLHB 1ODFA 3FHOA 3KKMA 1E3MA 1M7GA 3RSLA 3WP1B 3L0PA 4BECA 2BV3A 2JLSA 1FZQA 5DN6D 1FUUA 4TSFD 2UVQA 2P65A 4EFNA 4EQ6B 2EWVA 3KQHA 3EPLA 3REFA 3A4NA 2R6DA 3A37A 2ODNA 4OKSA 1N6IA 1ZM9A 2VF7A 5JRJA 4B3FX 1DOAA 4EPXA 1DAHA 1HA3A 4QHYA 2I1VB 5L3SB 3S1AB 3B2EA 5FBQB 1YKSA 1XX6A 3OHMA 3AVYA 1IXRC 5FR1A 2GXAA 3IIKA 5L3RA 4BRWA 5CDFE 5LBIA 2GZDA 1Z0DA 4NCKA 1GG2A 3WHLA 4M1WA 1FFHA 2ZSAA 5C18A 1Y63A 3AKDA 2QMEA 3ADKA 1XZQA 3GEHA 3K0CC 1QZXA 1FOEB 1TL7C 1TQ6A 2C9OA 2JAQA 3CX8A 4RCZA 1XJCA 4AG6A 2ECKA 2ZS9A 2IXEA 2X2EA 3PV0A 5DHFA 5H1YA 2BCJQ 4PQFA 4EDHA 3NWJA 2D74A 2IYRA 1B23P 3FMFA 1E2GA 2ZE7A 4BRUA 3SI7A 2RGCA 1DTSA 3U3JA 1JEEA 4MKIA 3B1VA 4JSTA 1ZIOA 3DEFA 2JJ8A 1YZUA 2JATA 1QHSA 5G41A 1RRGA 2HDNB 2Q6TA 3FWYA 4B71A 4DT1B 4TTPA 3W8NA 3WYFA 2N42A 4DBLC 3Q5DA 4XTRA 2WWIA 2YVUA 3ADBA 1ZNXA 1OH8A 1PV4A 3ZLJA 421PA 2KBFA 1N6PA 1ZM3A 3Q7PA 4GMDA 2DHRA 3EWSA 5CB8A 3WHKA 4OHYA 1Z2AA 1ZU5A 3ZD7A 2FEMA 3SC3A 1E94E 1G17A 2Z43A 3AF3A 3QPWA 3AF1A 2AK3A 5AR1A 5FBLB 1ZC4A 1E79D 2JDID 3A1UA 4M2LA 1W49A 1NSFA 4PAMA 1XWIA 5FPHA 4RZXA 3IIJA 3IDQA 4H9GA 1ZUIA 3HPQA 3EIQA 2PX3A 3SOPA 3VKGA 3OZXA 1DAEA 2OG2A 3IHLA 4PQRA 2IWHA 4LX0A 4AG5A 4DKXA 2ZE6A 2G1JA 2ZAOA 3R8CA 2CMKA 3B60A 1A5TA 5JLJA 4A9AA 4P4UA 1GP2A 4QG7A 4CT4B 1KJYA 3L8YA 2OHFA 1GKUB 3U44B 2LWIA 2VRWA 1E4YA 1OV4A 2A5DA 2AWNA 1V43A 2IS2A 3P20A 4MYUA 1IAQA 4IKEA 3ZYCA 5HZHA 2ZPTX 2FV8A 4MDEA 2H8KA 3ZIAD 1S1MA 2WWXA 4ESVA 3LY5A 1NMXA 2WZQA 3HDTA 2F43B 4LHWA 4LBVA 5CLQA 4D82A 1Z63A 2QU8A 3GP8A 2IYVA 1AN0A 1OIVA 4LBZA 5AUNB 5KOYA 3QXJA 4Q00A 4TT3D 5DIFA 1N0VC 3R9WA 2RKOA 3JZMA 1BMFD 1ZD8A 1T3LA 4JBXA 1MO6A 1Z29A 4B33A 4CEJB 4DCNA 3IGFA 4JLPA 3GJ8A 3C15C 2QY9A 4LI0A 5EQTA 2QROA 1P73A 4BE7B 2AFIE 3MSXA 3MRSA 3BB3A 1NKTA 4YONB 5HCIA 1E9CA 3R9IA 1LB1B 3TR5A 2XB4A 3SQXA 3IQXA 5SZJA 4Q9HA 5JBQA 1JJVA 1N6KA 4B6FA 1UFQA 3EX7C 1VTKA 3C16C 1LV7A 3H86A 3Q9LA 3ZS9A 5FL3A 4TMZA 4IOJA 4IOMA 2KJQA 3BFKA 1XTQA 2Y8EA 3RABA 2PT5A 3GLFA 2FDCA 2VL7A 3SJCA 3UWOA 1FTSA 1F6BA 1XD8A 3AF0A 4QC2A 2R8RA 4KVGA 4B32A 4DXAA 2I4IA 1W0KD 4M1MA 3KTAA 2XX3A 2AN9A 4Q7KA 3BGWA 4IDQA 5EE5B 1A2BA 4BFUA 1IN7A 2GCOA 4EIWA 4X8OA 3AVUA 3T1TA 4YLGA 1KYIA 2VP6A 4WZ6A 621PA 3QQ5A 4Q4JB 4Z8XA 2PZEA 4MRNA 3WYAA 1G3MA 5IK2A 5DNYB 4QOSA 1N5KA 1OXSC 2RGXA 4DJTA 3GLFE 4G0NA 1KNXA 5HZKA 3L43A 2XXAA 3PUZA 1E1QA 3OEHA 4NYMR 3RWOA 3EZ2A 4MYHA 5IDVA 4FMCB 2O8BB 1G4AE 1Z3IX 2OAP1 1HE1C 2J45A 4GOXA 2IEZA 2QE7A 1Z0KA 3CF0A 3F8TA 3QF7A 1E2MA 3SNHA 3GMTA 1BKDR 2ZRCA 4US0R 1AS2A 2FN4A 5HR5A 1UM8A 1OHHD 3MWLA 2GHIA 2NQ2C 2J7PD 3TAUA 5JI2E 3B1WA 3QOFA 2PZFA 1J99A 2ZE5A 1W44A 3BRWD 1E2JA 4AK9A 2H1LA 3WY9A 4C7OB 1GUAA 2CL7X 1MABA 2YYZA 2QI9C 4EPVA 1NSTA 1XTIA 2RMKA 1DAMA 4XWOA 5KYKA 1EFRA 3BAFA 3P1JA 3TUJC 1P2TA 3N2IA 1EK0A 5TDHA 5K8TA 2EYUA 3ZVNA 4WAUA 2V7QA 4D26A 1E9FA 4C0BA 2FG5A 3HR8A 1G7CA 2QGZA 1TUEA 5EJEA 2Z4RA 5UKDA 4YMVA 1Q20A 1DAKA 4JVLA 4LJYA 1E69A 3CONA 4M1KA 3T5DA 3TH5A 4DDTA 4HB3A 5JWRA 2JJ1D 2BIFA 1LF0A 1RYFA 4G5QA 5TV2A 2QMOA 2XNSA 3QEOA 4GNKA 2J59A 3QSYA 3HU2A 5TARA 1KDPA 4QJ3A 3A1VA 4CW7A 2GILA 1VCMA 2QP3A 1VIYA 2O0JA 3QENA 2UKDA 4OK5A 5EXTA 1ZCAA 1X1SA 4HLQB 4HZUB 3RC3A 5KU1A 5CM9C 2YOFA 1P2SA 2CVHA 2AKAB 1ZINA 3TLXA 3ASYA 3OE7A 5DHAA 4RSGA 1KI4A 4MGIR 2X1VA 4FD2A 1ZNYA 2ZUCA 2JGNA 3P27A 1TEXA 4C0SA 2PCLA 4G5RA 4XOIA 3QPVA 1GTVA 1R0ZA 4RD4A 1NKSA 1UDWA 4PR0A 1IM2A 1TF5A 4RFVA 2ZRJA 4DIDA 2F3RA 2MMCA 4HEJA 1G3IA 3IHWA 4QL3A 4B35A 3A4MA 2W6ID 2ZJYA 5E4FA 1UAAA 1E0AA 4CEHA 1Z0FA 1FX0A 4N1AA 2D4HA 4POAA 4DDUA 5EP4A 4OL0A 1N6HA 2R9VA 1MV5A 1T0HB 1L2TA 1G8PA 1TX4B 3FFBA 1G291 3PIRA 4PO9A 2CK3A 4DWJA 1DG1G 1TF7A 3VU9B 2O0HA 2OXRA 2DCUA 1PLJA 2P0EA 2JIZA 4LY6A 4XVUA 3U60B 4HYYA 3EIHA 4ZKEA 4D81A 4UXHA 5TY0A 4PO8A 4OI0A 1Z0JA 2VH5R 5EP2A 1GAJA 3ICQB 3LNCA 4KSBA 4Q1AA 3W34A 1RRPA 1RE0A 5JJKA 2CCJA 3BC1A 1E0JA 1JR3A 3NBYC 5JEDA 4ZI3A 5HCNA 5CK5A 4CGZA 2AD1A 1V5WA 2V3CC 4US2R 2GVDC 2XAUA 1MRNA 2BMDA 5FH9A 3UWKA 2J7KA 4LV5B 3KKQA 1PLLA 4TTQA 2BJVA 3LVRE 3QI2A 4TSFA 2HLDA 3AVQA 4L8GA 1C1YA 1U0HC 3EZ7A 1X86B 5FOXA 2XOKD 4MITA 4F4CA 1N0UA 2BBTA 4DLVA 2GRJA 5D3MB 4NTZA 3GJ6A 4QNRA 4W9MC 4QBIA 1GZSA 3QXCA 3PFIA 1JR3E 4IDNA 5BN5A 1U90A 5HKKA 1SGWA 4ACBA 5JS7A 2GEUA 2WVJA 1MRSA 2BC9A 3SR0A 1WF3A 5LDDC 2B7BA 2EWWA 3AF2A 3A36A 2GVZC 1N6NA 2ZSDA 4HB2A 1TEVA 4L4UA 2J0QA 4WW0A 3CNNA 4F7WA 1IY2A 2C2HA 1X6VA 2PX0A 1ZRHA 1LF5A 4ZCIA 3WRXC 4MYTA 5D3QA 1E6CA 1NY5A 4EPYA 4TL7A 3RLFA 2O8EB 1Q1EA 4MH0R 2IW3A 1SVMA 1Z6YA 5JSZB 1NVXQ 1Z08A 2YWGA 1GKYA 1QHHA 4A6XA 1OFUX 4Z1MD 3T1OA 4G01B 4BLSA 5J4VA 3I8SA 2C95A 2WWGA 5FOWA 3E1SA 4TYWA 2C8VA 1W5TA 2ZETA 3ZD6A 2OM2A 3AP2A 4GMXA 3B1XA 3U7GA 4HSEA 5KNCA 3FMPB 2OBMA 3IPXA 2GZHA 1II8A 3LLUA 4JL5A 2ORIA 4PC3A 2ZI7A 4O2LA 1Z8FA 3OAAA 4I1UA 2WSSD 3REGA 2SHKA 1YVDA 2XSZA 2ZYUX 1G8YA 3K9GA 2GAOA 3R7WA 3ZH9B 1T0JB 5L3QB 1A82A 4QJ5A 4DCTA 3AUYA 5KHOC 2GDJA 3FKSD 1P61B 3BERA 4EJSB 1XD2A 2N46A 4M0LA 2F6RA 2Z6VA 3MLEA 2J0UB 4LHYA 4FXPA 3W6PA 5FUVA 1X8JA 2I3BA 4Q1DA 3B1YA 3CH4B 2GETA 3QKRA 4NYMQ 4TMVA 1ZVQA 1GNPA 1UPTA 5EXXA 5H8WA 4UXJA 2ZQ5A 3NEYA 3WBJA 3T5GA 2FSHA 5KSPA 2W6JD 1N3BA 1NN5A 4Q18A 3GJXC 1GNRA 3T1QA 2WAYA 3A58B 4DLTA 3ZIAA 3RRZA 3BK7A 4LJ5A 1F48A 1XCPA 1YZTA 2QP4A 3Q7QA 3KQLA 1FNMA 4X8LA 3K0AA 2BBOA 1GDDA 4AYTA 4A0FA 1VG8A 3F3YA 1BMFA 2FZ4A 4HAWA 4TZ0A 3W8RA 1L8QA 3B82A 4WA7A 3FHCB 4E07A 1VHTA 2ATVA 2FWRA 4N0EA 4Q03A 4XSGA 3QXXA 1BYUA 1IHUA 3SJAA 1E2DA 1Z2CA 4C9BA 3O8CA 1IN5A 3TUZC 4JS0A 3EARA 3THWB 3BFXA 4I1VA 3ZVRA 2CCKA 1CU1A 4YMSA 2W00A 2A5YB 4JZKA 3QE0A 4PQYA 4QNMA 5F98A 3DZ8A 2OAQ1 2A3RA 1RPZA 2HV8A 3CPJB 4QGAA 3I62A 1FQJA 3W6NA 3NBFA 2QUZA 2J3EA 1ZUHA 1MOZA 1W2HA 2GTPA 4E5UA 5L3VA 1OB2A 3QKTA 1T8TA 4NCHA 4NBSA 5JWOA 4U7DA 1S3GA 2C04A 2OLJA 2AFHE 3B9PA 1G3RA 1S9DA 5J47A 5DI3B 2GNOA 1IXSB 5JCZA 3VKHA 4FN5A 2GWHA 5FTJA 4RD2A 5AJZA 1GFIA 4FCWA 4TLCA 3O8DA 5KDDA 4PZLA 3VR1A 4M9SA 1AM4D 4A8JC 2EU8A 2FZLA 2QORA 3DL0A 1X8LA 2KI5A 3NEJA 4WBSA 2N1BA 1XZPA 2HCJB 4EPTA 2GJAA 3LDAA 3KB2A 3O8BA 2WTUA 4QHTA 5JZVA 5CITA 2OESA 3THXA 2ZRHA 5C2JB 4PPGA 4TMKA 4A4DA 2BOVA 3NDPA 4QKQA 2F55A 2GZAA 1T9HA 2RGEA 2WIAA 4NH0A 5DH9A 3FOZA 1SZPA 4TQ9A 4P4TA 1HEIA 2GF9A 2IK8A 2MSDB 2KE5A 2GA8A 4TYYA 3QKRB 5FUXA 1NMZA 2RH5A 1AA9A 2RHDA 5TVKA 1IY1A 2QBYA 1NBMD 4Q4LA 1IY0A 2DY1A 2IC5A 2OO7A 1HQCA 4GSYA 4IEEA 1M1YE 3GLIA 1PUJA 4A8JB 5B58C 2F9LA 3QUSA 1J8MF 3KX2A 2ANBA 4NU0A 3JVUA 4DLZA 1TU3A 3BIFA 2D7CA 2ZU0C 3LW8A 1OH5A 2ATXA 2ZRFA 1N5JA 3GCGA 3K9LA 3I4LA 3UIEA 5ELXA 2D2FA 3DDCA 4CRWB 1G8GA 1SQ5A 5DLQC 1NJFA 2R6GA 1OT3A 3ADDA 4ARZA 3TQCA 1H8HD 1M7HA 1VCIA 5JCPA 3SDZA 3X1YA 5EE9A 1A4RA 1QHXA 1CRQA 3IPYA 4ZIRB 6Q21A 2A30A 1QHYA 4LUCA 1H8ED 2D2EA 4Q19A 1RRFA 2BJWA 1ZM4A 1YHNA 3DM5A 1KMHA 1YR6A 1XRJA 3K09A 1F3OA 1U9IA 1T91A 2BMJA 4BZQA 2ODWA 3GLIE 2ASEA 1OIXA 1E9BA 1FPMA 4PHTA 5EP3A 5GVSA 3I5XA 3T12A 1TNDA 2DWQA 1W36B 3UATA 3I8XA 4CIDA 4F91B 2NOAA 4Q4AA 2CHGA 3QNUA 2ZREA 2NO7A 2O8FB 1R4AA 2J41A 3V4FA 1YRAA 1RVDA 2DWOA 2QN6A 2WPDD 4IVPA 3SYNA 3TBKA 2GKSA 2DYKA 4HAVA 4Q48A 1JXOA 1E9AA 4A0GA 4BLTA 2WJIA 2JLWA 5B2ZA 2IYXA 4KU4A 3QVUA 1EFCA 1AKEA 1L4YA 2CBZA 2P2LA 4KYIB 4OI1A 1IOZA 5FTMA 1JR6A 4DSUA 2JCSA 2WV9A 4BFYA 4XVRA 3ECCA 2V9PA 3CR7A 1GNQA 2BEJA 3W5JA 3BJIC 2B7CA 2GJKA 2W6IA 2VSOA 2ZI4A 1U99A 1XJ0A 3EXAA 4D25A 3RYTC 5TB5A 1ZYUA 4MGZR 3K1JA 1UKVY 3IQWA 1R0WA 4LJ4A 2JLUA 1EWQA 4KXFB 5BQ5A 2O5VA 3Q5EA 4OJQA 1NRJB 1F2UA 1XMIA 4PAOA 1A2KC 4PPQA 2BVNA 4BLOA 2IS6A 2P6NA 2G0NA 1UBEA 2GF0A 5E95A 4LHXA 3CF2A 3EAQA 1KI1A 4IJMA 4X8MA 3L8ZA 3DPUA 2P67A 3AVOA 3IO5A 4OHZA 1U9IC 5C46F 2ZRDA 2QRNA 3U7HB 3SFVA 3QKSB 2ZRGA 2HYIC 1CULC 1RRCA 3PENA 1CLUA 1OSNA 3SS8A 2FGJA 4C2UA 1BIFA 3CPHA 3F5FA 1Z47A 2OCYC 3CPEA 1EWRA 1R2QA 1YJ5A 5J4KA 2D06A 4QM7A 3MAAC 1II0A 5LD2C 2XNDA 2PL3A 3L0SA 4UJ3A 1U8ZA 3NG1A 3VR4A 2FEOA 4ASUD 1P75A 3CX6A 1P72A 1Z22A 2ZRLA 2ORWA 4PHHA 4B47A 3LLMA 3H1TA 2VP0A 2YC2C 2VO1A 3RS4A 2CE7A 4W5HA 4AURA 3UPUA 1TQ4A 1G8HA 4P0TA 2ZR7A 3E5HA 2XZLA 3LXXA 1N5IA 2CNWA 2IYSA 4I1SA 1FNNA 1FP7A 4Q7MB 1ZBDA 3TSOA 1R7RA 2YV5A 3TUIC 3UXMA 1CJKC 1DG3A 221PA 3MJHA 4A2WA 4US1R 4PSVA 4A82A 4UNSA 1E99A 5EXPA 4KLZA 121PA 2VHJA 1T6NA 5AJYA 5J4HA 4TMTA 4TL9A 1FP6A 4FMDF 5KDLA 4IVRA 3SZRA 4LBWA 3TJZA 2WHXA 4C4PA 1W0JD 5DYGA 4JBYA 5KPDA 4L9SA 1S3SA 2IYYA 3GFPA 4HDQB 3A8TA 1MO5A 5C4MA 1VKJA 2DB3A 4JBWA 4OK3A 2C78A 2F1JA 5IF9A 5K8LA 3QJYA 1DARA 4QBFA 3Q8XB 2WWYA 1AGRA 3BXZA 4WZBE 3THOA 4Z1MA 3H4MA 2FH5B 3LA6A 4TMXA 4WIAA 2BKEA 3WMEA 3NXSA 1CJTC 3VNVA 1JB1A 1XF9A 2GCPA 2UZIR 2IUTA 4IXNA 4CDGA 1Q1QA 4BFWA 4M53A 1KK2A 3QEJA 1SVIA 4V0LA 3VX4A 3AKCA 3VFDA 3I3SR 3ETLA 4M8NE 1N2CE 4YXWD 1E9RA 2ZXUA 1X3SA 3RAPR 2QENA 1EG7A 1MO3A 2ZJOA 5BXQC 1KDOA 5FL7A 3PCRB 4AD8A 5AUPB 4AI6A 1R5OA 1GM5A 1E1RD 1LY1A 1KK3A 3RS2A 4UKDA 2FX3A 1RIFA 3U3KA 3B78A 4PX9A 4C0JA 3AVXA 1JECA 3GLGA 4Q02A 4QJ4A 3MGCA 1B0UA 3GJ7A 3N70A 4DLUA 4FMCF 4FMDB 3OF5A 1KI2A 1W47A 3NC0C 4F4JA 1KHTA 3QKUA 4Q7LA 1LW7A 2QPOA 4KFUA 2QT0A 1HUQA 3D6TB 1BOFA 1QHIA 4MYCA 3CO5A 3UMFA 2Q3HA 4JJKA 4IOKA 1T3SA 2FF7A 4V02A 1KO1A 1Q3TA 4PC7A 3AGQA 4NCIA 3EA0A 3HJNA 2A5JA 4FIDA 1NIPA 1KSFX 1OJLA 3DMDA 4HLDA 3SHWA 3IEVA 2WJGA 1KNQA 4G5GA 1W2GA 1WDTA 1JPNA 3K0FA 3UG6A 1NN3A 3G5UA 4N3NA 5FI1B 3ICEA 3HPRA 2W83A 3GLGE 1CR4A 4LGMA 3BB4A 1P9WA 3NH9A 4TQAA 2D3WA 3M4YA 5FUYA 5JWHA 1DO0A 2IYLD 2BEKA 2PEYA 1WQ1R 5CM8B 5AJVB 1G3UA 2CL6X 4TL6A 4URWR 3L0IB 3P4YA 1XBTA 1NY6A 3KQKA 2IXFA 2J9RA 3QBTA 4B48A 1W36D 1ZD1A 1OIWA 3AQ4A 3CZPA 4PC1A 4Q9IA 3QY0A 2ZJZA 1RJ9A 4BLPA 4MKGA 3UG7A 1P7CA 3TNFA 4D4MA 3ZDQA 2QAGA 1AKYA 1C4OA 2RAPA 2IL1A 4N0DA 4F4IA 1G7TA 3A1WA 2EW1A 1GIAA 2CJWA 2XGJA 2AD5A 2AKYA 1SXJA 4S2EA 1P4SA 1NN0A 1HYQA 2X19A 1VDZA 4LPSA 4MRPA 1OKKA 3CH5A 1WP9A 1KDTA 4I99A 1GOTA 3NH6A 3BH0A 3AB3A 3SBEA 1FMJA 1RZ3A 2JLXA 4OHXA 5A4JA 3VKWA 3M1IA 1D5CA 5B57C 1U8YA 1GL7A 3K70C 4B6EA 3MWKA 2W2VA 1XXHA 3EIEA 1A1VA 1XPOA 1J7KA 1E0SA 2F1HA 1UADA 3U7FB 3UMSA 4JLJA 3VMFA 2QZ4A 4A0HA 2REOA 1JXMA 2WMNB 2OILA 1SXJE 1Q57A 2YNMA 2IX3A 4A2PA 2QL6A 4ESHA 4GZMA 1GILA 4AYXA 4ACAA 5A5GA 2XB2A 1XEFA 2ZE8A 3TSWA 2PT7A 1HE8B 3TMKA 4DC9A 4IRUB 1AS0A 3RC8A 3NIBA 1VG1A 3EPHA 2AR7A 3KDSE 4HZIA 1MKYA 2AX4A 1I4LD 3KL4A 1XXHE 4KHZA 3GLFB 4RD1A 3LRPA 4XIGS 2QAGC 4EUNA 2XZPA 4O3MA 2PLFA 2ZJBA 4TLDA 5AJXA 1SKQA 4DSNA 2JLZA 2NIPA 2EFCB 1ZM7A 1P9NA 2H17A 1QF9A 1EFUA 2FJUA 4B44A 3BE4A 5FOTA 4CT5A 3B1ZA 4JLVA 1CR2A 1GWNA 1SXJC 3TE6A 3KTAB 1G19A 5CJPA 4AKHA 1UEJA 5K8UA 2BM1A 1N6LA 3SFZA 1XPUA 5CIWA 4FWTA 3TSZA 1SULA 2GCOB 2XJ9A 3KUCA 1Q12A 4GRAA 1M74A 1UEIA 4DSOA 4ZDKA 2IYUA 1ZIPA 1SHZA 1E2HA 4ZKDA 4A92A 5IHPA 2G83A 4LYJA 4QM6A 1RJ9B 4JLKA 1L7VC 1MT0A 1ZJ6A 4B74A 1N6OA 3T06B 3A1TA 2K5UA 2QEQA 1ESMA 2BM0A 3EWAA 4EPWA 1HH4A 1PZNA 2OCPA 2WPDA 2BDTA 2VP2A 2W2XA 2WWWA 3B9QA 2H5EA 3LWNA 5JRZA 2J0SA 2DBYA 1OFTA 3GFOA 5EE0A 1JBKA 2CVFA 2W0SA 2AHOA 3I1FA 4K46A 2GXSA 1SHKA 3FDIA 1I2DA 2JJ2D 2RB4A 3C7KA 4E22A 3X1WA 2ZEJA 3OFNA 2J0VA 1QVRA 4XWAA 2QRZA 4F38A 4LYAA 1TF2A 4YDSA 1M6NA 4PPFA 1PLKA 4LSGA 1WRBA 1KMQA 2ZRMA 1G8FA 4Q4HA 3IO3A 5TMPA 3LXRA 5GJBA 5AUOB 4NZYA 4K81B 3KXKA 1XXHB 3NTUA 1MABB 1VYUA 4BASA 3K0EA 1KK1A 3NHBA 2XITA 4P3YA 4HB0A 3BFVA 4QBGB 2GBLA 4QRHA 4CVNA 1RKBA 2G1KA 1GL9B 2X77A 1W1WA 3PEVA 4R71A 3IBGA 3PITA 4PSAA 5CYOA 1NLFA 1QBKC 3KXIA 3KJHA 1GSIA 3OESA 2IA5A 1VIAA 4KITB 4MRSA 5DN6A 4ZDJA 4EFMA 1OLOA 2ZI3A 3WRYC 1FMLA 3DOEA 4FCTA 2IYTA 4RD0A 2VP5A 5GADl 2ZR0A 2Q3MA 2HEIA 3HYRA 4C2TA 1Q44A 1R0YA 4MRRA 2OCBA 1E2IA 4YDHB 2ZVPX 4AWXA 4E09A 1KJWA 2PJZA 2ORVA 4KV9A 1WB9A 3FFAA 1E2KA 3WNDA 2ZJ5A 2WMOB 4TLEA 4MA4A 2VHTA 4CEIA 4DIEA 3FMIA 4DEXA 4LV8B 5DI9A 3WP0A 3GFTA 4PC6A 3MWJA 5TXGA 1E2EA 2ZTSA 1OPXA 4TMWA 3C5CA 3SJBA 3U4QA 5FUWA 5F2EA 2A5GA 2QGNA 1Z6AA 4BFVA 2RGBA 2YZ2A 4DSTA 3B85A 4DLWA 3IUYA 1OXXK 1E9SA 4K8OA 3IKJA 3HU1A 5LB4A 3THYA 1D6JA 4Y0VA 1QG2A 4CEHB 1HT1E 4PZZA 1FX0B 2P3SA 1I4TD 5AUQA 4AKEA 4OJKA 2GBLC 2PZGA 3MJRA 3CB4A 3NHAA 5FPTA 2XTNA 2HUPA 3CIOA 2QA5A 4AC9A 3ZVMA 5EUQB 1W0JA 3TK1A 4FI3C 4L16A 3I92A 3AF4A 2ZUDA 4M22A 2LCFA 4EKDA 1E2PA 5GJCA 2B6HA 2QQ0A 1WE2A 1KI6A 2O8DA 2E9SA 3J81k 4KSCA 1NL3A 4NL4H 5FOSA 2Q9AA 1VHLA 5AJWA 3KQNA 4P31A 1ZP6A 3CF6R 2HF8A 3O47A
chains in the Genus database with same CATH superfamily
3BXXA 1SUFA 2OZLA 1Y54A 4L02A 4NZNA 1KJZA 4QOFA 3LWDA 1B8PA 3AOGA 3DDNA 2E4UA 1HZOA 2O8CA 1E1RA 2QYOA 4E7OA 2OT3B 4S2KA 1LDMA 2ZITA 4RY2A 2RCXA 3LM8A 3S44A 3AL3A 2MSCB 5AD1A 2BJHA 1KZYC 5BOVA 5JYDA 2A88A 3E81A 3QE4A 1YZNA 5J2UF 4TUYA 4BO2A 3KWJA 2M7VA 3T9CA 4DHWA 3IB6A 3GOHA 4EJ2A 4MN5A 3OX1A 1CR0A 1HURA 1U7DA 5GZ3A 3BULA 5TR9A 3UPTA 8MHTA 2Q5CA 5EKDA 5IXSA 1C7EA 4Z54A 4D8WA 5ADVA 1H2RS 4ENTA 1QIKA 4K9NA 1J2UA 4Q9LA 1B0AA 1Q0TA 4PBTA 1H66A 3EZGA 1DC5A 4FCVA 2CHVA 4D0SA 1NYLA 2V7TA 3LL4A 3QIVA 4BBUA 1AN9A 4R2HA 2H0AA 3BRWA 1VSVA 1HFKA 2F7SA 1V7QA 3ABSB 2O7RA 2EL7A 3FVTA 2R2GA 4YJGB 1WMSA 4OQDA 2IP1A 1QU3A 3U49A 4TLAA 5HWVA 1DP8A 4FP9A 3ERCA 5LYYA 4I5IA 3DDUA 3DAGA 1G6OA 1UT8A 4JLOA 5ALHA 3B3QA 4KNYA 3RNOA 2R65A 4I9GA 1UQTA 2O52A 3GJQA 3EQ9A 3QP2A 1VG0B 4I0WB 4B31A 4INAA 4ON9A 1PJZA 3U5ZB 1LSWA 4NULA 4DT1A 3KCNA 2IUUA 1VMEA 3N5CA 4LCJA 1OASA 4YWHA 3O8QA 2O7QA 3T7CA 2Z2JA 1TM1E 3V00A 1N4DA 4YJKA 5E8RA 1KPHA 2W6ZA 3L8EA 1L0BA 5EA2A 4FUWA 3LWBA 3TLZA 2UZ1A 5LZ5A 4W6ZA 3WGTA 1Q1BA 2GJ9A 4NQZA 3OIGA 1EZ1A 1EROA 1KGFA 5LB2A 3K96A 2VUUA 1XVIA 2P5TB 1N7GA 1U0LA 4YUAA 1Q2UA 4TV8F 4S2IA 1ZU4A 4HQRA 2VOJA 4YPOA 3DM9B 4RPKA 3KBBA 4R5MA 2G77B 3C3EA 1XI2A 5KNCD 1NBWB 2OVBA 3OCWA 4WN5A 4CUJA 2V54A 3FC7A 4AI6A 1RFLA 3D6AA 4AJLA 1XUOA 1P91A 3DBVO 1NYYA 1VSQA 1SKOA 1KDSA 3WBFA 1CJFA 2XUIA 4YP7A 5IRCD 3SEQA 2BTOA 4DR7B 4RD3A 2J3JA 1XP8A 4I6JA 4URFA 4YJHA 3CKKA 3KD3A 3R0ZA 3K72B 2IKQA 3P9QA 2FAXA 3EGDA 4TX1A 4AMVA 4FE3A 1NNEA 4PWZA 2CLSA 1WQ4A 3LX5A 3TG8A 4NESA 4TGLA 4CR7A 3K71B 5FDSA 1JAYA 2WFAA 3UO8B 3NAZA 3W90A 4KC0A 4RA6A 2FSVC 4UCXA 2BKUA 1GUYA 3U3RA 3GVHA 3ZI4A 5FEMA 3UGTA 1QLWA 5DXAA 2Y1GA 2EJUA 1GKIA 2NSYA 3RF6A 2NPFA 5E6UA 2HJGA 4MKFA 4NICA 3SIXA 3ONNA 2WJJA 3ZQ6A 2FWPA 2VDOB 4X1YA 2G17A 5TQ0B 3ACDA 1JNYA 3WGKA 1TAUA 3IEUA 1Q2PA 4S2LA 1WB6A 3GZNA 3K0FB 4LJ9A 1Z17A 2C98A 5DFYA 5FPKA 1ECPA 4OYLA 1PQYA 1LNZA 3MB8A 3T4TA 4Y7PA 2R6AA 4O5AA 2OQRA 5M34A 1U3FA 4MDZA 1P2UA 2PS3A 3UE3A 4UOZA 3GH3A 1CUZA 1W5SA 2C31A 4RKEA 4OA5A 1Z0ZA 4RZ2A 1G16A 1QIEA 1MU0A 1PE0A 4GOKA 4M98A 2OFOA 1SUAA 3ES9A 2GXUA 5DM70 2I6TA 1SR8A 4WZAE 2IP2A 4HY8A 4R2LA 4FYPA 4GR4A 3WBKA 1XXLA 3KO6A 2VUHB 4RZIA 3E9DA 2MYNA 1ZQ1A 2J0UA 3ONWA 4QULA 5HW0A 1R0XA 3C4JA 3BH6A 1H5QA 3GZJA 4B3TB 1GSWA 4C2AA 3D1JA 4UEJA 1XMOB 2YINC 3KAJA 1HV8A 4MV4A 4B76A 1IDN1 4PGHA 1H9CA 1XGIA 1GSHA 4CLRA 1NLZA 4O1HA 2R7MA 2W2OA 4Z9BA 2FFQA 1H3QA 4JF4A 1HT2E 3L6OO 3LCEA 2CB9A 3E84A 1C7IA 2BFPA 4LXXA 3F3SA 1Z25A 2OCAA 1TVMA 4KN6A 3QBVA 5NLLA 4F4HA 4U5QA 4DPKA 4Q6WA 1N9GB 5JEEA 5HDBB 5I5EA 3OLVA 5IC6A 4L7QA 4RTKA 4FPXA 4C4RA 1NBIA 4GMFA 3D2LA 2W2QA 3ZBTA 3MF4A 3DMTA 3VHXA 3TL2A 1LVGA 2VJMB 3GLSA 2Q9NA 5EFOA 1JHAA 3TYXA 2BMEA 4YP5A 4J91A 1P2FA 2YXPX 3LBYA 3GA5A 3GRPA 1X1CA 1Z7BA 4ZVSA 3E9MA 1FMFA 1PJRA 5A8BA 4AJ1A 2JF0A 2H2HA 5FBZA 3FOCA 4O7DA 2PR5A 4WKCA 4O4LF 4EX7A 3BFFA 2QX9A 4D1YA 1KY2A 4EV4A 2ENUA 3X2EA 4X00A 3UYLA 1Y37A 3M9WA 1CJUC 1DQSA 3I12A 1T1EA 4MOWA 1OYWA 2AS0A 3ITAA 4HN2A 1WUYA 2I55A 2WWHA 4DEYA 4MQFA 3P5SA 2R6CA 3COWA 3VPAA 4BQOA 5E1MA 2AE1A 1H65A 2F1RA 3OECA 1JWBB 4HQAA 3OQBA 4L75A 4OQ4A 2P4QA 4HK4A 2C9YA 1UEXC 1LTKA 1X94A 3DLCA 4A6PA 5TGFA 1L6RA 1FFBA 3VR4H 3MBIA 2OV2A 1GPKA 2W1RA 4CQLA 1S0WA 5F9HA 4V0ME 4IBOA 1GQYA 1MDFA 5HF9A 2NXEA 4Z4HA 3DMNA 3N75A 3LEZA 1XEAA 2RJNA 1E59A 4TV9B 1N2ZA 2HRBA 5JT1A 3WNBA 4HUQB 5JZSA 3E7PA 1MB2A 2HDOA 5JMWA 1Q2QA 4EFLA 4D3YA 1YZLA 2YJ6A 3O90A 4LK2A 1XRMA 1YF3A 5I45A 2AZXA 4ETZA 2Y76A 2LPMA 3MR0A 4Y7CA 3GLHB 3MZDA 5KYUA 4MQEB 4AMZA 5I4CA 2B7LA 2GYUA 1P2BA 2QJ7A 4EPXA 2I1VB 4G9EA 2GKOA 1XJ4A 3BW6A 1IH8A 3HXLA 1E2BA 2JGKA 1XZQA 2AI1A 3NHFA 1GNSA 1K9SA 4FQ7A 1Y4ZA 1B6GA 3OH8A 3OQHA 4YLYA 4FFBA 3EDOA 3KR9A 5T3UA 4R1TA 1ZNXA 1K08A 3HRIA 1K54C 3AUTA 3SEFA 4WLOA 3WHKA 2QZZA 1QUFA 4W4TA 2HV1A 1E94E 3I9OA 3AF3A 2X14A 3QLUA 1EXDA 4FN4A 2PX3A 4PMAA 3KIPA 2P9VA 4N03A 1A5TA 4ARCA 3U44B 2XRNA 1IAQA 2ZIEA 2I9KA 3HDTA 4GOND 2VRBA 4TTVA 4ARIA 4Q3BA 2XD4A 1BMFD 9LDBA 4OGWA 4CEJB 4LI0A 1AZLA 4BE7B 3H1PA 1E9CA 5D1HA 5DX1A 2FP3A 5FL3A 1SH7A 1JMVA 2VL7A 1ZGAA 3B3GA 3ILSA 4DXAA 3RFTA 5JD3A 4GEKA 1EQAA 3OA0A 1Y5RA 4BFUA 3KOMA 3AM3A 3EEAA 1M1ZA 1QNLA 2CLMB 1LPAB 1KYIA 4S2MA 5K6AC 3DDOA 5A05A 1NBAA 1SHTX 4YJFA 4ZYTA 3BGIA 3IYLW 5E1DA 4DRYA 2J45A 5AOAA 1Z0KA 1BKDR 1IJBA 3A1CA 1UM8A 4DADA 4YNRA 1YQGA 3LC7O 1ID1A 3FCUB 1GUAA 1MABA 2QI9C 2UVDA 4KUGA 3WL7A 5GINE 3QYJA 4PF1A 1JKJB 3IUMA 4D26A 1YKFA 4YMVA 1Q20A 1QMEA 1CUBA 4PNPA 2TMYA 4G5QA 4MPJA 3ZJUA 1H2YA 1CZNA 3O3MB 2RHRA 1YDEA 2HDWA 3P9YA 1JKFA 2V20A 5KU1A 4E2FA 1SCNE 4IM7A 4ZRMA 3E3OA 1ZINA 4BNGA 3EIFA 1NV8A 1ESDA 1PIOA 4X1LA 2JA2A 5HKBA 5FV4A 3PVZA 5EP4A 3M2JA 1MZUA 5KWVA 3FFBA 2IYOA 2ZJ4A 2F00A 4LXQA 2DCUA 1PLJA 1ESEA 1FXSA 1XQ6A 2XUDA 3OCNA 4F3TA 2XUQA 1NVBA 2WD8A 5JJKA 3C1AA 4N01A 4P53A 3KYZA 4I3HA 1M2VB 1MHPA 2UYQA 4XYGA 3IFSA 1L0GA 3PB3A 1I4OA 5E2HA 4RTNA 3I04A 2VT3A 4NTZA 1JIKA 4KGXA 4JR0A 4FVTA 3I9V1 1BQ3A 2P4SA 1M73E 3RF7A 3ZYTA 3DVAB 3R6LA 3RK1A 3V3TA 3BWBA 4YJ2A 2P9JA 4NECA 2PX0A 4K9RA 2XZTA 1F8XA 2PX2A 2K2QB 3D8UA 4LF6B 1QORA 1Z08A 1H0RA 3I8SA 3OD5A 4L4SA 1WXFA 1TRKA 1FFCA 3DMPA 1XCOA 4A2CA 2ID7A 5BYBA 2VZEA 5L3QB 2GDJA 2GO1A 1I3OA 1NOJA 2I3BA 1UK6A 2Z9CA 3L7BA 4IQ0A 4FDTA 4IIUA 3HUFA 4KAFA 1NZOA 2EG5A 3GJXC 1V47A 3A58B 2RCYA 3D8HA 1GT6A 4DMHA 4MV6A 2ZLBA 1SHJA 3KPJA 1BMFA 4HAWA 5AQBA 2FWRA 4J9VA 2B0JA 3ABQB 1KHHA 1CU1A 4WDRA 3R3HA 4P6ZM 1SBTA 2XQFA 1C0LA 2C4NA 2J3EA 1ZUHA 2OP1A 2UUCB 2GTPA 2V1ZA 2IPXA 6REQA 3RO7A 3S4YA 1XZCA 4EUZA 2Y4NA 3KSGA 4M9SA 2EU8A 2R66A 2XE4A 1SWWA 2E4XA 4X6UA 1NX6A 4B45A 2WTUA 2OESA 4HBTA 1YDWA 2JG3A 1JEQA 4QDJA 2ST1A 3H8WA 2AZ4A 2DY1A 2IC5A 1WU7A 4NG5A 4XRRA 4DNOA 1L5HA 1X1BA 4P36A 2D2FA 3KJZA 3W8FA 5M1AA 4NV0A 1E3JA 4P7JA 4MWOA 5KQLA 1V39A 1QHYA 4FBGA 1H8ED 3VPFA 5FASA 5DGTA 3AOEA 3DHNA 1T91A 4IX1A 1E58A 1JDSA 3MMNA 1O94A 4Q4AA 4B84A 3QNUA 1R4AA 4FGLA 1HE5A 1RXCA 3W2EA 1A8PA 3ZHXA 3SXUA 1XZLA 1JVSA 3S1LA 1OLXA 1HYHA 5EJ6A 2JKRM 4J2OA 1ZN9A 3FJ1A 2G8NA 2H9AA 4QNNA 1FLAA 4DLLA 3L0ZA 4M8KA 1ZJYA 1REQA 3IF6B 2QLBA 3CF2A 2BEUA 3EAQA 4PFKA 3JAWA 4YMIA 4OJMX 3DOIA 4NEGA 4UM8B 2FGJA 3PT9A 3CPEA 2D06A 3ZCRA 4QM7A 1XKTA 2ZIXA 4PN7A 2Y2MA 1GUFA 2YC2C 1AMOA 2ZB3A 4P0TA 2HPBA 1XRNA 3ROQA 4BL5A 2QX7A 1O6BA 3D7SA 5CHMA 3GJYA 3P2KA 5ED4A 3ZG8B 4FZJA 2ZIFA 2PS1A 1AO3A 3R4VA 5KDLA 3H7WB 3TLEA 3HFSA 1QIHA 4WRRA 3BHNA 2HY7A 1CVLA 2A3UA 4RM3A 1STOA 2C1XA 1PR4A 3TMAA 2MSKA 1TVKA 3V5MA 3G8CA 3CKMA 1Y1RA 2PL5A 5K6TA 3SKXA 2UWXA 4BWIA 1BHQ1 2VYCA 3VPCA 5PGMA 1G98A 1EG7A 5A3JA 1KDOA 4OUDA 1GM5A 2VHYA 1H4VB 4NAHA 3GV0A 5ICEA 2RARA 1KJJA 2MYPA 5DLDA 1HUQA 4I1IA 4AZ3A 1WNFA 5AXCA 5CVCA 1T3SA 3U62A 2FF7A 3ZVWA 4X6YA 2EXAA 2DX7A 4MBKA 2JAUA 3SHWA 3E7XA 3IEVA 3OQVA 1QIGA 2WTMA 1QS0B 1AG9A 3BB4A 1H0MA 2VYND 4PHCA 2YIVX 3K4QA 4F4FA 1U1FA 4OP8A 3PA6A 4OB7A 3R1IA 4Y0TA 2ZLYA 3CJTA 3H18A 3TDMA 2RAPA 5JROA 4JEHA 3RTDA 2AKYA 1CDEA 3NYRA 4M3KA 3FFTA 2DQKA 1X42A 3AR4A 4M38A 3NH6A 1ICEA 1OT9A 1YIOA 4OHXA 4BYMA 1X13A 5IYZB 1OQAA 1K4FA 2W2VA 3QX3A 3JQBC 2JBAA 4A2PA 4YBRA 3GRUA 2BSXA 2ZUEA 5BUSA 2WT4A 3TSWA 3TMKA 4IRUB 5LP6A 1MT3A 5TGZA 1RYDA 4RD1A 4EUNA 4TLDA 4DSNA 5IG2A 1QYXA 1SXJC 4M0FA 2Y05A 2P04A 1R00A 4ZEXA 4MTCA 2Z8ZA 3RTAA 4JF6A 5BW5A 1SHZA 1UWKA 1BDIA 4DJ2A 2ECPA 2INGX 3DMHA 1HH4A 3G0BA 2BUBA 3CWCA 2G7ZA 1UWNX 2PUCA 2C54A 1UBLS 4OQ0A 2WTXA 1HM5A 1QVRA 3HY4A 2W27A 3MXRA 3IO3A 3LXRA 1OZFA 1A77A 1U9CA 3NVMB 3B3AA 4QXPA 1QH1A 5C7IO 4UQIS 1VIAA 1J49A 3GOQA 1BVUA 3RUHA 4OQZA 4HNUA 1FRQA 4UHKA 1R3UA 4DVJA 3LBFA 3T0GA 3UO9A 3ZE2B 2AR9A 3H5NA 2GBPA 1F0YA 5HUQA 5DTRA 3B85A 4UBMA 2WK1A 1D0SA 4K8OA 2XE8A 2YZNA 3SC4A 1ZJ4A 4XT2B 3CYFA 4J4TA 1FX0B 4Y3IA 2M1CA 4QPDA 3RKRA 1NW9B 2P2DA 3WLJA 2WJ4A 4EKDA 4EO4A 1XNHA 1JQKA 1T2NA 2RAVA 4QEDA 3QVLA 5KMWA 1AKUA 3QF4A 3H9WA 1VHJA 1E6KA 4YRZA 5CA1B 2ZJ0A 3VI4B 4JP2A 1SN7A 3L2OB 4Q6BA 3UPPA 2ZSHA 1QV9A 4BEJA 5TLSA 2HF9A 1D2NA 1OVMA 4FEYA 1Y6ZA 5CAEB 3R9KA 1MB9A 2EP5A 4WVLA 4I2NA 1TS7A 2DM6A 2WSLA 3CN9A 4A91A 4UFPA 1PDWA 2I71A 3TO5A 2PU5A 2O2ZA 3O03A 5HQJA 3K4HA 3KO8A 1R5BA 3N2GB 3RJ5A 3K8YA 5IKMA 1EIWA 1QHHB 1ZCZA 4V0KA 2EGHA 2BTEA 4GFDA 1VETB 2VYNA 3KVVA 2H4YA 2QHXA 3Q12A 3QH4A 4MMZB 3VR5A 4RH0A 1ZOSA 5JAZA 1IAVA 4AZ0B 5FF9A 3M4ZA 4O2BB 4D4JA 3D43A 4HLUA 4B4VA 3EQ8A 4PLCA 1P2VA 2J31A 1STZA 4CHTA 4N9QA 3TI7A 2ZRPA 2FYTA 3T4JA 3KQMA 3T1QB 2A1UA 4U02A 4P4LA 5LJIA 1TTHA 5DLEA 5A2QA 1IXZA 2I80A 2IF2A 1WMEA 3EAFA 1B41A 3BRCA 4X25A 5FTWA 5TIIA 4MBHA 3VDXA 2M1XA 4FJ0A 1VYHA 2NT4A 2HN9A 2Z6QA 5DTMA 5ENZA 4EKEA 2DBQA 4PO3X 3TZKA 3KV3O 2IYNA 2OWJA 1NI3A 5B4TA 2Z2KA 3ZGZA 5C1IA 4WLEA 4JYZA 4OQFA 1M1YB 2H11A 3TQTA 3UB2A 2IHVA 3GD5A 5EVIA 3LBAA 1U0BB 5B2EA 3G2MA 1XD9A 3VU0A 1P4HA 1PT7A 1RPAA 2MT9A 3N2EA 2PUJA 3RUFA 1WX1A 2FGKA 4MROA 1NVVQ 3GELA 5EZ6B 3VZDA 2YASA 1RPNA 1V9CA 2ZL1A 5JBNA 3GLIB 1CUSA 2EZ4A 3HLTA 3A3FA 3K8QA 3VDQA 2IYZA 4CKWA 2LDXA 1Z0UA 1DJNA 2SICE 3GPCA 2O3UA 1P97A 3KHUA 2YMPA 3RS8A 3WSVA 2JGLA 3HLFA 2RHOA 5AXAA 1GDHA 2VYQA 2EZUA 1N3YA 3HM2A 3TZHA 1I14A 1MX3A 4X1IB 2D5BA 2RHJA 1UKEA 4PVCA 1LH0A 2ZJAA 5KOJA 5GIOE 2FPLA 1QPGA 2P62A 4OBXA 5D85A 3QX8A 1ACLA 3LGXA 4BNDB 1MVOA 1MJGM 2QMIA 4LJKA 3FWLA 4BDTA 2QHKA 2B5OA 1POXA 4OXXA 4PCAA 3R6GA 3W5UA 3T5TA 4GRIA 4GZ6A 3AH8A 1F2UB 1ZA1A 1J1UA 4E0BA 1BWSA 5DHUA 5CGZA 2QMYA 3QGMA 2XKBA 1Y4DE 4Y9SA 3LH5A 1CUFA 4MEJA 4JEMA 1KEUA 1ZLXA 5FX2A 5FAPA 2XZOA 5EJAA 1EHCA 3DZBA 3DBRA 2P77A 3C7UA 3UHOA 3V1UA 1U2ZA 2KB0A 4F5WA 3ET5A 3ADCA 1M2JA 1Q0UA 2XLBA 1PL0A 4XWYA 3S1SA 1LRKA 3UMJA 1OREA 2P6OA 1YBFA 4M9RA 2IEBA 4EYKA 4AN1A 4YV7A 2BASA 2GAAA 1U0OC 3H83A 3PC6A 3GHYA 1CIJA 3UCFA 5EUMA 5LIRA 1WBBA 1S8OA 1OYYA 3LLSA 1J8YF 2V0NA 4QUAA 4X20A 3NI9A 4D43A 1MWUA 4K9QA 3ZY3A 3WJ7A 4RD6A 2ERXA 4HDNB 4ROSA 3FWHA 2QMUA 1AIPA 5JH7F 1TUIA 4JVNA 1O9HA 1AHNA 3DAHA 3Q10A 3Q4GA 5IJXA 2GA9A 5FI5A 2Q4BA 1L5SA 1MPLA 4LA4A 1LT0A 1U1EA 1GG8A 3AFIA 3ZQ5A 2D4AA 2C83A 4IS2A 2A58A 4R6XA 4TLBA 2HJVA 1W4ZA 5FIUA 3TTWA 3RWMB 1PJTA 4FHFA 3WDSA 2IHYA 4EGAA 4Q3KA 3GY0A 4KCGA 2X8JA 5DK6A 2V74B 4WY8A 1XCBA 1T26A 3FPSA 3AKEA 1Q0HA 3I6MA 4EB6B 2AMFA 1HLDA 5KYYA 1FR1A 4I55A 1DJLA 4IF4A 4I9NA 1ZK0A 1NFQA 5K0FA 3HJGA 2ORED 5IT4A 3OBFA 2HL6A 1BDJA 5LNK1 1M76A 1F60A 1Q1GA 1RWNA 4TYQA 5KNBA 2G3YA 3GH1A 3C8MA 3IHTA 3QVOA 4O2RA 2R8YA 2ZC3B 2ZRKA 3ASZA 5CTJA 4IPTA 4BJ3A 4CI0B 2CL0X 4EMBA 3SMVA 1USWA 5E7IA 1P74A 5A4DA 2F90A 4TTRA 2FPXA 4R1UA 3T5AA 3KE9A 2V65A 4MDYA 4X5OA 5FBKA 2G88A 1L1QA 1WLSA 3RQIA 1CQAA 4WV3A 5GONA 5HEKA 4JB0A 4LOHA 3T7DA 4XARA 3P0RA 4DXCA 2BL4A 4QSHA 4QTZA 4L0LA 4NEED 4JT2A 1KOLA 4RHTA 5L09A 2V1UA 3P9CA 1IRXA 2JD2A 3JQ9A 4LI3X 4I1PA 3JQ8B 3B38A 4L50A 4BFTA 4IJWA 2NO4A 4HHDA 1XEXB 4R2WA 5EV0A 1U2DA 1O7JA 2DE0X 4IW3B 4K7JA 1XZBA 4Y2SA 1IPHA 3EVBA 2IU0A 3TJMA 1PWEA 5BN4A 5CVVA 4DR1B 4RHYA 4UXIA 3WJ2A 3OURA 4EW7A 1Y1QA 1E1KA 5L6MB 3HCBA 3HVIA 1XDBA 4DA0A 3H8VA 1RADA 3G49A 4O4HB 2W1TB 2IWBA 1DWQA 1G2PA 4CZ2A 4IIXA 4D0GA 4KRFA 5TE9A 4M4XA 4LV6A 2CUTA 3R5SA 3C74A 3FPKA 3L6BA 1VFNA 4ITRC 5KTPA 4D4GA 2FVXA 1R6AA 1FUEA 1JF8A 3AI7A 3BAZA 4OQHA 1OAOA 1XLVA 1KYYA 4ZYUA 2VV6A 5LA6A 1QXSA 4DG8A 2C82A 2QD2A 2OZVA 2NXWA 3RLIA 3PUWA 2JNWA 1FFDA 2YN2A 4RKWA 4LYEA 2FK8A 3FLAA 1U8UA 3R20A 2G2UA 5CVJA 1J56A 4REQB 3ISVA 1TW3A 3DT8A 1H1DA 2HAEA 4X3OA 5A5VA 3GYBA 5LL6P 2GEJA 3NOTC 2HF2A 4ETIA 5AFSA 1NP6A 3IR5A 3IP1A 3ACCA 5B64A 4PXAA 3HJBA 2WYXA 2NXNA 1YJCA 3A70A 4DUYB 1T4CA 1PJCA 3QVJA 1B8VA 1FDRA 2XWSA 2VV8A 3D0KA 1ITZA 4RORA 1CDDA 1Y3BE 5AW1A 1FQKA 1MZPA 1P62B 4EM6A 2GEFA 5AI6A 1O9GA 1QRTA 4IQGA 3B1KA 4KYVA 5D84A 4IZ6A 1I33A 1XRPA 2AK2A 4IEIA 3H42B 3WGVA 2BHRA 1OZHA 4BZPA 4G5OA 3D2CA 2JA1A 1JI3A 5CNMA 5H0IA 2FWAA 3HCCA 5SZKB 2FR8C 2HZ7A 2WP8J 1U7OA 4IUYA 1DV1A 1G5QA 3HBNA 4QRDA 4BX0A 2RBEA 2KW5A 2QYSA 2FXIA 4G5HA 2V45A 4DJ3A 1XFDA 3T61A 5CBPA 3OFND 3ENWA 5KBYA 1JR6A 4BO5A 1J70A 5FDHA 1ODFA 1ESZA 1IZ9A 1M7GA 5AVOA 4RVFA 3WP1B 1FZQA 2P65A 2PUBA 4QHYA 5KZMB 2RFLA 4C01A 1YKSA 1PYOA 2P3QA 5ILOA 1RE1A 5LBIA 1Z0DA 2UYHA 1SQGA 5L7WA 2XDQB 3GEBA 5C18A 3GEHA 1ABFA 4MV8A 1FOEB 1Y9DA 2ET6A 4BO1A 4JUAA 4BKRA 4F3YA 2ADOA 4FOPA 1J8DA 7ADHA 3B1VA 2FSUA 2C59A 2GARA 4TTPA 4A5OA 3E18A 2YYAA 3AXTA 1B3RA 1PV4A 5AVRA 1NVGA 3EQZA 2P2NA 2X6TA 1OX6A 3NHKA 5F6AA 2ZVDA 4UQPA 1GAQA 3OWOA 3OM8A 4RNCA 3NUZA 4KIGA 2AFIA 1TK9A 2WG2A 3W04A 3C5AA 5F2OA 1KJYA 1EVEA 2LWIA 1W76A 4XDHA 3R76A 1EXVA 5HZHA 1UP6A 2Q0OA 1R74A 1ND6A 4XLLA 4PVDA 5E7QA 3OETA 1T0UA 2QROA 3H9CA 4I7EA 4BC0A 2O2GA 3Q88A 2FZVA 1UANA 2VXCA 3FYZA 1EE2A 1XD8A 3IAFA 4GU5A 4U9IS 3LQYA 2EAUA 3MQQA 3E58A 1DINA 3LZDA 1XA7A 4F1JA 3PS9A 1K56A 2VP6A 2AX3A 2FE1A 3M6LA 2R6R1 2QN7A 1RFGE 4AXBA 5HZKA 2RKWA 1Y7LA 3SC6A 3L43A 4BMZA 2V97A 5FA6A 5FQQA 3WZLA 2QE7A 1E2MA 4GKAA 2AYXA 3GT3A 1WHSB 3BRWD 2XY4A 5K0JA 3Q6MA 2YRXA 2ONZA 3AHFA 3DG9A 3DOOA 4MVJM 5K8TA 4BCBA 2IW1A 5UKDA 1DAKA 1U0GA 1ZWLA 1SXHA 2GPYA 2HH9A 2AJBA 5EYPB 1VI5A 3H5OA 2WTEA 3FW1A 1IZ0A 2E4YA 1Y4OA 1BT5A 1P2SA 1WSWA 4CCSA 4ISBA 1D2HA 5F77A 1KI4A 3H65A 2Q1YA 4V39A 3ZHQA 4F5YA 1WD7A 4L4ZA 2H51A 4RFVA 1LJ8A 3DEHA 1JH8A 4EYOA 5F9MA 4EZBA 2R9VA 1T0HB 4DDMA 5AICA 1LJUA 3TLGB 5JVDF 3ZHCA 4BO7A 3DAOA 1EQ2A 2HOQA 2YJZA 1QAMA 2CFCA 3W34A 1IM5A 3JPWA 4N1XA 1D04A 4RELA 4CLXA 5FWYB 2ZSKA 5ALFA 4KQ2A 4GS9A 2V3CC 1K6XA 1MRNA 2J6BA 4LV5B 3ANNA 1T10A 5CB0A 1W9HA 4MITA 2VK2A 3GJ6A 3PHYA 3KZNA 2O19A 5DYYA 2AI3A 3MWDB 1CQJB 2JH9A 3FHJA 4FS8A 5FV7A 1U3WA 3A9VA 2ZTUA 4FKMA 3QYPA 3F6PA 5I9NA 2PD3A 4KLCA 1XROA 2EQAA 4DXHA 4ER5A 5D3QA 2IW3A 3D2BA 1BWQA 4ZPJA 3KZVA 4U8HA 3QUQA 2C8VA 1DT5A 1JDJA 1W5TA 1L3LA 1YDHA 4ZJ2A 3S2IA 1EHYA 3D7NA 4M0CA 2A9FA 3Q82A 4PC3A 2IPLA 4HH1A 1WYBA 4EVRA 3K9GA 4X9XA 1JJBA 2ZIWB 4X62B 4TMYA 3ZG0A 4MKXA 4LVUA 1QKJA 3W6PA 2RKBA 5H3CA 1T35A 4AJEA 4DQVA 1QR6A 2EDCA 4KUEA 3P19A 3IL2A 1N33B 2X4GA 1FQOA 3KQLA 1QJ4A 5AK4A 3TIVA 1ZIYA 3MOGA 3D6JA 4E07A 4XSGA 3EGXB 3LR4A 3RVPA 2JK0A 3IMKA 1L7PA 3TUZC 1YVPA 2HPHA 3GUVA 5LQKA 2PXCA 2Y2PA 4JY7A 1XQXA 5FHRA 2EA9A 3D4FA 3HEMA 4X93A 5T6MA 1JYEA 3AUKA 1CQXA 3KV1A 4YUVA 2I6FA 2OHJA 1PV2A 2W4MA 4HIAA 3SEZA 1X8LA 3H4VA 3C4PA 1YLYA 3WIDA 4A4DA 4P0QB 1NRJA 4MUEA 4JBFA 1T9ZA 2R9XA 4HX5A 2GRAA 1KJQA 1TTQB 3VZQA 4EITA 2JI6A 1PUJA 4RVHA 4CKBA 1QYIA 1TZJA 3U1TA 1TU3A 2IXAA 1Z74A 4Z4GA 4UMFA 2GZSA 2IDJA 4FUTA 2UXDB 4JX8A 3MWGA 4ZIRB 3TF5A 4KO3S 1UCFA 5F1OA 2HJ9C 2QR5A 3II6X 5GVSA 3IOEA 3TSYA 3G8DA 3RTEA 3OWHA 2ZULA 1EUCA 3U4CA 4E5VA 1U3GA 5JUWA 3AY3A 3JZIA 4W5OA 4JCOA 1V1RB 3IDOA 1JDBB 3UMGA 2PLWA 3JQ7B 5IUJC 3CR7A 3AWIA 1EQUA 4MR7B 3NTRA 3FPLA 1R1DA 4KXFB 1G8MA 4ODIA 1UBEA 3GWGA 4CFZA 1E3DA 5E95A 2FQXA 5BRAA 3G13A 3MEQA 4N7RA 2LE0A 2FUKA 4AW9A 2TMGA 2P2ZA 2ALJA 3A11A 3IAS6 4KIUA 1NP3A 2OCYC 4UA7A 3MAAC 3O3VA 3OMLA 4PHHA 2VO1A 1TYDE 3I2FA 5LOVA 2RHWA 3PZRA 2CNWA 2VP3A 4ER6A 3NHZA 1FNNA 2RBGA 221PA 4N9LA 3O92A 4F9TA 1IULA 3L4BA 2ZP1A 3NJ8A 4FMDF 3SZRA 5T4BA 4R8MA 2QTVA 2F1JA 3UGJA 4NOMA 1GQFA 1SCUB 3BZWA 4F6RB 1N2GA 1OXKB 4E3LA 1WCYA 3QEJA 5A5FA 3IVXA 3TEMA 2V0UA 1ST3A 2Q1WA 1YL7A 1JIXA 4RIEA 3ESAA 4B3RB 5FL7A 2TECE 3BFPA 2XT6A 4E46A 5D6NA 1TE2A 3WE7A 3K1AA 3KPUA 1LPSA 1FQGA 1U7HA 4YB8A 4KFUA 2X58A 3CO5A 3UMFA 1MUUA 1J0BA 3INRA 3G9QA 4CXMA 1CPYA 4FIDA 2FN3A 2MWMA 1AQIA 2EXXA 2E55A 3O3OB 2B3TA 2GK3A 4PYQA 5FUYA 3T9BA 2BEKA 1N2CB 1WS6A 2IXFA 4WN3A 2QAGA 2EW1A 4PG7A 1NN0A 1KAEA 4BEVA 3CZCA 2KMLA 5EMKA 2DULA 1KDTA 4D45A 3T4UA 4KNVA 3WWXA 2R3SA 4BCDA 3T50A 3U7FB 2CLFB 2JGIA 2EX6A 5AVVA 4IIHA 2M32A 1FP4A 1KGSA 5BW4A 1X15A 2VJAA 3ADPA 4BNKA 2XT9A 1HE8B 1ACJA 4EHHA 2V7PA 4CQMB 3IJEB 1JMYA 2PLFA 2JLZA 1SKQA 2NIPA 3HJFA 4E2XA 3PFFA 2BM8A 5JQGF 4QPJC 5JASA 4FDVA 1M74A 2XRYA 1QLHA 5HKOA 4JLKA 1JDZA 1MT0A 3N8SA 5SV2A 3KPYA 5CVDA 2XCOA 2CVFA 3SAJA 2P75A 4BLMA 4B4XA 2Y79A 2VNKA 3GG9A 2Y77A 3QP1A 3I0ZA 1CB7A 1G8FA 1E1YA 3QWHA 1QNFA 1FTGA 1GQ2A 2XMQA 3OESA 4R54A 4KITB 2CW5A 1X38A 2MCFA 5GADl 4WELA 2V8FA 1E5LA 1Q44A 1ZITA 3H8JA 1KU6A 3NVKI 1WHTA 3VMMA 1KJWA 3H1BA 5K9ZA 5IAJA 1KMIY 2D6FA 1UDBA 4TLEA 3SJ7A 3NUQA 3K9BA 4X7MA 4PC6A 1NASA 4EJFA 1F5MA 3BCUA 4BFVA 1L0EA 4DSTA 4RTRA 1TM2A 3HU1A 3M3DA 2P3SA 1WPQA 1J2TA 1DCKA 4EEKA 4RVSA 4CDMA 3FVWA 1Z6FA 3OTHA 3ZVMA 1Y7HA 3I92A 1GPYA 3ZY2A 3DYVA 3G32A 4KHPB 2FY8A 1K63A 4KSCA 3AI3A 3O47A 4X68A 3BFEA 5ITVA 3EIWA 4E5SA 1YE5A 4QD4A 2R8OA 3VR6A 3CNEA 5HE8A 3EVZA 1SFRA 1ERQA 4TZKA 4PKYA 2YZ7A 1V3QE 1YBMA 2IS4A 4Z9XA 4BNMA 1HZJA 3OFKA 3T9FA 3A6JA 1OTIA 3IHAA 1T0BA 4KE8A 3RT7A 1JT9A 4UVDA 4JXVA 1OH6A 3TOZA 5ALDA 2WKSA 3NALA 5KSZA 2H4ZA 3LI2A 1BROA 2XUFA 3KUDA 5KQMA 2VNHA 3K20A 1FNBA 4XLTA 1ISMA 4DQ0A 1X1EA 2GCGA 4B3CA 1NMSA 2OCGA 3DOFA 4N49A 2ZC6B 1MGPA 4KYUA 4M8IA 2WZDA 4S35A 2Y71A 2YY5A 1AZWA 4DLXA 2XMRA 1MH1A 4MUIA 4F4DA 2YWHA 1GY8A 1WG8A 3I52A 1FMCA 1K68A 1YC5A 2WF5A 1UMCA 4DQKA 1J9EA 3NKLA 2UVPB 3TQIA 2CEAA 3LYXA 2ZB2A 5IAKA 3PC8C 3M8KA 4RMHA 5TBMB 4BWVA 1RAFA 3N2KA 1C9DB 1OZ0A 3AGPA 4IHJF 2Q4DA 4MCHA 1CJMA 3D3EA 2IZZA 4EELA 3MKFA 4QQNA 2HJHA 1NXWA 2OAGA 1J5XA 3NEAA 3DWIA 3L6RA 4BNIA 1C9JA 1K75A 4KQHA 4CR8A 2DRWA 2QSJA 5IKPA 3TAHA 1P3Y1 1QCCA 3LCRA 4PS1A 3OEYA 3V8MA 1X7WA 1OILA 4D80A 4RH1A 1MB4A 3F96A 1YQWA 3TRJA 1KOFA 4RMJA 3TM5A 1BEEA 3O74A 4FSDA 4Y2RA 1PNTA 4QFMA 1ATZA 4M99A 3AVWA 3KS9A 2JFHA 2RHGB 1A9YA 3VU3A 1ONHA 3SYTA 1PZGA 1TA9A 4JLUA 3AUJB 1CY1A 5G3ZA 4G0MA 2RB5A 1Y3CE 4PIVA 1JG6A 3VSCA 5HXAA 3K1YA 5FQJA 1YRHA 1AZSC 1PR9A 1TIBA 1FJXA 5IH7A 2WG1A 1RM4A 3WLOA 4C4OA 1E1CA 4LYHA 3ESYA 5JPCA 2KBEA 1FFSA 5JXHA 1TUGA 1DAGA 5C5CA 4UHCA 2HCTA 1FS5A 2C4WA 2JANA 2CXPA 2Q6VA 4QT0A 3O86A 2PL1A 4GC9A 2NMVA 1Y8QB 2LIVA 4ALJA 4L28A 2ZS8A 2DR3A 2VHQA 3DLHA 4I4TB 1PI4A 3I45A 3N6VA 3LYAA 5CPFA 4FC7A 2XH8A 2WUQA 3EN0A 4OXKA 4L15A 2QJFA 2VLGA 1OXUA 1FL9A 2RGGA 1S1YA 3FCXA 3T52A 2VEDA 2ZI6A 3FDZB 3LO5A 1XTRA 4YRBA 3HBLA 4DYVA 3NPAA 4W9RA 3N05A 5IEBA 1T8SA 2FMHA 1SA0B 3A2NA 3GECA 2PQ2A 1G7SA