1EROA

X-ray crystal structure of tem-1 beta lactamase in complex with a designed boronic acid inhibitor (1r)-2-phenylacetamido-2-(3-carboxyphenyl)ethyl boronic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TEM-1 BETA-LACTAMASE
publication title Structure-based design guides the improved efficacy of deacylation transition state analogue inhibitors of TEM-1 beta-Lactamase(,).
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1eroA00
2OLVA 3BLMA 1ONGA 1YM1A 4R3BA 4OONA 5CGSA 2WZZA 1IYSA 1MWRA 3NIAA 5DF7A 4MLLA 1AXBA 4B88A 2ZD8A 4X69A 2XLNA 1K56D 4R23A 3G34A 3W4OA 4CPKA 1SDNA 4UA9A 5FASA 5HAQA 1PW1A 3BFDA 1FSYA 1O07A 3PTEA 4GNUA 3QNBA 3ZG9B 4CJNA 5KZHA 4R4RA 1BLHA 4IBXA 1NYYA 3WRZA 3A3FA 5EVIC 3OCLA 4K0XA 4EBNA 4WEJA 3OCNA 5EUAA 1E3UD 3IF6A 3BFGA 1GA0A 3ZNYA 3FZCA 1YLWA 1K25A 5HAIA 3BEBA 5CHMA 3C4PA 3UNWA 1ES2A 4KENB 2OV5A 2FFFB 4YINA 1LI9A 4MBHA 5FAPA 4QY5A 4XUZA 1IKGA 1ES3A 2Y2NA 2Y91A 2HDUA 5CTNA 3ISGA 4RVAA 5AQAA 1K4EA 2XR0A 1KGFA 1NJ4A 1YMXA 2Y2PA 3Q1FA 4KZ6A 3O88A 3ZG5A 1PZOA 2EXAA 1KDWA 2HPBA 4DE2A 2V1ZA 3PBOA 3WS1A 4GDBA 4GOGA 4B4ZA 3IQAA 1FQGA 3C7VA 4OLGA 4GZBA 3V50A 1XGIA 1ALQA 5FI6A 1BUEA 4U0XA 1U60A 2Y2LA 3N4IA 3G32A 4E3NA 4OP8A 2BG1A 1Z6FA 1CEFA 4UA6A 1K6RA 5FATA 2EFUA 4DDSA 4EWFA 5HL1A 4OPZA 1L2SA 2Y2GA 4GKUA 4BL2A 1VQQA 2DCFA 2I72A 4KQRA 1K6SA 4LCLA 3QHYA 1GCEA 3VSLA 5DVAA 4DE0A 1BLCA 5EVIB 1K54C 1S0WA 1XP4A 3A3EA 4C75A 4EUZA 3Q7VA 3GSGA 1W5DA 3BLSA 3PBTA 1XA1A 5A90A 1FR1A 2ZQAA 3LY4A 4Y0TA 1YLTA 5FQKA 2QPNA 1IKIA 2ZM0A 4OP5A 2X71A 2P74A 3VMAA 2Q9NA 4KZ5A 5FAOA 3IXHA 4OQGA 1N4OA 4JXSA 3G4PA 3ZVTA 1CI9A 1M40A 1W8QA 3GV9A 4MBKA 3WWXA 2XF3A 5HX9A 2G2WA 3G30A 5FA7A 5E2GA 3UN7A 1HTZA 1DJAA 3BRMA 5KSHA 1O7EA 3N8SA 5E2HA 1HD8A 1LL5A 4QB8A 1K4FA 4DF6A 5JYOA 3HUNA 4S2JA 4ZDXA 3RJUA 1XPBA 1ESIA 3MZEA 3UDIA 1MKIA 1Y54A 3PAEA 2WAEA 3V39A 1IYQA 2XD1A 1KDSA 1L0EA 1ZC2A 3HLBA 4XXRA 5CXWA 2A3UA 3VFFA 4Y0OA 4S2KA 1NZOA 3DWZA 4EQIA 4OLDA 4OQHA 1QMEA 3AGEA 5E2EA 1PIOA 4DRTA 4JF5A 4E3OA 1CEGA 1BLPA 3IF6C 4GN2A 3UDFA 3ZHHA 4O7DA 3MXSA 2WGWA 4WELA 3NDEA 2WGWB 3Q07A 4Y0UA 5F83A 4BL3A 5HAPA 3NI9A 4KQQA 3E2KA 1Q2QA 1JWPA 2XD5A 4IVKA 3SS5A 4EV4A 4PM5A 4QD4A 2VGJA 1MPLA 1JTDA 2Y2HA 3PBSA 5CRFA 4IEDA 4JF6A 4OOYA 2HDSA 1BLSA 4WBGA 4XUXA 4OQ0A 5GL9A 2J9OA 4WZ4A 1NZUA 2PU4A 4ZTKA 1K55A 5TFQA 3LO7A 5CTMA 3CMZA 3C5AA 3PBRA 3N7WA 5EE8A 1YLZA 4Q8IA 5GHZA 1LLBA 2ZLYA 1IYPA 4KG5A 1K38A 1VM1A 2P9VB 5I94A 4BD1A 3WRTA 3O86A 1DY6A 3IXDA 3IWQA 3PAGA 5FQMA 4PM9A 4N1XA 3P98A 5AQBA 3WS0A 5CGWA 3WS5A 3BYDA 5AQ9A 2C5WB 4BQMA 5CECA 3FKWA 2ZM2A 3MKFA 3IWIA 5EECA 4JLFA 1BT5A 5IHVA 3S1YA 3ZVWA 5KMWA 1YLYA 3ITAA 3Q7ZA 4UAAA 1CK3A 1NYMA 2PBYA 4FCFA 4RX2A 5HARA 1NXYA 1K57C 5E2FA 1XXMA 3GRJA 5FQIA 3IHBA 1ZKJA 2H0YA 4JKTA 3V3SA 4PPRA 3HLCA 3LCEA 3UE1A 4E3KA 2XK1A 3FWLA 4YFMA 2JE5A 4RX3A 4MNRA 4E6WA 3DTMA 1EWZA 1IYOA 4S2NA 4E3JA 4X55A 5F1GA 4LV2A 5GLBA 4IBRA 5AQ7A 1FOFA 3IXBA 1GHPA 4OPRA 4X53A 1PZPA 4OH0A 2XFSA 3VP0A 5D3OA 4ZJ3A 1ES5A 4R1GA 5M19A 2XQZA 5CHJA 4B4XA 2HDRA 5BOHA 2EX6A 1LI0A 3PBNA 3RXXA 3MZDA 3TOIA 4N9LA 3FV7A 3G2YA 1XKZA 2G2UA 4E6XA 4KZAA 2JCHA 3N6IA 2ZQDA 2A49A 3M2JA 5U47A 3V5MA 3ZGAB 5DTKA 3D4FA 2DRWA 3N8RA 1LL9A 3M2KA 1IEMA 5CERA 1MY8A 4S2LA 3TG9A 3M6BA 1G6AA 2WGIA 3VOZA 1TEMA 4OPYA 5KSCA 2IWCA 2ZC6B 1JWVA 2WKEA 2WK0A 2UWXA 4X56A 5EVIA 1YMSA 1PI4A 2ZC5B 2FFYA 3RXWA 2R9XA 2WADA 4PM7A 1PWGA 3PBQA 4IVIA 1GA9A 2WGVA 3OC2A 4N1HA 3IT9A 3OPLA 3LY3A 5CEBA 3UPNA 1KE4A 2J7VA 4LV1A 4DKIA 3OZHA 2Y2OA 2RL3A 2J9PA 4K91A 2WUQA 4WYYA 4QJGA 2XGNA 4RYEA 3FYZA 1NY0A 3WS2A 1KVLA 3C7UA 2B5RA 4S2OA 2HDQA 1KE3A 4WMCA 5F82A 3HLEA 3O3VA 1DJBA 1N9BA 5DTSA 4X68A 3QNCA 4BLMA 3MKEA 4PM6A 3ZFZA 1I2WA 4QHCA 1K55C 2EXBA 3OPHA 1JVJA 2QMIA 1LHYA 3P09A 4FD8A 5TR7A 3SH7A 3VP4A 1XGJA 2ZC7A 1DJCA 2HP5A 4EBLA 1MBLA 1PI5A 2ZMAA 3CG5A 4HBUA 4P87A 4GD8A 4D2OA 5A93A 1FCNA 2Y2KA 2JC7A 2E8IA 5M1AA 3UE3A 4DE3A 1YQSA 2VGKA 5FI7A 2ZQ9A 5FSRA 4E3MA 2WZXA 3GTCA 4S2MA 4UHUA 2ZQ7A 5E43A 1SCWA 1JWZA 2Q9MA 4GD6A 3EQUA 1FSWA 2WKHA 4JXGA 4Z9QA 1TDLA 4OOLA 4KZ7A 5DTTA 5J8XA 1K56A 4ID4A 4DE1A 1L0GA 4JXVA 4R3JA 4OVDA 5A92A 1MWSA 3SH8A 4OQIA 1E4DA 2GDNA 4ZJ2A 1S6RA 2PU2A 3OPPA 2Y55A 2XDMA 5A91A 1BSGA 5TGFA 1SDEA 4M3KA 4WZ5A 4S2NC 1BULA 1H5XA 3UDXA 3G2ZA 3ZDJA 2BLSA 2P9VA 3S4XA 3VP1A 1ERMA 4R0QA 3VFHA 1E3UA 1GHMA 3HUOA 1KVMA 3W4PA 3W8KA 1RGZA 4BJPA 3HL9A 2XH9A 3UY6A 2ZJ9A 3GVBA 3BFCA 3IH8A 3A3IA 1BZAA 5FAQA 1CI8A 3VOYA 3VP3A 4A5RA 5EVLA 2WAFA 3HVFA 1MXOA 3ITBA 4H8RA 4JF4A 3HLWA 3BFEA 3IXGA 4E3LA 3IF5A 3AGDA 5M18A 3IHAA 1YLPA 4KZ4A 1ZG4A 4KZ9A 1ONHA 4S2IA 4PMAA 5F1FA 2QZ6A 4LCMA 4C6YA 4KG2A 2V20A 4L0LA 5CGXA 1ESUA 4MBFA 3BM6A 5FDHA 2RCXA 1W79A 1WYBA 4LV3A 3E2LA 4GB7A 1PYYA 3A3JA 4HEFA 1HVBA 5L2FA 3IF6B 1Q2PA 1GHIA 2ZQCA 2Z2MB 4FSFA 3WS4A 4UA7A 1BTLA 3NBLA 1SHVA 2WYXA 2DNSA 3HLDA 3MZFA 1XX2A 1KGEA 5GHYA 4WM9A 1YLJA 1XA7A 1JTGA 3NC8A 1TVFA 3UE0A 3UPPA 1C3BA 4MEZA 3Q82A 2ZC3B 3SS4A 4BD0A 2Y4AA 1FR6A 2Y2JA 1EROA 4NK3A 2HP9A 2OLUA 2EX9A 2CC1A 2HP6A 3OPRA 4EBPA 5CHUA 2R9WA 3MFDA 1L0DA 3ZCZA 3DW0A 1L0FA 4NETA 4P85A 3HLGA 3G31A 3ZNTA 1OMEA 4KZ3A 1EI5A 3M6HA 2WKIA 3BFFA 4C3QA 3UPOA 2H10A 1FCOA 3NCKA 5GLAA 2V2FF 3W4QA 4LV0A 1TDGA 4FH2A 5GLDA 1RP5A 4ZJ1A 1FCMA 2OSUA 3HLFA 3SS3A 2XEPA 4RA7A 2Y2MA 4S2PA 1NRFA 3S22A 2Z2LB 4KG6A 1K57A 3DWKA 1MWTA 5FQ9A 3I7JA 4HESA 3C4OA 3NDGA 1RCJA 3GMWA 4PM8A 1QMFA 5FQJA 4U3TA 1RGYA 2EFXA 3MXRA 4OKPA 1W8YA 4U0TA 1WYCA 5JYPA 1J9MA 3B3XA 4P6BA 5EOOA 3V3RA 1MWUA 4LENA 4KQOA 5HW3A 2EX8A 5EOEA 4JXWA 1ERQA 3Q7VB 5G18A 4JPMA 4QU3A 1PW8A 3VSKA 1W7FA 2ZM8A 5DF9A 3BECA 4WEKA 2C6WB 3LEZA 5FI2A 3CZDA 4WZ5C 5EPHA 4E3IA 3MBZA 1SKFA 1KGGA 5EVID 2IWDA 1IELA 4OOMA 4N92A 4K0WA 4JBFA 1YT4A 4Y7PA 3VP2A 1I2SA 3Q81A 2Y2QA 2EX2A 3CJMA 2XFTA 5HFOA 4BENA 3O87A 1I5QA 5DF8A 5FQQA 1M6KA 3SOIA 4FH4A 1H8ZA 1G68A 3FKVA 4DDYA 3TSGA 2Y59A 3A3DA 4ZAMA 3HUMA 3SH9A 1KE0A 4N9KA 3IH9A 3EQVA 2JBFA 3GQZA 4WMCD 3ZG8B 1H8YA 2IWBA 2ZQ8A 5CEDA 2H0TA 2X02A 1ES4A 3N8LA 4KZ8A 4P0MA 2X01A 4F94A 1E25A 5GLCA 1WE4A 1PWDA 2ZC4B 1K54A 3NY4A 4ZBEA 3UO9A 3IWOA 4GDNA 4OPQA 4X6TA 2Y2IA 1ZG6A 3GR2A 1PWCA 2H5SA 4HBTA 4QY6A 4R4SA 4DXCA 3HBRA 3ZG7B 1HZOA 3JYIA 5GHXA 4KZBA 4DXBA 3AGFA 3G35A 3ZG0A 3HREA 2J8YA
chains in the Genus database with same CATH superfamily
2VA0A 3MXQA 1YM1A 2WZZA 1MWRA 3EWKA 4DN0A 2XLNA 1K56D 3W4OA 4CPKA 2QKPA 5TBMB 1X0OA 3BFDA 1O07A 3ZG9B 4NXGA 3NULA 4EBNA 3IF6A 1HLUP 2KLIA 3BEBA 3C4PA 4KENB 2JHEA 4MBHA 2OWHA 4I3IA 1ZTUA 2Y2NA 2Y91A 2HDUA 4RVAA 5AQAA 1OTBA 1NJ4A 4KZ6A 1PZOA 2EXAA 2HPBA 1CQAA 4GDBA 5EFWA 4B4ZA 1DRMA 1FQGA 3C7VA 5MC7A 4GZBA 1BUEA 4U0XA 2Y2LA 3N4IA 1CEFA 4UA6A 3CPTA 1PNEA 2EFUA 2VV6A 3IS2A 4GKUA 1H3QA 4BL2A 3T4JA 5IU1A 2ZOIA 1OTAA 2B02A 4UQIM 4EUZA 5A90A 3BLSA 1FR1A 1IKIA 2ZM0A 3IXHA 1N4OA 4JXSA 5AJGA 3WWXA 3GV9A 2XF3A 1V9YA 1O7EA 3N8SA 4NXBA 5E2HA 4ZDXA 3K3CA 4D60A 2XA7M 4L9GA 3EOIA 1IYQA 3NHQA 2W3DA 4S2KA 1NZOA 5AVFA 3DTKA 4B9OA 4E3OA 3KYEA 3T4LA 4LRYC 2VLGA 4EXOA 3NDEA 4BL3A 2EWVA 4EERA 3E2KA 2M7UA 1LT0A 4QD4A 2MJ6A 4BBUA 1D06A 2HDSA 3S7OA 3QP2A 4YNRA 2PR5A 3LO7A 3CMZA 3MFXA 5EE8A 3RTYA 2ZLYA 1K38A 3PAGA 1TS7A 3H7WB 3RFBA 5DFYA 3WS5A 4BQMA 5CECA 4DJ3A 2ZM2A 4O8GA 4GLQA 5EECA 5IHVA 3NECA 4UAAA 5FQIA 3H82A 4HI4A 3V3SA 3UE1A 1Y28A 4RX3A 4PKYG 4S2NA 3QP5A 4OPRA 4OH0A 3VP0A 4ZJ3A 2LB9A 2XQZA 4LPZA 4B93A 2OAQ1 5BOHA 3MZDA 3FV7A 2G2UA 4E6XA 2JCHA 5DJUA 4GCZA 5U47A 3V5MA 3D4FA 2DRWA 5FEFA 3N8RA 2V1AA 2H28A 3M6BA 4EESA 3DAVA 3MJQA 2V8CA 2PAVP 3PHYA 5EVIA 1YMSA 3FC7A 1PRQA 3R7WA 5HDDA 4JGRA 4DKIA 2Y2OA 2RL3A 4K91A 3T1RA 2WUQA 4HQAA 3WS2A 3C7UA 1W63M 3S7NA 2HDQA 1KE3A 1T1BA 3ZQ5A 5F82A 3HLEA 4WN5A 1DJBA 2W3GA 3MKEA 4PM6A 1AWIA 4QHCA 3F1NB 1JVJA 2QMIA 1LHYA 4FD8A 3SH7A 1TS6A 1J3WA 1DJCA 2HP5A 2ZC7A 3TE8A 4ETXA 4HH2A 5I5LA 3CG5A 4P87A 2JKTM 1FCNA 5FI7A 1S4SA 3BW6A 2VGLM 1XJ6A 2ZQ7A 1JWZA 2Q9MA 3T4SA 4JXGA 4Z9QA 5DTTA 4ID4A 1IFQA 4R3JA 3OPPA 5DKKA 2XDMA 5A91A 3U4LP 1SDEA 2HJ9C 2PYRA 3G2ZA 2P9VA 4GHIB 3VP1A 1T19A 3F1PB 3BFCA 1BZAA 1DP6A 1CI8A 1G28A 3VP3A 4HJ4A 3HLWA 4E3LA 3UB5P 3LGOA 4R3AA 5J4EA 3NJAA 5EM0A 3HJIA 1ESUA 4MBFA 3BM6A 2M7VA 1PYYA 1HVBA 4EEUA 3IF6B 1Q2PA 2EWWA 2BASA 1SHVA 2WYXA 3HLDA 1YLJA 3NC8A 1TVFA 5F69A 1C3BA 1FR6A 4CLCA 1N9OA 2CC1A 4HY8A 5G4ZA 1L0DA 1KOUA 3MSHA 3W4QA 4LV0A 1TDGA 4GS9B 5GLDA 3IX8A 2VJWA 3ICYA 1OTIA 2OAP1 4RA7A 2Y2MA 3CPTB 4S2PA 2J3WA 3IS2B 4HESA 3C4OA 1RCJA 4CLCD 1QMFA 2EFXA 3MXRA 1W8YA 3QP1A 1WYCA 2XSSA 5EOOA 1NRJA 2EX8A 4JPMA 2VZWA 4PHTA 2ZBBA 5EPHA 2IWDA 2P08A 4K0WA 1MKMA 1Z09A 2EX2A 3CJMA 3D3OA 1NWZA 3O87A 4PKYA 1H8ZA 1G68A 3TSGA 2Y59A 2B18A 1T1AA 4N9KA 2JBFA 4WMCD 3E4OA 1A0KA 4BBVA 2X01A 5GLCA 1PWDA 3IWOA 2Y2IA 3P01A 5HPIA 2HV1A 1VEUA 1PWCA 3OLOA 3PYPA 1XJ3A 4H6JA 5CGSA 1IYSA 3NIAA 2ZD8A 4X69A 1ACFA 4MDZA 1SDNA 1ODVA 3TRCA 3T1SA 5FASA 3KSGA 1FSYA 3PTEA 5KZHA 4KQDA 2HZ5A 3OCNA 1GA0A 3IBJA 3T4OA 5L07A 5CHMA 3H82B 2OV5A 2AVXA 1LI9A 3MS6A 5CTNA 4HH3A 2XR0A 1KGFA 1GSVA 3LR3A 3MR0A 1STZA 1FILA 4GOGA 3D9YA 3IQAA 4OLGA 3V50A 1W63Q 1ALQA 2O0YA 3BJNA 1U60A 1D1JA 4E3NA 3T12B 3V67A 1K6RA 5FATA 3DBAA 5HL1A 4LFUA 4OPZA 2INWA 5F5YA 3EEAA 5HDCA 4KQRA 1TS8A 3QHYA 1BLCA 5EVIB 4C75A 3Q7VA 3GSGA 4HP4A 3PBTA 1XA1A 3VE4A 4L9FA 4Y0TA 5FQKA 2QPNA 4OP5A 2P74A 4KZ5A 1GSWA 1W8QA 4KUKA 2JKFA 5HX9A 2G2WA 3G30A 2YKFA 1DJAA 1HTZA 3BRMA 3GDIA 1FIKA 1HD8A 1LL5A 3HUNA 2I9VA 3RJUA 3MZEA 1Y54A 1XJ4A 3PAEA 2WAEA 3LI8A 5DKLA 1ZC2A 3BY9A 3VFFA 4EETB 1BYWA 4EQIA 4OLDA 4OQHA 1PIOA 4JF5A 1CEGA 1BLPA 3IF6C 3UDFA 3ZHHA 4O7DA 2P04A 4WELA 3LYXA 2WGWB 4P6ZS 2XD5A 4IVKA 1V9ZA 3PBSA 2Y2HA 5CRFA 5HWTA 5J3WA 4XUXA 1ZHHB 5GL9A 5F68A 4OQ0A 2J9OA 4ZTKA 1K55A 5TFQA 5CTMA 3PBRA 3C5AA 4Q8IA 3KYZA 1LLBA 3MQQA 2V9AA 1VM1A 2P9VB 4MCWA 3O86A 5FQMA 4N1XA 5AQBA 2Y8HA 3WS0A 5CGWA 1K0KA 3BYDA 4MN6A 5EVEA 5FEGA 3L9KA 4JLFA 1BT5A 3ZVWA 3ITAA 1NYMA 4WL9A 1XXMA 3IHBA 2H0YA 4YOFA 4PPRA 4Y2FA 2XK1A 3FWLA 4YFMA 3DTMA 3TJZC 5AQ7A 1FOFA 2Y79A 1GHPA 4X53A 3O5YA 1ES5A 4I3JA 1SZVA 4R1GA 2ZL1A 5CHJA 1P9WA 2HDRA 2EX6A 4CLCB 4N9LA 4KZAA 2A49A 3ZGAB 1LL9A 1IEMA 3UMEA 4S2LA 3TG9A 5KSCA 2ZC6B 2OWJA 3RXWA 4PM7A 3UMDA 1GA9A 3OC2A 3OPLA 3LY3A 5CEBA 3UE6A 3OZHA 2L1MA 3S7PA 4BMWA 4QJGA 2XGNA 4RYEA 2HF6A 2ZMVA 4BWIA 3LIEA 4S2OA 4ME4A 3O3VA 4UQIS 4BLMA 4EW7A 2O99A 2EXBA 4NG2A 3P09A 5TR7A 5AVEA 3VP4A 4EBLA 2ZMAA 4D2OA 2Y2KA 5M1AA 1YQSA 1DP9A 5FSRA 2NUPC 2PD7A 3R4KA 1CF0A 1SCWA 1OJGA 3EEHA 1S1YA 3G6OA 1FSWA 2WKHA 2XA7S 1TDLA 3W2ZA 5J8XA 1F5MA 4JXVA 3C30A 4OQIA 1E4DA 4ZJ2A 1JNUA 1S6RA 1VEUB 2XRNA 4S2NC 1BULA 2WKPA 1ERMA 1E3UA 3LI9A 4BJPA 3HL9A 4H6JB 2XH9A 3GVBA 5FAQA 3T4TA 4A5RA 3HVFA 1MXOA 3ITBA 4H8RA 5C5KA 3IF5A 5G4YA 5FDSA 1YLPA 3OBFA 4C6YA 2V20A 4Q0HA 5CGXA 2RCXA 1W79A 3E2LA 2PR6A 5L10A 1GHIA 1YKDA 2ZQCA 4FSFA 4UA7A 3NBLA 2DNSA 3MZFA 3JVUA 4R70A 1XA7A 3UE0A 4MEZA 3Q82A 4FTXA 2Y2JA 3LEQA 2OLUA 3C2WA 3OPRA 3PXPA 4EBPA 4YWZA 5CHUA 2R9WA 3ZCZA 5IS1A 3C38A 2M1CA 3M6HA 1S1ZA 2O9CA 4C3QA 3NCKA 4LRZE 2WKQA 3FPWA 3LIBA 1XFNA 1RP5A 1FCMA 1CJFA 2Z2LB 4M4XA 5FQ9A 3VE3A 3T50A 3NDGA 4PM8A 5FQJA 4EUVA 4U3TA 1RGYA 5JYPA 4P6BA 3V3RA 4LENA 4I39A 5EOEA 5G18A 4JXWA 1ERQA 3Q7VB 2L0WA 1PW8A 4R6LA 1W7FA 3LEZA 4XT2A 4E3IA 1SKFA 5EVID 5HDSA 1IELA 3IBRA 4G3KA 4OOMA 4JBFA 2V0WA 2K2NA 3Q81A 1MZUA 4BENA 1I5QA 3JPUA 1TS0A 4FH4A 4AFIA 1S67L 3HUMA 3EQVA 3GQZA 3NOTC 5F6AA 5CEDA 1H8YA 2IWBA 3LIDA 5HD5A 3N8LA 1PFLA 1E25A 3B42A 1K54A 2KDKA 2PRFA 3A0SA 4OPQA 5EM1A 4DXCA 2VGLS 2W3HA 3LFVA 1HZOA 3G35A 3ZG0A 3BLMA 3BWLA 1OTEA 4Q0IA 4R3BA 4OONA 4CLCC 1LSWA 4X25A 3QP8A 1YSPA 4MLLA 1AXBA 4B88A 2D01A 2O9BA 4R23A 2VK3A 4UA9A 1PW1A 4HNBA 4GNUA 3QNBA 4CJNA 4R4RA 5TJJA 2XROA 1NYYA 3WRZA 3A3FA 2A2LA 3OCLA 4JGOA 4WUJA 3LR4A 3ZNYA 3FZCA 1YLWA 5L8MA 1ES2A 4YINA 3CITA 4QY5A 4XUZA 4K08A 4I38A 3HCYA 1K4EA 2Y2PA 3O88A 3KSIA 3MQOA 2PDRA 4DE2A 2V1ZA 3PBOA 3WS1A 5FL3A 2EA9A 4I3AA 2ZL1B 4F3LA 1XGIA 5FI6A 2VX8A 3CAXA 2Z6CA 3UB6A 4HHDA 2BG1A 2PD8A 3LIFA 2W3FA 5L09A 4DDSA 1L3LA 1GSXA 4II7A 1L2SA 3E98A 2DCFA 2I72A 1K6SA 4LCLA 1GCEA 3K3DA 1XP4A 3A3EA 2ZQAA 3U2AA 1OPXA 1YLTA 2X71A 3VMAA 2Q9NA 1UGUA 4OQGA 3G4PA 3ZVTA 1M40A 3ZYTA 4GJ4A 2G7UA 3UN7A 5E2GA 2V1BA 4QB8A 4DF6A 4S2JA 1H0MA 1XPBA 3UDIA 2B95A 3V39A 4NXEA 2XD1A 3HLBA 5CXWA 4XXRA 4Y0OA 2A24A 3DWZA 2LB5A 3KSHA 3BQAA 3AGEA 4DRTA 2W27A 4GN2A 4G3VA 5F83A 1Q2QA 4EV4A 4PM5A 4WF0A 2VGJA 1MPLA 1JTDA 4IEDA 4OOYA 4WBGA 1BLSA 3BQ8A 4WZ4A 1NZUA 3N7WA 1YLZA 5GHZA 2QJ7A 5I94A 3CI6A 2QJ5A 3P98A 4G3WA 3HJKA 3MKFA 3IWIA 5KMWA 3Q7ZA 1CK3A 2PBYA 4FCFA 5E2FA 1K57C 3GRJA 2CMNA 3MQ0A 5HWVA 3HLCA 3LCEA 3KO6A 4E3KA 2JE5A 1T1CA 4E6WA 3QP4A 1IYOA 4E3JA 5F1GA 4LV2A 5GLBA 3IXBA 2VV7A 3A0VA 5D3OA 1VHMA 5M19A 4O01A 3PBNA 3RXXA 1YPRA 3G2YA 2L4RA 1P0ZA 3N6IA 2ZQDA 3M2JA 1MY8A 3CUEC 1G6AA 3VOZA 2IWCA 1JWVA 4WLAA 1PI4A 2VEAA 2ZC5B 4FUWA 1PWGA 3PBQA 4IVIA 4L9EA 4N1HA 3IT9A 3R7WB 3CWFA 3EGXC 2J7VA 3DTEA 3F1OA 4JGQA 1NY0A 2B5RA 3RH8B 4CQHA 1N9BA 3T4KA 3TW8A 1VETA 5DTSA 2QWSA 1I2WA 1K55C 3E4PA 2IA2A 3B47A 4NEED 4Y13A 1MBLA 1PI5A 2J3TC 4HBUA 5A93A 4GD8A 2E8IA 4DE3A 3GTCA 4UHUA 4DMZA 4GD6A 3EQUA 4OOLA 4KZ7A 1K56A 4DE1A 1L0GA 4Y15A 4OVDA 1MWSA 2GDNA 2PU2A 2Y55A 1BSGA 5TGFA 4M3KA 4WZ5A 3ZDJA 2BLSA 4R0QA 3HUOA 1KVMA 3W4PA 2QHKA 1RGZA 1IOUA 2K31A 4Y3IA 3SZTA 3UY6A 3IH8A 3A3IA 5EVLA 2WAFA 4MN7A 4X1MA 5M18A 4KZ4A 1ZG4A 1ONHA 5F1FA 2QZ6A 5HWWA 2KOIA 4KG2A 4L0LA 5FDHA 1WYBA 3A3JA 1SKOA 5L2FA 4PAUA 2J3TD 2PYPA 3WS4A 3UPPA 2ZC3B 4BD0A 2Y4AA 4ETZA 1EROA 4NK3A 2EX9A 2HP6A 1NLYA 1P97A 1L0FA 4P85A 3G31A 1OMEA 3DTIA 1N9NA 3BFFA 3UPOA 2H10A 3K2NA 2W1TA 4GS9A 3FG8A 4F3LB 4ZJ1A 1VB6A 3SS3A 2XEPA 3P7NA 4KG6A 3DWKA 3EGDC 4IUHA 2FZ0A 4U0TA 4X1LA 5HW3A 3VSKA 3L7HA 4QU3A 1XFQA 2Q0OA 3KSFA 1WA9A 5DF9A 3BECA 4WEKA 1UWNX 3PR6A 3MBZA 3LR0A 4Y7PA 3VP2A 3MF0A 2XFTA 5HFOA 1M6KA 3SOIA 3FKVA 3A3DA 3SH9A 4QWOA 3IH9A 4IHQA 1OTDA 3ZG8B 2ZQ8A 2X02A 1LL8A 1ES4A 4KZ8A 4P0MA 4E04A 1WE4A 2A24B 3OOVA 2E8JA 2UV0E 3GR2A 2K7SA 3H9WA 5GHXA 3JYIA 4KZBA 2NUTC 4DXBA 3AGFA 4LGWA 4S2IA 2J8YA 2OLVA 1ONGA 4LRXC 5DF7A 3G34A 1UWPX 5K5BA 1DP8A 5HAQA 3LUQA 4JGPA 2V8FA 4EEPA 1BLHA 2W1RA 4IBXA 5EVIC 4K0XA 4WEJA 5EUAA 3FPVA 1E3UD 3BFGA 3NOPC 1XJ2A 1K25A 5HAIA 1YAXA 3UNWA 2FH5A 2FFFB 5FAPA 4ARZA 4Y5FA 1IKGA 1ES3A 3KYQA 2R78A 3ISGA 3UB7A 1YMXA 3Q1FA 3ZG5A 1F2KA 1KDWA 1TF1A 3UB8A 4Y17A 5J7EA 3G32A 1D7EA 4OP8A 4MN5A 1Z6FA 4EWFA 2ACGA 2Y2GA 5HZHA 1G5UA 5HPFA 1VQQA 2ZOHA 3VSLA 2KX6A 5DVAA 4DE0A 3LR5A 1K54C 1S0WA 4BBTA 3C8CA 1W5DA 3LY4A 2Z6DA 4EQ1A 4IJGA 5FAOA 3F1OB 4ZRRA 1CI9A 4MBKA 3E4QA 5FA7A 1F9IA 5KSHA 1OT6A 1K4FA 5JYOA 1VETB 1ESIA 1MKIA 1KDSA 4DJ2A 1L0EA 2A3UA 1MC0A 2DMWA 2HJEA 1QMEA 5E2EA 4FOFA 3MXSA 2WGWA 3Q07A 4Y0UA 5HAPA 3NI9A 4KQQA 2JKGA 2JKRM 1JWPA 3SS5A 2GZAA 4HJ6A 1YSQA 4NXFA 4JF6A 2PU4A 2PHYA 1H8MA 1IYPA 4KG5A 5TBMA 4BD1A 1NLZA 3WRTA 1F98A 1DY6A 3IXDA 3IWQA 3LIAA 4PM9A 1T18A 5AQ9A 2C5WB 5HD3A 3FKWA 5DFXA 3S1YA 1YLYA 2JKTI 4RX2A 5HARA 1NXYA 1ZKJA 4JKTA 3T4QA 4I5SA 4MNRA 1EWZA 2JKRI 1SKOB 4X55A 4IBRA 4HJ3A 4LLOB 1PZPA 2XFSA 1OJ5A 3VV4A 4B4XA 3IX4A 1LI0A 3TOIA 4HOIA 1XKZA 3NOUC 3E0YA 5KIZA 2V0UA 2OOLA 5DTKA 3M2KA 2GJ3A 5CERA 3MMHA 4GW9A 4RQ9A 2WGIA 1TEMA 2W1TB 4OPYA 4UEYA 3LICA 5LBRA 2WKEA 2WK0A 2PBDP 4X56A 2UWXA 1EW0A 3D72A 2FFYA 3A0RA 2R9XA 2WADA 2WGVA 3UPNA 1KE4A 4LV1A 2J9PA 2O9AA 4WYYA 2QYBA 3FYZA 3T1QB 1KVLA 4WMCA 4X68A 3QNCA 4IUKA 3ZFZA 1LSVA 3OPHA 3T1XA 1TD5A 1G6OA 1XGJA 2WKRA 2JC7A 3UE3A 2VGKA 3KX0X 3VOLA 2ZQ9A 4E3MA 2WZXA 1S4RA 4S2MA 5HSQA 5E43A 4EU0A 5A92A 3SH8A 1LSXA 3CLOA 3GECA 1H5XA 3CHWP 3UDXA 3S4XA 4Q0JA 3VFHA 1GHMA 1S66L 3W8KA 3UB9A 1P9RA 3H7WA 2ZJ9A 3VOYA 4JF4A 5DJTA 3BFEA 3IXGA 3AGDA 3IHAA 4KZ9A 4PMAA 3IX3A 4LCMA 2P7JA 2BTFP 4LV3A 4GB7A 4HEFA 3JVVA 2GNXA 3S7QA 2Z2MB 1BTLA 1XX2A 1KGEA 5GHYA 4WM9A 2W3EA 1JTGA 5EV0A 3BY8A 3SS4A 4HP9A 2HP9A 4ARZB 2JN7A 4CLCE 2PT7A 3MFDA 3DW0A 4NETA 3HLGA 5CX7A 3ZNTA 4KUOA 4KZ3A 1EI5A 2WKIA 1FCOA 5GLAA 2ZMFA 2V2FF 1OT9A 4FH2A 5A8BA 4O0PA 1N9LA 2OSUA 3HLFA 2W0NA 4NKPA 1NRFA 3S22A 1K57A 1MWTA 3I7JA 4QPRA 3GMWA 4OKPA 1J9MA 3B3XA 5IT5A 1MWUA 3QP6A 4KQOA 2VV8A 2J80A 2ZM8A 3F1NA 2C6WB 5FI2A 3CZDA 4WZ5C 4XT2B 1KGGA 4MMNA 4ESPA 4N92A 1YT4A 2HGVA 4HIAA 1I2SA 2Y2QA 2YKHA 5DF8A 5FQQA 4DDYA 4ZAMA 4Z1WA 1KE0A 2D02A 4P6ZM 3CUEA 2H0TA 1Y4OA 3B33A 4F94A 2ZC4B 3NY4A 4ZBEA 3UO9A 4GDNA 4X6TA 1ZG6A 3ULFA 3SW1A 2H5SA 4HBTA 4QY6A 4R38A 4R4SA 2VKSA 3HBRA 4GHIA 3ZG7B 2GX5A 5HL6A 3F1PA 3HREA
chains in the Genus database with same CATH topology
2OLVA 3BLMA 1ONGA 1YM1A 4R3BA 4OONA 5CGSA 2WZZA 1IYSA 1MWRA 3NIAA 5DF7A 4MLLA 1AXBA 4B88A 2ZD8A 4X69A 2XLNA 1K56D 4R23A 3G34A 3W4OA 4CPKA 1SDNA 4UA9A 5FASA 5HAQA 1PW1A 3BFDA 1FSYA 1O07A 3PTEA 4GNUA 3QNBA 3ZG9B 4CJNA 5KZHA 4R4RA 1BLHA 4IBXA 1NYYA 3WRZA 3A3FA 5EVIC 3OCLA 4K0XA 4EBNA 4WEJA 3OCNA 5EUAA 1E3UD 3IF6A 3BFGA 1GA0A 3ZNYA 3FZCA 1YLWA 1K25A 5HAIA 3BEBA 5CHMA 3C4PA 3UNWA 1ES2A 4KENB 2OV5A 2FFFB 4YINA 1LI9A 4MBHA 5FAPA 4QY5A 4XUZA 1IKGA 1ES3A 2Y2NA 2Y91A 2HDUA 5CTNA 3ISGA 4RVAA 5AQAA 1K4EA 2XR0A 1KGFA 1NJ4A 1YMXA 2Y2PA 3Q1FA 4KZ6A 3O88A 3ZG5A 1PZOA 2EXAA 1KDWA 2HPBA 4DE2A 2V1ZA 3PBOA 3WS1A 4GDBA 4GOGA 4B4ZA 3IQAA 1FQGA 3C7VA 4OLGA 4GZBA 3V50A 1XGIA 1ALQA 5FI6A 1BUEA 4U0XA 1U60A 2Y2LA 3N4IA 3G32A 4E3NA 4OP8A 2BG1A 1Z6FA 1CEFA 4UA6A 1K6RA 5FATA 2EFUA 4DDSA 4EWFA 5HL1A 4OPZA 1L2SA 2Y2GA 4GKUA 4BL2A 1VQQA 2DCFA 2I72A 4KQRA 1K6SA 4LCLA 3QHYA 1GCEA 3VSLA 5DVAA 4DE0A 1BLCA 5EVIB 1K54C 1S0WA 1XP4A 3A3EA 4C75A 4EUZA 3Q7VA 3GSGA 1W5DA 3BLSA 3PBTA 1XA1A 5A90A 1FR1A 2ZQAA 3LY4A 4Y0TA 1YLTA 5FQKA 2QPNA 1IKIA 2ZM0A 4OP5A 2X71A 2P74A 3VMAA 2Q9NA 4KZ5A 5FAOA 3IXHA 4OQGA 1N4OA 4JXSA 3G4PA 3ZVTA 1CI9A 1M40A 1W8QA 3GV9A 4MBKA 3WWXA 2XF3A 5HX9A 2G2WA 3G30A 5FA7A 5E2GA 3UN7A 1HTZA 1DJAA 3BRMA 5KSHA 1O7EA 3N8SA 5E2HA 1HD8A 1LL5A 4QB8A 1K4FA 4DF6A 5JYOA 3HUNA 4S2JA 4ZDXA 3RJUA 1XPBA 1ESIA 3MZEA 3UDIA 1MKIA 1Y54A 3PAEA 2WAEA 3V39A 1IYQA 2XD1A 1KDSA 1L0EA 1ZC2A 3HLBA 4XXRA 5CXWA 2A3UA 3VFFA 4Y0OA 4S2KA 1NZOA 3DWZA 4EQIA 4OLDA 4OQHA 1QMEA 3AGEA 5E2EA 1PIOA 4DRTA 4JF5A 4E3OA 1CEGA 1BLPA 3IF6C 4GN2A 3UDFA 3ZHHA 4O7DA 3MXSA 2WGWA 4WELA 3NDEA 2WGWB 3Q07A 4Y0UA 5F83A 4BL3A 5HAPA 3NI9A 4KQQA 3E2KA 1Q2QA 1JWPA 2XD5A 4IVKA 3SS5A 4EV4A 4PM5A 4QD4A 2VGJA 1MPLA 1JTDA 2Y2HA 3PBSA 5CRFA 4IEDA 4JF6A 4OOYA 2HDSA 1BLSA 4WBGA 4XUXA 4OQ0A 5GL9A 2J9OA 4WZ4A 1NZUA 2PU4A 4ZTKA 1K55A 5TFQA 3LO7A 5CTMA 3CMZA 3C5AA 3PBRA 3N7WA 5EE8A 1YLZA 4Q8IA 5GHZA 1LLBA 2ZLYA 1IYPA 4KG5A 1K38A 1VM1A 2P9VB 5I94A 4BD1A 3WRTA 3O86A 1DY6A 3IXDA 3IWQA 3PAGA 5FQMA 4PM9A 4N1XA 3P98A 5AQBA 3WS0A 5CGWA 3WS5A 3BYDA 5AQ9A 2C5WB 4BQMA 5CECA 3FKWA 2ZM2A 3MKFA 3IWIA 5EECA 4JLFA 1BT5A 5IHVA 3S1YA 3ZVWA 5KMWA 1YLYA 3ITAA 3Q7ZA 4UAAA 1CK3A 1NYMA 2PBYA 4FCFA 4RX2A 5HARA 1NXYA 1K57C 5E2FA 1XXMA 3GRJA 5FQIA 3IHBA 1ZKJA 2H0YA 4JKTA 3V3SA 4PPRA 3HLCA 3LCEA 3UE1A 4E3KA 2XK1A 3FWLA 4YFMA 2JE5A 4RX3A 4MNRA 4E6WA 3DTMA 1EWZA 1IYOA 4S2NA 4E3JA 4X55A 5F1GA 4LV2A 5GLBA 4IBRA 5AQ7A 1FOFA 3IXBA 1GHPA 4OPRA 4X53A 1PZPA 4OH0A 2XFSA 3VP0A 5D3OA 4ZJ3A 1ES5A 4R1GA 5M19A 2XQZA 5CHJA 4B4XA 2HDRA 5BOHA 2EX6A 1LI0A 3PBNA 3RXXA 3MZDA 3TOIA 4N9LA 3FV7A 3G2YA 1XKZA 2G2UA 4E6XA 4KZAA 2JCHA 3N6IA 2ZQDA 2A49A 3M2JA 5U47A 3V5MA 3ZGAB 5DTKA 3D4FA 2DRWA 3N8RA 1LL9A 3M2KA 1IEMA 5CERA 1MY8A 4S2LA 3TG9A 3M6BA 1G6AA 2WGIA 3VOZA 1TEMA 4OPYA 5KSCA 2IWCA 2ZC6B 1JWVA 2WKEA 2WK0A 2UWXA 4X56A 5EVIA 1YMSA 1PI4A 2ZC5B 2FFYA 3RXWA 2R9XA 2WADA 4PM7A 1PWGA 3PBQA 4IVIA 1GA9A 2WGVA 3OC2A 4N1HA 3IT9A 3OPLA 3LY3A 5CEBA 3UPNA 1KE4A 2J7VA 4LV1A 4DKIA 3OZHA 2Y2OA 2RL3A 2J9PA 4K91A 2WUQA 4WYYA 4QJGA 2XGNA 4RYEA 3FYZA 1NY0A 3WS2A 1KVLA 3C7UA 2B5RA 4S2OA 2HDQA 1KE3A 4WMCA 5F82A 3HLEA 3O3VA 1DJBA 1N9BA 5DTSA 4X68A 3QNCA 4BLMA 3MKEA 4PM6A 3ZFZA 1I2WA 4QHCA 1K55C 2EXBA 3OPHA 1JVJA 2QMIA 1LHYA 3P09A 4FD8A 5TR7A 3SH7A 3VP4A 1XGJA 2ZC7A 1DJCA 2HP5A 4EBLA 1MBLA 1PI5A 2ZMAA 3CG5A 4HBUA 4P87A 4GD8A 4D2OA 5A93A 1FCNA 2Y2KA 2JC7A 2E8IA 5M1AA 3UE3A 4DE3A 1YQSA 2VGKA 5FI7A 2ZQ9A 5FSRA 4E3MA 2WZXA 3GTCA 4S2MA 4UHUA 2ZQ7A 5E43A 1SCWA 1JWZA 2Q9MA 4GD6A 3EQUA 1FSWA 2WKHA 4JXGA 4Z9QA 1TDLA 4OOLA 4KZ7A 5DTTA 5J8XA 1K56A 4ID4A 4DE1A 1L0GA 4JXVA 4R3JA 4OVDA 5A92A 1MWSA 3SH8A 4OQIA 1E4DA 2GDNA 4ZJ2A 1S6RA 2PU2A 3OPPA 2Y55A 2XDMA 5A91A 1BSGA 5TGFA 1SDEA 4M3KA 4WZ5A 4S2NC 1BULA 1H5XA 3UDXA 3G2ZA 3ZDJA 2BLSA 2P9VA 3S4XA 3VP1A 1ERMA 4R0QA 3VFHA 1E3UA 1GHMA 3HUOA 1KVMA 3W4PA 3W8KA 1RGZA 4BJPA 3HL9A 2XH9A 3UY6A 2ZJ9A 3GVBA 3BFCA 3IH8A 3A3IA 1BZAA 5FAQA 1CI8A 3VOYA 3VP3A 4A5RA 5EVLA 2WAFA 3HVFA 1MXOA 3ITBA 4H8RA 4JF4A 3HLWA 3BFEA 3IXGA 4E3LA 3IF5A 3AGDA 5M18A 3IHAA 1YLPA 4KZ4A 1ZG4A 4KZ9A 1ONHA 4S2IA 4PMAA 5F1FA 2QZ6A 4LCMA 4C6YA 4KG2A 2V20A 4L0LA 5CGXA 1ESUA 4MBFA 3BM6A 5FDHA 2RCXA 1W79A 1WYBA 4LV3A 3E2LA 4GB7A 1PYYA 3A3JA 4HEFA 1HVBA 5L2FA 3IF6B 1Q2PA 1GHIA 2ZQCA 2Z2MB 4FSFA 3WS4A 4UA7A 1BTLA 3NBLA 1SHVA 2WYXA 2DNSA 3HLDA 3MZFA 1XX2A 1KGEA 5GHYA 4WM9A 1YLJA 1XA7A 1JTGA 3NC8A 1TVFA 3UE0A 3UPPA 1C3BA 4MEZA 3Q82A 2ZC3B 3SS4A 4BD0A 2Y4AA 1FR6A 2Y2JA 1EROA 4NK3A 2HP9A 2OLUA 2EX9A 2CC1A 2HP6A 3OPRA 4EBPA 5CHUA 2R9WA 3MFDA 1L0DA 3ZCZA 3DW0A 1L0FA 4NETA 4P85A 3HLGA 3G31A 3ZNTA 1OMEA 4KZ3A 1EI5A 3M6HA 2WKIA 3BFFA 4C3QA 3UPOA 2H10A 1FCOA 3NCKA 5GLAA 2V2FF 3W4QA 4LV0A 1TDGA 4FH2A 5GLDA 1RP5A 4ZJ1A 1FCMA 2OSUA 3HLFA 3SS3A 2XEPA 4RA7A 2Y2MA 4S2PA 1NRFA 3S22A 2Z2LB 4KG6A 1K57A 3DWKA 1MWTA 5FQ9A 3I7JA 4HESA 3C4OA 3NDGA 1RCJA 3GMWA 4PM8A 1QMFA 5FQJA 4U3TA 1RGYA 2EFXA 3MXRA 4OKPA 1W8YA 4U0TA 1WYCA 5JYPA 1J9MA 3B3XA 4P6BA 5EOOA 3V3RA 1MWUA 4LENA 4KQOA 5HW3A 2EX8A 5EOEA 4JXWA 1ERQA 3Q7VB 5G18A 4JPMA 4QU3A 1PW8A 3VSKA 1W7FA 2ZM8A 5DF9A 3BECA 4WEKA 2C6WB 3LEZA 5FI2A 3CZDA 4WZ5C 5EPHA 4E3IA 3MBZA 1SKFA 1KGGA 5EVID 2IWDA 1IELA 4OOMA 4N92A 4K0WA 4JBFA 1YT4A 4Y7PA 3VP2A 1I2SA 3Q81A 2Y2QA 2EX2A 3CJMA 2XFTA 5HFOA 4BENA 3O87A 1I5QA 5DF8A 5FQQA 1M6KA 3SOIA 4FH4A 1H8ZA 1G68A 3FKVA 4DDYA 3TSGA 2Y59A 3A3DA 4ZAMA 3HUMA 3SH9A 1KE0A 4N9KA 3IH9A 3EQVA 2JBFA 3GQZA 4WMCD 3ZG8B 1H8YA 2IWBA 2ZQ8A 5CEDA 2H0TA 2X02A 1ES4A 3N8LA 4KZ8A 4P0MA 2X01A 4F94A 1E25A 5GLCA 1WE4A 1PWDA 2ZC4B 1K54A 3NY4A 4ZBEA 3UO9A 3IWOA 4GDNA 4OPQA 4X6TA 2Y2IA 1ZG6A 3GR2A 1PWCA 2H5SA 4HBTA 4QY6A 4R4SA 4DXCA 3HBRA 3ZG7B 1HZOA 3JYIA 5GHXA 4KZBA 4DXBA 3AGFA 3G35A 3ZG0A 3HREA 2J8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OLV A;  3BLM A;  1ONG A;  1YM1 A;  4R3B A;  4OON A;  5CGS A;  2WZZ A;  1IYS A;  1MWR A;  3NIA A;  5DF7 A;  4MLL A;  1AXB A;  4B88 A;  2ZD8 A;  4X69 A;  2XLN A;  1K56 D;  4R23 A;  3G34 A;  3W4O A;  4CPK A;  1SDN A;  4UA9 A;  5FAS A;  5HAQ A;  1PW1 A;  3BFD A;  1FSY A;  1O07 A;  3PTE A;  4GNU A;  3QNB A;  3ZG9 B;  4CJN A;  5KZH A;  4R4R A;  1BLH A;  4IBX A;  1NYY A;  3WRZ A;  3A3F A;  5EVI C;  3OCL A;  4K0X A;  4EBN A;  4WEJ A;  3OCN A;  5EUA A;  1E3U D;  3IF6 A;  3BFG A;  1GA0 A;  3ZNY A;  3FZC A;  1YLW A;  1K25 A;  5HAI A;  3BEB A;  5CHM A;  3C4P A;  3UNW A;  1ES2 A;  4KEN B;  2OV5 A;  2FFF B;  4YIN A;  1LI9 A;  4MBH A;  5FAP A;  4QY5 A;  4XUZ A;  1IKG A;  1ES3 A;  2Y2N A;  2Y91 A;  2HDU A;  5CTN A;  3ISG A;  4RVA A;  5AQA A;  1K4E A;  2XR0 A;  1KGF A;  1NJ4 A;  1YMX A;  2Y2P A;  3Q1F A;  4KZ6 A;  3O88 A;  3ZG5 A;  1PZO A;  2EXA A;  1KDW A;  2HPB A;  4DE2 A;  2V1Z A;  3PBO A;  3WS1 A;  4GDB A;  4GOG A;  4B4Z A;  3IQA A;  1FQG A;  3C7V A;  4OLG A;  4GZB A;  3V50 A;  1XGI A;  1ALQ A;  5FI6 A;  1BUE A;  4U0X A;  1U60 A;  2Y2L A;  3N4I A;  3G32 A;  4E3N A;  4OP8 A;  2BG1 A;  1Z6F A;  1CEF A;  4UA6 A;  1K6R A;  5FAT A;  2EFU A;  4DDS A;  4EWF A;  5HL1 A;  4OPZ A;  1L2S A;  2Y2G A;  4GKU A;  4BL2 A;  1VQQ A;  2DCF A;  2I72 A;  4KQR A;  1K6S A;  4LCL A;  3QHY A;  1GCE A;  3VSL A;  5DVA A;  4DE0 A;  1BLC A;  5EVI B;  1K54 C;  1S0W A;  1XP4 A;  3A3E A;  4C75 A;  4EUZ A;  3Q7V A;  3GSG A;  1W5D A;  3BLS A;  3PBT A;  1XA1 A;  5A90 A;  1FR1 A;  2ZQA A;  3LY4 A;  4Y0T A;  1YLT A;  5FQK A;  2QPN A;  1IKI A;  2ZM0 A;  4OP5 A;  2X71 A;  2P74 A;  3VMA A;  2Q9N A;  4KZ5 A;  5FAO A;  3IXH A;  4OQG A;  1N4O A;  4JXS A;  3G4P A;  3ZVT A;  1CI9 A;  1M40 A;  1W8Q A;  3GV9 A;  4MBK A;  3WWX A;  2XF3 A;  5HX9 A;  2G2W A;  3G30 A;  5FA7 A;  5E2G A;  3UN7 A;  1HTZ A;  1DJA A;  3BRM A;  5KSH A;  1O7E A;  3N8S A;  5E2H A;  1HD8 A;  1LL5 A;  4QB8 A;  1K4F A;  4DF6 A;  5JYO A;  3HUN A;  4S2J A;  4ZDX A;  3RJU A;  1XPB A;  1ESI A;  3MZE A;  3UDI A;  1MKI A;  1Y54 A;  3PAE A;  2WAE A;  3V39 A;  1IYQ A;  2XD1 A;  1KDS A;  1L0E A;  1ZC2 A;  3HLB A;  4XXR A;  5CXW A;  2A3U A;  3VFF A;  4Y0O A;  4S2K A;  1NZO A;  3DWZ A;  4EQI A;  4OLD A;  4OQH A;  1QME A;  3AGE A;  5E2E A;  1PIO A;  4DRT A;  4JF5 A;  4E3O A;  1CEG A;  1BLP A;  3IF6 C;  4GN2 A;  3UDF A;  3ZHH A;  4O7D A;  3MXS A;  2WGW A;  4WEL A;  3NDE A;  2WGW B;  3Q07 A;  4Y0U A;  5F83 A;  4BL3 A;  5HAP A;  3NI9 A;  4KQQ A;  3E2K A;  1Q2Q A;  1JWP A;  2XD5 A;  4IVK A;  3SS5 A;  4EV4 A;  4PM5 A;  4QD4 A;  2VGJ A;  1MPL A;  1JTD A;  2Y2H A;  3PBS A;  5CRF A;  4IED A;  4JF6 A;  4OOY A;  2HDS A;  1BLS A;  4WBG A;  4XUX A;  4OQ0 A;  5GL9 A;  2J9O A;  4WZ4 A;  1NZU A;  2PU4 A;  4ZTK A;  1K55 A;  5TFQ A;  3LO7 A;  5CTM A;  3CMZ A;  3C5A A;  3PBR A;  3N7W A;  5EE8 A;  1YLZ A;  4Q8I A;  5GHZ A;  1LLB A;  2ZLY A;  1IYP A;  4KG5 A;  1K38 A;  1VM1 A;  2P9V B;  5I94 A;  4BD1 A;  3WRT A;  3O86 A;  1DY6 A;  3IXD A;  3IWQ A;  3PAG A;  5FQM A;  4PM9 A;  4N1X A;  3P98 A;  5AQB A;  3WS0 A;  5CGW A;  3WS5 A;  3BYD A;  5AQ9 A;  2C5W B;  4BQM A;  5CEC A;  3FKW A;  2ZM2 A;  3MKF A;  3IWI A;  5EEC A;  4JLF A;  1BT5 A;  5IHV A;  3S1Y A;  3ZVW A;  5KMW A;  1YLY A;  3ITA A;  3Q7Z A;  4UAA A;  1CK3 A;  1NYM A;  2PBY A;  4FCF A;  4RX2 A;  5HAR A;  1NXY A;  1K57 C;  5E2F A;  1XXM A;  3GRJ A;  5FQI A;  3IHB A;  1ZKJ A;  2H0Y A;  4JKT A;  3V3S A;  4PPR A;  3HLC A;  3LCE A;  3UE1 A;  4E3K A;  2XK1 A;  3FWL A;  4YFM A;  2JE5 A;  4RX3 A;  4MNR A;  4E6W A;  3DTM A;  1EWZ A;  1IYO A;  4S2N A;  4E3J A;  4X55 A;  5F1G A;  4LV2 A;  5GLB A;  4IBR A;  5AQ7 A;  1FOF A;  3IXB A;  1GHP A;  4OPR A;  4X53 A;  1PZP A;  4OH0 A;  2XFS A;  3VP0 A;  5D3O A;  4ZJ3 A;  1ES5 A;  4R1G A;  5M19 A;  2XQZ A;  5CHJ A;  4B4X A;  2HDR A;  5BOH A;  2EX6 A;  1LI0 A;  3PBN A;  3RXX A;  3MZD A;  3TOI A;  4N9L A;  3FV7 A;  3G2Y A;  1XKZ A;  2G2U A;  4E6X A;  4KZA A;  2JCH A;  3N6I A;  2ZQD A;  2A49 A;  3M2J A;  5U47 A;  3V5M A;  3ZGA B;  5DTK A;  3D4F A;  2DRW A;  3N8R A;  1LL9 A;  3M2K A;  1IEM A;  5CER A;  1MY8 A;  4S2L A;  3TG9 A;  3M6B A;  1G6A A;  2WGI A;  3VOZ A;  1TEM A;  4OPY A;  5KSC A;  2IWC A;  2ZC6 B;  1JWV A;  2WKE A;  2WK0 A;  2UWX A;  4X56 A;  5EVI A;  1YMS A;  1PI4 A;  2ZC5 B;  2FFY A;  3RXW A;  2R9X A;  2WAD A;  4PM7 A;  1PWG A;  3PBQ A;  4IVI A;  1GA9 A;  2WGV A;  3OC2 A;  4N1H A;  3IT9 A;  3OPL A;  3LY3 A;  5CEB A;  3UPN A;  1KE4 A;  2J7V A;  4LV1 A;  4DKI A;  3OZH A;  2Y2O A;  2RL3 A;  2J9P A;  4K91 A;  2WUQ A;  4WYY A;  4QJG A;  2XGN A;  4RYE A;  3FYZ A;  1NY0 A;  3WS2 A;  1KVL A;  3C7U A;  2B5R A;  4S2O A;  2HDQ A;  1KE3 A;  4WMC A;  5F82 A;  3HLE A;  3O3V A;  1DJB A;  1N9B A;  5DTS A;  4X68 A;  3QNC A;  4BLM A;  3MKE A;  4PM6 A;  3ZFZ A;  1I2W A;  4QHC A;  1K55 C;  2EXB A;  3OPH A;  1JVJ A;  2QMI A;  1LHY A;  3P09 A;  4FD8 A;  5TR7 A;  3SH7 A;  3VP4 A;  1XGJ A;  2ZC7 A;  1DJC A;  2HP5 A;  4EBL A;  1MBL A;  1PI5 A;  2ZMA A;  3CG5 A;  4HBU A;  4P87 A;  4GD8 A;  4D2O A;  5A93 A;  1FCN A;  2Y2K A;  2JC7 A;  2E8I A;  5M1A A;  3UE3 A;  4DE3 A;  1YQS A;  2VGK A;  5FI7 A;  2ZQ9 A;  5FSR A;  4E3M A;  2WZX A;  3GTC A;  4S2M A;  4UHU A;  2ZQ7 A;  5E43 A;  1SCW A;  1JWZ A;  2Q9M A;  4GD6 A;  3EQU A;  1FSW A;  2WKH A;  4JXG A;  4Z9Q A;  1TDL A;  4OOL A;  4KZ7 A;  5DTT A;  5J8X A;  1K56 A;  4ID4 A;  4DE1 A;  1L0G A;  4JXV A;  4R3J A;  4OVD A;  5A92 A;  1MWS A;  3SH8 A;  4OQI A;  1E4D A;  2GDN A;  4ZJ2 A;  1S6R A;  2PU2 A;  3OPP A;  2Y55 A;  2XDM A;  5A91 A;  1BSG A;  5TGF A;  1SDE A;  4M3K A;  4WZ5 A;  4S2N C;  1BUL A;  1H5X A;  3UDX A;  3G2Z A;  3ZDJ A;  2BLS A;  2P9V A;  3S4X A;  3VP1 A;  1ERM A;  4R0Q A;  3VFH A;  1E3U A;  1GHM A;  3HUO A;  1KVM A;  3W4P A;  3W8K A;  1RGZ A;  4BJP A;  3HL9 A;  2XH9 A;  3UY6 A;  2ZJ9 A;  3GVB A;  3BFC A;  3IH8 A;  3A3I A;  1BZA A;  5FAQ A;  1CI8 A;  3VOY A;  3VP3 A;  4A5R A;  5EVL A;  2WAF A;  3HVF A;  1MXO A;  3ITB A;  4H8R A;  4JF4 A;  3HLW A;  3BFE A;  3IXG A;  4E3L A;  3IF5 A;  3AGD A;  5M18 A;  3IHA A;  1YLP A;  4KZ4 A;  1ZG4 A;  4KZ9 A;  1ONH A;  4S2I A;  4PMA A;  5F1F A;  2QZ6 A;  4LCM A;  4C6Y A;  4KG2 A;  2V20 A;  4L0L A;  5CGX A;  1ESU A;  4MBF A;  3BM6 A;  5FDH A;  2RCX A;  1W79 A;  1WYB A;  4LV3 A;  3E2L A;  4GB7 A;  1PYY A;  3A3J A;  4HEF A;  1HVB A;  5L2F A;  3IF6 B;  1Q2P A;  1GHI A;  2ZQC A;  2Z2M B;  4FSF A;  3WS4 A;  4UA7 A;  1BTL A;  3NBL A;  1SHV A;  2WYX A;  2DNS A;  3HLD A;  3MZF A;  1XX2 A;  1KGE A;  5GHY A;  4WM9 A;  1YLJ A;  1XA7 A;  1JTG A;  3NC8 A;  1TVF A;  3UE0 A;  3UPP A;  1C3B A;  4MEZ A;  3Q82 A;  2ZC3 B;  3SS4 A;  4BD0 A;  2Y4A A;  1FR6 A;  2Y2J A;  1ERO A;  4NK3 A;  2HP9 A;  2OLU A;  2EX9 A;  2CC1 A;  2HP6 A;  3OPR A;  4EBP A;  5CHU A;  2R9W A;  3MFD A;  1L0D A;  3ZCZ A;  3DW0 A;  1L0F A;  4NET A;  4P85 A;  3HLG A;  3G31 A;  3ZNT A;  1OME A;  4KZ3 A;  1EI5 A;  3M6H A;  2WKI A;  3BFF A;  4C3Q A;  3UPO A;  2H10 A;  1FCO A;  3NCK A;  5GLA A;  2V2F F;  3W4Q A;  4LV0 A;  1TDG A;  4FH2 A;  5GLD A;  1RP5 A;  4ZJ1 A;  1FCM A;  2OSU A;  3HLF A;  3SS3 A;  2XEP A;  4RA7 A;  2Y2M A;  4S2P A;  1NRF A;  3S22 A;  2Z2L B;  4KG6 A;  1K57 A;  3DWK A;  1MWT A;  5FQ9 A;  3I7J A;  4HES A;  3C4O A;  3NDG A;  1RCJ A;  3GMW A;  4PM8 A;  1QMF A;  5FQJ A;  4U3T A;  1RGY A;  2EFX A;  3MXR A;  4OKP A;  1W8Y A;  4U0T A;  1WYC A;  5JYP A;  1J9M A;  3B3X A;  4P6B A;  5EOO A;  3V3R A;  1MWU A;  4LEN A;  4KQO A;  5HW3 A;  2EX8 A;  5EOE A;  4JXW A;  1ERQ A;  3Q7V B;  5G18 A;  4JPM A;  4QU3 A;  1PW8 A;  3VSK A;  1W7F A;  2ZM8 A;  5DF9 A;  3BEC A;  4WEK A;  2C6W B;  3LEZ A;  5FI2 A;  3CZD A;  4WZ5 C;  5EPH A;  4E3I A;  3MBZ A;  1SKF A;  1KGG A;  5EVI D;  2IWD A;  1IEL A;  4OOM A;  4N92 A;  4K0W A;  4JBF A;  1YT4 A;  4Y7P A;  3VP2 A;  1I2S A;  3Q81 A;  2Y2Q A;  2EX2 A;  3CJM A;  2XFT A;  5HFO A;  4BEN A;  3O87 A;  1I5Q A;  5DF8 A;  5FQQ A;  1M6K A;  3SOI A;  4FH4 A;  1H8Z A;  1G68 A;  3FKV A;  4DDY A;  3TSG A;  2Y59 A;  3A3D A;  4ZAM A;  3HUM A;  3SH9 A;  1KE0 A;  4N9K A;  3IH9 A;  3EQV A;  2JBF A;  3GQZ A;  4WMC D;  3ZG8 B;  1H8Y A;  2IWB A;  2ZQ8 A;  5CED A;  2H0T A;  2X02 A;  1ES4 A;  3N8L A;  4KZ8 A;  4P0M A;  2X01 A;  4F94 A;  1E25 A;  5GLC A;  1WE4 A;  1PWD A;  2ZC4 B;  1K54 A;  3NY4 A;  4ZBE A;  3UO9 A;  3IWO A;  4GDN A;  4OPQ A;  4X6T A;  2Y2I A;  1ZG6 A;  3GR2 A;  1PWC A;  2H5S A;  4HBT A;  4QY6 A;  4R4S A;  4DXC A;  3HBR A;  3ZG7 B;  1HZO A;  3JYI A;  5GHX A;  4KZB A;  4DXB A;  3AGF A;  3G35 A;  3ZG0 A;  3HRE A;  2J8Y A; 
#chains in the Genus database with same CATH topology
 2VA0 A;  3MXQ A;  1YM1 A;  2WZZ A;  1MWR A;  3EWK A;  4DN0 A;  2XLN A;  1K56 D;  3W4O A;  4CPK A;  2QKP A;  5TBM B;  1X0O A;  3BFD A;  1O07 A;  3ZG9 B;  4NXG A;  3NUL A;  4EBN A;  3IF6 A;  1HLU P;  2KLI A;  3BEB A;  3C4P A;  4KEN B;  2JHE A;  4MBH A;  2OWH A;  4I3I A;  1ZTU A;  2Y2N A;  2Y91 A;  2HDU A;  4RVA A;  5AQA A;  1OTB A;  1NJ4 A;  4KZ6 A;  1PZO A;  2EXA A;  2HPB A;  1CQA A;  4GDB A;  5EFW A;  4B4Z A;  1DRM A;  1FQG A;  3C7V A;  5MC7 A;  4GZB A;  1BUE A;  4U0X A;  2Y2L A;  3N4I A;  1CEF A;  4UA6 A;  3CPT A;  1PNE A;  2EFU A;  2VV6 A;  3IS2 A;  4GKU A;  1H3Q A;  4BL2 A;  3T4J A;  5IU1 A;  2ZOI A;  1OTA A;  2B02 A;  4UQI M;  4EUZ A;  5A90 A;  3BLS A;  1FR1 A;  1IKI A;  2ZM0 A;  3IXH A;  1N4O A;  4JXS A;  5AJG A;  3WWX A;  3GV9 A;  2XF3 A;  1V9Y A;  1O7E A;  3N8S A;  4NXB A;  5E2H A;  4ZDX A;  3K3C A;  4D60 A;  2XA7 M;  4L9G A;  3EOI A;  1IYQ A;  3NHQ A;  2W3D A;  4S2K A;  1NZO A;  5AVF A;  3DTK A;  4B9O A;  4E3O A;  3KYE A;  3T4L A;  4LRY C;  2VLG A;  4EXO A;  3NDE A;  4BL3 A;  2EWV A;  4EER A;  3E2K A;  2M7U A;  1LT0 A;  4QD4 A;  2MJ6 A;  4BBU A;  1D06 A;  2HDS A;  3S7O A;  3QP2 A;  4YNR A;  2PR5 A;  3LO7 A;  3CMZ A;  3MFX A;  5EE8 A;  3RTY A;  2ZLY A;  1K38 A;  3PAG A;  1TS7 A;  3H7W B;  3RFB A;  5DFY A;  3WS5 A;  4BQM A;  5CEC A;  4DJ3 A;  2ZM2 A;  4O8G A;  4GLQ A;  5EEC A;  5IHV A;  3NEC A;  4UAA A;  5FQI A;  3H82 A;  4HI4 A;  3V3S A;  3UE1 A;  1Y28 A;  4RX3 A;  4PKY G;  4S2N A;  3QP5 A;  4OPR A;  4OH0 A;  3VP0 A;  4ZJ3 A;  2LB9 A;  2XQZ A;  4LPZ A;  4B93 A;  2OAQ 1;  5BOH A;  3MZD A;  3FV7 A;  2G2U A;  4E6X A;  2JCH A;  5DJU A;  4GCZ A;  5U47 A;  3V5M A;  3D4F A;  2DRW A;  5FEF A;  3N8R A;  2V1A A;  2H28 A;  3M6B A;  4EES A;  3DAV A;  3MJQ A;  2V8C A;  2PAV P;  3PHY A;  5EVI A;  1YMS A;  3FC7 A;  1PRQ A;  3R7W A;  5HDD A;  4JGR A;  4DKI A;  2Y2O A;  2RL3 A;  4K91 A;  3T1R A;  2WUQ A;  4HQA A;  3WS2 A;  3C7U A;  1W63 M;  3S7N A;  2HDQ A;  1KE3 A;  1T1B A;  3ZQ5 A;  5F82 A;  3HLE A;  4WN5 A;  1DJB A;  2W3G A;  3MKE A;  4PM6 A;  1AWI A;  4QHC A;  3F1N B;  1JVJ A;  2QMI A;  1LHY A;  4FD8 A;  3SH7 A;  1TS6 A;  1J3W A;  1DJC A;  2HP5 A;  2ZC7 A;  3TE8 A;  4ETX A;  4HH2 A;  5I5L A;  3CG5 A;  4P87 A;  2JKT M;  1FCN A;  5FI7 A;  1S4S A;  3BW6 A;  2VGL M;  1XJ6 A;  2ZQ7 A;  1JWZ A;  2Q9M A;  3T4S A;  4JXG A;  4Z9Q A;  5DTT A;  4ID4 A;  1IFQ A;  4R3J A;  3OPP A;  5DKK A;  2XDM A;  5A91 A;  3U4L P;  1SDE A;  2HJ9 C;  2PYR A;  3G2Z A;  2P9V A;  4GHI B;  3VP1 A;  1T19 A;  3F1P B;  3BFC A;  1BZA A;  1DP6 A;  1CI8 A;  1G28 A;  3VP3 A;  4HJ4 A;  3HLW A;  4E3L A;  3UB5 P;  3LGO A;  4R3A A;  5J4E A;  3NJA A;  5EM0 A;  3HJI A;  1ESU A;  4MBF A;  3BM6 A;  2M7V A;  1PYY A;  1HVB A;  4EEU A;  3IF6 B;  1Q2P A;  2EWW A;  2BAS A;  1SHV A;  2WYX A;  3HLD A;  1YLJ A;  3NC8 A;  1TVF A;  5F69 A;  1C3B A;  1FR6 A;  4CLC A;  1N9O A;  2CC1 A;  4HY8 A;  5G4Z A;  1L0D A;  1KOU A;  3MSH A;  3W4Q A;  4LV0 A;  1TDG A;  4GS9 B;  5GLD A;  3IX8 A;  2VJW A;  3ICY A;  1OTI A;  2OAP 1;  4RA7 A;  2Y2M A;  3CPT B;  4S2P A;  2J3W A;  3IS2 B;  4HES A;  3C4O A;  1RCJ A;  4CLC D;  1QMF A;  2EFX A;  3MXR A;  1W8Y A;  3QP1 A;  1WYC A;  2XSS A;  5EOO A;  1NRJ A;  2EX8 A;  4JPM A;  2VZW A;  4PHT A;  2ZBB A;  5EPH A;  2IWD A;  2P08 A;  4K0W A;  1MKM A;  1Z09 A;  2EX2 A;  3CJM A;  3D3O A;  1NWZ A;  3O87 A;  4PKY A;  1H8Z A;  1G68 A;  3TSG A;  2Y59 A;  2B18 A;  1T1A A;  4N9K A;  2JBF A;  4WMC D;  3E4O A;  1A0K A;  4BBV A;  2X01 A;  5GLC A;  1PWD A;  3IWO A;  2Y2I A;  3P01 A;  5HPI A;  2HV1 A;  1VEU A;  1PWC A;  3OLO A;  3PYP A;  1XJ3 A;  4H6J A;  5CGS A;  1IYS A;  3NIA A;  2ZD8 A;  4X69 A;  1ACF A;  4MDZ A;  1SDN A;  1ODV A;  3TRC A;  3T1S A;  5FAS A;  3KSG A;  1FSY A;  3PTE A;  5KZH A;  4KQD A;  2HZ5 A;  3OCN A;  1GA0 A;  3IBJ A;  3T4O A;  5L07 A;  5CHM A;  3H82 B;  2OV5 A;  2AVX A;  1LI9 A;  3MS6 A;  5CTN A;  4HH3 A;  2XR0 A;  1KGF A;  1GSV A;  3LR3 A;  3MR0 A;  1STZ A;  1FIL A;  4GOG A;  3D9Y A;  3IQA A;  4OLG A;  3V50 A;  1W63 Q;  1ALQ A;  2O0Y A;  3BJN A;  1U60 A;  1D1J A;  4E3N A;  3T12 B;  3V67 A;  1K6R A;  5FAT A;  3DBA A;  5HL1 A;  4LFU A;  4OPZ A;  2INW A;  5F5Y A;  3EEA A;  5HDC A;  4KQR A;  1TS8 A;  3QHY A;  1BLC A;  5EVI B;  4C75 A;  3Q7V A;  3GSG A;  4HP4 A;  3PBT A;  1XA1 A;  3VE4 A;  4L9F A;  4Y0T A;  5FQK A;  2QPN A;  4OP5 A;  2P74 A;  4KZ5 A;  1GSW A;  1W8Q A;  4KUK A;  2JKF A;  5HX9 A;  2G2W A;  3G30 A;  2YKF A;  1DJA A;  1HTZ A;  3BRM A;  3GDI A;  1FIK A;  1HD8 A;  1LL5 A;  3HUN A;  2I9V A;  3RJU A;  3MZE A;  1Y54 A;  1XJ4 A;  3PAE A;  2WAE A;  3LI8 A;  5DKL A;  1ZC2 A;  3BY9 A;  3VFF A;  4EET B;  1BYW A;  4EQI A;  4OLD A;  4OQH A;  1PIO A;  4JF5 A;  1CEG A;  1BLP A;  3IF6 C;  3UDF A;  3ZHH A;  4O7D A;  2P04 A;  4WEL A;  3LYX A;  2WGW B;  4P6Z S;  2XD5 A;  4IVK A;  1V9Z A;  3PBS A;  2Y2H A;  5CRF A;  5HWT A;  5J3W A;  4XUX A;  1ZHH B;  5GL9 A;  5F68 A;  4OQ0 A;  2J9O A;  4ZTK A;  1K55 A;  5TFQ A;  5CTM A;  3PBR A;  3C5A A;  4Q8I A;  3KYZ A;  1LLB A;  3MQQ A;  2V9A A;  1VM1 A;  2P9V B;  4MCW A;  3O86 A;  5FQM A;  4N1X A;  5AQB A;  2Y8H A;  3WS0 A;  5CGW A;  1K0K A;  3BYD A;  4MN6 A;  5EVE A;  5FEG A;  3L9K A;  4JLF A;  1BT5 A;  3ZVW A;  3ITA A;  1NYM A;  4WL9 A;  1XXM A;  3IHB A;  2H0Y A;  4YOF A;  4PPR A;  4Y2F A;  2XK1 A;  3FWL A;  4YFM A;  3DTM A;  3TJZ C;  5AQ7 A;  1FOF A;  2Y79 A;  1GHP A;  4X53 A;  3O5Y A;  1ES5 A;  4I3J A;  1SZV A;  4R1G A;  2ZL1 A;  5CHJ A;  1P9W A;  2HDR A;  2EX6 A;  4CLC B;  4N9L A;  4KZA A;  2A49 A;  3ZGA B;  1LL9 A;  1IEM A;  3UME A;  4S2L A;  3TG9 A;  5KSC A;  2ZC6 B;  2OWJ A;  3RXW A;  4PM7 A;  3UMD A;  1GA9 A;  3OC2 A;  3OPL A;  3LY3 A;  5CEB A;  3UE6 A;  3OZH A;  2L1M A;  3S7P A;  4BMW A;  4QJG A;  2XGN A;  4RYE A;  2HF6 A;  2ZMV A;  4BWI A;  3LIE A;  4S2O A;  4ME4 A;  3O3V A;  4UQI S;  4BLM A;  4EW7 A;  2O99 A;  2EXB A;  4NG2 A;  3P09 A;  5TR7 A;  5AVE A;  3VP4 A;  4EBL A;  2ZMA A;  4D2O A;  2Y2K A;  5M1A A;  1YQS A;  1DP9 A;  5FSR A;  2NUP C;  2PD7 A;  3R4K A;  1CF0 A;  1SCW A;  1OJG A;  3EEH A;  1S1Y A;  3G6O A;  1FSW A;  2WKH A;  2XA7 S;  1TDL A;  3W2Z A;  5J8X A;  1F5M A;  4JXV A;  3C30 A;  4OQI A;  1E4D A;  4ZJ2 A;  1JNU A;  1S6R A;  1VEU B;  2XRN A;  4S2N C;  1BUL A;  2WKP A;  1ERM A;  1E3U A;  3LI9 A;  4BJP A;  3HL9 A;  4H6J B;  2XH9 A;  3GVB A;  5FAQ A;  3T4T A;  4A5R A;  3HVF A;  1MXO A;  3ITB A;  4H8R A;  5C5K A;  3IF5 A;  5G4Y A;  5FDS A;  1YLP A;  3OBF A;  4C6Y A;  2V20 A;  4Q0H A;  5CGX A;  2RCX A;  1W79 A;  3E2L A;  2PR6 A;  5L10 A;  1GHI A;  1YKD A;  2ZQC A;  4FSF A;  4UA7 A;  3NBL A;  2DNS A;  3MZF A;  3JVU A;  4R70 A;  1XA7 A;  3UE0 A;  4MEZ A;  3Q82 A;  4FTX A;  2Y2J A;  3LEQ A;  2OLU A;  3C2W A;  3OPR A;  3PXP A;  4EBP A;  4YWZ A;  5CHU A;  2R9W A;  3ZCZ A;  5IS1 A;  3C38 A;  2M1C A;  3M6H A;  1S1Z A;  2O9C A;  4C3Q A;  3NCK A;  4LRZ E;  2WKQ A;  3FPW A;  3LIB A;  1XFN A;  1RP5 A;  1FCM A;  1CJF A;  2Z2L B;  4M4X A;  5FQ9 A;  3VE3 A;  3T50 A;  3NDG A;  4PM8 A;  5FQJ A;  4EUV A;  4U3T A;  1RGY A;  5JYP A;  4P6B A;  3V3R A;  4LEN A;  4I39 A;  5EOE A;  5G18 A;  4JXW A;  1ERQ A;  3Q7V B;  2L0W A;  1PW8 A;  4R6L A;  1W7F A;  3LEZ A;  4XT2 A;  4E3I A;  1SKF A;  5EVI D;  5HDS A;  1IEL A;  3IBR A;  4G3K A;  4OOM A;  4JBF A;  2V0W A;  2K2N A;  3Q81 A;  1MZU A;  4BEN A;  1I5Q A;  3JPU A;  1TS0 A;  4FH4 A;  4AFI A;  1S67 L;  3HUM A;  3EQV A;  3GQZ A;  3NOT C;  5F6A A;  5CED A;  1H8Y A;  2IWB A;  3LID A;  5HD5 A;  3N8L A;  1PFL A;  1E25 A;  3B42 A;  1K54 A;  2KDK A;  2PRF A;  3A0S A;  4OPQ A;  5EM1 A;  4DXC A;  2VGL S;  2W3H A;  3LFV A;  1HZO A;  3G35 A;  3ZG0 A;  3BLM A;  3BWL A;  1OTE A;  4Q0I A;  4R3B A;  4OON A;  4CLC C;  1LSW A;  4X25 A;  3QP8 A;  1YSP A;  4MLL A;  1AXB A;  4B88 A;  2D01 A;  2O9B A;  4R23 A;  2VK3 A;  4UA9 A;  1PW1 A;  4HNB A;  4GNU A;  3QNB A;  4CJN A;  4R4R A;  5TJJ A;  2XRO A;  1NYY A;  3WRZ A;  3A3F A;  2A2L A;  3OCL A;  4JGO A;  4WUJ A;  3LR4 A;  3ZNY A;  3FZC A;  1YLW A;  5L8M A;  1ES2 A;  4YIN A;  3CIT A;  4QY5 A;  4XUZ A;  4K08 A;  4I38 A;  3HCY A;  1K4E A;  2Y2P A;  3O88 A;  3KSI A;  3MQO A;  2PDR A;  4DE2 A;  2V1Z A;  3PBO A;  3WS1 A;  5FL3 A;  2EA9 A;  4I3A A;  2ZL1 B;  4F3L A;  1XGI A;  5FI6 A;  2VX8 A;  3CAX A;  2Z6C A;  3UB6 A;  4HHD A;  2BG1 A;  2PD8 A;  3LIF A;  2W3F A;  5L09 A;  4DDS A;  1L3L A;  1GSX A;  4II7 A;  1L2S A;  3E98 A;  2DCF A;  2I72 A;  1K6S A;  4LCL A;  1GCE A;  3K3D A;  1XP4 A;  3A3E A;  2ZQA A;  3U2A A;  1OPX A;  1YLT A;  2X71 A;  3VMA A;  2Q9N A;  1UGU A;  4OQG A;  3G4P A;  3ZVT A;  1M40 A;  3ZYT A;  4GJ4 A;  2G7U A;  3UN7 A;  5E2G A;  2V1B A;  4QB8 A;  4DF6 A;  4S2J A;  1H0M A;  1XPB A;  3UDI A;  2B95 A;  3V39 A;  4NXE A;  2XD1 A;  3HLB A;  5CXW A;  4XXR A;  4Y0O A;  2A24 A;  3DWZ A;  2LB5 A;  3KSH A;  3BQA A;  3AGE A;  4DRT A;  2W27 A;  4GN2 A;  4G3V A;  5F83 A;  1Q2Q A;  4EV4 A;  4PM5 A;  4WF0 A;  2VGJ A;  1MPL A;  1JTD A;  4IED A;  4OOY A;  4WBG A;  1BLS A;  3BQ8 A;  4WZ4 A;  1NZU A;  3N7W A;  1YLZ A;  5GHZ A;  2QJ7 A;  5I94 A;  3CI6 A;  2QJ5 A;  3P98 A;  4G3W A;  3HJK A;  3MKF A;  3IWI A;  5KMW A;  3Q7Z A;  1CK3 A;  2PBY A;  4FCF A;  5E2F A;  1K57 C;  3GRJ A;  2CMN A;  3MQ0 A;  5HWV A;  3HLC A;  3LCE A;  3KO6 A;  4E3K A;  2JE5 A;  1T1C A;  4E6W A;  3QP4 A;  1IYO A;  4E3J A;  5F1G A;  4LV2 A;  5GLB A;  3IXB A;  2VV7 A;  3A0V A;  5D3O A;  1VHM A;  5M19 A;  4O01 A;  3PBN A;  3RXX A;  1YPR A;  3G2Y A;  2L4R A;  1P0Z A;  3N6I A;  2ZQD A;  3M2J A;  1MY8 A;  3CUE C;  1G6A A;  3VOZ A;  2IWC A;  1JWV A;  4WLA A;  1PI4 A;  2VEA A;  2ZC5 B;  4FUW A;  1PWG A;  3PBQ A;  4IVI A;  4L9E A;  4N1H A;  3IT9 A;  3R7W B;  3CWF A;  3EGX C;  2J7V A;  3DTE A;  3F1O A;  4JGQ A;  1NY0 A;  2B5R A;  3RH8 B;  4CQH A;  1N9B A;  3T4K A;  3TW8 A;  1VET A;  5DTS A;  2QWS A;  1I2W A;  1K55 C;  3E4P A;  2IA2 A;  3B47 A;  4NEE D;  4Y13 A;  1MBL A;  1PI5 A;  2J3T C;  4HBU A;  5A93 A;  4GD8 A;  2E8I A;  4DE3 A;  3GTC A;  4UHU A;  4DMZ A;  4GD6 A;  3EQU A;  4OOL A;  4KZ7 A;  1K56 A;  4DE1 A;  1L0G A;  4Y15 A;  4OVD A;  1MWS A;  2GDN A;  2PU2 A;  2Y55 A;  1BSG A;  5TGF A;  4M3K A;  4WZ5 A;  3ZDJ A;  2BLS A;  4R0Q A;  3HUO A;  1KVM A;  3W4P A;  2QHK A;  1RGZ A;  1IOU A;  2K31 A;  4Y3I A;  3SZT A;  3UY6 A;  3IH8 A;  3A3I A;  5EVL A;  2WAF A;  4MN7 A;  4X1M A;  5M18 A;  4KZ4 A;  1ZG4 A;  1ONH A;  5F1F A;  2QZ6 A;  5HWW A;  2KOI A;  4KG2 A;  4L0L A;  5FDH A;  1WYB A;  3A3J A;  1SKO A;  5L2F A;  4PAU A;  2J3T D;  2PYP A;  3WS4 A;  3UPP A;  2ZC3 B;  4BD0 A;  2Y4A A;  4ETZ A;  1ERO A;  4NK3 A;  2EX9 A;  2HP6 A;  1NLY A;  1P97 A;  1L0F A;  4P85 A;  3G31 A;  1OME A;  3DTI A;  1N9N A;  3BFF A;  3UPO A;  2H10 A;  3K2N A;  2W1T A;  4GS9 A;  3FG8 A;  4F3L B;  4ZJ1 A;  1VB6 A;  3SS3 A;  2XEP A;  3P7N A;  4KG6 A;  3DWK A;  3EGD C;  4IUH A;  2FZ0 A;  4U0T A;  4X1L A;  5HW3 A;  3VSK A;  3L7H A;  4QU3 A;  1XFQ A;  2Q0O A;  3KSF A;  1WA9 A;  5DF9 A;  3BEC A;  4WEK A;  1UWN X;  3PR6 A;  3MBZ A;  3LR0 A;  4Y7P A;  3VP2 A;  3MF0 A;  2XFT A;  5HFO A;  1M6K A;  3SOI A;  3FKV A;  3A3D A;  3SH9 A;  4QWO A;  3IH9 A;  4IHQ A;  1OTD A;  3ZG8 B;  2ZQ8 A;  2X02 A;  1LL8 A;  1ES4 A;  4KZ8 A;  4P0M A;  4E04 A;  1WE4 A;  2A24 B;  3OOV A;  2E8J A;  2UV0 E;  3GR2 A;  2K7S A;  3H9W A;  5GHX A;  3JYI A;  4KZB A;  2NUT C;  4DXB A;  3AGF A;  4LGW A;  4S2I A;  2J8Y A;  2OLV A;  1ONG A;  4LRX C;  5DF7 A;  3G34 A;  1UWP X;  5K5B A;  1DP8 A;  5HAQ A;  3LUQ A;  4JGP A;  2V8F A;  4EEP A;  1BLH A;  2W1R A;  4IBX A;  5EVI C;  4K0X A;  4WEJ A;  5EUA A;  3FPV A;  1E3U D;  3BFG A;  3NOP C;  1XJ2 A;  1K25 A;  5HAI A;  1YAX A;  3UNW A;  2FH5 A;  2FFF B;  5FAP A;  4ARZ A;  4Y5F A;  1IKG A;  1ES3 A;  3KYQ A;  2R78 A;  3ISG A;  3UB7 A;  1YMX A;  3Q1F A;  3ZG5 A;  1F2K A;  1KDW A;  1TF1 A;  3UB8 A;  4Y17 A;  5J7E A;  3G32 A;  1D7E A;  4OP8 A;  4MN5 A;  1Z6F A;  4EWF A;  2ACG A;  2Y2G A;  5HZH A;  1G5U A;  5HPF A;  1VQQ A;  2ZOH A;  3VSL A;  2KX6 A;  5DVA A;  4DE0 A;  3LR5 A;  1K54 C;  1S0W A;  4BBT A;  3C8C A;  1W5D A;  3LY4 A;  2Z6D A;  4EQ1 A;  4IJG A;  5FAO A;  3F1O B;  4ZRR A;  1CI9 A;  4MBK A;  3E4Q A;  5FA7 A;  1F9I A;  5KSH A;  1OT6 A;  1K4F A;  5JYO A;  1VET B;  1ESI A;  1MKI A;  1KDS A;  4DJ2 A;  1L0E A;  2A3U A;  1MC0 A;  2DMW A;  2HJE A;  1QME A;  5E2E A;  4FOF A;  3MXS A;  2WGW A;  3Q07 A;  4Y0U A;  5HAP A;  3NI9 A;  4KQQ A;  2JKG A;  2JKR M;  1JWP A;  3SS5 A;  2GZA A;  4HJ6 A;  1YSQ A;  4NXF A;  4JF6 A;  2PU4 A;  2PHY A;  1H8M A;  1IYP A;  4KG5 A;  5TBM A;  4BD1 A;  1NLZ A;  3WRT A;  1F98 A;  1DY6 A;  3IXD A;  3IWQ A;  3LIA A;  4PM9 A;  1T18 A;  5AQ9 A;  2C5W B;  5HD3 A;  3FKW A;  5DFX A;  3S1Y A;  1YLY A;  2JKT I;  4RX2 A;  5HAR A;  1NXY A;  1ZKJ A;  4JKT A;  3T4Q A;  4I5S A;  4MNR A;  1EWZ A;  2JKR I;  1SKO B;  4X55 A;  4IBR A;  4HJ3 A;  4LLO B;  1PZP A;  2XFS A;  1OJ5 A;  3VV4 A;  4B4X A;  3IX4 A;  1LI0 A;  3TOI A;  4HOI A;  1XKZ A;  3NOU C;  3E0Y A;  5KIZ A;  2V0U A;  2OOL A;  5DTK A;  3M2K A;  2GJ3 A;  5CER A;  3MMH A;  4GW9 A;  4RQ9 A;  2WGI A;  1TEM A;  2W1T B;  4OPY A;  4UEY A;  3LIC A;  5LBR A;  2WKE A;  2WK0 A;  2PBD P;  4X56 A;  2UWX A;  1EW0 A;  3D72 A;  2FFY A;  3A0R A;  2R9X A;  2WAD A;  2WGV A;  3UPN A;  1KE4 A;  4LV1 A;  2J9P A;  2O9A A;  4WYY A;  2QYB A;  3FYZ A;  3T1Q B;  1KVL A;  4WMC A;  4X68 A;  3QNC A;  4IUK A;  3ZFZ A;  1LSV A;  3OPH A;  3T1X A;  1TD5 A;  1G6O A;  1XGJ A;  2WKR A;  2JC7 A;  3UE3 A;  2VGK A;  3KX0 X;  3VOL A;  2ZQ9 A;  4E3M A;  2WZX A;  1S4R A;  4S2M A;  5HSQ A;  5E43 A;  4EU0 A;  5A92 A;  3SH8 A;  1LSX A;  3CLO A;  3GEC A;  1H5X A;  3CHW P;  3UDX A;  3S4X A;  4Q0J A;  3VFH A;  1GHM A;  1S66 L;  3W8K A;  3UB9 A;  1P9R A;  3H7W A;  2ZJ9 A;  3VOY A;  4JF4 A;  5DJT A;  3BFE A;  3IXG A;  3AGD A;  3IHA A;  4KZ9 A;  4PMA A;  3IX3 A;  4LCM A;  2P7J A;  2BTF P;  4LV3 A;  4GB7 A;  4HEF A;  3JVV A;  2GNX A;  3S7Q A;  2Z2M B;  1BTL A;  1XX2 A;  1KGE A;  5GHY A;  4WM9 A;  2W3E A;  1JTG A;  5EV0 A;  3BY8 A;  3SS4 A;  4HP9 A;  2HP9 A;  4ARZ B;  2JN7 A;  4CLC E;  2PT7 A;  3MFD A;  3DW0 A;  4NET A;  3HLG A;  5CX7 A;  3ZNT A;  4KUO A;  4KZ3 A;  1EI5 A;  2WKI A;  1FCO A;  5GLA A;  2ZMF A;  2V2F F;  1OT9 A;  4FH2 A;  5A8B A;  4O0P A;  1N9L A;  2OSU A;  3HLF A;  2W0N A;  4NKP A;  1NRF A;  3S22 A;  1K57 A;  1MWT A;  3I7J A;  4QPR A;  3GMW A;  4OKP A;  1J9M A;  3B3X A;  5IT5 A;  1MWU A;  3QP6 A;  4KQO A;  2VV8 A;  2J80 A;  2ZM8 A;  3F1N A;  2C6W B;  5FI2 A;  3CZD A;  4WZ5 C;  4XT2 B;  1KGG A;  4MMN A;  4ESP A;  4N92 A;  1YT4 A;  2HGV A;  4HIA A;  1I2S A;  2Y2Q A;  2YKH A;  5DF8 A;  5FQQ A;  4DDY A;  4ZAM A;  4Z1W A;  1KE0 A;  2D02 A;  4P6Z M;  3CUE A;  2H0T A;  1Y4O A;  3B33 A;  4F94 A;  2ZC4 B;  3NY4 A;  4ZBE A;  3UO9 A;  4GDN A;  4X6T A;  1ZG6 A;  3ULF A;  3SW1 A;  2H5S A;  4HBT A;  4QY6 A;  4R38 A;  4R4S A;  2VKS A;  3HBR A;  4GHI A;  3ZG7 B;  2GX5 A;  5HL6 A;  3F1P A;  3HRE A; 
#chains in the Genus database with same CATH homology
 2OLV A;  3BLM A;  1ONG A;  1YM1 A;  4R3B A;  4OON A;  5CGS A;  2WZZ A;  1IYS A;  1MWR A;  3NIA A;  5DF7 A;  4MLL A;  1AXB A;  4B88 A;  2ZD8 A;  4X69 A;  2XLN A;  1K56 D;  4R23 A;  3G34 A;  3W4O A;  4CPK A;  1SDN A;  4UA9 A;  5FAS A;  5HAQ A;  1PW1 A;  3BFD A;  1FSY A;  1O07 A;  3PTE A;  4GNU A;  3QNB A;  3ZG9 B;  4CJN A;  5KZH A;  4R4R A;  1BLH A;  4IBX A;  1NYY A;  3WRZ A;  3A3F A;  5EVI C;  3OCL A;  4K0X A;  4EBN A;  4WEJ A;  3OCN A;  5EUA A;  1E3U D;  3IF6 A;  3BFG A;  1GA0 A;  3ZNY A;  3FZC A;  1YLW A;  1K25 A;  5HAI A;  3BEB A;  5CHM A;  3C4P A;  3UNW A;  1ES2 A;  4KEN B;  2OV5 A;  2FFF B;  4YIN A;  1LI9 A;  4MBH A;  5FAP A;  4QY5 A;  4XUZ A;  1IKG A;  1ES3 A;  2Y2N A;  2Y91 A;  2HDU A;  5CTN A;  3ISG A;  4RVA A;  5AQA A;  1K4E A;  2XR0 A;  1KGF A;  1NJ4 A;  1YMX A;  2Y2P A;  3Q1F A;  4KZ6 A;  3O88 A;  3ZG5 A;  1PZO A;  2EXA A;  1KDW A;  2HPB A;  4DE2 A;  2V1Z A;  3PBO A;  3WS1 A;  4GDB A;  4GOG A;  4B4Z A;  3IQA A;  1FQG A;  3C7V A;  4OLG A;  4GZB A;  3V50 A;  1XGI A;  1ALQ A;  5FI6 A;  1BUE A;  4U0X A;  1U60 A;  2Y2L A;  3N4I A;  3G32 A;  4E3N A;  4OP8 A;  2BG1 A;  1Z6F A;  1CEF A;  4UA6 A;  1K6R A;  5FAT A;  2EFU A;  4DDS A;  4EWF A;  5HL1 A;  4OPZ A;  1L2S A;  2Y2G A;  4GKU A;  4BL2 A;  1VQQ A;  2DCF A;  2I72 A;  4KQR A;  1K6S A;  4LCL A;  3QHY A;  1GCE A;  3VSL A;  5DVA A;  4DE0 A;  1BLC A;  5EVI B;  1K54 C;  1S0W A;  1XP4 A;  3A3E A;  4C75 A;  4EUZ A;  3Q7V A;  3GSG A;  1W5D A;  3BLS A;  3PBT A;  1XA1 A;  5A90 A;  1FR1 A;  2ZQA A;  3LY4 A;  4Y0T A;  1YLT A;  5FQK A;  2QPN A;  1IKI A;  2ZM0 A;  4OP5 A;  2X71 A;  2P74 A;  3VMA A;  2Q9N A;  4KZ5 A;  5FAO A;  3IXH A;  4OQG A;  1N4O A;  4JXS A;  3G4P A;  3ZVT A;  1CI9 A;  1M40 A;  1W8Q A;  3GV9 A;  4MBK A;  3WWX A;  2XF3 A;  5HX9 A;  2G2W A;  3G30 A;  5FA7 A;  5E2G A;  3UN7 A;  1HTZ A;  1DJA A;  3BRM A;  5KSH A;  1O7E A;  3N8S A;  5E2H A;  1HD8 A;  1LL5 A;  4QB8 A;  1K4F A;  4DF6 A;  5JYO A;  3HUN A;  4S2J A;  4ZDX A;  3RJU A;  1XPB A;  1ESI A;  3MZE A;  3UDI A;  1MKI A;  1Y54 A;  3PAE A;  2WAE A;  3V39 A;  1IYQ A;  2XD1 A;  1KDS A;  1L0E A;  1ZC2 A;  3HLB A;  4XXR A;  5CXW A;  2A3U A;  3VFF A;  4Y0O A;  4S2K A;  1NZO A;  3DWZ A;  4EQI A;  4OLD A;  4OQH A;  1QME A;  3AGE A;  5E2E A;  1PIO A;  4DRT A;  4JF5 A;  4E3O A;  1CEG A;  1BLP A;  3IF6 C;  4GN2 A;  3UDF A;  3ZHH A;  4O7D A;  3MXS A;  2WGW A;  4WEL A;  3NDE A;  2WGW B;  3Q07 A;  4Y0U A;  5F83 A;  4BL3 A;  5HAP A;  3NI9 A;  4KQQ A;  3E2K A;  1Q2Q A;  1JWP A;  2XD5 A;  4IVK A;  3SS5 A;  4EV4 A;  4PM5 A;  4QD4 A;  2VGJ A;  1MPL A;  1JTD A;  2Y2H A;  3PBS A;  5CRF A;  4IED A;  4JF6 A;  4OOY A;  2HDS A;  1BLS A;  4WBG A;  4XUX A;  4OQ0 A;  5GL9 A;  2J9O A;  4WZ4 A;  1NZU A;  2PU4 A;  4ZTK A;  1K55 A;  5TFQ A;  3LO7 A;  5CTM A;  3CMZ A;  3C5A A;  3PBR A;  3N7W A;  5EE8 A;  1YLZ A;  4Q8I A;  5GHZ A;  1LLB A;  2ZLY A;  1IYP A;  4KG5 A;  1K38 A;  1VM1 A;  2P9V B;  5I94 A;  4BD1 A;  3WRT A;  3O86 A;  1DY6 A;  3IXD A;  3IWQ A;  3PAG A;  5FQM A;  4PM9 A;  4N1X A;  3P98 A;  5AQB A;  3WS0 A;  5CGW A;  3WS5 A;  3BYD A;  5AQ9 A;  2C5W B;  4BQM A;  5CEC A;  3FKW A;  2ZM2 A;  3MKF A;  3IWI A;  5EEC A;  4JLF A;  1BT5 A;  5IHV A;  3S1Y A;  3ZVW A;  5KMW A;  1YLY A;  3ITA A;  3Q7Z A;  4UAA A;  1CK3 A;  1NYM A;  2PBY A;  4FCF A;  4RX2 A;  5HAR A;  1NXY A;  1K57 C;  5E2F A;  1XXM A;  3GRJ A;  5FQI A;  3IHB A;  1ZKJ A;  2H0Y A;  4JKT A;  3V3S A;  4PPR A;  3HLC A;  3LCE A;  3UE1 A;  4E3K A;  2XK1 A;  3FWL A;  4YFM A;  2JE5 A;  4RX3 A;  4MNR A;  4E6W A;  3DTM A;  1EWZ A;  1IYO A;  4S2N A;  4E3J A;  4X55 A;  5F1G A;  4LV2 A;  5GLB A;  4IBR A;  5AQ7 A;  1FOF A;  3IXB A;  1GHP A;  4OPR A;  4X53 A;  1PZP A;  4OH0 A;  2XFS A;  3VP0 A;  5D3O A;  4ZJ3 A;  1ES5 A;  4R1G A;  5M19 A;  2XQZ A;  5CHJ A;  4B4X A;  2HDR A;  5BOH A;  2EX6 A;  1LI0 A;  3PBN A;  3RXX A;  3MZD A;  3TOI A;  4N9L A;  3FV7 A;  3G2Y A;  1XKZ A;  2G2U A;  4E6X A;  4KZA A;  2JCH A;  3N6I A;  2ZQD A;  2A49 A;  3M2J A;  5U47 A;  3V5M A;  3ZGA B;  5DTK A;  3D4F A;  2DRW A;  3N8R A;  1LL9 A;  3M2K A;  1IEM A;  5CER A;  1MY8 A;  4S2L A;  3TG9 A;  3M6B A;  1G6A A;  2WGI A;  3VOZ A;  1TEM A;  4OPY A;  5KSC A;  2IWC A;  2ZC6 B;  1JWV A;  2WKE A;  2WK0 A;  2UWX A;  4X56 A;  5EVI A;  1YMS A;  1PI4 A;  2ZC5 B;  2FFY A;  3RXW A;  2R9X A;  2WAD A;  4PM7 A;  1PWG A;  3PBQ A;  4IVI A;  1GA9 A;  2WGV A;  3OC2 A;  4N1H A;  3IT9 A;  3OPL A;  3LY3 A;  5CEB A;  3UPN A;  1KE4 A;  2J7V A;  4LV1 A;  4DKI A;  3OZH A;  2Y2O A;  2RL3 A;  2J9P A;  4K91 A;  2WUQ A;  4WYY A;  4QJG A;  2XGN A;  4RYE A;  3FYZ A;  1NY0 A;  3WS2 A;  1KVL A;  3C7U A;  2B5R A;  4S2O A;  2HDQ A;  1KE3 A;  4WMC A;  5F82 A;  3HLE A;  3O3V A;  1DJB A;  1N9B A;  5DTS A;  4X68 A;  3QNC A;  4BLM A;  3MKE A;  4PM6 A;  3ZFZ A;  1I2W A;  4QHC A;  1K55 C;  2EXB A;  3OPH A;  1JVJ A;  2QMI A;  1LHY A;  3P09 A;  4FD8 A;  5TR7 A;  3SH7 A;  3VP4 A;  1XGJ A;  2ZC7 A;  1DJC A;  2HP5 A;  4EBL A;  1MBL A;  1PI5 A;  2ZMA A;  3CG5 A;  4HBU A;  4P87 A;  4GD8 A;  4D2O A;  5A93 A;  1FCN A;  2Y2K A;  2JC7 A;  2E8I A;  5M1A A;  3UE3 A;  4DE3 A;  1YQS A;  2VGK A;  5FI7 A;  2ZQ9 A;  5FSR A;  4E3M A;  2WZX A;  3GTC A;  4S2M A;  4UHU A;  2ZQ7 A;  5E43 A;  1SCW A;  1JWZ A;  2Q9M A;  4GD6 A;  3EQU A;  1FSW A;  2WKH A;  4JXG A;  4Z9Q A;  1TDL A;  4OOL A;  4KZ7 A;  5DTT A;  5J8X A;  1K56 A;  4ID4 A;  4DE1 A;  1L0G A;  4JXV A;  4R3J A;  4OVD A;  5A92 A;  1MWS A;  3SH8 A;  4OQI A;  1E4D A;  2GDN A;  4ZJ2 A;  1S6R A;  2PU2 A;  3OPP A;  2Y55 A;  2XDM A;  5A91 A;  1BSG A;  5TGF A;  1SDE A;  4M3K A;  4WZ5 A;  4S2N C;  1BUL A;  1H5X A;  3UDX A;  3G2Z A;  3ZDJ A;  2BLS A;  2P9V A;  3S4X A;  3VP1 A;  1ERM A;  4R0Q A;  3VFH A;  1E3U A;  1GHM A;  3HUO A;  1KVM A;  3W4P A;  3W8K A;  1RGZ A;  4BJP A;  3HL9 A;  2XH9 A;  3UY6 A;  2ZJ9 A;  3GVB A;  3BFC A;  3IH8 A;  3A3I A;  1BZA A;  5FAQ A;  1CI8 A;  3VOY A;  3VP3 A;  4A5R A;  5EVL A;  2WAF A;  3HVF A;  1MXO A;  3ITB A;  4H8R A;  4JF4 A;  3HLW A;  3BFE A;  3IXG A;  4E3L A;  3IF5 A;  3AGD A;  5M18 A;  3IHA A;  1YLP A;  4KZ4 A;  1ZG4 A;  4KZ9 A;  1ONH A;  4S2I A;  4PMA A;  5F1F A;  2QZ6 A;  4LCM A;  4C6Y A;  4KG2 A;  2V20 A;  4L0L A;  5CGX A;  1ESU A;  4MBF A;  3BM6 A;  5FDH A;  2RCX A;  1W79 A;  1WYB A;  4LV3 A;  3E2L A;  4GB7 A;  1PYY A;  3A3J A;  4HEF A;  1HVB A;  5L2F A;  3IF6 B;  1Q2P A;  1GHI A;  2ZQC A;  2Z2M B;  4FSF A;  3WS4 A;  4UA7 A;  1BTL A;  3NBL A;  1SHV A;  2WYX A;  2DNS A;  3HLD A;  3MZF A;  1XX2 A;  1KGE A;  5GHY A;  4WM9 A;  1YLJ A;  1XA7 A;  1JTG A;  3NC8 A;  1TVF A;  3UE0 A;  3UPP A;  1C3B A;  4MEZ A;  3Q82 A;  2ZC3 B;  3SS4 A;  4BD0 A;  2Y4A A;  1FR6 A;  2Y2J A;  1ERO A;  4NK3 A;  2HP9 A;  2OLU A;  2EX9 A;  2CC1 A;  2HP6 A;  3OPR A;  4EBP A;  5CHU A;  2R9W A;  3MFD A;  1L0D A;  3ZCZ A;  3DW0 A;  1L0F A;  4NET A;  4P85 A;  3HLG A;  3G31 A;  3ZNT A;  1OME A;  4KZ3 A;  1EI5 A;  3M6H A;  2WKI A;  3BFF A;  4C3Q A;  3UPO A;  2H10 A;  1FCO A;  3NCK A;  5GLA A;  2V2F F;  3W4Q A;  4LV0 A;  1TDG A;  4FH2 A;  5GLD A;  1RP5 A;  4ZJ1 A;  1FCM A;  2OSU A;  3HLF A;  3SS3 A;  2XEP A;  4RA7 A;  2Y2M A;  4S2P A;  1NRF A;  3S22 A;  2Z2L B;  4KG6 A;  1K57 A;  3DWK A;  1MWT A;  5FQ9 A;  3I7J A;  4HES A;  3C4O A;  3NDG A;  1RCJ A;  3GMW A;  4PM8 A;  1QMF A;  5FQJ A;  4U3T A;  1RGY A;  2EFX A;  3MXR A;  4OKP A;  1W8Y A;  4U0T A;  1WYC A;  5JYP A;  1J9M A;  3B3X A;  4P6B A;  5EOO A;  3V3R A;  1MWU A;  4LEN A;  4KQO A;  5HW3 A;  2EX8 A;  5EOE A;  4JXW A;  1ERQ A;  3Q7V B;  5G18 A;  4JPM A;  4QU3 A;  1PW8 A;  3VSK A;  1W7F A;  2ZM8 A;  5DF9 A;  3BEC A;  4WEK A;  2C6W B;  3LEZ A;  5FI2 A;  3CZD A;  4WZ5 C;  5EPH A;  4E3I A;  3MBZ A;  1SKF A;  1KGG A;  5EVI D;  2IWD A;  1IEL A;  4OOM A;  4N92 A;  4K0W A;  4JBF A;  1YT4 A;  4Y7P A;  3VP2 A;  1I2S A;  3Q81 A;  2Y2Q A;  2EX2 A;  3CJM A;  2XFT A;  5HFO A;  4BEN A;  3O87 A;  1I5Q A;  5DF8 A;  5FQQ A;  1M6K A;  3SOI A;  4FH4 A;  1H8Z A;  1G68 A;  3FKV A;  4DDY A;  3TSG A;  2Y59 A;  3A3D A;  4ZAM A;  3HUM A;  3SH9 A;  1KE0 A;  4N9K A;  3IH9 A;  3EQV A;  2JBF A;  3GQZ A;  4WMC D;  3ZG8 B;  1H8Y A;  2IWB A;  2ZQ8 A;  5CED A;  2H0T A;  2X02 A;  1ES4 A;  3N8L A;  4KZ8 A;  4P0M A;  2X01 A;  4F94 A;  1E25 A;  5GLC A;  1WE4 A;  1PWD A;  2ZC4 B;  1K54 A;  3NY4 A;  4ZBE A;  3UO9 A;  3IWO A;  4GDN A;  4OPQ A;  4X6T A;  2Y2I A;  1ZG6 A;  3GR2 A;  1PWC A;  2H5S A;  4HBT A;  4QY6 A;  4R4S A;  4DXC A;  3HBR A;  3ZG7 B;  1HZO A;  3JYI A;  5GHX A;  4KZB A;  4DXB A;  3AGF A;  3G35 A;  3ZG0 A;  3HRE A;  2J8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...