2EWVA

Crystal structure of the pilus retraction motor pilt and bound adp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
350
structure length
343
Chain Sequence
ELKILEIIKEAIELGASDIHLTAGAPPAVRIDGYIKFLKDFPRLTPEDTQKLAYSVMSEKHRQKLEENGQVDFSFGVRGVGRFRANVFYQRGSVAAALRSLPAEIPEFKKLGLPDKVLELCHRKMGLILVTGPTGSGKSTTIASMIDYINQTKSYHIITIEDPIEYVFKHKKSIVNQREVGEDTKSFADALRAALREDPDVIFVGEMRDLETVETALRAAETGHLVFGTLHTNTAIDTIHRIVDIFPLNQQEQVRIVLSFILQGIISQRLLPKIGGGRVLAYELLIPNTAIRNLIRENKLQQVYSLMQMQTMNQTLYKLYKQGLITLEDAMEASPDPKELERM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords twitching motility protein PilT
publication title Crystal structures of the pilus retraction motor PilT suggest large domain movements and subunit cooperation drive motility.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 74
structure length 343
sequence length 350
ec nomenclature
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ewvA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ewvA02
3CPJB 3L0PA 5FUXA 3PEUA 1P2VA 3R9IA 5CYPA 5G53C 1FNMA 1G5TA 1R0XA 2BEKA 3UMFA 2YINC 4QGFA 4HZIA 2ZAOA 1MH1A 3LWNA 3MUFA 3NH6A 4PQRA 1NN5A 2J7KA 1RRFA 2ZS8A 3E2IA 2ERYA 2CE2X 1Q3HA 1EX6A 2CCGA 3PEYA 3AGPA 2JAQA 1KO1A 4MUBA 4B43A 4HLUC 1HTWA 3Q3JB 3TR0A 4PZLA 1W36B 4GI7A 1GZSA 1YZLA 3OAAD 3U2QA 1CEEA 3DEFA 2MSEB 3LLMA 4ZIRB 4KFUA 1K8RA 1D5CA 1ZU5A 1F2TB 3MG9A 2AR7A 2CL7X 1XTKA 2ZVQX 3GLHE 4EQ6B 3Q8XB 3QF4B 3FOZA 1VKJA 3KQKA 2C78A 1F60A 1VTKA 2D3WA 2B7BA 1KGDA 4BEJA 1FQKA 2B8WA 3A1TA 1MR3F 4U00A 5CM9C 5AWFC 4A36A 4HLUA 2F43B 1U0LA 5BN4A 1P9NA 5DH9A 1Z6TA 3KQHA 5FBQB 4GP6A 1ZUHA 3H4MA 2JLUA 4PC7A 5JJKA 1TTTA 5JLJA 2GF0A 3D6TB 5CJ2A 4B35A 2YC2C 721PA 4ZO4A 1H8EA 1VG8A 2C9CA 3A1WA 3IBYA 4DC9A 2ZRKA 4PANA 2GXQA 4R71A 1WA5A 5AJYA 3V00A 4AKIA 3QENA 2QPTA 3CR8A 3Q7PA 3X1YA 2NO1A 3C5CA 5AJXA 1K6MA 1QHGA 1GL6A 3VTKA 1XEXA 4Q1DA 1TL7C 3PUVA 2PZFA 3KTAA 3RNLA 1R2QA 1Z07A 4B47A 3K9HA 1I4DD 2R6DA 2J59A 2IS2A 1T0JB 1RYFA 4P4UA 3PG5A 1PLKA 3LVQE 3T1VA 1KI9A 2CBZA 4TMWA 4Q4HA 4M9XA 5K8UA 1KJZA 1XJQA 4Q4LA 1IY0A 3GJ0A 3BH7A 1AN0A 1QZXA 2Q9BA 4R7ZA 3IBGA 4BFSA 5J5CA 2W0MA 3TH5A 2RGAA 1F48A 1FP7A 3GEHA 5FTNA 5JI3E 2XNSA 5EUQB 1YRBA 1SXJB 2QBYA 3B82A 1KAOA 1YZTA 1P6XA 2O8EA 2FG5A 1VG0B 3BERA 3BS4A 1E2LA 2ORIA 4PHHA 1KAGA 5FL3A 1M8PA 2P65A 3UATA 4FWTA 5ELXA 4JLNA 4NKRA 5E7MA 5BN5A 4KHZA 1XFAA 1XPUA 1KKMA 1QHNA 2C99A 1Q21A 1OFTA 4DUGD 4JKYA 2G1KA 3RDPA 4BLSA 1KSFX 1WE2A 4KCGA 4G5QA 1ESNA 3BFVA 4IDOA 2P6NA 1CJUC 3PITA 4L16A 1GKIA 3KKNA 1TQ4A 1Z2AA 5K8IA 2PZEA 3DL0A 3DPUA 1AS2A 3ZD6A 4PX9A 5KNBA 1ZM3A 4O2LA 2VP4A 4BLPA 3NBZC 1NIJA 1LB1B 4QHTA 3QPWA 4BWYA 3HU3A 5DIFA 4ILEA 1NL3A 2ERXA 4CEIA 4FXPA 4M1TA 3NG1A 4R2HA 5F9FA 5KHOC 4B3XA 4D0GA 4LYFA 2PLRA 4A2WA 2HT1A 4GMDA 1OXXK 3FMFA 5L3QA 4E09A 1ZP6A 3ZS8A 3B8HA 4FINA 4G5GA 2OM2A 2W2VA 4Q00A 2OFOA 3SJAA 3LX5A 5FI1B 4BFZA 2HDNB 3QKSB 2C03A 1N5IA 4GOKA 4TN1A 4W5JA 1T5IA 3VU9A 1FZQA 1FNNA 2ZI6A 3NVAA 3QKTA 2ZR0A 4JZKA 2XSZA 1AGPA 4L15A 5FL7D 4DCUA 1GOTA 4MUAA 2BIFA 3QIAA 1NBMD 2OCAA 2PEYA 1XEWX 2CVFA 1N6KA 4G5RA 1GILA 2EFGA 3UWKA 3B6EA 4YC7A 4BFTA 3PUWA 2IW3A 4JVMA 3BJIC 2GK7A 3AKDA 1G6OA 3QVUA 1EESA 1E2JA 4CEHA 2CXXA 1IHUA 4LJ9A 5J4LA 1XEWY 5DGXA 4AKEA 4PXAA 2ZSAA 4YMTA 3GLIA 4EJSC 3VX4A 2YWFA 4B3GA 2WV9A 4RD2A 1CRQA 3LFUA 2O8DB 4TL8A 1S96A 2XNDD 1AS3A 2ZJOA 1CR2A 1KO8A 3WY9A 2QAJA 4M2LA 4WA7A 1E0SA 1R6BX 4EFMA 4Z1MD 1JXOA 1XMVA 2ZRJA 4F93B 1E9AA 3PEVA 4B6EA 4XTRA 1NF3A 1X86B 3A37A 4RY2A 1YR6A 3GLFE 4NMMA 2FSGA 4IFEA 4M1WA 4TYNA 1OH5A 4OJQA 1GVNB 2PCLA 4RCZA 4ZKEA 4OK6A 4M1MA 1M1YE 3U5ZB 5DI3A 4QFMA 3LXXA 4KXFB 4EJSA 4D4JA 5EXPA 3TSZA 4IDPA 4DLTA 1DADA 1JALA 2XITA 3LX8A 3U7FB 1GNRA 1KMQA 1P4SA 1QHSA 1ZM9A 3MMPA 3NHAA 3MWLA 4M1SA 4ZDKA 3T06B 1RRCA 3KB2A 4LJ7A 3TBKA 4E07A 5HZKA 2XJ9A 4C0LA 4DLZA 2JLQA 3BD9A 1UEJA 4LRWA 1B0UA 3BB1A 4YLGA 3CRVA 5AJVB 2VHTA 3LBNA 3VR2A 4CZ2A 4X8MA 3FFAA 5G3YA 5JEEA 1WB9A 4M9QA 5FBVB 4B74A 3O47A 2W58A 1JR3D 1TMKA 2QM7A 4LY6A 4Q9IA 2XOKA 4YMVA 3OIVA 5H8WA 3L43A 3AVYA 2WKRA 2IYWA 4KODA 1IY1A 4NCHA 4DLVA 3I61A 3LRPA 4MYTA 5A5GA 2P3SA 4M4SA 1ELOA 3GJXC 3U4QA 3QKRA 2BHRA 1CIPA 1NJFA 1E4VA 1OKKA 1J99A 2CJWB 3TUIC 3UG6A 1EFTA 2YZ2A 5KTYA 3CZQA 3EZ7A 1Z22A 4N3NA 3OZXA 2XZOA 1SULA 1DELA 3EZFA 3NC1C 4F91B 1G8FA 1YJ5A 5L3SB 1E1QA 2JA1A 3G82C 4NYIQ 1E4YA 1VYUA 1ZW6A 3FDIA 4QL3A 3LNCA 2PMDA 3AUYA 1I4LD 4PPNA 3LQQA 3L0IB 1HH4A 1WRBA 1XD2A 3L82B 1JJVA 3IKJA 4LV6A 4TLEA 4TT3A 4B3BA 5EE1A 1IN4A 3GJ4A 3TKLA 3A1VA 3ZVLA 1YHNA 4IVQA 3KJEA 2CVHA 1NSTA 1F2UB 4TSFA 1KI7A 3ADDA 3PR1A 3IO3A 2AK2A 1W2HA 1DOAA 2GK6A 3OEEA 3FKSA 1D9XA 1U8ZA 2J0UB 2OCPA 4UXHA 3R7WA 2XTMA 1SKYB 3BAFA 2CEAA 4RZ3A 5SZKB 4U5XA 4C0QC 3PJRA 3LV8A 1P62B 4EAQA 4AURA 2W83A 2OESA 2OBNA 2P2LA 5H68A 3VMFA 2V1UA 4MRVA 4B3CA 3EC2A 5JHHB 1X8LA 3ADCA 4CGZA 4QBHA 4DEYA 4A0RA 4EPWA 2DBYA 4QHYA 1WF3A 3RABA 1J8MF 4EPRA 1Q44A 1FX0B 2FPMA 4PTLA 1Q1EA 2XX3A 1QHHA 3GQBA 4DSUA 2O8FB 4IDNA 3TIFA 1GWNA 1PVOA 3W8RA 4XVUA 1TADA 1ZU4A 4QRHA 4AIIA 2CCKA 4LC1A 2ZRIA 1A2KC 4IXMA 3IDQA 4PHGA 1HEIA 1FQJA 4HB3A 1W4BA 4Q47A 2REOA 3CONA 3SQWA 3UMSA 1QRAA 5FTKA 5AJZA 1KYIA 1OW3B 1WMSA 2RCNA 3OAAA 4A2PA 3VKWA 1YZQA 5TB5A 2O0HA 3EW9A 4NBSA 1ANKA 1DAEA 1A1VA 1JPJA 1VIAA 1JEDA 4NTZA 3CNNA 2A5FA 1BOFA 4DIDA 1DEKA 2CNWA 3B7GA 1P75A 2KJQA 1D6JA 2OFXA 4EPTA 1RIFA 2RGNC 3VHLB 4IXNA 3I4LA 2DPXA 2ZRGA 3ZQ6A 2WJYA 3GEEA 2HUPA 1YR7A 1JR3E 3K8YA 4LBVA 3U3MA 2ANBA 4TL6A 1TF7A 3JZMA 2IUUA 3PFIA 3UG7A 3U7HB 3CX6A 4C2TA 5B57C 1XTRA 3AF4A 4P4TA 1TF2A 2IK8A 2ORWA 4HAYA 4YMSA 5IF9A 1VECA 4C0JA 1OB5A 3PENA 1G1MA 2BM1A 1K5GA 2JLXA 5BW8A 2Y8EA 3C15C 1NKSA 2H7VA 4TYPA 4JVLA 4OHZA 2BMJA 1Z83A 4Q1AA 4Y0VA 1IJEA 4MGYR 1IONA 1G18A 1MT0A 4RD6A 3CUEF 2R6GA 1OIXA 3T1TA 1N25A 4Q9KA 3ZLJA 3QY0A 2RGNA 5DI9A 5B2ZA 4QJ5A 4BFYA 4DVGA 3Q7QA 2ZE7A 4RZXA 2G6BA 2HEIA 4Z54A 4M22A 2GDJA 3P32A 2ZROA 4PPQA 4WAUA 4ACBA 4WZAE 5AUQA 4A15A 1LY1A 4JSYA 1E6CA 5LD2C 1YVDA 2BJWA 3WP1B 3E5HA 2R2AA 4YONB 2NIPA 1KMHB 1RW4A 2F1JA 3IUYA 4KI0A 4DDUA 4OHYA 3B5JA 4NONA 2QQEA 4N0DA 4PC6A 1J8YF 4BFWA 2EWVA 2WVJA 1G5RA 3QXJA 4Z51A 1E2FA 5AUPB 1ZBDA 1G64A 1KO7A 2E87A 5EE3A 4DSTA 4EUNA 1DS6A 2OV2A 3KJGA 4Q03A 2E1RA 3KUCA 4L9WA 4B3DA 5KO2A 3EC1A 2FJUA 5J4YA 1G17A 1JAHA 1FTSA 4UNNA 1XEXB 1FMJA 3GJ8A 2J0QA 4JLKA 5BQ5A 1YR9A 821PA 2BJVA 1JB1A 3EARA 1KZ7B 1ZM7A 2LWIA 4HAWA 4OI2A 3GLFA 1TUEA 4PQYA 3AF3A 3SJBA 3EZ6A 4EFNA 1G20E 3B1YA 4UJ3A 2FSIA 2AXPA 5HTKA 2H92A 4Q02A 2FWRA 3ASZA 3TVDA 2O5VA 3A4MA 4K81B 4BLQA 1Z6GA 5IK2A 3WRXC 5JECA 4LHXA 5E4FA 4ZCLA 1E2KA 1T3LA 2KSQA 4H1VA 2X1VA 4KJZA 3TAUA 1D2EA 4BE7B 4Q66C 1OB2A 4C4PA 3LBIA 4Q1BA 3UKDA 1P5ZB 2IYRA 1G3UA 3C5HA 2JLYA 4DCTA 1MO4A 3WHKA 4RKEA 1Q1BA 4OL0A 3O8BA 1KI8A 3K0SA 2YV5A 2YJTD 1GRQA 3QG1A 1X8JA 1OXSC 3FKQA 3Q9LA 2YKGA 5L8VA 1YU9A 1CF4A 1S3SA 1VHLA 5FTLA 2W0SA 2A30A 3DVLA 2D2EA 1RE0A 2ZE6A 4NZYA 5CB6A 3UWOA 2EYQA 4Q21A 5JSZB 1Z6YA 2PMKA 1TEVA 3LAWA 4LSGA 4A8JC 4ARZB 5FR2A 2WWIA 1NG1A 4NE2A 4XWAA 2DWPA 3AB3A 2N1BA 4NCNA 2WJGA 2P6UA 2ZJAA 3Q5EA 2WWWA 4JKIA 1DO2A 2EYUA 5HR5A 4WZ6A 3RC3A 5JFGA 3THXB 3ZZ0A 4F92B 2WAYA 3O8RA 1AS0A 3AGQA 4TLCA 4LJ4A 1KSJA 1RRGA 1U81A 2QNRA 5CDFE 4DLSA 1P9RA 5JMTA 1O3YA 4KVGA 1AZTA 5BN3A 3R20A 4OKSA 4IFBA 2J46A 5CM8B 4N0EA 4UJ5A 1EK0A 4PC2A 3B9PA 2D7CA 1TF5A 3EAQA 4B76A 3UXMA 1RYHA 1SVLA 3GJ5A 1Z0KA 3SJCA 1BYUA 1L2TA 1E3MA 2R8RA 3RS0A 2W6JA 1XB2A 4GMXA 2C98A 2FEOA 4GP7A 4JVNA 3VR3A 3H86A 4MYUA 2GJAA 5JWRA 2V3CC 3K70B 1IXSB 2Q9AA 4A92A 4XTCS 1GL9B 3T34A 3SYLA 2XOKD 4HUQA 4US1R 2HLDD 2R44A 2VA8A 4FCWA 1XXHE 4KO8A 4Q1FA 3U7EB 3SDZA 4URZR 5KSYA 1HA3A 1W48A 2YOHA 3W8NA 4Q1CA 4Q48A 1OHHA 1P2TA 1ZJ6A 2DWQA 3AH8A 4GOXA 4LYAA 1QHYA 4LX0A 1WXQA 2J3EA 2FF7A 5GADl 1T8TA 1KI3A 1GSIA 4NCIA 4KU4A 2R6FA 3IO5A 4AD8A 5LDDC 1XDBA 4URXR 4TLAA 1S9DA 5HE8A 4KAXA 2IC5A 1W5SA 3KJHA 5CJPA 3FB4A 1ZRHA 2MMCA 4M1KA 1G9XA 5BYKA 4KV9A 5LBIA 6Q21A 2IS4A 3CIOA 4OK3A 1SVOA 1XWIA 5FFMA 4TL7A 1SHZA 4DIEA 4PAOA 4TSFD 4LHZA 1XPOA 1KHTA 4NYJR 3ZH9B 5FOVA 4LYJA 4PZZA 4QNRA 2WJIA 5FI0B 2FPKA 3FKSD 3HPQA 3GLIE 3SU8A 1W5TA 5DI3B 1NY5A 4URVR 2WIBA 1GNQA 3BB4A 1Q1ZA 2CL6X 3IILA 4A0FA 2NZJA 1GITA 3WBJA 4EJSB 2WMNB 1QHXA 5KUTA 3ZVNA 4MRSA 1NJGA 2FSFA 1KI6B 3HU2A 3NC0C 4LJAA 2AWOA 3ZVMA 1ONBA 3B13B 2GRJA 1CR4A 3D8BA 3QOFA 4HDOB 4TQAA 1N0VC 4A6XA 2R65A 2IYVA 1IBRA 3AF1A 4LBZA 5HE9A 3GLHB 2ORVA 2GVZC 4OQFA 2MMGA 4C7OA 3R9WA 3U3JA 2C04A 2OFWA 5AUNB 2OBLA 1L4YA 5EP3A 4II7A 3AV0B 2BCJQ 4NCJA 5B30A 4NYMQ 1I2MA 1WBBA 1DBSA 4FW9A 4XD7A 2YC4C 4HB0A 2QEQA 1G8YA 4MRRA 4P32A 3QKRB 4DEXA 1XJCA 5IHPA 3U4QB 1OV4A 3LD9A 2IYYA 4Q4AB 2CNWD 1ZNYA 2NO0A 4WZBE 4QHSA 3HYRA 3ZQJA 4I1SA 3SS8A 2ZE8A 4RKFA 3SC3A 1E0JA 1N6IA 4HAVA 4C0SA 2D4HA 1T5LA 2BV3A 4CYMA 2O52A 5CLLA 1DO0A 3BC1A 5FTJA 2EFHB 2WKPA 1KK2A 3KFVA 3S1AA 3V9PA 1Z2CA 1P3JA 4US2R 3CM0A 4F4IA 5JJLA 2WJVA 1LTQA 4K46A 1VCNA 4V0KA 3IPYA 5FOUA 5DN6A 1DAMA 1NVVQ 1UKYA 2FFHA 5LB2A 1Z0IA 4D2IA 1MO5A 2JLZA 3TQFA 2OG2A 3RRMA 1QG2A 2V6JA 2VQSA 3RWOA 4PAMA 4YQFA 3TSOA 5KNCA 1BH2A 3AVOA 3QBTA 4MGZR 1GP2A 2TMKA 4ZDWA 3VNVA 5C1BA 2QN6A 1KJWA 2A7QA 5FOWA 1JAIA 4P4SA 2IUSA 3SBDA 2DR3A 5JHGB 1L7VC 1WDTA 2KWIA 3CNLA 1LW7A 4MKFA 4LJ5A 2B21A 3OF5A 4OQLA 1E9RA 2BBSA 2ZVPX 4JL6A 4M21A 3BE4A 3AVXA 4M8NE 2EU8A 3MJRA 2KE5A 1KNXA 4ZKDA 4E5UA 1QHHB 4V0MA 2NG1A 5DHAA 2Q9CA 1UAAA 3HR8A 4L9SA 3EPHA 2Q3MA 3GP8A 4MA4A 4DHEA 2JIZD 1JEEA 1OYWA 1S1MA 2R62A 4KSBA 1KZGB 2H57A 2JJ2A 2XB4A 1NI3A 2ZRFA 1US8B 4L4UA 3QF7A 5EE5B 5CIWA 1CBUA 3L2OB 4OQNA 3WMGA 5HPYB 1TQDA 4HZUA 2FPLA 2QTFA 2WWGA 1UPTA 2DFNA 4V0OA 1J90A 1S4QA 2OO7A 2ATXA 4D4KA 2GJSA 3FMOB 1U2RA 4TMVA 4EPYA 4HI0E 2AKAB 1ZD8A 3K1JA 5CLQA 2IYXA 2RKOA 1JBKA 1KI1A 1XTIA 3ADKA 4YMUA 2ODNA 3Q72A 2HCBA 2QSZA 4JMPA 2F3RA 1N6OA 2NQ2C 1U0HC 4GL2A 1RRPA 5IK2D 4TLBA 1KDRA 2W00A 4JLBA 3U60B 3WHLA 5CDFA 4BECA 4POAA 4ZPXA 5LB4A 4ASUA 1R5OA 2GAAA 3SR0A 2GJ9A 4KFSA 4W5HA 4DKXA 4L5BA 3CRMA 2DYKA 4A9AA 4GRAA 3T35A 1CP2A 1KI4A 3EXAA 5KDOA 4OI1A 1S3GA 1II8B 2LCFA 2ZU6A 3TJZA 4CRWB 1RJ9B 1U94A 2C5LA 1UFQA 5F3WB 4ZI3A 1GTVA 4NHOA 5KSOA 3L8ZA 4WBSA 1SVKA 1ZYUA 2NTYC 4QM6A 4FMBB 3QJYA 2JGNA 1LF5A 4PO1A 5FOSA 2YYZA 4PSKA 2ZR9A 3OHMA 3T12A 4D26A 2GEUA 2K5UA 3P20A 1XXHA 2J0VA 1E99A 1ZM2A 4JLVA 2C9OA 1M34E 2QP4A 4MKGA 3EPKA 3ICQB 3KL4A 5EP1A 2E9SA 3MWYW 2RHMA 4TYWA 4JBYA 1E9BA 4LDJA 1X6VA 4PC1A 3H1TA 3EPJA 1DTSA 3QUSA 2FEMA 2YOFA 2O8BA 2F3TA 4IVRA 1AGRA 1MO3A 4KLZA 1XPRA 2XXAA 2VHCA 2W6IA 2HXSA 3K9NA 4Q01A 3QPVA 5AJWA 1FUKA 5JS7A 2O8CB 3THOA 4Q7LA 4DLXA 2GESA 3QXCA 4B44A 4D0NA 2VSXA 4S2EA 2QAGC 3SZRA 1ZIOA 3KFXA 2CHQA 3EZ9A 1FOEB 3LO5A 2OCYC 4Q4JA 2C96A 1A82A 1OH7A 1VHTA 2QU8A 2QUZA 2GEVA 2W6JD 3ADBA 4CEJA 3HP1A 4P33A 2VIIA 1XD9A 3AKEA 3MWJA 1U90A 3VHXA 2I1VB 4E22A 1OFIA 3WP0A 4RD4A 1G4AE 1ZVQA 4AWXA 1U8AA 2G1JA 4DSOA 2J0SA 1P2SA 2NGRA 1EFHA 1X1SA 2IYUA 2ASEA 3B1WA 1ZD9A 1KK3A 1OHHD 3FVQA 3KKQA 2PT7A 1W0KA 3KB1A 4XSGA 2WIAA 1NVXQ 4WXRA 3OIWA 1E2NA 2AWNA 3NEYA 1A4RA 1PJRA 3A8TA 4QGHA 2XEXA 4AG6A 4DT1A 4HAUA 1MABA 3W9YA 1KJYA 4ERNA 4FCTA 1Q12A 3PCRB 3K53A 2CHVA 2JLVA 1N0WA 2J7PA 2ZJ5A 3C16C 1V43A 3W3ZB 1IN5A 4XH9B 5HCNA 3SYNA 3ZS9A 3U7GA 3AVUA 1G5PA 2IEZA 2XTZA 2IF2A 4H9GA 4NCKA 2JCSA 2YVUA 3QG5A 2GJ8A 1GRRA 2XTNA 3EIEA 2ZE5A 2GWHA 2QG6A 2QQ0A 1ZNWA 3AQ4A 3BBPA 2P5TB 4ON9A 1II9A 1P2UA 1W4CA 2RGEA 4LYHA 1E98A 4PQFA 4XVRA 3SOPA 1G3IA 5FPHA 1Z0FA 3I73A 3RRZA 2HYIC 1NNEA 2ZJ8A 3VX3A 2OUKA 4NP6A 4BUJA 3K0AB 1OXVA 2HYDA 4KVAA 1F3OA 5JRJA 1VMAA 2G88A 1NLZA 1O87A 2BC9A 2QZ4A 2ZRCA 4KBGA 4CIDA 1XU4A 1LS6A 4BZQA 5HZHA 5EQTA 1R8SA 2PEZA 2BOVA 4I81A 1XMJA 2EFCB 2HLDA 4JLMA 5H1YA 1T9HA 2IYZA 1OF1A 1IAQA 4GFDA 1ZC4A 2QMHA 5BYJA 3NBFA 4V0LA 4GT1A 3B85A 5K8LA 1LFDB 4D6PA 2QL6A 2XZPA 3M6AA 1R5BA 2OCBA 3I8SA 3THWB 1E2PA 1T8UA 4Q5IA 3T5DA 1TAGA 4XD7D 5E3HA 1UEIA 2ZTSA 1SVMA 2PBRA 1YKSA 2QMUA 2ZRBA 3W6OA 3U61B 2QSYA 3TR5A 4ZIRA 4CVNA 2QRNA 1NIPA 4LV5B 3U44B 2PJRA 3A4LA 4TMTA 4PSAA 3KXLA 1F2TA 2CL0X 3DKVA 1NP6A 4EQ6A 1OSNA 4JIMA 3QF4A 421PA 1QVAA 3GLGE 4DLYA 5E7IA 1DVRA 4TWZA 2DFTA 3X1XA 4LJ8A 1GDDA 2HT6A 2ZJ2A 3TE6A 3M0EA 2FOLA 4B6FA 2EVWX 1MOZA 3NDBB 1KTVA 1YRAA 2F43A 2CLCX 1N6PA 2BVNA 2YWEA 5DN6D 621PA 1DPFA 2RGXA 3ZIAA 4I1UA 4TQUS 3EWAA 2X2EA 1E0KA 1E69A 1W1WA 3A1UA 3ECCA 2JDIA 3PQCA 2QA5A 3NXSA 4DCVA 4DDVA 2IUTA 2A9KA 3WNDA 5KPJA 3JZAA 1ZM4A 3BH0A 1J70A 3AP1A 1SKQA 1YZNA 2ANCA 2VPPA 5C2JB 3B60A 1M74A 1VYTA 2FZ4A 4URYR 3KUDA 4RZ2A 4GZMA 4JJZA 1AZSC 4B73A 2GXAA 2FU5C 3HJNA 4TMXA 2YOGA 4NU0A 4OBEA 1SXJC 3QEOA 1CJVC 1NN3A 3ZJYA 4EIWA 4A6PA 3TNFA 2JJ8A 2IYTA 3UANA 3CO5A 3RC8A 1XP8A 1Z6XA 2V6IA 4FN5A 2PL3A 1F5NA 4LCBA 2V1XA 2RGBA 1JQJC 3EA5A 5GVSA 2X8AA 4KSCA 2JJ2D 2WHXA 1GL7A 3EA0A 4RZUA 2ODBA 4US0R 1KSGA 1Y3AA 1CR1A 2WOJA 1GIAA 2ZI5A 2ZUCA 4AYWA 3VR4A 2PCJA 5EZ5A 4AKHA 3BGWA 2RH5A 1AA9A 1AKEA 2GZAA 2FX3A 3IQXA 2FV8A 5DYGA 4B33A 3FHTA 1ZUNB 1MV5A 1SXJA 5TDHA 2G0NA 3KDSE 3WYFA 1TEXA 2KB0A 521PA 2Q0HA 3R8FA 2GXUA 2OILA 2WBLC 2IHYA 3I8XA 2PZGA 2XZLA 3B1XA 5J47A 4IRUB 4MRNA 3K0FA 1HYQA 2I1QA 2R9VA 4ASUD 2WMOB 4I99A 3C41J 1KOFA 2IHBA 3DMDA 2A5YB 2IF0A 1N6HA 1G7CA 1G8PA 3C7KA 4TYQA 3GJ6A 1BYIA 4GDFA 3CW2A 2AFIE 2ZPTX 4F4JA 1W7AA 5C4GB 1CJTC 4JT4A 3SN6A 1IY2A 2VSFA 4JLAA 1MKYA 4WXPA 4X8OA 3ZDQA 2P6RA 4FMCB 2FDCA 4DDWA 4QOSA 3DZ8A 2Q3HA 4PZYA 3VR1A 1EFUA 4L8GA 2PX0A 1EFCA 4LK2A 2GF9A 2VBCA 4PHFA 3J81k 3WMFA 3RRNA 4FMDB 4IVPA 2JIZA 4RD0A 4AY2A 4FWIB 2ZUBA 5KSPA 3AKYA 4HLDA 3LDAA 3OE7A 2WWXA 2Z5FA 2P5SA 3KTAB 3MCAA 5B58C 5EP2A 3SHFA 4JBXA 4F7WA 4IDHA 4X8LA 2A3RA 2QGZA 1NRJB 2QI9C 4WIAA 2AX4A 4IDQA 4IOKA 3EZ2A 2IXFA 1R10A 1HQYE 2GZHA 3BOSA 2W6ID 3QKSA 2ZYWX 4Q4HB 3TLXA 1AJEA 1CXZA 2AHOA 4MKHA 5EE0A 4JJKA 5JEDA 2ZRDA 4KLNA 2YWGA 2D7DA 3F0TA 3E1SA 1R8QA 4HZUB 3DZDA 2ZYVX 3LXRA 2GA8A 3B9QA 4Q19A 2CK3A 4K8OA 2ZRPA 1W46A 1VPLA 4QBIA 1S1CA 1IQPA 2QT0A 1Z5ZA 4LOAA 4V0ME 1HT2E 2FGKA 2VHJA 3CF6R 4PPFA 2QBYB 2H8KA 2ZI4A 2O8EB 2DFLA 3OIUA 3CRRA 4A82A 4C0HA 1S0UA 2LKDA 4J0QA 1ZCBA 4C2UA 2UVQA 1G3MA 2EQBA 1NG9A 2GCOA 5TXGA 4GNKA 1XTQA 4EKDA 1MO6A 4IEIA 1N0UA 5EZ6B 3HYTA 4XVQA 1Q22A 2ZRLA 3AM1A 2O8DA 3KJIA 5J4KA 5TARA 1W0KD 1GUAA 3QKUA 2QE7A 1IXRC 3X1ZA 3GJ3A 2I4IA 3PVSA 4TTRA 1YZGA 3W90A 1II0A 4LBYA 3RYTC 4B2IA 3EIHA 4MYHA 1Z3IX 3TAHA 1NN1A 1SVIA 1Z29A 2OLJA 2Z4SA 2HCJB 4V0NA 2IYQA 1CS4C 1W4RA 2XGJA 3WNCA 3SYKA 1OJLA 2X2FA 4G3XA 1JQLB 5IDVA 2IS1A 4HLCA 4IOJA 1KDOA 2J7PD 3K0EA 3TMKA 2VHQA 1G8GA 4BFVA 1QVRA 3ZVRA 5DNYB 2QTVB 3CLVA 1YR8A 2FZLA 3VAAA 4GOJA 2WKQA 2ZYTX 2ZU0C 5JBQA 1XTSA 2OBMA 3CX8A 3GFTA 4CEIB 3AEZA 5IT5A 4C9BA 2DB3A 1AQYA 4MGIR 3EX7C 3I5YA 1A5TA 3RWMB 5BWMA 4RFSA 1KK0A 4LBWA 1W2GA 2VP5A 5FPSA 1AQUA 5L3QB 2EFDB 1C9KA 1JECA 1G19A 1LVGA 1W47A 5SZJA 1UKZA 1RKBA 5AR1A 4A8JA 3IEVA 4TZ0A 3RVBA 1AK2A 3RS7A 2IL1A 1HQCA 3IPXA 3IEUA 2F1RA 2O8BB 5JWHA 3X2SA 1IN8A 1N6NA 1GRNA 2VP9A 3K9GA 2DCUA 3VU9B 4AYXA 1GKUB 1EFRA 3GLGA 3CRW1 5L3RA 5D3MA 4E03A 4ZCMA 3DKPA 4FI3C 1XF9A 1GNPA 1TQ2A 1PV4A 4WOPA 1E2QA 2BCGY 1YZUA 1PLJA 1RZ3A 2KBEA 4H1UA 4Q4JB 1ZUIA 2REBA 3F8TA 4UXJA 2GAOA 4PC3A 5FPKA 3T1QA 2V4ZA 1H65A 4BLTA 4G5SA 1P9WA 3GFPA 1VCIA 3ONWA 5DYIA 4DJTA 2ZJBA 4CEHB 1VG1A 1JXMA 3D3QA 3U6BA 2VTKA 3PIRA 3GLIB 3EG5A 3UPUA 3FTQA 5L3SA 3SFVA 4OI0A 2OSBA 4RD1A 1UKVY 3CNOA 3FYHA 1EXMA 1N6RA 4TZ6A 1NY6A 1KY3A 1Z0DA 2GVDC 1Z28A 1GKYA 2C8VA 1F6BA 4EFLA 1RPZA 4O0MA 1E9SA 4TMKA 3ZZUA 4PAQA 1S9HA 5FBLB 2O0KA 3LBHA 4NYJQ 4UQOA 1X3SA 3X1WA 5CITA 1T3HA 2QRZA 2EFEB 3QNUA 1F2UA 1CR0A 1T3SA 2BBWA 2CLDX 4D81A 2QMOA 4A4DA 4Q9HA 4BPBA 4UNSA 5C46F 4P31A 2H18A 2IXEA 2J0UA 5TV2A 3FMPB 3QE0A 4Q9JA 2NMVA 1XRJA 2WJHA 2A5DA 1E2HA 3I3SR 1XZQA 2P0EA 5AK0A 4U7DA 1CULC 2D74A 3F3YA 3ZIAD 1YE8A 3NIBA 1ZD1A 1RVDA 1D8TA 3KKPA 1Q57A 4HDQB 4JVSB 1AIPA 1HT1E 2JDID 3LW7A 5HCIA 4M9ZA 3W6NA 2OT3B 4AK9A 1FX0A 1OT3A 3G5UA 1KNQA 3DM5A 2GTPA 2O8FA 4M0LA 1BIFA 1KY2A 1UADA 1V5WA 2OAP1 4B2PA 2VF7A 1OH6A 4AYTA 4LJYA 5C4MA 4IKEA 4BRUA 3EIQA 1KO4A 1CRPA 1LNZA 1OPXA 3GMTA 2VF8A 3QEJA 4GPTA 4LHYA 4D80A 3NWJA 3SI7A 1Z08A 3I92A 1Q0UA 3TGPA 1NMXA 2VEDA 3MD0A 2V8OA 4W7SA 4W5WA 2IYSA 2H16A 2VYFA 4FD2A 3N5CA 4BLOA 3CF0A 4ZDJA 2GCNA 4DCNA 2WOOA 1Z06A 3I62A 1OH8A 1QBKC 1FW6A 4GSYA 3VR6A 1N5KA 1ESMA 1ZAKA 1ZCAA 2OZEA 4NYMR 5E95A 2AKYA 4MYCA 1G16A 2WWHA 3RRYA 1TQ6A 3U6KA 2AXNA 3H2YA 3NBYC 2J41A 4HEJA 1G291 3NKVA 2ONJA 3GFOA 1XD2B 4XIGS 1G4UR 4QXAA 4BZXA 2PX3A 5FR1A 2CE7A 3D7MA 4JLPA 1IXZA 5GJWC 4XWOA 1BMFA 1SXJD 4FMCF 1COWA 2HV8A 1Z0JA 4O25A 2ZYUX 1ZINA 4LGMA 4QBFA 1HURA 3N2IA 4W9MC 5J4HA 4QM7A 3R7WB 2RGGA 1ODFA 4FMDF 5HKKA 4D4MA 1G41A 4N1AA 5CYOA 3C4JA 4CT5A 1SVWA 2VRWA 2CDNA 3MFYA 1VYVA 4QGAA 2B8TA 2ZITA 1E2GA 2Z43A 4BRWA 1E1RA 1XX6A 1DAHA 2IXGA 1LS1A 1NVVR 4IEEA 5EP4A 3KQLA 5F98A 2GKSA 1S2MA 3FHCB 2DFKB 1E2EA 4G01B 1MRSA 3L0SA 4OQXA 1KO5A 2ZM5A 1KMHA 4HAZA 2F55A 3MLEA 4DDTA 3D31A 3MRSA 8OHMA 3X1DA 1A2BA 1ZNZA 3U3RA 1GM5A 1G7RA 3UMRA 4UNRA 3OE7D 1Z0AA 2ZIAA 3UK6A 4C0BA 2XAUA 3MJHA 4Z8YA 1HV8A 3FWYA 1TPZA 2Q3FA 2BBOA 1I4TD 1OE0A 4YXWA 4KFRA 4ACAA 2VP6A 4WVFA 1KKLA 2ZEJA 2JLWA 1N2CE 1BKDR 2YWHA 3ND9A 1LF0A 2DHRA 3KKOA 1T4GA 1X8KA 2P67A 5C18A 3V4RA 2JJ1A 4R9UC 1SHKA 1DAKA 4OHVA 1G21E 4QJ4A 4FIDA 2CK3D 3TW8B 2KBFA 3AVWA 1XEFA 4ITRC 1YZKA 3P27A 1H8HA 3DO6A 4CT4B 3TSWA 2NO6A 2VP2A 1SVSA 1PZNA 1G7TA 4AKGA 1BS1A 3GPLA 2V7QA 1JI0A 5EXXA 3KKMA 4RCYA 5FPTA 1VCMA 2ZI7A 4B71A 3LLUA 2WJJA 3BORA 2X77A 3NHBA 3GJ7A 4R98A 1NMZA 5UKDA 2G77B 3GD7A 3K0FB 4Q7JB 2HF9A 1UBGA 2MSDB 1Q1QA 2OXCA 2VHUA 3CX7A 2FFQA 1XCMA 4PR0A 2ZANA 3QXXA 2HJVA 1E9CA 2QE7D 1M7GA 5FBWB 5JJIA 1HE8B 2AD5A 4HB2A 2NPFA 5JSZA 4B32A 3VNUA 1CKEA 3T15A 5LD2B 2WAXA 4ARZA 3A36A 1IJFA 4B2LA 1QF9A 1FMLA 4FCVA 3ICEA 1SXJE 3QVVA 1TU3A 4TTQA 3VR5A 4XOIA 3LY5A 1MRNA 2J5XA 1TUIA 5EE9A 3K70C 3BRWD 3QI2A 1EWRA 5FUVA 1NLYA 3CPEA 5DSZA 3OEHA 4ESHA 1OIVA 1R4AA 2B6HA 2CHGA 3RSLA 4V02A 3THYA 3THXA 3QXHA 4DBLC 3TK1A 5FTMA 3CWZA 1E0AA 3NEJA 2V55B 3TQCA 4NH0A 3U3KA 1FL9A 5KU1A 2OE2A 2WSMA 4OHXA 5JS8A 4PHTA 4UNPA 4XSHA 4MGKR 1CLUA 3PEWA 3E70C 4LZZA 2ZUDA 5G40A 1DE0A 3REGA 3G0HA 5DO9A 5KYKA 3VQTA 3A6PC 2AL7A 2ZRAA 2F7SA 2RB4A 1DAFA 1NMYA 3GLFB 2BMDA 2REXB 2GBLC 3AF2A 4MDEA 1EFRD 1FTNA 3TUZC 4MITA 1KSHA 1L4UA 3LH5A 5FOTA 1VIYA 4I1VA 4MH0R 5LPNA 1E2DA 1D2MA 1PLLA 2A5JA 2FFAA 3R8CA 4HAXA 1M2OB 3KXKA 1QHIA 2QROA 4JLDA 3DDCA 1J7KA 5KOYA 1E2MA 1N5JA 3LA6A 1GAJA 1Q20A 2J45A 2VL7A 3ASYA 3LVRE 3ND8A 1UJ2A 2ATVA 3CWQA 4BQSA 3UIEA 2BEJA 2JASA 3BFXA 4UKDA 1P73A 2QAGA 3DM9B 3VKGA 3QPUA 2J9RA 3W5JA 2HJGA 3BIFA 3WRYC 4BGDA 2BDTA 2GCOB 3WXMA 5GJCA 2PH1A 2WZQA 3KQUA 2GBLA 4F4CA 2D06A 4V03A 1WP9A 1P7CA 3IHWA 3T5GA 3WNBA 3A4NA 3PUZA 4D0LB 1OFHA 1W44A 2Z83A 5EUMA 1HUQA 2LKCA 2ZRNA 3AKCA 4CF7A 2WWYA 4DXAA 1U9IC 1SGWA 5G41A 2ZRMA 2AN9A 2GNOA 2VH5R 1C1YA 2J1LA 2ZI3A 3A58B 2CLSA 3C8UA 3HDTA 1XTJA 2F1IA 1N5LA 3QBVA 3QSYA 2SHKA 2DWOA 2L0XA 1KI2A 3I32A 1R0ZA 3V4FA 3I5XA 4B3FX 1P61B 2IT1A 2FA9A 3OFNA 2WSSA 2ODEA 3JVVA 4EPXA 1WBDA 2GZDA 1W36C 2C77A 5FPYA 3W5IA 4DRZA 4RFSB 2VP0A 2QY9A 1WCV1 1KI6A 4TL9A 2FE4A 3DMNA 4B34A 1IN7A 5JCZA 1U9IA 2WICA 4HB4A 1OXUA 3TW4A 4A8JB 3K9LA 4HDCA 4AC9A 5JWOA 2GILA 2UZ3A 4KYUA 4OK5A 3SHWA 2A5GA 1SQ5A 1NVUQ 3B1VA 3O8DA 4D25A 4LPSA 2VLIA 1AM4D 3BXZA 3GLHA 4O2RA 1JJ7A 3H84A 1UBEA 3M1IA 1QG4A 4A2QA 3SEAA 3GLGB 1NN0A 3WMEA 4GZLA 5D3MB 4HUQB 1IOZA 1Z47A 2NO7A 2QTHA 5AUOB 5H70A 2IX3A 2DY1A 3IGFA 1D9ZA 4GBMA 4OI4A 5M04A 1XBTA 2R6AA 1XCPA 2FH5B 4Z8XA 1B23P 1KDPA 2Q21A 3CR7A 3P26A 2UZIR 2QPAA 1G3QA 3L8YA 1TX4B 1E2IA 4IJMA 2J87A 4QC2A 4Q4AA 1N6LA 2EW1A 4LHWA 4ZCIA 1TNDA 3O8CA 4AI6A 1ETUA 3TVTA 2WPDA 3FGNA 3BWDD 1E79A 3TUJC 4MDFA 2N42A 2F6RA 4NYIR 4ABYA 1E9FA 5GJVC 3EWSA 5JCPA 121PA 3W6PA 4PO9A 2MSCB 3AVPA 1W4AA 3MWKA 4DB4A 3M4YA 1E9EA 1NBME 3I1FA 1NVWQ 1RC8A 3MSXA 1DG3A 2IS6A 1BMFD 1COWD 2QM8A 3K09C 1W49A 4OYHA 4JYBA 5FH9A 4KITB 1FPMA 4TTPA 5EXSA 1M7HA 3JVUA 2ZSEA 5JZVA 5A4JA 3HPRA 2GEDA 1JPNA 4OQMA 2C9YA 3MGCA 1JNYA 4WW0A 4BEBA 2V9PA 5HKKD 1G6HA 4HYYA 4IHQA 3N70A 3EPLA 4Q18A 2FGJA 2IEYA 4A0HA 1XCGB 5KPDA 2AFHE 1UF9A 1WQ1R 3HWSA 5D3QA 4TLDA 4LC0A 5TVKA 1R5NA 2F9LA 2CCJA 1E1RD 1W0JA 2X19A 5SZHB 2RAPA 4G5OA 1C4OA 1HE1C 3RHFA 2H1LA 4M53A 3CBQA 3SBEA 3K09A 4QG7A 4URWR 1H8ED 2ECKA 4C7OB 4ZDIA 2PLFA 4Q7MB 3IQWA 3B1ZA 3NTUA 3ZZTA 3Q5DA 1OFUX 2ZSBA 4RSGA 2RGCA 5CK4A 2W2XA 1T6NA 4DLUA 3BK7A 5FUWA 4KYIB 1SKYE 3CPHA 4G1UC 4LI0A 3FPAA 3EASA 2AD1A 3AVTA 2V54A 2Z6VA 5FBRB 1XMSA 1M6NA 1US8A 1VG9B 4PSVA 4QNMA 4RD3A 3I72A 3HR7A 3REFA 3P4YA 3SE0A 2ZS9A 5KSZA 4YXWD 4JS0A 4C3ZA 4TYYA 4DWJA 1U99A 1FP6A 4JYCA 2XB2A 5FOXA 4Q1EA 2BMFA 2ZAMA 4LHVA 4Q9LA 4RVCA 3T61A 1FFHA 2F9MA 4XWKA 5L3VA 2RHDA 4PO8A 5A0FA 4OHWA 3CB4A 1DARA 3SQXA 2JJ1D 3RLFA 4AG5A 3S1AB 4C0AC 2H5EA 2IBMA 2G83A 2VO1A 3AF0A 5CB8A 4JSTA 3A1SA 4HLQB 1H8HD 3AP3A 3KXIA 3RS3A 4LPKA 2NZ8A 3GCGA 1K5DA 4BASA 4QBGB 1UDWA 1ZMXA 4MRPA 1L8QA 2V7QD 1U98A 2GJKA 4X8HA 3AP2A 3NH9A 4DZZA 4Q7KA 2NO9A 4LJ6A 3W34A 4M1YA 1II8A 2O0JA 2ZI9A 1EWQA 4TQ9A 1KIMA 2B7CA 1PUIA 1E9DA 4OJKA 1RJ9A 2XJ4A 1ZNXA 3VKHA 3DOFA 4IW3B 5CIQA 1Z8FA 4JT2A 5F2EA 4MKIA 4JL5A 4NPHA 1Q3TA 3PXGA 4P4SB 3SFZA 3W3AA 3OESA 2WWFA 1Z63A 5KDDA 4LUCA 2QGNA 1NLFA 5JI2E 2FFBA 4PFSA 2ZSDA 1ZC3A 2EWWA 1A7JA 3QQ5A 3BH6A 1CJKC 1ZIPA 3IIKA 3Q85A 4HSEA 2R6CA 4I4LA 1UM8A 3CZPA 4A0GA 2NPIA 1J2JA 1TU4A 3CH4B 3WYGA 3AUXA 4JLOA 1AKYA 2N46A 3OEHD 4URUR 2WTUA 4IOMA 5SZIA 4D4LA 3FFBA 2ZSFA 2CMKA 2UKDA 2Z4RA 4RFVA 2HXYA 3C14C 3NBXX 4IOLA 4YDHB 1IM2A 3ETLA 3B78A 2QPOA 3KX2A 4YMWA 4DSNA 4NL4H 2O8CA 2G9NA 1BO6A 4UXIA 4MQBA 3CRQA 3RS4A 2OEPA 4CW7A 2JLRA 4KBFA 5CK5A 2Z0MA 3AVVA 3K0CC 1R0WA 1XZPA 3BB3A 5P21A 5J4VA 2BWJA 2QORA 3QXSA 1XMIA 4M1OA 3K70D 2NOAA 4YDSA 2BKEA 3FE2A 1OYYA 1LV7A 3WBKA 2XSZD 3CH5A 4R2IA 4Y0AA 2QP9X 2G0TA 2FNAA 4JBWA 2KI5A 3ZYCA 1N3BA 3B2EA 1GG2A 2VSOA 4DUGA 3ZD7A 1U8YA 4G0NA 2QT1A 1G8HA 3RS5A 4LV8B 4ESVA 2IYLD 2ZETA 2FSHA 3H0KA 5BXQC 2FMXA 1T91A 3K0CA 2YHSA 5K8TA 2QMEA 1E96A 1CU1A 1UDXA 1R0YA 1UBCA 3RAPR 5EJEA 1P72A 4QJ3A 3IIJA 1OLOA 4C0KA 1KK1A 5FUYA 4EPVA 4DCSA 4B48A 2GHIA 5EXTA 3KQNA 1XJ0A 1VCOA 1RFLA 1G3RA 3N2EA 1NSFA 1XXHB 2ZREA 3VFDA 4QKQA 2PJZA 2ZS7A 4JLJA 2JLSA 3DOEA 3NDPA 4RJLA 5B64A 2ZRHA 3CF2A 2ZJZA 1EGAA 2JATA 5KDLA 3RANA 1JR6A 3LQRA 3MAAC 1DAGA 5TY0A 3THYB 3IHLA 5F9HA 1YQTA 4U02A 5ANRB 3OFND 1X1RA 2WSSD 3U3OA 4A1FA 4P0TA 3K0AA 2XXAB 1G7SA 2ZJYA 1FUUA 2YNMA 5DE3A 4BFXA 5E7JA 4CDGA 2OHFA 3SNHA 2IWHA 4PPGA 1VDZA 5FL7A 2C95A 2A2ZA 4DLRA 3PUXA 3LW8A 4XJXA 4HUTA 5IRCD 1NBMA 4DLWA 2AK3A 2Q6TA 3KZ1E 3SJZA 2BKUA 4S35A 2CJWA 4CEJB 4TMZA 3ZGXA 5GVRA 2PT5A 2F1HA 4O3MA 1GFIA 1Z6AA 3DHWC 1OIWA 4BFUA 1KDTA 1UBFA 2W2TA 2ZR7A 2RMKA 4JL8A 3THWA 2D62A 1CJMA 5G3ZA 1W36D 2RGDA 2ZQ5A 4BLRA 1E94E 1Y63A 1OKKD 2XNDA 1DG1G 2D2FA 4NDZA 2IA5A 2IWRA 3TRFA 1XNJA 2QAGB 5KNDA 4M9SA 2JEOA 1SZPA 2FN4A 1T0HB 5J40A 3U44A 2BMEA 4Z1MA 3WYAA 2QP3A 2WPDD 5DLQC 1PUJA 1OXTA 2QENA 3IIMA 3RSOA 2WM9B 2BBTA 4KFTA 4DT1B 1E1QD 1E79D 1MABB 4UNQA 2OAQ1 3PUYA 1I2DA 1S8FA 3FHOA 1CTQA 1EG7A 1U0JA 4LWZA 3HU1A 2GXSA 1NKTA 1EX7A 3RS2A 4D82A 4TT3D 2OXRA 4QGGA 3R9XA 2BM0A 5DHFA 2G3YA 4DB2A 4HATA 2A78A 4ZI2A 3T1OA 4C30A 1DAIA 1M7BA 3L0OA 5GJBA 5JRZA 1XD8A 221PA 2ODWA 3P4XA 4I1OA 5TMPA 2GETA 1QDEA 3OEED 4BZPA 2H17A 3OIYA 1E32A 2ZXUA 3BFKA 3CKLA 2ONKA 4F38A 3PV0A 3P1JA 1R7RA 3F5FA 2C2HA 1D2NA 2HF8A 2B92A 1IN6A 3GEIA 4B75A 1JR3A 2I3BA 4P3YA 1P60A 1W0JD 3AVQA 4ZV4A 4EDHA 1HY3A 1UKEA 3FMIA 2GCPA 5DISB 2OLKA
chains in the Genus database with same CATH superfamily
3OC2A 1UC8A 3NDIA 1G5TA 2B83A 2BEKA 3UMFA 3HNPA 2XQFA 2ZS8A 2ERYA 1JFRA 2OORC 1KO1A 2VKTA 3LQ4A 3IOEA 4J4HA 1MC5A 2VKQA 4X71A 5A93A 4NNJA 3TTUA 3MG9A 1NMEA 2AR7A 3HBMA 5IZCA 1T1GA 3D7NA 5AW1A 2C0CA 3LLCA 2HWKA 4C1BA 1YRWA 4DQXA 1K7YA 2X9VA 1MZPA 1EUCA 1YUMA 3HBFA 5FIUA 4U2DA 3P0FA 1ZUHA 2JKRM 3VZQA 2WYVA 5DX1A 5PGMA 1JG4A 2C59A 2ZRKA 4R6WA 3P2MA 2AZTA 1XVVA 3QENA 2P3LA 1K6MA 1QHGA 3LY4A 2IHKA 3DBRA 1W96A 5KIZA 1YTLA 1R9JA 5T3UA 5FJJA 5K8UA 1KJZA 1XN1A 4QPNA 4RTLA 3U1BA 3ZTYA 3LE8A 5IPFA 3PYXA 5LU8A 1LRLA 4BO6A 2BYTA 4UEJA 3BS4A 1E2LA 1BROA 1N8SA 3MUNA 1KKMA 3K0HA 1Q21A 2NUPA 2AG6A 4NX2A 4FGJA 4NSNA 1PO7A 1GKIA 1WS6A 1ZM3A 1WP4A 1LPSA 3GVHA 1NIJA 1X0XA 1RMQA 4ILEA 4X6UA 2E4ZA 2UUAB 4BQQA 5LDHA 5FOQA 1R9MA 4RIHA 1IFQA 2CDAA 4BFZA 3C3AA 5KAMA 1QOZA 1Y6FA 4ZAGA 4L15A 5FL7D 4WTOA 1UEXC 2FMKA 3QE3A 4H6PA 3UWKA 2Q5FA 4GR9A 2CXXA 5J4LA 4ALNA 4WKGA 9ABPA 5EN4A 4YGYA 4PIVA 3QLVA 3L4BC 2PGNA 1JXAA 4F93B 3EIUA 3AT1A 1PHRA 3OT1B 3W2TA 4F56A 1LLDA 3AHDA 3CEAA 1OH5A 3DBLA 4E15A 3MMNA 4OK6A 2OCGA 1XHEA 1K0UA 3R7BA 1HX7A 4DLTA 3EG9A 2VK2A 1UK6A 3PR6A 1EX1A 4ZDKA 3DHEA 2NUAA 5T3YA 1XQWA 2FWBA 3GUYA 2R9WA 2P3SA 1L5WA 4FFSA 1H5XA 3I58A 2C31A 3VJMA 3CT6A 3FF4A 5A92A 1E1QA 2HN9A 4JGOA 1REQB 2FX2A 4OM8A 3FDFA 2I2XB 1K5HA 2LVBA 2QXTA 3WRWA 1M8JA 1EHYA 2FW9A 2EBHX 4X84A 2Y59A 3KJEA 1ZSYA 3PR1A 3O1JC 2QX8A 1G6KA 3GFRA 1P62B 3ZU3A 2RIPA 4FYYA 1QTNA 5H68A 2V7GA 3JR7A 5B1DA 5LIPA 2Z98A 3RABA 3UF0A 1QHHA 1UBSB 3JU3A 2CCKA 1O4VA 1KYIA 4PRKA 5D8DA 4ESPA 2ID8A 2J07A 3FSGD 3WFZA 1ZCFA 1RCFA 3ESRA 3W6UA 2ZQCA 4G36A 4LBVA 2IUUA 2KMLA 1R6XA 5BW8A 2IYFA 1IYSA 1IONA 5EIXA 2HC9A 3D5EA 2BN4A 2DQKA 4Z54A 2ZROA 4ACBA 2IGTA 2CSUA 2QUHA 5JU6A 4NH4A 1YVDA 3WP1B 3DTTA 4GKKB 4PC6A 1KO7A 4DSTA 1I24A 5JCOA 4L28A 3EK2A 3HB0A 3R3HA 2VRCD 3OKFA 1ZTUA 3HDJA 4E3ZA 3GGJA 2XV1A 4EFNA 1D1SA 1KE0A 5HS4A 1M1YA 3ASZA 4JASB 4JENA 1Z6GA 1XNRB 1JYFA 2PM8A 4BE7B 2BSAA 4ZEVA 4BVJA 4RTMA 2WEKA 2Y2GA 1FBTA 4YCNA 1GPDG 3FKQA 4Z9FA 5L8VA 2BCEA 3ZG6A 3KQQA 3TEMA 1KWKA 3KT3A 2Y27A 3UWOA 4M9UA 3WA7A 3O93A 1NG1A 3CI6A 5ALHA 1YFLA 2Y8HA 5CB0A 3RC3A 2Q50A 4YBZA 2I6GA 2MT9A 4V3BA 3DE6X 1T1BA 3DZGA 3TINA 3KYQA 4B76A 4C5CA 1RYHA 3LIPA 2VZ8A 4J3FA 4R1SA 3VR2D 2IXAA 3DL7A 5CVDA 5MGNA 3H86A 3VH4A 2MWMA 1NQXA 4JK3A 3T34A 3F8SA 5ALWA 1O95C 1XKTA 3WQHA 3G6OA 3U48A 5HM6A 3D2BA 3VP4A 3ZYZA 2C2YA 1Q92A 4FFVA 3Q1FA 5BYKA 1GFWA 5AIAA 4LK3A 3BIWA 2VX8A 4HY3A 2UUBB 1DL5A 2ISCA 3FYUC 3HBLA 2ET6A 2IYAA 5B7QA 4EI7A 3F1KA 4LHZA 1XPOA 4LF7B 3I6MA 3ZH9B 1JMYA 1ISPA 2I0FA 4BBUA 2FEWB 3BGVA 4MULA 1GITA 3MTGA 4YBRA 1Y5IA 2WMNB 4B1FA 1NJGA 1H4TA 4NMHA 1EZ4A 4FLEA 4A6XA 2LIPA 4ZJYA 1ESDA 4OA5A 1F20A 2APJA 3U3JA 3E23A 3PTEA 1J09A 4II7A 4BCCA 3ULFA 4P3OA 1P19A 1UQRA 3VVBA 1R4MB 1KOJA 2WFAA 5IJAA 2J6CA 4F86A 2EFHB 1XLUA 2ECPA 3MXRA 4IIJA 4UTOA 2WUDA 3PCXA 1XZCA 1YB4A 4JEHA 2AI3A 1Z25A 5BSVA 2JLZA 3TQFA 1QG2A 1QO9A 2E6UX 3UA4A 3TSOA 2IY9A 3NO4A 2TMKA 1KJWA 3SBDA 5FA7A 3KJZA 2FPPA 1W5AA 2B21A 3B3QA 2R25B 5F7ZA 3GV0A 3UY4A 1CZNA 1R66A 5EZYF 3E3LA 3GXOA 3R5FA 3R7FA 4HJ4A 4XX0A 3BK2A 3ELYA 2XB4A 4L4UA 1NI3A 2ZRFA 1ILWA 2QTFA 3HB9A 3BFJA 2IW1A 3TZKA 4TMVA 3W78A 3F7TA 5K3EA 3S2GA 1YRLA 5JSUA 3NDGA 1U0FA 2ES4A 4U4AA 1KQ3A 2WRZA 5ALDA 3QW2A 3MINB 5EERA 3B8EA 4ASUA 1U1FA 2VWHA 1X9HA 2PPLA 4E6EA 2IZ5A 3JYOA 3LX6A 4J2OA 1SVKA 5JYEA 2LV8A 2QWSA 4BTVA 3LQKA 1R0SA 4EYQA 2C9OA 5IM5A 4TYWA 4GX0A 2PSHA 3H1TA 2O8BA 1OZFA 2W6IA 1PX0A 4DLXA 1OD6A 1YLYA 5K4GA 2W6CX 1XLTA 2R78A 2Q1TA 1NW8A 2EKPA 4CEJA 4P33A 3L6OO 1R9GA 1TOAA 1PR2A 1ZVQA 4OHPA 4AWXA 2H4HA 1P2SA 4O2AF 4TS4A 3B1WA 1ZD9A 3KKQA 3FVQA 3EXFA 3KB1A 1ECGA 4GPZA 1X1DA 3OIWA 1FPQA 2J4DA 1WWKA 3W9YA 1EBFA 4LE0A 3P96A 4YH1A 1B1AA 1NQ5A 3EIXA 1VEUA 3AVUA 2YVUA 3QG5A 1YVUA 2QG6A 1H4SA 1SC9A 1SRQA 2PUGA 3T41A 4DQVA 2DUUA 2H2WA 2PS0A 4BVHA 4L4XA 2QMIA 1SBIA 1SUWA 4X20A 4CIDA 1LS6A 4OLFA 2IYEA 2Y79A 1GLGA 3T9BA 1YI8A 3NBFA 5I4CA 4Y2FA 1P18A 1ZIDA 1B73A 4DCCA 2ZM8A 2NU8A 2BKLA 1GT6A 1OROA 1SUEA 1Z4NA 2ZRBA 2E5FA 1CY0A 3KR9A 4DLYA 4QYIB 4TWZA 3JZIA 2Y55A 2F17A 4FGSA 4IJ6A 3ROQA 5JBNA 4KUGA 3ZIAA 1TFRA 5L95A 1DJMA 4I1UA 1TCAA 5IANA 1SUSA 3EUWA 3DMRA 1HO3A 3QE9Y 3SZTA 3JVDA 3O91A 1Z45A 5DHUA 3HJAA 5HL6A 1QIDA 4PQEA 3CZDA 3G9TA 2JJ2D 2ODBA 4MKRA 3O26A 3PC3A 1CUJA 1MORA 3WGGA 4BKUA 2I87A 4RM2A 3ZHBA 1FQOA 4JX9A 1HETA 1C7RA 2WBLC 3QMVA 4OY3A 2O7NA 2CYCA 3C7KA 3ZTWA 3GJ6A 3K0KA 2P7HA 2BHTA 1D1JA 2YDYA 3VVCA 4CV2A 1MKYA 3IRVA 4WXPA 3M5CA 4FZVA 1X7YB 1QK4A 4WMLA 2FDCA 4A5RA 4DDWA 5EJGA 3IX8A 4Y67A 1TYZA 1G20B 4P81A 1VQ1A 2D5AA 1Q2QA 3ESCA 3WDKA 4AY2A 3PZBA 3ZHYA 2P5SA 4EITA 5EP2A 3ED1A 4JYZA 2IXFA 1BE0A 3DUWA 4YRLA 2AHOA 4GEKA 3EZYA 2ZRDA 3AWIA 4RPLA 2BEWA 5EM1A 3E1SA 1EK1A 4UU8A 1W46A 3RFBA 4WLNA 4KXVA 1IQPA 3CURA 1BX1A 4IQ8A 4V0ME 3NM4A 4MS4B 3S68A 2LKDA 4F1JA 2O8DA 3OX2A 5DBFA 1W0KD 3VOSA 5BYAA 3TAHA 2B69A 3F71A 1J3WA 4BRZA 3TN7A 4W82A 1G8GA 2E4UA 3ACBA 4W1SA 1PBTA 2WV7A 4B5KA 2PQMA 2WKQA 5H82A 2DB3A 5CFRA 3FZCA 3I5YA 3RWMB 4PG6A 5FPSA 4X1YB 5SZJA 4IX1A 5BSRA 5AIBA 1AUOA 3GFVA 2WAAA 4AYXA 2VTBA 2INGX 3DEIA 4ZCMA 4QPRA 2VDJA 2Z2LB 1W63M 4WOPA 1E2QA 5C4IA 1F14A 5K6AA 2REBA 5EHIA 4EP1A 4QYMA 3X1JA 5A9SB 3R7DA 3A0RA 4EOGA 4TRJA 2AMYA 2OGWA 2HBRA 4F3CA 2XHZA 4RL4A 4RTJA 2ZB8A 3U6BA 3PE4A 3PIRA 2NO5A 5E4YA 4B85A 2OSBA 3BSFA 3TLCA 1HQKA 3RQIA 4HH2A 4PAQA 2HF7A 4PICA 5CITA 3HY3A 4G0YA 4Q3EA 2QMOA 1GJRA 3R5SA 3ROEA 3PT5A 3P9NA 1B0ZA 4KUKA 3MLBA 4YJFA 3BXEA 4Z4EA 1YE8A 3FYDA 3OECA 1YZFA 4CCYB 1OT3A 1ABBA 3TRKA 2VJWA 1QB8A 3O88A 3G7NA 3IHBA 5EIOA 3DE5X 1OPXA 2P4EA 3NWJA 4B3TB 4RVHA 1Q0UA 5KB3A 4CE6A 4GX5A 4W7SA 4FD2A 5FWYA 2JFVA 4UASA 5DASA 2WOOA 1N5KA 3U6KA 2AKYA 5F73A 1T1AA 4P0PB 2UZ0A 5C8YB 3RAJA 1T2DA 3O94A 3DTVA 4XLLA 2XKKA 4RADA 2O2GA 1VPEA 4RABA 3R7WB 2AI2A 3M6BA 5CYOA 5HDCA 1SVWA 1FX1A 5EIWA 3PHIA 3BHIA 3IEKA 4EMTA 5JDCA 4YCAA 4DEVA 2ZOIA 2QVLA 3IAUA 2YX1A 1KMNA 4OBXA 4C0BA 4P2BA 2QRHA 1DJCA 2Q3FA 1AURA 2BBOA 3ZUPA 5EKXA 4KFRA 1DC8A 3HADA 1K57A 4MBFA 4BE9A 2EWMA 4IH9A 1IJBA 2ZUWA 3NBMA 3L6UA 1KU6A 2KBFA 2JGDA 3UBTA 2JS7A 2P9GA 5IWAB 4BE4A 2IY7A 4W63A 4XQGA 4BO4A 1G7TA 1JBEA 1FY2A 3UB7A 1PFLA 4M89A 5B3JA 3EXHA 4MV9A 2OXCA 2H52A 3WK8A 2UZ1B 4Y18A 1EGMB 1WUHS 4YAKA 3LYXA 5FUVA 3CPEA 1NF8A 3OEHA 2CHGA 3DWKA 3UE6A 2FW0A 4PHTA 4DCOA 3WTBA 3RAEC 2VUUA 5CNMA 4R1TA 5HM8A 3L8GA 3QK7A 4MW0A 1QYCA 3KXKA 3LA6A 3ND8A 1ZJWA 2ATVA 3E9CA 3VYWA 4IXDA 3ZWCA 3ESZA 1AUVA 3NBAA 4YA6A 3TMAA 4JOSA 2P9QA 5JO9A 2BDTA 2OLEA 1QMFA 1A2QA 3IHWA 1W44A 1QKKA 4EG0A 4P35A 2IH5A 4AS1A 2J1LA 4DMRA 1A04A 3I1IA 3D02A 3I5XA 5DKLA 3UJAA 1QH8A 2WSSA 2XMSA 4X6XA 1SQSA 5JATA 5BN3B 3MJQA 2DP4E 3IL2A 2QY9A 4RAQA 1LC3A 1BCSA 1W7AA 3UB8A 4EF6A 4ZYXA 4OK5A 3F96A 2E0IA 2YHIB 2ZIZA 1DKRA 3T7DA 2D5IA 2XTJA 4L27A 3RUHA 4GZLA 2D4AA 2Y4NA 4ARSA 1DGQA 1YIOA 2IWDA 1KH2A 3TX6A 1UBHS 5HX9A 3E9EA 3F73A 1W85A 2QPAA 1G3QA 1N6LA 3ONVA 1ONPA 4S0ZA 1TPYA 5F1KA 5AI9A 1JUDA 1GCUA 4U7GA 4TWRA 3W2EA 1POWA 3F49S 1NVWQ 3E4PA 4J16C 2W93A 3Q8KA 3D4BA 1DU4A 1KYYA 1K8ZB 5EXSA 3JWPA 3CEJA 5A4JA 1N2EA 4TKZA 4WW0A 5ERGB 3URKA 4TLMB 1VLLA 4P4LA 3WLMA 2XNJA 4HQOA 4A10A 1GTMA 1KYWA 1KBQA 2W70A 4UULA 3ANSA 4KWEA 3OLCX 2ZTVA 3B1ZA 4PTYA 1OFUX 2I7VA 4N8SA 2QU7A 1AMOA 1K6XA 1UZUA 4U7FA 4RD3A 4DNPA 1IOLA 4BNKA 2BMFA 4CM9A 4JXKA 1BN6A 2ZPUA 4QFBA 5I7WA 1DARA 1UJBA 4ECEA 2YFHA 3BXFA 3QIVA 1FLAA 1Q15A 4TWAA 3GCGA 3BL5A 3RASA 5J7EA 2LZ0A 5DK6A 2JHFA 4LVNA 3UAVA 4IW3B 2WU1A 3KR2A 5REQA 4JU9A 1NLFA 1L8XA 3K96A 4E2FA 1STZA 4JLOA 3SLRA 4D4LA 3ZCQA 2TMGA 2GZMA 1P0MA 3SHQA 5HIJA 5KJFA 1BA2A 4NV1A 2PGLA 4HWKA 3BB3A 3N53A 5P21A 4AJOA 5JQGB 1MX9A 3CE6A 1JHOA 2LPMA 2XBLA 1OA1A 3ZYCA 4D60A 1I3CA 3N8NA 4NAVA 1L4NA 3ZV4A 4PGHA 3KSHA 4YCBA 2BFFB 3OCCA 1OLOA 4XX1A 1PFWA 3RUCA 1VL0A 3LXMA 3L8EA 4BMSA 3VFDA 4NDAA 2BE9A 4WM9A 4I1RA 4QASA 1ZH6A 2QM3A 2D00A 5TY0A 1QB7A 1X1RA 1PNOA 2ZJYA 1UWLA 2GR9A 5E7JA 3ZG5A 1SUDA 2PVPA 5EHGA 5JDIC 2Y1KA 4TKUA 1RHQA 2C95A 3OHSX 3OT5A 1UBKS 3ZV3A 3EN0A 1PJLA 1GRCA 2W2TA 4UAUA 3O8OA 1E94E 3LCJA 2IA5A 3QYAA 2ZB2A 3FKVA 2NN3C 4CLCA 2HJRA 4L5JA 1VZ2A 4N18A 1ZCJA 1U0JA 3RBZA 3RS2A 5ESWA 2CD7A 4N54A 5LM3A 3ZDYB 4E33A 4LXUA 3MSHA 1Y33E 3JARB 2W8ZA 4YALA 2VQDA 3V3RA 1AKWA 4HWRA 4KZKA 1XJ2A 2H7YA 1FXSA 3CKLA 2ONKA 4KPFC 2HJ9C 5A3SA 1QANA 2CN1A 1K6RA 2I3BA 1G8JA 2VWGA 2WHPB 1H2XA 3LUGA 2HMAA 4L0LA 4K87A 1V96A 3IWQA 4LHSA 1WXFA 4S1WA 3I9FA 3C8ZA 3FFXA 4PZLA 4P84A 4L75A 5LDGA 3TL2A 3UE0A 1R0CA 1ZU5A 2A4MA 3LT2A 1Y4ZA 1A7UA 4CM8B 1XTKA 3Q8XB 4Z4HA 1VHWA 5TNXA 1QV7A 4ZHQA 3ITEA 2B4AA 4DKIA 4UFPA 3LZDA 2ZIEA 3OE4A 2ZIXA 1YS2X 4M1QA 2C94A 3OTOB 4LXQA 4MRMA 5CJ2A 3QFFA 1KU0A 3WJ1A 1AQIA 5LXTB 5ABPA 3KC2A 1TW2A 1WA5A 3QUCA 2NU6A 3C5CA 5AJXA 4RLQA 1GL6A 1WB6A 3PUVA 3H3JA 3C4OA 5EHNA 1NRJA 1P31A 3Q0EA 2YL2A 1KP9A 4EGAA 1LBIA 1IY0A 4JGIA 3UZUA 2JFFA 4UCFA 4IR7A 1P1BA 1SKBA 1YZ3A 2P2NA 1AG9A 3GDWA 1XZDA 3JQPA 4WK0B 4NEED 2FG5A 4Y6SA 1KAGA 2P65A 4KHZA 4BV2A 1GZ3A 4PLGA 2R8OA 2ZULA 3AR5A 4BLSA 1KZHA 2MJ6A 4PNZA 1XV5A 4JCOA 1Z2AA 4ZV7A 4C7VA 4GB7A 4HEA1 5CLIA 4C22A 4QHTA 1V3UA 4UBJA 1MH9A 4ETZA 4N3BA 1ISHA 4CEIA 1ZVVA 4Z1OA 1F9EA 2PLRA 1CUWA 2VPZA 3EVTA 3EEBA 2I3DA 1FJ2A 2QJ7A 1ZP6A 4AAYA 5DT9A 3HYNA 3SX4A 3GHYA 2YNMD 4AMUA 3MRXA 3QKTA 1MVOA 2C2OA 2BZ1A 4QXMA 2OCAA 4L9FA 1N6KA 2QM0A 2WD9A 1XWWA 1YCGA 1MPTA 2QX9A 4CEHA 3T5BA 1IHUA 1S7GA 2YWFA 4C4AA 4RD2A 1CRQA 1EVIA 3GIWA 2EIXA 1NC1A 2LCIA 1Z8HA 4FE3A 3ZCVA 2B8EA 1M2VA 4XJTA 4XTRA 4NMMA 2VT7A 2FSGA 3U80A 1YO6A 1E3JA 1U4SA 3Q11A 4G4JA 1YRHA 5CMLA 2I62A 3CBGA 1J24A 3MYRA 2EKQA 1RWQA 1KMQA 3K9CA 2JBAA 3N1UA 4ZC1A 2IP2A 4YLGA 2RJNA 3LBNA 4GDBA 5JEEA 3L6CA 2RSLA 1IY1A 4M4SA 3NRBA 2C54A 1ESIA 5MC7A 3O90A 4BNHA 3VDQA 5AT1A 2JKYA 1YJ5A 2Z56A 5HAIA 3KD2A 4IHAA 3L0IB 5E9QA 2VNAA 1PAUA 2PZLA 2X5XA 5EI5A 3F98A 1PQUA 3F5SA 1TM4E 1MVLA 2OCPA 3BMOA 4RZ3A 4L6IA 3LV8A 4Q4CA 5AXBA 1PL7A 4P7JA 4EPWA 2HIAA 2VT3A 4NZNA 2BP7B 2XGNA 5EVIA 2H1RA 4QRHA 4F6LA 1V1RA 4Q47A 3H3XA 4FTXA 3HJFA 4DTIA 3D2AA 1JHDA 1GT91 4Y2RA 4D0SA 4GXRA 3BL8A 2A9QA 4EPTA 4KIJA 1GKLA 1YR7A 3U3MA 1TF7A 3JZMA 4YMSA 5IF9A 1OB5A 2GLUA 4UATA 2CJFA 4RD6A 4PYNA 2R6GA 3RVSA 1N25A 1H5UA 4M6WB 1H8ZA 4HDKB 3RS8A 1LC0A 4RX2A 1WKVA 3TXYA 2BRUC 3STHA 1H2FA 1YMXA 1GNLA 3N0XA 3FAZA 3PUHA 3UB6A 3A2MA 2NIPA 1RW4A 1IULA 2WVJA 1KMCA 1EWYA 1G64A 1VGRA 1G17A 4E1VA 5FADA 4Z53A 2FMFA 4HY8A 4MV3A 4NBWA 4OF4A 1XWFA 3RRBA 1QP0A 3EARA 4NXMB 4KQHA 4BL2A 1B6RA 2IIQA 1APBA 2VAPA 1YTUA 4UJ3A 1QGDA 1J0XO 4BLQA 4Q66C 3LGXA 3G6WA 4Q3DA 1XHFA 1U2PA 1P5ZB 2CXPA 1F0KA 4G0WA 1Q1BA 2E49A 3E2MA 2JKRI 2WJZB 5DVZA 2YKGA 4KYTA 1IHXA 3C30A 3A9VA 1AE1A 3FNBA 4AS2A 2PMKA 4WBNB 5FR2A 3MEQA 4D92A 1O5OA 2FMIA 4RDCA 3HJCA 5DLYA 1ZSVA 3BX1A 4LJ4A 1RRGA 3P2IA 1SCJA 1MW9X 2WYXA 1Q1NA 2FWPA 4I3HA 5C1PA 2J9FA 4MR9A 4JBHA 3VR3A 1FDUA 3W1WA 1IHPA 4FKMA 1DXQA 1WTAA 4EKEA 1ZLXA 3LF1A 1Y8QB 5IAEA 4AUKA 3LYLA 3IMKA 1O08A 1Z09A 4G5YA 1GU1A 5JAMA 1IRIA 6CHYA 3WLFA 3LT5A 1ZRMA 5LDDC 4GL4A 1B3BA 5TQ2A 1S3IA 3DLPX 4FOTA 6Q21A 3IXGA 2CMNA 2Q5EA 3CIOA 3OLZA 1MU0A 3LDGA 1SVOA 3NXKA 4NYJR 2A1TR 1ID1A 2D01A 3MB8A 1V9CA 4LENA 5EOVA 4RVSA 4PCVA 1K9VF 5C53B 4LHEA 5KUTA 3PXXA 4EO4A 1KI6B 4LJAA 1OA0A 1RHJA 4ETIA 1T1CA 3OQPA 3ROMA 1CYDA 1F98A 3DMFA 1Z26A 4FW9A 4HB0A 2IYYA 1L8OA 3ANXA 2B82A 1Y8RB 3BILA 2PNFA 4EESA 2AVXA 3MCWA 1WDKA 3B7WA 1XZEA 3S1AA 2H31A 2Z2ZA 4RJIA 1PFGA 3AG6A 1BG6A 1NBOA 1VCNA 5FOUA 4PE5B 2XUHA 3CV3A 4ZYLA 1FCMA 1FB5A 3UNXA 5FWXB 4PGFA 3EPRA 1RADA 3OF5A 1QX4A 2ZDGA 3V46A 4D0RA 3NOOA 4OPYA 5DN9A 4CCWA 2FR8A 1P2BA 3WLOA 2CNLA 4JBLA 1S1MA 4M49A 3SQMA 3ZQ4A 4KPUB 1EE1A 1VB3A 5LJIA 4ND4A 3IYLW 3JASA 4D4KA 3UN7A 4EPYA 1ULZA 4Q82A 1LLUA 4MCJA 4F12A 1BUEA 4IHJA 2ODNA 2QSZA 4WXYB 2QLFA 1N6OA 4B5LA 4K9OA 3P2OA 1R5OA 1SUAA 4KFSA 4W5HA 4DKXA 2BD0A 4Y2JA 4GRAA 5IZ4A 1U2DC 1IYQA 3WS4A 2QJ5A 4I3GA 1DJNA 4ZI3A 1NZFA 2V58A 2UVPA 3RVPA 1SKMA 1Z5UA 2D5LA 2F4VB 4OU5A 2X4IA 3IV9A 2RHMA 2CFCA 2W11A 1V7QA 3MW8A 3ML1A 2R96A 4ZVTA 2JCHA 3L7LA 2RHWA 2YN4A 3PNQA 4ZREA 4D0NA 1FOEB 4EGQA 3U3DA 1N7JA 2C96A 3ADBA 1XD9A 2J3TD 1Y8CA 3VHXA 4W9NC 4XCVA 3LTNC 5KZHA 1SBNE 2ZG6A 1KC3A 4PXSA 4XSGA 4BX3A 1FU7A 3RM3A 1KJYA 5KQSA 3QP1A 2WUGA 5M29A 2WU4A 1QFSA 1H2RS 4X25A 4YT8A 1XYYA 3H7WA 4OG2A 4FU0A 1HFWA 1W4CA 4MIOA 4PQFA 4XVRA 4CF6A 1QWOA 1NNEA 3DXZA 1RCUA 3K0AB 1OXVA 1F3OA 3L5KA 4YAIA 3AEQA 4KQOA 4JLMA 4R81A 1EVKA 2IPAB 4BX2A 3N3AC 2ZCUA 4YRFA 4OVKA 3LGSA 4H3VA 4Q6BA 3L01A 5T4FA 2IODA 2V7UA 2NV6A 4XCQA 3TR5A 4D8XA 5DSTA 2AEJA 4LAFA 4O4IB 2O07A 2DEUA 3HWRA 4XFJA 5I01A 3C2WA 5FULA 3R5KA 1DVRA 1GGVA 5HQTA 4QGBA 3HO6A 5EIHA 4F45A 5H9WA 3ER8A 4RDIA 3MJTA 4YJHB 3VC7A 2CV1A 4DCVA 1IK6A 4DV4B 1YZNA 4H59A 1C8VB 4TTSA 4ID4A 3NCTA 4IJWA 4ESEA 5I9NA 2NU7A 3D6AA 1EJ6A 3RC8A 4FN5A 1WXHA 3CINA 3YASA 2VA0A 3D2CA 2X8AA 1M2GA 3DBHA 2CF6A 5KTNA 4UAAA 3DYIA 1GUYA 4M9CA 3CIFA 2PK3A 3O3MB 4IRUB 4DJ5X 4U2FA 3VZDA 4ASUD 4KB5A 1Z9BA 3C41J 2IHBA 1EUCB 1ILEA 2NLOA 4RFLA 4WFQA 3WK9A 4BJHB 2C2KA 5JFTA 1RJFA 2NADA 2X6RA 5C32A 2O7RA 1QS0A 3RE1A 2CGEA 3CVWA 1PYYA 3DBRB 4OGFA 4OHUA 2WK0A 1GGFA 5EWLB 4X54A 1HQYE 4OBWA 2W6ID 1IVSA 5EE0A 4JJKA 1G2IA 2XMZA 2EXXA 2ZYVX 2Q3DA 1YM1A 1C3OA 2FGKA 1ZK3A 3A6ZA 2HFJA 1A9SA 1NG9A 2GHRA 1XTQA 1W35A 3BREA 4NJMB 2I55A 4MJ7A 2NUPB 3QKUA 2VWPA 1YZGA 3KB8A 1UK7A 2OLJA 4V0NA 1CS4C 1XHLA 2XGJA 1OJLA 1TC1A 2Q8NA 2XQKA 1HFEL 2JPDA 3T12B 5K7SA 2OBMA 3AEZA 1AQYA 2XYVA 3EX7C 1U28C 1IMJA 1CY4A 1G19A 4UHHA 3UY6A 2R7MA 2PYZA 3AM5A 3K9GA 2WIGA 3OWXA 5L3RA 2VLGA 1JTVA 4E03A 4FI3C 5C81A 5DB4A 4WCDA 2L4RA 1JG1A 5ALOA 2II6A 3OZAA 1AV6A 3AM4A 3Q3CA 3PIDA 3MTJA 4QOFA 2VTKA 4EUFA 1CQIA 2IU3A 3SFVA 4REMA 1WLSA 4H7PA 4NK5A 3MGBA 3WWCA 3JWIA 5K20A 2HRRA 1Y5LA 4NYJQ 3MXOA 3NX4A 1D1TA 1D1PA 1ADYA 4YEDA 4ZANA 5B7GA 3DNPA 1VKNA 2IDJA 3GYBA 3EG9B 3ZIAD 1L8LA 2ACVA 4KTVE 3HDYA 3VDRA 1W5BA 3BA1A 1IY9A 1A3CA 3OT4A 1U8EA 2NUAB 2G7MC 1UADA 1UPFA 3UJBA 5DF9A 4DPKA 4D97A 3EIQA 3HLDA 2Z8XA 3TGPA 1X7GA 1NMXA 5E43A 1I14A 2WE8A 1R37A 1N9NA 2OLUA 3N5CA 2Z58A 3FIJA 4AWAA 4GOLD 3IUEA 2BFNA 1DKLA 3NKVA 5IVDA 1DIGA 1EM8B 1TKCA 3M2TA 2ZYUX 2PRFA 1KJNA 3SJ7A 5F1PA 1T2AA 5HKKA 4D4MA 4AJ1A 4EY6A 4Y0OA 1WO8A 3WWEA 4W5QA 3H1AA 2WMYA 2FK7A 4X94A 3M82A 3H82A 2J33A 4G01B 3V42A 1EP3B 4I5GA 1UJCA 3F3KA 1X39A 3QEMB 2ZIAA 1GLNA 4CM6A 4G3WA 1WEKA 4ETNA 4KXNA 1N2CE 1DFGA 4ZRRA 4TVBA 5FKJA 4FZJA 1XVLA 2C84A 5C18A 1SHKA 3HLBA 3VFFA 3PS9A 2TS1A 3SXUA 4GW3A 5JNVA 4NXEA 2NO6A 2WF5A 3T7SA 3AEUA 5EXXA 4ZGGA 2GPWA 2PO7A 1LQUA 2X77A 1U2GA 1NMZA 3ST7A 2NYUA 3LECA 4YRIA 3ESAA 4MVJH 4PR0A 1DV2A 2PWPA 1CKEA 4CF3A 1L5VA 1VXRA 1EUDA 3NCKA 1U11A 1KZ4A 1D8AA 3CWZA 1YZYA 2W71A 3OPHA 3LI9A 2V1BA 1YAJA 2QOEA 1XTVA 5JASA 2ZJ4A 1JT9A 1PT7A 3V33A 1UBNA 1CG6A 2WUQA 1D2MA 1PI3A 2C2MA 1JLLB 2QROA 1E2MA 4F72A 4FOSA 5LNK6 5AOBA 5DHPA 2WF6A 3W5JA 4EW6A 1BDIA 2GCOB 5B2FA 3WXMA 2GFQA 4WLUA 5GJCA 5JPCA 2WZQA 1F9AA 1J0DA 4MI6A 2D06A 2E1PA 3T5GA 4XUDA 1HUQA 5NLLA 1DCTA 5G41A 2XVMA 4RHYA 3HDTA 4PRLA 1DIBA 3EXG2 2HRQA 3Q0TA 1SVNA 7ABPA 3I32A 3OA0A 3WRYA 4H3SA 2QN9A 2ODEA 3EEIA 2G5PA 3W5IA 4AX8A 4R3AA 3NETA 2EXBA 3IIIA 2L18A 3ETNA 3O8DA 3RAGA 3LR5A 2C0QA 4JQYA 3GLGB 3MKFA 3WMEA 4FK8A 3DG9A 4O8CA 2QD5A 2EL9A 5C8YF 3IAEA 3GFQA 3GRFA 1IEMA 3Q7RA 1X1BA 2HWYA 5EFWA 1K6EA 1ETUA 1P0QA 3ZHZA 3BRCA 4U3JA 2O23A 1PU2A 3GNSA 3QP8A 4UPVA 4B8ZA 3WL5A 4J0GA 3TE8A 1JSLA 4NESA 3HVKA 3CQ9A 3GF4A 5EG5A 3G5MA 1GQRA 3DTVD 4E5MA 4JKOA 1FFXA 2ZSEA 1B26A 3EF1A 1QQ6A 2O3SA 2PWBA 5ECYA 3H3FA 4HYYA 2DBVO 4KACA 2AFHE 1UF9A 4X66B 4EEKA 4LC0A 3N2GA 3FCUB 4ENUA 4G5OA 1AHIA 3NLLA 5TRTA 5THKA 3CBQA 4BY9E 2PLFA 4OHBA 2H0YA 2QTNA 1HLUP 3SZ3A 4E5PA 3KBBA 4KWIA 4TYYA 1I0IA 3JQGB 2G17A 1YZVA 3AJDA 1D06A 1E1MA 5ULLA 3FR7A 2HGSA 3BIXA 4S2JA 5I48A 2G83A 4TWJA 2NZ8A 2IV7A 1K5DA 4U7TB 4BKMA 2WSYB 3V2IA 1U98A 1ZMRA 4MEAA 4CCSA 3MSCA 4YO8A 5JYOA 1T2FA 3HK2A 1Y6JA 3H2GA 4IDAA 3SFZA 1UL1X 1U7TA 1T2CA 1FP2A 3W06A 2QLBA 3CH4B 1KVTA 3OEHD 4HH1A 5SZIA 3WL7A 3FVWA 1R5JA 5JVDA 3MMXA 4JI2B 2EG9A 3AK4A 1D2RA 1BO6A 2ZYRA 5AI0A 2HKIA 4PR3A 2OEPA 4ZJZA 4D74A 2JLRA 3L0ZA 2R0QC 2JZOA 2BMWA 1A8QA 3UCXA 5JJBA 4J0FA 1XMIA 2GYUA 2GYYA 4MROA 3W4PA 2XSZD 4U8HA 3TQTA 2ZTLA 4AMGA 4KIWA 3UJ8A 2AC2A 1UT5A 3AFNA 1XCJA 2YJGA 2QL5A 4ZBEA 3H0KA 1G5UA 2Y2VA 1GYRA 4B6SA 5DBIA 5EJEA 1DQSA 5AXAA 2AW3A 2RBGA 2DOKA 3OQJA 4R23A 4QKQA 2PJZA 4YPVA 1EM6A 1TTQB 5CLFA 3CF2A 4LS3A 1DAGA 2WSSD 3IP7A 4RVDA 2J9XB 2C7VA 3PUXA 3U4LP 2LNDA 3OJOA 4X3CA 3GVBA 5AKLA 3SJZA 3EYAA 1HEYA 1ZOPA 4CEJB 4L7VA 3KYZA 1Y3DE 4V0RA 1KXJA 3JATA 4DG8A 1NQWA 1AY0A 1Z2EA 3EXFB 5TR7A 3PPXA 4BLRA 3OFJA 1S6YA 1TI7A 1XNJA 1NYRA 3HSKA 4QTYA 3JQ8A 1UKBA 2D2IA 2OAQ1 3PUYA 2DFDA 4L22A 1VEUB 2H5SA 1RRMA 4RNDB 1MJGM 4C30A 3LI8A 3IRUA 4ERXA 2G71A 4MUYA 3NHYA 3GL9A 2DSNA 3PV0A 4J03A 4U6QA 3AOEC 2GCPA 1CJSA 3CPJB 1KZ1A 3PEUA 3QJ5A 4Q3OA 3MOGA 4XDZA 1LI0A 1RRFA 3E2IA 4KLAA 2NU8B 4ZOLA 4FE4A 3H9QA 1HTTA 2QJRA 3ICOA 1G8KA 1W36B 3D0KA 3OAAD 1WETA 2PHZA 5KKCA 4CM9D 2HB6A 1P4GA 2K31A 3I1YA 3AZOA 3FCOA 4HLUA 3E3NA 1MOPA 4GP6A 1IWBB 2JLUA 4E4RA 4IO1A 2ARKA 2GF0A 2H6EA 3R0ZA 8ATCA 3ZHRA 2GXQA 4R0NA 3OZUA 3CVOA 4AKIA 3VYSB 4MHTA 1G21B 4GE3A 5JQGF 3RH0A 1IWPB 4IQ4A 2R6DA 1GRVA 2HNBA 3L05A 3A25A 3IE0A 3BH7A 1IG3A 4F3LA 2BH2A 2W4MA 3URMA 2LB9A 1BLPA 1M8PA 1SAYA 3OEWA 2R00A 3HKDB 2C99A 1CNEA 4L16A 4V38A 1TQ4A 2BKVA 2J08A 1SCUA 1YAXA 4ZT7A 4NBLA 4BMXA 2I6SA 4LTDA 1X80A 1TUBB 3SIRA 2O5CA 3SX0A 3BHMA 2WM2A 2WZBA 1WQ3A 3IB6A 3PA6A 1FVFA 4Q3KA 4OGKA 4ZQFA 2VK8A 3VU9A 2HJWA 1XN4A 1CY1A 1F8YA 5DYTA 1M6VA 4HGNA 1GILA 2OGUA 3AI2A 4UOQA 2WPNA 3JQFC 4K08A 2RC6A 2Y77A 4D56A 2O8DB 1CZUA 4NU6A 4V2IA 1M0WA 2ZJOA 4ODIA 1QAOA 5LWQA 4WA7A 1OTEA 4YWZA 4CLCD 3PRHA 3SZLA 3MJFA 4B0PA 3RRXA 2XITA 1S2IA 1R15A 3MMPA 3LI2A 4YUZA 3NTLA 3IOYA 1CW2B 4IICA 3KU1A 2VTBB 3FFAA 1ULTA 1SIBE 2AYZA 1MEJA 4KODA 5F4BA 4TWBA 5TPWB 3AHIA 3A0RB 4OP3A 3CEHA