3RXWA

Kpc-2 carbapenemase in complex with psr3-226
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
b'TNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbepenem-hydrolyzing beta-lactamase KPC
publication title Crystal structures of KPC-2 {beta}-lactamase in complex with 3-nitrophenyl boronic acid and the penam sulfone PSR-3-226.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 97
structure length 264
sequence length 264
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3rxwA00
3Q1FA 4RA7A 5TR7A 1RP5A 5CHUA 4OOMA 2Y55A 1ZG6A 4OQHA 1DJCA 1LL5A 2P9VB 2ZC6B 2PU2A 5CTMA 1I5QA 2EXBA 2WADA 3PBQA 4UA7A 2HP9A 3LY3A 3OCNA 3VP0A 1M6KA 1VM1A 2X01A 1U60A 2Y2OA 4U3TA 3EQUA 3C4PA 2BLSA 4WM9A 4X6TA 4S2LA 1BLHA 1H8ZA 3CJMA 3QHYA 1KGGA 5E2HA 3UPNA 3OC2A 5CECA 3MKFA 3HBRA 2HDSA 4DXCA 2IWDA 4KZBA 1GA9A 1IYQA 1MWRA 2VGKA 3A3DA 4L0LA 4MEZA 4S2OA 4DDSA 3M2KA 1PWCA 3G2YA 4GDBA 1XX2A 2OV5A 3WRTA 1O07A 4E3JA 4E3MA 1YMXA 1L0GA 3GSGA 3W4QA 5FI6A 1J9MA 2QPNA 4JBFA 3UO9A 3VMAA 5EOEA 4QJGA 4JPMA 3M6HA 3IH8A 3HLBA 5AQBA 3OPPA 3ZG8B 3BLSA 1BLCA 1G68A 4MBKA 5CHJA 3OPHA 3MXSA 5A92A 1GHIA 2X71A 4N1HA 2ZQAA 1RCJA 2HP5A 2QMIA 2ZQCA 5DF8A 1EI5A 4QU3A 5EOOA 3UE0A 4MBFA 2X02A 2Y2NA 3SH8A 3VSLA 1KGFA 1ES5A 4OONA 3MZEA 3G2ZA 3TSGA 5EVID 3W8KA 1LLBA 3O88A 4YFMA 3G30A 2XF3A 3PAEA 4MLLA 2CC1A 2XFTA 2XD5A 3HL9A 5CGWA 3V5MA 4OQ0A 4OPRA 3A3IA 3W4PA 1FSWA 3HVFA 3M6BA 2Y2IA 4CPKA 3DTMA 2RL3A 3NI9A 1IKIA 3WS5A 2J9OA 5EVIA 4LCMA 4OOYA 4ZJ3A 3V3RA 3MZDA 4IVIA 1JTDA 1TVFA 5CRFA 3P98A 3GVBA 3GV9A 4P0MA 3NC8A 4PM9A 4OLGA 3UY6A 3BFCA 2WZXA 1YLZA 4E6WA 2GDNA 2Q9MA 3FYZA 1TEMA 1W7FA 3LEZA 5E2EA 2C6WB 1L2SA 2WGWA 5CERA 3NBLA 4X56A 5CXWA 4HBUA 1PW1A 2Z2MB 3PAGA 4JXWA 1CEGA 4Y0OA 3UNWA 2Y2MA 3HLGA 5CEBA 2PBYA 3GMWA 1LL9A 3O3VA 4U0TA 3ZVTA 1PWDA 2JBFA 1NY0A 2WKHA 2XLNA 3MKEA 1ES3A 2H0TA 2B5RA 2XDMA 2ZM2A 1XKZA 2Y2PA 1NYYA 4KQRA 3WWXA 1S0WA 4E3NA 1XP4A 3HLFA 4WYYA 4DE3A 5M18A 1FCNA 3IHAA 2WKEA 3MBZA 1KVMA 1FQGA 1L0FA 1PYYA 3BLMA 4R4RA 1IKGA 1HVBA 4EBLA 4PPRA 2WGIA 1W79A 4B4ZA 4P87A 3BFGA 3I7JA 3UN7A 4Y0TA 4DRTA 1LI9A 2ZC5B 1MBLA 3OZHA 3ZG5A 4LV3A 2Y2LA 3SH7A 3HLEA 2Y2JA 4GD6A 4BD1A 1YQSA 4LV2A 1NYMA 2P74A 2JCHA 2DNSA 4CJNA 3NDGA 3IHBA 3PTEA 5EECA 3SOIA 2XK1A 3G31A 4S2JA 3TG9A 2XH9A 4PM7A 2HDRA 2Y4AA 2R9XA 3HUOA 4K0XA 4GD8A 4D2OA 1YM1A 2Y91A 3ZVWA 1W8QA 4FCFA 4KG2A 3ZNYA 1RGZA 2ZMAA 3QNCA 3S1YA 1KDWA 1KE3A 2XQZA 1SKFA 4OP5A 1BTLA 3VP3A 1H5XA 3B3XA 3ZCZA 2H10A 3JYIA 2ZQ7A 3VOZA 3V39A 1ONHA 1E4DA 1N9BA 2ZM8A 3IF6B 4KZ4A 1XA1A 4KQOA 5FI7A 2PU4A 4R4SA 1IEMA 1MY8A 4GN2A 4S2NC 2FFFB 3N4IA 4KZ5A 2G2UA 2JC7A 3FZCA 3IWOA 2XR0A 3OCLA 4P85A 4X69A 5FQIA 3GRJA 2ZC3B 1SHVA 3C7VA 3PBOA 3W4OA 3CMZA 3SS3A 1ERQA 5E2FA 2P9VA 1YLJA 3OPLA 4UAAA 3RXWA 2Y2KA 5HAQA 4OPZA 4O7DA 1K54C 1GHPA 5FAQA 4E3IA 1HTZA 1MPLA 3UDXA 1O7EA 5CGXA 5F82A 1FCMA 1BUEA 1ES4A 2XGNA 4OH0A 5AQ7A 1ES2A 2H0YA 2Y2HA 4HESA 4M3KA 2J8YA 4X53A 3BECA 4JXVA 2Z2LB 3N8LA 3ZG7B 1KE0A 2ZQ8A 4Z9QA 5KSHA 5L2FA 1ERMA 4QY6A 2WAEA 3PBRA 5DVAA 5IHVA 1L0EA 4E6XA 4F94A 1PZPA 2EXAA 2IWBA 3UE3A 5M19A 4GDNA 4XUZA 4DF6A 1M40A 1FOFA 4BQMA 1SCWA 1WE4A 1PWGA 2UWXA 4QY5A 3BFDA 1XGJA 1MKIA 5FAPA 3PBNA 4R0QA 5EVLA 4X68A 3VP1A 4EUZA 4GNUA 1PI4A 4R1GA 3O87A 3G32A 3LO7A 4EWFA 1YT4A 2DCFA 4IEDA 4JF4A 4KZ7A 1JTGA 4LV1A 2WYXA 4U0XA 4UA9A 4S2MA 5FQ9A 3GR2A 1HD8A 3ZFZA 4ZJ1A 3UDIA 3N8RA 5TFQA 1SDEA 1WYBA 1I2SA 3NY4A 5HX9A 3IWQA 1MXOA 1ZC2A 2V1ZA 3TOIA 3V50A 3EQVA 5HAPA 4UA6A 5F1FA 3A3FA 4KENB 1DY6A 3IT9A 4PMAA 4R23A 5CTNA 3GTCA 5A91A 2XEPA 1K4EA 4EBNA 4EBPA 4C6YA 4GKUA 1BT5A 1CK3A 4Q8IA 1K38A 3HLDA 5DF7A 5GHYA 4DE0A 5A93A 4RVAA 3GQZA 2EX2A 3NDEA 1IYOA 4OLDA 1IYPA 2ZQDA 2WGVA 4KG5A 3ZGAB 3D4FA 4GZBA 1K6SA 2XD1A 3HREA 3IF6C 4S2NA 3ITAA 5FDHA 4S2IA 5M1AA 4DKIA 1ALQA 1K25A 5GLCA 5GHXA 3WS2A 2ZC4B 2WK0A 4BD0A 2C5WB 4WZ5C 3ZDJA 5HARA 1XGIA 1NZUA 4FD8A 1N4OA 3Q7ZA 4WEJA 1K54A 3M2JA 4DDYA 3SS5A 2HDQA 3MFDA 2I72A 5CEDA 5EE8A 1FR1A 1KGEA 5JYPA 1GCEA 2EFUA 2OSUA 3IF5A 5FI2A 4FSFA 4R3JA 3FWLA 2HP6A 1YLYA 4XXRA 2ZQ9A 1CI9A 2H5SA 3HUMA 3IH9A 1XA7A 2ZM0A 3AGDA 4JXGA 3S4XA 3Q7VB 3NCKA 4ZBEA 4RX2A 4KG6A 4OP8A 4KZ3A 1BZAA 1YLTA 5D3OA 3UDFA 1ZG4A 5DF9A 2XFSA 4BENA 1Y54A 3V3SA 4PM6A 5HFOA 2IWCA 1TDLA 2EFXA 1NZOA 3AGFA 3VSKA 5HL1A 1ESUA 2A49A 5FA7A 1JWPA 1JWVA 4A5RA 1XPBA 1K6RA 3FKWA 4YINA 4KZ6A 5FQMA 5FSRA 1TDGA 3DWKA 4S2PA 4Y7PA 3G34A 4GB7A 1C3BA 4KZ9A 1GA0A 4XUXA 4NK3A 3HLCA 3MXRA 4WMCD 1Q2QA 3DWZA 1GHMA 3HLWA 1BSGA 4EV4A 3NIAA 3E2LA 4KZAA 3RJUA 3G4PA 3BFEA 4PM8A 5I94A 1MWSA 4JF6A 2R9WA 1OMEA 3ZG0A 5GHZA 1L0DA 3BFFA 1K56D 2G2WA 5KSCA 5GLBA 5FASA 1DJBA 1KVLA 5FQJA 3Q81A 3SS4A 5GLDA 1PIOA 4WMCA 1JVJA 5BOHA 4HEFA 1K57C 1H8YA 3FKVA 1IYSA 1K55C 1YLWA 3N6IA 2ZD8A 1K4FA 3IF6A 4S2KA 2EX6A 5E43A 3IXDA 5DTKA 4N1XA 1I2WA 3CG5A 4E3LA 5KMWA 5TGFA 4IBXA 5U47A 3S22A 1K56A 3C5AA 2WAFA 4WZ5A 5KZHA 4DXBA 2E8IA 1KE4A 4KZ8A 3VOYA 4NETA 4WEKA 3OPRA 4FH4A 4P6BA 3ZG9B 1LHYA 2J9PA 4ID4A 3PBTA 1EWZA 3IXGA 3FV7A 1QMFA 5FQQA 1YMSA 4ZJ2A 4OPQA 3HUNA 3G35A 1W8YA 1NJ4A 1QMEA 1WYCA 1YLPA 1CEFA 3AGEA 2OLUA 1SDNA 4B4XA 4QD4A 2ZLYA 2Y2QA 3O86A 1IELA 3UPPA 4HBTA 1CI8A 5J8XA 4IBRA 5JYOA 5EVIB 3MZFA 2RCXA 3Q82A 1HZOA 3SH9A 5CGSA 2JE5A 4DE2A 4JLFA 1MWTA 1FCOA 1RGYA 4BL3A 3ITBA 2QZ6A 4K0WA 5GL9A 3ISGA 1NXYA 4FH2A 2ZC7A 1BLSA 2HDUA 1G6AA 3IQAA 3QNBA 1XXMA 2WKIA 2WGWB 5F83A 1VQQA 3N7WA 2WZZA 5AQ9A 4MNRA 2DRWA 4Y0UA 1LI0A 1KDSA 1ESIA 4ZAMA 5F1GA 1Z6FA 3UPOA 4OVDA 4WZ4A 1FR6A 3BRMA 5AQAA 5DTSA 1PZOA 4BL2A 3WRZA 3ZNTA 2A3UA 3A3EA 5CHMA 4RYEA 4JKTA 4WELA 3ZHHA 1E3UD 3CZDA 4RX3A 2V20A 3BYDA 2ZJ9A 3VP2A 4C75A 3IWIA 4N9LA 4MBHA 3IXHA 3P09A 3IXBA 1PI5A 4K91A 2Q9NA 1FSYA 3PBSA 5E2GA 4LENA 3N8SA 5EPHA 5G18A 4B88A 1K57A 1NRFA 4EQIA 3RXXA 3LCEA 3E2KA 1K55A 1EROA 4BLMA 4IVKA 1Q2PA 3A3JA 4DE1A 1DJAA 1E25A 1MWUA 1E3UA 5FAOA 4UHUA 4E3KA 3BM6A 3C4OA 2Y2GA 3LY4A 3UE1A 4QHCA 2J7VA 2OLVA 3BEBA 4ZTKA 1W5DA 2FFYA 4N92A 5HW3A 5EUAA 1PW8A 2VGJA 4ZDXA 1ONGA 2HPBA 4OKPA 3VP4A 3C7UA 1BLPA 3WS1A 4X55A 4OQIA 3Q07A 2EX9A 4QB8A 4H8RA 4WBGA 1BULA 1S6RA 5FQKA 4OQGA 2V2FF 4OOLA 5HAIA 2BG1A 5FATA 1ZKJA 4OPYA 4JXSA 4LV0A 5DTTA 4PM5A 1AXBA 2EX8A 4N9KA 3VFFA 5A90A 4BJPA 4E3OA 4GOGA 3Q7VA 5EVIC 4R3BA 3WS4A 3DW0A 3WS0A 2WUQA 5GLAA 3VFHA 2Y59A 4C3QA 4LCLA 4KQQA 4JF5A 1JWZA
chains in the Genus database with same CATH superfamily
5TR7A 3BQ8A 1LL5A 2HP9A 1P9RA 1VM1A 3FPVA 1CQAA 5F6AA 4WM9A 2YKFA 3UB5P 1BLHA 3CJMA 5E2HA 3UPNA 2HDSA 2KLIA 1GA9A 1MWRA 4S2OA 4DDSA 4E3JA 3G2YA 2W3HA 3GECA 1PNEA 3W4QA 3U4LP 4QJGA 4JPMA 1G68A 1FIKA 3MXSA 5HWTA 5HDSA 4NXBA 1RCJA 4CLCE 4MBFA 1EW0A 2Y2NA 5IT5A 1KGFA 4WL9A 3G2ZA 4JGPA 4JGQA 5EVID 3O88A 3G30A 3PAEA 3QP1A 4OQ0A 4OPRA 3LR0A 1FSWA 3MXQA 3S7OA 3E98A 3V67A 3HVFA 4CPKA 3DTMA 2KOIA 2J3TC 1VHMA 3WS5A 2J9OA 1TVFA 3T1RA 4P0MA 3T4LA 4PHTA 4EETB 4IUHA 3LICA 3SW1A 1CEGA 2Y2MA 3MFXA 3GMWA 3O3VA 2JBFA 3DBAA 1NY0A 2Q0OA 2H0TA 1NYYA 1FCNA 3IHAA 2WKEA 1KVMA 4R4RA 3BLMA 1IKGA 2XSSA 4EBLA 1GSWA 4P87A 1SZVA 4DRTA 5IS1A 4YNRA 2QKPA 4BBVA 4GD6A 4BD1A 1YKDA 2DNSA 4X25A 4CJNA 3SOIA 3D3OA 2Y4AA 3P01A 2R9XA 4K0XA 4GD8A 1TS6A 4PKYA 1W8QA 3ZNYA 2ZMAA 1KE3A 1SKFA 3KSIA 2VZWA 3ZCZA 2H10A 3DTEA 1P9WA 5FI7A 3D9YA 1MY8A 4AFIA 2PHYA 3N4IA 2V1AA 1LL8A 1V9ZA 1X0OA 3W4OA 2ZC3B 3H82A 3CMZA 4UAAA 2Y2KA 5HAQA 4OPZA 4O7DA 3MQOA 5AVEA 3UDXA 4KQDA 1BUEA 4EQ1A 2XGNA 4G3VA 2Y2HA 2VV6A 4JXVA 3N8LA 2ZQ8A 1ERMA 3PBRA 1LSVA 5M19A 4DF6A 4IJGA 4LRYC 1SCWA 1PWGA 2UWXA 5FAPA 3PBNA 2VV7A 5F69A 3KSFA 2VK3A 1SKOB 4EWFA 1YT4A 4KZ7A 3RTYA 4S2MA 1HD8A 3UDIA 3NY4A 3ZG8B 1I2SA 3V50A 1MXOA 5HAPA 1DY6A 2ACGA 3TRCA 5CX7A 3K2NA 3T4KA 5HL6A 1CK3A 5A93A 1IYOA 1IYPA 2ZQDA 2WGVA 3HJKA 3D4FA 3IF6C 4S2IA 3UMEA 5GHXA 4HH2A 3O5YA 5HARA 4FD8A 1N4OA 4WUJA 4DDYA 2HDQA 3MFDA 5EE8A 2LB5A 1KGEA 5JYPA 2KDKA 5HD3A 2XRNA 2OSUA 3IF5A 4MN5A 4FSFA 4R3JA 3FWLA 2H5SA 3HUMA 1XA7A 4JXGA 3S4XA 4LRXC 2VV8A 2HV1A 3G6OA 3QP6A 4KZ3A 1BZAA 4I39A 2WKRA 5DF9A 3K3DA 3MSHA 1NZOA 4ME4A 5FA7A 1JWVA 4A5RA 2W3FA 2V0UA 3DWKA 3G34A 4GB7A 1C3BA 4XUXA 2V1BA 4R6LA 2J80A 4WMCD 3HLWA 4EV4A 3E2LA 4PM8A 4IUKA 4MCWA 3ZG0A 2EWWA 1L0DA 3BFFA 2G2WA 2ZL1A 3KO6A 3ZQ5A 3SS4A 5FL3A 1PIOA 1F2KA 5AJGA 4GS9A 1YLWA 3N6IA 2W27A 2ZD8A 2EX6A 5E43A 2PYPA 1I2WA 3CG5A 4E3LA 4XT2A 4FTXA 4LPZA 5TGFA 3S22A 2VLGA 3C30A 3C5AA 4WZ5A 2NUTC 4DXBA 4KZ8A 5EM0A 4HH3A 1EWZA 3IXGA 5FQQA 2NUPC 5J7EA 1WYCA 2OLUA 4B4XA 1IELA 3UPPA 4HBTA 1XFQA 2JKTI 2RCXA 4ESPA 2GNXA 5CGSA 2JE5A 2FH5A 1RGYA 1D7EA 1S66L 2QZ6A 4K0WA 3ISGA 1TS7A 3IQAA 2WKIA 1VQQA 5KIZA 3D72A 3N7WA 1IOUA 2WZZA 1VB6A 1KDSA 1ESIA 3UPOA 4OVDA 2Y79A 5AQAA 2M7UA 5J3WA 3UE6A 4JKTA 3VP2A 4I3JA 3P09A 1PI5A 4NXGA 2Q9NA 1FSYA 4LRZE 3N8SA 2K2NA 1K57A 2VA0A 3E2KA 1EROA 4IVKA 1BYWA 1DJAA 1E25A 2GX5A 1E3UA 2O9AA 4DJ3A 3BJNA 2Y2GA 3LY4A 5HWWA 4QHCA 3BEBA 4ZTKA 1PW8A 3IBRA 4ZDXA 2INWA 2ZMVA 4BWIA 3VP4A 3C7UA 1BLPA 3T4QA 3WS1A 4X55A 4OQIA 3Q07A 2EX9A 4H8RA 3LI9A 5HAIA 4OQGA 2V2FF 4MN6A 1ZKJA 2EX8A 4N9KA 2IA2A 3LIFA 3VFFA 3L7HA 5EVIC 3VFHA 1WA9A 4JF5A 1JWZA 2PD8A 3IX4A 1RP5A 3H82B 2JHEA 3B47A 4OQHA 2ZC6B 1VETA 1PFLA 2EXBA 3PBQA 4UA7A 3OCNA 2PR5A 2BLSA 4X6TA 3QHYA 2EA9A 5CECA 2D02A 3MKFA 4DXCA 2IWDA 1IYQA 1XJ4A 1PWCA 3KX0X 2E8JA 3A0SA 1L0GA 4JBFA 3UO9A 3H7WB 1LT0A 5EOEA 3IH8A 3OPPA 5CHJA 1OTEA 3OPHA 1GHIA 3S7NA 3MJQA 2ZOHA 5EOOA 4QU3A 2VEAA 3VSLA 2MJ6A 1LLBA 2W0NA 4MLLA 3V5MA 4GJ4A 2V0WA 2Y2IA 3LGOA 2PRFA 4II7A 3NI9A 3BY9A 3CITA 3KSGA 3MZDA 4IVIA 4PM9A 1L3LA 3CUEC 2Q9MA 1N9NA 1VEUA 5E2EA 1L2SA 4NG2A 4HI4A 3UNWA 3HLGA 5CEBA 3LIDA 5HWVA 1PWDA 1N9OA 1G28A 4LFUA 1ES3A 2ZM2A 1XKZA 2Y2PA 1S0WA 4E3NA 1YAXA 3HLFA 4DE3A 2GZAA 3MBZA 5DFXA 4EERA 1CF0A 4B4ZA 4I5SA 4Y0TA 1LI9A 2ZC5B 1DRMA 2Y2LA 3HCYA 3SH7A 2Y2JA 1S4RA 3KYZA 2JCHA 1YPRA 5TBMA 4PM7A 2W1TA 3A0RA 2HDRA 4MMNA 1YM1A 3ZVWA 4FCFA 1XJ3A 3QNCA 1KDWA 2ZL1B 2XQZA 4OP5A 3VP3A 1H5XA 3JYIA 2ZQ7A 4GS9B 1ONHA 2ZM8A 2PU4A 4XT2B 2K31A 2G2UA 1OTIA 3FZCA 4P85A 5IU1A 3C7VA 1SHVA 3CWFA 5E2FA 2P9VA 1K54C 1O7EA 4QPRA 1ES4A 4NEED 4OH0A 5AQ7A 3PYPA 1ES2A 2B18A 2H0YA 4M3KA 3BECA 4Z9QA 4QY6A 4QWOA 2JKTM 2WAEA 5HSQA 4E6XA 4F94A 2IWBA 4DN0A 1M40A 2OOLA 4BQMA 4QY5A 1MKIA 4R0QA 1Z09A 4GNUA 1PI4A 2OAQ1 3FG8A 4BL3A 4IEDA 1JTGA 5FQ9A 2WYXA 3GR2A 5TFQA 3TOIA 1WYBA 1ZC2A 4UA6A 5F1FA 2JKFA 3EEAA 4KENB 4R23A 4YOFA 3GTCA 4MN7A 4Y17A 4C6YA 1BT5A 2FZ0A 4Q8IA 1F5MA 4DE0A 2EX2A 4OLDA 4KG5A 3ZGAB 3BY8A 2XD1A 4GZBA 3GDIA 4DKIA 4Y13A 4BD0A 2C5WB 4PKYG 4HJ3A 3EGXC 1NZUA 3QP5A 3Q7ZA 3M2JA 4GW9A 2I72A 3S7QA 1ACFA 1FR1A 2EFUA 2YKHA 1YLYA 4XXRA 1CI9A 1J3WA 3LR5A 3T50A 3IH9A 4CLCB 3RFBA 4RX2A 4KG6A 2O99A 5D3OA 2A2LA 4RQ9A 1ZG4A 2XFSA 1Y54A 1VETB 2IWCA 4EW7A 3VSKA 5HL1A 1JWPA 1XPBA 3P7NA 3LR4A 4KZ6A 5FQMA 3C2WA 3HLCA 1TF1A 2R9WA 1OMEA 3T4OA 4FUWA 3NECA 1K56D 1XJ6A 1S1ZA 5FASA 3Q81A 1JVJA 1H8YA 1K4FA 3IF6A 5KMWA 2O9BA 2QJ5A 5KZHA 2E8IA 3MQQA 4NETA 4WEKA 1W8YA 3H7WA 1G5UA 1YLPA 1SDNA 2Y2QA 2PDRA 3JPUA 5DJTA 4YWZA 3HJIA 3T1QB 3Q82A 4DE2A 1MWTA 3ULFA 1F9IA 1VEUB 1S1YA 2DRWA 1LI0A 5F1GA 1Z6FA 2JKRM 4WZ4A 3BRMA 4I3IA 5F68A 1DP8A 3WRZA 3ZNTA 2A3UA 3LIEA 3EWKA 4WELA 3ZHHA 3CZDA 4RX3A 2PR6A 3RH8B 2ZJ9A 3SZTA 4K08A 4MBHA 3T1XA 3CI6A 3T1SA 5E2GA 3W2ZA 1DP9A 1OJ5A 3LCEA 4BLMA 5FAOA 1MWUA 4UHUA 3FPWA 3EGDC 4G3WA 4F3LA 2J7VA 2OLVA 3E4QA 2R78A 5EUAA 5TBMB 1S67L 2W1TB 1ONGA 4OKPA 2OWHA 1T18A 4QB8A 3MR0A 5FQKA 4LV0A 4PM5A 4BJPA 4GCZA 4R3AA 3DW0A 2WUQA 5GLAA 4C3QA 5CHUA 4OOMA 1ZG6A 2P9VB 2PU2A 1I5QA 4O01A 3NOUC 2WADA 1W63Q 3LY3A 1TD5A 3VP0A 1M6KA 2Y2OA 4U3TA 2L1MA 4Y15A 3C4PA 4GLQA 2L0WA 1KGGA 3HBRA 4KZBA 3A3DA 4L0LA 1T1BA 2QYBA 4GDBA 3WRTA 1XX2A 5J4EA 4E3MA 4GHIB 5A8BA 3GSGA 3IX3A 1J9MA 2P08A 3M6HA 1BLCA 5A92A 2X71A 3ZYTA 4N1HA 2ZQAA 2QMIA 2HP5A 2ZQCA 5DF8A 1EI5A 1ES5A 4OONA 3MZEA 2V9AA 2XFTA 3A3IA 3LEQA 3W4PA 1UWPX 3UB8A 1YSQA 4WN5A 2RL3A 1OT9A 5EVIA 4OOYA 4ZJ3A 3V3RA 3QP8A 3GV9A 3NC8A 4OLGA 3BFCA 2WZXA 1T1AA 3OOVA 3F1NA 2CMNA 3LEZA 2H28A 4ZRRA 2WGWA 5CERA 4Y5FA 3NBLA 5CXWA 1PW1A 4Y0OA 1YSPA 3JVVA 2PBYA 3ZVTA 1IFQA 5L8MA 2O0YA 3VE4A 2WKHA 2XLNA 3MKEA 4KQRA 3WWXA 1GSVA 3FC7A 4WYYA 5M18A 3ICYA 2QHKA 1L0FA 1HVBA 2M1CA 2WGIA 1W79A 2P04A 1MBLA 3ZG5A 5HDDA 3H9WA 3HLEA 1FILA 1YQSA 2P74A 4CLCA 1OT6A 3NDGA 3OBFA 3PTEA 5EECA 2XK1A 3G31A 4R70A 3HUOA 4D2OA 2WKPA 3L9KA 4KG2A 4G3KA 1RGZA 3S1YA 5FEFA 1BTLA 3B3XA 1G6OA 3VOZA 1N9BA 4E04A 3IF6B 4KZ4A 1XA1A 4KQOA 4S2NC 1IEMA 3IWOA 3QP4A 4ETXA 2XR0A 3OCLA 1V9YA 1A0KA 5TJJA 4X69A 3GRJA 1ERQA 3LFVA 1YLJA 3OPLA 3RXWA 3KYEA 5FAQA 3R7WA 4E3IA 1MPLA 3LIAA 2W3EA 5F82A 1STZA 4HESA 4HIAA 2J8YA 5K5BA 2Z2LB 1N9LA 5L2FA 5G4YA 4UEYA 5DVAA 5IHVA 1PZPA 2EXAA 4GDNA 4XUZA 1LSXA 4MDZA 5EFWA 3UB9A 3C8CA 1KOUA 1WE4A 3BFDA 3VP1A 5EVLA 4X68A 4R1GA 2I9VA 4LV1A 4ZJ1A 4B88A 3IWQA 5I5LA 3EQVA 3IX8A 3IT9A 4ARZB 4PMAA 5A91A 5CTNA 2XEPA 1K4EA 4EBNA 3UB6A 3HLDA 5DF7A 2JKRI 3UB7A 3GQZA 1T19A 2PT7A 4HNBA 5FDHA 1K6SA 4Y2FA 5M1AA 3ITAA 5DFYA 1K25A 4F3LB 5GLCA 2ZC4B 5G4ZA 3BWLA 1K54A 4WEJA 4NXFA 1MC0A 4Q0IA 1W63M 4ETZA 1GCEA 2M7VA 5FI2A 2OWJA 2HP6A 2GJ3A 1HLUP 2ZQ9A 3TW8A 2ZMFA 1AWIA 2V8FA 4ZBEA 3MF0A 4OP8A 1K0KA 1NLYA 4BENA 5HFOA 2EFXA 3NOPC 2PYRA 2HF6A 5FSRA 1TDGA 4Y7PA 5EV0A 2XA7S 4P6ZS 4NK3A 2ZOIA 3MXRA 3DTIA 1Q2QA 3DWZA 1GHMA 1BSGA 4KZAA 3PR6A 5GHZA 5EM1A 1OTAA 3VV4A 5GLBA 1DJBA 1KVLA 3CPTA 4HHDA 4Z1WA 4HJ6A 4WMCA 5BOHA 4HEFA 3FKVA 1K55C 4NXEA 3IXDA 4N1XA 2JN7A 4HOIA 2HJEA 1KE4A 3VOYA 4FH4A 1LHYA 4ID4A 4GHIA 3MQ0A 1QMFA 4ZJ2A 3HUNA 3G35A 1NJ4A 2EWVA 1CEFA 3AGEA 5L10A 4QD4A 2O9CA 5J8XA 5EVIB 1NRJA 3DAVA 3MZFA 1HZOA 3LI8A 2UV0E 1S4SA 1FCOA 5GL9A 1NXYA 2ZC7A 2HDUA 3F1NB 3QNBA 1XXMA 2WGWB 4D60A 3EOIA 4Y0UA 2XROA 3T4SA 3VE3A 5DTSA 1JNUA 5CHMA 3A3EA 4RYEA 4DJ2A 1XFNA 1E3UD 2V20A 4N9LA 2AVXA 3IXHA 3IXBA 4K91A 4WF0A 3PBSA 4LENA 5EPHA 4EEUA 1NRFA 3PXPA 1Q2PA 3A3JA 4DE1A 3B33A 3C4OA 3UE1A 1CJFA 1W5DA 4Q0HA 4EXOA 5HW3A 2VGJA 4CLCD 2HPBA 4JGOA 3E0YA 1BULA 1S6RA 3T4TA 2B02A 2BG1A 5FATA 3PHYA 4I3AA 5A90A 4E3OA 3VOLA 4GOGA 3Q7VA 4R3BA 3WS0A 4LCLA 4HP9A 3Q1FA 4RA7A 3CAXA 2J3WA 2Y55A 2ZBBA 1DJCA 5CTMA 3R7WB 2X01A 1U60A 3EQUA 2VGLS 4S2LA 1H8ZA 5C5KA 1UGUA 3OC2A 2HGVA 3E4PA 2VGKA 4MEZA 3QP2A 2P7JA 3M2KA 2OV5A 1O07A 1YMXA 3BQAA 5FI6A 2QPNA 3VMAA 2PD7A 3HLBA 2WKQA 5AQBA 3BLSA 2D01A 4MBKA 1UWNX 5HD5A 2PAVP 3DTKA 3UE0A 2K7SA 3SH8A 2X02A 3NJAA 5EVEA 4R38A 3NOTC 3TSGA 3W8KA 4YFMA 3UMDA 2XF3A 2CC1A 3HL9A 2XD5A 5CGWA 1P0ZA 2V8CA 3M6BA 3TJZC 1IKIA 1D06A 2QWSA 1ZTUA 4LGWA 2A24B 4LCMA 2JKGA 5CRFA 1JTDA 4EU0A 3P98A 3GVBA 3F1PA 1MKMA 3F1OA 3UY6A 1YLZA 4E6WA 2GDNA 3FYZA 1TEMA 1W7FA 4ARZA 2C6WB 4EEPA 4X56A 4HBUA 2Z2MB 1NLZA 3PAGA 4JXWA 4B93A 3IBJA 1P97A 3U2AA 2XA7M 4P6ZM 4HY8A 4HJ4A 1LL9A 4U0TA 4H6JA 3NULA 2XDMA 2B5RA 3K3CA 1XJ2A 1XP4A 2HJ9C 1FQGA 1PYYA 2B95A 2QJ7A 3NHQA 4PPRA 3BFGA 3I7JA 3UN7A 3OZHA 3BW6A 4LV3A 3JVUA 1DP6A 1GSXA 4LV2A 1NYMA 1NWZA 1ODVA 2BASA 3IHBA 4L9GA 2J3TD 4S2JA 3TG9A 2XH9A 3IS2A 4BMWA 2Y91A 4KUOA 5HDCA 2W3GA 3CPTB 3V39A 3LYXA 1E4DA 3S7PA 5DJUA 4R4SA 4GN2A 2FFFB 4O8GA 4KZ5A 1D1JA 2JC7A 2L4RA 5FQIA 3PBOA 2Z6DA 3SS3A 3A0VA 1GHPA 1H3QA 1HTZA 5CGXA 1FCMA 3LR3A 4X53A 3ZG7B 1LSWA 1KE0A 5KSHA 4UQIS 4L9FA 5HPFA 1L0EA 3UE3A 2VJWA 1OJGA 1FOFA 5HPIA 5DKLA 1XGJA 4EUZA 2W3DA 5FDSA 3O87A 3G32A 3LO7A 1OTBA 2DCFA 4U0XA 4JF4A 4UA9A 4DMZA 3ZFZA 3N8RA 1SDEA 5HX9A 5FEGA 2V1ZA 3A3FA 4EBPA 4GKUA 2LB9A 1K38A 5GHYA 4RVAA 3NDEA 3R4KA 3CHWP 3HREA 4S2NA 2VX8A 1ALQA 3WS2A 2WK0A 4WZ5C 3ZDJA 1XGIA 1Y4OA 3SS5A 3EEHA 4IHQA 5CEDA 3C38A 2VGLM 2G7UA 3MS6A 4X1MA 4B9OA 2ZM0A 3AGDA 4WLAA 3Q7VB 3NCKA 4CQHA 1YLTA 2Y8HA 4Q0JA 3UDFA 3V3SA 4FOFA 4PM6A 1TDLA 3AGFA 1ESUA 2A49A 4Y3IA 1K6RA 5AVFA 3FKWA 4YINA 3T12B 4S2PA 4KZ9A 1GA0A 4HQAA 3NIAA 3RJUA 3G4PA 3BFEA 5I94A 1MWSA 4JF6A 3CUEA 3T4JA 3E4OA 3KSHA 5KSCA 4JGRA 1TS8A 2VKSA 5FQJA 5GLDA 1H0MA 1PRQA 1K57C 4L9EA 1IYSA 2KX6A 4S2KA 5DTKA 4IBXA 5U47A 1K56A 2WAFA 1OPXA 4O0PA 3OPRA 4P6BA 3ZG9B 2J9PA 1F98A 3PBTA 3FV7A 1YMSA 4OPQA 2HZ5A 1QMEA 2OAP1 2ZLYA 1TS0A 3O86A 1CI8A 3B42A 4IBRA 4NKPA 5JYOA 4CLCC 5HZHA 2BTFP 3SH9A 1Y28A 4JLFA 3F1PB 2DMWA 3F1OB 3ITBA 5L09A 4FH2A 4M4XA 1BLSA 1G6AA 4I38A 5F83A 1MZUA 5AQ9A 5L07A 4MNRA 4ZAMA 5MC7A 2W1RA 1FR6A 1SKOA 1T1CA 4H6JB 4BBUA 2A24A 1PZOA 4BBTA 4BL2A 5LBRA 3CLOA 4KUKA 5F5YA 3BYDA 4C75A 3IWIA 1ZHHB 1OTDA 1H8MA 5G18A 4EQIA 3RXXA 1K55A 3LUQA 4E3KA 3BM6A 4X1LA 2FFYA 4N92A 4PAUA 3TE8A 3IS2B 5DKKA 4EESA 4EUVA 2PBDP 3KYQA 3LIBA 4WBGA 3MMHA 4OOLA 4OPYA 4JXSA 5DTTA 1AXBA 4UQIM 3WS4A 4LLOB 2Y59A 4KQQA 2Z6CA 4HP4A 3OLOA
chains in the Genus database with same CATH topology
3Q1FA 4RA7A 5TR7A 1RP5A 5CHUA 4OOMA 2Y55A 1ZG6A 4OQHA 1DJCA 1LL5A 2P9VB 2ZC6B 2PU2A 5CTMA 1I5QA 2EXBA 2WADA 3PBQA 4UA7A 2HP9A 3LY3A 3OCNA 3VP0A 1M6KA 1VM1A 2X01A 1U60A 2Y2OA 4U3TA 3EQUA 3C4PA 2BLSA 4WM9A 4X6TA 4S2LA 1BLHA 1H8ZA 3CJMA 3QHYA 1KGGA 5E2HA 3UPNA 3OC2A 5CECA 3MKFA 3HBRA 2HDSA 4DXCA 2IWDA 4KZBA 1GA9A 1IYQA 1MWRA 2VGKA 3A3DA 4L0LA 4MEZA 4S2OA 4DDSA 3M2KA 1PWCA 3G2YA 4GDBA 1XX2A 2OV5A 3WRTA 1O07A 4E3JA 4E3MA 1YMXA 1L0GA 3GSGA 3W4QA 5FI6A 1J9MA 2QPNA 4JBFA 3UO9A 3VMAA 5EOEA 4QJGA 4JPMA 3M6HA 3IH8A 3HLBA 5AQBA 3OPPA 3ZG8B 3BLSA 1BLCA 1G68A 4MBKA 5CHJA 3OPHA 3MXSA 5A92A 1GHIA 2X71A 4N1HA 2ZQAA 1RCJA 2HP5A 2QMIA 2ZQCA 5DF8A 1EI5A 4QU3A 5EOOA 3UE0A 4MBFA 2X02A 2Y2NA 3SH8A 3VSLA 1KGFA 1ES5A 4OONA 3MZEA 3G2ZA 3TSGA 5EVID 3W8KA 1LLBA 3O88A 4YFMA 3G30A 2XF3A 3PAEA 4MLLA 2CC1A 2XFTA 2XD5A 3HL9A 5CGWA 3V5MA 4OQ0A 4OPRA 3A3IA 3W4PA 1FSWA 3HVFA 3M6BA 2Y2IA 4CPKA 3DTMA 2RL3A 3NI9A 1IKIA 3WS5A 2J9OA 5EVIA 4LCMA 4OOYA 4ZJ3A 3V3RA 3MZDA 4IVIA 1JTDA 1TVFA 5CRFA 3P98A 3GVBA 3GV9A 4P0MA 3NC8A 4PM9A 4OLGA 3UY6A 3BFCA 2WZXA 1YLZA 4E6WA 2GDNA 2Q9MA 3FYZA 1TEMA 1W7FA 3LEZA 5E2EA 2C6WB 1L2SA 2WGWA 5CERA 3NBLA 4X56A 5CXWA 4HBUA 1PW1A 2Z2MB 3PAGA 4JXWA 1CEGA 4Y0OA 3UNWA 2Y2MA 3HLGA 5CEBA 2PBYA 3GMWA 1LL9A 3O3VA 4U0TA 3ZVTA 1PWDA 2JBFA 1NY0A 2WKHA 2XLNA 3MKEA 1ES3A 2H0TA 2B5RA 2XDMA 2ZM2A 1XKZA 2Y2PA 1NYYA 4KQRA 3WWXA 1S0WA 4E3NA 1XP4A 3HLFA 4WYYA 4DE3A 5M18A 1FCNA 3IHAA 2WKEA 3MBZA 1KVMA 1FQGA 1L0FA 1PYYA 3BLMA 4R4RA 1IKGA 1HVBA 4EBLA 4PPRA 2WGIA 1W79A 4B4ZA 4P87A 3BFGA 3I7JA 3UN7A 4Y0TA 4DRTA 1LI9A 2ZC5B 1MBLA 3OZHA 3ZG5A 4LV3A 2Y2LA 3SH7A 3HLEA 2Y2JA 4GD6A 4BD1A 1YQSA 4LV2A 1NYMA 2P74A 2JCHA 2DNSA 4CJNA 3NDGA 3IHBA 3PTEA 5EECA 3SOIA 2XK1A 3G31A 4S2JA 3TG9A 2XH9A 4PM7A 2HDRA 2Y4AA 2R9XA 3HUOA 4K0XA 4GD8A 4D2OA 1YM1A 2Y91A 3ZVWA 1W8QA 4FCFA 4KG2A 3ZNYA 1RGZA 2ZMAA 3QNCA 3S1YA 1KDWA 1KE3A 2XQZA 1SKFA 4OP5A 1BTLA 3VP3A 1H5XA 3B3XA 3ZCZA 2H10A 3JYIA 2ZQ7A 3VOZA 3V39A 1ONHA 1E4DA 1N9BA 2ZM8A 3IF6B 4KZ4A 1XA1A 4KQOA 5FI7A 2PU4A 4R4SA 1IEMA 1MY8A 4GN2A 4S2NC 2FFFB 3N4IA 4KZ5A 2G2UA 2JC7A 3FZCA 3IWOA 2XR0A 3OCLA 4P85A 4X69A 5FQIA 3GRJA 2ZC3B 1SHVA 3C7VA 3PBOA 3W4OA 3CMZA 3SS3A 1ERQA 5E2FA 2P9VA 1YLJA 3OPLA 4UAAA 3RXWA 2Y2KA 5HAQA 4OPZA 4O7DA 1K54C 1GHPA 5FAQA 4E3IA 1HTZA 1MPLA 3UDXA 1O7EA 5CGXA 5F82A 1FCMA 1BUEA 1ES4A 2XGNA 4OH0A 5AQ7A 1ES2A 2H0YA 2Y2HA 4HESA 4M3KA 2J8YA 4X53A 3BECA 4JXVA 2Z2LB 3N8LA 3ZG7B 1KE0A 2ZQ8A 4Z9QA 5KSHA 5L2FA 1ERMA 4QY6A 2WAEA 3PBRA 5DVAA 5IHVA 1L0EA 4E6XA 4F94A 1PZPA 2EXAA 2IWBA 3UE3A 5M19A 4GDNA 4XUZA 4DF6A 1M40A 1FOFA 4BQMA 1SCWA 1WE4A 1PWGA 2UWXA 4QY5A 3BFDA 1XGJA 1MKIA 5FAPA 3PBNA 4R0QA 5EVLA 4X68A 3VP1A 4EUZA 4GNUA 1PI4A 4R1GA 3O87A 3G32A 3LO7A 4EWFA 1YT4A 2DCFA 4IEDA 4JF4A 4KZ7A 1JTGA 4LV1A 2WYXA 4U0XA 4UA9A 4S2MA 5FQ9A 3GR2A 1HD8A 3ZFZA 4ZJ1A 3UDIA 3N8RA 5TFQA 1SDEA 1WYBA 1I2SA 3NY4A 5HX9A 3IWQA 1MXOA 1ZC2A 2V1ZA 3TOIA 3V50A 3EQVA 5HAPA 4UA6A 5F1FA 3A3FA 4KENB 1DY6A 3IT9A 4PMAA 4R23A 5CTNA 3GTCA 5A91A 2XEPA 1K4EA 4EBNA 4EBPA 4C6YA 4GKUA 1BT5A 1CK3A 4Q8IA 1K38A 3HLDA 5DF7A 5GHYA 4DE0A 5A93A 4RVAA 3GQZA 2EX2A 3NDEA 1IYOA 4OLDA 1IYPA 2ZQDA 2WGVA 4KG5A 3ZGAB 3D4FA 4GZBA 1K6SA 2XD1A 3HREA 3IF6C 4S2NA 3ITAA 5FDHA 4S2IA 5M1AA 4DKIA 1ALQA 1K25A 5GLCA 5GHXA 3WS2A 2ZC4B 2WK0A 4BD0A 2C5WB 4WZ5C 3ZDJA 5HARA 1XGIA 1NZUA 4FD8A 1N4OA 3Q7ZA 4WEJA 1K54A 3M2JA 4DDYA 3SS5A 2HDQA 3MFDA 2I72A 5CEDA 5EE8A 1FR1A 1KGEA 5JYPA 1GCEA 2EFUA 2OSUA 3IF5A 5FI2A 4FSFA 4R3JA 3FWLA 2HP6A 1YLYA 4XXRA 2ZQ9A 1CI9A 2H5SA 3HUMA 3IH9A 1XA7A 2ZM0A 3AGDA 4JXGA 3S4XA 3Q7VB 3NCKA 4ZBEA 4RX2A 4KG6A 4OP8A 4KZ3A 1BZAA 1YLTA 5D3OA 3UDFA 1ZG4A 5DF9A 2XFSA 4BENA 1Y54A 3V3SA 4PM6A 5HFOA 2IWCA 1TDLA 2EFXA 1NZOA 3AGFA 3VSKA 5HL1A 1ESUA 2A49A 5FA7A 1JWPA 1JWVA 4A5RA 1XPBA 1K6RA 3FKWA 4YINA 4KZ6A 5FQMA 5FSRA 1TDGA 3DWKA 4S2PA 4Y7PA 3G34A 4GB7A 1C3BA 4KZ9A 1GA0A 4XUXA 4NK3A 3HLCA 3MXRA 4WMCD 1Q2QA 3DWZA 1GHMA 3HLWA 1BSGA 4EV4A 3NIAA 3E2LA 4KZAA 3RJUA 3G4PA 3BFEA 4PM8A 5I94A 1MWSA 4JF6A 2R9WA 1OMEA 3ZG0A 5GHZA 1L0DA 3BFFA 1K56D 2G2WA 5KSCA 5GLBA 5FASA 1DJBA 1KVLA 5FQJA 3Q81A 3SS4A 5GLDA 1PIOA 4WMCA 1JVJA 5BOHA 4HEFA 1K57C 1H8YA 3FKVA 1IYSA 1K55C 1YLWA 3N6IA 2ZD8A 1K4FA 3IF6A 4S2KA 2EX6A 5E43A 3IXDA 5DTKA 4N1XA 1I2WA 3CG5A 4E3LA 5KMWA 5TGFA 4IBXA 5U47A 3S22A 1K56A 3C5AA 2WAFA 4WZ5A 5KZHA 4DXBA 2E8IA 1KE4A 4KZ8A 3VOYA 4NETA 4WEKA 3OPRA 4FH4A 4P6BA 3ZG9B 1LHYA 2J9PA 4ID4A 3PBTA 1EWZA 3IXGA 3FV7A 1QMFA 5FQQA 1YMSA 4ZJ2A 4OPQA 3HUNA 3G35A 1W8YA 1NJ4A 1QMEA 1WYCA 1YLPA 1CEFA 3AGEA 2OLUA 1SDNA 4B4XA 4QD4A 2ZLYA 2Y2QA 3O86A 1IELA 3UPPA 4HBTA 1CI8A 5J8XA 4IBRA 5JYOA 5EVIB 3MZFA 2RCXA 3Q82A 1HZOA 3SH9A 5CGSA 2JE5A 4DE2A 4JLFA 1MWTA 1FCOA 1RGYA 4BL3A 3ITBA 2QZ6A 4K0WA 5GL9A 3ISGA 1NXYA 4FH2A 2ZC7A 1BLSA 2HDUA 1G6AA 3IQAA 3QNBA 1XXMA 2WKIA 2WGWB 5F83A 1VQQA 3N7WA 2WZZA 5AQ9A 4MNRA 2DRWA 4Y0UA 1LI0A 1KDSA 1ESIA 4ZAMA 5F1GA 1Z6FA 3UPOA 4OVDA 4WZ4A 1FR6A 3BRMA 5AQAA 5DTSA 1PZOA 4BL2A 3WRZA 3ZNTA 2A3UA 3A3EA 5CHMA 4RYEA 4JKTA 4WELA 3ZHHA 1E3UD 3CZDA 4RX3A 2V20A 3BYDA 2ZJ9A 3VP2A 4C75A 3IWIA 4N9LA 4MBHA 3IXHA 3P09A 3IXBA 1PI5A 4K91A 2Q9NA 1FSYA 3PBSA 5E2GA 4LENA 3N8SA 5EPHA 5G18A 4B88A 1K57A 1NRFA 4EQIA 3RXXA 3LCEA 3E2KA 1K55A 1EROA 4BLMA 4IVKA 1Q2PA 3A3JA 4DE1A 1DJAA 1E25A 1MWUA 1E3UA 5FAOA 4UHUA 4E3KA 3BM6A 3C4OA 2Y2GA 3LY4A 3UE1A 4QHCA 2J7VA 2OLVA 3BEBA 4ZTKA 1W5DA 2FFYA 4N92A 5HW3A 5EUAA 1PW8A 2VGJA 4ZDXA 1ONGA 2HPBA 4OKPA 3VP4A 3C7UA 1BLPA 3WS1A 4X55A 4OQIA 3Q07A 2EX9A 4QB8A 4H8RA 4WBGA 1BULA 1S6RA 5FQKA 4OQGA 2V2FF 4OOLA 5HAIA 2BG1A 5FATA 1ZKJA 4OPYA 4JXSA 4LV0A 5DTTA 4PM5A 1AXBA 2EX8A 4N9KA 3VFFA 5A90A 4BJPA 4E3OA 4GOGA 3Q7VA 5EVIC 4R3BA 3WS4A 3DW0A 3WS0A 2WUQA 5GLAA 3VFHA 2Y59A 4C3QA 4LCLA 4KQQA 4JF5A 1JWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q1F A;  4RA7 A;  5TR7 A;  1RP5 A;  5CHU A;  4OOM A;  2Y55 A;  1ZG6 A;  4OQH A;  1DJC A;  1LL5 A;  2P9V B;  2ZC6 B;  2PU2 A;  5CTM A;  1I5Q A;  2EXB A;  2WAD A;  3PBQ A;  4UA7 A;  2HP9 A;  3LY3 A;  3OCN A;  3VP0 A;  1M6K A;  1VM1 A;  2X01 A;  1U60 A;  2Y2O A;  4U3T A;  3EQU A;  3C4P A;  2BLS A;  4WM9 A;  4X6T A;  4S2L A;  1BLH A;  1H8Z A;  3CJM A;  3QHY A;  1KGG A;  5E2H A;  3UPN A;  3OC2 A;  5CEC A;  3MKF A;  3HBR A;  2HDS A;  4DXC A;  2IWD A;  4KZB A;  1GA9 A;  1IYQ A;  1MWR A;  2VGK A;  3A3D A;  4L0L A;  4MEZ A;  4S2O A;  4DDS A;  3M2K A;  1PWC A;  3G2Y A;  4GDB A;  1XX2 A;  2OV5 A;  3WRT A;  1O07 A;  4E3J A;  4E3M A;  1YMX A;  1L0G A;  3GSG A;  3W4Q A;  5FI6 A;  1J9M A;  2QPN A;  4JBF A;  3UO9 A;  3VMA A;  5EOE A;  4QJG A;  4JPM A;  3M6H A;  3IH8 A;  3HLB A;  5AQB A;  3OPP A;  3ZG8 B;  3BLS A;  1BLC A;  1G68 A;  4MBK A;  5CHJ A;  3OPH A;  3MXS A;  5A92 A;  1GHI A;  2X71 A;  4N1H A;  2ZQA A;  1RCJ A;  2HP5 A;  2QMI A;  2ZQC A;  5DF8 A;  1EI5 A;  4QU3 A;  5EOO A;  3UE0 A;  4MBF A;  2X02 A;  2Y2N A;  3SH8 A;  3VSL A;  1KGF A;  1ES5 A;  4OON A;  3MZE A;  3G2Z A;  3TSG A;  5EVI D;  3W8K A;  1LLB A;  3O88 A;  4YFM A;  3G30 A;  2XF3 A;  3PAE A;  4MLL A;  2CC1 A;  2XFT A;  2XD5 A;  3HL9 A;  5CGW A;  3V5M A;  4OQ0 A;  4OPR A;  3A3I A;  3W4P A;  1FSW A;  3HVF A;  3M6B A;  2Y2I A;  4CPK A;  3DTM A;  2RL3 A;  3NI9 A;  1IKI A;  3WS5 A;  2J9O A;  5EVI A;  4LCM A;  4OOY A;  4ZJ3 A;  3V3R A;  3MZD A;  4IVI A;  1JTD A;  1TVF A;  5CRF A;  3P98 A;  3GVB A;  3GV9 A;  4P0M A;  3NC8 A;  4PM9 A;  4OLG A;  3UY6 A;  3BFC A;  2WZX A;  1YLZ A;  4E6W A;  2GDN A;  2Q9M A;  3FYZ A;  1TEM A;  1W7F A;  3LEZ A;  5E2E A;  2C6W B;  1L2S A;  2WGW A;  5CER A;  3NBL A;  4X56 A;  5CXW A;  4HBU A;  1PW1 A;  2Z2M B;  3PAG A;  4JXW A;  1CEG A;  4Y0O A;  3UNW A;  2Y2M A;  3HLG A;  5CEB A;  2PBY A;  3GMW A;  1LL9 A;  3O3V A;  4U0T A;  3ZVT A;  1PWD A;  2JBF A;  1NY0 A;  2WKH A;  2XLN A;  3MKE A;  1ES3 A;  2H0T A;  2B5R A;  2XDM A;  2ZM2 A;  1XKZ A;  2Y2P A;  1NYY A;  4KQR A;  3WWX A;  1S0W A;  4E3N A;  1XP4 A;  3HLF A;  4WYY A;  4DE3 A;  5M18 A;  1FCN A;  3IHA A;  2WKE A;  3MBZ A;  1KVM A;  1FQG A;  1L0F A;  1PYY A;  3BLM A;  4R4R A;  1IKG A;  1HVB A;  4EBL A;  4PPR A;  2WGI A;  1W79 A;  4B4Z A;  4P87 A;  3BFG A;  3I7J A;  3UN7 A;  4Y0T A;  4DRT A;  1LI9 A;  2ZC5 B;  1MBL A;  3OZH A;  3ZG5 A;  4LV3 A;  2Y2L A;  3SH7 A;  3HLE A;  2Y2J A;  4GD6 A;  4BD1 A;  1YQS A;  4LV2 A;  1NYM A;  2P74 A;  2JCH A;  2DNS A;  4CJN A;  3NDG A;  3IHB A;  3PTE A;  5EEC A;  3SOI A;  2XK1 A;  3G31 A;  4S2J A;  3TG9 A;  2XH9 A;  4PM7 A;  2HDR A;  2Y4A A;  2R9X A;  3HUO A;  4K0X A;  4GD8 A;  4D2O A;  1YM1 A;  2Y91 A;  3ZVW A;  1W8Q A;  4FCF A;  4KG2 A;  3ZNY A;  1RGZ A;  2ZMA A;  3QNC A;  3S1Y A;  1KDW A;  1KE3 A;  2XQZ A;  1SKF A;  4OP5 A;  1BTL A;  3VP3 A;  1H5X A;  3B3X A;  3ZCZ A;  2H10 A;  3JYI A;  2ZQ7 A;  3VOZ A;  3V39 A;  1ONH A;  1E4D A;  1N9B A;  2ZM8 A;  3IF6 B;  4KZ4 A;  1XA1 A;  4KQO A;  5FI7 A;  2PU4 A;  4R4S A;  1IEM A;  1MY8 A;  4GN2 A;  4S2N C;  2FFF B;  3N4I A;  4KZ5 A;  2G2U A;  2JC7 A;  3FZC A;  3IWO A;  2XR0 A;  3OCL A;  4P85 A;  4X69 A;  5FQI A;  3GRJ A;  2ZC3 B;  1SHV A;  3C7V A;  3PBO A;  3W4O A;  3CMZ A;  3SS3 A;  1ERQ A;  5E2F A;  2P9V A;  1YLJ A;  3OPL A;  4UAA A;  3RXW A;  2Y2K A;  5HAQ A;  4OPZ A;  4O7D A;  1K54 C;  1GHP A;  5FAQ A;  4E3I A;  1HTZ A;  1MPL A;  3UDX A;  1O7E A;  5CGX A;  5F82 A;  1FCM A;  1BUE A;  1ES4 A;  2XGN A;  4OH0 A;  5AQ7 A;  1ES2 A;  2H0Y A;  2Y2H A;  4HES A;  4M3K A;  2J8Y A;  4X53 A;  3BEC A;  4JXV A;  2Z2L B;  3N8L A;  3ZG7 B;  1KE0 A;  2ZQ8 A;  4Z9Q A;  5KSH A;  5L2F A;  1ERM A;  4QY6 A;  2WAE A;  3PBR A;  5DVA A;  5IHV A;  1L0E A;  4E6X A;  4F94 A;  1PZP A;  2EXA A;  2IWB A;  3UE3 A;  5M19 A;  4GDN A;  4XUZ A;  4DF6 A;  1M40 A;  1FOF A;  4BQM A;  1SCW A;  1WE4 A;  1PWG A;  2UWX A;  4QY5 A;  3BFD A;  1XGJ A;  1MKI A;  5FAP A;  3PBN A;  4R0Q A;  5EVL A;  4X68 A;  3VP1 A;  4EUZ A;  4GNU A;  1PI4 A;  4R1G A;  3O87 A;  3G32 A;  3LO7 A;  4EWF A;  1YT4 A;  2DCF A;  4IED A;  4JF4 A;  4KZ7 A;  1JTG A;  4LV1 A;  2WYX A;  4U0X A;  4UA9 A;  4S2M A;  5FQ9 A;  3GR2 A;  1HD8 A;  3ZFZ A;  4ZJ1 A;  3UDI A;  3N8R A;  5TFQ A;  1SDE A;  1WYB A;  1I2S A;  3NY4 A;  5HX9 A;  3IWQ A;  1MXO A;  1ZC2 A;  2V1Z A;  3TOI A;  3V50 A;  3EQV A;  5HAP A;  4UA6 A;  5F1F A;  3A3F A;  4KEN B;  1DY6 A;  3IT9 A;  4PMA A;  4R23 A;  5CTN A;  3GTC A;  5A91 A;  2XEP A;  1K4E A;  4EBN A;  4EBP A;  4C6Y A;  4GKU A;  1BT5 A;  1CK3 A;  4Q8I A;  1K38 A;  3HLD A;  5DF7 A;  5GHY A;  4DE0 A;  5A93 A;  4RVA A;  3GQZ A;  2EX2 A;  3NDE A;  1IYO A;  4OLD A;  1IYP A;  2ZQD A;  2WGV A;  4KG5 A;  3ZGA B;  3D4F A;  4GZB A;  1K6S A;  2XD1 A;  3HRE A;  3IF6 C;  4S2N A;  3ITA A;  5FDH A;  4S2I A;  5M1A A;  4DKI A;  1ALQ A;  1K25 A;  5GLC A;  5GHX A;  3WS2 A;  2ZC4 B;  2WK0 A;  4BD0 A;  2C5W B;  4WZ5 C;  3ZDJ A;  5HAR A;  1XGI A;  1NZU A;  4FD8 A;  1N4O A;  3Q7Z A;  4WEJ A;  1K54 A;  3M2J A;  4DDY A;  3SS5 A;  2HDQ A;  3MFD A;  2I72 A;  5CED A;  5EE8 A;  1FR1 A;  1KGE A;  5JYP A;  1GCE A;  2EFU A;  2OSU A;  3IF5 A;  5FI2 A;  4FSF A;  4R3J A;  3FWL A;  2HP6 A;  1YLY A;  4XXR A;  2ZQ9 A;  1CI9 A;  2H5S A;  3HUM A;  3IH9 A;  1XA7 A;  2ZM0 A;  3AGD A;  4JXG A;  3S4X A;  3Q7V B;  3NCK A;  4ZBE A;  4RX2 A;  4KG6 A;  4OP8 A;  4KZ3 A;  1BZA A;  1YLT A;  5D3O A;  3UDF A;  1ZG4 A;  5DF9 A;  2XFS A;  4BEN A;  1Y54 A;  3V3S A;  4PM6 A;  5HFO A;  2IWC A;  1TDL A;  2EFX A;  1NZO A;  3AGF A;  3VSK A;  5HL1 A;  1ESU A;  2A49 A;  5FA7 A;  1JWP A;  1JWV A;  4A5R A;  1XPB A;  1K6R A;  3FKW A;  4YIN A;  4KZ6 A;  5FQM A;  5FSR A;  1TDG A;  3DWK A;  4S2P A;  4Y7P A;  3G34 A;  4GB7 A;  1C3B A;  4KZ9 A;  1GA0 A;  4XUX A;  4NK3 A;  3HLC A;  3MXR A;  4WMC D;  1Q2Q A;  3DWZ A;  1GHM A;  3HLW A;  1BSG A;  4EV4 A;  3NIA A;  3E2L A;  4KZA A;  3RJU A;  3G4P A;  3BFE A;  4PM8 A;  5I94 A;  1MWS A;  4JF6 A;  2R9W A;  1OME A;  3ZG0 A;  5GHZ A;  1L0D A;  3BFF A;  1K56 D;  2G2W A;  5KSC A;  5GLB A;  5FAS A;  1DJB A;  1KVL A;  5FQJ A;  3Q81 A;  3SS4 A;  5GLD A;  1PIO A;  4WMC A;  1JVJ A;  5BOH A;  4HEF A;  1K57 C;  1H8Y A;  3FKV A;  1IYS A;  1K55 C;  1YLW A;  3N6I A;  2ZD8 A;  1K4F A;  3IF6 A;  4S2K A;  2EX6 A;  5E43 A;  3IXD A;  5DTK A;  4N1X A;  1I2W A;  3CG5 A;  4E3L A;  5KMW A;  5TGF A;  4IBX A;  5U47 A;  3S22 A;  1K56 A;  3C5A A;  2WAF A;  4WZ5 A;  5KZH A;  4DXB A;  2E8I A;  1KE4 A;  4KZ8 A;  3VOY A;  4NET A;  4WEK A;  3OPR A;  4FH4 A;  4P6B A;  3ZG9 B;  1LHY A;  2J9P A;  4ID4 A;  3PBT A;  1EWZ A;  3IXG A;  3FV7 A;  1QMF A;  5FQQ A;  1YMS A;  4ZJ2 A;  4OPQ A;  3HUN A;  3G35 A;  1W8Y A;  1NJ4 A;  1QME A;  1WYC A;  1YLP A;  1CEF A;  3AGE A;  2OLU A;  1SDN A;  4B4X A;  4QD4 A;  2ZLY A;  2Y2Q A;  3O86 A;  1IEL A;  3UPP A;  4HBT A;  1CI8 A;  5J8X A;  4IBR A;  5JYO A;  5EVI B;  3MZF A;  2RCX A;  3Q82 A;  1HZO A;  3SH9 A;  5CGS A;  2JE5 A;  4DE2 A;  4JLF A;  1MWT A;  1FCO A;  1RGY A;  4BL3 A;  3ITB A;  2QZ6 A;  4K0W A;  5GL9 A;  3ISG A;  1NXY A;  4FH2 A;  2ZC7 A;  1BLS A;  2HDU A;  1G6A A;  3IQA A;  3QNB A;  1XXM A;  2WKI A;  2WGW B;  5F83 A;  1VQQ A;  3N7W A;  2WZZ A;  5AQ9 A;  4MNR A;  2DRW A;  4Y0U A;  1LI0 A;  1KDS A;  1ESI A;  4ZAM A;  5F1G A;  1Z6F A;  3UPO A;  4OVD A;  4WZ4 A;  1FR6 A;  3BRM A;  5AQA A;  5DTS A;  1PZO A;  4BL2 A;  3WRZ A;  3ZNT A;  2A3U A;  3A3E A;  5CHM A;  4RYE A;  4JKT A;  4WEL A;  3ZHH A;  1E3U D;  3CZD A;  4RX3 A;  2V20 A;  3BYD A;  2ZJ9 A;  3VP2 A;  4C75 A;  3IWI A;  4N9L A;  4MBH A;  3IXH A;  3P09 A;  3IXB A;  1PI5 A;  4K91 A;  2Q9N A;  1FSY A;  3PBS A;  5E2G A;  4LEN A;  3N8S A;  5EPH A;  5G18 A;  4B88 A;  1K57 A;  1NRF A;  4EQI A;  3RXX A;  3LCE A;  3E2K A;  1K55 A;  1ERO A;  4BLM A;  4IVK A;  1Q2P A;  3A3J A;  4DE1 A;  1DJA A;  1E25 A;  1MWU A;  1E3U A;  5FAO A;  4UHU A;  4E3K A;  3BM6 A;  3C4O A;  2Y2G A;  3LY4 A;  3UE1 A;  4QHC A;  2J7V A;  2OLV A;  3BEB A;  4ZTK A;  1W5D A;  2FFY A;  4N92 A;  5HW3 A;  5EUA A;  1PW8 A;  2VGJ A;  4ZDX A;  1ONG A;  2HPB A;  4OKP A;  3VP4 A;  3C7U A;  1BLP A;  3WS1 A;  4X55 A;  4OQI A;  3Q07 A;  2EX9 A;  4QB8 A;  4H8R A;  4WBG A;  1BUL A;  1S6R A;  5FQK A;  4OQG A;  2V2F F;  4OOL A;  5HAI A;  2BG1 A;  5FAT A;  1ZKJ A;  4OPY A;  4JXS A;  4LV0 A;  5DTT A;  4PM5 A;  1AXB A;  2EX8 A;  4N9K A;  3VFF A;  5A90 A;  4BJP A;  4E3O A;  4GOG A;  3Q7V A;  5EVI C;  4R3B A;  3WS4 A;  3DW0 A;  3WS0 A;  2WUQ A;  5GLA A;  3VFH A;  2Y59 A;  4C3Q A;  4LCL A;  4KQQ A;  4JF5 A;  1JWZ A; 
#chains in the Genus database with same CATH topology
 5TR7 A;  3BQ8 A;  1LL5 A;  2HP9 A;  1P9R A;  1VM1 A;  3FPV A;  1CQA A;  5F6A A;  4WM9 A;  2YKF A;  3UB5 P;  1BLH A;  3CJM A;  5E2H A;  3UPN A;  2HDS A;  2KLI A;  1GA9 A;  1MWR A;  4S2O A;  4DDS A;  4E3J A;  3G2Y A;  2W3H A;  3GEC A;  1PNE A;  3W4Q A;  3U4L P;  4QJG A;  4JPM A;  1G68 A;  1FIK A;  3MXS A;  5HWT A;  5HDS A;  4NXB A;  1RCJ A;  4CLC E;  4MBF A;  1EW0 A;  2Y2N A;  5IT5 A;  1KGF A;  4WL9 A;  3G2Z A;  4JGP A;  4JGQ A;  5EVI D;  3O88 A;  3G30 A;  3PAE A;  3QP1 A;  4OQ0 A;  4OPR A;  3LR0 A;  1FSW A;  3MXQ A;  3S7O A;  3E98 A;  3V67 A;  3HVF A;  4CPK A;  3DTM A;  2KOI A;  2J3T C;  1VHM A;  3WS5 A;  2J9O A;  1TVF A;  3T1R A;  4P0M A;  3T4L A;  4PHT A;  4EET B;  4IUH A;  3LIC A;  3SW1 A;  1CEG A;  2Y2M A;  3MFX A;  3GMW A;  3O3V A;  2JBF A;  3DBA A;  1NY0 A;  2Q0O A;  2H0T A;  1NYY A;  1FCN A;  3IHA A;  2WKE A;  1KVM A;  4R4R A;  3BLM A;  1IKG A;  2XSS A;  4EBL A;  1GSW A;  4P87 A;  1SZV A;  4DRT A;  5IS1 A;  4YNR A;  2QKP A;  4BBV A;  4GD6 A;  4BD1 A;  1YKD A;  2DNS A;  4X25 A;  4CJN A;  3SOI A;  3D3O A;  2Y4A A;  3P01 A;  2R9X A;  4K0X A;  4GD8 A;  1TS6 A;  4PKY A;  1W8Q A;  3ZNY A;  2ZMA A;  1KE3 A;  1SKF A;  3KSI A;  2VZW A;  3ZCZ A;  2H10 A;  3DTE A;  1P9W A;  5FI7 A;  3D9Y A;  1MY8 A;  4AFI A;  2PHY A;  3N4I A;  2V1A A;  1LL8 A;  1V9Z A;  1X0O A;  3W4O A;  2ZC3 B;  3H82 A;  3CMZ A;  4UAA A;  2Y2K A;  5HAQ A;  4OPZ A;  4O7D A;  3MQO A;  5AVE A;  3UDX A;  4KQD A;  1BUE A;  4EQ1 A;  2XGN A;  4G3V A;  2Y2H A;  2VV6 A;  4JXV A;  3N8L A;  2ZQ8 A;  1ERM A;  3PBR A;  1LSV A;  5M19 A;  4DF6 A;  4IJG A;  4LRY C;  1SCW A;  1PWG A;  2UWX A;  5FAP A;  3PBN A;  2VV7 A;  5F69 A;  3KSF A;  2VK3 A;  1SKO B;  4EWF A;  1YT4 A;  4KZ7 A;  3RTY A;  4S2M A;  1HD8 A;  3UDI A;  3NY4 A;  3ZG8 B;  1I2S A;  3V50 A;  1MXO A;  5HAP A;  1DY6 A;  2ACG A;  3TRC A;  5CX7 A;  3K2N A;  3T4K A;  5HL6 A;  1CK3 A;  5A93 A;  1IYO A;  1IYP A;  2ZQD A;  2WGV A;  3HJK A;  3D4F A;  3IF6 C;  4S2I A;  3UME A;  5GHX A;  4HH2 A;  3O5Y A;  5HAR A;  4FD8 A;  1N4O A;  4WUJ A;  4DDY A;  2HDQ A;  3MFD A;  5EE8 A;  2LB5 A;  1KGE A;  5JYP A;  2KDK A;  5HD3 A;  2XRN A;  2OSU A;  3IF5 A;  4MN5 A;  4FSF A;  4R3J A;  3FWL A;  2H5S A;  3HUM A;  1XA7 A;  4JXG A;  3S4X A;  4LRX C;  2VV8 A;  2HV1 A;  3G6O A;  3QP6 A;  4KZ3 A;  1BZA A;  4I39 A;  2WKR A;  5DF9 A;  3K3D A;  3MSH A;  1NZO A;  4ME4 A;  5FA7 A;  1JWV A;  4A5R A;  2W3F A;  2V0U A;  3DWK A;  3G34 A;  4GB7 A;  1C3B A;  4XUX A;  2V1B A;  4R6L A;  2J80 A;  4WMC D;  3HLW A;  4EV4 A;  3E2L A;  4PM8 A;  4IUK A;  4MCW A;  3ZG0 A;  2EWW A;  1L0D A;  3BFF A;  2G2W A;  2ZL1 A;  3KO6 A;  3ZQ5 A;  3SS4 A;  5FL3 A;  1PIO A;  1F2K A;  5AJG A;  4GS9 A;  1YLW A;  3N6I A;  2W27 A;  2ZD8 A;  2EX6 A;  5E43 A;  2PYP A;  1I2W A;  3CG5 A;  4E3L A;  4XT2 A;  4FTX A;  4LPZ A;  5TGF A;  3S22 A;  2VLG A;  3C30 A;  3C5A A;  4WZ5 A;  2NUT C;  4DXB A;  4KZ8 A;  5EM0 A;  4HH3 A;  1EWZ A;  3IXG A;  5FQQ A;  2NUP C;  5J7E A;  1WYC A;  2OLU A;  4B4X A;  1IEL A;  3UPP A;  4HBT A;  1XFQ A;  2JKT I;  2RCX A;  4ESP A;  2GNX A;  5CGS A;  2JE5 A;  2FH5 A;  1RGY A;  1D7E A;  1S66 L;  2QZ6 A;  4K0W A;  3ISG A;  1TS7 A;  3IQA A;  2WKI A;  1VQQ A;  5KIZ A;  3D72 A;  3N7W A;  1IOU A;  2WZZ A;  1VB6 A;  1KDS A;  1ESI A;  3UPO A;  4OVD A;  2Y79 A;  5AQA A;  2M7U A;  5J3W A;  3UE6 A;  4JKT A;  3VP2 A;  4I3J A;  3P09 A;  1PI5 A;  4NXG A;  2Q9N A;  1FSY A;  4LRZ E;  3N8S A;  2K2N A;  1K57 A;  2VA0 A;  3E2K A;  1ERO A;  4IVK A;  1BYW A;  1DJA A;  1E25 A;  2GX5 A;  1E3U A;  2O9A A;  4DJ3 A;  3BJN A;  2Y2G A;  3LY4 A;  5HWW A;  4QHC A;  3BEB A;  4ZTK A;  1PW8 A;  3IBR A;  4ZDX A;  2INW A;  2ZMV A;  4BWI A;  3VP4 A;  3C7U A;  1BLP A;  3T4Q A;  3WS1 A;  4X55 A;  4OQI A;  3Q07 A;  2EX9 A;  4H8R A;  3LI9 A;  5HAI A;  4OQG A;  2V2F F;  4MN6 A;  1ZKJ A;  2EX8 A;  4N9K A;  2IA2 A;  3LIF A;  3VFF A;  3L7H A;  5EVI C;  3VFH A;  1WA9 A;  4JF5 A;  1JWZ A;  2PD8 A;  3IX4 A;  1RP5 A;  3H82 B;  2JHE A;  3B47 A;  4OQH A;  2ZC6 B;  1VET A;  1PFL A;  2EXB A;  3PBQ A;  4UA7 A;  3OCN A;  2PR5 A;  2BLS A;  4X6T A;  3QHY A;  2EA9 A;  5CEC A;  2D02 A;  3MKF A;  4DXC A;  2IWD A;  1IYQ A;  1XJ4 A;  1PWC A;  3KX0 X;  2E8J A;  3A0S A;  1L0G A;  4JBF A;  3UO9 A;  3H7W B;  1LT0 A;  5EOE A;  3IH8 A;  3OPP A;  5CHJ A;  1OTE A;  3OPH A;  1GHI A;  3S7N A;  3MJQ A;  2ZOH A;  5EOO A;  4QU3 A;  2VEA A;  3VSL A;  2MJ6 A;  1LLB A;  2W0N A;  4MLL A;  3V5M A;  4GJ4 A;  2V0W A;  2Y2I A;  3LGO A;  2PRF A;  4II7 A;  3NI9 A;  3BY9 A;  3CIT A;  3KSG A;  3MZD A;  4IVI A;  4PM9 A;  1L3L A;  3CUE C;  2Q9M A;  1N9N A;  1VEU A;  5E2E A;  1L2S A;  4NG2 A;  4HI4 A;  3UNW A;  3HLG A;  5CEB A;  3LID A;  5HWV A;  1PWD A;  1N9O A;  1G28 A;  4LFU A;  1ES3 A;  2ZM2 A;  1XKZ A;  2Y2P A;  1S0W A;  4E3N A;  1YAX A;  3HLF A;  4DE3 A;  2GZA A;  3MBZ A;  5DFX A;  4EER A;  1CF0 A;  4B4Z A;  4I5S A;  4Y0T A;  1LI9 A;  2ZC5 B;  1DRM A;  2Y2L A;  3HCY A;  3SH7 A;  2Y2J A;  1S4R A;  3KYZ A;  2JCH A;  1YPR A;  5TBM A;  4PM7 A;  2W1T A;  3A0R A;  2HDR A;  4MMN A;  1YM1 A;  3ZVW A;  4FCF A;  1XJ3 A;  3QNC A;  1KDW A;  2ZL1 B;  2XQZ A;  4OP5 A;  3VP3 A;  1H5X A;  3JYI A;  2ZQ7 A;  4GS9 B;  1ONH A;  2ZM8 A;  2PU4 A;  4XT2 B;  2K31 A;  2G2U A;  1OTI A;  3FZC A;  4P85 A;  5IU1 A;  3C7V A;  1SHV A;  3CWF A;  5E2F A;  2P9V A;  1K54 C;  1O7E A;  4QPR A;  1ES4 A;  4NEE D;  4OH0 A;  5AQ7 A;  3PYP A;  1ES2 A;  2B18 A;  2H0Y A;  4M3K A;  3BEC A;  4Z9Q A;  4QY6 A;  4QWO A;  2JKT M;  2WAE A;  5HSQ A;  4E6X A;  4F94 A;  2IWB A;  4DN0 A;  1M40 A;  2OOL A;  4BQM A;  4QY5 A;  1MKI A;  4R0Q A;  1Z09 A;  4GNU A;  1PI4 A;  2OAQ 1;  3FG8 A;  4BL3 A;  4IED A;  1JTG A;  5FQ9 A;  2WYX A;  3GR2 A;  5TFQ A;  3TOI A;  1WYB A;  1ZC2 A;  4UA6 A;  5F1F A;  2JKF A;  3EEA A;  4KEN B;  4R23 A;  4YOF A;  3GTC A;  4MN7 A;  4Y17 A;  4C6Y A;  1BT5 A;  2FZ0 A;  4Q8I A;  1F5M A;  4DE0 A;  2EX2 A;  4OLD A;  4KG5 A;  3ZGA B;  3BY8 A;  2XD1 A;  4GZB A;  3GDI A;  4DKI A;  4Y13 A;  4BD0 A;  2C5W B;  4PKY G;  4HJ3 A;  3EGX C;  1NZU A;  3QP5 A;  3Q7Z A;  3M2J A;  4GW9 A;  2I72 A;  3S7Q A;  1ACF A;  1FR1 A;  2EFU A;  2YKH A;  1YLY A;  4XXR A;  1CI9 A;  1J3W A;  3LR5 A;  3T50 A;  3IH9 A;  4CLC B;  3RFB A;  4RX2 A;  4KG6 A;  2O99 A;  5D3O A;  2A2L A;  4RQ9 A;  1ZG4 A;  2XFS A;  1Y54 A;  1VET B;  2IWC A;  4EW7 A;  3VSK A;  5HL1 A;  1JWP A;  1XPB A;  3P7N A;  3LR4 A;  4KZ6 A;  5FQM A;  3C2W A;  3HLC A;  1TF1 A;  2R9W A;  1OME A;  3T4O A;  4FUW A;  3NEC A;  1K56 D;  1XJ6 A;  1S1Z A;  5FAS A;  3Q81 A;  1JVJ A;  1H8Y A;  1K4F A;  3IF6 A;  5KMW A;  2O9B A;  2QJ5 A;  5KZH A;  2E8I A;  3MQQ A;  4NET A;  4WEK A;  1W8Y A;  3H7W A;  1G5U A;  1YLP A;  1SDN A;  2Y2Q A;  2PDR A;  3JPU A;  5DJT A;  4YWZ A;  3HJI A;  3T1Q B;  3Q82 A;  4DE2 A;  1MWT A;  3ULF A;  1F9I A;  1VEU B;  1S1Y A;  2DRW A;  1LI0 A;  5F1G A;  1Z6F A;  2JKR M;  4WZ4 A;  3BRM A;  4I3I A;  5F68 A;  1DP8 A;  3WRZ A;  3ZNT A;  2A3U A;  3LIE A;  3EWK A;  4WEL A;  3ZHH A;  3CZD A;  4RX3 A;  2PR6 A;  3RH8 B;  2ZJ9 A;  3SZT A;  4K08 A;  4MBH A;  3T1X A;  3CI6 A;  3T1S A;  5E2G A;  3W2Z A;  1DP9 A;  1OJ5 A;  3LCE A;  4BLM A;  5FAO A;  1MWU A;  4UHU A;  3FPW A;  3EGD C;  4G3W A;  4F3L A;  2J7V A;  2OLV A;  3E4Q A;  2R78 A;  5EUA A;  5TBM B;  1S67 L;  2W1T B;  1ONG A;  4OKP A;  2OWH A;  1T18 A;  4QB8 A;  3MR0 A;  5FQK A;  4LV0 A;  4PM5 A;  4BJP A;  4GCZ A;  4R3A A;  3DW0 A;  2WUQ A;  5GLA A;  4C3Q A;  5CHU A;  4OOM A;  1ZG6 A;  2P9V B;  2PU2 A;  1I5Q A;  4O01 A;  3NOU C;  2WAD A;  1W63 Q;  3LY3 A;  1TD5 A;  3VP0 A;  1M6K A;  2Y2O A;  4U3T A;  2L1M A;  4Y15 A;  3C4P A;  4GLQ A;  2L0W A;  1KGG A;  3HBR A;  4KZB A;  3A3D A;  4L0L A;  1T1B A;  2QYB A;  4GDB A;  3WRT A;  1XX2 A;  5J4E A;  4E3M A;  4GHI B;  5A8B A;  3GSG A;  3IX3 A;  1J9M A;  2P08 A;  3M6H A;  1BLC A;  5A92 A;  2X71 A;  3ZYT A;  4N1H A;  2ZQA A;  2QMI A;  2HP5 A;  2ZQC A;  5DF8 A;  1EI5 A;  1ES5 A;  4OON A;  3MZE A;  2V9A A;  2XFT A;  3A3I A;  3LEQ A;  3W4P A;  1UWP X;  3UB8 A;  1YSQ A;  4WN5 A;  2RL3 A;  1OT9 A;  5EVI A;  4OOY A;  4ZJ3 A;  3V3R A;  3QP8 A;  3GV9 A;  3NC8 A;  4OLG A;  3BFC A;  2WZX A;  1T1A A;  3OOV A;  3F1N A;  2CMN A;  3LEZ A;  2H28 A;  4ZRR A;  2WGW A;  5CER A;  4Y5F A;  3NBL A;  5CXW A;  1PW1 A;  4Y0O A;  1YSP A;  3JVV A;  2PBY A;  3ZVT A;  1IFQ A;  5L8M A;  2O0Y A;  3VE4 A;  2WKH A;  2XLN A;  3MKE A;  4KQR A;  3WWX A;  1GSV A;  3FC7 A;  4WYY A;  5M18 A;  3ICY A;  2QHK A;  1L0F A;  1HVB A;  2M1C A;  2WGI A;  1W79 A;  2P04 A;  1MBL A;  3ZG5 A;  5HDD A;  3H9W A;  3HLE A;  1FIL A;  1YQS A;  2P74 A;  4CLC A;  1OT6 A;  3NDG A;  3OBF A;  3PTE A;  5EEC A;  2XK1 A;  3G31 A;  4R70 A;  3HUO A;  4D2O A;  2WKP A;  3L9K A;  4KG2 A;  4G3K A;  1RGZ A;  3S1Y A;  5FEF A;  1BTL A;  3B3X A;  1G6O A;  3VOZ A;  1N9B A;  4E04 A;  3IF6 B;  4KZ4 A;  1XA1 A;  4KQO A;  4S2N C;  1IEM A;  3IWO A;  3QP4 A;  4ETX A;  2XR0 A;  3OCL A;  1V9Y A;  1A0K A;  5TJJ A;  4X69 A;  3GRJ A;  1ERQ A;  3LFV A;  1YLJ A;  3OPL A;  3RXW A;  3KYE A;  5FAQ A;  3R7W A;  4E3I A;  1MPL A;  3LIA A;  2W3E A;  5F82 A;  1STZ A;  4HES A;  4HIA A;  2J8Y A;  5K5B A;  2Z2L B;  1N9L A;  5L2F A;  5G4Y A;  4UEY A;  5DVA A;  5IHV A;  1PZP A;  2EXA A;  4GDN A;  4XUZ A;  1LSX A;  4MDZ A;  5EFW A;  3UB9 A;  3C8C A;  1KOU A;  1WE4 A;  3BFD A;  3VP1 A;  5EVL A;  4X68 A;  4R1G A;  2I9V A;  4LV1 A;  4ZJ1 A;  4B88 A;  3IWQ A;  5I5L A;  3EQV A;  3IX8 A;  3IT9 A;  4ARZ B;  4PMA A;  5A91 A;  5CTN A;  2XEP A;  1K4E A;  4EBN A;  3UB6 A;  3HLD A;  5DF7 A;  2JKR I;  3UB7 A;  3GQZ A;  1T19 A;  2PT7 A;  4HNB A;  5FDH A;  1K6S A;  4Y2F A;  5M1A A;  3ITA A;  5DFY A;  1K25 A;  4F3L B;  5GLC A;  2ZC4 B;  5G4Z A;  3BWL A;  1K54 A;  4WEJ A;  4NXF A;  1MC0 A;  4Q0I A;  1W63 M;  4ETZ A;  1GCE A;  2M7V A;  5FI2 A;  2OWJ A;  2HP6 A;  2GJ3 A;  1HLU P;  2ZQ9 A;  3TW8 A;  2ZMF A;  1AWI A;  2V8F A;  4ZBE A;  3MF0 A;  4OP8 A;  1K0K A;  1NLY A;  4BEN A;  5HFO A;  2EFX A;  3NOP C;  2PYR A;  2HF6 A;  5FSR A;  1TDG A;  4Y7P A;  5EV0 A;  2XA7 S;  4P6Z S;  4NK3 A;  2ZOI A;  3MXR A;  3DTI A;  1Q2Q A;  3DWZ A;  1GHM A;  1BSG A;  4KZA A;  3PR6 A;  5GHZ A;  5EM1 A;  1OTA A;  3VV4 A;  5GLB A;  1DJB A;  1KVL A;  3CPT A;  4HHD A;  4Z1W A;  4HJ6 A;  4WMC A;  5BOH A;  4HEF A;  3FKV A;  1K55 C;  4NXE A;  3IXD A;  4N1X A;  2JN7 A;  4HOI A;  2HJE A;  1KE4 A;  3VOY A;  4FH4 A;  1LHY A;  4ID4 A;  4GHI A;  3MQ0 A;  1QMF A;  4ZJ2 A;  3HUN A;  3G35 A;  1NJ4 A;  2EWV A;  1CEF A;  3AGE A;  5L10 A;  4QD4 A;  2O9C A;  5J8X A;  5EVI B;  1NRJ A;  3DAV A;  3MZF A;  1HZO A;  3LI8 A;  2UV0 E;  1S4S A;  1FCO A;  5GL9 A;  1NXY A;  2ZC7 A;  2HDU A;  3F1N B;  3QNB A;  1XXM A;  2WGW B;  4D60 A;  3EOI A;  4Y0U A;  2XRO A;  3T4S A;  3VE3 A;  5DTS A;  1JNU A;  5CHM A;  3A3E A;  4RYE A;  4DJ2 A;  1XFN A;  1E3U D;  2V20 A;  4N9L A;  2AVX A;  3IXH A;  3IXB A;  4K91 A;  4WF0 A;  3PBS A;  4LEN A;  5EPH A;  4EEU A;  1NRF A;  3PXP A;  1Q2P A;  3A3J A;  4DE1 A;  3B33 A;  3C4O A;  3UE1 A;  1CJF A;  1W5D A;  4Q0H A;  4EXO A;  5HW3 A;  2VGJ A;  4CLC D;  2HPB A;  4JGO A;  3E0Y A;  1BUL A;  1S6R A;  3T4T A;  2B02 A;  2BG1 A;  5FAT A;  3PHY A;  4I3A A;  5A90 A;  4E3O A;  3VOL A;  4GOG A;  3Q7V A;  4R3B A;  3WS0 A;  4LCL A;  4HP9 A;  3Q1F A;  4RA7 A;  3CAX A;  2J3W A;  2Y55 A;  2ZBB A;  1DJC A;  5CTM A;  3R7W B;  2X01 A;  1U60 A;  3EQU A;  2VGL S;  4S2L A;  1H8Z A;  5C5K A;  1UGU A;  3OC2 A;  2HGV A;  3E4P A;  2VGK A;  4MEZ A;  3QP2 A;  2P7J A;  3M2K A;  2OV5 A;  1O07 A;  1YMX A;  3BQA A;  5FI6 A;  2QPN A;  3VMA A;  2PD7 A;  3HLB A;  2WKQ A;  5AQB A;  3BLS A;  2D01 A;  4MBK A;  1UWN X;  5HD5 A;  2PAV P;  3DTK A;  3UE0 A;  2K7S A;  3SH8 A;  2X02 A;  3NJA A;  5EVE A;  4R38 A;  3NOT C;  3TSG A;  3W8K A;  4YFM A;  3UMD A;  2XF3 A;  2CC1 A;  3HL9 A;  2XD5 A;  5CGW A;  1P0Z A;  2V8C A;  3M6B A;  3TJZ C;  1IKI A;  1D06 A;  2QWS A;  1ZTU A;  4LGW A;  2A24 B;  4LCM A;  2JKG A;  5CRF A;  1JTD A;  4EU0 A;  3P98 A;  3GVB A;  3F1P A;  1MKM A;  3F1O A;  3UY6 A;  1YLZ A;  4E6W A;  2GDN A;  3FYZ A;  1TEM A;  1W7F A;  4ARZ A;  2C6W B;  4EEP A;  4X56 A;  4HBU A;  2Z2M B;  1NLZ A;  3PAG A;  4JXW A;  4B93 A;  3IBJ A;  1P97 A;  3U2A A;  2XA7 M;  4P6Z M;  4HY8 A;  4HJ4 A;  1LL9 A;  4U0T A;  4H6J A;  3NUL A;  2XDM A;  2B5R A;  3K3C A;  1XJ2 A;  1XP4 A;  2HJ9 C;  1FQG A;  1PYY A;  2B95 A;  2QJ7 A;  3NHQ A;  4PPR A;  3BFG A;  3I7J A;  3UN7 A;  3OZH A;  3BW6 A;  4LV3 A;  3JVU A;  1DP6 A;  1GSX A;  4LV2 A;  1NYM A;  1NWZ A;  1ODV A;  2BAS A;  3IHB A;  4L9G A;  2J3T D;  4S2J A;  3TG9 A;  2XH9 A;  3IS2 A;  4BMW A;  2Y91 A;  4KUO A;  5HDC A;  2W3G A;  3CPT B;  3V39 A;  3LYX A;  1E4D A;  3S7P A;  5DJU A;  4R4S A;  4GN2 A;  2FFF B;  4O8G A;  4KZ5 A;  1D1J A;  2JC7 A;  2L4R A;  5FQI A;  3PBO A;  2Z6D A;  3SS3 A;  3A0V A;  1GHP A;  1H3Q A;  1HTZ A;  5CGX A;  1FCM A;  3LR3 A;  4X53 A;  3ZG7 B;  1LSW A;  1KE0 A;  5KSH A;  4UQI S;  4L9F A;  5HPF A;  1L0E A;  3UE3 A;  2VJW A;  1OJG A;  1FOF A;  5HPI A;  5DKL A;  1XGJ A;  4EUZ A;  2W3D A;  5FDS A;  3O87 A;  3G32 A;  3LO7 A;  1OTB A;  2DCF A;  4U0X A;  4JF4 A;  4UA9 A;  4DMZ A;  3ZFZ A;  3N8R A;  1SDE A;  5HX9 A;  5FEG A;  2V1Z A;  3A3F A;  4EBP A;  4GKU A;  2LB9 A;  1K38 A;  5GHY A;  4RVA A;  3NDE A;  3R4K A;  3CHW P;  3HRE A;  4S2N A;  2VX8 A;  1ALQ A;  3WS2 A;  2WK0 A;  4WZ5 C;  3ZDJ A;  1XGI A;  1Y4O A;  3SS5 A;  3EEH A;  4IHQ A;  5CED A;  3C38 A;  2VGL M;  2G7U A;  3MS6 A;  4X1M A;  4B9O A;  2ZM0 A;  3AGD A;  4WLA A;  3Q7V B;  3NCK A;  4CQH A;  1YLT A;  2Y8H A;  4Q0J A;  3UDF A;  3V3S A;  4FOF A;  4PM6 A;  1TDL A;  3AGF A;  1ESU A;  2A49 A;  4Y3I A;  1K6R A;  5AVF A;  3FKW A;  4YIN A;  3T12 B;  4S2P A;  4KZ9 A;  1GA0 A;  4HQA A;  3NIA A;  3RJU A;  3G4P A;  3BFE A;  5I94 A;  1MWS A;  4JF6 A;  3CUE A;  3T4J A;  3E4O A;  3KSH A;  5KSC A;  4JGR A;  1TS8 A;  2VKS A;  5FQJ A;  5GLD A;  1H0M A;  1PRQ A;  1K57 C;  4L9E A;  1IYS A;  2KX6 A;  4S2K A;  5DTK A;  4IBX A;  5U47 A;  1K56 A;  2WAF A;  1OPX A;  4O0P A;  3OPR A;  4P6B A;  3ZG9 B;  2J9P A;  1F98 A;  3PBT A;  3FV7 A;  1YMS A;  4OPQ A;  2HZ5 A;  1QME A;  2OAP 1;  2ZLY A;  1TS0 A;  3O86 A;  1CI8 A;  3B42 A;  4IBR A;  4NKP A;  5JYO A;  4CLC C;  5HZH A;  2BTF P;  3SH9 A;  1Y28 A;  4JLF A;  3F1P B;  2DMW A;  3F1O B;  3ITB A;  5L09 A;  4FH2 A;  4M4X A;  1BLS A;  1G6A A;  4I38 A;  5F83 A;  1MZU A;  5AQ9 A;  5L07 A;  4MNR A;  4ZAM A;  5MC7 A;  2W1R A;  1FR6 A;  1SKO A;  1T1C A;  4H6J B;  4BBU A;  2A24 A;  1PZO A;  4BBT A;  4BL2 A;  5LBR A;  3CLO A;  4KUK A;  5F5Y A;  3BYD A;  4C75 A;  3IWI A;  1ZHH B;  1OTD A;  1H8M A;  5G18 A;  4EQI A;  3RXX A;  1K55 A;  3LUQ A;  4E3K A;  3BM6 A;  4X1L A;  2FFY A;  4N92 A;  4PAU A;  3TE8 A;  3IS2 B;  5DKK A;  4EES A;  4EUV A;  2PBD P;  3KYQ A;  3LIB A;  4WBG A;  3MMH A;  4OOL A;  4OPY A;  4JXS A;  5DTT A;  1AXB A;  4UQI M;  3WS4 A;  4LLO B;  2Y59 A;  4KQQ A;  2Z6C A;  4HP4 A;  3OLO A; 
#chains in the Genus database with same CATH homology
 3Q1F A;  4RA7 A;  5TR7 A;  1RP5 A;  5CHU A;  4OOM A;  2Y55 A;  1ZG6 A;  4OQH A;  1DJC A;  1LL5 A;  2P9V B;  2ZC6 B;  2PU2 A;  5CTM A;  1I5Q A;  2EXB A;  2WAD A;  3PBQ A;  4UA7 A;  2HP9 A;  3LY3 A;  3OCN A;  3VP0 A;  1M6K A;  1VM1 A;  2X01 A;  1U60 A;  2Y2O A;  4U3T A;  3EQU A;  3C4P A;  2BLS A;  4WM9 A;  4X6T A;  4S2L A;  1BLH A;  1H8Z A;  3CJM A;  3QHY A;  1KGG A;  5E2H A;  3UPN A;  3OC2 A;  5CEC A;  3MKF A;  3HBR A;  2HDS A;  4DXC A;  2IWD A;  4KZB A;  1GA9 A;  1IYQ A;  1MWR A;  2VGK A;  3A3D A;  4L0L A;  4MEZ A;  4S2O A;  4DDS A;  3M2K A;  1PWC A;  3G2Y A;  4GDB A;  1XX2 A;  2OV5 A;  3WRT A;  1O07 A;  4E3J A;  4E3M A;  1YMX A;  1L0G A;  3GSG A;  3W4Q A;  5FI6 A;  1J9M A;  2QPN A;  4JBF A;  3UO9 A;  3VMA A;  5EOE A;  4QJG A;  4JPM A;  3M6H A;  3IH8 A;  3HLB A;  5AQB A;  3OPP A;  3ZG8 B;  3BLS A;  1BLC A;  1G68 A;  4MBK A;  5CHJ A;  3OPH A;  3MXS A;  5A92 A;  1GHI A;  2X71 A;  4N1H A;  2ZQA A;  1RCJ A;  2HP5 A;  2QMI A;  2ZQC A;  5DF8 A;  1EI5 A;  4QU3 A;  5EOO A;  3UE0 A;  4MBF A;  2X02 A;  2Y2N A;  3SH8 A;  3VSL A;  1KGF A;  1ES5 A;  4OON A;  3MZE A;  3G2Z A;  3TSG A;  5EVI D;  3W8K A;  1LLB A;  3O88 A;  4YFM A;  3G30 A;  2XF3 A;  3PAE A;  4MLL A;  2CC1 A;  2XFT A;  2XD5 A;  3HL9 A;  5CGW A;  3V5M A;  4OQ0 A;  4OPR A;  3A3I A;  3W4P A;  1FSW A;  3HVF A;  3M6B A;  2Y2I A;  4CPK A;  3DTM A;  2RL3 A;  3NI9 A;  1IKI A;  3WS5 A;  2J9O A;  5EVI A;  4LCM A;  4OOY A;  4ZJ3 A;  3V3R A;  3MZD A;  4IVI A;  1JTD A;  1TVF A;  5CRF A;  3P98 A;  3GVB A;  3GV9 A;  4P0M A;  3NC8 A;  4PM9 A;  4OLG A;  3UY6 A;  3BFC A;  2WZX A;  1YLZ A;  4E6W A;  2GDN A;  2Q9M A;  3FYZ A;  1TEM A;  1W7F A;  3LEZ A;  5E2E A;  2C6W B;  1L2S A;  2WGW A;  5CER A;  3NBL A;  4X56 A;  5CXW A;  4HBU A;  1PW1 A;  2Z2M B;  3PAG A;  4JXW A;  1CEG A;  4Y0O A;  3UNW A;  2Y2M A;  3HLG A;  5CEB A;  2PBY A;  3GMW A;  1LL9 A;  3O3V A;  4U0T A;  3ZVT A;  1PWD A;  2JBF A;  1NY0 A;  2WKH A;  2XLN A;  3MKE A;  1ES3 A;  2H0T A;  2B5R A;  2XDM A;  2ZM2 A;  1XKZ A;  2Y2P A;  1NYY A;  4KQR A;  3WWX A;  1S0W A;  4E3N A;  1XP4 A;  3HLF A;  4WYY A;  4DE3 A;  5M18 A;  1FCN A;  3IHA A;  2WKE A;  3MBZ A;  1KVM A;  1FQG A;  1L0F A;  1PYY A;  3BLM A;  4R4R A;  1IKG A;  1HVB A;  4EBL A;  4PPR A;  2WGI A;  1W79 A;  4B4Z A;  4P87 A;  3BFG A;  3I7J A;  3UN7 A;  4Y0T A;  4DRT A;  1LI9 A;  2ZC5 B;  1MBL A;  3OZH A;  3ZG5 A;  4LV3 A;  2Y2L A;  3SH7 A;  3HLE A;  2Y2J A;  4GD6 A;  4BD1 A;  1YQS A;  4LV2 A;  1NYM A;  2P74 A;  2JCH A;  2DNS A;  4CJN A;  3NDG A;  3IHB A;  3PTE A;  5EEC A;  3SOI A;  2XK1 A;  3G31 A;  4S2J A;  3TG9 A;  2XH9 A;  4PM7 A;  2HDR A;  2Y4A A;  2R9X A;  3HUO A;  4K0X A;  4GD8 A;  4D2O A;  1YM1 A;  2Y91 A;  3ZVW A;  1W8Q A;  4FCF A;  4KG2 A;  3ZNY A;  1RGZ A;  2ZMA A;  3QNC A;  3S1Y A;  1KDW A;  1KE3 A;  2XQZ A;  1SKF A;  4OP5 A;  1BTL A;  3VP3 A;  1H5X A;  3B3X A;  3ZCZ A;  2H10 A;  3JYI A;  2ZQ7 A;  3VOZ A;  3V39 A;  1ONH A;  1E4D A;  1N9B A;  2ZM8 A;  3IF6 B;  4KZ4 A;  1XA1 A;  4KQO A;  5FI7 A;  2PU4 A;  4R4S A;  1IEM A;  1MY8 A;  4GN2 A;  4S2N C;  2FFF B;  3N4I A;  4KZ5 A;  2G2U A;  2JC7 A;  3FZC A;  3IWO A;  2XR0 A;  3OCL A;  4P85 A;  4X69 A;  5FQI A;  3GRJ A;  2ZC3 B;  1SHV A;  3C7V A;  3PBO A;  3W4O A;  3CMZ A;  3SS3 A;  1ERQ A;  5E2F A;  2P9V A;  1YLJ A;  3OPL A;  4UAA A;  3RXW A;  2Y2K A;  5HAQ A;  4OPZ A;  4O7D A;  1K54 C;  1GHP A;  5FAQ A;  4E3I A;  1HTZ A;  1MPL A;  3UDX A;  1O7E A;  5CGX A;  5F82 A;  1FCM A;  1BUE A;  1ES4 A;  2XGN A;  4OH0 A;  5AQ7 A;  1ES2 A;  2H0Y A;  2Y2H A;  4HES A;  4M3K A;  2J8Y A;  4X53 A;  3BEC A;  4JXV A;  2Z2L B;  3N8L A;  3ZG7 B;  1KE0 A;  2ZQ8 A;  4Z9Q A;  5KSH A;  5L2F A;  1ERM A;  4QY6 A;  2WAE A;  3PBR A;  5DVA A;  5IHV A;  1L0E A;  4E6X A;  4F94 A;  1PZP A;  2EXA A;  2IWB A;  3UE3 A;  5M19 A;  4GDN A;  4XUZ A;  4DF6 A;  1M40 A;  1FOF A;  4BQM A;  1SCW A;  1WE4 A;  1PWG A;  2UWX A;  4QY5 A;  3BFD A;  1XGJ A;  1MKI A;  5FAP A;  3PBN A;  4R0Q A;  5EVL A;  4X68 A;  3VP1 A;  4EUZ A;  4GNU A;  1PI4 A;  4R1G A;  3O87 A;  3G32 A;  3LO7 A;  4EWF A;  1YT4 A;  2DCF A;  4IED A;  4JF4 A;  4KZ7 A;  1JTG A;  4LV1 A;  2WYX A;  4U0X A;  4UA9 A;  4S2M A;  5FQ9 A;  3GR2 A;  1HD8 A;  3ZFZ A;  4ZJ1 A;  3UDI A;  3N8R A;  5TFQ A;  1SDE A;  1WYB A;  1I2S A;  3NY4 A;  5HX9 A;  3IWQ A;  1MXO A;  1ZC2 A;  2V1Z A;  3TOI A;  3V50 A;  3EQV A;  5HAP A;  4UA6 A;  5F1F A;  3A3F A;  4KEN B;  1DY6 A;  3IT9 A;  4PMA A;  4R23 A;  5CTN A;  3GTC A;  5A91 A;  2XEP A;  1K4E A;  4EBN A;  4EBP A;  4C6Y A;  4GKU A;  1BT5 A;  1CK3 A;  4Q8I A;  1K38 A;  3HLD A;  5DF7 A;  5GHY A;  4DE0 A;  5A93 A;  4RVA A;  3GQZ A;  2EX2 A;  3NDE A;  1IYO A;  4OLD A;  1IYP A;  2ZQD A;  2WGV A;  4KG5 A;  3ZGA B;  3D4F A;  4GZB A;  1K6S A;  2XD1 A;  3HRE A;  3IF6 C;  4S2N A;  3ITA A;  5FDH A;  4S2I A;  5M1A A;  4DKI A;  1ALQ A;  1K25 A;  5GLC A;  5GHX A;  3WS2 A;  2ZC4 B;  2WK0 A;  4BD0 A;  2C5W B;  4WZ5 C;  3ZDJ A;  5HAR A;  1XGI A;  1NZU A;  4FD8 A;  1N4O A;  3Q7Z A;  4WEJ A;  1K54 A;  3M2J A;  4DDY A;  3SS5 A;  2HDQ A;  3MFD A;  2I72 A;  5CED A;  5EE8 A;  1FR1 A;  1KGE A;  5JYP A;  1GCE A;  2EFU A;  2OSU A;  3IF5 A;  5FI2 A;  4FSF A;  4R3J A;  3FWL A;  2HP6 A;  1YLY A;  4XXR A;  2ZQ9 A;  1CI9 A;  2H5S A;  3HUM A;  3IH9 A;  1XA7 A;  2ZM0 A;  3AGD A;  4JXG A;  3S4X A;  3Q7V B;  3NCK A;  4ZBE A;  4RX2 A;  4KG6 A;  4OP8 A;  4KZ3 A;  1BZA A;  1YLT A;  5D3O A;  3UDF A;  1ZG4 A;  5DF9 A;  2XFS A;  4BEN A;  1Y54 A;  3V3S A;  4PM6 A;  5HFO A;  2IWC A;  1TDL A;  2EFX A;  1NZO A;  3AGF A;  3VSK A;  5HL1 A;  1ESU A;  2A49 A;  5FA7 A;  1JWP A;  1JWV A;  4A5R A;  1XPB A;  1K6R A;  3FKW A;  4YIN A;  4KZ6 A;  5FQM A;  5FSR A;  1TDG A;  3DWK A;  4S2P A;  4Y7P A;  3G34 A;  4GB7 A;  1C3B A;  4KZ9 A;  1GA0 A;  4XUX A;  4NK3 A;  3HLC A;  3MXR A;  4WMC D;  1Q2Q A;  3DWZ A;  1GHM A;  3HLW A;  1BSG A;  4EV4 A;  3NIA A;  3E2L A;  4KZA A;  3RJU A;  3G4P A;  3BFE A;  4PM8 A;  5I94 A;  1MWS A;  4JF6 A;  2R9W A;  1OME A;  3ZG0 A;  5GHZ A;  1L0D A;  3BFF A;  1K56 D;  2G2W A;  5KSC A;  5GLB A;  5FAS A;  1DJB A;  1KVL A;  5FQJ A;  3Q81 A;  3SS4 A;  5GLD A;  1PIO A;  4WMC A;  1JVJ A;  5BOH A;  4HEF A;  1K57 C;  1H8Y A;  3FKV A;  1IYS A;  1K55 C;  1YLW A;  3N6I A;  2ZD8 A;  1K4F A;  3IF6 A;  4S2K A;  2EX6 A;  5E43 A;  3IXD A;  5DTK A;  4N1X A;  1I2W A;  3CG5 A;  4E3L A;  5KMW A;  5TGF A;  4IBX A;  5U47 A;  3S22 A;  1K56 A;  3C5A A;  2WAF A;  4WZ5 A;  5KZH A;  4DXB A;  2E8I A;  1KE4 A;  4KZ8 A;  3VOY A;  4NET A;  4WEK A;  3OPR A;  4FH4 A;  4P6B A;  3ZG9 B;  1LHY A;  2J9P A;  4ID4 A;  3PBT A;  1EWZ A;  3IXG A;  3FV7 A;  1QMF A;  5FQQ A;  1YMS A;  4ZJ2 A;  4OPQ A;  3HUN A;  3G35 A;  1W8Y A;  1NJ4 A;  1QME A;  1WYC A;  1YLP A;  1CEF A;  3AGE A;  2OLU A;  1SDN A;  4B4X A;  4QD4 A;  2ZLY A;  2Y2Q A;  3O86 A;  1IEL A;  3UPP A;  4HBT A;  1CI8 A;  5J8X A;  4IBR A;  5JYO A;  5EVI B;  3MZF A;  2RCX A;  3Q82 A;  1HZO A;  3SH9 A;  5CGS A;  2JE5 A;  4DE2 A;  4JLF A;  1MWT A;  1FCO A;  1RGY A;  4BL3 A;  3ITB A;  2QZ6 A;  4K0W A;  5GL9 A;  3ISG A;  1NXY A;  4FH2 A;  2ZC7 A;  1BLS A;  2HDU A;  1G6A A;  3IQA A;  3QNB A;  1XXM A;  2WKI A;  2WGW B;  5F83 A;  1VQQ A;  3N7W A;  2WZZ A;  5AQ9 A;  4MNR A;  2DRW A;  4Y0U A;  1LI0 A;  1KDS A;  1ESI A;  4ZAM A;  5F1G A;  1Z6F A;  3UPO A;  4OVD A;  4WZ4 A;  1FR6 A;  3BRM A;  5AQA A;  5DTS A;  1PZO A;  4BL2 A;  3WRZ A;  3ZNT A;  2A3U A;  3A3E A;  5CHM A;  4RYE A;  4JKT A;  4WEL A;  3ZHH A;  1E3U D;  3CZD A;  4RX3 A;  2V20 A;  3BYD A;  2ZJ9 A;  3VP2 A;  4C75 A;  3IWI A;  4N9L A;  4MBH A;  3IXH A;  3P09 A;  3IXB A;  1PI5 A;  4K91 A;  2Q9N A;  1FSY A;  3PBS A;  5E2G A;  4LEN A;  3N8S A;  5EPH A;  5G18 A;  4B88 A;  1K57 A;  1NRF A;  4EQI A;  3RXX A;  3LCE A;  3E2K A;  1K55 A;  1ERO A;  4BLM A;  4IVK A;  1Q2P A;  3A3J A;  4DE1 A;  1DJA A;  1E25 A;  1MWU A;  1E3U A;  5FAO A;  4UHU A;  4E3K A;  3BM6 A;  3C4O A;  2Y2G A;  3LY4 A;  3UE1 A;  4QHC A;  2J7V A;  2OLV A;  3BEB A;  4ZTK A;  1W5D A;  2FFY A;  4N92 A;  5HW3 A;  5EUA A;  1PW8 A;  2VGJ A;  4ZDX A;  1ONG A;  2HPB A;  4OKP A;  3VP4 A;  3C7U A;  1BLP A;  3WS1 A;  4X55 A;  4OQI A;  3Q07 A;  2EX9 A;  4QB8 A;  4H8R A;  4WBG A;  1BUL A;  1S6R A;  5FQK A;  4OQG A;  2V2F F;  4OOL A;  5HAI A;  2BG1 A;  5FAT A;  1ZKJ A;  4OPY A;  4JXS A;  4LV0 A;  5DTT A;  4PM5 A;  1AXB A;  2EX8 A;  4N9K A;  3VFF A;  5A90 A;  4BJP A;  4E3O A;  4GOG A;  3Q7V A;  5EVI C;  4R3B A;  3WS4 A;  3DW0 A;  3WS0 A;  2WUQ A;  5GLA A;  3VFH A;  2Y59 A;  4C3Q A;  4LCL A;  4KQQ A;  4JF5 A;  1JWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...