3RXWA

Kpc-2 carbapenemase in complex with psr3-226
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
TNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Carbepenem-hydrolyzing beta-lactamase KPC
publication title Crystal structures of KPC-2 {beta}-lactamase in complex with 3-nitrophenyl boronic acid and the penam sulfone PSR-3-226.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 97
structure length 264
sequence length 264
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3rxwA00
4M3KA 3HVFA 4MBFA 2H5SA 3OC2A 5IHVA 1K38A 1BSGA 1L0EA 4WZ5C 1SHVA 4E6WA 1GHPA 5CGWA 4A5RA 2HP9A 2XD1A 4Y0UA 4QU3A 2EFUA 4RA7A 5F1GA 5GLDA 4ZBEA 1KDWA 2V2FF 3G34A 1FR1A 1HVBA 2ZQDA 1PI5A 3IXBA 3A3JA 5M19A 4LV0A 4R3BA 3SH8A 1L0DA 1K57A 3BM6A 3MBZA 4IBXA 4ID4A 4IVIA 4MLLA 5E2EA 4CPKA 4WZ4A 5F83A 2ZC4B 3N8LA 1NXYA 1NJ4A 3FKVA 1K57C 5EVIB 2Y2IA 3M6BA 5F1FA 4C6YA 4OQHA 5DF9A 2B5RA 4R0QA 2ZJ9A 4OPZA 1M6KA 3UDXA 1WYBA 4DDSA 3E2LA 1YQSA 4L0LA 3NC8A 3UNWA 1ONHA 4RX2A 3UE1A 1MWUA 5EVIA 2A49A 1XXMA 3VMAA 4DXBA 4N9LA 1NY0A 1PIOA 5U47A 4GDBA 1Q2PA 1KE0A 2Q9MA 4JXVA 3O86A 1IYPA 1Q2QA 3WS5A 5EVIC 2J7VA 3PBNA 3ZDJA 1W8QA 4GDNA 1PZOA 1L2SA 1C3BA 2V1ZA 4EBLA 3BFEA 4FCFA 1FSYA 2WUQA 1PI4A 2RL3A 3N4IA 1VM1A 3FYZA 3LEZA 1PWGA 1YLTA 4S2JA 5TR7A 1S6RA 2OLUA 3TSGA 3IH8A 1ESUA 1DJAA 3BYDA 5CTNA 4EUZA 3MKEA 4WEKA 3UPPA 4WM9A 5EECA 1ALQA 2DRWA 4DE3A 5FQMA 4BL2A 3HLGA 3N7WA 5EVLA 5EOOA 4JF4A 5CHMA 2Y2MA 4S2PA 4B88A 1E4DA 1I2SA 4WELA 5EUAA 4BD1A 3E2KA 3IWIA 3NIAA 1LHYA 1LL5A 3W4PA 1E3UD 1QMFA 5E2FA 1HTZA 3MFDA 4MNRA 2QPNA 3G4PA 2X71A 4DXCA 1J9MA 3SH9A 1RGZA 1IYOA 2J8YA 3UDIA 3IT9A 4E3KA 4K91A 1MPLA 2OV5A 1KDSA 5TFQA 1KVLA 1ERMA 1O07A 1PW1A 3HUOA 1ES3A 3O88A 4R3JA 3ITBA 3V3RA 3CJMA 3O3VA 2WGWA 4WBGA 2WADA 1CK3A 4P0MA 4F94A 4B4ZA 2WAEA 3V3SA 3ZGAB 5EVID 3S1YA 5CGSA 1RCJA 5EE8A 3S22A 1MWRA 5GLBA 1ZC2A 1SKFA 4HEFA 1K56A 1RGYA 4PPRA 2ZM2A 1JWPA 1H5XA 3Q1FA 4OQIA 2V20A 2EXAA 2ZMAA 3MKFA 4FH2A 5GLCA 4QY5A 1DJBA 3PBRA 2VGJA 2P9VA 2WZXA 1ZG4A 4PM7A 4BD0A 5A92A 5A93A 3OPHA 4QJGA 4KZ4A 2ZD8A 4DKIA 1KVMA 3PTEA 3OPRA 4OPRA 3RJUA 2XQZA 3DWZA 4RYEA 4YFMA 3UE3A 2C6WB 3VP2A 3WWXA 4RVAA 3OCLA 3WS4A 3C5AA 5FI2A 5FATA 1MY8A 1WE4A 2UWXA 3QHYA 1YMSA 3HLFA 4FH4A 3D4FA 4KQQA 4X69A 1GHIA 5M18A 3A3IA 4KQRA 1BTLA 5DF8A 4GOGA 4JKTA 4OH0A 2IWDA 4N9KA 1W5DA 2GDNA 3NY4A 4JLFA 4K0XA 2EXBA 2ZQ8A 4LCLA 3RXXA 1YT4A 2C5WB 2ZC5B 4DDYA 4GD8A 3M2KA 3I7JA 3LCEA 1XA1A 1NYYA 5FAPA 4WYYA 1SDNA 1SCWA 1JWZA 5CERA 4Y7PA 3G31A 4FSFA 1GA0A 1S0WA 2HPBA 2WKHA 3NCKA 2VGKA 5FI7A 5KMWA 1TEMA 4S2IA 3UN7A 4S2OA 3W4QA 1SDEA 2IWBA 4E3NA 3WS1A 1K4FA 1HZOA 1YLWA 4JXWA 2XF3A 2HDRA 3PBTA 4D2OA 2XK1A 2DCFA 4DE2A 3AGEA 4OOYA 3IXGA 4DRTA 1ZG6A 2WAFA 3SH7A 3UPOA 1DY6A 3C7VA 5HL1A 3PBQA 5E2HA 2X02A 4ZJ3A 1KE4A 3FKWA 5FSRA 1N4OA 3WRTA 2ZM8A 2PU2A 3M2JA 3ZVWA 5FQIA 1XA7A 4E3MA 1Z6FA 1H8ZA 2ZC3B 2WGIA 4E3OA 4BLMA 4GB7A 3HL9A 3EQVA 2IWCA 1EWZA 5EOEA 4OLGA 2G2WA 3LY3A 4JPMA 1YMXA 3ZCZA 4JBFA 4KZ8A 5GHZA 5GL9A 5CHUA 4U0TA 5JYPA 5BOHA 3A3FA 4QHCA 1BT5A 1ERQA 3AGFA 1IYSA 2Y2OA 5FQJA 4R4SA 3ZFZA 2WKIA 4UA9A 3FZCA 3PBSA 3UY6A 3N6IA 3VOZA 4B4XA 4OPYA 3MXRA 3OPPA 1IKIA 5CXWA 1G68A 3O87A 3TOIA 3N8SA 3IF6A 2JC7A 4PM6A 5KSHA 2Y55A 4KG5A 1NZUA 3SS4A 3FWLA 5CEBA 2HDQA 4KG6A 3IF6C 4OP8A 4OQGA 2WGWB 4X6TA 2I72A 3GMWA 5FDHA 4Y0OA 1DJCA 4EV4A 1CEGA 4U0XA 5M1AA 1BUEA 4YINA 4OLDA 4Q8IA 1ZKJA 1FR6A 1XP4A 1U60A 1TVFA 4EWFA 2PU4A 5DF7A 2P74A 4LCMA 3IWOA 3PBOA 4EQIA 3Q82A 5GHXA 4OOMA 1WYCA 4N1HA 4HBUA 3BFDA 2P9VB 1MKIA 3QNBA 2EX2A 4BL3A 4WMCA 3Q7ZA 5A90A 1FCOA 3ZG5A 4S2LA 4KZ5A 2XLNA 4KG2A 1PZPA 4E6XA 4XUZA 2WYXA 2A3UA 3JYIA 2Y59A 5HFOA 2E8IA 4DE0A 1CEFA 3G35A 2Y2QA 3FV7A 1IEMA 3GRJA 3BEBA 5EPHA 1LI9A 5F82A 4JXGA 4P87A 3S4XA 2WZZA 5G18A 2XD5A 3SS3A 5FASA 4NETA 1FCNA 1FSWA 2HP5A 1L0FA 3VSLA 3ITAA 1ESIA 2J9PA 5AQAA 1XGJA 3HUNA 4QY6A 4OKPA 5KZHA 2EFXA 1XGIA 3IH9A 2Z2MB 2BLSA 3V5MA 4KZ9A 3VP4A 4C75A 1YLPA 2ZC6B 3CZDA 4RX3A 3GSGA 2X01A 1K6SA 1CI8A 1GHMA 1TDLA 2OSUA 3G32A 2EX8A 3HUMA 4S2NA 3W4OA 4EBNA 5DTKA 5CRFA 4OOLA 4R23A 3BRMA 3VP1A 4PMAA 1IYQA 3SS5A 3PAGA 1L0GA 4P85A 3G30A 4S2NC 2H10A 4PM5A 1FCMA 1BLHA 2Z2LB 2QZ6A 1QMEA 2XFTA 3IQAA 3Q7VB 1ES5A 3G2ZA 4HBTA 4ZTKA 5FI6A 5HX9A 4XUXA 5HAIA 3HLBA 3W8KA 3ZG0A 4LV1A 3Q81A 4K0WA 3PAEA 4BQMA 1EI5A 4OP5A 4BJPA 4X53A 2R9XA 4N1XA 3HLEA 1VQQA 1NRFA 2ZLYA 4JXSA 3LO7A 3CMZA 4UA6A 3Q7VA 3ZG9B 1JVJA 4Y0TA 3VP3A 4UAAA 2Y2KA 1K56D 1YLJA 5E43A 2R9WA 1KE3A 3HLWA 2WKEA 5HAQA 1NYMA 5FQQA 4KZ3A 4X56A 3VFHA 3GV9A 3A3DA 4XXRA 1CI9A 3DTMA 3BFCA 4GKUA 4OPQA 1YLZA 1JTGA 5CTMA 1H8YA 2HDSA 3BFFA 4GZBA 4KZ7A 4OONA 4DE1A 3UPNA 3G2YA 2WK0A 4IEDA 3OZHA 1E3UA 4ZDXA 5DTSA 3P09A 4NK3A 1KGGA 3EQUA 3MZDA 3DW0A 4LENA 3HLCA 1BLPA 3ZVTA 4GNUA 1I2WA 4OQ0A 3CG5A 3RXWA 4X68A 2QMIA 3V50A 5HW3A 5A91A 3GR2A 5TGFA 1E25A 1LI0A 1TDGA 2Y2GA 2XEPA 2Y91A 1GCEA 3GTCA 1FOFA 3TG9A 4X55A 1KGFA 3IF6B 1PWDA 2XDMA 4ZAMA 5L2FA 2Y2JA 4S2MA 1ONGA 1Y54A 2XH9A 2JCHA 1K25A 2JBFA 3BLSA 3IWQA 3LY4A 5HARA 3WS2A 5CEDA 4BENA 3QNCA 2FFYA 5FAOA 3C4PA 2CC1A 2H0TA 5AQ7A 1JTDA 3GQZA 4ZJ1A 4CJNA 1I5QA 5FQ9A 1XX2A 3IF5A 3WRZA 3WS0A 2J9OA 1K4EA 2HP6A 5D3OA 2RCXA 1O7EA 4ZJ2A 3OPLA 2G2UA 3HLDA 4LV2A 4QB8A 5AQBA 1BLSA 1W79A 4E3IA 5GHYA 1ES4A 1W7FA 4KENB 4MBKA 1K6RA 3UDFA 3NDEA 3MXSA 2EX9A 3P98A 1MBLA 4Z9QA 1NZOA 2ZQ9A 3ZNYA 5GLAA 4HESA 5CGXA 3HREA 4E3JA 2ZQAA 4O7DA 3MZEA 1BLCA 3C7UA 2HDUA 1K54A 4JF5A 1W8YA 3B3XA 4KZ6A 3VFFA 1XKZA 1FQGA 5FQKA 1K54C 4QD4A 3ZHHA 5HAPA 4GN2A 1AXBA 1HD8A 4N92A 2WGVA 1YM1A 2ZM0A 2XFSA 3VSKA 4H8RA 2JE5A 1YLYA 5DVAA 3UO9A 4KQOA 1OMEA 3ZG8B 3GVBA 1G6AA 2PBYA 3VP0A 3N8RA 3IXHA 3ISGA 1GA9A 2H0YA 3OCNA 4R4RA 3V39A 2OLVA 3ZG7B 4U3TA 3BLMA 4PM8A 3BFGA 3ZNTA 1M40A 4UHUA 1EROA 2ZC7A 2Y2LA 1IELA 1N9BA 3NI9A 2DNSA 4EBPA 4DF6A 1PW8A 4UA7A 3BECA 4IBRA 5CHJA 5FAQA 1BZAA 3Q07A 1PWCA 1ES2A 4LV3A 5J8XA 1LLBA 5JYOA 4OVDA 3VOYA 2Q9NA 3M6HA 4IVKA 1MWTA 4JF6A 4PM9A 2EX6A 1IKGA 1LL9A 2Y2NA 2Y2HA 1MXOA 4FD8A 3NDGA 1XPBA 2FFFB 1BULA 2BG1A 3SOIA 4E3LA 5KSCA 1K55A 3UE0A 2Y4AA 3IXDA 3NBLA 3HBRA 4MEZA 3IHBA 5AQ9A 1MWSA 4R1GA 4C3QA 1JWVA 3MZFA 5I94A 1K55C 2Y2PA 4KZBA 2XGNA 2ZQCA 3C4OA 4S2KA 4GD6A 5DTTA 4WEJA 5CECA 1PYYA 3A3EA 2ZQ7A 3IHAA 4MBHA 4WMCD 3AGDA 4WZ5A 4KZAA 4P6BA 2XR0A 1RP5A 5E2GA 1KGEA 5FA7A 3DWKA
chains in the Genus database with same CATH superfamily
2H5SA 3OC2A 1K38A 1L0EA 4WZ5C 1SHVA 4E6WA 1GHPA 5CGWA 4YOFA 5F1GA 4QU3A 2EFUA 1NWZA 3KSGA 4HP4A 1FR1A 3DTEA 2ZQDA 4R3BA 3SH8A 4WZ4A 5F83A 3N8LA 1NXYA 2Y2IA 2W1RA 4X25A 1LL8A 5F1FA 4EU0A 1WYBA 5MC7A 2A24A 1YQSA 4L0LA 1ONHA 3LR3A 2BTFP 4RX2A 4UQIM 2W1TB 1MWUA 5EVIA 3VMAA 4DXBA 3T50A 3T4JA 1NY0A 5U47A 2Q9MA 4I3JA 4GDNA 4HH3A 3SZTA 4EBLA 1FSYA 5J4EA 1PI4A 3N4IA 4JGOA 1ESUA 3BYDA 5CTNA 4GS9A 4EUZA 3MKEA 1S1ZA 3HLGA 5EVLA 4JF4A 1S67L 2Y2MA 3H9WA 3NIAA 5FL3A 1LL5A 1E3UD 1QMFA 1HTZA 3MFDA 3G4PA 1J9MA 2J8YA 3MQ0A 1MPLA 1KDSA 1XJ4A 1KVLA 3O88A 3S7PA 1ES3A 1XFQA 1S4SA 2WADA 2V0WA 1OTEA 2WAEA 3V3SA 1H3QA 5CGSA 5TBMB 5C5KA 4HEFA 1RGYA 2IA2A 1H8MA 2V20A 4ME4A 2LB9A 5GLCA 2QYBA 4BD0A 2P7JA 4RYEA 3VP2A 5L09A 5EFWA 5FI2A 1BYWA 2UWXA 3QHYA 3NJAA 1YMSA 4GW9A 4FH4A 3D4FA 1PRQA 1GHIA 2K2NA 2W3DA 3A3IA 2WKRA 5DF8A 2HV1A 2W0NA 4YWZA 2ZQ8A 3RXXA 1YT4A 3M2KA 1XA1A 1VEUA 1JWZA 4Y7PA 4FSFA 2VGKA 4S2IA 2A2LA 4S2OA 4EETB 4BWIA 2PD7A 5IT5A 1SDEA 1N9NA 1OTDA 3D72A 2V9AA 3T4OA 4ETZA 1K4FA 3SW1A 4JXWA 2XF3A 1H0MA 2JKTI 3AGEA 1ZG6A 2WAFA 3UPOA 1DY6A 3PBQA 5E2HA 3PR6A 4DMZA 3WRTA 3JVVA 3E4OA 3M2JA 4WL9A 3ZVWA 1XA7A 4E3MA 2ZC3B 1H8ZA 3UMDA 1TD5A 2IWCA 3ZCZA 5JYPA 5FEGA 1BT5A 3ZFZA 1IYSA 3L9KA 4UA9A 3FZCA 3N6IA 3VOZA 3OPPA 1G68A 3O87A 2OAP1 2QHKA 1OT6A 1Y4OA 4MN5A 2I72A 2W3HA 3GMWA 4Y0OA 4EV4A 4OLDA 1ZKJA 3VE3A 1DP8A 1OTIA 1U60A 2JKRI 3NHQA 4LCMA 4OOMA 3EEHA 4N1HA 5L10A 5DKKA 3QNBA 1OTBA 3Q7ZA 5A90A 4H6JA 4S2LA 4KZ5A 2Y59A 1Y28A 3EGXC 5EPHA 5F82A 3QP4A 4P87A 3SS3A 5FASA 4WLAA 1VHMA 2HP5A 5AQAA 4IUHA 4OKPA 3H82A 2BLSA 3HCYA 4RX3A 3VOLA 3HUMA 4FOFA 3CUEC 5CRFA 3BRMA 4PMAA 2KOIA 4S2NC 1F98A 2XFTA 3FPWA 3Q7VB 3K2NA 4XUXA 3W8KA 3PAEA 4BQMA 4N1XA 3HLEA 2ZLYA 2O9CA 3K3CA 3UB8A 5E43A 1KE3A 3E98A 2WKEA 5FQQA 4X56A 2OOLA 3A3DA 3F1PB 1CI9A 3FPVA 4OONA 4DE1A 2XROA 4FUWA 2HZ5A 4HOIA 3MS6A 5DTSA 4NK3A 3EQUA 1P97A 1BLPA 5EVEA 3RXWA 3CG5A 5TGFA 3GTCA 1FOFA 3MJQA 4S2MA 2DMWA 3IBRA 5A8BA 4BENA 2G7UA 5AVFA 4ZJ1A 5FQ9A 3WRZA 3TW8A 2J9OA 3B42A 3UE6A 1IOUA 1YKDA 1BLSA 1W79A 3NOUC 1J3WA 1ES4A 3KSIA 3LFVA 3RH8B 2Q0OA 3UDFA 3NDEA 3MXSA 4ETXA 4Z9QA 4HHDA 4FTXA 3LUQA 3ULFA 3MZEA 4JF5A 2B02A 2M7UA 1K54C 4QD4A 2M7VA 4NXGA 5HAPA 3BY9A 5CX7A 2JKTM 3UB9A 1YLYA 3F1OA 3UO9A 4KQOA 2B95A 3DTIA 3V39A 1GA9A 2H0YA 3ZG7B 2OLVA 4U3TA 3BLMA 4PM8A 3T12B 4HNBA 4UHUA 1EROA 1TS0A 2DNSA 5AVEA 3LYXA 5CHJA 3BECA 4DF6A 1BZAA 4LRYC 1VETA 4DN0A 3QP6A 1MWTA 4JF6A 4PM9A 1BULA 4E3LA 5KSCA 3UMEA 3UE0A 3IXDA 1X0OA 4LFUA 4C3QA 1JWVA 3MZFA 1K55C 2ZL1A 4S2KA 2XGNA 4WEJA 4I3AA 4MBHA 4KZAA 4P6BA 3T4SA 1RP5A 5E2GA 2VV8A 5FA7A 4MBFA 5IHVA 1BSGA 2JKRM 2J3WA 3OOVA 2HP9A 4RA7A 1KDWA 2V2FF 3G34A 3LEQA 3A3JA 2PRFA 3BM6A 4IBXA 4ID4A 4CPKA 4ARZA 1NJ4A 3FKVA 1K57C 5EVIB 3CLOA 4HJ4A 1M6KA 4DDSA 3NC8A 4MN6A 3UE1A 1PIOA 2YKHA 1KE0A 1IYPA 4GS9B 3WS5A 3PBNA 2QJ7A 1W8QA 4WN5A 1PZOA 1L2SA 1C3BA 2V1ZA 1D7EA 4FCFA 4HJ6A 1VM1A 1PWGA 4G3VA 1YSPA 1ALQA 5EOOA 3TJZC 5CHMA 4S2PA 1I2SA 4WELA 5F6AA 4BD1A 3A0RA 3E2KA 1LHYA 1VB6A 3LICA 4DXCA 2V1BA 3SH9A 1RGZA 4X1MA 1MZUA 3H7WB 3IT9A 4E3KA 3BJNA 2V1AA 1XJ3A 5TFQA 3U4LP 4NEED 1ERMA 4R3JA 3V3RA 3V67A 4WBGA 4R70A 4F94A 5G4YA 1CJFA 4F3LB 3C2WA 5HSQA 3S22A 1SKFA 1F5MA 1K56A 2ZM2A 3W2ZA 3D9YA 4OQIA 4II7A 4NG2A 3G6OA 1T1CA 5DFXA 3LIBA 3MKFA 2W3FA 3PBRA 2P9VA 3CITA 1ZG4A 4MDZA 4PM7A 4QJGA 1N9OA 4KZ4A 4EQ1A 2ZD8A 3GDIA 4DKIA 1KVMA 2XQZA 4YFMA 3UE3A 3WWXA 4RVAA 3OCLA 2E8JA 4CLCA 5FATA 3T1SA 3C8CA 3HLFA 5M18A 4Q0IA 2KDKA 2PHYA 4JKTA 4GCZA 2GDNA 2ZC5B 1V9ZA 5TJJA 1NYYA 2XA7M 2KX6A 4Y2FA 3HJKA 1S0WA 2VA0A 5KMWA 3UN7A 3IS2A 4WF0A 3O5YA 3W4QA 5AJGA 2EA9A 4R3AA 4E3NA 2JKGA 1YLWA 3PBTA 3MMHA 4I39A 4P6ZM 4DRTA 4CLCE 1MC0A 3ZQ5A 1GSVA 1W63M 3LI8A 2VJWA 2XSSA 1Z6FA 2WGIA 1XFNA 4GB7A 3HL9A 5EOEA 1D06A 4OLGA 2G2WA 2VK3A 4JBFA 2L0WA 5GL9A 5CHUA 2NUPC 5DKLA 4QHCA 2WKIA 3UY6A 3LIAA 4B4XA 3KYZA 2JC7A 2Y55A 5KIZA 1N9LA 2HDQA 3IF6C 2WGWB 4DJ3A 1DJCA 1D1JA 5M1AA 1XP4A 1TVFA 4R38A 2FZ0A 2P74A 3IWOA 3PBOA 5GHXA 2PBDP 1S66L 1L3LA 4HBUA 3BFDA 1LSXA 2EX2A 4WMCA 3KSHA 2ZOHA 2XLNA 2WYXA 2A3UA 3H82B 2Y2QA 3FV7A 3T4KA 1SKOB 2ZMVA 3CPTA 1FSWA 1ESIA 1XGJA 3HUNA 4L9EA 5KZHA 1OJGA 3T1QB 3VP4A 3LR4A 4C75A 3GSGA 2OSUA 2EX8A 4EBNA 5DTKA 4R23A 3VP1A 1IYQA 3SS5A 3PAGA 2YKFA 3T4LA 2H10A 2PD8A 2QZ6A 1ES5A 3G2ZA 5HX9A 5HAIA 3Q81A 2INWA 1EI5A 4OP5A 4X53A 1P0ZA 2R9XA 1WA9A 4JXSA 4UA6A 1JVJA 3VP3A 1TF1A 1K56D 1YLJA 3P7NA 4B93A 3HLWA 1NYMA 4LGWA 3DTMA 2K31A 3BFCA 4OPQA 5F5YA 1JTGA 3JPUA 1H8YA 2HDSA 2Y8HA 3BFFA 4GZBA 2QKPA 3UPNA 4ZDXA 3P09A 1KGGA 3MZDA 3C38A 3ZVTA 4GNUA 4OQ0A 4BMWA 2QMIA 4EEUA 3ICYA 4CLCD 1E25A 1TDGA 2Y2GA 3IF6B 2XDMA 2VV7A 4HIAA 1ONGA 2XH9A 3BLSA 3IWQA 3TE8A 2GJ3A 1XJ2A 5AQ7A 1JTDA 1K4EA 2HP6A 5D3OA 2RCXA 1O7EA 4WUJA 4E3IA 1W7FA 2W1TA 4KENB 1T19A 1MBLA 3T1XA 4Y17A 2J80A 3T1RA 2O9AA 4O7DA 2HJ9C 4CQHA 4ZRRA 4KZ6A 3F1OB 4HQAA 3VFFA 3KYEA 4HJ3A 3K3DA 4Y3IA 2UV0E 3E4PA 4L9FA 1AXBA 2HF6A 4JGPA 3ZG8B 2PBYA 3ISGA 4R4RA 5HWVA 2JN7A 4L9GA 3BFGA 1M40A 3NOPC 2ZC7A 1IELA 3NI9A 2VV6A 4NXEA 4LV3A 5J8XA 4OVDA 1G28A 3L7HA 4D60A 1IKGA 1AWIA 1LSVA 5F68A 2ZL1B 2Y2HA 1MXOA 3NDGA 1XPBA 3KYQA 2J3TD 3SOIA 3NBLA 5K5BA 5AQ9A 1MWSA 4LRXC 5DFYA 5I94A 2ZQCA 1HLUP 2ZQ7A 4WMCD 1W63Q 4WZ5A 5LBRA 3DBAA 1KGEA 4M3KA 2XD1A 4Y0UA 3IXBA 5M19A 4LV0A 5IS1A 1L0DA 3MBZA 4IVIA 4MLLA 1CQAA 3M6BA 4MMNA 4C6YA 4RQ9A 4OQHA 4R0QA 3E2LA 3UNWA 4I38A 4Y13A 2XA7S 2A49A 1XXMA 1Q2PA 1TS8A 4JXVA 3O86A 1Q2QA 3LIDA 5EVIC 2J7VA 2WUQA 2RL3A 3FYZA 1YLTA 5TR7A 3NECA 1OPXA 3TSGA 5DJUA 4P6ZS 1DJAA 3S7OA 3UPPA 5EECA 4DE3A 2DRWA 5FQMA 3LR0A 4UQIS 3R7WA 4B88A 1E4DA 5EUAA 3IWIA 3W4PA 5E2FA 4MNRA 4E04A 5J3WA 4K91A 2OV5A 2Y79A 1PW1A 3BQAA 3MFXA 3ITBA 2NUTC 3CJMA 3O3VA 2EWVA 1CK3A 4P0MA 2EWWA 3EOIA 3ZGAB 4XT2B 1RCJA 5EE8A 5GLBA 4PPRA 4Y15A 1H5XA 3Q1FA 4Q0HA 2EXAA 1YAXA 2VKSA 4EEPA 4NXBA 5A93A 3OPHA 3BQ8A 1DP9A 1NLZA 3PTEA 3OPRA 3RJUA 4UEYA 2PYRA 5FEFA 5IU1A 2HJEA 3PXPA 1OTAA 4I5SA 4KQQA 1PFLA 2ZMFA 2IWDA 1W5DA 4K0XA 2EXBA 2C5WB 4DDYA 2VGLM 3EWKA 3I7JA 3LCEA 3IBJA 4DJ2A 1UWPX 1GA0A 2HPBA 2JKFA 2WKHA 3E0YA 3NCKA 1ZTUA 4PHTA 2A24B 4BBUA 5L8MA 2IWBA 3WS1A 1T18A 1V9YA 4D2OA 2PR6A 4OOYA 3IXGA 3KO6A 4NKPA 3LI9A 1KE4A 3FKWA 5L07A 4KUKA 4E3OA 4BLMA 1EWZA 3PYPA 3LY3A 4JPMA 2PYPA 5GHZA 3AGFA 4R4SA 3MXRA 3N8SA 5KSHA 4KG5A 1NZUA 3GECA 1F2KA 3SS4A 3FWLA 2GX5A 4KG6A 3MXQA 2AVXA 1MKMA 5FDHA 2O99A 1BUEA 4YINA 3PHYA 4Q8IA 5FDSA 1FR6A 1UGUA 1NLYA 3F1NA 2PU4A 5DF7A 4EQIA 1GSWA 1WYCA 1MKIA 4BL3A 4G3WA 4E6XA 4XUZA 2BASA 3P01A 5HFOA 2E8IA 4DE0A 1IEMA 3BEBA 2PR5A 5EM0A 1LI9A 2P08A 4JXGA 2WZZA 5G18A 3CI6A 1FCNA 1L0FA 3ITAA 2J9PA 2EFXA 1XGIA 3CUEA 3V5MA 1YLPA 4HY8A 2ZC6B 3CZDA 2PT7A 1K6SA 1CI8A 1TDLA 4S2NA 4OOLA 3ZYTA 1L0GA 4P85A 3LGOA 2LB5A 3KX0X 4PM5A 1FCMA 1VEUB 1BLHA 2GNXA 2Z2LB 1S4RA 1KOUA 1FIKA 3ZG0A 3HLBA 1PNEA 2ACGA 4EW7A 5EM1A 1NRFA 3LO7A 4R6LA 4UAAA 4PKYG 2R9WA 5HAQA 4QWOA 4JGRA 4XXRA 4GKUA 1G6OA 1YLZA 4KZ7A 2WK0A 1EW0A 3OZHA 4ESPA 3HLCA 5HW3A 1YPRA 1I2WA 1IFQA 2MJ6A 3V50A 4X68A 2Y91A 3QP2A 1P9WA 4X55A 3TG9A 5L2FA 1Y54A 2JCHA 4Z1WA 3HJIA 1ACFA 3LY4A 3C30A 2FFYA 5FAOA 4CJNA 1XX2A 3WS0A 2O9BA 2WKPA 4ZJ2A 4GHIA 3OPLA 2G2UA 5AQBA 1K6RA 4LLOB 2EX9A 2V0UA 5F69A 2ZQ9A 3ZNYA 2Z6CA 4H6JB 5CGXA 3C7UA 1ZHHB 2HDUA 1K54A 1W8YA 3B3XA 5FQKA 4O01A 3ZHHA 5HZHA 4N92A 2WGVA 5HWTA 1YM1A 2ZM0A 2JE5A 4Y5FA 1TS7A 1OMEA 1G6AA 4B9OA 3VP0A 3N8RA 3IXHA 4PAUA 3H7WA 3R4KA 2PDRA 2Y2LA 1N9BA 2FH5A 2K7SA 4EBPA 4UA7A 4IBRA 3Q07A 1ES2A 3VOYA 4F3LA 4G3KA 2Q9NA 3IX8A 1ODVA 2EX6A 1LL9A 4Q0JA 4QPRA 2QWSA 2BG1A 5HD5A 1K55A 1UWNX 2Y4AA 3QP8A 1T1AA 3IHBA 4R1GA 2Y2PA 5CECA 4GD6A 3A3EA 3AGDA 2XR0A 3HVFA 3QP1A 2ZBBA 4A5RA 1TS6A 3MR0A 4JGQA 5GLDA 4ZBEA 2PAVP 1HVBA 1PI5A 2I9VA 5HDSA 3OLOA 1K57A 3D3OA 5E2EA 2JHEA 2ZC4B 5DF9A 2B5RA 2ZJ9A 4OPZA 3UDXA 3LIFA 2D01A 2VGLS 3NULA 2W27A 2M1CA 2R78A 2L1MA 4N9LA 4GDBA 3VE4A 3ZDJA 3DAVA 2VLGA 2L4RA 3BFEA 3R7WB 3MQQA 3MSHA 3LEZA 4S2JA 4LRZE 1S6RA 2OLUA 3IH8A 4M4XA 4WEKA 4WM9A 3UB5P 1P9RA 4BL2A 1Z09A 3N7WA 4GLQA 3LR5A 2QPNA 2X71A 2Z6DA 1IYOA 3UDIA 1YSQA 4IHQA 5HDDA 5J7EA 1LSWA 1O07A 3HUOA 3DTKA 2WGWA 4B4ZA 1VETB 1T1BA 2HGVA 5EVID 3S1YA 1MWRA 3B47A 1ZC2A 1JWPA 1FILA 2ZMAA 4BBVA 3T4QA 5HDCA 4FH2A 4K08A 1DJBA 4QY5A 2VGJA 2WZXA 5TBMA 5A92A 2H28A 3S7QA 4HH2A 4OPRA 3DWZA 1SKOA 2C6WB 3VV4A 3WS4A 3C5AA 1MY8A 1WE4A 5HPIA 4CLCC 4X69A 4KQRA 3TRCA 1BTLA 4GOGA 4NXFA 3FC7A 4OH0A 3OBFA 4N9KA 4JLFA 3NY4A 4LCLA 2QJ5A 4GJ4A 4GD8A 4ARZB 3EGDC 5FAPA 4WYYA 1SDNA 1SCWA 5CERA 3G31A 5FI7A 4MCWA 2W3EA 1TEMA 3RTYA 3B33A 4EUVA 4EESA 1HZOA 2HDRA 2XK1A 2DCFA 4DE2A 1SZVA 1K0KA 3SH7A 2VZWA 2WKQA 3C7VA 4IJGA 5HL1A 2OWJA 2X02A 4ZJ3A 5FSRA 4YNRA 1N4OA 2ZM8A 2PU2A 5FQIA 3LIEA 3EQVA 2VX8A 1YMXA 4KZ8A 4U0TA 5BOHA 3IX3A 3A3FA 1ERQA 2Y2OA 5FQJA 2GZAA 5HL6A 3PBSA 4OPYA 5CXWA 1IKIA 4HI4A 3TOIA 3IF6A 4PM6A 3UB7A 3RFBA 3BWLA 5CEBA 4OP8A 2VEAA 3F1NB 4OQGA 4X6TA 3MF0A 4EXOA 3BY8A 1CEGA 4U0XA 1XJ6A 2KLIA 4EERA 4EWFA 2J3TC 3Q82A 3E4QA 3CAXA 2P9VB 1CF0A 3KSFA 1FCOA 3ZG5A 4KG2A 1PZPA 1S1YA 3CHWP 3JYIA 5HD3A 3T4TA 1CEFA 3G35A 3GRJA 3S4XA 4CLCB 1JNUA 2XD5A 4NETA 3VSLA 4QY6A 3IH9A 2Z2MB 4KZ9A 2X01A 1GHMA 3G32A 3W4OA 1DP6A 3G30A 4X1LA 1QMEA 3IQAA 4HBTA 4ZTKA 5FI6A 3IS2B 4O0PA 4LV1A 4K0WA 4BJPA 3BW6A 1VQQA 2B18A 1DRMA 5DJTA 3CMZA 3Q7VA 3ZG9B 4Y0TA 2Y2KA 1F9IA 1NRJA 4KZ3A 3VFHA 3GV9A 3NOTC 3CWFA 5CTMA 2OAQ1 3G2YA 4IEDA 1LT0A 2O0YA 2ZOIA 1E3UA 3DW0A 3F1PA 2XRNA 4LENA 2P04A 5A91A 3GR2A 1LI0A 3IX4A 2XEPA 1GCEA 4ZAMA 1KGFA 1PWDA 2Y2JA 2V8FA 1K25A 5HWWA 4GHIB 4HP9A 2JBFA 5HARA 3WS2A 2V8CA 5CEDA 3QNCA 3UB6A 3C4PA 2CC1A 2H0TA 3FG8A 3JVUA 3GQZA 1I5QA 3IF5A 3HLDA 3EEAA 4LV2A 4QB8A 3QP5A 5GHYA 1OT9A 2W3GA 4MBKA 3A0VA 4PKYA 3P98A 2D02A 1NZOA 1A0KA 5GLAA 4HESA 4O8GA 3HREA 4E3JA 2ZQAA 1BLCA 3MQOA 5EV0A 1XKZA 1FQGA 2OWHA 4GN2A 3S7NA 1HD8A 1GSXA 3CPTB 4BBTA 2XFSA 3VSKA 4IUKA 4H8RA 5DVAA 3U2AA 3GVBA 5HPFA 3A0SA 3OCNA 4AFIA 1OJ5A 1G5UA 3ZNTA 1PW8A 1STZA 5FAQA 1PWCA 4KUOA 1LLBA 4MN7A 5JYOA 3M6HA 4IVKA 4XT2A 5I5LA 2Y2NA 4FD8A 2FFFB 4KQDA 5G4ZA 3HBRA 4MEZA 4LPZA 4I3IA 4KZBA 3C4OA 5DTTA 1PYYA 2CMNA 3IHAA 3DWKA
chains in the Genus database with same CATH topology
4M3KA 3HVFA 4MBFA 2H5SA 3OC2A 5IHVA 1K38A 1BSGA 1L0EA 4WZ5C 1SHVA 4E6WA 1GHPA 5CGWA 4A5RA 2HP9A 2XD1A 4Y0UA 4QU3A 2EFUA 4RA7A 5F1GA 5GLDA 4ZBEA 1KDWA 2V2FF 3G34A 1FR1A 1HVBA 2ZQDA 1PI5A 3IXBA 3A3JA 5M19A 4LV0A 4R3BA 3SH8A 1L0DA 1K57A 3BM6A 3MBZA 4IBXA 4ID4A 4IVIA 4MLLA 5E2EA 4CPKA 4WZ4A 5F83A 2ZC4B 3N8LA 1NXYA 1NJ4A 3FKVA 1K57C 5EVIB 2Y2IA 3M6BA 5F1FA 4C6YA 4OQHA 5DF9A 2B5RA 4R0QA 2ZJ9A 4OPZA 1M6KA 3UDXA 1WYBA 4DDSA 3E2LA 1YQSA 4L0LA 3NC8A 3UNWA 1ONHA 4RX2A 3UE1A 1MWUA 5EVIA 2A49A 1XXMA 3VMAA 4DXBA 4N9LA 1NY0A 1PIOA 5U47A 4GDBA 1Q2PA 1KE0A 2Q9MA 4JXVA 3O86A 1IYPA 1Q2QA 3WS5A 5EVIC 2J7VA 3PBNA 3ZDJA 1W8QA 4GDNA 1PZOA 1L2SA 1C3BA 2V1ZA 4EBLA 3BFEA 4FCFA 1FSYA 2WUQA 1PI4A 2RL3A 3N4IA 1VM1A 3FYZA 3LEZA 1PWGA 1YLTA 4S2JA 5TR7A 1S6RA 2OLUA 3TSGA 3IH8A 1ESUA 1DJAA 3BYDA 5CTNA 4EUZA 3MKEA 4WEKA 3UPPA 4WM9A 5EECA 1ALQA 2DRWA 4DE3A 5FQMA 4BL2A 3HLGA 3N7WA 5EVLA 5EOOA 4JF4A 5CHMA 2Y2MA 4S2PA 4B88A 1E4DA 1I2SA 4WELA 5EUAA 4BD1A 3E2KA 3IWIA 3NIAA 1LHYA 1LL5A 3W4PA 1E3UD 1QMFA 5E2FA 1HTZA 3MFDA 4MNRA 2QPNA 3G4PA 2X71A 4DXCA 1J9MA 3SH9A 1RGZA 1IYOA 2J8YA 3UDIA 3IT9A 4E3KA 4K91A 1MPLA 2OV5A 1KDSA 5TFQA 1KVLA 1ERMA 1O07A 1PW1A 3HUOA 1ES3A 3O88A 4R3JA 3ITBA 3V3RA 3CJMA 3O3VA 2WGWA 4WBGA 2WADA 1CK3A 4P0MA 4F94A 4B4ZA 2WAEA 3V3SA 3ZGAB 5EVID 3S1YA 5CGSA 1RCJA 5EE8A 3S22A 1MWRA 5GLBA 1ZC2A 1SKFA 4HEFA 1K56A 1RGYA 4PPRA 2ZM2A 1JWPA 1H5XA 3Q1FA 4OQIA 2V20A 2EXAA 2ZMAA 3MKFA 4FH2A 5GLCA 4QY5A 1DJBA 3PBRA 2VGJA 2P9VA 2WZXA 1ZG4A 4PM7A 4BD0A 5A92A 5A93A 3OPHA 4QJGA 4KZ4A 2ZD8A 4DKIA 1KVMA 3PTEA 3OPRA 4OPRA 3RJUA 2XQZA 3DWZA 4RYEA 4YFMA 3UE3A 2C6WB 3VP2A 3WWXA 4RVAA 3OCLA 3WS4A 3C5AA 5FI2A 5FATA 1MY8A 1WE4A 2UWXA 3QHYA 1YMSA 3HLFA 4FH4A 3D4FA 4KQQA 4X69A 1GHIA 5M18A 3A3IA 4KQRA 1BTLA 5DF8A 4GOGA 4JKTA 4OH0A 2IWDA 4N9KA 1W5DA 2GDNA 3NY4A 4JLFA 4K0XA 2EXBA 2ZQ8A 4LCLA 3RXXA 1YT4A 2C5WB 2ZC5B 4DDYA 4GD8A 3M2KA 3I7JA 3LCEA 1XA1A 1NYYA 5FAPA 4WYYA 1SDNA 1SCWA 1JWZA 5CERA 4Y7PA 3G31A 4FSFA 1GA0A 1S0WA 2HPBA 2WKHA 3NCKA 2VGKA 5FI7A 5KMWA 1TEMA 4S2IA 3UN7A 4S2OA 3W4QA 1SDEA 2IWBA 4E3NA 3WS1A 1K4FA 1HZOA 1YLWA 4JXWA 2XF3A 2HDRA 3PBTA 4D2OA 2XK1A 2DCFA 4DE2A 3AGEA 4OOYA 3IXGA 4DRTA 1ZG6A 2WAFA 3SH7A 3UPOA 1DY6A 3C7VA 5HL1A 3PBQA 5E2HA 2X02A 4ZJ3A 1KE4A 3FKWA 5FSRA 1N4OA 3WRTA 2ZM8A 2PU2A 3M2JA 3ZVWA 5FQIA 1XA7A 4E3MA 1Z6FA 1H8ZA 2ZC3B 2WGIA 4E3OA 4BLMA 4GB7A 3HL9A 3EQVA 2IWCA 1EWZA 5EOEA 4OLGA 2G2WA 3LY3A 4JPMA 1YMXA 3ZCZA 4JBFA 4KZ8A 5GHZA 5GL9A 5CHUA 4U0TA 5JYPA 5BOHA 3A3FA 4QHCA 1BT5A 1ERQA 3AGFA 1IYSA 2Y2OA 5FQJA 4R4SA 3ZFZA 2WKIA 4UA9A 3FZCA 3PBSA 3UY6A 3N6IA 3VOZA 4B4XA 4OPYA 3MXRA 3OPPA 1IKIA 5CXWA 1G68A 3O87A 3TOIA 3N8SA 3IF6A 2JC7A 4PM6A 5KSHA 2Y55A 4KG5A 1NZUA 3SS4A 3FWLA 5CEBA 2HDQA 4KG6A 3IF6C 4OP8A 4OQGA 2WGWB 4X6TA 2I72A 3GMWA 5FDHA 4Y0OA 1DJCA 4EV4A 1CEGA 4U0XA 5M1AA 1BUEA 4YINA 4OLDA 4Q8IA 1ZKJA 1FR6A 1XP4A 1U60A 1TVFA 4EWFA 2PU4A 5DF7A 2P74A 4LCMA 3IWOA 3PBOA 4EQIA 3Q82A 5GHXA 4OOMA 1WYCA 4N1HA 4HBUA 3BFDA 2P9VB 1MKIA 3QNBA 2EX2A 4BL3A 4WMCA 3Q7ZA 5A90A 1FCOA 3ZG5A 4S2LA 4KZ5A 2XLNA 4KG2A 1PZPA 4E6XA 4XUZA 2WYXA 2A3UA 3JYIA 2Y59A 5HFOA 2E8IA 4DE0A 1CEFA 3G35A 2Y2QA 3FV7A 1IEMA 3GRJA 3BEBA 5EPHA 1LI9A 5F82A 4JXGA 4P87A 3S4XA 2WZZA 5G18A 2XD5A 3SS3A 5FASA 4NETA 1FCNA 1FSWA 2HP5A 1L0FA 3VSLA 3ITAA 1ESIA 2J9PA 5AQAA 1XGJA 3HUNA 4QY6A 4OKPA 5KZHA 2EFXA 1XGIA 3IH9A 2Z2MB 2BLSA 3V5MA 4KZ9A 3VP4A 4C75A 1YLPA 2ZC6B 3CZDA 4RX3A 3GSGA 2X01A 1K6SA 1CI8A 1GHMA 1TDLA 2OSUA 3G32A 2EX8A 3HUMA 4S2NA 3W4OA 4EBNA 5DTKA 5CRFA 4OOLA 4R23A 3BRMA 3VP1A 4PMAA 1IYQA 3SS5A 3PAGA 1L0GA 4P85A 3G30A 4S2NC 2H10A 4PM5A 1FCMA 1BLHA 2Z2LB 2QZ6A 1QMEA 2XFTA 3IQAA 3Q7VB 1ES5A 3G2ZA 4HBTA 4ZTKA 5FI6A 5HX9A 4XUXA 5HAIA 3HLBA 3W8KA 3ZG0A 4LV1A 3Q81A 4K0WA 3PAEA 4BQMA 1EI5A 4OP5A 4BJPA 4X53A 2R9XA 4N1XA 3HLEA 1VQQA 1NRFA 2ZLYA 4JXSA 3LO7A 3CMZA 4UA6A 3Q7VA 3ZG9B 1JVJA 4Y0TA 3VP3A 4UAAA 2Y2KA 1K56D 1YLJA 5E43A 2R9WA 1KE3A 3HLWA 2WKEA 5HAQA 1NYMA 5FQQA 4KZ3A 4X56A 3VFHA 3GV9A 3A3DA 4XXRA 1CI9A 3DTMA 3BFCA 4GKUA 4OPQA 1YLZA 1JTGA 5CTMA 1H8YA 2HDSA 3BFFA 4GZBA 4KZ7A 4OONA 4DE1A 3UPNA 3G2YA 2WK0A 4IEDA 3OZHA 1E3UA 4ZDXA 5DTSA 3P09A 4NK3A 1KGGA 3EQUA 3MZDA 3DW0A 4LENA 3HLCA 1BLPA 3ZVTA 4GNUA 1I2WA 4OQ0A 3CG5A 3RXWA 4X68A 2QMIA 3V50A 5HW3A 5A91A 3GR2A 5TGFA 1E25A 1LI0A 1TDGA 2Y2GA 2XEPA 2Y91A 1GCEA 3GTCA 1FOFA 3TG9A 4X55A 1KGFA 3IF6B 1PWDA 2XDMA 4ZAMA 5L2FA 2Y2JA 4S2MA 1ONGA 1Y54A 2XH9A 2JCHA 1K25A 2JBFA 3BLSA 3IWQA 3LY4A 5HARA 3WS2A 5CEDA 4BENA 3QNCA 2FFYA 5FAOA 3C4PA 2CC1A 2H0TA 5AQ7A 1JTDA 3GQZA 4ZJ1A 4CJNA 1I5QA 5FQ9A 1XX2A 3IF5A 3WRZA 3WS0A 2J9OA 1K4EA 2HP6A 5D3OA 2RCXA 1O7EA 4ZJ2A 3OPLA 2G2UA 3HLDA 4LV2A 4QB8A 5AQBA 1BLSA 1W79A 4E3IA 5GHYA 1ES4A 1W7FA 4KENB 4MBKA 1K6RA 3UDFA 3NDEA 3MXSA 2EX9A 3P98A 1MBLA 4Z9QA 1NZOA 2ZQ9A 3ZNYA 5GLAA 4HESA 5CGXA 3HREA 4E3JA 2ZQAA 4O7DA 3MZEA 1BLCA 3C7UA 2HDUA 1K54A 4JF5A 1W8YA 3B3XA 4KZ6A 3VFFA 1XKZA 1FQGA 5FQKA 1K54C 4QD4A 3ZHHA 5HAPA 4GN2A 1AXBA 1HD8A 4N92A 2WGVA 1YM1A 2ZM0A 2XFSA 3VSKA 4H8RA 2JE5A 1YLYA 5DVAA 3UO9A 4KQOA 1OMEA 3ZG8B 3GVBA 1G6AA 2PBYA 3VP0A 3N8RA 3IXHA 3ISGA 1GA9A 2H0YA 3OCNA 4R4RA 3V39A 2OLVA 3ZG7B 4U3TA 3BLMA 4PM8A 3BFGA 3ZNTA 1M40A 4UHUA 1EROA 2ZC7A 2Y2LA 1IELA 1N9BA 3NI9A 2DNSA 4EBPA 4DF6A 1PW8A 4UA7A 3BECA 4IBRA 5CHJA 5FAQA 1BZAA 3Q07A 1PWCA 1ES2A 4LV3A 5J8XA 1LLBA 5JYOA 4OVDA 3VOYA 2Q9NA 3M6HA 4IVKA 1MWTA 4JF6A 4PM9A 2EX6A 1IKGA 1LL9A 2Y2NA 2Y2HA 1MXOA 4FD8A 3NDGA 1XPBA 2FFFB 1BULA 2BG1A 3SOIA 4E3LA 5KSCA 1K55A 3UE0A 2Y4AA 3IXDA 3NBLA 3HBRA 4MEZA 3IHBA 5AQ9A 1MWSA 4R1GA 4C3QA 1JWVA 3MZFA 5I94A 1K55C 2Y2PA 4KZBA 2XGNA 2ZQCA 3C4OA 4S2KA 4GD6A 5DTTA 4WEJA 5CECA 1PYYA 3A3EA 2ZQ7A 3IHAA 4MBHA 4WMCD 3AGDA 4WZ5A 4KZAA 4P6BA 2XR0A 1RP5A 5E2GA 1KGEA 5FA7A 3DWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3K A;  3HVF A;  4MBF A;  2H5S A;  3OC2 A;  5IHV A;  1K38 A;  1BSG A;  1L0E A;  4WZ5 C;  1SHV A;  4E6W A;  1GHP A;  5CGW A;  4A5R A;  2HP9 A;  2XD1 A;  4Y0U A;  4QU3 A;  2EFU A;  4RA7 A;  5F1G A;  5GLD A;  4ZBE A;  1KDW A;  2V2F F;  3G34 A;  1FR1 A;  1HVB A;  2ZQD A;  1PI5 A;  3IXB A;  3A3J A;  5M19 A;  4LV0 A;  4R3B A;  3SH8 A;  1L0D A;  1K57 A;  3BM6 A;  3MBZ A;  4IBX A;  4ID4 A;  4IVI A;  4MLL A;  5E2E A;  4CPK A;  4WZ4 A;  5F83 A;  2ZC4 B;  3N8L A;  1NXY A;  1NJ4 A;  3FKV A;  1K57 C;  5EVI B;  2Y2I A;  3M6B A;  5F1F A;  4C6Y A;  4OQH A;  5DF9 A;  2B5R A;  4R0Q A;  2ZJ9 A;  4OPZ A;  1M6K A;  3UDX A;  1WYB A;  4DDS A;  3E2L A;  1YQS A;  4L0L A;  3NC8 A;  3UNW A;  1ONH A;  4RX2 A;  3UE1 A;  1MWU A;  5EVI A;  2A49 A;  1XXM A;  3VMA A;  4DXB A;  4N9L A;  1NY0 A;  1PIO A;  5U47 A;  4GDB A;  1Q2P A;  1KE0 A;  2Q9M A;  4JXV A;  3O86 A;  1IYP A;  1Q2Q A;  3WS5 A;  5EVI C;  2J7V A;  3PBN A;  3ZDJ A;  1W8Q A;  4GDN A;  1PZO A;  1L2S A;  1C3B A;  2V1Z A;  4EBL A;  3BFE A;  4FCF A;  1FSY A;  2WUQ A;  1PI4 A;  2RL3 A;  3N4I A;  1VM1 A;  3FYZ A;  3LEZ A;  1PWG A;  1YLT A;  4S2J A;  5TR7 A;  1S6R A;  2OLU A;  3TSG A;  3IH8 A;  1ESU A;  1DJA A;  3BYD A;  5CTN A;  4EUZ A;  3MKE A;  4WEK A;  3UPP A;  4WM9 A;  5EEC A;  1ALQ A;  2DRW A;  4DE3 A;  5FQM A;  4BL2 A;  3HLG A;  3N7W A;  5EVL A;  5EOO A;  4JF4 A;  5CHM A;  2Y2M A;  4S2P A;  4B88 A;  1E4D A;  1I2S A;  4WEL A;  5EUA A;  4BD1 A;  3E2K A;  3IWI A;  3NIA A;  1LHY A;  1LL5 A;  3W4P A;  1E3U D;  1QMF A;  5E2F A;  1HTZ A;  3MFD A;  4MNR A;  2QPN A;  3G4P A;  2X71 A;  4DXC A;  1J9M A;  3SH9 A;  1RGZ A;  1IYO A;  2J8Y A;  3UDI A;  3IT9 A;  4E3K A;  4K91 A;  1MPL A;  2OV5 A;  1KDS A;  5TFQ A;  1KVL A;  1ERM A;  1O07 A;  1PW1 A;  3HUO A;  1ES3 A;  3O88 A;  4R3J A;  3ITB A;  3V3R A;  3CJM A;  3O3V A;  2WGW A;  4WBG A;  2WAD A;  1CK3 A;  4P0M A;  4F94 A;  4B4Z A;  2WAE A;  3V3S A;  3ZGA B;  5EVI D;  3S1Y A;  5CGS A;  1RCJ A;  5EE8 A;  3S22 A;  1MWR A;  5GLB A;  1ZC2 A;  1SKF A;  4HEF A;  1K56 A;  1RGY A;  4PPR A;  2ZM2 A;  1JWP A;  1H5X A;  3Q1F A;  4OQI A;  2V20 A;  2EXA A;  2ZMA A;  3MKF A;  4FH2 A;  5GLC A;  4QY5 A;  1DJB A;  3PBR A;  2VGJ A;  2P9V A;  2WZX A;  1ZG4 A;  4PM7 A;  4BD0 A;  5A92 A;  5A93 A;  3OPH A;  4QJG A;  4KZ4 A;  2ZD8 A;  4DKI A;  1KVM A;  3PTE A;  3OPR A;  4OPR A;  3RJU A;  2XQZ A;  3DWZ A;  4RYE A;  4YFM A;  3UE3 A;  2C6W B;  3VP2 A;  3WWX A;  4RVA A;  3OCL A;  3WS4 A;  3C5A A;  5FI2 A;  5FAT A;  1MY8 A;  1WE4 A;  2UWX A;  3QHY A;  1YMS A;  3HLF A;  4FH4 A;  3D4F A;  4KQQ A;  4X69 A;  1GHI A;  5M18 A;  3A3I A;  4KQR A;  1BTL A;  5DF8 A;  4GOG A;  4JKT A;  4OH0 A;  2IWD A;  4N9K A;  1W5D A;  2GDN A;  3NY4 A;  4JLF A;  4K0X A;  2EXB A;  2ZQ8 A;  4LCL A;  3RXX A;  1YT4 A;  2C5W B;  2ZC5 B;  4DDY A;  4GD8 A;  3M2K A;  3I7J A;  3LCE A;  1XA1 A;  1NYY A;  5FAP A;  4WYY A;  1SDN A;  1SCW A;  1JWZ A;  5CER A;  4Y7P A;  3G31 A;  4FSF A;  1GA0 A;  1S0W A;  2HPB A;  2WKH A;  3NCK A;  2VGK A;  5FI7 A;  5KMW A;  1TEM A;  4S2I A;  3UN7 A;  4S2O A;  3W4Q A;  1SDE A;  2IWB A;  4E3N A;  3WS1 A;  1K4F A;  1HZO A;  1YLW A;  4JXW A;  2XF3 A;  2HDR A;  3PBT A;  4D2O A;  2XK1 A;  2DCF A;  4DE2 A;  3AGE A;  4OOY A;  3IXG A;  4DRT A;  1ZG6 A;  2WAF A;  3SH7 A;  3UPO A;  1DY6 A;  3C7V A;  5HL1 A;  3PBQ A;  5E2H A;  2X02 A;  4ZJ3 A;  1KE4 A;  3FKW A;  5FSR A;  1N4O A;  3WRT A;  2ZM8 A;  2PU2 A;  3M2J A;  3ZVW A;  5FQI A;  1XA7 A;  4E3M A;  1Z6F A;  1H8Z A;  2ZC3 B;  2WGI A;  4E3O A;  4BLM A;  4GB7 A;  3HL9 A;  3EQV A;  2IWC A;  1EWZ A;  5EOE A;  4OLG A;  2G2W A;  3LY3 A;  4JPM A;  1YMX A;  3ZCZ A;  4JBF A;  4KZ8 A;  5GHZ A;  5GL9 A;  5CHU A;  4U0T A;  5JYP A;  5BOH A;  3A3F A;  4QHC A;  1BT5 A;  1ERQ A;  3AGF A;  1IYS A;  2Y2O A;  5FQJ A;  4R4S A;  3ZFZ A;  2WKI A;  4UA9 A;  3FZC A;  3PBS A;  3UY6 A;  3N6I A;  3VOZ A;  4B4X A;  4OPY A;  3MXR A;  3OPP A;  1IKI A;  5CXW A;  1G68 A;  3O87 A;  3TOI A;  3N8S A;  3IF6 A;  2JC7 A;  4PM6 A;  5KSH A;  2Y55 A;  4KG5 A;  1NZU A;  3SS4 A;  3FWL A;  5CEB A;  2HDQ A;  4KG6 A;  3IF6 C;  4OP8 A;  4OQG A;  2WGW B;  4X6T A;  2I72 A;  3GMW A;  5FDH A;  4Y0O A;  1DJC A;  4EV4 A;  1CEG A;  4U0X A;  5M1A A;  1BUE A;  4YIN A;  4OLD A;  4Q8I A;  1ZKJ A;  1FR6 A;  1XP4 A;  1U60 A;  1TVF A;  4EWF A;  2PU4 A;  5DF7 A;  2P74 A;  4LCM A;  3IWO A;  3PBO A;  4EQI A;  3Q82 A;  5GHX A;  4OOM A;  1WYC A;  4N1H A;  4HBU A;  3BFD A;  2P9V B;  1MKI A;  3QNB A;  2EX2 A;  4BL3 A;  4WMC A;  3Q7Z A;  5A90 A;  1FCO A;  3ZG5 A;  4S2L A;  4KZ5 A;  2XLN A;  4KG2 A;  1PZP A;  4E6X A;  4XUZ A;  2WYX A;  2A3U A;  3JYI A;  2Y59 A;  5HFO A;  2E8I A;  4DE0 A;  1CEF A;  3G35 A;  2Y2Q A;  3FV7 A;  1IEM A;  3GRJ A;  3BEB A;  5EPH A;  1LI9 A;  5F82 A;  4JXG A;  4P87 A;  3S4X A;  2WZZ A;  5G18 A;  2XD5 A;  3SS3 A;  5FAS A;  4NET A;  1FCN A;  1FSW A;  2HP5 A;  1L0F A;  3VSL A;  3ITA A;  1ESI A;  2J9P A;  5AQA A;  1XGJ A;  3HUN A;  4QY6 A;  4OKP A;  5KZH A;  2EFX A;  1XGI A;  3IH9 A;  2Z2M B;  2BLS A;  3V5M A;  4KZ9 A;  3VP4 A;  4C75 A;  1YLP A;  2ZC6 B;  3CZD A;  4RX3 A;  3GSG A;  2X01 A;  1K6S A;  1CI8 A;  1GHM A;  1TDL A;  2OSU A;  3G32 A;  2EX8 A;  3HUM A;  4S2N A;  3W4O A;  4EBN A;  5DTK A;  5CRF A;  4OOL A;  4R23 A;  3BRM A;  3VP1 A;  4PMA A;  1IYQ A;  3SS5 A;  3PAG A;  1L0G A;  4P85 A;  3G30 A;  4S2N C;  2H10 A;  4PM5 A;  1FCM A;  1BLH A;  2Z2L B;  2QZ6 A;  1QME A;  2XFT A;  3IQA A;  3Q7V B;  1ES5 A;  3G2Z A;  4HBT A;  4ZTK A;  5FI6 A;  5HX9 A;  4XUX A;  5HAI A;  3HLB A;  3W8K A;  3ZG0 A;  4LV1 A;  3Q81 A;  4K0W A;  3PAE A;  4BQM A;  1EI5 A;  4OP5 A;  4BJP A;  4X53 A;  2R9X A;  4N1X A;  3HLE A;  1VQQ A;  1NRF A;  2ZLY A;  4JXS A;  3LO7 A;  3CMZ A;  4UA6 A;  3Q7V A;  3ZG9 B;  1JVJ A;  4Y0T A;  3VP3 A;  4UAA A;  2Y2K A;  1K56 D;  1YLJ A;  5E43 A;  2R9W A;  1KE3 A;  3HLW A;  2WKE A;  5HAQ A;  1NYM A;  5FQQ A;  4KZ3 A;  4X56 A;  3VFH A;  3GV9 A;  3A3D A;  4XXR A;  1CI9 A;  3DTM A;  3BFC A;  4GKU A;  4OPQ A;  1YLZ A;  1JTG A;  5CTM A;  1H8Y A;  2HDS A;  3BFF A;  4GZB A;  4KZ7 A;  4OON A;  4DE1 A;  3UPN A;  3G2Y A;  2WK0 A;  4IED A;  3OZH A;  1E3U A;  4ZDX A;  5DTS A;  3P09 A;  4NK3 A;  1KGG A;  3EQU A;  3MZD A;  3DW0 A;  4LEN A;  3HLC A;  1BLP A;  3ZVT A;  4GNU A;  1I2W A;  4OQ0 A;  3CG5 A;  3RXW A;  4X68 A;  2QMI A;  3V50 A;  5HW3 A;  5A91 A;  3GR2 A;  5TGF A;  1E25 A;  1LI0 A;  1TDG A;  2Y2G A;  2XEP A;  2Y91 A;  1GCE A;  3GTC A;  1FOF A;  3TG9 A;  4X55 A;  1KGF A;  3IF6 B;  1PWD A;  2XDM A;  4ZAM A;  5L2F A;  2Y2J A;  4S2M A;  1ONG A;  1Y54 A;  2XH9 A;  2JCH A;  1K25 A;  2JBF A;  3BLS A;  3IWQ A;  3LY4 A;  5HAR A;  3WS2 A;  5CED A;  4BEN A;  3QNC A;  2FFY A;  5FAO A;  3C4P A;  2CC1 A;  2H0T A;  5AQ7 A;  1JTD A;  3GQZ A;  4ZJ1 A;  4CJN A;  1I5Q A;  5FQ9 A;  1XX2 A;  3IF5 A;  3WRZ A;  3WS0 A;  2J9O A;  1K4E A;  2HP6 A;  5D3O A;  2RCX A;  1O7E A;  4ZJ2 A;  3OPL A;  2G2U A;  3HLD A;  4LV2 A;  4QB8 A;  5AQB A;  1BLS A;  1W79 A;  4E3I A;  5GHY A;  1ES4 A;  1W7F A;  4KEN B;  4MBK A;  1K6R A;  3UDF A;  3NDE A;  3MXS A;  2EX9 A;  3P98 A;  1MBL A;  4Z9Q A;  1NZO A;  2ZQ9 A;  3ZNY A;  5GLA A;  4HES A;  5CGX A;  3HRE A;  4E3J A;  2ZQA A;  4O7D A;  3MZE A;  1BLC A;  3C7U A;  2HDU A;  1K54 A;  4JF5 A;  1W8Y A;  3B3X A;  4KZ6 A;  3VFF A;  1XKZ A;  1FQG A;  5FQK A;  1K54 C;  4QD4 A;  3ZHH A;  5HAP A;  4GN2 A;  1AXB A;  1HD8 A;  4N92 A;  2WGV A;  1YM1 A;  2ZM0 A;  2XFS A;  3VSK A;  4H8R A;  2JE5 A;  1YLY A;  5DVA A;  3UO9 A;  4KQO A;  1OME A;  3ZG8 B;  3GVB A;  1G6A A;  2PBY A;  3VP0 A;  3N8R A;  3IXH A;  3ISG A;  1GA9 A;  2H0Y A;  3OCN A;  4R4R A;  3V39 A;  2OLV A;  3ZG7 B;  4U3T A;  3BLM A;  4PM8 A;  3BFG A;  3ZNT A;  1M40 A;  4UHU A;  1ERO A;  2ZC7 A;  2Y2L A;  1IEL A;  1N9B A;  3NI9 A;  2DNS A;  4EBP A;  4DF6 A;  1PW8 A;  4UA7 A;  3BEC A;  4IBR A;  5CHJ A;  5FAQ A;  1BZA A;  3Q07 A;  1PWC A;  1ES2 A;  4LV3 A;  5J8X A;  1LLB A;  5JYO A;  4OVD A;  3VOY A;  2Q9N A;  3M6H A;  4IVK A;  1MWT A;  4JF6 A;  4PM9 A;  2EX6 A;  1IKG A;  1LL9 A;  2Y2N A;  2Y2H A;  1MXO A;  4FD8 A;  3NDG A;  1XPB A;  2FFF B;  1BUL A;  2BG1 A;  3SOI A;  4E3L A;  5KSC A;  1K55 A;  3UE0 A;  2Y4A A;  3IXD A;  3NBL A;  3HBR A;  4MEZ A;  3IHB A;  5AQ9 A;  1MWS A;  4R1G A;  4C3Q A;  1JWV A;  3MZF A;  5I94 A;  1K55 C;  2Y2P A;  4KZB A;  2XGN A;  2ZQC A;  3C4O A;  4S2K A;  4GD6 A;  5DTT A;  4WEJ A;  5CEC A;  1PYY A;  3A3E A;  2ZQ7 A;  3IHA A;  4MBH A;  4WMC D;  3AGD A;  4WZ5 A;  4KZA A;  4P6B A;  2XR0 A;  1RP5 A;  5E2G A;  1KGE A;  5FA7 A;  3DWK A; 
#chains in the Genus database with same CATH topology
 2H5S A;  3OC2 A;  1K38 A;  1L0E A;  4WZ5 C;  1SHV A;  4E6W A;  1GHP A;  5CGW A;  4YOF A;  5F1G A;  4QU3 A;  2EFU A;  1NWZ A;  3KSG A;  4HP4 A;  1FR1 A;  3DTE A;  2ZQD A;  4R3B A;  3SH8 A;  4WZ4 A;  5F83 A;  3N8L A;  1NXY A;  2Y2I A;  2W1R A;  4X25 A;  1LL8 A;  5F1F A;  4EU0 A;  1WYB A;  5MC7 A;  2A24 A;  1YQS A;  4L0L A;  1ONH A;  3LR3 A;  2BTF P;  4RX2 A;  4UQI M;  2W1T B;  1MWU A;  5EVI A;  3VMA A;  4DXB A;  3T50 A;  3T4J A;  1NY0 A;  5U47 A;  2Q9M A;  4I3J A;  4GDN A;  4HH3 A;  3SZT A;  4EBL A;  1FSY A;  5J4E A;  1PI4 A;  3N4I A;  4JGO A;  1ESU A;  3BYD A;  5CTN A;  4GS9 A;  4EUZ A;  3MKE A;  1S1Z A;  3HLG A;  5EVL A;  4JF4 A;  1S67 L;  2Y2M A;  3H9W A;  3NIA A;  5FL3 A;  1LL5 A;  1E3U D;  1QMF A;  1HTZ A;  3MFD A;  3G4P A;  1J9M A;  2J8Y A;  3MQ0 A;  1MPL A;  1KDS A;  1XJ4 A;  1KVL A;  3O88 A;  3S7P A;  1ES3 A;  1XFQ A;  1S4S A;  2WAD A;  2V0W A;  1OTE A;  2WAE A;  3V3S A;  1H3Q A;  5CGS A;  5TBM B;  5C5K A;  4HEF A;  1RGY A;  2IA2 A;  1H8M A;  2V20 A;  4ME4 A;  2LB9 A;  5GLC A;  2QYB A;  4BD0 A;  2P7J A;  4RYE A;  3VP2 A;  5L09 A;  5EFW A;  5FI2 A;  1BYW A;  2UWX A;  3QHY A;  3NJA A;  1YMS A;  4GW9 A;  4FH4 A;  3D4F A;  1PRQ A;  1GHI A;  2K2N A;  2W3D A;  3A3I A;  2WKR A;  5DF8 A;  2HV1 A;  2W0N A;  4YWZ A;  2ZQ8 A;  3RXX A;  1YT4 A;  3M2K A;  1XA1 A;  1VEU A;  1JWZ A;  4Y7P A;  4FSF A;  2VGK A;  4S2I A;  2A2L A;  4S2O A;  4EET B;  4BWI A;  2PD7 A;  5IT5 A;  1SDE A;  1N9N A;  1OTD A;  3D72 A;  2V9A A;  3T4O A;  4ETZ A;  1K4F A;  3SW1 A;  4JXW A;  2XF3 A;  1H0M A;  2JKT I;  3AGE A;  1ZG6 A;  2WAF A;  3UPO A;  1DY6 A;  3PBQ A;  5E2H A;  3PR6 A;  4DMZ A;  3WRT A;  3JVV A;  3E4O A;  3M2J A;  4WL9 A;  3ZVW A;  1XA7 A;  4E3M A;  2ZC3 B;  1H8Z A;  3UMD A;  1TD5 A;  2IWC A;  3ZCZ A;  5JYP A;  5FEG A;  1BT5 A;  3ZFZ A;  1IYS A;  3L9K A;  4UA9 A;  3FZC A;  3N6I A;  3VOZ A;  3OPP A;  1G68 A;  3O87 A;  2OAP 1;  2QHK A;  1OT6 A;  1Y4O A;  4MN5 A;  2I72 A;  2W3H A;  3GMW A;  4Y0O A;  4EV4 A;  4OLD A;  1ZKJ A;  3VE3 A;  1DP8 A;  1OTI A;  1U60 A;  2JKR I;  3NHQ A;  4LCM A;  4OOM A;  3EEH A;  4N1H A;  5L10 A;  5DKK A;  3QNB A;  1OTB A;  3Q7Z A;  5A90 A;  4H6J A;  4S2L A;  4KZ5 A;  2Y59 A;  1Y28 A;  3EGX C;  5EPH A;  5F82 A;  3QP4 A;  4P87 A;  3SS3 A;  5FAS A;  4WLA A;  1VHM A;  2HP5 A;  5AQA A;  4IUH A;  4OKP A;  3H82 A;  2BLS A;  3HCY A;  4RX3 A;  3VOL A;  3HUM A;  4FOF A;  3CUE C;  5CRF A;  3BRM A;  4PMA A;  2KOI A;  4S2N C;  1F98 A;  2XFT A;  3FPW A;  3Q7V B;  3K2N A;  4XUX A;  3W8K A;  3PAE A;  4BQM A;  4N1X A;  3HLE A;  2ZLY A;  2O9C A;  3K3C A;  3UB8 A;  5E43 A;  1KE3 A;  3E98 A;  2WKE A;  5FQQ A;  4X56 A;  2OOL A;  3A3D A;  3F1P B;  1CI9 A;  3FPV A;  4OON A;  4DE1 A;  2XRO A;  4FUW A;  2HZ5 A;  4HOI A;  3MS6 A;  5DTS A;  4NK3 A;  3EQU A;  1P97 A;  1BLP A;  5EVE A;  3RXW A;  3CG5 A;  5TGF A;  3GTC A;  1FOF A;  3MJQ A;  4S2M A;  2DMW A;  3IBR A;  5A8B A;  4BEN A;  2G7U A;  5AVF A;  4ZJ1 A;  5FQ9 A;  3WRZ A;  3TW8 A;  2J9O A;  3B42 A;  3UE6 A;  1IOU A;  1YKD A;  1BLS A;  1W79 A;  3NOU C;  1J3W A;  1ES4 A;  3KSI A;  3LFV A;  3RH8 B;  2Q0O A;  3UDF A;  3NDE A;  3MXS A;  4ETX A;  4Z9Q A;  4HHD A;  4FTX A;  3LUQ A;  3ULF A;  3MZE A;  4JF5 A;  2B02 A;  2M7U A;  1K54 C;  4QD4 A;  2M7V A;  4NXG A;  5HAP A;  3BY9 A;  5CX7 A;  2JKT M;  3UB9 A;  1YLY A;  3F1O A;  3UO9 A;  4KQO A;  2B95 A;  3DTI A;  3V39 A;  1GA9 A;  2H0Y A;  3ZG7 B;  2OLV A;  4U3T A;  3BLM A;  4PM8 A;  3T12 B;  4HNB A;  4UHU A;  1ERO A;  1TS0 A;  2DNS A;  5AVE A;  3LYX A;  5CHJ A;  3BEC A;  4DF6 A;  1BZA A;  4LRY C;  1VET A;  4DN0 A;  3QP6 A;  1MWT A;  4JF6 A;  4PM9 A;  1BUL A;  4E3L A;  5KSC A;  3UME A;  3UE0 A;  3IXD A;  1X0O A;  4LFU A;  4C3Q A;  1JWV A;  3MZF A;  1K55 C;  2ZL1 A;  4S2K A;  2XGN A;  4WEJ A;  4I3A A;  4MBH A;  4KZA A;  4P6B A;  3T4S A;  1RP5 A;  5E2G A;  2VV8 A;  5FA7 A;  4MBF A;  5IHV A;  1BSG A;  2JKR M;  2J3W A;  3OOV A;  2HP9 A;  4RA7 A;  1KDW A;  2V2F F;  3G34 A;  3LEQ A;  3A3J A;  2PRF A;  3BM6 A;  4IBX A;  4ID4 A;  4CPK A;  4ARZ A;  1NJ4 A;  3FKV A;  1K57 C;  5EVI B;  3CLO A;  4HJ4 A;  1M6K A;  4DDS A;  3NC8 A;  4MN6 A;  3UE1 A;  1PIO A;  2YKH A;  1KE0 A;  1IYP A;  4GS9 B;  3WS5 A;  3PBN A;  2QJ7 A;  1W8Q A;  4WN5 A;  1PZO A;  1L2S A;  1C3B A;  2V1Z A;  1D7E A;  4FCF A;  4HJ6 A;  1VM1 A;  1PWG A;  4G3V A;  1YSP A;  1ALQ A;  5EOO A;  3TJZ C;  5CHM A;  4S2P A;  1I2S A;  4WEL A;  5F6A A;  4BD1 A;  3A0R A;  3E2K A;  1LHY A;  1VB6 A;  3LIC A;  4DXC A;  2V1B A;  3SH9 A;  1RGZ A;  4X1M A;  1MZU A;  3H7W B;  3IT9 A;  4E3K A;  3BJN A;  2V1A A;  1XJ3 A;  5TFQ A;  3U4L P;  4NEE D;  1ERM A;  4R3J A;  3V3R A;  3V67 A;  4WBG A;  4R70 A;  4F94 A;  5G4Y A;  1CJF A;  4F3L B;  3C2W A;  5HSQ A;  3S22 A;  1SKF A;  1F5M A;  1K56 A;  2ZM2 A;  3W2Z A;  3D9Y A;  4OQI A;  4II7 A;  4NG2 A;  3G6O A;  1T1C A;  5DFX A;  3LIB A;  3MKF A;  2W3F A;  3PBR A;  2P9V A;  3CIT A;  1ZG4 A;  4MDZ A;  4PM7 A;  4QJG A;  1N9O A;  4KZ4 A;  4EQ1 A;  2ZD8 A;  3GDI A;  4DKI A;  1KVM A;  2XQZ A;  4YFM A;  3UE3 A;  3WWX A;  4RVA A;  3OCL A;  2E8J A;  4CLC A;  5FAT A;  3T1S A;  3C8C A;  3HLF A;  5M18 A;  4Q0I A;  2KDK A;  2PHY A;  4JKT A;  4GCZ A;  2GDN A;  2ZC5 B;  1V9Z A;  5TJJ A;  1NYY A;  2XA7 M;  2KX6 A;  4Y2F A;  3HJK A;  1S0W A;  2VA0 A;  5KMW A;  3UN7 A;  3IS2 A;  4WF0 A;  3O5Y A;  3W4Q A;  5AJG A;  2EA9 A;  4R3A A;  4E3N A;  2JKG A;  1YLW A;  3PBT A;  3MMH A;  4I39 A;  4P6Z M;  4DRT A;  4CLC E;  1MC0 A;  3ZQ5 A;  1GSV A;  1W63 M;  3LI8 A;  2VJW A;  2XSS A;  1Z6F A;  2WGI A;  1XFN A;  4GB7 A;  3HL9 A;  5EOE A;  1D06 A;  4OLG A;  2G2W A;  2VK3 A;  4JBF A;  2L0W A;  5GL9 A;  5CHU A;  2NUP C;  5DKL A;  4QHC A;  2WKI A;  3UY6 A;  3LIA A;  4B4X A;  3KYZ A;  2JC7 A;  2Y55 A;  5KIZ A;  1N9L A;  2HDQ A;  3IF6 C;  2WGW B;  4DJ3 A;  1DJC A;  1D1J A;  5M1A A;  1XP4 A;  1TVF A;  4R38 A;  2FZ0 A;  2P74 A;  3IWO A;  3PBO A;  5GHX A;  2PBD P;  1S66 L;  1L3L A;  4HBU A;  3BFD A;  1LSX A;  2EX2 A;  4WMC A;  3KSH A;  2ZOH A;  2XLN A;  2WYX A;  2A3U A;  3H82 B;  2Y2Q A;  3FV7 A;  3T4K A;  1SKO B;  2ZMV A;  3CPT A;  1FSW A;  1ESI A;  1XGJ A;  3HUN A;  4L9E A;  5KZH A;  1OJG A;  3T1Q B;  3VP4 A;  3LR4 A;  4C75 A;  3GSG A;  2OSU A;  2EX8 A;  4EBN A;  5DTK A;  4R23 A;  3VP1 A;  1IYQ A;  3SS5 A;  3PAG A;  2YKF A;  3T4L A;  2H10 A;  2PD8 A;  2QZ6 A;  1ES5 A;  3G2Z A;  5HX9 A;  5HAI A;  3Q81 A;  2INW A;  1EI5 A;  4OP5 A;  4X53 A;  1P0Z A;  2R9X A;  1WA9 A;  4JXS A;  4UA6 A;  1JVJ A;  3VP3 A;  1TF1 A;  1K56 D;  1YLJ A;  3P7N A;  4B93 A;  3HLW A;  1NYM A;  4LGW A;  3DTM A;  2K31 A;  3BFC A;  4OPQ A;  5F5Y A;  1JTG A;  3JPU A;  1H8Y A;  2HDS A;  2Y8H A;  3BFF A;  4GZB A;  2QKP A;  3UPN A;  4ZDX A;  3P09 A;  1KGG A;  3MZD A;  3C38 A;  3ZVT A;  4GNU A;  4OQ0 A;  4BMW A;  2QMI A;  4EEU A;  3ICY A;  4CLC D;  1E25 A;  1TDG A;  2Y2G A;  3IF6 B;  2XDM A;  2VV7 A;  4HIA A;  1ONG A;  2XH9 A;  3BLS A;  3IWQ A;  3TE8 A;  2GJ3 A;  1XJ2 A;  5AQ7 A;  1JTD A;  1K4E A;  2HP6 A;  5D3O A;  2RCX A;  1O7E A;  4WUJ A;  4E3I A;  1W7F A;  2W1T A;  4KEN B;  1T19 A;  1MBL A;  3T1X A;  4Y17 A;  2J80 A;  3T1R A;  2O9A A;  4O7D A;  2HJ9 C;  4CQH A;  4ZRR A;  4KZ6 A;  3F1O B;  4HQA A;  3VFF A;  3KYE A;  4HJ3 A;  3K3D A;  4Y3I A;  2UV0 E;  3E4P A;  4L9F A;  1AXB A;  2HF6 A;  4JGP A;  3ZG8 B;  2PBY A;  3ISG A;  4R4R A;  5HWV A;  2JN7 A;  4L9G A;  3BFG A;  1M40 A;  3NOP C;  2ZC7 A;  1IEL A;  3NI9 A;  2VV6 A;  4NXE A;  4LV3 A;  5J8X A;  4OVD A;  1G28 A;  3L7H A;  4D60 A;  1IKG A;  1AWI A;  1LSV A;  5F68 A;  2ZL1 B;  2Y2H A;  1MXO A;  3NDG A;  1XPB A;  3KYQ A;  2J3T D;  3SOI A;  3NBL A;  5K5B A;  5AQ9 A;  1MWS A;  4LRX C;  5DFY A;  5I94 A;  2ZQC A;  1HLU P;  2ZQ7 A;  4WMC D;  1W63 Q;  4WZ5 A;  5LBR A;  3DBA A;  1KGE A;  4M3K A;  2XD1 A;  4Y0U A;  3IXB A;  5M19 A;  4LV0 A;  5IS1 A;  1L0D A;  3MBZ A;  4IVI A;  4MLL A;  1CQA A;  3M6B A;  4MMN A;  4C6Y A;  4RQ9 A;  4OQH A;  4R0Q A;  3E2L A;  3UNW A;  4I38 A;  4Y13 A;  2XA7 S;  2A49 A;  1XXM A;  1Q2P A;  1TS8 A;  4JXV A;  3O86 A;  1Q2Q A;  3LID A;  5EVI C;  2J7V A;  2WUQ A;  2RL3 A;  3FYZ A;  1YLT A;  5TR7 A;  3NEC A;  1OPX A;  3TSG A;  5DJU A;  4P6Z S;  1DJA A;  3S7O A;  3UPP A;  5EEC A;  4DE3 A;  2DRW A;  5FQM A;  3LR0 A;  4UQI S;  3R7W A;  4B88 A;  1E4D A;  5EUA A;  3IWI A;  3W4P A;  5E2F A;  4MNR A;  4E04 A;  5J3W A;  4K91 A;  2OV5 A;  2Y79 A;  1PW1 A;  3BQA A;  3MFX A;  3ITB A;  2NUT C;  3CJM A;  3O3V A;  2EWV A;  1CK3 A;  4P0M A;  2EWW A;  3EOI A;  3ZGA B;  4XT2 B;  1RCJ A;  5EE8 A;  5GLB A;  4PPR A;  4Y15 A;  1H5X A;  3Q1F A;  4Q0H A;  2EXA A;  1YAX A;  2VKS A;  4EEP A;  4NXB A;  5A93 A;  3OPH A;  3BQ8 A;  1DP9 A;  1NLZ A;  3PTE A;  3OPR A;  3RJU A;  4UEY A;  2PYR A;  5FEF A;  5IU1 A;  2HJE A;  3PXP A;  1OTA A;  4I5S A;  4KQQ A;  1PFL A;  2ZMF A;  2IWD A;  1W5D A;  4K0X A;  2EXB A;  2C5W B;  4DDY A;  2VGL M;  3EWK A;  3I7J A;  3LCE A;  3IBJ A;  4DJ2 A;  1UWP X;  1GA0 A;  2HPB A;  2JKF A;  2WKH A;  3E0Y A;  3NCK A;  1ZTU A;  4PHT A;  2A24 B;  4BBU A;  5L8M A;  2IWB A;  3WS1 A;  1T18 A;  1V9Y A;  4D2O A;  2PR6 A;  4OOY A;  3IXG A;  3KO6 A;  4NKP A;  3LI9 A;  1KE4 A;  3FKW A;  5L07 A;  4KUK A;  4E3O A;  4BLM A;  1EWZ A;  3PYP A;  3LY3 A;  4JPM A;  2PYP A;  5GHZ A;  3AGF A;  4R4S A;  3MXR A;  3N8S A;  5KSH A;  4KG5 A;  1NZU A;  3GEC A;  1F2K A;  3SS4 A;  3FWL A;  2GX5 A;  4KG6 A;  3MXQ A;  2AVX A;  1MKM A;  5FDH A;  2O99 A;  1BUE A;  4YIN A;  3PHY A;  4Q8I A;  5FDS A;  1FR6 A;  1UGU A;  1NLY A;  3F1N A;  2PU4 A;  5DF7 A;  4EQI A;  1GSW A;  1WYC A;  1MKI A;  4BL3 A;  4G3W A;  4E6X A;  4XUZ A;  2BAS A;  3P01 A;  5HFO A;  2E8I A;  4DE0 A;  1IEM A;  3BEB A;  2PR5 A;  5EM0 A;  1LI9 A;  2P08 A;  4JXG A;  2WZZ A;  5G18 A;  3CI6 A;  1FCN A;  1L0F A;  3ITA A;  2J9P A;  2EFX A;  1XGI A;  3CUE A;  3V5M A;  1YLP A;  4HY8 A;  2ZC6 B;  3CZD A;  2PT7 A;  1K6S A;  1CI8 A;  1TDL A;  4S2N A;  4OOL A;  3ZYT A;  1L0G A;  4P85 A;  3LGO A;  2LB5 A;  3KX0 X;  4PM5 A;  1FCM A;  1VEU B;  1BLH A;  2GNX A;  2Z2L B;  1S4R A;  1KOU A;  1FIK A;  3ZG0 A;  3HLB A;  1PNE A;  2ACG A;  4EW7 A;  5EM1 A;  1NRF A;  3LO7 A;  4R6L A;  4UAA A;  4PKY G;  2R9W A;  5HAQ A;  4QWO A;  4JGR A;  4XXR A;  4GKU A;  1G6O A;  1YLZ A;  4KZ7 A;  2WK0 A;  1EW0 A;  3OZH A;  4ESP A;  3HLC A;  5HW3 A;  1YPR A;  1I2W A;  1IFQ A;  2MJ6 A;  3V50 A;  4X68 A;  2Y91 A;  3QP2 A;  1P9W A;  4X55 A;  3TG9 A;  5L2F A;  1Y54 A;  2JCH A;  4Z1W A;  3HJI A;  1ACF A;  3LY4 A;  3C30 A;  2FFY A;  5FAO A;  4CJN A;  1XX2 A;  3WS0 A;  2O9B A;  2WKP A;  4ZJ2 A;  4GHI A;  3OPL A;  2G2U A;  5AQB A;  1K6R A;  4LLO B;  2EX9 A;  2V0U A;  5F69 A;  2ZQ9 A;  3ZNY A;  2Z6C A;  4H6J B;  5CGX A;  3C7U A;  1ZHH B;  2HDU A;  1K54 A;  1W8Y A;  3B3X A;  5FQK A;  4O01 A;  3ZHH A;  5HZH A;  4N92 A;  2WGV A;  5HWT A;  1YM1 A;  2ZM0 A;  2JE5 A;  4Y5F A;  1TS7 A;  1OME A;  1G6A A;  4B9O A;  3VP0 A;  3N8R A;  3IXH A;  4PAU A;  3H7W A;  3R4K A;  2PDR A;  2Y2L A;  1N9B A;  2FH5 A;  2K7S A;  4EBP A;  4UA7 A;  4IBR A;  3Q07 A;  1ES2 A;  3VOY A;  4F3L A;  4G3K A;  2Q9N A;  3IX8 A;  1ODV A;  2EX6 A;  1LL9 A;  4Q0J A;  4QPR A;  2QWS A;  2BG1 A;  5HD5 A;  1K55 A;  1UWN X;  2Y4A A;  3QP8 A;  1T1A A;  3IHB A;  4R1G A;  2Y2P A;  5CEC A;  4GD6 A;  3A3E A;  3AGD A;  2XR0 A;  3HVF A;  3QP1 A;  2ZBB A;  4A5R A;  1TS6 A;  3MR0 A;  4JGQ A;  5GLD A;  4ZBE A;  2PAV P;  1HVB A;  1PI5 A;  2I9V A;  5HDS A;  3OLO A;  1K57 A;  3D3O A;  5E2E A;  2JHE A;  2ZC4 B;  5DF9 A;  2B5R A;  2ZJ9 A;  4OPZ A;  3UDX A;  3LIF A;  2D01 A;  2VGL S;  3NUL A;  2W27 A;  2M1C A;  2R78 A;  2L1M A;  4N9L A;  4GDB A;  3VE4 A;  3ZDJ A;  3DAV A;  2VLG A;  2L4R A;  3BFE A;  3R7W B;  3MQQ A;  3MSH A;  3LEZ A;  4S2J A;  4LRZ E;  1S6R A;  2OLU A;  3IH8 A;  4M4X A;  4WEK A;  4WM9 A;  3UB5 P;  1P9R A;  4BL2 A;  1Z09 A;  3N7W A;  4GLQ A;  3LR5 A;  2QPN A;  2X71 A;  2Z6D A;  1IYO A;  3UDI A;  1YSQ A;  4IHQ A;  5HDD A;  5J7E A;  1LSW A;  1O07 A;  3HUO A;  3DTK A;  2WGW A;  4B4Z A;  1VET B;  1T1B A;  2HGV A;  5EVI D;  3S1Y A;  1MWR A;  3B47 A;  1ZC2 A;  1JWP A;  1FIL A;  2ZMA A;  4BBV A;  3T4Q A;  5HDC A;  4FH2 A;  4K08 A;  1DJB A;  4QY5 A;  2VGJ A;  2WZX A;  5TBM A;  5A92 A;  2H28 A;  3S7Q A;  4HH2 A;  4OPR A;  3DWZ A;  1SKO A;  2C6W B;  3VV4 A;  3WS4 A;  3C5A A;  1MY8 A;  1WE4 A;  5HPI A;  4CLC C;  4X69 A;  4KQR A;  3TRC A;  1BTL A;  4GOG A;  4NXF A;  3FC7 A;  4OH0 A;  3OBF A;  4N9K A;  4JLF A;  3NY4 A;  4LCL A;  2QJ5 A;  4GJ4 A;  4GD8 A;  4ARZ B;  3EGD C;  5FAP A;  4WYY A;  1SDN A;  1SCW A;  5CER A;  3G31 A;  5FI7 A;  4MCW A;  2W3E A;  1TEM A;  3RTY A;  3B33 A;  4EUV A;  4EES A;  1HZO A;  2HDR A;  2XK1 A;  2DCF A;  4DE2 A;  1SZV A;  1K0K A;  3SH7 A;  2VZW A;  2WKQ A;  3C7V A;  4IJG A;  5HL1 A;  2OWJ A;  2X02 A;  4ZJ3 A;  5FSR A;  4YNR A;  1N4O A;  2ZM8 A;  2PU2 A;  5FQI A;  3LIE A;  3EQV A;  2VX8 A;  1YMX A;  4KZ8 A;  4U0T A;  5BOH A;  3IX3 A;  3A3F A;  1ERQ A;  2Y2O A;  5FQJ A;  2GZA A;  5HL6 A;  3PBS A;  4OPY A;  5CXW A;  1IKI A;  4HI4 A;  3TOI A;  3IF6 A;  4PM6 A;  3UB7 A;  3RFB A;  3BWL A;  5CEB A;  4OP8 A;  2VEA A;  3F1N B;  4OQG A;  4X6T A;  3MF0 A;  4EXO A;  3BY8 A;  1CEG A;  4U0X A;  1XJ6 A;  2KLI A;  4EER A;  4EWF A;  2J3T C;  3Q82 A;  3E4Q A;  3CAX A;  2P9V B;  1CF0 A;  3KSF A;  1FCO A;  3ZG5 A;  4KG2 A;  1PZP A;  1S1Y A;  3CHW P;  3JYI A;  5HD3 A;  3T4T A;  1CEF A;  3G35 A;  3GRJ A;  3S4X A;  4CLC B;  1JNU A;  2XD5 A;  4NET A;  3VSL A;  4QY6 A;  3IH9 A;  2Z2M B;  4KZ9 A;  2X01 A;  1GHM A;  3G32 A;  3W4O A;  1DP6 A;  3G30 A;  4X1L A;  1QME A;  3IQA A;  4HBT A;  4ZTK A;  5FI6 A;  3IS2 B;  4O0P A;  4LV1 A;  4K0W A;  4BJP A;  3BW6 A;  1VQQ A;  2B18 A;  1DRM A;  5DJT A;  3CMZ A;  3Q7V A;  3ZG9 B;  4Y0T A;  2Y2K A;  1F9I A;  1NRJ A;  4KZ3 A;  3VFH A;  3GV9 A;  3NOT C;  3CWF A;  5CTM A;  2OAQ 1;  3G2Y A;  4IED A;  1LT0 A;  2O0Y A;  2ZOI A;  1E3U A;  3DW0 A;  3F1P A;  2XRN A;  4LEN A;  2P04 A;  5A91 A;  3GR2 A;  1LI0 A;  3IX4 A;  2XEP A;  1GCE A;  4ZAM A;  1KGF A;  1PWD A;  2Y2J A;  2V8F A;  1K25 A;  5HWW A;  4GHI B;  4HP9 A;  2JBF A;  5HAR A;  3WS2 A;  2V8C A;  5CED A;  3QNC A;  3UB6 A;  3C4P A;  2CC1 A;  2H0T A;  3FG8 A;  3JVU A;  3GQZ A;  1I5Q A;  3IF5 A;  3HLD A;  3EEA A;  4LV2 A;  4QB8 A;  3QP5 A;  5GHY A;  1OT9 A;  2W3G A;  4MBK A;  3A0V A;  4PKY A;  3P98 A;  2D02 A;  1NZO A;  1A0K A;  5GLA A;  4HES A;  4O8G A;  3HRE A;  4E3J A;  2ZQA A;  1BLC A;  3MQO A;  5EV0 A;  1XKZ A;  1FQG A;  2OWH A;  4GN2 A;  3S7N A;  1HD8 A;  1GSX A;  3CPT B;  4BBT A;  2XFS A;  3VSK A;  4IUK A;  4H8R A;  5DVA A;  3U2A A;  3GVB A;  5HPF A;  3A0S A;  3OCN A;  4AFI A;  1OJ5 A;  1G5U A;  3ZNT A;  1PW8 A;  1STZ A;  5FAQ A;  1PWC A;  4KUO A;  1LLB A;  4MN7 A;  5JYO A;  3M6H A;  4IVK A;  4XT2 A;  5I5L A;  2Y2N A;  4FD8 A;  2FFF B;  4KQD A;  5G4Z A;  3HBR A;  4MEZ A;  4LPZ A;  4I3I A;  4KZB A;  3C4O A;  5DTT A;  1PYY A;  2CMN A;  3IHA A;  3DWK A; 
#chains in the Genus database with same CATH homology
 4M3K A;  3HVF A;  4MBF A;  2H5S A;  3OC2 A;  5IHV A;  1K38 A;  1BSG A;  1L0E A;  4WZ5 C;  1SHV A;  4E6W A;  1GHP A;  5CGW A;  4A5R A;  2HP9 A;  2XD1 A;  4Y0U A;  4QU3 A;  2EFU A;  4RA7 A;  5F1G A;  5GLD A;  4ZBE A;  1KDW A;  2V2F F;  3G34 A;  1FR1 A;  1HVB A;  2ZQD A;  1PI5 A;  3IXB A;  3A3J A;  5M19 A;  4LV0 A;  4R3B A;  3SH8 A;  1L0D A;  1K57 A;  3BM6 A;  3MBZ A;  4IBX A;  4ID4 A;  4IVI A;  4MLL A;  5E2E A;  4CPK A;  4WZ4 A;  5F83 A;  2ZC4 B;  3N8L A;  1NXY A;  1NJ4 A;  3FKV A;  1K57 C;  5EVI B;  2Y2I A;  3M6B A;  5F1F A;  4C6Y A;  4OQH A;  5DF9 A;  2B5R A;  4R0Q A;  2ZJ9 A;  4OPZ A;  1M6K A;  3UDX A;  1WYB A;  4DDS A;  3E2L A;  1YQS A;  4L0L A;  3NC8 A;  3UNW A;  1ONH A;  4RX2 A;  3UE1 A;  1MWU A;  5EVI A;  2A49 A;  1XXM A;  3VMA A;  4DXB A;  4N9L A;  1NY0 A;  1PIO A;  5U47 A;  4GDB A;  1Q2P A;  1KE0 A;  2Q9M A;  4JXV A;  3O86 A;  1IYP A;  1Q2Q A;  3WS5 A;  5EVI C;  2J7V A;  3PBN A;  3ZDJ A;  1W8Q A;  4GDN A;  1PZO A;  1L2S A;  1C3B A;  2V1Z A;  4EBL A;  3BFE A;  4FCF A;  1FSY A;  2WUQ A;  1PI4 A;  2RL3 A;  3N4I A;  1VM1 A;  3FYZ A;  3LEZ A;  1PWG A;  1YLT A;  4S2J A;  5TR7 A;  1S6R A;  2OLU A;  3TSG A;  3IH8 A;  1ESU A;  1DJA A;  3BYD A;  5CTN A;  4EUZ A;  3MKE A;  4WEK A;  3UPP A;  4WM9 A;  5EEC A;  1ALQ A;  2DRW A;  4DE3 A;  5FQM A;  4BL2 A;  3HLG A;  3N7W A;  5EVL A;  5EOO A;  4JF4 A;  5CHM A;  2Y2M A;  4S2P A;  4B88 A;  1E4D A;  1I2S A;  4WEL A;  5EUA A;  4BD1 A;  3E2K A;  3IWI A;  3NIA A;  1LHY A;  1LL5 A;  3W4P A;  1E3U D;  1QMF A;  5E2F A;  1HTZ A;  3MFD A;  4MNR A;  2QPN A;  3G4P A;  2X71 A;  4DXC A;  1J9M A;  3SH9 A;  1RGZ A;  1IYO A;  2J8Y A;  3UDI A;  3IT9 A;  4E3K A;  4K91 A;  1MPL A;  2OV5 A;  1KDS A;  5TFQ A;  1KVL A;  1ERM A;  1O07 A;  1PW1 A;  3HUO A;  1ES3 A;  3O88 A;  4R3J A;  3ITB A;  3V3R A;  3CJM A;  3O3V A;  2WGW A;  4WBG A;  2WAD A;  1CK3 A;  4P0M A;  4F94 A;  4B4Z A;  2WAE A;  3V3S A;  3ZGA B;  5EVI D;  3S1Y A;  5CGS A;  1RCJ A;  5EE8 A;  3S22 A;  1MWR A;  5GLB A;  1ZC2 A;  1SKF A;  4HEF A;  1K56 A;  1RGY A;  4PPR A;  2ZM2 A;  1JWP A;  1H5X A;  3Q1F A;  4OQI A;  2V20 A;  2EXA A;  2ZMA A;  3MKF A;  4FH2 A;  5GLC A;  4QY5 A;  1DJB A;  3PBR A;  2VGJ A;  2P9V A;  2WZX A;  1ZG4 A;  4PM7 A;  4BD0 A;  5A92 A;  5A93 A;  3OPH A;  4QJG A;  4KZ4 A;  2ZD8 A;  4DKI A;  1KVM A;  3PTE A;  3OPR A;  4OPR A;  3RJU A;  2XQZ A;  3DWZ A;  4RYE A;  4YFM A;  3UE3 A;  2C6W B;  3VP2 A;  3WWX A;  4RVA A;  3OCL A;  3WS4 A;  3C5A A;  5FI2 A;  5FAT A;  1MY8 A;  1WE4 A;  2UWX A;  3QHY A;  1YMS A;  3HLF A;  4FH4 A;  3D4F A;  4KQQ A;  4X69 A;  1GHI A;  5M18 A;  3A3I A;  4KQR A;  1BTL A;  5DF8 A;  4GOG A;  4JKT A;  4OH0 A;  2IWD A;  4N9K A;  1W5D A;  2GDN A;  3NY4 A;  4JLF A;  4K0X A;  2EXB A;  2ZQ8 A;  4LCL A;  3RXX A;  1YT4 A;  2C5W B;  2ZC5 B;  4DDY A;  4GD8 A;  3M2K A;  3I7J A;  3LCE A;  1XA1 A;  1NYY A;  5FAP A;  4WYY A;  1SDN A;  1SCW A;  1JWZ A;  5CER A;  4Y7P A;  3G31 A;  4FSF A;  1GA0 A;  1S0W A;  2HPB A;  2WKH A;  3NCK A;  2VGK A;  5FI7 A;  5KMW A;  1TEM A;  4S2I A;  3UN7 A;  4S2O A;  3W4Q A;  1SDE A;  2IWB A;  4E3N A;  3WS1 A;  1K4F A;  1HZO A;  1YLW A;  4JXW A;  2XF3 A;  2HDR A;  3PBT A;  4D2O A;  2XK1 A;  2DCF A;  4DE2 A;  3AGE A;  4OOY A;  3IXG A;  4DRT A;  1ZG6 A;  2WAF A;  3SH7 A;  3UPO A;  1DY6 A;  3C7V A;  5HL1 A;  3PBQ A;  5E2H A;  2X02 A;  4ZJ3 A;  1KE4 A;  3FKW A;  5FSR A;  1N4O A;  3WRT A;  2ZM8 A;  2PU2 A;  3M2J A;  3ZVW A;  5FQI A;  1XA7 A;  4E3M A;  1Z6F A;  1H8Z A;  2ZC3 B;  2WGI A;  4E3O A;  4BLM A;  4GB7 A;  3HL9 A;  3EQV A;  2IWC A;  1EWZ A;  5EOE A;  4OLG A;  2G2W A;  3LY3 A;  4JPM A;  1YMX A;  3ZCZ A;  4JBF A;  4KZ8 A;  5GHZ A;  5GL9 A;  5CHU A;  4U0T A;  5JYP A;  5BOH A;  3A3F A;  4QHC A;  1BT5 A;  1ERQ A;  3AGF A;  1IYS A;  2Y2O A;  5FQJ A;  4R4S A;  3ZFZ A;  2WKI A;  4UA9 A;  3FZC A;  3PBS A;  3UY6 A;  3N6I A;  3VOZ A;  4B4X A;  4OPY A;  3MXR A;  3OPP A;  1IKI A;  5CXW A;  1G68 A;  3O87 A;  3TOI A;  3N8S A;  3IF6 A;  2JC7 A;  4PM6 A;  5KSH A;  2Y55 A;  4KG5 A;  1NZU A;  3SS4 A;  3FWL A;  5CEB A;  2HDQ A;  4KG6 A;  3IF6 C;  4OP8 A;  4OQG A;  2WGW B;  4X6T A;  2I72 A;  3GMW A;  5FDH A;  4Y0O A;  1DJC A;  4EV4 A;  1CEG A;  4U0X A;  5M1A A;  1BUE A;  4YIN A;  4OLD A;  4Q8I A;  1ZKJ A;  1FR6 A;  1XP4 A;  1U60 A;  1TVF A;  4EWF A;  2PU4 A;  5DF7 A;  2P74 A;  4LCM A;  3IWO A;  3PBO A;  4EQI A;  3Q82 A;  5GHX A;  4OOM A;  1WYC A;  4N1H A;  4HBU A;  3BFD A;  2P9V B;  1MKI A;  3QNB A;  2EX2 A;  4BL3 A;  4WMC A;  3Q7Z A;  5A90 A;  1FCO A;  3ZG5 A;  4S2L A;  4KZ5 A;  2XLN A;  4KG2 A;  1PZP A;  4E6X A;  4XUZ A;  2WYX A;  2A3U A;  3JYI A;  2Y59 A;  5HFO A;  2E8I A;  4DE0 A;  1CEF A;  3G35 A;  2Y2Q A;  3FV7 A;  1IEM A;  3GRJ A;  3BEB A;  5EPH A;  1LI9 A;  5F82 A;  4JXG A;  4P87 A;  3S4X A;  2WZZ A;  5G18 A;  2XD5 A;  3SS3 A;  5FAS A;  4NET A;  1FCN A;  1FSW A;  2HP5 A;  1L0F A;  3VSL A;  3ITA A;  1ESI A;  2J9P A;  5AQA A;  1XGJ A;  3HUN A;  4QY6 A;  4OKP A;  5KZH A;  2EFX A;  1XGI A;  3IH9 A;  2Z2M B;  2BLS A;  3V5M A;  4KZ9 A;  3VP4 A;  4C75 A;  1YLP A;  2ZC6 B;  3CZD A;  4RX3 A;  3GSG A;  2X01 A;  1K6S A;  1CI8 A;  1GHM A;  1TDL A;  2OSU A;  3G32 A;  2EX8 A;  3HUM A;  4S2N A;  3W4O A;  4EBN A;  5DTK A;  5CRF A;  4OOL A;  4R23 A;  3BRM A;  3VP1 A;  4PMA A;  1IYQ A;  3SS5 A;  3PAG A;  1L0G A;  4P85 A;  3G30 A;  4S2N C;  2H10 A;  4PM5 A;  1FCM A;  1BLH A;  2Z2L B;  2QZ6 A;  1QME A;  2XFT A;  3IQA A;  3Q7V B;  1ES5 A;  3G2Z A;  4HBT A;  4ZTK A;  5FI6 A;  5HX9 A;  4XUX A;  5HAI A;  3HLB A;  3W8K A;  3ZG0 A;  4LV1 A;  3Q81 A;  4K0W A;  3PAE A;  4BQM A;  1EI5 A;  4OP5 A;  4BJP A;  4X53 A;  2R9X A;  4N1X A;  3HLE A;  1VQQ A;  1NRF A;  2ZLY A;  4JXS A;  3LO7 A;  3CMZ A;  4UA6 A;  3Q7V A;  3ZG9 B;  1JVJ A;  4Y0T A;  3VP3 A;  4UAA A;  2Y2K A;  1K56 D;  1YLJ A;  5E43 A;  2R9W A;  1KE3 A;  3HLW A;  2WKE A;  5HAQ A;  1NYM A;  5FQQ A;  4KZ3 A;  4X56 A;  3VFH A;  3GV9 A;  3A3D A;  4XXR A;  1CI9 A;  3DTM A;  3BFC A;  4GKU A;  4OPQ A;  1YLZ A;  1JTG A;  5CTM A;  1H8Y A;  2HDS A;  3BFF A;  4GZB A;  4KZ7 A;  4OON A;  4DE1 A;  3UPN A;  3G2Y A;  2WK0 A;  4IED A;  3OZH A;  1E3U A;  4ZDX A;  5DTS A;  3P09 A;  4NK3 A;  1KGG A;  3EQU A;  3MZD A;  3DW0 A;  4LEN A;  3HLC A;  1BLP A;  3ZVT A;  4GNU A;  1I2W A;  4OQ0 A;  3CG5 A;  3RXW A;  4X68 A;  2QMI A;  3V50 A;  5HW3 A;  5A91 A;  3GR2 A;  5TGF A;  1E25 A;  1LI0 A;  1TDG A;  2Y2G A;  2XEP A;  2Y91 A;  1GCE A;  3GTC A;  1FOF A;  3TG9 A;  4X55 A;  1KGF A;  3IF6 B;  1PWD A;  2XDM A;  4ZAM A;  5L2F A;  2Y2J A;  4S2M A;  1ONG A;  1Y54 A;  2XH9 A;  2JCH A;  1K25 A;  2JBF A;  3BLS A;  3IWQ A;  3LY4 A;  5HAR A;  3WS2 A;  5CED A;  4BEN A;  3QNC A;  2FFY A;  5FAO A;  3C4P A;  2CC1 A;  2H0T A;  5AQ7 A;  1JTD A;  3GQZ A;  4ZJ1 A;  4CJN A;  1I5Q A;  5FQ9 A;  1XX2 A;  3IF5 A;  3WRZ A;  3WS0 A;  2J9O A;  1K4E A;  2HP6 A;  5D3O A;  2RCX A;  1O7E A;  4ZJ2 A;  3OPL A;  2G2U A;  3HLD A;  4LV2 A;  4QB8 A;  5AQB A;  1BLS A;  1W79 A;  4E3I A;  5GHY A;  1ES4 A;  1W7F A;  4KEN B;  4MBK A;  1K6R A;  3UDF A;  3NDE A;  3MXS A;  2EX9 A;  3P98 A;  1MBL A;  4Z9Q A;  1NZO A;  2ZQ9 A;  3ZNY A;  5GLA A;  4HES A;  5CGX A;  3HRE A;  4E3J A;  2ZQA A;  4O7D A;  3MZE A;  1BLC A;  3C7U A;  2HDU A;  1K54 A;  4JF5 A;  1W8Y A;  3B3X A;  4KZ6 A;  3VFF A;  1XKZ A;  1FQG A;  5FQK A;  1K54 C;  4QD4 A;  3ZHH A;  5HAP A;  4GN2 A;  1AXB A;  1HD8 A;  4N92 A;  2WGV A;  1YM1 A;  2ZM0 A;  2XFS A;  3VSK A;  4H8R A;  2JE5 A;  1YLY A;  5DVA A;  3UO9 A;  4KQO A;  1OME A;  3ZG8 B;  3GVB A;  1G6A A;  2PBY A;  3VP0 A;  3N8R A;  3IXH A;  3ISG A;  1GA9 A;  2H0Y A;  3OCN A;  4R4R A;  3V39 A;  2OLV A;  3ZG7 B;  4U3T A;  3BLM A;  4PM8 A;  3BFG A;  3ZNT A;  1M40 A;  4UHU A;  1ERO A;  2ZC7 A;  2Y2L A;  1IEL A;  1N9B A;  3NI9 A;  2DNS A;  4EBP A;  4DF6 A;  1PW8 A;  4UA7 A;  3BEC A;  4IBR A;  5CHJ A;  5FAQ A;  1BZA A;  3Q07 A;  1PWC A;  1ES2 A;  4LV3 A;  5J8X A;  1LLB A;  5JYO A;  4OVD A;  3VOY A;  2Q9N A;  3M6H A;  4IVK A;  1MWT A;  4JF6 A;  4PM9 A;  2EX6 A;  1IKG A;  1LL9 A;  2Y2N A;  2Y2H A;  1MXO A;  4FD8 A;  3NDG A;  1XPB A;  2FFF B;  1BUL A;  2BG1 A;  3SOI A;  4E3L A;  5KSC A;  1K55 A;  3UE0 A;  2Y4A A;  3IXD A;  3NBL A;  3HBR A;  4MEZ A;  3IHB A;  5AQ9 A;  1MWS A;  4R1G A;  4C3Q A;  1JWV A;  3MZF A;  5I94 A;  1K55 C;  2Y2P A;  4KZB A;  2XGN A;  2ZQC A;  3C4O A;  4S2K A;  4GD6 A;  5DTT A;  4WEJ A;  5CEC A;  1PYY A;  3A3E A;  2ZQ7 A;  3IHA A;  4MBH A;  4WMC D;  3AGD A;  4WZ5 A;  4KZA A;  4P6B A;  2XR0 A;  1RP5 A;  5E2G A;  1KGE A;  5FA7 A;  3DWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...