2EWVA

Crystal structure of the pilus retraction motor pilt and bound adp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
350
structure length
343
Chain Sequence
b'ELKILEIIKEAIELGASDIHLTAGAPPAVRIDGYIKFLKDFPRLTPEDTQKLAYSVMSEKHRQKLEENGQVDFSFGVRGVGRFRANVFYQRGSVAAALRSLPAEIPEFKKLGLPDKVLELCHRKMGLILVTGPTGSGKSTTIASMIDYINQTKSYHIITIEDPIEYVFKHKKSIVNQREVGEDTKSFADALRAALREDPDVIFVGEMRDLETVETALRAAETGHLVFGTLHTNTAIDTIHRIVDIFPLNQQEQVRIVLSFILQGIISQRLLPKIGGGRVLAYELLIPNTAIRNLIRENKLQQVYSLMQMQTMNQTLYKLYKQGLITLEDAMEASPDPKELERM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords twitching motility protein PilT
publication title Crystal structures of the pilus retraction motor PilT suggest large domain movements and subunit cooperation drive motility.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Protein transport
total genus 74
structure length 343
sequence length 350
ec nomenclature
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ewvA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ewvA02
1E2HA 1CEEA 1M7HA 2ZVPX 3B9PA 4M53A 3ZS8A 4MH0R 1E1QA 5HPYB 3KQKA 4RD2A 4TQAA 2IS4A 2KI5A 3B1VA 5CM8B 1N0UA 4KBGA 4ON9A 1RFLA 4TTRA 4B33A 4QNRA 3R8CA 4IW3B 1Q1ZA 1IONA 2OSBA 3K0CC 5JWHA 2IUUA 1D9XA 2H57A 3C16C 3CX8A 3VX4A 1XTRA 2ZSBA 1XXHE 3RRYA 5HZHA 3ZZUA 3C8UA 3KX2A 3K0FA 4GOKA 4M9ZA 4AC9A 4A4DA 4ZI2A 4KO8A 2IF2A 1Q12A 5EE0A 1DO2A 4YMSA 1UKZA 3MWKA 5JI3E 3Q7PA 1R5BA 1E1QD 1YR8A 2R6CA 4JIMA 1XZPA 2ORIA 4C0KA 3D31A 4QHYA 2W83A 2VP2A 1B0UA 1E32A 3SBDA 3FKSA 3E2IA 5FUXA 4PHTA 3UG6A 3UMSA 3ETLA 5JJKA 2FOLA 3DKPA 1E2KA 1OIWA 3DMDA 4D4LA 3EASA 4DB4A 1SVMA 1TU3A 3E5HA 3ZD6A 4AYWA 2G1KA 2AD5A 4XVRA 4OQXA 1KYIA 5BQ5A 1JR3A 1G5TA 2PLFA 1E9AA 3UKDA 2IF0A 3BJIC 521PA 4TL6A 2ZS9A 1D2EA 1W48A 5AJZA 3PJRA 2BEKA 1Q57A 4R98A 5HTKA 1R0YA 3SJBA 1E2JA 3AVTA 4OQFA 4D0NA 2JLVA 1YR7A 4A8JA 3ADDA 3GCGA 2W2TA 3T12A 3RSOA 1M6NA 2OM2A 3FKSD 3GLFA 1DARA 1G5PA 3D8BA 2ODBA 5CLQA 1P2VA 4XVUA 1Z8FA 2F3RA 3QXSA 1OV4A 2CL0X 4JBWA 3SBEA 3VTKA 2VYFA 4FCWA 4II7A 3CH4B 1AZSC 2QI9C 2QMOA 2IA5A 5JEEA 4MYCA 5B58C 1XPRA 3BB4A 1S0UA 2F6RA 1JR3D 2F55A 1KO7A 1VCMA 2RMKA 1E96A 4OJQA 3GMTA 1E99A 3L0IB 1TMKA 3WMFA 4A2WA 5LD2B 2GF9A 4G01B 1II8A 2B7CA 1KSHA 2UKDA 4NCKA 2WAYA 3B1ZA 1XD9A 3ZLJA 4URYR 2ZE5A 4EUNA 2FX3A 3B85A 3A58B 4KHZA 1CF4A 1OFIA 3VHLB 1EX7A 1WMSA 4LV5B 5CYPA 3UMRA 1OXVA 3K1JA 1XCGB 3K0EA 1JPJA 1MKYA 2ZM5A 1R10A 2QN6A 4LBWA 5G3YA 2GA8A 3VFDA 4MDEA 5FPKA 1GILA 1EX6A 1IN5A 2A5YB 2JEOA 2CLDX 2P2LA 3CH5A 5AR1A 1A7JA 4A6XA 3SI7A 3OEEA 5K8IA 3TLXA 4KXFB 2HYDA 1DAFA 5UKDA 2IWHA 3SDZA 5LDDC 3PR1A 4AYXA 4A0FA 2WAXA 1U8AA 2IYSA 1BH2A 2ZRIA 4WW0A 2VHTA 2ZRLA 3QXCA 4JLKA 2G0NA 3KKQA 1BYIA 1K5DA 3U7HB 3SJCA 1G17A 2QAGA 2PLRA 4LGMA 4QC2A 5FOUA 3LNCA 4ABYA 5TXGA 2K5UA 4DCUA 2YWGA 4M1WA 3P20A 3KQHA 1E0SA 1NMXA 3X1WA 3KXLA 2CLSA 2WWWA 4B6FA 3OEED 2G9NA 2ZUDA 4JLBA 1E9CA 4ZDWA 3KQUA 5KDDA 1KZGB 2QTFA 3NXSA 4QOSA 1BOFA 2R6AA 4POAA 1G6OA 2QAGC 2ZRCA 4QJ4A 3JVVA 2BC9A 2ODNA 5H8WA 3RYTC 3QEOA 2VHCA 1NN1A 4ZCMA 3V4RA 5JHHB 5CB8A 3MG9A 3MUFA 1M2OB 1XWIA 3NBZC 4ZIRB 5IHPA 4ITRC 2O8DB 3VMFA 1JB1A 1EFCA 4DDVA 4BFTA 4XH9B 2OO7A 1VCOA 3WYGA 1OH5A 3NEJA 1QZXA 1US8B 4YLGA 2OT3B 4B75A 3ZQJA 1D2NA 3F3YA 3QSYA 4CGZA 4C7OB 2QZ4A 1S1MA 3FGNA 1QBKC 2XAUA 4MGYR 1KDPA 3SC3A 3BRWD 3R7WB 4GDFA 1LTQA 5JJLA 2FE4A 5FUWA 3LY5A 4DDUA 3RANA 3SQWA 2CCKA 4M4SA 1U9IC 5DO9A 4L4UA 1W44A 4BEBA 3AVXA 2EYQA 1BKDR 3QPWA 4PHHA 4O3MA 1HV8A 4AG5A 3I5XA 1KSGA 2JLYA 2VHUA 2V8OA 2GAAA 1GUAA 4IFEA 1I2MA 2DWOA 4U7DA 1R6BX 2O8EB 1FMLA 1YVDA 1E9DA 2YNMA 1Z0FA 2AFIE 4ACBA 4TMTA 3LQRA 5DI3A 2WOOA 2YINC 4CEHB 4EJSC 4URUR 4DSOA 3QOFA 1QF9A 1QDEA 4LBZA 2GK6A 2BM0A 2J59A 4IDQA 2GCOA 2WWXA 3ECCA 2IK8A 5L3QA 3RLFA 4GMXA 5EXSA 1MO6A 3LX8A 1P5ZB 4PC1A 1E9BA 4CW7A 2Q6TA 2H8KA 2X77A 3CKLA 2ZS7A 5KPDA 2RCNA 1U8YA 1CTQA 3VU9A 2F43A 2GJ8A 2ZRJA 4H1VA 3THYB 2CE2X 1BS1A 1ZNXA 1J2JA 2F7SA 4RFSA 4Q7JB 3LLMA 4NU0A 2F1RA 821PA 1XEWX 2VEDA 2QMHA 1IHUA 1NMYA 4Q9HA 5H70A 1PJRA 2UZIR 4L9WA 1W36B 3IIJA 4FWIB 4FW9A 4KSCA 3BD9A 1G7CA 4KU4A 3U3RA 1CP2A 3CIOA 4OHWA 1FW6A 3LX5A 5CDFE 5IK2A 3HYTA 1PVOA 4CYMA 2XNDA 5CLLA 2QQ0A 1N6KA 4PQRA 2WJVA 4RZXA 4Z8XA 4ZKEA 4DXAA 2J5XA 2XX3A 1VCIA 2V55B 5IT5A 2YOHA 1WF3A 3CRVA 3KFVA 4HZUA 4UJ5A 1LY1A 3EPLA 3A1TA 1UBGA 3BFVA 3MWYW 3TSOA 4HDQB 4W9MC 1N2CE 3KKOA 1GM5A 2WWGA 1ZD9A 5FL3A 3ZZTA 5GJBA 4B3BA 1YZGA 3ASYA 2VSFA 2B21A 3T61A 4HUTA 3HR8A 3KKMA 2XZOA 4H1UA 1Z63A 5IK2D 5TMPA 1HYQA 1XEWY 2KJQA 4A0HA 2XNDD 2NPIA 3NIBA 5DYGA 2CDNA 5LBIA 1OXTA 1XEFA 1Z6XA 4Q1BA 1CLUA 4EPTA 3FFAA 2VP4A 1LVGA 5FBWB 3BH6A 2E1RA 3QEJA 5GJVC 2B8WA 3VNVA 121PA 1JQJC 4EQ6A 4O2RA 4TSFA 3U3JA 1LS6A 2OBNA 3LLUA 1V43A 3TRFA 4G5OA 4HLUA 5EUMA 3KJGA 4JL5A 1AZTA 4KBFA 1XRJA 2H1LA 3RSLA 4BFSA 4EKDA 2XGJA 3EW9A 2A2ZA 2I4IA 2VF7A 3MJHA 4LC0A 3IHWA 2QBYB 4R9UC 5K8TA 4PC6A 3B1XA 3U7FB 1EFRA 2EFGA 4GOXA 2QSZA 2HCBA 4QRHA 4LK2A 4M1KA 3ZIAA 2IXEA 3I92A 3A4LA 1CS4C 3IIMA 4NCHA 3ZGXA 5K8LA 3AKYA 1EWRA 2EYUA 1NVVQ 1ZNWA 4Q1FA 4US1R 3X1ZA 3OZXA 3U6BA 2ZJ5A 4UNSA 1KI4A 2RGNC 2WHXA 3NG1A 3ICEA 2GBLC 4IOKA 3D7MA 3EZ9A 4RD3A 5EXTA 2ZSFA 4XWOA 3A1UA 2OCBA 1P4SA 1EFRD 1XU4A 3Q3JB 5DLQC 2A5GA 3ZIAD 2ZJYA 4QKQA 2IXGA 1RRCA 4GSYA 4LV6A 3ADBA 4FWTA 4IVQA 5FI1B 1NSFA 2D06A 2AWOA 2NQ2C 2BMJA 3CX6A 3RVBA 4CEIB 5A4JA 2IUSA 2CXXA 2X8AA 4W5HA 5CDFA 2B6HA 2QORA 3ZDQA 2BOVA 3CNNA 4UNQA 4A1FA 1YZUA 3OESA 4C9BA 4PZYA 5KSZA 1NMZA 2WWHA 1TEXA 1R5OA 1VCNA 2VF8A 2HLDA 2Q9CA 3IEVA 4L16A 4NCJA 5L3RA 4D4JA 1UDXA 1NLZA 1X8KA 5BN5A 1F2UA 2GJSA 4X8HA 4BRUA 5B30A 1ZP6A 1MT0A 2OBMA 2PMKA 2CCJA 1ZIOA 5HKKA 4NYJR 2IHYA 4HAZA 2IHBA 4M1MA 2AR7A 1E0KA 5KU1A 1N5LA 2Q21A 3IO3A 5ELXA 1W5SA 3GFTA 5EXXA 4IVPA 1NY5A 2OFOA 1ZM3A 2HLDD 2WSMA 4PZLA 2R6DA 1X3SA 1BO6A 2BKUA 4UNRA 4AKHA 2NO7A 1AS2A 3R8FA 4QNMA 3W8NA 2C99A 4LZZA 3IQWA 3LBNA 1GG2A 5HKKD 5E95A 1GRRA 2GNOA 4MKHA 1N5KA 2EU8A 5J4LA 1AJEA 2ZVQX 2ODEA 4JLPA 3TW4A 5F9FA 1P62B 1WP9A 1AQUA 1N6HA 1KI8A 2C03A 2YYZA 3ONWA 2CL6X 4TTQA 1M74A 1XXHB 2FMXA 4A0GA 2QPTA 1JXMA 1NG1A 4QJ3A 1GRQA 1TF2A 4FIDA 4MUAA 4EPRA 1NP6A 4IVRA 1UBCA 1ZUNB 3TVTA 2XJ4A 2JLZA 4C3ZA 1OF1A 1G8PA 2ONKA 5HCIA 1XD2B 5EZ5A 2JJ8A 3M1IA 1VYTA 4B2PA 4FD2A 2QNRA 2ZI3A 721PA 2QE7A 1IQPA 1XEXB 2IW3A 4RZ3A 5BW8A 5C18A 2J0UB 2R8RA 4I4LA 1T0JB 3HDTA 5EZ6B 3U60B 1NIJA 4IDOA 3MLEA 2J41A 4NTZA 2Z6VA 5HE9A 4QFMA 5FL7A 1KNQA 4RD0A 4RZUA 3AUYA 4X8MA 3RNLA 3UWKA 4AWXA 1XTIA 2OG2A 4QHTA 5FOXA 2YZ2A 2GEDA 2YV5A 3QF4B 4HUQB 3K8YA 2GJAA 1T8UA 2P67A 1HTWA 3WP0A 1SZPA 3BXZA 4QJ5A 1VG1A 5BYJA 4AYTA 2CVHA 1MOZA 4FXPA 4ZIRA 3JVUA 4A36A 1IXSB 2O8DA 3CX7A 2N46A 5EP3A 2QT1A 2QE7D 1HEIA 4FCTA 2Z83A 2D3WA 1US8A 1P72A 1YZNA 4MGKR 5HE8A 2L0XA 4C7OA 2FSHA 3X1DA 2ZYUX 3AF4A 4LPSA 4N0DA 1ZUIA 1XPUA 5FTNA 3BWDD 4BLSA 4R71A 2YC2C 3R7WA 2QMEA 4UQOA 2ZU0C 1E1RA 1KK0A 2IYLD 4TMKA 4TYQA 5EUQB 2GF0A 1MO3A 1J8YF 4S35A 4DLUA 4AG6A 2OCAA 1FX0B 4TYWA 2A9KA 3QNUA 4LCBA 3U6KA 4D25A 2OXRA 2BMDA 5KSYA 1KDOA 1KO8A 3U3OA 2O8EA 5EXPA 4QBGB 2NZJA 1O87A 1JXOA 2YVUA 1RE0A 3LO5A 2GWHA 5AUNB 2WPDA 4CEHA 1KI2A 4TN1A 2QAJA 5AUPB 4FINA 4RCYA 1Q22A 2C78A 1MR3F 1E6CA 1GWNA 1KJZA 1Z06A 2H18A 1E3MA 1W4AA 4GMDA 4DLVA 3GLIB 1E1RD 2EVWX 1TQ6A 1X8LA 1S4QA 1ONBA 3FKQA 4N1AA 3K70B 1QG2A 3EARA 4X8LA 4Q21A 2GDJA 1T4GA 2BV3A 2YOGA 3EG5A 4D0GA 3KQLA 2ZSAA 5EE1A 1D2MA 4DRZA 4URVR 2PL3A 2AX4A 3TUIC 4PAMA 3KXIA 3THYA 2J7KA 2I1VB 2VP9A 4GI7A 4DBLC 2WPDD 1C4OA 3PFIA 4V0OA 4B43A 3K09A 1FQJA 1ODFA 2Y8EA 3BFKA 1Q1QA 2IEYA 2IWRA 1AQYA 3B82A 4PC7A 2ZSEA 2WWIA 5GJWC 3CONA 4C0AC 2NGRA 3L0SA 1QHGA 1UKYA 2OLJA 5FFMA 3VKGA 4FMDB 2ZXUA 2VP5A 1QVAA 4LC1A 2SHKA 4O2LA 4NBSA 4UNPA 2A5FA 3QJYA 3G82C 4UNNA 3IKJA 4DKXA 2YC4C 1F2TB 4NYIR 2O8FB 2J3EA 4C0HA 1CULC 3RDPA 3SR0A 2EWWA 3AH8A 2X2FA 4NKRA 4LBYA 1XZQA 3ADKA 3PENA 3UATA 4BFXA 4F38A 3PEYA 1EXMA 1KSFX 2FWRA 2ZROA 2IS2A 3RS5A 3V4FA 1RRGA 2D4HA 1II0A 3AM1A 3H86A 3EA0A 1QHNA 2FU5C 3I8XA 2WJJA 1W36D 2R65A 3QKSB 2B92A 4XOIA 3PUXA 621PA 3RABA 4MKIA 2Z43A 5C46F 1NJGA 1Z6AA 4MRPA 3TK1A 2XOKA 3I3SR 1R5NA 3MJRA 4ZI3A 4UXJA 1YR6A 3TMKA 1M1YE 4B3CA 1KOFA 1ZM7A 1HUQA 3TR5A 4JLOA 2UVQA 4QGAA 3GJ4A 4OKSA 4HZIA 4A0RA 1HURA 4QL3A 2J1LA 3VKWA 1AIPA 1W4CA 1RYFA 5DHAA 5JRZA 5J4VA 2HJVA 1ZINA 2V6IA 4LJ9A 3O8CA 3CF0A 4OHXA 4DHEA 3EZ7A 3M0EA 1TU4A 1GTVA 1G4AE 2W2XA 2XOKD 4AKEA 3VX3A 4D80A 2O8BB 1ZU5A 2QBYA 2PEYA 1FL9A 1CJUC 3AKCA 2MMCA 1CXZA 3FB4A 3GLGE 4HYYA 3TSZA 4WBSA 1DTSA 2V6JA 1QHHB 5BN4A 1DO0A 1LF5A 4WXPA 4TZ6A 3DMNA 3AV0B 2DWPA 2GZDA 5KUTA 4DDTA 3LD9A 2BJVA 2PZFA 1YJ5A 1ZC3A 3WYAA 5AK0A 3KL4A 3MFYA 2RGGA 4DLSA 3DHWC 2MSEB 4PPQA 3HPRA 2ZR9A 4PC3A 2ZYWX 4PXAA 1JQLB 1JJ7A 1YZLA 4I1VA 2LWIA 4Y0AA 3Q9LA 4FCVA 3ZVLA 3CPEA 1S9HA 3FTQA 4L9SA 2FFHA 2G88A 5JLJA 1Q21A 2ZPTX 3HU3A 3QUSA 1MABB 1ZCAA 2IC5A 2J0SA 1UBFA 4MKGA 4ARZB 2CHGA 1G20E 2A78A 1SQ5A 2GKSA 3BH7A 2GEUA 3DKVA 3SFVA 5ANRB 4CEIA 4KAXA 1TX4B 1ZM4A 2F1JA 4N3NA 3DZDA 1E98A 3IBYA 3QG1A 4NYMR 4Q4AB 4B76A 5EP2A 2GCPA 1KI3A 1VTKA 2GESA 5AJXA 4B35A 3DVLA 1KK2A 1U8ZA 5LB2A 2A3RA 4FMCB 1F2UB 4NH0A 3BS4A 1LW7A 5CIQA 1WQ1R 4PPGA 3Q72A 2FN4A 1A2BA 5DISB 2Z4SA 2GVZC 3HR7A 4PO9A 1E69A 4LHXA 4I1OA 3VR5A 1Q1EA 1Z2AA 3OIUA 3TKLA 5JHGB 2ZAMA 1XB2A 4DLTA 5TARA 4Q1CA 4C0LA 4A8JC 3NHAA 2AK2A 1UKEA 2GXAA 1GNPA 4LYFA 3HU1A 5FTLA 1ZAKA 2BHRA 1JBKA 2GETA 1X6VA 3H1TA 5J4HA 3FE2A 1E2LA 3LVRE 2VBCA 3SJAA 3A4MA 3E1SA 3UXMA 1XJQA 3LXXA 1G3IA 2ZYVX 1NKTA 3NH6A 3EX7C 2FSFA 3HJNA 1YU9A 2GZAA 1E2FA 1E2DA 2YOFA 1G8HA 3QKTA 2ZYTX 4XVQA 2C8VA 3FFBA 4XJXA 3PUVA 3GLIE 5G3ZA 2VSOA 2HJGA 3FMOB 3LRPA 3FPAA 3OHMA 2RKOA 2QGNA 1Z6YA 3PQCA 5G41A 3I32A 3T34A 2XZLA 4BASA 1TUEA 3L2OB 2OESA 5FBQB 4M0LA 1Z0JA 4URZR 5JBQA 3B9QA 4RJLA 1T8TA 4I81A 5JSZB 3A6PC 5FTKA 5H68A 4A15A 4OYHA 4QXAA 3CZQA 3ZVRA 4XTRA 1XXHA 3Q5DA 1OXUA 2KBEA 1IAQA 2AWNA 5DYIA 1R2QA 1Q0UA 1UBEA 4URXR 2QP9X 2QG6A 3P1JA 1U0LA 1UPTA 4JVMA 3TE6A 2CBZA 4LJ7A 2O52A 3SN6A 4C4PA 1MRNA 1XD2A 3LA6A 5CM9C 3ND9A 1G7SA 1OFHA 1ZW6A 3GQBA 4HAVA 1CRPA 1XEXA 3CPHA 2RHDA 1EFUA 2J0UA 5B2ZA 1CJKC 2GXQA 3CRW1 4PSAA 4M1YA 1W1WA 4ILEA 3N2EA 2VHJA 4DLZA 3VR2A 1TQ2A 4B32A 2WKPA 2N1BA 3GD7A 3M6AA 3OEHA 3W3AA 2DPXA 3QF4A 4HUQA 2WIAA 2BJWA 5AUQA 3I61A 3QBVA 1G6HA 3L8ZA 1O3YA 2IX3A 2R62A 3RC3A 4BFVA 1IXRC 1X1RA 3KJHA 2JLXA 1ETUA 2OUKA 2ATXA 1TF7A 4TYPA 5KNCA 1P2UA 2KWIA 1FP6A 3FMPB 3W6OA 2BBOA 5FI0B 4GP7A 1HH4A 3TJZA 2WMOB 4B71A 4LUCA 5A0FA 2I1QA 2G3YA 4DDWA 4V0KA 1U81A 4KYUA 1FZQA 3OEHD 1KAGA 3RRNA 4BFYA 2OLKA 4NCNA 1A5TA 4M9QA 1VECA 5JS8A 4ESVA 1FX0A 2FEMA 1E94E 3PUZA 2EFDB 4URWR 1OYWA 5KNBA 5L3VA 5C2JB 2RGXA 3K9NA 3SNHA 3TQCA 3WP1B 1KK1A 1DBSA 1UM8A 4B3XA 4IDNA 2IBMA 3T1QA 4JVSB 4A2PA 4TL7A 1QHXA 1PV4A 3I4LA 2YKGA 5FBRB 1KMHB 5FTMA 2WJHA 4M1SA 3KZ1E 1XPOA 2OFXA 3AUXA 4Q1AA 3U3MA 2QL6A 3GLIA 2G0TA 1LS1A 5J4YA 4LYJA 4EFLA 2HCJB 1XTSA 3P26A 4KITB 5IRCD 3R9XA 1JPNA 3L82B 1OYYA 2C04A 4O0MA 2QY9A 1J8MF 1F48A 1N6IA 3U7EB 1VG0B 1R4AA 1DAIA 1D9ZA 5HR5A 2ANCA 3PXGA 4JVNA 1OJLA 4J0QA 4AKIA 4OJKA 3THXB 3H4MA 1CKEA 1YZTA 2BDTA 1E9EA 1IJEA 3IPXA 3THWB 4HB2A 4YDSA 1VYVA 4R2HA 2FNAA 2VRWA 1S96A 1SXJE 3SOPA 4KLNA 4RD6A 2JDIA 4LHYA 3N2IA 4PPNA 3K70D 3BB1A 2VP6A 3B7GA 2ZRKA 1R8QA 3U2QA 1R0XA 2LKDA 4MRRA 4OK6A 5E4FA 3C15C 3K9HA 2W0SA 3IEUA 3T1TA 5JS7A 5DHFA 3JZAA 4NONA 5FPYA 5KHOC 3AP1A 1F2TA 3DM5A 3FVQA 2O8FA 2AKAB 1UEJA 2QT0A 4G3XA 5J40A 1ZMXA 1GNRA 1XFAA 3IO5A 3NDBB 1DS6A 1V5WA 4PTLA 4JBYA 3CWZA 4XSGA 4QHSA 4BGDA 2WBLC 3TAUA 1JI0A 2JDID 2ZRAA 3R20A 3AP3A 4NYJQ 1R0WA 4LSGA 2OXCA 4F93B 1HT2E 3I5YA 3ASZA 3L8YA 4JYBA 4BLOA 1XJ0A 4PFSA 4F4IA 3QKSA 4UXHA 4KI0A 1F60A 2DFNA 4KFTA 2JJ2A 1MV5A 4HAWA 4TLDA 1S3GA 1J70A 2O8CB 3UWOA 2Q3HA 3NVAA 1D6JA 3W5IA 2E87A 1UFQA 4LJAA 4JLNA 2JLWA 5EP4A 1LV7A 2FPLA 1P7CA 4CRWB 2DY1A 4MRVA 4DSNA 2CJWB 2GCNA 1GZSA 1Z47A 5E7JA 4IOMA 1H8EA 4PPFA 1XP8A 3CO5A 3T5GA 3ND8A 2AK3A 2JATA 2GK7A 4LYAA 3SQXA 1W0JA 3OF5A 2W00A 1RYHA 1E0AA 8OHMA 4LHWA 3EC1A 5B57C 2CCGA 3QG5A 3LDAA 2HF9A 4HDOB 1J99A 5DGXA 4OQNA 2JJ2D 2ZJOA 3MGCA 1OH8A 3HPQA 3MMPA 1Z3IX 4LWZA 2O8BA 4OK3A 3REFA 4G5GA 4D2IA 4HLUC 3OE7A 3U4QB 3WBKA 2PEZA 4U00A 3RRMA 4TSFD 4HB3A 1QHHA 3BGWA 4I99A 2ZRNA 2ZRBA 1H8ED 4WZ6A 4A2QA 5J5CA 4LHVA 4E22A 3AVOA 1W0JD 4DLYA 3AKDA 4D0LB 3CPJB 4C30A 3EPKA 4Q19A 2D62A 2EQBA 3BH0A 2GVDC 2R6FA 3PITA 2GXSA 2RGCA 3BAFA 1AGRA 3AKEA 3GJ5A 3ZVMA 1M7GA 4BFUA 1NIPA 4B2IA 4LI0A 4IFBA 4CVNA 4AY2A 1NVXQ 3AQ4A 1ZNZA 1S9DA 1MABA 3A1WA 3OE7D 2P0EA 2KB0A 5BYKA 3TBKA 4F91B 4HDCA 3KB1A 5CK4A 1TNDA 3LBIA 4ARZA 1ZUHA 4B3DA 4GZMA 2BCGY 1G8FA 3B8HA 2C95A 3SYKA 3ZD7A 4FI3C 1JECA 3HYRA 3FHCB 2PZEA 5GVRA 3QF7A 3GJ6A 2NTYC 4Q4AA 4MGIR 4HB4A 3TUZC 2GJKA 3VR1A 3CM0A 2NMVA 4TL9A 3TNFA 2LCFA 4M9XA 4NPHA 4OBEA 4Q9JA 3RAPR 1TTTA 3VR3A 5JRJA 3QXXA 2O0HA 4OI1A 1W49A 1PZNA 4TT3A 3CBQA 3W9YA 4A9AA 4CT5A 5KNDA 2FDCA 2Q3FA 2J87A 2YJTD 2ZS8A 4PQYA 4Q4LA 4C2UA 1M7BA 5DSZA 2OAP1 2V1UA 4RZ2A 3BBPA 5KDLA 1KGDA 4NP6A 4YMVA 2ZE8A 4TLCA 1E4VA 1S8FA 4DIDA 1Q1BA 2WJGA 3IHLA 3KTAB 1VG9B 4AKGA 1VG8A 2A7QA 3L43A 4Q4JB 2QU8A 3K53A 3TAHA 1HE1C 2TMKA 3F0TA 2W58A 1SHZA 4K46A 4MYUA 2F9LA 1CR1A 4TT3D 1ESNA 3WY9A 2IYXA 2D2EA 5JJIA 1SVLA 3ADCA 5D3MB 3PV0A 4MRSA 2PT5A 4P32A 1KMQA 4HLDA 1KNXA 3U5ZB 2OILA 1E9RA 1CR2A 1E4YA 5FPSA 5LD2C 3OIYA 2JLQA 3VQTA 2AFHE 1ELOA 4R2IA 2ZRPA 3UK6A 1FMJA 3SE0A 3GLGB 2XSZA 4JLJA 3FHTA 1NI3A 2JASA 3EA5A 1L4YA 1PLLA 3LV8A 1G4UR 2YHSA 1S1CA 4DIEA 3T1VA 1VIYA 2PX0A 5JSZA 3EWAA 5BWMA 4L5BA 221PA 4FN5A 5SZJA 4BZQA 3T06B 2H16A 4IOJA 4JLAA 4DLRA 4DB2A 2QM8A 1LNZA 2ZI7A 3Q85A 5SZIA 3LVQE 3LFUA 3RS2A 4TMVA 2C9OA 3GFOA 3A37A 1NLYA 1YE8A 4ACAA 2RAPA 2REXB 2ZSDA 2GTPA 4JMPA 4P4TA 1WBDA 2XSZD 4KJZA 1G1MA 4Q03A 1W4BA 1GNQA 1K8RA 3NWJA 1DOAA 4G5RA 4US2R 4LHZA 4AD8A 3CF2A 4HAXA 2IYTA 5SZKB 3NBXX 1RPZA 4DCVA 4D81A 1S2MA 5TDHA 3KQNA 3OAAA 4C0JA 4TZ0A 1T3LA 4QBFA 1KI6B 2REBA 5K8UA 5L3SB 1GKYA 1VKJA 4Q48A 4BWYA 2VA8A 1ZCBA 1E2MA 1KZ7B 1U2RA 3C14C 4NCIA 1SVKA 3NC1C 3SU8A 5B64A 1EK0A 1I4TD 3CRMA 3MCAA 4E03A 3A4NA 1KJWA 1FFHA 2E9SA 1G3MA 2ZE6A 1UEIA 2R44A 2ZEJA 1SVOA 1JEDA 2WWFA 4TLBA 2CE7A 2HXYA 5FBVB 4TQUS 3EIQA 1YZKA 2QP3A 1F3OA 4ZKDA 1F5NA 1XNJA 1U94A 5FL7D 1ZD8A 3S1AB 2ORVA 3OAAD 2XXAB 3A8TA 2ATVA 2FG5A 4HLQB 1Z28A 4X8OA 3Q5EA 4LOAA 3ZH9B 4NE2A 1VPLA 1UJ2A 2ZI4A 1H8HA 2MMGA 4A82A 1DEKA 1L7VC 3GEHA 4DVGA 4RY2A 1XMSA 1X86B 2ZQ5A 1M8PA 1N6NA 2C98A 4WA7A 1R8SA 1A1VA 5DH9A 5E7MA 2F1HA 4MA4A 3P27A 1NF3A 4RKEA 5FUYA 3TUJC 4EJSB 3JZMA 2UZ3A 3KJEA 3BOSA 4DEYA 4HATA 2REOA 2IXFA 3CR8A 4LY6A 3UMFA 4CF7A 4OK5A 2G6BA 5GJCA 3UG7A 1YQTA 3CWQA 1TF5A 3PG5A 2P5TB 4C2TA 1MO5A 1QRAA 1XMVA 3GEEA 5F98A 1ZVQA 1KMHA 5E7IA 4CT4B 4LJ5A 4DT1B 3J81k 1H8HD 1JEEA 3AF2A 4CEJB 3MAAC 1TQ4A 1IN4A 3BB3A 3UANA 3WRXC 2HEIA 2OV2A 1NY6A 2DFLA 3BFXA 2ERXA 2ZU6A 3GJ8A 4JS0A 3WNDA 4QM7A 3PEVA 4OI4A 1WXQA 1ANKA 4BZXA 2DBYA 3O8DA 5SZHB 4E07A 3I62A 1AS0A 1CJMA 4WZAE 2QRNA 2PX3A 4OHYA 5F2EA 4P33A 4P4UA 4MITA 1GSIA 2H17A 3RRZA 2FGKA 5CIWA 3THXA 1NJFA 1EWQA 2PCLA 4RVCA 3THWA 2HT1A 4ZDJA 3I72A 1EG7A 3AVWA 1W46A 3V00A 2BBSA 1E2QA 1KTVA 1SGWA 1N5IA 5JWOA 4XWAA 1GDDA 3LBHA 2OCYC 3CNLA 3DM9B 3KDSE 2ZRGA 3K09C 3TVDA 3EXAA 3I8SA 4NYMQ 4EFMA 2ZTSA 3CLVA 2CNWA 2C77A 1OSNA 2NO9A 3Q8XB 4OI2A 1A2KC 2QSYA 3I73A 1W36C 1JR6A 1XX6A 2BBTA 1TQDA 2C9CA 3C7KA 1W5TA 1IN7A 3B1YA 3G5UA 4LX0A 4IRUB 1E9SA 1NKSA 5L8VA 2QGZA 4KLZA 1D8TA 3I1FA 5G40A 1JR3E 3B2EA 421PA 3WMGA 1P6XA 3U44B 1T91A 4GRAA 2P65A 1TPZA 2WZQA 1E2EA 3BIFA 1KAOA 4LRWA 2CNWD 2V9PA 3EC2A 4PHGA 5DIFA 5JMTA 3VR6A 2D7CA 3QPVA 1FNMA 4YMTA 2O8CA 2AKYA 2J9RA 3KB2A 4RSGA 4OQMA 4BLQA 4IXNA 3EZ6A 1II9A 3GLHB 3KKNA 1DPFA 3NEYA 1XCPA 2FZ4A 1AN0A 2O0KA 1GFIA 4P0TA 3C5HA 5JCPA 2OAQ1 3AEZA 2CJWA 3PVSA 1N5JA 3IGFA 4G5SA 4NZYA 3AF3A 1IM2A 2CHQA 4CDGA 3SZRA 1OXSC 2ZRHA 1Z6GA 3K9GA 1G19A 3QIAA 3T15A 4EPVA 1T3SA 5CK5A 1EESA 2IEZA 3L0PA 1N6LA 2O0JA 2W2VA 1SHKA 4K8OA 3U3KA 5EE3A 4JSYA 2J0VA 4F92B 4A92A 1DAHA 2B8TA 2DCUA 4TLAA 3R9WA 4WZBE 4B2LA 3CNOA 3W5JA 1QG4A 3IILA 3EIHA 3MSXA 3U4QA 1FUUA 3CRQA 1G291 3K0CA 1FTNA 4IDPA 2JLRA 3AP2A 1R0ZA 1SVWA 1DE0A 1KDRA 2F3TA 1NRJB 4R7ZA 3BC1A 1Z0DA 3W3ZB 1MRSA 1J7KA 1NVUQ 2HF8A 1P75A 3KFXA 1IBRA 4IEEA 3NTUA 4BEJA 2C9YA 2A30A 1DVRA 2ERYA 5C4GB 4H9GA 5FPTA 2BVNA 1LF0A 1IN8A 3AVUA 1OPXA 1SXJB 2RGDA 4AI6A 2VL7A 4A6PA 2QUZA 4K81B 4YQFA 4WOPA 1N0WA 2ZI6A 1ZYUA 4Q1EA 4BRWA 4GOJA 4PR0A 1FQKA 2F1IA 2NOAA 1MO4A 1WB9A 3QXHA 3SEAA 3RHFA 4MGZR 1E2PA 1KO1A 4GNKA 4EPWA 4ZCIA 1FUKA 4XIGS 1B23P 4BLRA 2DHRA 2X1VA 2JJ1A 3MRSA 4ZPXA 1E0JA 1RW4A 3B5JA 4P4SB 2A5JA 4L8GA 1WA5A 2C96A 1AKYA 1YRBA 4TLEA 1KI9A 1Q20A 2QA5A 3PCRB 2JIZA 1LFDB 1TADA 4G5QA 2WWYA 2CMKA 5IF9A 3B60A 3K0AB 2IYUA 3WNCA 2C2HA 4PSKA 1KDTA 1N25A 3QE0A 4D6PA 2FFBA 4GL2A 4Q7LA 1ZIPA 5KSOA 2FF7A 3CB4A 2ZETA 4LPKA 1U0HC 3MD0A 3KTAA 2GZHA 2JJ1D 1XCMA 3LXRA 5FTJA 4B3GA 2G83A 1CR0A 1OIVA 1OLOA 4Q4JA 5CYOA 2AL7A 4IKEA 3IQXA 4B48A 2P6RA 2RGEA 3TW8B 1CU1A 1QHIA 2KE5A 1RIFA 3QBTA 4Q9IA 2JIZD 5EQTA 1W7AA 4OI0A 2ZRFA 2JCSA 4U5XA 4Q7MB 3WYFA 1OB5A 2PH1A 4JT2A 3QPUA 1KJYA 4YDHB 5D3MA 4Y0VA 3AVYA 2R6GA 2ECKA 2RGAA 2VSXA 1COWA 2WSSA 5FBLB 1NN3A 5F9HA 2Z5FA 3CF6R 1NBME 1D5CA 3IDQA 1HA3A 3BK7A 3GLGA 2FA9A 4DCNA 3P4YA 2JGNA 4DZZA 3UPUA 4PQFA 4BFWA 3GJ0A 1AGPA 4Q47A 5F3WB 4KFRA 4MYHA 1XTKA 6Q21A 2ZRDA 4DEXA 4TTPA 1SKYB 3F5FA 1U99A 3QY0A 4LJYA 1XF9A 2WOJA 5TB5A 4M1TA 3PUYA 3KXKA 2WICA 2O5VA 2D7DA 3T1OA 2A5DA 2BM1A 1COWD 2WSSD 4F4CA 4V0NA 1KO5A 3OIWA 2WTUA 2VP0A 2CEAA 1T9HA 3P32A 1Z0KA 2ODWA 4G0NA 1RKBA 4IDHA 2QTVB 2WVJA 3VAAA 3NC0C 5J4KA 2X19A 1IJFA 1GL7A 1L8QA 2KBFA 3EWSA 3QQ5A 4FMDF 4GBMA 4HLCA 4IOLA 4WAUA 4JL6A 2QPAA 1CJTC 2WV9A 4LYHA 1G8GA 2FPKA 1NVWQ 3DZ8A 4IEIA 3W6NA 3QI2A 1ZD1A 1KI6A 2ANBA 4YXWA 4TYNA 2NO1A 1T5LA 5L3SA 4D82A 2ZR7A 2GILA 3DPUA 5LPNA 1JAHA 3EZ2A 2Q9AA 2WJYA 4G1UC 5AJVB 4JLVA 2ZITA 2P5SA 1A4RA 2H92A 3GJ3A 2IYWA 3KUCA 3N5CA 2FFAA 5M04A 1C1YA 1OHHA 1DG1G 2XTZA 2RGBA 3GEIA 4JSTA 3H84A 2FH5B 1G16A 1XTQA 2J45A 3A36A 1F6BA 3N70A 1I2DA 3S1AA 3SYLA 4N0EA 5DI9A 2XXAA 5KYKA 3FOZA 1IY2A 4D26A 3GLHE 3CRRA 3NHBA 4YXWD 1U9IA 4TL8A 1GVNB 3RWOA 1T0HB 2MSDB 2WKQA 4UXIA 5JWRA 4QGHA 5JZVA 1RJ9B 3WHKA 3PUWA 2PBRA 4Q4HB 2OE2A 5DN6A 4F4JA 4M22A 1FOEB 4OL0A 1OHHD 2BBWA 1UF9A 1AK2A 4TMWA 1YHNA 2NO6A 3BERA 4YMWA 3SHWA 4EJSA 4DSUA 3AVPA 2FSGA 2PT7A 2QRZA 4M8NE 1G5RA 2C5LA 2EFCB 2ORWA 3LW7A 1OE0A 2OBLA 1KY3A 3A1VA 3FMFA 1RVDA 1ZRHA 5FPHA 3NH9A 4DT1A 1GP2A 5CJPA 3L0OA 3DEFA 1NBMA 4GT1A 3ICQB 2FJUA 4CEJA 5G53C 4V0LA 4BQSA 3PIRA 1OXXK 4TMXA 5DN6D 2IYRA 2KSQA 4DJTA 2VHQA 2Z4RA 3ZJYA 1OFUX 1GIAA 2QM7A 2J7PA 4PX9A 4AIIA 4B74A 3K70C 3U7GA 2CLCX 2X2EA 1I4DD 4JLMA 2HT6A 1Q3HA 4BLPA 1BIFA 3G0HA 3RC8A 4MKFA 2B7BA 5EE5B 3B6EA 1M34E 1VHLA 2RB4A 2XB4A 1NBMD 1OW3B 2CHVA 1WDTA 2GEVA 4JKYA 4MDFA 2OZEA 1YZQA 5LB4A 1KIMA 4GFDA 1XTJA 4Q9LA 3IBGA 3THOA 3C5CA 2H5EA 2JLUA 1ZNYA 1GITA 2D2FA 4RD4A 4JT4A 5GADl 4JZKA 4Z1MA 2H7VA 2FSIA 4Z51A 2IYVA 2J7PD 2QENA 2DWQA 2J0QA 2WIBA 1KHTA 3FMIA 3QVUA 4V0ME 1GKIA 4QGFA 3V9PA 1KK3A 3W90A 3ZS9A 5AUOB 4PO8A 4PO1A 1E2NA 2P6UA 3CW2A 4E5UA 1VIAA 2QMUA 1U98A 4FMCF 5CB6A 4JKIA 4DCSA 1SKQA 3D3QA 3ZZ0A 3PEUA 1AKEA 4Q00A 2XJ9A 4I1SA 2AN9A 4KV9A 1PLKA 2DFTA 5BXQC 4DSTA 2GXUA 3WMEA 5JFGA 3U44A 5DNYB 2RHMA 2VLIA 1VYUA 2NPFA 5JI2E 3KJIA 3LAWA 1W2GA 4Z1MD 2IYZA 3QVVA 2LKCA 4LBVA 1P3JA 4B3FX 5FOWA 3CUEF 1L2TA 2BWJA 3K9LA 3W8RA 3AVQA 3FDIA 1H65A 3GLHA 2EW1A 3QKRB 1NNEA 2VIIA 1G3UA 5TV2A 2XB2A 4YONB 4V02A 4PSVA 3NDPA 1WBBA 4EAQA 3PEWA 1XDBA 1EFHA 2ZRMA 3AF1A 4JJKA 1QHYA 5D3QA 2NO0A 4US0R 3VR4A 1UADA 1CIPA 4HI0E 2BEJA 1ZM2A 2FV8A 4I1UA 4DLXA 1IY1A 4W7SA 1G21E 3P4XA 3FWYA 5J47A 2HDNB 5KSPA 2EFHB 2ZUBA 1MH1A 3CR7A 4B47A 4Q7KA 4JLDA 4M21A 2WMNB 1DAEA 3OIVA 3EAQA 5E3HA 1SKYE 1YKSA 2RGNA 4M1OA 2ZJAA 4CZ2A 1SULA 2PMDA 2XNSA 1JAIA 3GFPA 2GBLA 4PAOA 1NL3A 3HU2A 1N6PA 1J90A 3KKPA 1KY2A 5CITA 1RC8A 1W4RA 1E9FA 4ZV4A 1U0JA 4PC2A 3D6TB 4BZPA 5AJYA 3TIFA 2ONJA 4L15A 3K0FB 3X1YA 2VH5R 3DOFA 3T5DA 1SXJA 4XSHA 2ZI5A 3DL0A 2AD1A 1OKKA 1R7RA 3TSWA 5A5GA 4GP6A 3REGA 1NG9A 5P21A 4KODA 2VO1A 4HAUA 2QROA 4M2LA 5DE3A 1P61B 3EIEA 3BORA 4S2EA 5EP1A 1GOTA 3O8BA 4D4MA 4GZLA 1K6MA 3O8RA 1BYUA 1T6NA 1XBTA 2I3BA 4EIWA 1CBUA 1SXJC 2Q0HA 2XITA 1IN6A 1OB2A 3SHFA 4P4SA 4V0MA 4RCZA 4EPYA 3LQQA 1DAKA 3HWSA 1VMAA 4KFSA 4DUGA 2V3CC 2GJ9A 1SXJD 1G41A 2P6NA 4ZCLA 2XZPA 3C41J 1E2IA 1GKUB 1OKKD 2F9MA 4AURA 4CIDA 3RS0A 1Z29A 3H0KA 3K0AA 5FH9A 3VNUA 5JCZA 4A8JB 3NBYC 1TEVA 3TQFA 1OFTA 3SS8A 3GLFB 2HXSA 1T5IA 4QG7A 4EDHA 5H1YA 3B78A 1C9KA 2ZANA 4JL8A 2D74A 4PZZA 4Q18A 3SFZA 1P9RA 2VPPA 5FR1A 2ZUCA 1SVIA 1YR9A 4UKDA 1N6OA 2IT1A 5HCNA 3DO6A 1GL9B 4KFUA 4DUGD 4KSBA 4C0QC 2IS6A 1IY0A 1Z22A 3R9IA 4OHZA 1UAAA 1VHTA 3LWNA 2IYQA 1G18A 4LJ8A 2ZAOA 1II8B 2R9VA 4ESHA 2IUTA 1HQYE 2FZLA 4NL4H 1ZU4A 4XTCS 3OFNA 4TYYA 2AXNA 3RWMB 4RKFA 1Z2CA 5AWFC 4IHQA 1OT3A 3QXJA 3WNBA 3W6PA 4LJ4A 1EFTA 2HV8A 2ZIAA 4F7WA 3ZVNA 2XTMA 1ESMA 1N3BA 2DFKB 3M4YA 5KOYA 1NN0A 5C4MA 5KDOA 2WJIA 1HQCA 1ZJ6A 4JJZA 5GVSA 1G7RA 1BMFA 2W0MA 1W47A 3UIEA 1Z83A 3CZPA 3GJ7A 3RS4A 1Z08A 5EJEA 4BPBA 1JJVA 4OHVA 4KVGA 4WVFA 2GAOA 4LJ6A 1HT1E 1N6RA 4Q02A 1SVSA 3K0SA 1NVVR 1ZM9A 4TWZA 3OFND 1I4LD 3MWJA 4BUJA 2IL1A 2QPOA 4NYIQ 1QHSA 2QAGB 1LB1B 4W5JA 2WKRA 4B6EA 3FHOA 1KI1A 2AHOA 5FR2A 2BCJQ 4QBIA 2PJRA 2RH5A 1Q44A 4YC7A 1P9NA 5C1BA 1DAGA 1OIXA 1DELA 4MUBA 4XWKA 4HB0A 4PHFA 1BMFD 1HY3A 2ZR0A 3ZYCA 1EGAA 1KKMA 1ZBDA 2ZREA 1G64A 2YWEA 4KYIB 4UJ3A 2PJZA 2OEPA 5KPJA 1DG3A 2R2AA 4HEJA 1WCV1 3X1XA 4B73A 3U61B 1IXZA 1OH7A 1Z0AA 1G8YA 1FPMA 2BIFA 2HUPA 2PZGA 3AF0A 5JECA 1P2SA 2VQSA 4OQLA 3SYNA 1A82A 1KI7A 4DLWA 5KO2A 4P31A 1NLFA 2W6IA 2NZ8A 3GP8A 4MQBA 4WIAA 3LW8A 4QGGA 1XMIA 2DR3A 4U02A 4BE7B 3NKVA 4C0BA 1N0VC 4JVLA 4PANA 4BFZA 1Z5ZA 1W2HA 2GHIA 2DYKA 2OCPA 1P2TA 1U90A 4QM6A 4E09A 1AA9A 1X1SA 3EPJA 1K5GA 2N42A 2GRJA 1HE8B 1ZC4A 1TAGA 1RJ9A 3E70C 1TL7C 2V7QA 4Q4HA 2HYIC 1QVRA 1AS3A 1Y3AA 3LH5A 1RZ3A 4Z8YA 3WXMA 1G3RA 1G9XA 2BMEA 4DCTA 2W6ID 3AB3A 5AJWA 4JYCA 2ZJBA 1RRPA 1DAMA 2IYYA 4TQ9A 2FFQA 5BN3A 3FYHA 1P73A 2ZE7A 1X8JA 1JALA 5DI3B 2J46A 4HAYA 5IDVA 1P9WA 4NMMA 4DC9A 2AXPA 1UKVY 3EZFA 1Z07A 3AGQA 3ZQ6A 3T35A 4NDZA 4NHOA 4Q1DA 4EPXA 2GCOB 2V1XA 5L3QB 4XD7A 4KVAA 2V7QD 1E79A 2ZI9A 4JBXA 3RS3A 3MWLA 4HSEA 1G3QA 2G77B 3IUYA 3NBFA 3WHLA 2VTKA 5KTYA 2QP4A 2Q3MA 1KKLA 5TVKA 3VU9B 2F43B 1DADA 4AK9A 4ERNA 2Z0MA 2QTHA 4PAQA 2NG1A 4LV8B 4B34A 1TUIA 4RFSB 4M9SA 3F8TA 4W5WA 4BECA 2OFWA 4YMUA 1JNYA 4ASUA 2P3SA 4RD1A 3GPLA 5JEDA 1UDWA 4GPTA 1NSTA 4IXMA 3AGPA 5HZKA 3TGPA 4XD7D 1FNNA 1PUJA 1E79D 3TH5A 1W0KA 2NIPA 3B1WA 1FTSA 4ZO4A 2CK3A 3B13B 5FOVA 4B44A 1KSJA 4Q9KA 1CR4A 1Y63A 1Z0IA 4D4KA 3RS7A 3O47A 3TR0A 1GAJA 3HP1A 3QKUA 1Q3TA 4TMZA 2QEQA 1FP7A 1G7TA 3Q7QA 3KUDA 1GRNA 1L4UA 2EWVA 4FMBB 4HZUB 2XEXA 1WRBA 3X2SA 2JAQA 4ASUD 2IS1A 2YWHA 3A1SA 4QBHA 4V03A 2W6JA 3QENA 1XJCA 2CVFA 2JLSA 2YWFA 4BLTA 2PCJA 2Q9BA 4MRNA 1WE2A 5FUVA 3EPHA 1P60A 1W0KD 2XTNA 1CRQA 4Z54A 1PUIA 3GLFE 2FPMA 5CJ2A 1Z6TA 2V4ZA 2CK3D 3WBJA 2ASEA 2BMFA 3DDCA 1S3SA 4Q66C 4C0SA 2CL7X 4LDJA 1RRFA 1PLJA 2BKEA 4Q5IA 5TY0A 4ZDIA 4EFNA 1OH6A 2WM9B 4P3YA 3C4JA 1CJVC 3W34A 3QKRA 1AM4D 4DWJA 4IJMA 3DOEA 1XD8A 2ZJ2A 1YRAA 2V54A 4Q01A 2ZJZA 2EFEB 1GL6A 3VHXA 3H2YA 1T3HA 2G1JA 2W6JD 4O25A 4EQ6B 1NN5A 3BE4A 1KO4A 3VKHA 1VDZA 3IIKA 4WXRA 2DB3A 2FEOA 3SJZA 1E2GA 2MSCB 5FOSA 4ZDKA 1IOZA 4RFVA 4MYTA 5FOTA 3GJXC 3IPYA 3AVVA 3WRYC 4KCGA 2JA1A 5EE9A 2OHFA 2ZJ8A 2FGJA 1XMJA 2QQEA
chains in the Genus database with same CATH superfamily
1EK5A 2ZVPX 4J4HA 1Y6ZA 3TCNA 2A9PA 3EW7A 1T1AA 3M70A 1YRWA 4TTRA 2HDQA 1A88A 3B2NA 4IW3B 4RDXA 1D9XA 2H57A 4UARA 1NBOA 2ZSBA 3G9QA 1W30A 3GRFA 4KPYA 1O94D 4J07A 4B4DA 1B42A 4KTTE 3O4JA 3KE8A 2CZQA 2VP2A 3E82A 3FKSA 2WTBA 4Y2SA 3UG6A 3KPYA 1GPJA 1C7JA 1H0RA 1GGVA 2OQVA 4UAUA 1VGQA 2Q3JA 2PNFA 3FIUA 2ZS9A 3FWHA 4C05A 5BN5B 4KRFA 4F71A 5GONB 4GXQA 1QX4A 3HZOA 3VTKA 5BQ3A 1PJSA 4FJ1A 2RMKA 3D6AA 2ZL1B 4EAAA 5T6BA 2WAYA 1XD9A 4EUNA 3ASUA 3BK2A 3O3CA 3R4CA 2QN6A 2JGAA 2F64A 4J43A 4DIFA 2PZ8A 4A6XA 4JPMA 3NHJA 2WVGA 2C88A 5JXIA 1W25A 1DAFA 3TQSA 1S5PA 5CH3A 3HGMA 3GEGA 1BYIA 4QTYA 2H5JA 3K4PA 3LNCA 4EB0A 1L7BA 3D43A 5ARBA 1X42A 2B5WA 3OEED 2E48A 1ZITA 3EVAA 1E9CA 1JG1A 3I30X 4RY9A 5AM1A 2V59A 1P6UA 2CKDA 5CFLA 5F7OA 4WL0A 1Z5WA 5IH7A 4B4VA 3URMA 1JB1A 1SCUB 5CJJA 1E4EB 4GNRA 3JQEA 4C7OB 1D2NA 3LCCA 1QBKC 3H65A 4GDFA 3C3WA 5FUWA 3LY5A 1YZFA 5IZ4A 1QGYA 3QSGA 3GN1A 4PG5A 3TX6A 3A32A 4EARA 2DWOA 4R1MA 4NFLA 3DDWA 4DSOA 1I3MA 4AJPA 3G5MA 3DBVO 3BFPA 4KMMA 2QLBA 1FNBA 3OTQA 3H3FA 1U2GC 4X1IA 3DE0X 1DLJA 4FBGA 2YRFA 4CT0A 2H4XA 1W36B 4OGWA 4AJ9A 1N9LA 5CDFE 2WJVA 1OWLA 4MVWA 1N9OA 2BFWA 1Y7TA 4E1BA 4RTRA 3NV7A 3U19A 4F85A 4HDKA 5JDIA 4JI3B 4QODA 3LP6A 4UA7A 4JF5A 3HR8A 2FWMX 4D9FA 1ESDA 2R8ZA 4EA6A 1H4SA 3ZK9A 5CRIA 4Q1BA 2BGRA 5CDSA 1OU0A 1A0OA 3R76A 2IYPA 3U3JA 1JU3A 2V0CA 1V43A 4GHIB 4BWFB 3FAKA 4DM7A 3G1TA 2BPOA 1DEHA 1DIGA 1WD7A 5FEGA 4K0KB 4AZ3A 1Z25A 2HHAA 3AKYA 4YREA 4WN9A 4M7OA 2WDZA 3MJSA 4L50A 1QWSA 1XA7A 1TO6A 2GBLC 2JFQA 1L5WA 3WWEA 4FT4A 2PZJA 3T7JA 3IQZA 5DTJA 1HPLA 4GGMX 1QFMA 4BO3A 3FZCA 1F12A 1UWCA 1GZ5A 3R5SA 5KAPA 3T4XA 5CDFA 3D7SA 5B3AA 4A1FA 4PZYA 1NXYA 1H1DA 5KX5B 4M1QA 4F9FA 6REQB 4J7UA 3V8VA 2VF8A 3PC8C 3R6LA 5F1PA 5HGJA 1EVKA 1UDXA 3O84A 4E21A 3OECA 3UFBA 3Q7VB 4B79A 2H59A 2ZUUA 4RC9A 2IHBA 2Q5HA 4MBKA 1IBKB 5SY6A 1FFXB 4ZEOA 1UMDB 3BWVA 1I7LA 1T3TA 3QITA 5FQ9A 4EYQA 3HB1A 4GLBA 2ZIXA 3RFUA 1ESZA 5U9CA 1BXRB 4L0QA 5CLJA 4MGHA 5E95A 4DE2A 2HDSA 1STZA 1TK3A 5IYZB 1PT5A 5D1HA 1E61A 1JP7A 3OPYB 1X38A 1YF3A 2LGJA 3ZHVA 3QW4B 3R2JA 1SPXA 2ZYSA 2IP2A 4YPFA 3NYIA 1XCBA 3PI7A 3HLFA 2R8RA 2X2PA 4F11A 1WU8A 5F1YA 4NK5A 3T3PB 1QOQB 3PD1A 5IAEA 4UE6A 2CVHA 1JPUA 3IVXA 2WWRA 1IXSB 2HF6A 3UOGA 1X9GA 3ZG5A 1YZNA 4MV8A 2FSHA 5FTNA 4QXQA 5T67A 2VGLS 4FSHA 3UAGA 5GOZA 2IYLD 1MRZA 2JI9A 2CJPA 4TYWA 2OXRA 4DILA 2IPXA 3TOZA 3M5CA 2QTNA 2YVUA 1MW9X 1QRTA 3JQAB 5JQGB 1KVUA 3BQ9A 4RCYA 4BO6A 1E3MA 1TMYA 4P5DA 2XQKA 2JLCA 3SEZA 5HJ5A 2ZSAA 2VTVA 1ZFNA 3ZTYA 2FSUA 2Q6OA 4Y13A 4A27A 4BEVA 2NGRA 4MAMA 3QJYA 4OBBA 4DKXA 2YC4C 4BX2A 3NHSA 2X2FA 4ZAGA 5TIIA 1XHEA 3ZXIA 4IIBA 1NBWB 3TEMA 4GX0A 1JW9B 3GRYA 3HCPA 2Z43A 3CUKA 1TCBA 2ZDHA 4B3CA 2CBXA 1TU0A 3ZXSA 5FQQA 5IKOA 4X7MA 1UPAA 4LW8A 4QATA 4UZSA 3OJOA 4YFVA 1FFAA 1GTVA 3QX7A 4M8SA 5IVDA 2AQHA 3EDCA 2V0GA 2V7XA 4XQGA 1K2WA 3ROGA 3GMDA 5E6UA 4W99A 1GY8A 4B93A 4MQEA 1V4BA 1N92A 2BJVA 4PGMA 1C41A 1BGVA 5KSWB 2QW0X 2OCGA 1MJ5A 2O2HA 1XNRB 4L9SA 3B51X 1CEXA 3QUSA 2IC5A 1UBFA 4D9JA 4ARZB 4QPDA 2CHGA 1N1MA 3I1JA 4QUHA 2Y2HA 1NR7A 1L3LA 1HDGO 4D8YA 4K0WA 5K4GA 5IN4A 1T8RA 1F2UB 1MX9A 3WWCA 1IVNA 4FPXA 1BEEA 5L4SA 1J4AA 1AG9A 1Z2AA 3OC6A 1HO3A 4A8JC 5K99A 5G4LA 2JGDA 1GNLA 1VL8A 1QBGA 5HIIA 1UAGA 2W3GA 3DTEA 2GPBA 2AG1A 2O6LA 4XVQA 2ZYTX 3G2NA 4HWSA 3AJ8A 4V0SA 5FA7A 1L3BA 1H2YA 1Z6YA 4RY8A 3I32A 3NVDA 2PS1A 5ITVA 5FBQB 1V3QE 3I04M 1MD9A 1AZWA 2FUNB 1ST3A 5H68A 4K1XA 4XTRA 2WJAA 4FM9A 1R2QA 2WIDA 1EHIA 4F2PA 4GLLA 1OFHA 3EMDA 2BI4A 4RE5A 2GXQA 2DJ5A 3CJRA 2EX9A 3BYDA 4ZO6A 2FPOA 3OX3A 3E1GA 4E32A 2WF7A 1IK6A 5H3CA 2XF3A 2PANA 3LY3A 4RX2A 1ETUA 1WCIA 3NC4A 2KWIA 1C8BA 5C53B 4LUCA 2GNXA 4DDWA 1MJGA 3RRNA 5IC5A 1ZN7A 4B83A 4LFAB 4AJKA 4M9QA 2XWJI 3CZMA 1NVDA 5EEHA 5L3VA 3F1PB 5KWVA 3TFWA 2GARA 2G4LA 4RADA 3OZCA 4ENVA 4TROA 2QRVB 2ZUWA 3LXMA 2O9CA 2CY0A 1Y1TA 3ELUA 3N53A 2O48X 1FBTA 2ANCA 3CVJA 3LCVB 5IJ9B 1OJLA 2GJ3A 2BDTA 1VYVA 3W78A 4R2HA 3ELDA 2NSJA 5EM1A 3F7NA 3RBAA 2QGFA 3DQZA 5FX2A 2YX1A 3JZAA 5KHOC 3NUGA 3LT5A 1GNRA 1E6MA 3C8HA 5EVCA 3EXFB 4HEFA 3W2TA 2QVGA 3M1LA 4EHJA 3BCSA 1XJ0A 4BNDA 3H5IA 1QMPA 3H3JA 3C6BA 1SK8A 3VZSA 2XCLA 4FNOA 2WE8A 2JFPA 4JP5A 4M0KA 1GZ3A 1RYHA 1G5UA 3EC1A 1JR4A 3MMPA 1HC7A 4RAOA 4EHIA 1JWLA 2AC2A 2AJTA 3BHJA 3B52X 2ILTA 3ZWCA 4H35A 3GH3A 2R6FA 1DDGA 3DUFB 3V42A 4IGKA 2AN5A 2EX1A 1NIPA 3T7IA 4B2IA 2FUG1 1MGOA 3CURA 4AJ4A 1NOKA 1NW8A 4GWGA 1F8UA 3UF0A 1N78A 3WWDA 1PP4A 4N6OA 4P4NA 3BREA 4C6HA 1OTXA 1TTTA 1T0UA 5LQDA 2XK1A 3BHIA 5KNDA 3SC2B 1C5KA 3GRRA 1KGDA 2RHWA 3GVXA 1T1RA 2O2DA 4FGUA 1JN0A 4FYKA 2HMYB 4AKGA 1V5FA 2IEIA 4S1WA 3FROA 3HA2A 4ZHQF 4KGDA 2FUEA 1CUEA 5TNXA 2ZJ4A 3DULA 3D6HA 4U8HA 3FHTA 1Q5PA 2JAUA 2O7RA 3PDWA 4L4YA 2O2ZA 4BWVA 2INWA 1BQ4A 4XAQA 4MV9A 4UMDA 1ABFA 1RADA 3GFOA 4YRQA 3NB0A 2PHYA 3WO1A 2IYTA 4ETXA 3QUQA 4UVGA 1TJ4A 9LDBA 2QN8A 3C14C 2I1WA 3CRMA 3KX0X 1YJXA 2H1WA 3DZCA 2J3JA 4DUZB 1XNJA 1UKCA 2RSLA 3IJ5A 1F2VA 1VPLA 1LJLA 2CBGA 3TNYA 3E3MA 4Q93A 3IJRA 1PRYA 2QV0A 2QDKA 2VKSA 3VVCA 5DGTA 5LOVA 2JH8A 1IOWA 4LJ5A 4XCQA 1N5OX 3AF2A 5EZYB 1EM6A 4CDMA 4BDTA 2FE1A 4JS0A 3S2SA 5CNIA 3O8DA 2R4UA 3I62A 2R7MA 3ANMA 1V9YA 4YCLA 1P31A 3GWZA 1Y0BA 2J5QA 5CVVA 1YCHA 5CFQA 3V00A 1ZUD1 4N1XA 4U5QA 5K03A 1NF9A 2RFLA 4OI2A 4QPJC 1JR6A 5A06A 3AGEA 1Q14A 1XZKA 3SNKA 2I2WA 5CTMA 1W5BA 3ANLA 1PZMA 1F9IA 4PYRA 3B2EA 1G9SA 2B5OA 1UK8A 3BIFA 1KAOA 1PJAA 5HOQA 4B1FA 4RQBA 4U2CA 3VR6A 2D7CA 4YMTA 4QYMA 4W82A 3OZWA 1AN0A 4EUFA 1NUHA 5CUQA 5IASA 4AO6A 3NVMB 3QPBA 2ZRHA 1WOMA 1R5JA 4JSYA 3VYVA 1Q6ZA 3R9WA 1GTSA 3GMSA 3IAS1 1V4NA 1H1TA 5IVIA 1Z0DA 3RTAA 1JL3A 4X1KB 1LLCA 3DV0A 1MV8A 4PU0A 4TTAA 2Q2QA 3Q3HA 4UBOA 1VIVA 3T54A 4Q05A 1FSFA 2F1IA 1LVUA 3UMGA 1E2PA 3QNCA 4RVSA 1L1FA 4R9SA 4YRKA 2KMLA 4H7DA 1RPJA 5DBOA 4G5QA 3KUXA 3K0AB 2C2HA 1KDTA 4GL2A 2YWCA 4LPKA 4DA6A 3ECAA 3MD0A 3H0CA 5I7HA 3SEQA 3GLKA 2WKHA 5COAA 3OOJA 1Q0TA 2HMWA 2VT7A 5A4KA 5J4EA 1U02A 2YWBA 1RQGA 5GIPE 5KIAA 1IY9A 3IDQA 4HRVA 3GLGA 1LTHR 4I2NA 3GJ0A 3JVDA 1VB6A 3C5AA 4KDRA 4RK4A 3UV7A 2WOJA 1H66A 3UMJA 4DLPA 4Q8IA 1UQRA 2CEAA 1OT5A 4ZYXA 5KEIA 4KIFA 4RHYA 4FMDF 5JW6A 2KW5A 4GBMA 1SBCA 1JHYA 3QU9A 4JROA 4MARA 3Q88A 3BYZA 4IEIA 5CDGA 2JEZA 3H4TA 5CXWA 4C7JA 1VSTA 2V7VA 2FVYA 4DDYA 1W35A 3CV3A 5E0OA 5GM1A 1R12A 1NJ2A 4WNYA 3ZHHA 2MDTA 2W6NA 2WKQA 3IHTA 5B4VA 4OKIA 5HD3A 3QHYA 1H6DA 3RXXA 1G63A 1N2BA 3HDVA 2X42A 1XTTA 1EWYA 1KY3A 1ZRHA 3I12A 1X7YB 4IBXA 2OZLB 1FFCA 2DNSA 1OXXK 3DFIA 5MN6A 5NULA 2HDWA 3RC8A 4MKFA 1A7UA 4EQ1A 2FPIA 3M5PA 1V8DA 1W8IA 5L09A 3OCYA 1U1CA 2DKNA 4FOSA 2J7PD 1CYDA 3K73O 3CT4A 5AM2A 2QMUA 4FMCF 1YMUA 1XI2A 4PLGA 1SKQA 1ZH2A 4PQEA 2DFTA 5BQFA 4WT7A 4Y2PA 4OSEA 2BWJA 4TTJA 4XIIA 5BQPA 3VV3A 4CV1A 4Q3EA 3FUUA 4PICA 3UICA 5L6MB 1ZK1A 1X7WB 3C6ZA 2E49A 3EAQA 5E3HA 4M1OA 5IAJA 3GFPA 1R8XA 2LE0A 2FFYA 4EQIA 2MYUA 5HARA 4MVCA 2W3HA 3MZDA 2H1VA 3TIFA 3ROFA 4L15A 3DL0A 1M1NB 5AFSA 2CW5A 4HAUA 2QROA 4M2LA 4GE0A 4S2EA 2FG7C 3O7WA 3DEAA 2Q0HA 3KUKA 1IWBB 3E22B 1DAKA 2QYOA 4K03A 3K1YA 1ZN8A 5ALVA 1JSRA 5F64A 1XZAA 3TTXA 4GKUA 2AZMA 2CMFA 1ENOA 1OFTA 3BZUA 1QH8A 3NULA 2H4ZA 3COVA 5FR1A 2IT1A 2HK9A 4H7HA 1WNFA 1CVRA 4JDUA 2OHIA 4UQIM 1TYAE 5A03A 5KSCA 2O19A 1A5AB 1Z2CA 4IHQA 2BGUA 5AWFC 2DC1A 4WASA 1CT9A 5C4MA 3G8BA 2P6PA 4LS3A 4CQMA 1M6HA 3PHCA 1JJVA 2GAOA 4ABTA 3PWZA 4Q02A 3BFGA 2BY4A 4B3JA 1LRKA 1X0XA 4MVJG 4L7QA 5FR2A 3DTTA 4GGOA 4PF1A 4MUBA 2UYGA 1EGAA 3F4LA 5BV7A 3UCXA 1Z0AA 3SJ7A 2PWAA 4P4GA 3JWEA 4DLWA 5ICEA 2YDYA 1CQAA 4E3KA 1KEWA 1PNTA 2EJBA 2VRCA 1E7WA 1E58A 3OT4A 4OP3A 4RCVA 3FDZA 5DBHX 4EFKA 1LBSA 4I5FA 1RRPA 5ALDA 4HVLA 1NRIA 1J2RA 1QIHA 2HLPA 4GSLA 3N7TA 1UBSB 1P3DA 5C5DA 3DEZA 2HK7A 2WUFA 1KFBB 2F43B 3B12A 1ND5A 3MNFA 1LPPA 2L2QA 4BECA 5HJ7A 4IV0A 3DAOA 3RVQA 1WZUA 1JFVA 1E89A 2LPMA 4BU0A 5EKUA 3EPPA 1Z0IA 3MT8A 3OOVA 1U3WA 1V0JA 2HA0A 1G7TA 3KHTA 5CG2A 4M86A 2OWJA 1OAOA 4XUXA 3DTMA 3TDMA 3KS9A 3FJOA 5BR1A 4V1CI 3WWPA 4KQIA 1RJGA 1MP0A 1DZ3A 4CUJA 4FS3A 1I3CA 4L78A 5HFAA 5TY0A 2XA7S 1W8YA 1W75A 2WJ3A 4HNHA 3LI2A 4DV1B 4MI9A 2OG1A 5K0JA 1Y98A 4G3VA 1NBAA 2EFEB 3P19A 2AN3A 2O2XA 3IP1A 1KL7A 3IPYA 5C35A 2AJCA 1BFUA 3UA4A 2G07A 3X44A 1OV6A 2DQKA 5CIYA 1ZD2P 3AHIA 2ZC4B 1M0TA 4QNRA 1Q1ZA 1TT5A 1EDEA 2PR2A 3EDYA 5EYPA 4BNWA 4A4DA 2X5KO 3NWEA 4YMSA 3MWKA 5J2UB 1U0EA 1P4RA 4PS0A 3WGIA 3X2FA 4Y2GA 3E4OA 3CLUD 3SBDA 2HFKA 1RWVA 1IRXA 4D4LA 3EASA 3W8FA 2EKDA 3R7LA 1YASA 2G1KA 4ZJZA 3BRCA 3FCAA 1E3JA 4G2TA 2XMGA 3H82B 4MVJH 4ES6A 1DC5A 4QYWA 3AJ9A 4GI1A 1ILWA 3FVWA 1UT8A 4I6GA 4XVUA 1Z8FA 2BELA 1GTZA 3STYA 2OPBA 2IW1A 5ECYA 4OJQA 1E99A 1Z74A 2H0QA 2B7CA 2UKDA 3EOAI 1D2GA 5BSFA 3B1ZA 3ZLJA 4URYR 2YWRA 4LV5B 1Q16A 4J49A 1XCGB 1W29A 3KD3A 4CV0A 5FSRA 3A3OA 1PR4A 1TKAA 2X8BA 3PNMA 5DKLA 4BL5A 3PFCA 3MZFA 3KR1A 3UUWA 4MWOA 2QAGA 3ZD9A 4Z4HA 2YWGA 2IZOA 4GR9A 3EGXC 3Q3EA 2A24A 4GECA 4CJNA 4DRXB 3WKAA 2G9NA 1KZGB 1TUGA 1ZK4A 3IUPA 2HPAA 5KYTA 5ALJA 3MUFA 5FADA 2YVKA 3ESXA 4J03A 3CEPB 2OM6A 3TPFA 5DTQA 2OT3B 2F90A 4R1TA 2XVZA 4A6DA 4RLQA 3SXUB 3RANA 3NASA 2Y1LA 3PIIA 2NNWB 1S7CA 5TQ2A 3EXEA 2V8OA 2R1VB 5HQ3B 3RTGA 1ZA1A 2O8EB 5EVIB 3T3OA 5JPIA 2OCDA 2DRIA 2BM0A 3ZGVA 3ZY3A 2K7SA 2ZW9A 5L3QA 3TZCA 3GHYA 4ZYWA 1GPUA 1FR1A 5FNZA 2Q6TA 3MS4A 1T5OA 3TE7A 1IQUA 3MMZA 4E5DA 2HBYA 2YNMD 4E2WA 2JBAB 2FZ5A 1C1XB 1F2DA 3EFOA 5IJZA 2QTBA 4KU4A 5BWOA 5EY5B 3L7HA 5IK2A 2XNDA 1T13A 3DFUA 4DR1B 4MOWA 4IXTA 3MWYW 5AHRA 1NZFA 2WWGA 2PFSA 3E03A 4CMIA 2B21A 5ALTA 1Z63A 3B5IA 1HYQA 2HGVA 3ESZA 4OFZA 2R4TA 3A2MA 4XXHA 2HU2A 1R9GA 1UPXA 1C8VB 2VP4A 4NS1A 2NP6A 4KXLA 3KB8A 2I0FA 5HAPA 1Q7CA 1LQ2A 3WQRA 4R68A 3EW9A 3ZWDA 3GT4A 4NNJA 2VJOA 2B95A 5CX1B 5HKAA 1VI2A 3AIIA 4NCHA 4UU7A 5K8LA 2VJDA 1ZNWA 4FC7A 1E1YA 2P9TA 2G5GX 3M2PA 4UHHA 2HCRA 2PGLA 3RREA 4JA2A 5LXTA 4XWOA 3I9NA 1SY7A 1P4SA 4DR4B 3Q2KA 4E3IA 4LV6A 3QBJA 4I9GA 2FPGB 2G9QA 3JD1A 4AY3A 2JGKA 2QORA 2RGYA 4IUDS 2MYNA 2QWSA 5I9TA 4KR0A 4M98A 4TM7A 2WWHA 2VR1A 4F04A 2J8YA 2I7VA 2F4VB 4ZWNA 2Y1KA 3GWGA 4DV6B 1NQOA 4LCEA 3FXAA 2ATIA 4LF5B 3UB4A 5EJ2A 2P40A 3FUXA 4M0MA 2B35A 3LWDA 1QK4A 5K5BA 1NVMB 1AS2A 2JAPA 3UT5A 3UB3A 4DF3A 3OT1B 4MR8B 1GRRA 3ZWMA 3Q0EA 4AICA 1L5SA 4BE4A 4FIDA 3WIVA 3H5OA 2HKIA 4HY3A 4QRDA 4FD2A 3G5TA 3OUTA 1XEXB 4AB1A 2ZXFA 5EZ6B 2ZAYA 3SMQA 1LU9A 2Q6IA 1LSXA 1SBIA 2Z6VA 5F9MA 5AI8A 1VGRA 4L9EA 3RD5A 1SIWA 1AQLA 3CNHA 5DCUA 5JXHA 4Z9BA 3OKCA 4HNAA 3LIEA 2L0XA 1GXSA 4CV2A 1VGVA 1GAXA 1HBJA 1JEAA 7AT1A 2GF0A 4BBJA 1J8YF 3GY0A 1FX0B 1FVOA 4D25A 3WLQA 3U6KA 5G0VA 4C2AA 2BFCB 2A7XA 4KV7A 2H9YA 4XGQA 3V6MA 2E4AA 2VQEB 1EXDA 1KI2A 2F62A 4FINA 5DEIA 5K0FA 3SBXA 1BMQA 4YIKA 3PUKA 2J3LA 2NTNA 2PL3A 1TVKA 4CHGA 2ZBBA 3M4ZA 3PXDA 3K09A 2LB9A 2IEYA 1O6CA 3L1JA 1JF8A 2JFNA 1XYVA 4LXQA 5JADA 1Y3IA 2HNBA 1ZRSA 2A5FA 3F97A 4QAQA 4QFCA 5JISA 2EZUA 1MF7A 4C0HA 2QTMA 3RDPA 3ADKA 2XGMA 3DZHA 4ZFNA 3QFHA 3V4FA 1K0KA 1RRGA 1II0A 4KQOA 5CXUA 2R11A 4G0ZA 5CURA 4DXCA 4J1QA 3AW8A 1I2WA 2Y6VA 4X66B 2WR8A 4ZI3A 4I1IA 3QMMA 1KFCB 1ZBQA 5KYYA 5LYJF 4OKSA 3DDOA 2FEAA 3SH7A 4HPJB 2EBHX 2ZYGA 5J4VA 3B9RA 2AFIB 1C9MA 4EY4A 1PEAA 2IZ6A 3I9FA 3EF1A 2VK4A 4RVHA 1GRVA 3TBFA 2AEEA 2ZSIA 1OJGA 4WXPA 3LDUA 3H11B 3EWNA 3G23A 1KJNA 13PKA 4UOQA 5LP6A 3VU0A 2B9VA 2VFAA 3PXCX 2GCGA 3FTQA 1EP9A 2FFHA 4CTMA 1FNCA 4OFBA 4CTOA 5G1OA 2GKSA 1O54A 3SFVA 4AF6A 4P7GA 1CUGA 3ZBQA 1EP2B 1L3CA 1W73A 2WD7A 4HJXA 2GCPA 4DJJA 4YRMA 3OPLA 3C7UA 1LI5A 1JTVA 1U7UA 2H4YA 2WVHA 3TJMA 1Q83A 5TGZA 5IAAA 3AI1A 4EX7A 2ZBUA 3T9DA 2K87A 2RARA 2CSXA 5KSHA 4XARA 1PR3A 4TUYB 1Z5VA 5HG0A 3E9EA 3QUTA 3MAGA 2C8VA 1OFUA 5EINA 3GRVA 3UT0A 2HJGA 1JKMA 3H9WA 2RKOA 4INPA 1K54A 3LCRA 4IF4A 1SRRA 3ER8A 2K2NA 1KFJB 4H4CA 3BHNA 4P4LA 1OILA 3CZQA 1T4BA 1AHNA 2Y2KA 1Q0UA 3A9CA 3IUJA 2E55A 2FN8A 3HKBA 3N0VA 1EM8B 3NOPC 1Y3HA 2HBRA 3ER9A 3I5MA 1EFUA 1CJKC 5CA1F 2VJAA 4IIYA 4ME4A 5TBMA 2V6MA 4FSXA 1HT3A 1RCFA 4MKXA 2DPXA 1TYCA 3DW3X 1B0ZA 1CHNA 1TF7A 2VUHB 2WP0A 5AW5A 4OPYA 4G56A 1PJ8A 1U7DA 2ZG6A 4D6YA 3LA8A 2BE9A 3ECSA 1JYSA 4JXGA 3LM8A 4XLTA 1EEHA 5AVUA 1KAGA 3W3AD 4YASA 3ENWA 3PUZA 4JEHA 2NUTA 2WFAA 3R5FA 1WL8A 1UM8A 4IDNA 4NMLA 1B8OA 2R86A 2Y92A 2C5EA 4N49A 1VHJA 4BNMA 2IDMA 2R9WA 3G0GA 4AF8A 4Q1AA 1TFRA 1Y5RA 3GEPA 1OYYA 2QY9A 5KNBD 2DMWA 3ESQA 1CUAA 1YVEI 4LRTB 3IC5A 4BKOA 4GR5A 3HXOA 3THXB 2CLIB 1CKEA 2AVNA 1IPEA 4NEQA 1YMXA 4BVJA 3GPDG 2LKDA 4O8ZA 1DQZA 3IEUA 3DLBA 5DHFA 1YHYA 1NT2A 1ZZEA 2V20A 1P8JA 3ICOA 1JI0A 4W6ZA 2ZRAA 4CNQA 4IDCA 2OXCA 3C8DA 4KI0A 3TD2A 1D6JA 4PYLA 5GHYA 2R7NA 4YJFB 4OH0A 2A0KA 4RJTA 4KLRA 2DY1A 4MRVA 4ZT5A 3HCEA 2AK3A 2JATA 5IUJC 3CAXA 1KFKB 4ZYVA 3B1JA 4U3JA 1U2ZA 1RXEA 1NRFA 4QLOA 3TIIA 3CVUA 5DGXA 4OQNA 3F6EX 5BT9A 4YRGA 2HMSA 4HLUC 4EYSA 1SQFA 2YXBA 3SSMA 5GZ6A 2JFYA 4KLAA 1Z15A 4MS4A 1LQTA 4L51A 2DJIA 4BB6A 3ENNA 1EVEA 1I3NA 2ADFA 4DFDA 4YJ3B 3K8OE 4BNFA 2GXSA 1KY4A 1AGRA 3AKEA 2B4TO 4QELA 2QRGA 1E5VA 4KUOA 3F90A 2P08A 5BSRA 5E2FA 2ZJ1A 2C95A 4MEJA 2Z6QA 3Q3IA 3VOBA 4HB4A 3I76A 2IU0A 3SQNA 4UCWA 3GJQA 5A5FA 3QE4A 4RMJA 2OXEA 3FSEA 3CBQA 2HMTA 3OLVA 3TKYA 2PX8A 3MJFA 2IV3A 4UTRA 3UAOA 2NXJA 2ZE8A 3L0DA 4HL6A 3F1KA 3G68A 1BSVA 3VR3D 3TLGA 1JEJA 1CJCA 1I0LA 4BTVA 5D3MB 2Y2IA 3ZW9A 3ZHSA 2XD4A 3V33A 4K9DA 2Z57A 3TRJA 1BE8A 2ON6A 4R2IA 4D41A 4ZCRA 1DBQA 3FGZA 3CG0A 1LV8A 4OU5A 1DFGA 3QV2A 3VSEA 1XMPA 4I1YA 1YMSA 2PX0A 5CDYA 3E27A 1RYMA 3K3PA 3AQIA 2IBSA 4DLRA 4N7MA 2ZI7A 1KQNA 2C9OA 4BP1A 1RP5A 4GRDA 4Q3KA 3RQSA 1KP2A 2XSZD 4KJZA 1GNQA 5A7GA 5EC8A 3KSMA 5JNLA 4LHZA 4S1NA 2JK0A 3NUZA 3KSHA 3HCAA 5F76A 4DCVA 2RHOA 2BTQA 5JZMA 1QP4A 4QJGA 1EWTA 3V1UA 1V16B 4Y7DA 4D9GA 1OC4A 4HQOA 1UEIA 2ZEJA 3V7FA 5FRDA 3IOEA 3U81A 1JWAB 4YRLA 4PBSA 5JXGA 3NC8A 3VSBA 2IPLA 3T4KA 3U7IA 4A82A 1MXOA 4DVGA 1ACFA 3I6QA 5B4UA 1RI2A 1N5DA 3ROTA 1Y7IA 2F1HA 2CV1A 3HLGA 3CW9A 4DEYA 5IPFA 5ESRA 2G6BA 5REQB 2Z56A 4E94A 2C4HA 3GEEA 5ILQA 2X3FA 1BD4A 4DT1B 3GDHA 3BT7A 4IXDA 2E89A 4FGSA 3PEVA 2DSTA 4KTVE 3ENQA 2XGNA 1SC6A 3MOSA 3UQYS 4WZAE 1IMOA 4K9NA 5DVAA 5BMVB 4MITA 3R0IA 1EG7A 2A94A 3MTAA 4WZ5A 1PT6A 3JYNA 1N5IA 1GDDA 3CNLA 1H8YA 3TMAA 2NO9A 3OU2A 3HJAA 1P4AA 4F6LA 2BBTA 3H9JA 3O4HA 1CC1S 4FMPA 4Q1VA 5L8VA 2QGZA 4P0MA 3WMGA 3FPEA 3PBSA 4NAUA 1FNMA 3H2HA 3KB2A 3TDKA 1KVLA 4OREX 3NIWA 1E6EA 4ZZIA 1AKUA 2JZOA 1T1EA 3WRYA 3FPLA 1G19A 1KRHA 1T3SA 1EESA 2ZUFA 2VN8A 5EKXA 3LKVA 4J6EA 4FYJA 1TCAA 2WYWA 2G82A 3ZG9B 1HEYA 4GOOD 1P75A 1HFEL 4WZAA 2B4YA 4AI6A 4WXEA 3HXQA 5TEVA 5B1SA 1SCBA 2J9XB 4CIAA 2FSPA 3W4KA 2IWCA 3BFJA 5D86A 4MO9A 2DHRA 1UP4A 4Q3DA 3KPVA 2J3WA 4W1PA 1XV5A 3BSFA 5FYQA 2FFBA 2VNAA 3BRQA 2ZETA 4ZVNA 1MIHA 2YRXA 1K2VN 5F2KA 3FPKA 3IWIA 5D3ZA 4YDHB 2F8SA 3ANYB 3LTEA 1DJNA 1WZCA 3H16A 2G9VA 2XB8A 3V5NA 3MZ0A 1TTPB 3F9CA 3G0BA 3HLWA 4KFRA 5KTNA 3HL9A 4D96A 3ST7A 4WOCA 1SVNA 1OLSA 3KVOA 3CF4G 5AVVA 4P85A 3ZEIA 1GUFA 1FSPA 2VYVA 4IDHA 1VP9A 5K3CA 4WAUA 3HKEB 2CGEA 2IEAA 2VTEA 3L9XA 2HBZA 4BRZA 4TYNA 1X7XB 2A0XA 3LYHA 4DMMA 1TS8A 3HY4A 1JDVA 2ZR7A 4HOYA 2PVCA 3GUUA 2Q9AA 4G1UC 3Q3CA 2JC7A 5JZOA 2CYBA 5CW1A 2Q3CA 2J6CA 1GTMA 3SYLA 3V2UA 1D1PA 4D26A 1P4HA 2RI0A 4WM9A 2AR0A 3C24A 5C37A 3IPLA 2E5LB 1MB0A 3AVPA 5BN3B 5KYXB 3DBIA 1DX9A 1IKGA 2HQ1A 5FPHA 4H0CA 2PWZA 3L0OA 5L8MA 3PIRA 4ZQFA 4IJWA 1BLCA 1WU7A 1PQWA 4RETA 5LXTF 2ZSUA 5LR6A 5LQUA 2IDKA 5HRCA 4FI3F 3HVJA 1IYQA 1SRQA 3ANSA 1WDTA 1YZQA 3N2LA 2VRBA 4Q9LA 4NRDA 4EEPA 3RLIA 2PA3A 4RD4A 2D2FA 1BUEA 4HMOA 3GROA 3PNLA 1YI1A 3LF1A 3TSGA 4UNIA 1C7EA 1SCKA 2NU8B 2VJMA 3WMEA 1QGUB 4KAJA 2GD2A 3KJIA 4Z1MD 2HDHA 1Z34A 5TV2A 4YONB 4FLFA 1FYWA 4G8BA 1KYTA 1NP7A 2CD9A 3RTYA 5GV8A 2WMNB 4ZVUA 4F06A 5E2EA 3TYXA 4F3LA 4P3KA 1JAIA 4Y2VA 1PL6A 3LUKA 1W4RA 5ALMA 3HP7A 1JLLB 4GPAA 4XSHA 1H3EA 4R3JA 4IMPA 2A9OA 2IZ1A 2OL4A 5CD1A 1JFTA 3O8BA 4D4MA 1BYUA 2I3BA 4EIWA 1WVMA 3V6LA 1AQNA 4YP0A 4OBWA 2PQMA 4XB1A 1WB6A 2GJ9A 1SXJD 4MUHA 1QS0B 3HUTA 3C41J 3NU1A 1YNOA 3OD1A 2NW6A 1E7YA 1HNXB 1T35A 1N8TA 4RLFA 1Y5LA 3WSTA 3FHLA 1IB6A 4PZZA 3OQIA 4OB8A 4BMCA 1FX1A 1PZOA 3HDJA 5EA2A 1IY0A 4RXMA 1DQPA 2IYQA 4CLXA 3V8QA 5AICA 4NWIA 5F3RA 3WK5A 3SQDA 2YCBA 2D1TA 4M1EA 2B5RA 1U5BA 3ZVNA 2XCOA 4V24A 2HF2A 2DFKB 2XOEA 3M4YA 2ZC3B 3UIEA 3EGXB 3RS4A 3V1MA 1NW4A 4OHVA 4QTTB 2Q5EA 4HAIA 5A9RA 1RWWA 4M46A 5COBA 4QTUB 2E4XA 2PU5A 1MWRA 3GA0A 3NHZA 4AF7A 4UVHA 3LXUX 1M0EA 4R3AA 2IGBA 3KG2A 3PHIA 1XTVA 2GYVA 2BMAA 5E3IA 3KV3O 1KAEA 1U1EA 2J3DA 1IXZA 4B6GA 1M2FA 1ORDA 4GXRA 3SYNA 4UW9A 2RI1A 4P31A 4QGGA 4X55A 5ARDA 1W2HA 2GLXA 2ONZA 1P2TA 3RRFA 4RPHA 4MW9A 1LDEA 4R5MA 1R9NA 3K1ZA 3AOEC 4CL0A 3ELBA 2ZJBA 4OHFA 3E35A 2IYYA 3Q5GA 2CNLA 3E2PA 2ZE7A 1X8JA 3IL2A 4XQCA 5G4KB 4N12A 4BL2A 2A4MA 3IUYA 2NU9B 4GI3A 4R1PA 1BU5A 1OVGA 1C30A 4IAOA 1SUDA 4E1VA 1PL7A 1QZUA 3OCXA 3O1HB 3MTEA 4XD7D 3D3JA 3TH5A 4GWLA 1U4SA 2BFMA 1Y63A 1CZKA 4E13A 2AUNA 1HKUA 5TJJA 3WK9A 3A26A 4O5OA 3RVNA 2YWHA 5IAKA 1XJCA 2CVFA 2Q9BA 3TBHA 4Z54A 1K7XB 1Z6TA 4FK8A 3SC4A 3TS1A 1V1RB 4PRKA 10MHA 4IJMA 4NDAA 1CUYA 1G28A 2RIPA 4OQ0A 3BE4A 5FJIA 1KO4A 4QSMA 3WISA 2O7QA 1F8XA 1JR2A 3R8CA 4GBED 1IONA 4HNRA 5DULA 3FPFA 1M34B 4FFBB 2ERCA 1I36A 3T41A 4C0KA 3N8NA 4F2GA 4DV7B 2ID4A 3ETLA 3DKPA 3FWLA 1RKQA 4PNEA 5BQ5A 1E9AA 2IUEA 5AJZA 2Q0OA 1JSLA 1VKHA 6ABPA 1EXWA 2X6TA 3T12A 1YL7A 4J0GA 1JHMA 4D3ZA 2OM2A 4JOBA 2O05A 4AJIA 2BISA 1X1CA 1SKBA 1XPRA 2VNSA 2GHRA 2C57A 4Y0UA 5CB0A 4Y67A 3EGVA 1II8A 4XX0B 4EYGA 3FFWA 1KC3A 1Z5OA 1LL8A 3PC2A 3KEQA 3S0JA 1M5RA 3K1JA 1EGQA 1R10A 2C2MA 1VKZA 4X25A 4LBWA 5EVEA 2GA8A 4MDEA 3RUDA 2P2LA 2ZJ7A 4EW2A 2PSDA 5HL1A 4KXFB 2X23A 3TG8A 5LDDC 1FSSA 4OVKA 5A4DA 2GN0A 1HZOA 3D6UA 5FOUA 3K7EA 1E0SA 1NMXA 4WINA 2ZQ8A 4KZAA 1C7RA 1R6XA 1VL2A 4LX8A 3DVRX 4PSUA 4POAA 3DBHA 2B2NA 2ODNA 1L5HA 3QEOA 4XSVA 3DWZA 5AM4A 1LKZA 4YFMA 1EFCA 2B99A 1GCUA 4NJEA 3OFVA 3RVMA 3EXHC 3C7TA 4WDRA 2WU8A 3PC7A 3QSYA 5U4XA 1TK2A 4DWVA 3HC7A 2ZTMA 3FTCA 4M4SA 1V8FA 4BNNA 1U9IC