2EWVA

Crystal structure of the pilus retraction motor pilt and bound adp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
350
structure length
343
Chain Sequence
ELKILEIIKEAIELGASDIHLTAGAPPAVRIDGYIKFLKDFPRLTPEDTQKLAYSVMSEKHRQKLEENGQVDFSFGVRGVGRFRANVFYQRGSVAAALRSLPAEIPEFKKLGLPDKVLELCHRKMGLILVTGPTGSGKSTTIASMIDYINQTKSYHIITIEDPIEYVFKHKKSIVNQREVGEDTKSFADALRAALREDPDVIFVGEMRDLETVETALRAAETGHLVFGTLHTNTAIDTIHRIVDIFPLNQQEQVRIVLSFILQGIISQRLLPKIGGGRVLAYELLIPNTAIRNLIRENKLQQVYSLMQMQTMNQTLYKLYKQGLITLEDAMEASPDPKELERM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the pilus retraction motor PilT suggest large domain movements and subunit cooperation drive motility.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Protein transport
molecule keywords twitching motility protein PilT
total genus 74
structure length 343
sequence length 350
ec nomenclature
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ewvA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ewvA02
1WQ1R 1B0UA 4MYHA 1UBCA 1KNQA 3GFPA 1RIFA 4P0TA 3MJRA 5LD2C 2XEXA 1CJTC 1ZIPA 4DLYA 3CX7A 2PBRA 4YMTA 1NY5A 3PUXA 2WPDD 3E2IA 4WAUA 3CPEA 3K70D 3FHTA 4JLNA 1OIXA 2ZE5A 2DFTA 121PA 3PEYA 1D6JA 1R0XA 1YU9A 1G20E 3DDCA 1KJWA 1U2RA 3EG5A 5DO9A 4Q1CA 3ZS9A 3QXJA 3TNFA 3BAFA 3TR0A 1P9NA 3BXZA 4XSGA 2XZOA 3KXIA 2QORA 1GG2A 2GWHA 4JLAA 4TMZA 2XTZA 2ZRLA 2IYUA 3SE0A 3T06B 3EARA 3X1ZA 5AWFC 4V0NA 1EFCA 1CJVC 4HUQB 4E22A 2WWXA 3CW2A 2P2LA 5BN3A 1TADA 1X8KA 1N5IA 1G3MA 2ZROA 3KJEA 1CR2A 3EZ7A 5H1YA 5L3VA 4JJKA 5GJBA 2FFQA 2GZHA 2KBEA 1CJUC 2AXPA 1NVUQ 1AZTA 2FMXA 4PANA 5J5CA 3F3YA 3WNCA 1MRSA 2FZ4A 3C4JA 1YHNA 4Q02A 2X19A 3OEED 4PQRA 4G0NA 4I1SA 2DFLA 1GKYA 5EXTA 1GRQA 3W6NA 4EPRA 3LDAA 1QG4A 1E96A 2XSZA 2FG5A 3SC3A 1G7CA 2JJ1A 1COWA 1OE0A 1CJKC 1CR0A 2PJRA 4NYIQ 3ZD7A 5FUYA 3CIOA 3AVWA 2DWQA 2D2FA 3E70C 3TR5A 1XCGB 3THXB 1M7HA 2AK3A 3ZGXA 1JPJA 2ZXUA 2MSEB 2ZRPA 2VPPA 1YR9A 4IVPA 4JBXA 3VKWA 1FNNA 4DLSA 1XMSA 4KI0A 3AQ4A 4LYJA 4D0GA 2WWYA 2YJTD 3N70A 4RZ2A 3C14C 3NDPA 3TSZA 1OH6A 3OESA 2QL6A 2FFAA 2ZJ8A 3CRMA 5H68A 1NSFA 3QF4A 1E2IA 1ZINA 2ANBA 3PG5A 4KSCA 3AM1A 1M7BA 4JKYA 4Q4JB 5JBQA 4JBYA 4LWZA 3AKCA 2YWHA 3S1AA 3FFBA 1II0A 3ADCA 1WCV1 5CB8A 4E03A 1WA5A 2GJKA 2VHTA 4P31A 3P32A 5GJWC 4DIDA 3ZQ6A 1V43A 4LZZA 5FPSA 3ZVLA 5J4YA 4BFVA 5TARA 3NHBA 3KXKA 4US0R 3UKDA 3BOSA 3QF7A 3QPVA 2WJVA 4GBMA 2UVQA 3N5CA 1CR1A 3ZVRA 3RS7A 4Q66C 2YINC 4FMCB 2D7CA 4M1MA 4G3XA 2N46A 2W83A 2O8EB 5FR1A 1FP6A 2CLDX 5JSZA 4TYYA 2IHYA 4MKHA 1E2MA 4I1OA 2HLDD 1EX6A 1DG3A 1QRAA 5FL7D 2E9SA 3PUWA 3F8TA 3PENA 4PHHA 3I8XA 5FTNA 2H17A 4BZQA 2C96A 1ESMA 4TQ9A 3U3OA 1G3IA 5DYGA 4JJZA 4OK6A 1W2GA 3UG7A 4EQ6B 1ZMXA 2CHGA 5AR1A 2KI5A 3ADKA 2IYYA 1W48A 2HLDA 5KPDA 2WBLC 3W3ZB 4Z8XA 1ZD1A 3KKNA 2CCJA 2NZJA 2IS4A 1XCPA 5KSOA 2IF0A 4ZI2A 1ONBA 1T8UA 4WXRA 5DSZA 1ZNYA 1I2MA 3IHLA 4XWAA 4OI1A 4IDNA 1KSGA 1L2TA 2ZRJA 3PVSA 3W34A 2HEIA 1SXJD 2BEJA 3FE2A 1LB1B 2PH1A 5EUMA 3VTKA 1OLOA 2W2VA 1JJVA 4QKQA 1E4VA 4Q4HA 2CE7A 5DHFA 3HYTA 2R65A 4URXR 2Q3HA 4QXAA 5GVSA 1P2TA 1F5NA 3O8DA 3CPJB 3ICEA 5E7MA 5FR2A 4PXAA 4ZDWA 3GMTA 1E1RD 4HLUA 3KUCA 4R7ZA 2EVWX 3L0OA 4BFTA 3R7WA 2BMFA 3SYNA 2Y8EA 4Q00A 1MO6A 1E2EA 1P5ZB 3I8SA 4CEIA 1TMKA 4V02A 2VH5R 2JLVA 2OFOA 3OIVA 3H0KA 1KI8A 3K9NA 3OEEA 5AJWA 2FZLA 2F1JA 1QDEA 2V4ZA 4CW7A 4LYHA 4A0RA 2CEAA 2W6JA 2EFDB 1DAEA 1U94A 4M22A 1DO0A 4PC3A 3G82C 3BS4A 2GK7A 4FI3C 5HTKA 5TB5A 4DCTA 4XWOA 2OLKA 5L3QA 2ZR7A 3GLIB 2WHXA 1G17A 4DWJA 4XVUA 2WJGA 4K46A 4QL3A 4DLRA 1BO6A 5L3SB 4C2TA 2H1LA 2JLXA 1W4BA 3Q7QA 3EWSA 3RNLA 3B78A 4PPFA 5HZKA 5J4HA 2ZI5A 1MO4A 4L4UA 3FB4A 4Q21A 3SDZA 3B82A 3C5HA 2G1JA 1F2TB 2A7QA 2JASA 3EWAA 2VP9A 4LHZA 4YLGA 3U3KA 4TLDA 2AHOA 1QG2A 2UKDA 2B7CA 4AK9A 2OAP1 4UJ5A 2ZSEA 2F1IA 5IDVA 2BVNA 4NL4H 4B48A 3GLGB 1JR3D 2ZE8A 2ONJA 1NKTA 1CEEA 1U98A 1ZCBA 2IYXA 1EX7A 3OEHD 3THYB 1BMFA 4NCHA 3BORA 5FOXA 5TV2A 3W8NA 3BB1A 1KZ7B 3CWZA 1OHHD 2ZS9A 4IXMA 2J0UB 2KWIA 2LCFA 5EQTA 2B21A 2DHRA 4B3FX 3B2EA 4OKSA 2H18A 1OB2A 2O8FB 1G1MA 1R4AA 1TQ2A 4F93B 1VCOA 3U3RA 3UWOA 2RH5A 3KQUA 3MGCA 1EFRD 4EUNA 4DLWA 2RGBA 4EFNA 5JS7A 5D3MB 3A1TA 3CO5A 1G3RA 3DL0A 4U7DA 1E98A 1MV5A 3HU1A 3REGA 2JJ2D 4P4SA 1OB5A 2XTMA 1H8EA 1VYVA 2QT1A 1Z0FA 4WZ6A 4ASUD 2WSMA 3MWYW 3IEUA 1O87A 4M9QA 3SR0A 2B6HA 1BKDR 4RZ3A 2PT5A 2P6UA 1GP2A 4NP6A 2W6JD 3TRFA 2F6RA 5HE9A 1IOZA 5FOWA 2YWGA 2FU5C 5DIFA 2AFHE 4URVR 2AD1A 3TQFA 1UPTA 1U0LA 5EP1A 4A1FA 2ZJOA 1NP6A 1IXSB 4DLVA 1XJCA 2G0NA 3FYHA 5L3QB 3JVVA 1UKVY 1MKYA 4WZAE 3DOFA 3W90A 2N42A 5FL7A 4LY6A 4ITRC 5HKKA 3AKYA 1U90A 4L5BA 1K5DA 2ZJ2A 1ZUNB 3C15C 3HU3A 5CIWA 3W3AA 4AKHA 5FI1B 5TMPA 3PUVA 4QGHA 1FPMA 3T1QA 3SYLA 2OSBA 3HYRA 1HTWA 1YR7A 4C0JA 3RRNA 2QUZA 2J9RA 2RGCA 3KL4A 2H7VA 2WKRA 3KFVA 3P4YA 4U00A 4W7SA 4AI6A 1GSIA 1NLZA 2GXAA 1XEXB 4GZMA 1F60A 1SGWA 2ZRHA 1Q0UA 4P4UA 1LTQA 4KO8A 1W36C 5IK2D 2FSHA 1JR3A 1PLKA 3LBHA 1NKSA 2Z5FA 1NMXA 5JWHA 4OYHA 2OO7A 4TTRA 1R5OA 1E9DA 2BBOA 2WMOB 2WAYA 1G9XA 2FSIA 4YMWA 5FTMA 4TL8A 2ZYTX 4ZPXA 1AS2A 1GL6A 4B3BA 2OCPA 5DLQC 3LAWA 2GEUA 4ERNA 2KE5A 1KY3A 5ELXA 1NMZA 3H4MA 3SJCA 2X1VA 1JR6A 4JT2A 1XFAA 1FMLA 1NN5A 3GLGE 2BM0A 1NVWQ 3V00A 4IW3B 2C5LA 4U5XA 5E95A 4CEIB 1B23P 4A8JC 5TY0A 2VA8A 1II8A 1CJMA 2ODEA 4BFWA 721PA 4GI7A 2XB4A 1D5CA 1KI3A 4W5JA 4XD7D 5JHGB 3VKGA 4MRSA 3TW8B 4CVNA 3TUJC 1GTVA 3FKSA 2ZITA 3B60A 4EAQA 1CULC 2RGGA 3K9LA 2QE7A 1MRNA 4BLQA 2UZIR 2C78A 1XEFA 1T5IA 3IO3A 4UNRA 3TUZC 4DB4A 4ILEA 1ZM3A 1IJFA 2Z4SA 3LW8A 3WRYC 4YDSA 1KY2A 1NIPA 3TMKA 2BWJA 1OFHA 1SVKA 4F4JA 4IDOA 4TSFD 1G7RA 2IYTA 3R9IA 2IK8A 2ZANA 1LS1A 3L8YA 2WSSA 3K0CA 2IYQA 2C9CA 1MO5A 4DVGA 2VRWA 3THXA 1TEXA 1NN1A 2QNRA 2PZEA 4CT5A 5JI3E 3CUEF 5FBLB 4C0BA 1P73A 3AP1A 3DM5A 3NIBA 3OEHA 2VP2A 4RD4A 5DI3B 5KO2A 3THYA 1XB2A 1ZAKA 2Q3MA 2ZE7A 3M1IA 1Z0IA 4GP6A 3NKVA 1HE1C 2OLJA 5JLJA 3CRW1 1JQJC 4MRPA 1SHZA 2NQ2C 2R44A 3AGQA 1OH7A 3LVRE 3QQ5A 1E32A 1V5WA 3WY9A 3FHOA 3SJZA 5JWRA 4RFVA 4I1VA 2IS1A 4BLSA 1L8QA 2FFHA 2RAPA 2O8BB 3CZQA 1VMAA 2E87A 1OJLA 1JEDA 1NRJB 3GJ3A 4LJ4A 4KAXA 4YXWA 1UKYA 3QPUA 1U8AA 3ZIAA 5EXXA 4Z1MD 4HUQA 4P4TA 2C77A 1Z08A 2BCGY 3E5HA 2FJUA 2FPLA 3ONWA 2ZJYA 1EG7A 4JVSB 3HR8A 2R6FA 4L8GA 4C0AC 1BIFA 3TSOA 4A2PA 4POAA 3QKSB 2H57A 4ZIRB 2ZRKA 1AA9A 1TPZA 3A4LA 1IXZA 4JLKA 1GM5A 2JLWA 1XBTA 5J47A 2WTUA 1IY2A 3U7GA 4D0LB 1XPRA 1BS1A 4E09A 1H65A 3AV0B 4FIDA 4HAVA 4OQMA 4NE2A 3IBYA 2I3BA 1GAJA 2AL7A 1AIPA 1F2UB 4GT1A 4IJMA 4ZDIA 2ECKA 2XXAB 1E2JA 2RGAA 3UIEA 4C0LA 2PZGA 4LJ8A 1YE8A 8OHMA 2ZRFA 4XVQA 4MKIA 1CTQA 4XWKA 1XD8A 2VHQA 1E79D 1DTSA 2R6GA 5JJKA 2AKAB 1XPOA 1PZNA 2ZAMA 5CJPA 5BN4A 4V0ME 4OHZA 1F48A 4F38A 4D4LA 2ANCA 1RZ3A 1XEXA 2IA5A 3C16C 2YWEA 2OCBA 1M1YE 3R8CA 2B7BA 4GSYA 2ZI7A 1TF7A 3LXRA 3KJHA 1T6NA 2BC9A 4HI0E 1PLLA 3DZ8A 3DVLA 1E1QA 1E94E 4RSGA 4NCIA 3VR4A 2V55B 1TX4B 4FXPA 4KV9A 4NYJR 3KKOA 4DDWA 4UNNA 3OF5A 5CYOA 1Z6GA 5CJ2A 4XTRA 1C4OA 4B44A 3BFKA 4XVRA 4QGAA 2JLSA 3RS4A 1R7RA 4HB2A 4KLNA 4A6XA 1KMQA 2LKDA 2GZAA 1NN3A 3B1XA 1FP7A 2I4IA 2QAGA 5CYPA 4TL7A 3OHMA 5DE3A 1AN0A 1VKJA 1G64A 3ND8A 4G5QA 4CEHA 1NJGA 2LWIA 4G5SA 4MYUA 3GLFB 4OHXA 4MGKR 5F9HA 4ESHA 1I4TD 1N6OA 1UF9A 5G40A 5AUPB 2PEZA 1P7CA 1S3GA 5D3MA 4M0LA 2MSCB 4GPTA 3I61A 2JDID 2PX3A 1LW7A 2WJYA 1NJFA 4P4SB 5F9FA 1D9XA 2ZUDA 4M1WA 2ZSBA 4DJTA 4TTPA 1JECA 1QHXA 4OI4A 3O8RA 5FH9A 2JJ2A 4XOIA 2FH5B 1DAKA 1Z6YA 4JVLA 4KFSA 1S9HA 5KNDA 3DKPA 3QBTA 3KKMA 3VMFA 6Q21A 2CK3A 2A5YB 4HDOB 1XX6A 2XXAA 3PEUA 4JMPA 2FE4A 2GXUA 3BWDD 1PJRA 4NH0A 3R9WA 4TL6A 3IKJA 4B3DA 5F3WB 2CLSA 4KODA 4LBZA 4BPBA 3AVVA 1UKZA 4DC9A 1Z2CA 1ZC3A 1JB1A 5HCNA 1XZPA 4TZ6A 2VTKA 4BFYA 4WBSA 4AG6A 3TJZA 1NG1A 4A0HA 1Z07A 4URUR 2HCBA 3O47A 1S2MA 4TMKA 5JRJA 3CNNA 1AKEA 3QKUA 1Z2AA 1SHKA 2GCOB 4B3GA 4RD6A 4HAYA 1FX0A 2C03A 3U44A 5FPHA 2WWWA 4ZIRA 4TZ0A 2GXSA 3F0TA 3HWSA 3K09C 1UADA 1N6KA 3BFVA 3VU9B 2YV5A 4HEJA 3SOPA 1YR8A 2JJ8A 2WKPA 2O8DA 1HYQA 1XTJA 4L9WA 5IF9A 3MUFA 1SKQA 2B92A 1FFHA 3GJXC 4XJXA 5JWOA 2VP4A 4RD3A 2FEOA 4JL8A 2CLCX 5C4MA 2IXFA 1NVVR 1DAGA 1P61B 2G77B 1TL7C 3I5XA 5FTLA 1R0WA 1IN4A 1AQUA 4Z8YA 2ZI6A 3ZZ0A 3PCRB 2QBYA 3TQCA 1CS4C 1OFTA 1XEWX 5CM9C 1HY3A 1N6IA 1IBRA 4B43A 3GFTA 4EJSC 4CF7A 5FBVB 1ODFA 4QJ4A 5KNCA 3NC1C 1YZLA 2VP0A 1KO5A 1OXTA 1LF5A 3DHWC 3TW4A 1FUUA 4QBFA 5SZJA 1XDBA 3A58B 3KDSE 4LBVA 2F7SA 4B2LA 4P33A 3AF4A 5EUQB 1W4AA 1SVMA 1HE8B 1P2VA 4EPYA 5CITA 3KJIA 1G8FA 3EZ6A 2J7PA 3NHAA 4LX0A 2ZJBA 2A3RA 2YOGA 4R9UC 2IXGA 2R6DA 2DR3A 2JGNA 4TWZA 1RJ9A 4BRUA 2QU8A 3QSYA 4QC2A 1OIVA 1OV4A 2GVDC 2CCKA 4M9XA 4OBEA 2OE2A 3KX2A 1WDTA 1XMVA 1P60A 2YHSA 3LXXA 3GJ0A 5K8TA 3IDQA 5JEDA 1G7SA 3IIMA 1GL9B 4HDQB 1P4SA 3K70C 1ZNWA 4ACAA 2NZ8A 1XTIA 1NVVQ 4RFSB 4O0MA 2BBTA 5KTYA 4BASA 3BH6A 4KYUA 1QHHA 1FQJA 3VR1A 4G5GA 2OBLA 2GF0A 4BQSA 4ABYA 3SBDA 4F4IA 4ZKDA 1SQ5A 1XZQA 4OHYA 1E2FA 3DM9B 2YVUA 2WVJA 2OG2A 4LUCA 2C95A 3WYGA 2XJ9A 1X8LA 2RGXA 3FTQA 4HAWA 4QHSA 1UDXA 4OHWA 1G291 2QSZA 3PEWA 1W36B 2ZS8A 1WMSA 3AF0A 4V0LA 3FDIA 2MMCA 1QVAA 5CK5A 4LJAA 1A82A 2P65A 2GTPA 3X1WA 4V0KA 4I81A 1A7JA 4A2WA 4YONB 3I62A 1UEIA 1VPLA 2BM1A 1D9ZA 2QRZA 1T4GA 5BQ5A 4PR0A 2B8TA 2ORVA 2IHBA 5AUOB 2H92A 3EC1A 2CVHA 4HLQB 4M4SA 1KI1A 3VR3A 4Q7MB 3BRWD 3OAAD 2Q6TA 2QMUA 4HZUB 4QG7A 3SHFA 2RGEA 2NPFA 4GNKA 2GBLC 3ZJYA 3QF4B 4LOAA 3BH7A 1IN7A 2C9YA 2V6IA 2G83A 4Q19A 2V6JA 4EQ6A 3LVQE 2CL6X 1UAAA 4FW9A 4HLCA 3Q5DA 2AD5A 3Q72A 1HUQA 3QKTA 1SVLA 4C0QC 4TLEA 1FOEB 4D80A 1JALA 3D3QA 4MRRA 1OXXK 4QOSA 4JSTA 5FOVA 1RVDA 2ZM5A 1GFIA 2A5JA 1PUIA 1W44A 5JHHB 5SZKB 3UWKA 3C7KA 4AYXA 3JVUA 2GCOA 2NIPA 1XJQA 2JA1A 4FMCF 4R98A 3FMPB 1X1SA 1P2SA 1NSTA 1GL7A 1S96A 2MSDB 1T3SA 2BV3A 3IGFA 2UZ3A 4YXWD 3NBXX 4GOJA 3GEIA 4YMSA 2GESA 4JIMA 1GDDA 1J70A 2QY9A 2RB4A 2VLIA 2AN9A 1OYWA 2ZIAA 1KK3A 1W4RA 1ZP6A 4C0HA 1DG1G 4AC9A 4ARZA 1P3JA 3FPAA 4MUAA 2FSGA 3ETLA 5DGXA 821PA 5L3RA 3WP0A 2D3WA 4B2PA 1AKYA 2O5VA 4M53A 4RCYA 1E9AA 1S1MA 3BB3A 3IBGA 4TSFA 2QT0A 2FSFA 2QBYB 4TYNA 4KHZA 2O0HA 2OAQ1 2F3TA 4Q4LA 2OZEA 4M1KA 4ESVA 2AKYA 1PVOA 1UDWA 3B1VA 3C41J 4V0OA 4MDEA 1G5RA 2ZYUX 1TQ4A 2WSSD 4M1YA 4C9BA 1M34E 1G6HA 3IHWA 421PA 2A2ZA 2QPAA 1DAIA 3H86A 4BEJA 4EIWA 3UPUA 1CKEA 4NHOA 1R0ZA 4RZUA 4C7OB 2QG6A 1R6BX 4YMVA 3IPXA 1DVRA 2RGNA 2JLRA 2VP6A 3GJ6A 4MA4A 3P4XA 3FVQA 2GHIA 221PA 5L8VA 4E07A 3EPJA 2PL3A 4DUGD 1BYIA 3FMOB 4RY2A 1CRPA 2A5GA 2X77A 1KK2A 1XD2B 3CM0A 2IXEA 2FWRA 1HEIA 2OV2A 3M0EA 2IUSA 5HR5A 3QXHA 1G4UR 5G41A 3GLIE 1QZXA 2A78A 2OILA 5HPYB 1XXHA 4DT1B 5FTJA 1JR3E 4NYJQ 3B1YA 5CIQA 4XIGS 3EPLA 2O8FA 4UQOA 2IWRA 5BWMA 2YC2C 1G5PA 2IS2A 4EJSB 3BK7A 3P20A 1H8HA 5CK4A 3FKQA 4PHGA 4PQFA 1WBDA 1E9EA 1W0JA 2E1RA 3L0IB 5BYKA 1Z3IX 2P6NA 1OKKD 4PC2A 3VX3A 4QJ3A 4DXAA 2HCJB 1WP9A 4B2IA 4QBHA 4UXIA 4HDCA 1F2TA 1NL3A 4X8OA 3ZZUA 3MAAC 1K5GA 2ASEA 1KK0A 1Z29A 4EPWA 3SJBA 2JLYA 1N6RA 3MSXA 2D06A 2DBYA 3TBKA 2JDIA 2F43B 4C4PA 1E99A 3C8UA 3VAAA 2KB0A 3IIJA 3U7FB 3GLHA 1OKKA 4FWIB 3W6PA 2ZRAA 1RYFA 3HJNA 4FCWA 2V1XA 4RJLA 4II7A 4TYPA 1G18A 3AGPA 5AUQA 4I1UA 1Z47A 4Q4HB 1QHNA 2QAGB 1N2CE 2QPTA 4CGZA 4LJ6A 4A6PA 1RYHA 3UMFA 3Q85A 5LD2B 1OH8A 2CVFA 3EC2A 3B9QA 5J4VA 3THWA 2C04A 1U9IA 2O8CB 2XTNA 4HLDA 5HE8A 4HZUA 5IRCD 5F2EA 5K8LA 1OXUA 1EFUA 3CR7A 1N0UA 3WBKA 2VO1A 1E4YA 2RHMA 3KKQA 1ZJ6A 2JCSA 2VP5A 4B71A 1GIAA 1ZM7A 3X1XA 1E1QD 3QENA 1RW4A 5J4LA 3PIRA 3AKEA 2OFWA 2PLRA 4BWYA 4NBSA 3K9HA 4LBWA 1AGPA 2QENA 3P26A 4GZLA 3WBJA 1KHTA 1VTKA 5DNYB 3GLIA 2FX3A 1Q1EA 2XNDD 3RSOA 3VNVA 2IT1A 3K53A 3T34A 5KYKA 2J1LA 4Z51A 1ZUHA 1SXJB 1QBKC 1Z6XA 2WV9A 1Z0AA 3QNUA 2V54A 4NU0A 2R9VA 4H9GA 2GXQA 3QOFA 3QBVA 1DBSA 4KITB 2BMDA 3Q7PA 4NTZA 1W49A 3K0AA 2ZRCA 5AJVB 4B33A 1E0AA 4EJSA 4BLTA 4PZLA 1X8JA 4JLBA 3RS3A 3BGWA 3TAUA 4LHWA 1FZQA 1IAQA 1XNJA 2ZRGA 5G3ZA 1LNZA 3B7GA 5FL3A 4Q1EA 1E2GA 3HPQA 4QGGA 1II8B 1OHHA 2DY1A 3QG5A 2ZJZA 3N2EA 1VDZA 3AVPA 4DSTA 1T3HA 1W5TA 4GOKA 2Z4RA 1AJEA 4J0QA 3O8CA 1NBMD 2JAQA 1OW3B 2C8VA 2CL7X 3TH5A 4GDFA 4KXFB 4Q4AB 3A6PC 1SULA 1VYUA 4V03A 1XD2A 4XD7A 4X8HA 4WVFA 4AYWA 2WOOA 1CLUA 1XD9A 1US8A 4BE7B 1GRRA 3CX8A 4DSOA 1GKIA 2DCUA 2H8KA 3GJ7A 4DRZA 2QZ4A 3PEVA 4K8OA 2AXNA 4DKXA 3UANA 1E0JA 3T12A 3D8BA 4DSNA 4Q5IA 4ASUA 3NWJA 1KGDA 4N0EA 1FNMA 4A9AA 2O8CA 3VHLB 1R10A 2OBMA 4Z54A 1BH2A 5GJCA 2Q9CA 1DPFA 3LBNA 3KXLA 4XTCS 4C2UA 1CXZA 2H16A 4NPHA 1MOZA 4NZYA 5TVKA 4C0KA 1SXJC 1ZIOA 5JJLA 1ZW6A 1VCMA 2IC5A 4MKGA 3MMPA 3D6TB 1P62B 3NC0C 3K8YA 2QGNA 2YNMA 3B13B 3CR8A 3AF3A 4PAMA 521PA 3R7WB 4NCKA 3TLXA 1W36D 1KMHB 4NDZA 3RVBA 3W8RA 1Z8FA 2VL7A 4L9SA 4IOKA 1ZM4A 3NBZC 2C9OA 1VHTA 3K0CC 3ZD6A 4MKFA 4JBWA 4NCJA 1XWIA 2IEYA 5FI0B 2WJIA 4DCUA 3ADDA 4LV5B 4AYTA 4CT4B 2QI9C 4IVQA 2ZI4A 1O3YA 2AK2A 1TF5A 4QGFA 4CEJB 1XMJA 1GWNA 1HT1E 3RRMA 4JL6A 5DI9A 4A15A 3D31A 4TQUS 4Z1MA 3THWB 3L0PA 3MWJA 2ATXA 4DHEA 1OFIA 3VR6A 3SYKA 1ZCAA 4O2LA 3FFAA 1QHSA 4K81B 3TAHA 4LHXA 3FKSD 1XEWY 1K8RA 2QAGC 1N5LA 3IQXA 1F6BA 1JQLB 2W6ID 3BJIC 3LRPA 2W2XA 1ZRHA 4O3MA 1IN8A 4W5WA 1TTTA 3MRSA 3DOEA 3U7EB 4LHYA 1AK2A 2FNAA 4KBGA 4PZZA 2IYSA 4BLPA 2XGJA 2REBA 2IUTA 1QHGA 3I4LA 4JLMA 4BFXA 1XP8A 2KSQA 2OEPA 1ZD9A 1YZQA 2CBZA 2VEDA 2ZRNA 4UNSA 4A0GA 2D62A 4Q9JA 3X2SA 5A0FA 1AGRA 4A2QA 3ZVNA 3AVUA 2ZS7A 3EZ2A 1MH1A 2QPOA 3T1VA 4EFLA 4G5RA 5B64A 3WRXC 3BD9A 4LYAA 3LX8A 1UJ2A 4A4DA 3T5GA 4MGYR 4AWXA 1DELA 2DYKA 5G3YA 3VHXA 4IXNA 2RKOA 1U99A 1HA3A 2BKUA 2VQSA 3EAQA 1R8QA 3EZ9A 4JL5A 3IO5A 5E3HA 5KHOC 2NGRA 3QVVA 3AEZA 4HAZA 4D4KA 5AUNB 2HYDA 3SHWA 3RSLA 4Q18A 2OBNA 4R2IA 4I99A 1Q20A 2WPDA 1QF9A 1XCMA 4TT3D 2PX0A 5C1BA 4BRWA 1OSNA 1KSHA 3QUSA 4GP7A 5E7JA 2IYLD 1FL9A 1TQ6A 3NBYC 4BLRA 5HCIA 4PC6A 4JS0A 1P9RA 2NO9A 4TN1A 3L82B 4JLDA 4B3XA 4JSYA 4M9ZA 3A1VA 4RD0A 2W0MA 3SN6A 2PCJA 3PITA 4FCTA 3ASYA 1TUEA 1VCNA 2F9MA 1KIMA 1M8PA 1ZU5A 2TMKA 4HYYA 5DISB 1NF3A 4O25A 5EE0A 5JECA 2BJVA 2FN4A 3MLEA 2WWFA 2IS6A 4JKIA 3AP2A 3QEOA 4Q4AA 2CHQA 3EIHA 4NYMR 4KCGA 4B32A 1OH5A 2W58A 1XTQA 4RKFA 1Z63A 3QVUA 1SKYB 3UMSA 4B6EA 3T5DA 1D2EA 5KDLA 3CF0A 2IEZA 3B8HA 1UFQA 1N6NA 4PSKA 1GILA 3GLHB 1KMHA 1Q3HA 2WOJA 2ZR0A 3K0AB 5DHAA 4AIIA 1K6MA 1J99A 2BCJQ 3OFNA 3I5YA 3V4RA 2XB2A 4EDHA 1E9RA 1GKUB 4PPNA 4TMWA 1IJEA 2QP4A 1Q1ZA 2V3CC 5GADl 1KDRA 3U4QB 1NMYA 3K9GA 4Q48A 3KTAA 1VG9B 1JI0A 4RZXA 2FA9A 3CLVA 2VSFA 3EPKA 4PTLA 4WZBE 5JI2E 1HQYE 4R2HA 3RABA 1KI9A 1U8YA 1Z6TA 3WMFA 1KAGA 3WNBA 4X8MA 2ATVA 5BW8A 1U81A 1SXJE 4LRWA 4KBFA 4OI2A 1U0JA 2PMDA 2ZJAA 1RC8A 3T15A 3DZDA 2Q0HA 2QP9X 4LHVA 4IFEA 1KO7A 1TF2A 3SU8A 4BZPA 4MRVA 1UBGA 4LC1A 1GNQA 4PAQA 1R5NA 2EU8A 1HURA 3A4MA 3CZPA 4PQYA 1JBKA 1KJYA 4HAXA 1LFDB 3QY0A 4OK5A 4QJ5A 1W0KA 1GZSA 3AVYA 2BKEA 5IT5A 1KZGB 1J8YF 2P3SA 1MABA 1EESA 3EIEA 1W47A 2IYWA 3KZ1E 1Q1QA 4IHQA 2WKQA 4W5HA 5EE5B 1N6LA 2CL0X 1YRBA 5JS8A 2G88A 4D2IA 2ZVPX 1SVOA 1VECA 4LV6A 3NG1A 1KYIA 1Q21A 4B73A 1DAMA 1S0UA 2X2FA 4PHFA 3LQRA 1JEEA 3LWNA 3SFVA 4BZXA 1DO2A 3UG6A 1S8FA 2ONKA 2ZRDA 5SZIA 2QMEA 4WOPA 3QXSA 1XTSA 2ZU6A 1YZUA 5K8IA 1N5KA 1QHYA 4QM7A 4ZDJA 1P6XA 3I32A 3CH5A 2FGKA 1KI6B 1ZM9A 3QXXA 2FOLA 2GJSA 1G4AE 1G8HA 1KSFX 4QNRA 4QHTA 4EPXA 4Q9LA 3KQKA 5FOSA 2EFCB 1RRCA 3CB4A 1L4UA 1F2UA 1IY0A 2ZEJA 3K0FA 1OT3A 2FPKA 2J7KA 2YZ2A 3H2YA 1BMFD 1H8HD 4ZKEA 1GNPA 1JXMA 5FUWA 1W0JD 1KSJA 4G1UC 3W5JA 1XRJA 4UXHA 4D26A 4PX9A 1PUJA 1TNDA 4D81A 5LB4A 3BE4A 4M1SA 4URYR 2I1QA 2GEDA 3PR1A 1E2NA 3MCAA 1IN6A 5JRZA 4B47A 2JJ1D 3EX7C 2PZFA 1E2QA 2IYVA 2QM7A 3NH9A 1ZD8A 1U8ZA 2OM2A 3P1JA 1KI4A 2IL1A 1UBFA 1T3LA 5FPKA 2GCNA 2NTYC 4MITA 4S35A 4UJ3A 2R6AA 4P32A 4KU4A 4A8JB 3FHCB 1M6NA 3NDBB 1JPNA 4Q9HA 5TXGA 2CHVA 2ZRBA 3LV8A 4HB0A 4DEXA 2Z43A 4B34A 2GDJA 1J90A 2VSOA 5JZVA 3B1ZA 2D74A 2H5EA 3SFZA 1US8B 2NO7A 3Q3JB 1WB9A 4OQXA 2G3YA 1NBME 4OQLA 1Z22A 1FX0B 4D82A 1E79A 2QA5A 4LBYA 2NPIA 4JT4A 2ZSDA 5FOTA 1E1RA 4FMBB 1T0HB 3GD7A 3R8FA 2N1BA 4HSEA 4UKDA 2HF9A 3U3MA 2P6RA 3RHFA 2SHKA 4JLOA 3QI2A 3VR5A 3LW7A 4GFDA 1NNEA 2XAUA 2ZREA 2W00A 2WZQA 1EXMA 1AQYA 2P0EA 2J7PD 1M7GA 3PV0A 3U7HB 4TMVA 1G19A 5B58C 4GL2A 3ZVMA 4Q03A 2QAJA 1KO4A 3NBFA 4ZCLA 1F3OA 3Q5EA 1OIWA 5JCZA 2ZYWX 3AH8A 2CJWA 2GETA 3GCGA 2D4HA 3NEJA 4KJZA 2HT6A 2FF7A 1KTVA 3CF2A 5EE3A 2PEYA 3U60B 4M9SA 2QM8A 4N0DA 2ZE6A 4U02A 1I2DA 4Q1AA 1YR6A 4QBIA 1DAHA 2DWPA 4RCZA 2J0SA 3UXMA 2ZETA 3OIUA 1LY1A 3Q9LA 4ZV4A 5FBQB 1H8ED 3KQNA 3MFYA 2CXXA 2G6BA 2WWHA 1W7AA 2XOKA 5HZHA 2J46A 2CE2X 2WM9B 2IX3A 4OQNA 3KB2A 2XNSA 2YKGA 3A8TA 1RKBA 1FUKA 4PFSA 3ZQJA 4D6PA 1Q57A 4US2R 4P3YA 5EXPA 5BYJA 2W6IA 4MRNA 5H8WA 1A5TA 3DMDA 4CYMA 5L3SA 3WYAA 1ZYUA 2C98A 3PXGA 5LPNA 1Z0DA 4BGDA 1DEKA 4CEJA 5JCPA 2HYIC 5AK0A 3FMIA 2F9LA 2AWNA 2NO1A 4TMXA 2R62A 5DN6D 4AY2A 1E0SA 4DDUA 3LLUA 4LC0A 3U6KA 1TAGA 4MH0R 2GZDA 2V7QD 1HV8A 3G5UA 2ZUBA 3I92A 5J40A 1ESNA 2J87A 3AVXA 1G8YA 4M2LA 3B9PA 4X8LA 2GVZC 5AJXA 2A30A 4PPQA 3MWKA 1E2DA 2DB3A 1A4RA 4UXJA 3SJAA 4AD8A 3GPLA 2R6CA 4B6FA 3AVTA 3G0HA 3OIWA 4DUGA 2O52A 1NIJA 5KU1A 4DDVA 1UEJA 2DPXA 3FMFA 4TLBA 2K5UA 5EP2A 1AS0A 3OE7D 1ZU4A 4LJ9A 5KUTA 1COWD 2J0VA 1VIAA 2ZQ5A 3WMEA 1XJ0A 2IYZA 2O8DB 2CJWB 2KBFA 2VYFA 3PJRA 1CF4A 2CCGA 3K0SA 3QE0A 5D3QA 2EWVA 2RHDA 3KFXA 3T35A 1VG1A 1S9DA 1KKLA 2A5FA 2FFBA 4Y0AA 4MYCA 2NO6A 1II9A 2CNWA 2GF9A 4YDHB 1LS6A 4HAUA 3CONA 4NKRA 2ORWA 2GILA 1NVXQ 4GOXA 5JSZB 3CRRA 4NCNA 2L0XA 4FMDB 2OHFA 2QSYA 1ETUA 3EA5A 4C7OA 3PQCA 2WIAA 3S1AB 1E2HA 4XH9B 5H70A 3X1DA 1VCIA 4CDGA 4D4JA 3SI7A 2GRJA 1LVGA 4HB4A 4PZYA 4RVCA 1WBBA 3QPWA 3C5CA 1E2PA 5J4KA 1E6CA 4JLPA 1FTSA 3JZAA 2P5TB 5EJEA 3H1TA 2HF8A 4LI0A 2QE7D 1RRPA 1VYTA 1EWRA 4YMUA 1XF9A 1ZVQA 5P21A 4H1VA 5KSYA 2G9NA 2BMEA 2VHJA 1QVRA 1XPUA 5B57C 4BLOA 1Z0JA 4N1AA 4PO8A 4GRAA 3TK1A 2V1UA 2WWGA 2F1HA 1QHIA 3CRVA 3M4YA 2FV8A 4FD2A 1GRNA 1E2LA 3RLFA 2HJGA 1W0KD 1E9CA 3EASA 2VIIA 1ELOA 4ARZB 2AR7A 1N0WA 2P67A 1WXQA 4DZZA 3LA6A 5JMTA 1R2QA 3REFA 1TUIA 3A36A 3KTAB 5GJVC 3K09A 2ZUCA 1G6OA 5B2ZA 1Z6AA 2OFXA 2DFKB 2R8RA 3DO6A 2ZR9A 4KFUA 5FBRB 4LDJA 3TVDA 4F91B 1QHHB 2Q9AA 4S2EA 4PO9A 1NLYA 1Z0KA 1W1WA 1E9SA 1RJ9B 3EXAA 4F7WA 5HKKD 3ZLJA 2ORIA 4URZR 3OE7A 4TYQA 2ZYVX 5CB6A 2DWOA 1KDPA 3SNHA 1R5BA 3K0EA 4LGMA 3WYFA 2QN6A 5EXSA 2O8BA 1KDTA 2YOHA 1FTNA 5G53C 3ZS8A 1EWQA 1J7KA 2GBLA 1YRAA 2XZPA 4MYTA 2WWIA 4BFSA 3TGPA 3LY5A 1XTRA 2ZU0C 3CBQA 4N3NA 4IEEA 1W4CA 2QRNA 2ZSAA 4EKDA 5E7IA 3LH5A 3ZIAD 3ECCA 2O0JA 3VKHA 1Z5ZA 4YQFA 1A2KC 5KSZA 4PHTA 1NN0A 3IUYA 5EE1A 4C0SA 3OAAA 1FMJA 4WXPA 3UATA 1D2MA 5BXQC 5CLLA 1YZTA 1L7VC 2EFEB 2XITA 3LFUA 2CK3D 1OFUX 4QBGB 2B8WA 1SVSA 3A1UA 3BH0A 3K70B 3BBPA 2OESA 4DSUA 3FWYA 2AX4A 1G7TA 3R20A 4BECA 1SZPA 2F3RA 4DEYA 4Q7JB 1SVWA 4M8NE 1KI7A 2JIZD 4I4LA 2EYQA 3AB3A 1OPXA 5JFGA 2EW1A 3AVQA 1Q1BA 3OIYA 4QNMA 1YKSA 1SXJA 4B75A 1C1YA 1KI6A 1OXVA 2YWFA 4TLAA 3IIKA 1NG9A 1P2UA 1Q12A 2GJ9A 1WF3A 3AP3A 1YZKA 2ZI9A 2Z83A 4A82A 2HJVA 3KUDA 2J3EA 3LNCA 2EWWA 1L4YA 1Q44A 3E1SA 3QJYA 4BFZA 3IQWA 2VF8A 3A1WA 2WJHA 3EW9A 2EFHB 4DLZA 1BOFA 2I1VB 3GLGA 2BIFA 3HDTA 3T61A 2JLUA 2FEMA 2P5SA 2BEKA 2F1RA 1IN5A 1G3UA 2XJ4A 2GJAA 3NXSA 2YYZA 4Q1DA 3PFIA 2ZPTX 1Z83A 3X1YA 5KNBA 4KLZA 2BOVA 3RANA 3V9PA 2J0QA 3Q8XB 2Q9BA 1X1RA 2Q3FA 2NO0A 3RDPA 2WIBA 4W9MC 5IHPA 2PCLA 2REOA 3WNDA 4TLCA 2ZSFA 1SKYE 2OUKA 4KFRA 3BC1A 3HR7A 2J59A 3RAPR 3KKPA 2REXB 4BUJA 2ODBA 5UKDA 1T5LA 2ODWA 2YOFA 2MMGA 2VSXA 3LO5A 4TTQA 1P9WA 3QKRA 3O8BA 4M1TA 3LQQA 4Q1FA 4GMXA 1C9KA 4B3CA 2W0SA 1LV7A 5AJZA 2HXSA 3IILA 4FWTA 1TU3A 1TEVA 3L0SA 4LCBA 3RS5A 5GVRA 3TE6A 3W9YA 3MD0A 4MDFA 2J45A 3VX4A 3SQXA 4A8JA 3CPHA 5KDOA 2XSZD 5IK2A 2WJJA 3WHKA 1T9HA 1G5TA 4RD2A 3DEFA 3KB1A 1X86B 2KJQA 2BBSA 1W46A 3N2IA 1FQKA 5FPYA 1E69A 4KVAA 1XMIA 1YVDA 1FW6A 1R0YA 4DDTA 4JLJA 3GJ4A 3ICQB 2ODNA 1CRQA 2WICA 4F92B 4PSAA 1WRBA 1ZM2A 2YC4C 3ND9A 3CNOA 1ZNZA 3EA0A 3JZMA 2JLZA 3DPUA 2GNOA 4IKEA 2AWOA 3TIFA 1G16A 2VBCA 1U9IC 5DYIA 5KDDA 1YQTA 3SS8A 4JYBA 4V0MA 1KO8A 3B85A 2Q21A 1YZGA 3GEHA 3A4NA 2ZAOA 4G01B 2EYUA 1E9BA 2HDNB 3HPRA 2GKSA 2OXCA 2IWHA 4Q4JA 4HZIA 1GNRA 5JJIA 1JJ7A 2HXYA 2FPMA 3P27A 4LPSA 4R71A 1JAIA 2JIZA 2F43A 1PV4A 2QMHA 3CKLA 1Y3AA 4ON9A 1AZSC 4NYMQ 1DADA 2ZRMA 1KK1A 3HP1A 1LF0A 1VG0B 4PAOA 4NMMA 3KQLA 1TQDA 1KDOA 3IPYA 4NYIR 4ZI3A 2Z0MA 3NEYA 4D4MA 4QM6A 4EPTA 4MQBA 2BDTA 3ASZA 4Y0VA 2D2EA 2NMVA 1NI3A 4DCSA 1MR3F 2BJWA 5KOYA 1GVNB 2QQEA 3F5FA 3ZZTA 3WP1B 4HUTA 1NY6A 1G8GA 4TMTA 2VHUA 2QMOA 4BEBA 3WMGA 2NG1A 3QKRB 1TU4A 1ZNXA 2GK6A 3RS2A 1UM8A 1D2NA 2QROA 1YZNA 4AKGA 1E9FA 1Y63A 3U44B 1RPZA 1BYUA 2CNWD 4HLUC 1MO3A 2HUPA 2ZRIA 2C99A 3U3JA 3NTUA 1KI2A 4CZ2A 1DARA 2QTFA 4OQFA 2JLQA 3ZDQA 3LD9A 2GEVA 2IUUA 4ZCIA 1E2KA 4LV8B 5CDFA 5B30A 4M1OA 4KFTA 4Q47A 4EPVA 4O2RA 2GCPA 3U5ZB 3CNLA 4Q9KA 3VFDA 3TVTA 1NLFA 4TYWA 1EGAA 2V8OA 3K1JA 5CDFE 1N25A 4NONA 3QEJA 4QFMA 4DIEA 4PC1A 1W2HA 3BFXA 4EFMA 3I1FA 2PT7A 2PJZA 5FPTA 4IOLA 2Z6VA 5A5GA 1XTKA 1UKEA 5DI3A 3LLMA 4JZKA 4XSHA 2OXRA 3WHLA 5EP3A 1DAFA 2CDNA 1CP2A 2W2TA 4LSGA 4US1R 4WIAA 4DLTA 3THOA 4TL9A 2C2HA 4TQAA 3R9XA 2G1KA 3QKSA 3VQTA 4JLVA 4YC7A 4Q1BA 3RS0A 2PMKA 4OK3A 2XZLA 4QRHA 4IRUB 2OCYC 5DN6A 5TDHA 2XX3A 3GJ8A 4A36A 4AURA 1JAHA 1OYYA 1MT0A 2X8AA 1UBEA 3GQBA 1CIPA 2IBMA 4FMDF 2QQ0A 1EFHA 5KPJA 3I73A 4LK2A 1MABB 1HQCA 2V7QA 1SVIA 3HU2A 1WE2A 3QXCA 3ZH9B 5K8UA 2J5XA 2GAAA 1ZBDA 4IDPA 3W5IA 4CRWB 3U4QA 3AKDA 1IM2A 4Q9IA 2HV8A 2ZJ5A 2JEOA 2R2AA 3U2QA 5SZHB 1T0JB 5LBIA 4URWR 1G21E 1M2OB 4WW0A 3A37A 2RCNA 3B5JA 5A4JA 621PA 1N6HA 3FGNA 2GAOA 2QTHA 2RGDA 3CH4B 1X6VA 1RRFA 3LBIA 4M21A 4RFSA 1J8MF 3RRYA 4OJQA 2ZVQX 2EQBA 1KAOA 1ZUIA 3CX6A 4IOJA 3GLFE 3KJGA 4PC7A 3SZRA 2A5DA 1N3BA 4IEIA 2RMKA 2GA8A 3J81k 2J41A 1GOTA 3QIAA 3RWMB 4D0NA 2BMJA 1T8TA 1HH4A 4FINA 4LJYA 2WAXA 4JVMA 4CIDA 3UK6A 3AUYA 3NVAA 2BHRA 1VG8A 1RE0A 2O8EA 3GEEA 1KJZA 4FCVA 3K0FB 4RKEA 3NH6A 5M04A 4PSVA 2ZTSA 1CR4A 2WMNB 1IONA 1XXHE 1Z28A 2GJ8A 4MGZR 3PUYA 3PUZA 3CRQA 3LX5A 4AKEA 1N0VC 4LJ7A 3BB4A 1NBMA 3ADBA 1JXOA 1A1VA 1VHLA 2OCAA 3D7MA 1KNXA 3AUXA 3UMRA 3GLFA 3RC3A 4ZO4A 3TUIC 2BBWA 4AG5A 1G3QA 4IDQA 1I4DD 4MGIR 1N5JA 4C3ZA 1DS6A 5EZ5A 3AVOA 1G41A 4HATA 4LPKA 1E0KA 5E4FA 5FUVA 5CM8B 5FFMA 5LB2A 4IOMA 2F55A 1U0HC 2EFGA 3GLHE 3VU9A 5FOUA 2PLFA 4AKIA 2QP3A 1ANKA 3GFOA 2J0UA 4GMDA 4HB3A 3T1OA 3DMNA 4IVRA 4A92A 4JYCA 3MJHA 4E5UA 4A0FA 1J2JA 2A9KA 3BERA 2X2EA 3V4FA 5C46F 3W6OA 4DBLC 4OL0A 4DLUA 1P75A 1VIYA 3DKVA 4BFUA 1OXSC 1EK0A 3H84A 3GJ5A 4MUBA 5LDDC 5CLQA 4L15A 1DE0A 3A1SA 2JATA 4F4CA 2NOAA 4PO1A 4B74A 4B35A 3CF6R 2CMKA 5BN5A 3BIFA 3SQWA 3CWQA 1N6PA 5FUXA 3L8ZA 4DCVA 1X3SA 5C2JB 2DFNA 4JVNA 4DB2A 2VF7A 1Q3TA 1W5SA 1IY1A 3SBEA 1CU1A 1M74A 2O0KA 4LYFA 3GP8A 1XU4A 4UNPA 1CBUA 4Q7KA 3U6BA 3EIQA 1S3SA 3B6EA 4LJ5A 4TT3A 1IHUA 1XXHB 1EFRA 2XNDA 4DT1A 1S1CA 3RRZA 5F98A 4WA7A 4CEHB 3VNUA 1AS3A 3AF1A 1KO1A 5FTKA 4Q7LA 1RFLA 5KSPA 1ZC4A 2IYRA 3M6AA 2IF2A 1KKMA 3OFND 2VHCA 1GITA 4QHYA 3RWOA 2FGJA 4DCNA 1Q22A 1GUAA 4KSBA 4IDHA 3SEAA 3TSWA 1PLJA 1Z06A 2FDCA 3VR2A 1OF1A 4L16A 5DH9A 3IEVA 3B1WA 1IQPA 5EE9A 5AJYA 2QGZA 4H1UA 3MG9A 4ACBA 5C18A 4DLXA 5C4GB 3WXMA 4KVGA 3I72A 3U61B 4G5OA 5FBWB 1A2BA 3TKLA 3L43A 1IXRC 3OZXA 2OT3B 1I4LD 1T91A 4D25A 2V9PA 2XOKD 3I3SR 5JEEA 4C30A 1P72A 4KYIB 1R8SA 2ZI3A 4OJKA 5EZ6B 3FOZA 1G8PA 4UNQA 2D7DA 2AFIE 4ZDKA 3MWLA 3L2OB 3KQHA 3EPHA 2ERYA 4RD1A 1HT2E 3QG1A 3T1TA 3RC8A 1E3MA 2LKCA 3AF2A 4Q01A 4IFBA 2QEQA 5ANRB 3RYTC 5EP4A 1S4QA 2G0TA 2IW3A 1RRGA 1AM4D 2ERXA 4OHVA 3ZYCA 4OI0A 1D8TA 1DOAA 4PPGA 2QTVB 2HT1A 4FN5A 4ZCMA 4B76A 1EFTA 3EZFA 1YJ5A 1KOFA 1JNYA 2RGNC
chains in the Genus database with same CATH superfamily
3HU5A 4ZFNA 1VZ2A 4PYIA 1KNQA 2PU7A 3IS2B 1DWPA 4ZMBA 2FUEA 1K4FA 4B3IA 3BX1A 4WNIA 4EKGA 3FDZA 1K06A 5LD2C 1CJTC 1BX1A 1ZIPA 3CX7A 3OX2A 2HY7A 2G5TA 4HFRA 5IX8A 2EKQA 4I3IA 5GAJA 2RH9B 2NUAB 2CUZA 3K1ZA 4R1GA 3LPDA 4HH0A 2YWRA 1KJWA 2YN0A 2AI2A 1JDNA 2JBWA 4FDVA 1KIAA 4JWTA 2FQWA 5E8JA 2IOHA 2G80A 3TTXA 4PGGA 5DTEA 5TR7A 3W04A 5FFFA 4XSGA 3DYIA 2ZWVA 4IBRA 1REQB 5LKRA 4BBVA 1SUAA 3K4PA 4IX1A 2XZOA 1GG2A 2FMIA 3FWKA 4EG8A 1GZ6A 2QNIA 3ZWMA 1EFCA 3F49S 1QP7A 4J0DA 3PHJA 2KM1A 4E22A 2VF4X 3BWMA 1X8KA 4XLTA 5JCJD 4OYRA 1G5QA 3W5VA 1N5IA 2Z6DA 4WKPA 2OZPA 2GBGA 1BGWA 4MDHA 1AKQA 3KJEA 1TEHA 1K6JA 3KYEA 3EUAA 5HUHA 1VMDA 2R1VA 3C5WP 1YR3A 5LIRA 5SYNA 4JC4A 3IQGX 4YCSA 1EUZA 2VDWB 2HDWA 4HF7A 4YA6A 4HDKB 1YHNA 3QVKA 4Q02A 1XAIA 2H11A 4QBKA 1EE2A 4I1SA 4B4WA 1A98A 4XR9A 3W6NA 1NZFA 2AMVA 2HB6A 3OT5A 3SQMA 3LDAA 2VDUE 1XJ5A 2J3WA 1FDWA 3W6ZA 3FAKA 3OH8A 1FNSA 2AFVA 1SAYA 1XRPA 4FDTA 4LY0A 2PGLA 4NYIQ 3UFXA 1UODA 2W3FA 1N2HA 3WB9A 1KEVA 1CQJA 4LRQA 3LR3A 1ONHA 2ZQZA 3AINA 3E70C 4KRFA 1VC2A 2VRCD 1TTQB 2XQZA 3FN4A 2I6UA 3G1UA 4YAFA 5KAPA 4TV8B 5C8DA 3ZGXA 1K2WA 1OFGA 3Q3HA 1HT3A 1PJ2A 2ZRPA 2CXTA 4WLAA 2XOXA 4BLVA 3AUUA 1FP1D 5GMOA 4CF6A 3MQFA 1B3RA 1ABEA 1FNNA 3KSUA 5BT9A 4LYJA 1GR0A 1B14A 3N70A 3TZHA 4BMSA 5K4HA 3C14C 3NDPA 3P0HA 4KAAA 2WINI 3OESA 4LQ4A 1AUOA 3TSZA 1OH6A 3S70A 4PZCA 2H1OA 4EL5A 4GP9A 1E2IA 2QM0A 5IUJC 1K9VF 2GFIA 4UVGA 3PG5A 4RC9A 4S2NA 4KR0A 5AFSA 2BFDA 2HK9A 2P91A 4CKZA 1PNQA 5FDSA 1PT8A 2KPOA 2EXBA 2YZ7A 3I1YA 3MELA 4PX5A 4YRTA 4JKYA 2Q5HA 1CB0A 1A7AA 3EWNA 4K9MA 5J1TB 3DYBA 3ZHQA 3AFHA 1DEAA 3E4QA 2A9FA 3AKCA 4JBYA 4P7BA 3L18A 3N8SA 5AM0A 1JKMA 4RU1A 5FQOA 4XRGA 5EJ8A 3ADCA 1E3UD 2EJBA 3OZEA 1Y33E 3ETNA 1H94A 2H4XA 3GOHA 3GUCA 3HEMA 4P31A 1BWRA 1PJQA 5GJWC 2AOXA 4MUNA 5FPSA 3Q41A 5CEEA 3VU3A 1ZITA 3BQ8A 3OZAA 5IAJA 2WA2A 2P30A 1ORTA 1NV8A 1RMQA 1GR1A 2F8MA 2UVQA 4GBMA 2D1FA 4MW5A 5U4QA 3RS7A 2NSDA 4Q66C 4FMCB 4UM9B 1PT5A 3NZEA 1UR5A 5IZCA 3MQQA 1QH9A 4D5GA 3NC8A 1CF2O 1RNLA 2N46A 3GUZA 3BMOB 4U8HA 5FQMA 2XK1A 1FP6A 5FR1A 3ZQ4A 2O8EB 4MKHA 4MA5A 1TVEA 3VYWA 1BS9A 2DHEA 3C6ZA 3K8OE 5CDHA 4EHHA 1EX6A 3MQ0A 5IVDA 3FUXA 3AGEA 4PW0A 2H59A 4NV0A 4OOEA 4OHMA 1UJMA 5FTNA 2PAAA 4BZQA 3A3EA 3OIDA 2KX7A 4EBFA 3ZJTA 3U3OA 4G65A 1ZEMA 1CF0A 1FYEA 1G3IA 3MZDA 3BF7A 4JJZA 5FWYA 2YWDA 3DTEA 1HK7A 3OU6A 4RIGA 3UA3A 5AKKA 3ZDRA 1W48A 2WBLC 3G32A 1TS6A 4N8EA 2J9GA 4E30A 2CCJA 1EDDA 2QTNA 3HVFA 5DNDA 2FN8A 2BFOA 2IF0A 3ITEA 4UE2A 3U26A 4ZI2A 3ZVTA 4YT2A 4DJJA 5GY7A 4WXRA 8LDHA 1OWPA 1ZNYA 1I2MA 2YNMC 3GI1A 4TRRA 1KSGA 5KVAA 5IJWA 4EAAA 2REQA 1YR1A 1E1KA 2HDRA 3PVSA 1MKIA 4HNHA 5I4CA 2HL6A 2NYRA 2C0CA 3VSEA 3GAMA 2C3YA 3FE2A 2HHHB 4W63A 2G4CA 1H2FA 5J4EA 1E4VA 2CE7A 3AO0B 3EQ2A 5P8WA 1K7XB 1MB9A 4NWIA 3DBRA 5EKDA 2IV7A 1MW9X 3W1WA 5M2QA 2Q3HA 3VNQA 2HWKA 3MTJA 1ZIDA 4U7WA 1P2TA 4JD5A 2R96A 4WN3A 1NQAO 2OD7A 1XRQA 5JCJA 3S7QA 3U39A 5DTTA 2XNKA 3CSUA 1PGQA 3NC4A 1E1RD 1HDZA 3P0RA 4HLUA 4R7ZA 1UJ5A 6REQA 5JADA 3ZQKA 4FGJA 3R7WA 3ESAA 4BFTA 5E43A 1BMDA 1YAXA 1U2GC 1MO6A 5LZ5A 4BE9A 4FHZA 1TKCA 2E1PA 1TMKA 4BRSA 2JLVA 1ST2A 5D5HA 1IEQA 2X7XA 2OFOA 4WL9A 2Q5EA 3CWCA 3K9NA 1PEKE 3OEEA 1JLKA 2QYSA 4K88A 3GA5A 2V4ZA 3BQAA 3V8PA 3DFZA 5JYDA 3KLOA 5I7WA 4C7KA 3HS3A 3HK2A 1RD4A 1XLTA 1XRMA 1VKRA 2P0YA 4OU5A 3OA0A 4R1TA 1FVOA 2O19A 5F7OA 1V5GA 5HTKA 3EAGA 4H16A 3PWSA 4IIYA 4TRJA 2WHXA 1O97C 4BNYA 4DWJA 2XYVA 4XVUA 3FY4A 3SM3A 3AXSA 3GEPA 4K46A 3L6EA 4R2MA 4YP5A 3SIXA 1D1SA 1LNQA 3GPDG 3KYBA 2H1LA 4GSLA 4EHFA 5L45A 3D4LA 3ZUPA 3H8JA 3EWSA 3HA7A 1PSDA 1WEKA 4KQFA 2CVZA 3B78A 4PPFA 5DVZA 4KXXA 4FJ1A 5EKSA 3SDZA 4EF5A 4XCXA 5K6AA 3AGFA 2A7QA 3NVMB 4H4CA 5BSUA 1NATA 2VP9A 3I30X 4TLDA 1X7WB 1ZTUA 1RPAA 2WYWA 3F3SA 3LBFA 2J3IA 2UKDA 1K4YA 3HRKA 4YBRA 1FVFA 4AK9A 2H7CA 1U0TA 2Y67A 2L0WA 1UMKA 3FLEA 3PX3A 4UJ5A 4YAKA 3AEUB 4IKPA 2F1IA 2EZ4A 2BVNA 3Q0EA 2AMFA 5AM1A 4B48A 5JISA 5JG7A 1MNQA 3SF8B 5FF9A 3DKKA 1XNQB 4PCUA 5T8KC 3BWYA 2CHUA 1TE2A 3OKCA 3OEHD 1HO3A 1V47A 3WGVA 5FQJA 1BMFA 2X1MA 4MW6A 1MMFB 1XTTA 1T6XA 3ELWA 3F7MA 3W8NA 4IXMA 5DGCA 1G5UA 1OHHD 2J0UB 1ACFA 2KWIA 1UANA 4TM8A 2GYWA 2B21A 2DHRA 2NZUG 2GJ4A 2HJWA 2VRCA 1KYTA 2FN3A 4OKSA 2H18A 5AJHA 4BVFA 1OB2A 1TQ2A 1CETA 1VCOA 4DTIA 2I65A 2FMKA 3U3RA 1QO9A 4P7GA 3PC3A 2PU2A 3HB1A 5FV4A 3KQUA 4M8IA 1VRVA 4FK8A 1BT5A 1A0KA 2B9VA 3DPIA 3MXQA 3GARA 4ILKA 4O2BF 4TROA 1BHJA 1R8XA 3UH1A 4EVSA 1OX4B 3A1TA 3PGXA 5KYKA 3DL0A 1MQSA 2CMDA 3MEQA 4OF4A 5EG5A 1E98A 1MV5A 1Z82A 2B4YA 1IG0A 5THKA 4B85A 5L40A 2BYTA 1EIWA 4BIMA 4F8YA 4XZ3A 4EGAA 1KH3A 5JO0A 1PTKA 3WL4A 5IASA 5KWJA 3ZI0A 3SZMA 4P54A 3CY6A 3IEUA 2F3SA 4FKMA 4EWLA 2DR0A 3G89A 2HGZA 1B41A 2XMSA 4RZ3A 3HEAA 2P6UA 2B5RA 2NU8A 3LKZA 4J2TA 1W9MA 2ZBBA 4Z9AA 4IGIA 4KPUA 4GC9A 2W6JD 2XEPA 4IYJA 3UK7A 5CFNA 5FOWA 4GVXA 1CUGA 4PIMA 3TNYA 4K3VA 2QXUA 5CXQA 3K1YA 5EP1A 3PC2A 4DLVA 1NP6A 1AHPA 3DCYA 5LMZA 5CH8A 5E0OA 3PX7A 2HKIA 4L4SA 1RM3A 4JI7B 3RBAA 3FHLA 4J1NA 3JVVA 4X53A 3VR4D 1TCAA 2HU2A 2N42A 4QSMA 3H5TA 4DF3A 1GSXA 2Y2LA 5IF3A 4ITRC 1V71A 4WQMA 4DJ5X 1G60A 2GKGA 4LHSA 5C80A 4NENB 5KYYA 3HU3A 1RACA 1ZUNB 1RBMA 3PPWA 3ZGVA 2C2MA 2QXTA 4DJEC 4EBBA 4O4JF 3GDOA 3TBHA 1DQRA 4XVHA 1SY7A 3KOOA 1FPMA 2KDKA 1A2OA 1XA3A 1QGOA 2J5RA 2P3QA 4RVNA 1BDJA 4S24A 1HTWA 1YR7A 4WLFA 5I8PA 4AI6A 2GRAA 5L6MB 1O9HA 3RXWA 1NLZA 5CEJA 2A4KA 1XEXB 5E4JA 5AKXA 5JLAA 3EXHC 2EFXA 1RU3A 1Q0UA 1L1RA 3DCIA 4UMVA 4EY5A 5B6IA 2XLCA 3D7RA 1N2JA 3LBHA 1QRDA 1NKSA 1YNSA 4B7ZA 2WB2A 4LXYA 5HMLA 1MB2A 4BB6A 1R74A 2WAYA 3OUZA 9LDTA 3MUEA 1UGUA 1EDBA 1NBEA 1G9XA 4YMWA 5FTMA 2BGGA 1IYPA 1AXBA 4ZPXA 1AS2A 3PIIA 1VJDA 2RJ3A 4RDIA 1THTA 4G0MA 1RPTA 2OCPA 3PS9A 4B4KA 1ARZA 5KMWA 2XBMA 1QDUA 2X3FA 4ERNA 4ZN6A 1CW2B 1KY3A 4Q37A 4R0MA 3SJCA 4BGIA 4PLZA 1K8QA 4MYSA 3UFXB 1T1IA 3IAEA 4YECA 2FWMX 2WADA 4EETB 4R3WA 1T34A 2IKQA 3PTLA 1L7BA 4HDMB 3DXZA 1RCJA 4WRRA 4H15A 3TTVA 1NVWQ 4IW3B 2C5LA 4U5XA 5E95A 3FROA 2R1UA 3VNAA 2ZQYA 1Z7EA 3BCHA 3LCCA 2VA8A 1LVUA 3O4JA 4KV7A 4N6NA 1DC8A 1GLVA 1RRVA 3D2CA 5TGFA 4GI7A 2R5WA 5D1NA 1T4CA 1K6SA 2B8JA 1WXEA 1FFXB 4U7FA 3MCWA 1EK2A 5A3VA 5CB4A 5CA0F 2B3TA 1HNNA 5CDTA 3H4TA 3V8VA 3DTNA 3V46A 3GCDA 2DLDA 3IYLW 2ZITA 3B60A 1U2DC 2O8CB 4M9RA 1IZYA 4EAQA 3G88A 3GU3A 5D87A 2JHFA 3VAZA 3DEIA 3HKEB 2NT3A 1S3FA 2QE7A 2RK6A 4YJ3F 4Y2TA 3UCXA 2EFYA 1CUYA 3NTVA 3IO3A 2EFUA 4UNRA 3AEXA 1K4EA 2R86A 4ILEA 4N7BA 5K0CA 1IJFA 1DKLA 1WCIB 4GW3A 4FM9A 1NIPA 2XUJA 2ZBQA 1WPRA 5L8MA 2I72A 4S2KA 1OFHA 3H8SA 4UM7A 4DWVA 5HPFA 1AVTA 2QRGA 3H2BA 3LUFA 3WB2A 1WUTA 5JANA 1NYQA 4MR7B 1RYBA 2ZANA 4KQHA 5AHXA 1UL1X 5ENDA 5EPOA 4Q3OA 5K3BA 2W5UA 1Y89A 4JGOA 3MHPA 3DEJA 4XJSA 3NNSA 3UB3A 1L0FA 1W93A 1SURA 2H1CA 2H6EA 1STOA 4DVGA 2CD9A 3IAM6 4DR2B 1CUBA 2ISSD 3EYWA 3D7NA 1OTYA 3KQPA 2E5FA 3T9AA 4ZHQB 3RFVA 2PZEA 1NWZA 3CUUA 4C20A 5JI3E 3CUEF 4QODA 5EERA 5FBLB 4DYDA 1PFYA 5KO2A 1JQ5A 2Y99A 2VWGA 1P3Y1 2Z2JA 5EJ7A 1CFZA 2XIQA 3WNVA 3M1IA 3NKVA 4MWGA 4FCFA 3GZTB 4TKUB 3KO6A 5DGDA 1SHZA 2NQ2C 4BNMA 4BO4A 3A06A 3A0SA 3T4OA 3QQ5A 1SNYA 3OPLA 1JL3A 4QUAA 2WU1A 1UXGA 2WTNA 2NU9A 2DPGA 4DMLA 3H9BA 5LJIA 2I8LA 3RS9A 3K6KA 4W5RA 3IP6A 2IS1A 1CS0A 1RQ2A 4BLSA 1Q0QA 1AKMA 2PWAA 2Y0BA 3UB5P 2V65A 1F1JA 5JE8A 4TV8A 2Y1OA 1RHQA 2BFAA 2B02A 1XAJA 4WMCD 1FLDA 1NRJB 3GJ3A 3O26A 4NPCA 3WDMA 1UKYA 3CWFA 2WUDA 5FBKA 1U8AA 3OBFA 4DV5B 3GH1A 3PNYA 4TKVA 4RLFA 1PWCA 1Z5PA 1YXMA 3LGAA 1MGOA 1THMA 2ID7A 3HVRA 2PX4A 1T9GS 2RI0A 5AO9A 2XGMA 5TPWB 2R6FA 5MFZA 1XTZA 2VJDA 1K54C 5CU7A 2CHEA 2A7XA 1GQOA 5J5VA 4AF7A 4CM9D 2YJZA 4J43A 4ZIRB 4YDRA 1AA9A 3ORSA 1CUUA 2QMZA 4L72A 1V7PC 5GHZA 1QOPB 3E9RA 3S81A 2INGX 1UWLA 1IY2A 3GVIA 4BVBA 4U9IS 5M34A 3O84A 2DECA 1DFGA 2VSNA 4D0LB 3T4SA 4NAHA 4KUOA 1BS1A 4C0WA 1RJFA 2DG2A 3LOQA 3N7TA 5TBMA 4FIDA 4ZZ2A 5LYYA 4HRAA 3UUEA 4B8YA 5HW3A 4ZCPA 1ZWLA 2DBZA 2WP8J 3FDFA 2AL7A 4UBMA 4D98A 4IJMA 4ZGBA 2JI6A 2OQ2A 4YRPA 4ZDIA 1DQSA 3BL6A 4Z4CA 2I2BA 2JIRA 3O3NB 4EHLA 4C0LA 2PZGA 4ZAWA 2IIPA 2P3LA 4HQFA 3CLKA 3W6UA 4OXYA 2C4KA 1JWZA 1S4SA 1V1RB 2FQ1A 4XVQA 2R5FA 3DDOA 2ATIA 3KYZA 2ST1A 4Y2VA 1U2EA 5CVTA 4H6VA 1V9ZA 1U2GA 2ZZKA 5CFRA 6CHYA 5JJKA 3DAFA 2Q6OA 1C8LA 2IIVA 1YIOA 2ZAMA 3D2AA 4NFLA 1ES9A 1MC5A 2XUHA 3OFJA 3JALA 4MB2A 3RYIA 3VC1A 5BN4A 3O5YA 2LXNA 5BMVB 2OXEA 2ZCVA 1ZISA 3OOWA 3QNCA 3O3VA 3FDJA 1Q7GA 1EXDA 2A24B 1GCOA 2YWEA 3MVEA 4EJ2A 3UOWA 2WP0A 3HM2A 4S2UA 2Y0CA 2H4WA 1C4WA 3TKAA 3AIIA 1T6NA 4U0JA 3W5BA 4HI0E 5E6UB 3GLFA 4BDSA 1PLLA 4EY8A 5F7XA 2JS7A 3DZ8A 3EOAI 1JJFA 4MPDA 4QU3A 1LK0A 1PE0A 4P53A 1E94E 4A5RA 5DWQA 3T7DA 4BWFB 1W19A 1SC3A 3CZMA 3VR4A 2V55B 1TX4B 1Z8NA 4KV9A 4NYJR 4CM1A 4DDWA 4NCAA 4FU0A 1CY7A 4INOA 1E5DA 3UMDA 1JEYB 3HUUA 4RTRA 1D7EA 3EVBA 4G1VA 4ZI7F 2Y2NA 2HWWA 5CMLA 2VJLA 3RS4A 4HNBA 4I1YA 2YRFA 1J8FA 3QVGA 2J3MA 2GZAA 4TZKA 5ITVA 5BPHA 2PR2A 3WMXA 4P92A 4D2OA 3ER6A 1KDSA 2CDBA 4R05A 1N34B 2PS0A 5DE3A 1BRTA 3HDHA 2VRBA 1AN0A 1VKJA 2FQYA 3QP1A 1QB7A 2WSLA 4BO6A 4WEKA 2XCLA 3T94A 3CA8A 1EFVB 2G9ZA 3BXHA 2HWYA 3JR7A 4HQOA 3LI8A 1N2ZA 4MYUA 4A2CA 4IH4A 2VHVA 2ZC4B 2I4NA 3IVGA 4C4SA 1UFVA 4D41A 3IQZA 1D4FA 5C1PA 4EW2A 2MSCB 1F9EA 1KU6A 1KYWA 4YMVA 1MG0A 1B00A 1UPUA 2WJYA 5B1SA 4FZ5A 3TM5A 3A6HA 3QW2A 2PPLA 4YY3B 1G8AA 4HYEA 5KAMA 3AOEC 2OVBA 1XZHA 5D3ZA 2G9RA 3CR3C 1F2DA 1I2BA 1Q5PA 3DQZA 1C7IA 5DT2A 3NRJA 2FUG6 3C3PA 2BGWA 1YDFA 3JS5A 3MYYA 2EG5A 4Y8VA 4JVLA 3PUHA 1LBHA 2I3ZA 2QMYA 3KLNA 4H77A 3G85A 3C8HA 3F1OB 5IG2A 3TSGA 4L3OA 3WNQA 2OBYA 2ID9A 1V16A 1TVKB 3LP8A 4JSRA 2FE4A 1MZPA 3BRQA 4HH2A 1A9XA 3S55A 2EEPA 2ZYRA 3F6EX 5FI5A 2ID8A 4LBZA 4C0AC 1CZUA 2BF7A 5HCNA 1JB1A 3ZTYA 3KUKA 5HBRA 4WBSA 1DC6A 3AL3A 3I3OA 1XZMA 4BV2A 1NG1A 3O7WA 1LK7A 1SCQA 3V67A 3EGOA 3OM8A 4V3CA 1GT91 1OGJA 1TDJA 2NZVG 2FDXA 3DFMA 3O47A 4E11A 4WEOA 3QE9Y 1AKEA 3VXKA 1Z2AA 3AESA 5T8KA 3VU1A 2C4TA 2EBWA 4HAYA 4N8SA 2IODA 3V34A 4AZVA 3CG5A 2HRQA 4W99A 3U44A 2E8JA 5EYPB 4KMRA 1C7FA 2IXAA 1Z15A 4RKWA 5AVOA 5LOVA 3CTPA 4TV9A 5PGMA 4TZ0A 2GXSA 4BBPA 3F0TA 3K09C 3LTEA 3Q1KA 3NJAA 1N6KA 3BFVA 3JAKB 4OUDB 1QZZA 2FN9A 4Q3DA 4XPIB 5B55A 3SH7A 1USGA 5JY6A 5F5YA 3KDAA 1E6LA 2E89A 2WKPA 3N74A 2E8IA 4WCFA 4WK4B 5IN5A 3S5UA 3W5AA 1HYQA 2YFKA 2O8DA 1XTJA 3U3XA 5HL6A 2POCA 1P29A 2FCAA 2YVLA 3GJXC 3DBAA 1AKTA 1E3QA 3AOEA 3U40A 1BX3A 1UH5A 7GPBA 4Y6RA 5C4MA 1NVVR 4BDTA 2DPHA 1QFJA 3DA8A 1YK1A 5HRUA 5EIWA 3R41A 3F1NA 1IN4A 5DNWA 3WLAA 1LBEA 3GRAA 1DT5A 1PJCA 2NYAA 4KPFC 1HQKA 1OBFO 1FXUA 3RVKA 4HDNA 4RHUA 1EDEA 1GXSB 1I4EB 1OBVA 1HY3A 1XEWX 1NW6A 3FYUC 3KYJB 3PNOA 3OF2A 3R6DA 4QARA 4YJHB 2Q27A 3QLUA 3RC9A 4UAGA 3TIGA 1D4AA 1FTGA 4G89A 1I13A 5FBVB 1V0JA 2V45A 2O5EA 2W70A 2AQ8A 4BB0A 3IE2A 1V8ZA 1KO5A 3GGCA 4DYHA 1NUQA 3VE4A 3DHWC 1EP2B 1ZUNA 3TW4A 3OY7A 2C97A 3ZG8B 3KDSE 3CLSC 4LBVA 1PO7A 5C5DA 5HOEA 2DP4E 2X8JB 1OT9A 3ROEA 1D4OA 1TJ5A 2X02A 3KSFA 1X80A 3AF4A 4MVJF 3HKBA 2PUJA 4EPYA 1KA9H 4GLFA 5LWHA 2JK0A 2RHBA 1VETA 1S8AA 2E82A 3H17A 1JI3A 4MLCA 4LXQA 3UT0A 5KWEA 2JGNA 3H87A 3NULA 1LV8A 3E9NA 5C5IA 5FDFA 5IKMA 1SBNE 3I23A 1PIWA 1DIRA 2GVDC 3O73A 2ACKA 2W8BA 4JF6A 4Y2UA 3T5MA 3ZTTA 3AY0A 4QTYA 3M6UA 4M9XA 2OE2A 4OBEA 5F1YA 1WDTA 3EAFA 5CVCA 4EJ6A 2ZB4A 4V1CB 1P60A 3FYCA 2YHSA 1J0AA 4I36A 4DIFA 1Y42X 5JEDA 4IJ5A 3UDFA 2OKGA 4W5QA 4J0JA 3OO1A 5EVID 2ZDGA 1P4SA 3W79A 1ZNWA 5B1IA 4CMIB 1DBWA 3II6X 3OLWA 4EZIA 1LT0A 3M89A 3OSUA 2J6CA 3L8FA 3I09A 4KYUA 1QHHA 3R23A 4GOLD 2C3MA 3ITDA 2QLBA 3GFQA 1TJNA 2OBLA 2GF0A 3AR5A 1MEEA 3VTAA 4F4IA 4RDXA 4QFDA 5KC9A 2FPXA 1BJKA 1E2FA 5F76A 2QLFA 1FLNA 5LQDA 2PBFA 1QGUB 2CF5A 3VYVA 4LUCA 4KQOA 2C95A 3EMVA 4CG2A 2XJ9A 1X8LA 2GB4A 3FTQA 4LXHA 3TL6A 3N0RA 1KWGA 1CY0A 1G291 4OHWA 1W36B 2A58A 1KRWA 3WGLA 4P38A 2ZS8A 4LRXC 2GO7A 2J9ZB 1SKFA 2OK7A 3M6VA 4LMRA 3FDIA 4TVKA 1Q7TA 2WHQA 4QEZA 1PWYE 2HUNA 2P65A 1I2ZA 5FATA 2GTPA 2P8SA 5KKAA 3IDZA 2O0YA 1PJSA 2QIPA 4I81A 3A7DA 5DF8A 3EULA 3NWOA 4OQYA 3S8EA 3C3CA 4OLHA 1JKJB 2R8XA 3ZU6A 3ZXUB 2VGKA 3N2KA 4OAOA 1NW8A 1PJZA 2FSVA 3GMWA 4PR0A 2XDQB 1N9ZA 3CLSD 4G8JA 1Z25A 2H92A 3T3IA 3EC1A 4CR8A 2IHTA 5AUOB 3UMMA 2XMZA 3ZDYB 4CV1A 1OYOA 5I4IA 1JFFA 2Q6TA 4HZUB 3VC3A 4F6RA 1X2BA 2RGEA 4MEAA 4GNKA 3EVFA 3FGZA 4Q19A 2C9YA 4UBIA 4CFYA 1N1GA 1YZ3A 1NURA 2CL6X 3F71A 3CAXA 3NTOA 2DUJA 3CJRA 3RTEA 1BA2A 2ILVA 2XMRA 4NICA 3SLGA 5ITZB 3RLIA 3HQ4O 7REQB 2EBHX 3D3QA 4MRRA 2PKYX 1IZ8A 4IGEA 1C7EA 1B8NA 1H4TA 5E2AA 4XIYA 3BLSA 3L5KA 3NYQA 4GUDA 1HM5A 4N12A 4NS4A 3QOYA 4J0EA 4J90A 2ZM5A 4JXGA 3ABQB 2HJRA 3AEKA 3QEMB 1GFIA 3C3KA 3ZGAB 4PLCA 3UWKA 3CZCA 3KALA 2G6TA 3S7TA 4ZREA 3VJLA 4YUYA 3AM5A 1WL8A 3T0GA 1X1SA 4GW9A 1ZSNA 4HRXA 1NSTA 1GL3A 1S96A 2CLOB 1T3SA 3LLSA 4W7HA 2O1EA 5GQSA 3RUIA 4E14A 4Z2AA 3JATA 3L8CA 5K6TA 3RYIB 1J70A 2QY9A 1E7RA 2VLIA 4NOLA 1UBSB 3MUNA 2EFJA 1KK3A 4KENB 4I8DA 1TCVA 2C9MA 3IJEB 3TB4A 1KP3A 4BO1A 4DM7A 1KFJB 1P4HA 1P3JA 4EABA 1YL7A 4XARA 1D03A 4DILA 5BV2P 1NASA 5A4MS 2ACGA 4H0CA 4B8WA 4H3SA 4WUTA 1VSBA 5FEGA 2D3WA 2BFPA 4FVTA 4OGLA 4OKIA 4QNNA 4B2PA 1E3WA 4M53A 4RCYA 5AQBA 4BC1A 3JQ7B 2Q5LA 1OJ5A 5CEDA 3IBGA 3TW6A 3OTHA 2WF7A 1Z8DA 2FDRA 2ICAA 2YMPA 1VE1A 3P7MA 1V7ZA 4J16C 1GSWA 3OJ0A 1LDEA 1JIQA 3U56A 1TTPB 1WCWA 1R4MB 1LRKA 5EKXA 1Q1AA 4JN6B 4S3MA 2I55A 4ZJ1A 2D0PB 2JAXA 3FCCA 3RU9A 3R0QA 3B1VA 1DFHA 5CLFA 1M3SA 1M34E 1K97A 3MQ2A 3CH7A 3OURA 2W1TB 3UPPA 4EG5A 3PQ6A 1GDTA 2Y1GA 1FYWA 1L3BA 3RF6A 1BHQ1 1DAIA 4J2HA 4FJ0A 1K92A 3ENKA 1GZVA 4YLEA 4CIXA 3DAHA 4AJHA 2HJ9A 1R6BX 5HP4A 1P0QA 4PKYA 3IPXA 3DW0A 4D79A 2RGNA 2VP6A 5L8VA 3P4XA 3TIXB 2ZL1A 4U0KA 4E07A 5F82A 1BYIA 2GARA 4MEZA 4HGZA 5ALPA 1GZHB 4LTDA 4JGQA 3R6GA 1VRWA 5LWQA 3V3SA 1FR6A 2WUQA 4GKUA 1KYYA 1YB5A 1ZHFA 3PZBA 1ZW1A 4IMPA 5G41A 2HPBA 1NPYA 1QZXA 2A78A 2NO4A 2PU5A 1JDTA 2HLNA 2Q0SA 4PPRA 3V4VB 4AROA 4UD2A 5HPYB 1XROA 1LVHA 3FCUB 4KDFA 1VL0A 1XXHA 4KQCA 4RGYA 4MV4A 1F8GA 1X1BA 5FTJA 1JR3E 5BN4B 4Z7JA 4YRJA 5CIQA 3S1LA 4DDKA 4ES6A 2A35A 5BWMA 4ZV7A 3VKFA 8ADHA 4EJSB 2HMAA 5CK4A 1W88A 5JC1A 2X4IA 1L4MA 1R3UA 3O38A 4OQQA 4PHGA 5IJ0B 1A0OA 1E9EA 3HFJA 1PHPA 4B0OA 2E1RA 1W8IA 1JEQA 5LFAA 5BYKA 1UMCA 1A7KA 1OKKD 1Z3IX 2IDJA 3P2JA 5SV2A 3VX3A 2B9EA 4JC0A 4B2IA 3G1TA 3CLHA 3G8YA 4HDCA 4QGBA 2HLHA 3ZZUA 1W8QA 1U9YA 4I6EA 1M6VA 1N6RA 4YO8A 3CW9A 1C2TA 3RIEA 5AVWA 1AGYA 2D06A 3IR7A 3TBKA 3VR0A 4C4PA 1H5QA 1E99A 2ENWA 2EEZA 1DCFA 3F78A 2KB0A 3IIJA 3U7FB 3GLHA 4XWTA 2H9AA 4GR9A 3NOOA 1JQDA 1ZD5A 4J07A 1UBHS 1M2HA 2ZRAA 3OY2A 3V9AA 3CUKA 3E2KA 2V1AA 2V1XA 1NE7A 4II7A 4HX9A 4EKYA 1NVGA 2P9QA 2NYVA 1DIGA 4XPIA 3L4KA 3TLYA 4I1UA 1Z47A 2O8NA 4RACA 4YCDA 4DY6A 1J6UA 5AVXA 2XQIA 4V3BA 1W5BA 1N2SA 1RYHA 2Q3DA 3HNRA 3OCYA 4KWCA 3WG9A 4RMHA 1KY5A 1PWZA 3Q0IA 3A2LA 3VP3A 4JP5A 3UMYA 1DSSG 3PFGA 1P44A 1SC1A 4JXSA 1EUCB 2JL1A 1L5WA 2PR5A 1S7CA 5IRCD 2AN3A 2F59A 1ZLYA 1VKNA 1YHYA 3EF1A 1EFUA 1FPQA 5E9QA 3AC0A 1EP1B 1N0UA 2B7LA 4Z9XA 4ERXA 2BE7A 2G63A 4FKZA 2RHMA 3KKQA 4OMUA 5F73A 4AZ3A 1XLTC 3F73A 4YPVA 1MCZA 5TQJA 4MVJH 1RW4A 1TO6A 3H83A 4D8UA 5J4LA 3F5QA 2EJWA 3AKEA 4BWYA 3BFCA 2HU7A 4NF2A 5CXUA 1AGPA 2BFWA 4IZ6A 5ALIA 4DNOA 3WBJA 4DC0A 1AXEA 1WMEA 1KHTA 4HJ4A 1NRIA 1Y8ZA 4KG2A 4I5FA 1IMJA 2FX3A 2PIAA 4L5YA 1JILA 2XNDD 4U6NA 3AJAA 3RSOA 4IIBA 4DLNA 3HWRA 3LDUA 1QYCA 2FTKE 3T34A 1UWKA 2Y2HA 1I2SA 2CDRA 2J1LA 3NJRA 4RVFA 4GSKA 5JCOC 3OPHA 1PJ8A 3B12A 1L3IA 4DL9A 1XP5A 2V6MA 4LGVA 5EOEA 2GQ0A 5IT0A 4Y17A 2WWVD 3GRYA 1TK9A 2LIVA 3AXTA 3QOFA 3QBVA 1DBSA 3T3GA 4LF6B 3TG9A 3HY4A 3G9ZA 4A23A 3JR3A 1B4DA 2ZRCA 2JHAA 3MBIA 4FI3F 2XDWA 4IXTA 3ORYA 5AJVB 3RVQA 2M6RA 3TQTA 3GOQA 4B33A 5CFQA 3UPTA 3QPDA 2C0PA 4GRDA 1E0AA 4JB2A 1KDYA 2QS9A 2CXOA 2OYSA 1ZGZA 1XDUA 3BN3A 3RS3A 1DG9A 2PYIA 3BGWA 2PMEA 3CS3A 4I55B 2Q8PA 2QMQA 4LHWA 2ZRGA 1XNJA 4KN6A 5G3ZA 3P2YA 5HDBB 4ED9A 1GKLA 1IVYA 5DTIA 3E2PA 3R6WA 1AU9A 2H5IA 3HH8A 4G9BA 4Q1EA 4XFDA 1OHHA 3WRZA 2QL7A 1GTMA 2HRDA 4OX9Y 3NHLA 5K99A 4DSTA 2P41A 1A95A 1W5TA 1I6MA 4GOKA 3I28A 1Y5MA 2Z4RA 3O8CA 1NBMD 3AI2A 3FTDA 1H8MA 4GDFA 2VNKA 2QN2A 1UC9A 4KXFB 4Q4AB 3VYRB 5JAMA 1RHJA 1UEXC 2EDCA 2QRMA 4XD7A 6PFKA 1ULTA 1CI9A 3R7NA 1SZCA 4OLAA 1US8A 2W6PA 3M5DA 4H7DA 1MX5A 1ORVA 4WECA 1GRRA 1PZHA 4OOYA 1T4MA 4L8VA 2ZIUB 3CX8A 4Q6BA 1GKIA 3RVLA 1GQFA 2HH9A 2Z1DA 2AXNA 5C3MA 2FOXA 5DJUA 3UANA 1E0JA 3T12A 4G1BA 4AM8A 2QRUA 1XEAA 1SOAA 1KGDA 1ECJA 3LICA 4H7KA 3R5JA 4R6WA 3MBZA 4Y2FA 3OZTA 4RO0A 1DWQA 4P0QB 5GJCA 5DLEA 3UXYA 3L4JA 3LBNA 4CNBA 3KXLA 4PRYA 1XQWA 3NM4A 4XUXA 4Z4HA 1RADA 1P1FA 1Z2PX 2H16A 5KTMA 5MFPA 3PC8C 4C0KA 2JAPA 4D9CA 1DEOA 1PX0A 1SXJC 1XHFA 2NLOA 1ZIOA 1XKZA 1EXWA 1XJWA 2ABWA 4OG2A 4QJIA 3CGGA 2B3DA 1Z2DA 2C29D 3VHRA 4BTEA 5LQCA 1ZW6A 2PTHA 1VCMA 3SBXA 1JFFB 3I9V1 1DP8A 2BGLA 2X1LA 3UV7A 4F6RB 5K2OA 3L1VA 3HKDA 2PSSA 3NC0C 2YNMA 4RPHA 3AF3A 1XE3A 4I3FA 1W36D 1DC4A 4NDZA 4L4XA 1ULUA 3W8RA 1XQYA 2IOFA 3F4BA 3HB4X 4ND3A 4IOKA 2I6TA 3WGZA 4FONA 3ZD6A 3K0CC 1ULSA 3L79A 4MKFA 3DDUA 1XWIA 2QZ6A 2WJIA 1IN1A 4AYTA 2VX8A 2ZI4A 4UDYX 1O3YA 1OI4A 3HYLA 3LKBA 1Z2OX 4LE2A 4MCJA 1KE1A 1VL5A 2H4ZA 3G7SA 1WB5A 4CEJB 2WY2D 4ZVMA 2O1XA 3IJPA 4MROA 4JL6A 3RRMA 4DIMA 2OB2A 3I04A 4TQUS 5BSFA 1S4MA 2CDAA 2FW7A 1WCYA 3L0PA 3QFTA 5EZYB 4EI8A 1BUEA 5EPHA 1FSSA 1MF7A 3ICPA 3NU1A 4RPGA 1U1IA 5YASA 3SYKA 4O2LA 3CUEC 4P0MA 3FFAA 1QHSA 2C5GA 3TAHA 2Q6VA 3FKSD 1XEWY 1OILA 3MBKA 1FDVA 4G0XA 3FA2A 1SU4A 4TSRA 4W8HA 3S68A 1F6BA 4GX2A 5DHQA 3O4IA 1O5TA 3MIIA 4B6SA 5EJ5A 2JAUA 2W6ID 3LRPA 4HADA 4NS1A 2W2XA 1P4JA 4F6LA 1HDCA 3MGKA 1KIFA 1LTKA 1VA5A 2BP7A 2Y6UA 2ZT6A 4W5WA 1ISGA 4UHFA 3X3HA 5HM6A 1AK2A 2Z5LA 4KBGA 2XV1A 3ZW7A 3NDBB 4LRSB 2IUTA 2V97A 3I4LA 4H31A 4JLMA 1XP8A 1QZ3A 2KSQA 5AH0A 1QU3A 4RTJA 2UYGA 1PFGA 4EEKA 4BO2A 2VEDA 1TJYA 1FNBA 4HPWA 4UNSA 4A0GA 1YZVA 1JT9A 2D62A 2JD2A 4Z7NB 4Q9JA 1JIJA 3O8LA 4UOQA 1XA7A 4GS9B 3FYDA 4XQ0A 3C8ZA 5FNVF 1X77A 2GBIA 2Q9UA 3EGCA 1DLIA 1TRHA 3EZ2A 3NLLA 3KQMA 4K7JA 2QPOA<