1EROA

X-ray crystal structure of tem-1 beta lactamase in complex with a designed boronic acid inhibitor (1r)-2-phenylacetamido-2-(3-carboxyphenyl)ethyl boronic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-1 BETA-LACTAMASE
publication title Structure-based design guides the improved efficacy of deacylation transition state analogue inhibitors of TEM-1 beta-Lactamase(,).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 96
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1eroA00
3NIAA 1CK3A 2R9XA 1HZOA 4N92A 1N4OA 3LO7A 1BTLA 1HD8A 1ESIA 1ZG6A 4Y0OA 1TVFA 3W8KA 4JXVA 1BULA 2P9VB 1YT4A 4K91A 1L0FA 1PWDA 4IEDA 3SH7A 4N9KA 4HBTA 1NYMA 2J8YA 3FKWA 4ZBEA 3W4PA 2JC7A 3DWKA 1NJ4A 4KQOA 3V3SA 5AQBA 3ZG9B 4LV0A 5GLCA 4OQGA 5GHXA 4LV3A 4R0QA 1S0WA 3M2JA 4KZAA 2Y2IA 1TEMA 1YLPA 3VSLA 2V2FF 1YM1A 1JTDA 2HP6A 1PW8A 1K57C 2JE5A 5CRFA 1PI5A 4FD8A 3MFDA 2ZM8A 4QB8A 4S2LA 5CERA 2DRWA 1MXOA 1XA1A 2OLVA 2ZQ7A 1K55A 2A49A 3A3FA 4MNRA 4OP8A 4OQIA 3WWXA 3ZHHA 4WZ5C 2EX9A 4EBNA 4MEZA 2IWDA 3PBSA 4E3JA 1LI9A 5CEDA 4RX3A 4KQRA 1XKZA 3BM6A 5IHVA 5FASA 5FQJA 3JYIA 3IH8A 3UE3A 2Y2HA 4QD4A 3EQUA 3GMWA 3E2KA 3O86A 4R3JA 3VOYA 1EI5A 2QMIA 3HLCA 2XQZA 3IWIA 3C4PA 1NRFA 4MBFA 5F83A 2OSUA 4DRTA 3WS1A 1K57A 4KG2A 4GOGA 4X56A 3WS5A 5F1FA 5HAQA 4GZBA 1ONGA 1LL9A 4L0LA 4XUXA 3SOIA 4KZ3A 1W5DA 5TFQA 3HUMA 4UAAA 1SKFA 5GLAA 3VFHA 2WGVA 4E6XA 1H5XA 4WZ5A 5CEBA 3PBOA 1RGZA 5GHZA 5FAPA 2CC1A 4IVKA 1H8ZA 5FQKA 2WYXA 3ITAA 2WAFA 2XEPA 1MWTA 5GL9A 2DCFA 2XK1A 3P09A 4N1XA 5DTSA 5AQ7A 3RXWA 2WGWA 3SS5A 3VOZA 2XR0A 1JTGA 4DDYA 1O7EA 3G34A 2ZC6B 4GN2A 4OOYA 4DF6A 3NC8A 3BRMA 1HTZA 4JF6A 5FDHA 5A92A 3UPOA 4GDBA 3GRJA 2ZMAA 4WMCD 1I5QA 1K6SA 2EX6A 2Y2OA 1KGGA 2ZQ9A 3N6IA 2RL3A 5FQQA 5KSHA 1NXYA 5HAIA 1K38A 4BD0A 5FSRA 1CI8A 4S2PA 3FZCA 1ERMA 1M40A 4PM9A 3CG5A 4X69A 2G2UA 3G31A 1GCEA 3WRTA 5J8XA 1BLHA 1Z6FA 4Y0UA 1O07A 4DE3A 3SH9A 3MKFA 3BYDA 5M1AA 2WZXA 3V3RA 5CHUA 3UO9A 4UA7A 4RYEA 4KZ9A 3CZDA 5FI6A 4DE2A 1XA7A 1PWCA 4ZJ2A 3Q82A 3ISGA 3S22A 5A91A 3SS3A 2EX8A 4JPMA 2WGIA 3FV7A 4JKTA 3VP1A 2WZZA 1L0GA 3AGFA 1L0EA 1MBLA 4GD6A 2ZQDA 2WADA 4DXBA 4DDSA 3HUOA 4WMCA 4XXRA 1PYYA 4IVIA 1CEGA 2ZJ9A 3DW0A 5D3OA 3G2YA 1J9MA 3ZG5A 1RP5A 1JWZA 3HREA 5FAQA 4ZAMA 3B3XA 2Y2MA 5CGSA 4HBUA 5E2GA 2Y2NA 3IF6B 2QPNA 5JYOA 4OPQA 4BJPA 3PBNA 3W4QA 1K55C 5M19A 4OH0A 3MZDA 2ZC5B 2R9WA 1BSGA 3QNBA 4E3LA 2WK0A 1W79A 1E3UD 4WM9A 1ES2A 1GHMA 5EPHA 1DJCA 5DTKA 1MWUA 1PW1A 4IBRA 2VGJA 3NDEA 3LEZA 3NBLA 5EVLA 3NCKA 2P9VA 2XGNA 3NDGA 4LV1A 4MBKA 1OMEA 1E4DA 4S2NC 3IWQA 3LY3A 4PM8A 1RCJA 3PAGA 3GVBA 4NK3A 4ZJ1A 5GLDA 3VFFA 3C4OA 2A3UA 4YFMA 1YLWA 1WYCA 1KE0A 3WRZA 1PI4A 3V50A 2WKHA 5E2EA 2H0TA 4DKIA 3UY6A 1K54A 1U60A 3WS2A 1K25A 1BT5A 4R4SA 1SDEA 1EWZA 1XGIA 1FOFA 1IYOA 3N7WA 4E3IA 1BLCA 1W7FA 3N8RA 3ZG7B 3G32A 5GHYA 4E3MA 1BZAA 2B5RA 4QY6A 4GDNA 4BD1A 1E3UA 1K4EA 2Z2LB 2EFUA 4OLGA 4RVAA 4S2NA 3PTEA 2H5SA 3WS4A 4BENA 3TSGA 1K56D 1IELA 2WKIA 3HL9A 2GDNA 4X53A 2X01A 2C6WB 1YMSA 1AXBA 1BLPA 2IWCA 3HLDA 3OPLA 4KZ6A 1GA0A 1FSYA 4MLLA 1YMXA 4U0TA 5CTMA 2Q9NA 4KQQA 4KZ7A 3UDFA 4N1HA 4E3NA 4FH2A 2ZQ8A 3HUNA 2J9OA 2J9PA 4PM6A 4UA6A 3C7VA 1BUEA 4B4XA 3UNWA 2WUQA 1KVMA 5EVIB 2Q9MA 3MZEA 1WYBA 4IBXA 3SS4A 3IWOA 4DE1A 2Y55A 4GKUA 1C3BA 4EQIA 1HVBA 4WELA 3QNCA 3BFCA 3N8SA 5CECA 3LY4A 1FCOA 2ZC4B 2FFFB 4FCFA 1NZOA 1SDNA 4OP5A 4X6TA 1YLJA 5FQMA 4YINA 5DVAA 2OV5A 2BLSA 4PMAA 3LCEA 1IEMA 4OVDA 2Y2PA 1K56A 4NETA 2EXBA 1L0DA 1S6RA 4WEKA 4K0XA 5CHJA 4WBGA 3OPRA 1ES3A 1G6AA 1IYQA 3M6HA 3Q7VB 1NZUA 1MY8A 4N9LA 3ZCZA 2PU2A 1G68A 1N9BA 2H0YA 2Y2GA 3AGDA 3MBZA 4Z9QA 3UN7A 4BL3A 4OOMA 1JVJA 3HVFA 4E3KA 1IKGA 2JBFA 4ID4A 2ZC3B 3G2ZA 1SHVA 1RGYA 4P6BA 4QHCA 2PU4A 4LENA 5I94A 1ES4A 4CJNA 4O7DA 2Y2KA 5G18A 1ERQA 4U0XA 3M6BA 3ZFZA 1ZKJA 3UDIA 3VP4A 1DJBA 3IF6C 4UHUA 1ALQA 3ZVWA 3A3IA 3IXGA 4OONA 2ZQAA 3MXSA 4QU3A 2FFYA 4C3QA 4X68A 1FCMA 1CEFA 1FQGA 5CGWA 3BEBA 4XUZA 3FYZA 3RJUA 4EBPA 3BECA 3VSKA 1QMFA 5FI2A 4UA9A 2I72A 1KVLA 4P87A 1MWSA 1Q2QA 4S2IA 3V5MA 3M2KA 3GTCA 4OPZA 5FA7A 3E2LA 1XX2A 4JF4A 4X55A 1KE3A 4OOLA 5AQAA 5HW3A 4OQHA 4WEJA 2BG1A 1MKIA 3HLGA 3O87A 1LLBA 1K54C 3Q07A 4EV4A 2HDSA 2HPBA 3Q81A 4PM7A 1K4FA 3VP2A 4R3BA 4FH4A 3IF6A 3W4OA 2IWBA 5E43A 1KDWA 3FWLA 2G2WA 4KZ8A 1JWVA 2XLNA 1Q2PA 4ZTKA 3VP3A 3VMAA 3A3JA 3ZGAB 1L2SA 3UDXA 4Y7PA 3MXRA 2HP5A 5BOHA 3C5AA 3ZG8B 1VQQA 1TDLA 2XH9A 1SCWA 2Y91A 5E2FA 2ZLYA 4DE0A 3OCLA 3V39A 3A3DA 5DF7A 3OC2A 3DTMA 4S2KA 1PZPA 5EOEA 5EE8A 4LCLA 5KSCA 1W8YA 3A3EA 4BQMA 3ITBA 1CI9A 4E6WA 5CHMA 2E8IA 4WYYA 4EWFA 2X02A 4H8RA 3C7UA 2PBYA 3BFFA 3N8LA 4JXGA 4OQ0A 5FAOA 5FQIA 3PBQA 5TGFA 3TOIA 1YLZA 3EQVA 1E25A 1FR1A 3S1YA 4KZBA 2ZM0A 1GHPA 3HLBA 5EVID 3PBRA 2XDMA 4OKPA 5DTTA 2JCHA 3BFEA 3NY4A 4C6YA 4B88A 3G35A 3OCNA 3HLEA 4R1GA 4KZ4A 5EVIC 4R23A 4S2JA 5CXWA 3ZDJA 3O88A 4E3OA 5TR7A 3ZVTA 5JYPA 3I7JA 3IHBA 3OPPA 4KG5A 1Y54A 2ZQCA 3AGEA 3IH9A 5HX9A 5E2HA 2EFXA 2EX2A 4LCMA 1KE4A 2ZD8A 4ZDXA 1JWPA 2WAEA 4KZ5A 3O3VA 4Y0TA 1WE4A 1ESUA 1XGJA 3HLFA 3OPHA 1IYPA 1YQSA 5GLBA 1W8QA 4FSFA 4OPRA 2HDRA 1VM1A 1YLTA 2J7VA 5CGXA 1ZC2A 4PPRA 5HFOA 3MKEA 2P74A 3UPPA 3OZHA 1EROA 3ZNYA 5M18A 1LL5A 3HLWA 4U3TA 3CJMA 3UE0A 2XFTA 4KENB 3GR2A 3Q1FA 5EVIA 3TG9A 1XPBA 4DXCA 3MZFA 5HL1A 1K6RA 5EOOA 2EXAA 1PZOA 1LI0A 2Y2LA 4RA7A 3N4IA 4CPKA 3BFDA 2Y4AA 1GHIA 2XD5A 5F1GA 2Y59A 4JXWA 2WGWB 5HAPA 1YLYA 4K0WA 1ES5A 1KDSA 4BLMA 1FR6A 2WKEA 2XD1A 2Z2MB 2ZM2A 3IT9A 3G4PA 4S2MA 3Q7ZA 2H10A 2V1ZA 3IXDA 5DF9A 1MPLA 3BFGA 4GB7A 3QHYA 1QMEA 4P0MA 3IXBA 4S2OA 3HBRA 1TDGA 1FCNA 3Q7VA 2V20A 1IYSA 2QZ6A 3GV9A 3PBTA 4HESA 2HDUA 3S4XA 4QJGA 1ZG4A 1PWGA 5F82A 4EUZA 4A5RA 3ZG0A 3UE1A 4QY5A 3P98A 1XP4A 2OLUA 5U47A 3D4FA 2Y2JA 1PIOA 4JLFA 2DNSA 2HP9A 4OPYA 5DF8A 5FQ9A 2Y2QA 5HARA 5L2FA 5FI7A 1GA9A 1NY0A 2C5WB 2RCXA 5KZHA 1IKIA 5KMWA 2UWXA 3SH8A 5A90A 2VGKA 1DY6A 2HDQA 5EUAA 4F94A 4C75A 1H8YA 1KGFA 1BLSA 4KG6A 1KGEA 2XFSA 3GQZA 3WS0A 4MBHA 1LHYA 4ZJ3A 2X71A 4LV2A 3CMZA 1DJAA 1I2SA 5FATA 4B4ZA 4EBLA 3NI9A 1XXMA 4BL2A 4HEFA 1MWRA 3DWZA 3IF5A 4PM5A 3BLSA 3IHAA 4GD8A 1M6KA 5AQ9A 4Q8IA 3GSGA 4R4RA 2ZC7A 3PAEA 4GNUA 4D2OA 3BLMA 4OLDA 3VP0A 2XF3A 4RX2A 1NYYA 3IQAA 4JXSA 5EECA 1FSWA 3UPNA 1I2WA 5A93A 3IXHA 4P85A 5CTNA 4JBFA 3RXXA 1ONHA 4WZ4A 3FKVA 4JF5A 3ZNTA 4M3KA 3G30A
chains in the Genus database with same CATH superfamily
3NIAA 1CK3A 4N92A 1HZOA 1N4OA 4BBVA 2E8JA 1DP8A 2AVXA 4JXVA 4Y17A 3CPTB 4M4XA 3H9WA 3ULFA 4IEDA 3QP1A 4ZBEA 2JC7A 1BYWA 1N9NA 3NHQA 5FEFA 1F98A 4OQGA 1ZTUA 4R0QA 1F9IA 3UB9A 3M2JA 1YM1A 5HD5A 1K57C 2L1MA 4FD8A 4B9OA 4S2LA 2W3EA 2OLVA 3A3FA 2A49A 4OP8A 4EXOA 4EBNA 4MEZA 2IWDA 1LI9A 4RX3A 4E04A 3JYIA 4HIAA 3CUEA 3UE3A 2Y2HA 4QD4A 3GMWA 3VOYA 2QMIA 2GNXA 1FILA 4Y3IA 4DRTA 2VZWA 4R38A 4GOGA 1Y4OA 3HUMA 1SKFA 3VFHA 4WZ5A 1MKMA 4PHTA 2DCFA 2XK1A 3RXWA 2WGWA 3B42A 3VOZA 1V9ZA 1O7EA 2ZC6B 4GN2A 3BRMA 3UPOA 4GDBA 2HZ5A 1I5QA 1K6SA 2Y2OA 3N6IA 5FQQA 2RL3A 3LI9A 1NXYA 1YKDA 5HDSA 5HAIA 3T4LA 2W1TA 3IBRA 4CLCB 3ZYTA 4F3LA 1ERMA 4HP4A 2G2UA 1GCEA 3E98A 5J8XA 1BLHA 4Y0UA 3E4PA 3MKFA 5M1AA 4UA7A 1XA7A 1XFNA 3ISGA 2WKRA 2WGIA 3FV7A 4JKTA 3VP1A 3S7NA 2OAP1 2ZQDA 4G3KA 4XXRA 4KUKA 2B02A 3VV4A 3NJAA 1RP5A 4FOFA 3T1SA 3EOIA 4ZAMA 4X1LA 2Y2MA 5CGSA 2Y2NA 3CITA 3MSHA 3S7QA 4OH0A 5FEGA 2ZC5B 1P97A 2WK0A 1E3UD 4CLCE 1T1BA 3H82B 3O5YA 2DMWA 2PBDP 3CPTA 2XGNA 2V0WA 4LV1A 4MBKA 1E4DA 5AVFA 3LY3A 4ZJ1A 4NK3A 1T19A 3VFFA 3C4OA 3D3OA 1WYCA 1VEUB 3WRZA 4NEED 4DKIA 3UY6A 3VOLA 1SDEA 1IYOA 3N7WA 3OOVA 2M7UA 4E3MA 1XJ2A 3BWLA 4BD1A 1E3UA 1K4EA 4S2NA 4BENA 3TSGA 1K56D 2GDNA 1G28A 2C6WB 1OTBA 1YMSA 4Z1WA 2IWCA 3HLDA 3OPLA 2JKTM 4MLLA 4JGRA 4CLCD 3IX8A 4KZ7A 4KQQA 3T12B 4X25A 4B4XA 3UNWA 4IBXA 3IWOA 4DE1A 2B95A 4FCFA 1NZOA 1W63Q 4X6TA 1YLJA 3DTKA 4OVDA 3FPWA 5AVEA 2Y2PA 1K56A 4HOIA 4NETA 2M7VA 1UGUA 1L0DA 3W2ZA 5CHJA 2PU2A 1G68A 3UN7A 4CQHA 4CLCA 1J3WA 4ID4A 3F1OB 2PU4A 1ES4A 3T4TA 2B18A 3EWKA 4U0XA 1ZKJA 3UDIA 5L10A 5HSQA 4MN6A 4I5SA 4C3QA 3BEBA 2KLIA 3LGOA 4P6ZM 2I72A 1KVLA 1MWSA 3GTCA 3KO6A 4HJ3A 4OOLA 5HW3A 4WEJA 3LFVA 2ZL1B 3Q07A 4PM7A 1SKOA 4R3BA 4FH4A 4QPRA 3IBJA 3FC7A 3W4OA 2G2WA 2KDKA 2XLNA 3LIFA 1L2SA 3H82A 2HP5A 4R70A 1VQQA 1TDLA 2XH9A 1SCWA 5E2FA 2ZLYA 3OCLA 3V39A 4FTXA 5HWTA 3LR4A 4GLQA 5CHMA 1VEUA 4WYYA 3OBFA 4L9EA 3C7UA 1P0ZA 2PBYA 3BFFA 5FAOA 4BBUA 4DMZA 4EERA 5JYPA 3TOIA 1GHPA 2XDMA 4OKPA 3K3CA 3G35A 5EVIC 4R23A 3ZDJA 4Y5FA 5TR7A 3OPPA 2WKPA 3IH9A 5HX9A 1KE4A 4EQ1A 4ZDXA 1XGJA 3OPHA 1TS8A 3D72A 1YLTA 4Q0HA 2J7VA 1LT0A 5HFOA 3MKEA 3OZHA 4R3AA 1PRQA 4DXCA 3MZFA 5HL1A 4FUWA 1LI0A 1GHIA 5HAPA 4JXWA 2JKRI 3RH8B 1KDSA 4LFUA 1W63M 1FR6A 2ZM2A 3IT9A 3ZQ5A 2QHKA 2NUPC 3BFGA 3B47A 1QMEA 4EEUA 3HBRA 1TDGA 1F5MA 2BTFP 4HH3A 1PWGA 5HPIA 4A5RA 3F1OA 4QY5A 5G4YA 5HD3A 2EA9A 3D4FA 2Y2QA 5HARA 1GA9A 1DY6A 5EUAA 3UMEA 4KG6A 3VE4A 3UB8A 4G3VA 2R78A 5FATA 4B4ZA 2JKFA 4EBLA 1XXMA 2FH5A 4XT2B 4PM5A 4GJ4A 4HNBA 4GHIB 1N9LA 4GNUA 2ZL1A 4D2OA 3H7WB 3VP0A 1NRJA 3IQAA 2V1AA 3HJKA 1FSWA 2VV8A 4JXSA 5CTNA 5TBMB 2QJ7A 1GSWA 3LO7A 3NECA 1HD8A 1MZUA 5HWWA 1BULA 2P9VB 3SH7A 1DRMA 4N9KA 4HBTA 1NYMA 3DWKA 3V3SA 4IHQA 4KZAA 1YLPA 3KYEA 2HP6A 1PI5A 2ZM8A 4QB8A 3MMHA 3KSIA 3LR3A 4DJ2A 3WWXA 2P04A 4KQRA 3BM6A 5FQJA 1T1CA 2QWSA 3HLCA 2OWJA 3C4PA 5F83A 3T4JA 3WS5A 1X0OA 5F1FA 5HAQA 4GZBA 4XUXA 3T4KA 1OJGA 2LB5A 4KZ3A 1TS7A 4UAAA 4MMNA 5CEBA 1RGZA 5FAPA 1XJ3A 2XEPA 4N1XA 3P09A 5DTSA 2W3HA 3G34A 2PRFA 4ESPA 3NC8A 1A0KA 1HTZA 1YSQA 3A0RA 2VEAA 3GRJA 2ZMAA 2EX6A 4EEPA 5FSRA 4GS9B 5EVEA 3KYZA 4PM9A 3CG5A 4X69A 3G31A 2A24B 4DE3A 3SH9A 5CX7A 5CHUA 2W0NA 4ZJ2A 1AWIA 4JPMA 1DP9A 1N9OA 2GZAA 1L0GA 1YAXA 4XT2A 3HUOA 4GHIA 1PYYA 1TS0A 1D06A 2ZJ9A 3DW0A 3H7WA 5MC7A 3G2YA 1JWZA 3HREA 1PFLA 5E2GA 4HBUA 4OPQA 3NOUC 4YWZA 1K55C 5TBMA 3QNBA 3PR6A 4E3LA 2UV0E 2J80A 4B93A 3NBLA 5EVLA 3NCKA 2P9VA 3LIBA 2ZMVA 3LI8A 3PAGA 5GLDA 2HV1A 1KE0A 1U60A 3WS2A 1K25A 2PYRA 4R4SA 4Q0IA 4BWIA 1YPRA 3JVVA 4HJ6A 3G32A 2J3WA 2B5RA 4QY6A 4GDNA 4P6ZS 1D1JA 2V8FA 3CI6A 4D60A 1IELA 2V9AA 4X53A 2X01A 4GW9A 1S4SA 2HJEA 1BLPA 1GA0A 2EWVA 1FSYA 3NOPC 4U0TA 1YMXA 2Q9NA 4FH2A 2ZQ8A 4PM6A 1KVMA 3LIDA 2XSSA 3FPVA 3DAVA 2Y55A 1C3BA 3QNCA 3BFCA 3N8SA 1FCOA 2ZC4B 3LR5A 2FFFB 1SDNA 4OP5A 1G5UA 2OV5A 3LCEA 4GCZA 2O9AA 3R7WB 4O0PA 2PAVP 4JGPA 2YKFA 4K0XA 3ZCZA 3EGXC 3QP4A 5LBRA 3AGDA 1N9BA 2H0YA 4BL3A 4E3KA 4GS9A 2ZC3B 3G2ZA 4QHCA 4CJNA 5G18A 1P9RA 3ZFZA 2A24A 5EM0A 3IF6C 1ALQA 3ZVWA 4OONA 3IXGA 2ZQAA 3MXSA 3KX0X 1FCMA 1CEFA 2PD8A 4ARZB 3TE8A 3BECA 4UA9A 4P87A 1H8MA 3E2LA 1XX2A 2L0WA 4JF4A 1GSXA 4X55A 2BG1A 3VE3A 2MJ6A 2HDSA 3Q81A 4DN0A 1CF0A 3FWLA 3TJZC 4KZ8A 1JWVA 1Q2PA 3CWFA 3A3JA 3UDXA 3MXRA 2VLGA 3C5AA 5HDCA 3ZG8B 4DE0A 5J3WA 2KOIA 4ETZA 1LL8A 4I39A 1PZPA 3A3EA 4BQMA 3ITBA 4E6WA 5FDSA 4HI4A 4EWFA 4JXGA 3PBQA 3ZG9B 2XRNA 2ZM0A 3PBRA 2JCHA 3BFEA 5C5KA 3UB5P 3HLEA 5CXWA 1FIKA 2CMNA 3I7JA 3IHBA 4WLAA 3KSHA 5E2HA 2EX2A 4LCMA 2A2LA 4IUHA 1JWPA 2WAEA 3O3VA 4UQIM 1ESUA 3HLFA 3ICYA 1IYPA 5GLBA 1W8QA 4FSFA 4MDZA 1ODVA 1ZC2A 3CAXA 2VV7A 1EROA 5M18A 4U3TA 3CJMA 3UE0A 2PDRA 2ZOIA 1K6RA 1HLUP 3T1XA 2XD5A 5F1GA 1YSPA 1YLYA 5L09A 2JHEA 4BLMA 2XD1A 1JNUA 3R7WA 4LRZE 3Q7ZA 1MPLA 4GB7A 3BJNA 2L4RA 4BMWA 2V20A 3S4XA 2HDUA 3U2AA 4JLFA 2Y2JA 2DNSA 1ZHHB 2VX8A 2C5WB 1IKIA 4QWOA 5A90A 4C75A 1KGFA 4ARZA 1KGEA 1LSVA 3MQQA 3WS0A 1VHMA 3DWZA 3U4LP 3IHAA 1M6KA 2PR5A 5AQ9A 4Q8IA 3GSGA 5KIZA 3PAEA 1LSWA 4RX2A 1Z09A 2W3FA 1I2WA 3KSGA 4JBFA 3RXXA 1ONHA 2Z6DA 4JF5A 3G30A 2R9XA 3LUQA 1BTLA 1ESIA 1TVFA 3W8KA 2W3DA 4EESA 4K91A 1PWDA 3FKWA 3JPUA 3CUEC 4LRXC 5GLCA 3TW8A 5GHXA 3S7PA 1T1AA 2Y2IA 3MS6A 3VSLA 2V2FF 1OTAA 5FL3A 3CLOA 1PW8A 2JE5A 5CRFA 2JN7A 5CERA 2DRWA 2VKSA 1MXOA 4MNRA 4X1MA 3ZHHA 1K55A 2VK3A 2NUTC 4WZ5C 2EX9A 2V0UA 3LEQA 5AJGA 5IHVA 3IH8A 3E2KA 4R3JA 1EI5A 1K0KA 2XQZA 3IWIA 1OTIA 1NRFA 4MBFA 3PXPA 2OSUA 3WS1A 1K57A 4X56A 1LL9A 3SOIA 5GLAA 4E6XA 3E4QA 2HGVA 3PBOA 5GHZA 4HJ4A 3E0YA 2J3TD 4IVKA 1H8ZA 2WYXA 3ITAA 5GL9A 4HY8A 5AQ7A 3SS5A 2XROA 5DFYA 3MQOA 4DDYA 4OOYA 2OOLA 4JF6A 3EGDC 4WMCD 4NG2A 1K38A 1H0MA 2D02A 5EV0A 1CI8A 1GSVA 1M40A 5HZHA 2WZXA 3V3RA 3UO9A 4RYEA 3A0SA 3G6OA 3CZDA 5FI6A 1MC0A 4NXBA 3S22A 3LIEA 3SS3A 3V67A 1L0EA 1MBLA 1XFQA 3PYPA 4GD6A 2WADA 4LPZA 3QP2A 4WMCA 4KUOA 4IVIA 4II7A 5D3OA 3ZG5A 1J9MA 1OJ5A 2QPNA 4YOFA 3LYXA 3PBNA 3W4QA 1TS6A 3K3DA 5EPHA 5DTKA 2VGJA 4JGQA 3LEZA 3E4OA 4NXGA 3DTIA 2QYBA 3NDGA 4S2NC 5IU1A 3IWQA 4PM8A 1RCJA 4L9FA 4EUVA 4YFMA 3SZTA 1NLYA 1PI4A 1XJ4A 4HHDA 5E2EA 1EWZA 1CJFA 1FOFA 4E3IA 1BLCA 4RQ9A 3N8RA 3ZG7B 5DFXA 1BZAA 5DJTA 4RVAA 2H5SA 4IJGA 1AXBA 2JKRM 1F2KA 2HJ9C 2V1BA 3UDFA 4N1HA 4E3NA 2K2NA 2J9OA 2J9PA 2G7UA 2WUQA 4CLCC 3K2NA 5EVIB 3MZEA 3SS4A 3LR0A 3F1NB 3MR0A 1KOUA 1HVBA 4WELA 1S1ZA 4R6LA 5CECA 1Y28A 1D7EA 4JGOA 4EU0A 4PMAA 4AFIA 1S6RA 5J4EA 4WEKA 3OPRA 1ES3A 3F1PB 4N9LA 4Z9QA 3MBZA 3MXQA 4MN5A 3B33A 1IKGA 1SHVA 5I94A 4LENA 1XJ6A 4O7DA 2W1TB 3M6BA 1DJBA 4ZRRA 3A3IA 4QU3A 4X68A 3BQ8A 5CGWA 3FYZA 3RJUA 5FI2A 3T50A 4UQIS 2XA7M 2Z6CA 4EETB 1Q2QA 1TF1A 3M2KA 4OPZA 4G3WA 1KE3A 3QP5A 4OQHA 1MKIA 3HLGA 3O87A 1TD5A 1LLBA 1K54C 4EV4A 2ZBBA 3QP8A 3S7OA 1K4FA 4ME4A 1L3LA 5E43A 4EW7A 3VP3A 4ZTKA 4I38A 3KSFA 2INWA 3BW6A 3OC2A 3DTMA 2YKHA 4S2KA 1IFQA 4DJ3A 5EOEA 5EE8A 5HWVA 5J7EA 1LSXA 4H8RA 3N8LA 1E25A 1FR1A 5EVID 3HLBA 3FG8A 5DTTA 3NY4A 4C6YA 4B88A 3BY9A 4HH2A 4R1GA 4KZ4A 3O88A 4E3OA 5HPFA 4I3AA 4KG5A 1Y54A 2ZQCA 2ZD8A 1NLZA 4KZ5A 4Y0TA 3C38A 5IS1A 4OPRA 2HDRA 1T18A 1VM1A 2Y8HA 4WUJA 5CGXA 4PPRA 3T4OA 2P74A 3ZNYA 3HLWA 4HP9A 4KENB 3GR2A 3Q1FA 3P01A 5EVIA 3TRCA 2VGLM 3A0VA 3F1NA 5EOOA 2EXAA 1VETB 4RA7A 4Y13A 4CPKA 3LICA 3BFDA 2Y4AA 5F69A 2PR6A 5DKLA 2Y59A 5G4ZA 5IT5A 2JKTI 2BASA 3BY8A 3G4PA 4S2MA 2H10A 2V1ZA 5DF9A 2J3TC 4P0MA 2O0YA 4BBTA 1FCNA 3F1PA 4LRYC 3PBTA 4PKYG 4HESA 4QJGA 1ZG4A 3P98A 2K7SA 1PIOA 5FQ9A 5A8BA 5L2FA 4WL9A 5FI7A 5KZHA 2RCXA 5KMWA 2UWXA 2VGKA 4F94A 1H8YA 2XFSA 3GQZA 4MBHA 4Q0JA 2X71A 4LV2A 3CMZA 1I2SA 5I5LA 3NI9A 3C8CA 4HEFA 1MWRA 4GD8A 2K31A 3C30A 3RFBA 4R4RA 3BLMA 4LLOB 4OLDA 2XF3A 1NYYA 5EECA 5A93A 4WZ4A 4M3KA 4Y15A 1SKOB 1ZG6A 4Y0OA 3HCYA 2P08A 1YT4A 1L0FA 3MF0A 2J8YA 3W4PA 3RTYA 1NJ4A 4KQOA 5AQBA 4LV0A 5HDDA 4HQAA 3UB6A 4LV3A 1S0WA 1TEMA 1JTDA 3MFDA 1XA1A 4I3IA 4OQIA 2PD7A 2ZQ7A 5F68A 3PBSA 4E3JA 5CEDA 1XKZA 5FASA 2I9VA 3EQUA 3O86A 2H28A 1H3QA 2P7JA 2VV6A 1SZVA 4KG2A 3L9KA 1ONGA 4L0LA 1W5DA 5TFQA 2WGVA 1H5XA 1VETA 2CC1A 5FQKA 1P9WA 3DTEA 2WAFA 5F6AA 1MWTA 4NXFA 1ACFA 2XR0A 3T4QA 1JTGA 2GX5A 2QKPA 4DF6A 2PHYA 5FDHA 5A92A 5KSHA 1KGGA 2ZQ9A 4BD0A 2V8CA 4S2PA 1OTEA 3FZCA 3WRTA 5DJUA 1Z6FA 1O07A 3KYQA 3BYDA 4KZ9A 3GECA 4DE2A 1PWCA 3Q82A 2W27A 5A91A 2EX8A 2WZZA 3D9YA 3AGFA 2KX6A 4DXBA 4DDSA 1CEGA 4PAUA 5EFWA 1OT6A 3BQAA 5FAQA 3B3XA 3IF6B 2JKGA 5JYOA 4BJPA 5M19A 3MZDA 2R9WA 1BSGA 1V9YA 1W79A 4WM9A 1ES2A 1GHMA 1DJCA 1MWUA 1PW1A 4IBRA 3NDEA 3PHYA 3T4SA 4O01A 1OMEA 1OT9A 3GVBA 2OWHA 1VB6A 4IUKA 2A3UA 1YLWA 1S67L 3MJQA 2VA0A 3V50A 2WKHA 2H0TA 1K54A 1BT5A 2Q0OA 3R4KA 1XGIA 1W7FA 4WN5A 5GHYA 2ACGA 2PT7A 3EEHA 2Z2LB 2EFUA 2PYPA 4OLGA 2XA7S 3PTEA 3WS4A 3EEAA 2WKIA 3HL9A 3UE6A 4KZ6A 2QJ5A 4L9GA 5CTMA 1S66L 3HUNA 3T1RA 4UA6A 3C7VA 1BUEA 2Q9MA 1WYBA 4I3JA 2O9BA 4GKUA 4EQIA 3LY4A 2GJ3A 5FQMA 4YINA 5DVAA 2BLSA 4H6JB 1IEMA 3IX3A 5EM1A 5F5YA 1OTDA 1STZA 3IS2B 2EXBA 4WBGA 1G6AA 1IYQA 3CHWP 3M6HA 1NZUA 1MY8A 3Q7VB 2Y2GA 4OOMA 1JVJA 3HVFA 3IX4A 2JBFA 3DBAA 4P6BA 1RGYA 2Y2KA 2FZ0A 3HJIA 1ERQA 1S1YA 3VP4A 2M1CA 4UHUA 1UWPX 1S4RA 2FFYA 4WF0A 1FQGA 4KQDA 4XUZA 3UMDA 2ZOHA 4EBPA 3VSKA 1QMFA 3SW1A 4MCWA 4S2IA 3V5MA 5FA7A 3NULA 5AQAA 2W3GA 1OPXA 3C2WA 5DKKA 5HL6A 5K5BA 2HPBA 2VGLS 3VP2A 3IF6A 2IWBA 1KDWA 3T1QB 3VMAA 3ZGAB 4Y7PA 2LB9A 5BOHA 3JVUA 2EWWA 1NWZA 2Y91A 2VJWA 3A3DA 5DF7A 5TJJA 2O9CA 4LCLA 5KSCA 1W8YA 1CI9A 4ETXA 2E8IA 2X02A 4OQ0A 4PKYA 5FQIA 5TGFA 1YLZA 3EQVA 3S1YA 4KZBA 4O8GA 2HF6A 1WA9A 4NKPA 2WKQA 3OCNA 4S2JA 3ZVTA 2W1RA 4YNRA 3UB7A 3P7NA 3AGEA 2EFXA 1WE4A 2O99A 1DP6A 1CQAA 1YQSA 2IA2A 3UPPA 1LL5A 2XFTA 3TG9A 3LIAA 1XPBA 1EW0A 1PNEA 5L8MA 1PZOA 2Y2LA 3N4IA 4LGWA 4UEYA 2WGWB 2ZMFA 4K0WA 1ES5A 4H6JA 2WKEA 2Z2MB 3GDIA 1UWNX 3IS2A 3IXDA 2Y79A 3L7HA 3QHYA 4MN7A 3IXBA 4S2OA 3NOTC 3MFXA 3OLOA 3Q7VA 4Y2FA 3GV9A 1IYSA 2QZ6A 1G6OA 5F82A 4EUZA 4F3LB 4NXEA 3ZG0A 3UE1A 1XP4A 2OLUA 5U47A 1IOUA 2HP9A 4OPYA 5DF8A 1NY0A 5L07A 3SH8A 2HDQA 1BLSA 2OAQ1 4K08A 1LHYA 4ZJ3A 1DJAA 4BL2A 3IF5A 3QP6A 3BLSA 2D01A 2ZC7A 3UPNA 3IXHA 4P85A 3MQ0A 3FKVA 3ZNTA
chains in the Genus database with same CATH topology
3NIAA 1CK3A 2R9XA 1HZOA 4N92A 1N4OA 3LO7A 1BTLA 1HD8A 1ESIA 1ZG6A 4Y0OA 1TVFA 3W8KA 4JXVA 1BULA 2P9VB 1YT4A 4K91A 1L0FA 1PWDA 4IEDA 3SH7A 4N9KA 4HBTA 1NYMA 2J8YA 3FKWA 4ZBEA 3W4PA 2JC7A 3DWKA 1NJ4A 4KQOA 3V3SA 5AQBA 3ZG9B 4LV0A 5GLCA 4OQGA 5GHXA 4LV3A 4R0QA 1S0WA 3M2JA 4KZAA 2Y2IA 1TEMA 1YLPA 3VSLA 2V2FF 1YM1A 1JTDA 2HP6A 1PW8A 1K57C 2JE5A 5CRFA 1PI5A 4FD8A 3MFDA 2ZM8A 4QB8A 4S2LA 5CERA 2DRWA 1MXOA 1XA1A 2OLVA 2ZQ7A 1K55A 2A49A 3A3FA 4MNRA 4OP8A 4OQIA 3WWXA 3ZHHA 4WZ5C 2EX9A 4EBNA 4MEZA 2IWDA 3PBSA 4E3JA 1LI9A 5CEDA 4RX3A 4KQRA 1XKZA 3BM6A 5IHVA 5FASA 5FQJA 3JYIA 3IH8A 3UE3A 2Y2HA 4QD4A 3EQUA 3GMWA 3E2KA 3O86A 4R3JA 3VOYA 1EI5A 2QMIA 3HLCA 2XQZA 3IWIA 3C4PA 1NRFA 4MBFA 5F83A 2OSUA 4DRTA 3WS1A 1K57A 4KG2A 4GOGA 4X56A 3WS5A 5F1FA 5HAQA 4GZBA 1ONGA 1LL9A 4L0LA 4XUXA 3SOIA 4KZ3A 1W5DA 5TFQA 3HUMA 4UAAA 1SKFA 5GLAA 3VFHA 2WGVA 4E6XA 1H5XA 4WZ5A 5CEBA 3PBOA 1RGZA 5GHZA 5FAPA 2CC1A 4IVKA 1H8ZA 5FQKA 2WYXA 3ITAA 2WAFA 2XEPA 1MWTA 5GL9A 2DCFA 2XK1A 3P09A 4N1XA 5DTSA 5AQ7A 3RXWA 2WGWA 3SS5A 3VOZA 2XR0A 1JTGA 4DDYA 1O7EA 3G34A 2ZC6B 4GN2A 4OOYA 4DF6A 3NC8A 3BRMA 1HTZA 4JF6A 5FDHA 5A92A 3UPOA 4GDBA 3GRJA 2ZMAA 4WMCD 1I5QA 1K6SA 2EX6A 2Y2OA 1KGGA 2ZQ9A 3N6IA 2RL3A 5FQQA 5KSHA 1NXYA 5HAIA 1K38A 4BD0A 5FSRA 1CI8A 4S2PA 3FZCA 1ERMA 1M40A 4PM9A 3CG5A 4X69A 2G2UA 3G31A 1GCEA 3WRTA 5J8XA 1BLHA 1Z6FA 4Y0UA 1O07A 4DE3A 3SH9A 3MKFA 3BYDA 5M1AA 2WZXA 3V3RA 5CHUA 3UO9A 4UA7A 4RYEA 4KZ9A 3CZDA 5FI6A 4DE2A 1XA7A 1PWCA 4ZJ2A 3Q82A 3ISGA 3S22A 5A91A 3SS3A 2EX8A 4JPMA 2WGIA 3FV7A 4JKTA 3VP1A 2WZZA 1L0GA 3AGFA 1L0EA 1MBLA 4GD6A 2ZQDA 2WADA 4DXBA 4DDSA 3HUOA 4WMCA 4XXRA 1PYYA 4IVIA 1CEGA 2ZJ9A 3DW0A 5D3OA 3G2YA 1J9MA 3ZG5A 1RP5A 1JWZA 3HREA 5FAQA 4ZAMA 3B3XA 2Y2MA 5CGSA 4HBUA 5E2GA 2Y2NA 3IF6B 2QPNA 5JYOA 4OPQA 4BJPA 3PBNA 3W4QA 1K55C 5M19A 4OH0A 3MZDA 2ZC5B 2R9WA 1BSGA 3QNBA 4E3LA 2WK0A 1W79A 1E3UD 4WM9A 1ES2A 1GHMA 5EPHA 1DJCA 5DTKA 1MWUA 1PW1A 4IBRA 2VGJA 3NDEA 3LEZA 3NBLA 5EVLA 3NCKA 2P9VA 2XGNA 3NDGA 4LV1A 4MBKA 1OMEA 1E4DA 4S2NC 3IWQA 3LY3A 4PM8A 1RCJA 3PAGA 3GVBA 4NK3A 4ZJ1A 5GLDA 3VFFA 3C4OA 2A3UA 4YFMA 1YLWA 1WYCA 1KE0A 3WRZA 1PI4A 3V50A 2WKHA 5E2EA 2H0TA 4DKIA 3UY6A 1K54A 1U60A 3WS2A 1K25A 1BT5A 4R4SA 1SDEA 1EWZA 1XGIA 1FOFA 1IYOA 3N7WA 4E3IA 1BLCA 1W7FA 3N8RA 3ZG7B 3G32A 5GHYA 4E3MA 1BZAA 2B5RA 4QY6A 4GDNA 4BD1A 1E3UA 1K4EA 2Z2LB 2EFUA 4OLGA 4RVAA 4S2NA 3PTEA 2H5SA 3WS4A 4BENA 3TSGA 1K56D 1IELA 2WKIA 3HL9A 2GDNA 4X53A 2X01A 2C6WB 1YMSA 1AXBA 1BLPA 2IWCA 3HLDA 3OPLA 4KZ6A 1GA0A 1FSYA 4MLLA 1YMXA 4U0TA 5CTMA 2Q9NA 4KQQA 4KZ7A 3UDFA 4N1HA 4E3NA 4FH2A 2ZQ8A 3HUNA 2J9OA 2J9PA 4PM6A 4UA6A 3C7VA 1BUEA 4B4XA 3UNWA 2WUQA 1KVMA 5EVIB 2Q9MA 3MZEA 1WYBA 4IBXA 3SS4A 3IWOA 4DE1A 2Y55A 4GKUA 1C3BA 4EQIA 1HVBA 4WELA 3QNCA 3BFCA 3N8SA 5CECA 3LY4A 1FCOA 2ZC4B 2FFFB 4FCFA 1NZOA 1SDNA 4OP5A 4X6TA 1YLJA 5FQMA 4YINA 5DVAA 2OV5A 2BLSA 4PMAA 3LCEA 1IEMA 4OVDA 2Y2PA 1K56A 4NETA 2EXBA 1L0DA 1S6RA 4WEKA 4K0XA 5CHJA 4WBGA 3OPRA 1ES3A 1G6AA 1IYQA 3M6HA 3Q7VB 1NZUA 1MY8A 4N9LA 3ZCZA 2PU2A 1G68A 1N9BA 2H0YA 2Y2GA 3AGDA 3MBZA 4Z9QA 3UN7A 4BL3A 4OOMA 1JVJA 3HVFA 4E3KA 1IKGA 2JBFA 4ID4A 2ZC3B 3G2ZA 1SHVA 1RGYA 4P6BA 4QHCA 2PU4A 4LENA 5I94A 1ES4A 4CJNA 4O7DA 2Y2KA 5G18A 1ERQA 4U0XA 3M6BA 3ZFZA 1ZKJA 3UDIA 3VP4A 1DJBA 3IF6C 4UHUA 1ALQA 3ZVWA 3A3IA 3IXGA 4OONA 2ZQAA 3MXSA 4QU3A 2FFYA 4C3QA 4X68A 1FCMA 1CEFA 1FQGA 5CGWA 3BEBA 4XUZA 3FYZA 3RJUA 4EBPA 3BECA 3VSKA 1QMFA 5FI2A 4UA9A 2I72A 1KVLA 4P87A 1MWSA 1Q2QA 4S2IA 3V5MA 3M2KA 3GTCA 4OPZA 5FA7A 3E2LA 1XX2A 4JF4A 4X55A 1KE3A 4OOLA 5AQAA 5HW3A 4OQHA 4WEJA 2BG1A 1MKIA 3HLGA 3O87A 1LLBA 1K54C 3Q07A 4EV4A 2HDSA 2HPBA 3Q81A 4PM7A 1K4FA 3VP2A 4R3BA 4FH4A 3IF6A 3W4OA 2IWBA 5E43A 1KDWA 3FWLA 2G2WA 4KZ8A 1JWVA 2XLNA 1Q2PA 4ZTKA 3VP3A 3VMAA 3A3JA 3ZGAB 1L2SA 3UDXA 4Y7PA 3MXRA 2HP5A 5BOHA 3C5AA 3ZG8B 1VQQA 1TDLA 2XH9A 1SCWA 2Y91A 5E2FA 2ZLYA 4DE0A 3OCLA 3V39A 3A3DA 5DF7A 3OC2A 3DTMA 4S2KA 1PZPA 5EOEA 5EE8A 4LCLA 5KSCA 1W8YA 3A3EA 4BQMA 3ITBA 1CI9A 4E6WA 5CHMA 2E8IA 4WYYA 4EWFA 2X02A 4H8RA 3C7UA 2PBYA 3BFFA 3N8LA 4JXGA 4OQ0A 5FAOA 5FQIA 3PBQA 5TGFA 3TOIA 1YLZA 3EQVA 1E25A 1FR1A 3S1YA 4KZBA 2ZM0A 1GHPA 3HLBA 5EVID 3PBRA 2XDMA 4OKPA 5DTTA 2JCHA 3BFEA 3NY4A 4C6YA 4B88A 3G35A 3OCNA 3HLEA 4R1GA 4KZ4A 5EVIC 4R23A 4S2JA 5CXWA 3ZDJA 3O88A 4E3OA 5TR7A 3ZVTA 5JYPA 3I7JA 3IHBA 3OPPA 4KG5A 1Y54A 2ZQCA 3AGEA 3IH9A 5HX9A 5E2HA 2EFXA 2EX2A 4LCMA 1KE4A 2ZD8A 4ZDXA 1JWPA 2WAEA 4KZ5A 3O3VA 4Y0TA 1WE4A 1ESUA 1XGJA 3HLFA 3OPHA 1IYPA 1YQSA 5GLBA 1W8QA 4FSFA 4OPRA 2HDRA 1VM1A 1YLTA 2J7VA 5CGXA 1ZC2A 4PPRA 5HFOA 3MKEA 2P74A 3UPPA 3OZHA 1EROA 3ZNYA 5M18A 1LL5A 3HLWA 4U3TA 3CJMA 3UE0A 2XFTA 4KENB 3GR2A 3Q1FA 5EVIA 3TG9A 1XPBA 4DXCA 3MZFA 5HL1A 1K6RA 5EOOA 2EXAA 1PZOA 1LI0A 2Y2LA 4RA7A 3N4IA 4CPKA 3BFDA 2Y4AA 1GHIA 2XD5A 5F1GA 2Y59A 4JXWA 2WGWB 5HAPA 1YLYA 4K0WA 1ES5A 1KDSA 4BLMA 1FR6A 2WKEA 2XD1A 2Z2MB 2ZM2A 3IT9A 3G4PA 4S2MA 3Q7ZA 2H10A 2V1ZA 3IXDA 5DF9A 1MPLA 3BFGA 4GB7A 3QHYA 1QMEA 4P0MA 3IXBA 4S2OA 3HBRA 1TDGA 1FCNA 3Q7VA 2V20A 1IYSA 2QZ6A 3GV9A 3PBTA 4HESA 2HDUA 3S4XA 4QJGA 1ZG4A 1PWGA 5F82A 4EUZA 4A5RA 3ZG0A 3UE1A 4QY5A 3P98A 1XP4A 2OLUA 5U47A 3D4FA 2Y2JA 1PIOA 4JLFA 2DNSA 2HP9A 4OPYA 5DF8A 5FQ9A 2Y2QA 5HARA 5L2FA 5FI7A 1GA9A 1NY0A 2C5WB 2RCXA 5KZHA 1IKIA 5KMWA 2UWXA 3SH8A 5A90A 2VGKA 1DY6A 2HDQA 5EUAA 4F94A 4C75A 1H8YA 1KGFA 1BLSA 4KG6A 1KGEA 2XFSA 3GQZA 3WS0A 4MBHA 1LHYA 4ZJ3A 2X71A 4LV2A 3CMZA 1DJAA 1I2SA 5FATA 4B4ZA 4EBLA 3NI9A 1XXMA 4BL2A 4HEFA 1MWRA 3DWZA 3IF5A 4PM5A 3BLSA 3IHAA 4GD8A 1M6KA 5AQ9A 4Q8IA 3GSGA 4R4RA 2ZC7A 3PAEA 4GNUA 4D2OA 3BLMA 4OLDA 3VP0A 2XF3A 4RX2A 1NYYA 3IQAA 4JXSA 5EECA 1FSWA 3UPNA 1I2WA 5A93A 3IXHA 4P85A 5CTNA 4JBFA 3RXXA 1ONHA 4WZ4A 3FKVA 4JF5A 3ZNTA 4M3KA 3G30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NIA A;  1CK3 A;  2R9X A;  1HZO A;  4N92 A;  1N4O A;  3LO7 A;  1BTL A;  1HD8 A;  1ESI A;  1ZG6 A;  4Y0O A;  1TVF A;  3W8K A;  4JXV A;  1BUL A;  2P9V B;  1YT4 A;  4K91 A;  1L0F A;  1PWD A;  4IED A;  3SH7 A;  4N9K A;  4HBT A;  1NYM A;  2J8Y A;  3FKW A;  4ZBE A;  3W4P A;  2JC7 A;  3DWK A;  1NJ4 A;  4KQO A;  3V3S A;  5AQB A;  3ZG9 B;  4LV0 A;  5GLC A;  4OQG A;  5GHX A;  4LV3 A;  4R0Q A;  1S0W A;  3M2J A;  4KZA A;  2Y2I A;  1TEM A;  1YLP A;  3VSL A;  2V2F F;  1YM1 A;  1JTD A;  2HP6 A;  1PW8 A;  1K57 C;  2JE5 A;  5CRF A;  1PI5 A;  4FD8 A;  3MFD A;  2ZM8 A;  4QB8 A;  4S2L A;  5CER A;  2DRW A;  1MXO A;  1XA1 A;  2OLV A;  2ZQ7 A;  1K55 A;  2A49 A;  3A3F A;  4MNR A;  4OP8 A;  4OQI A;  3WWX A;  3ZHH A;  4WZ5 C;  2EX9 A;  4EBN A;  4MEZ A;  2IWD A;  3PBS A;  4E3J A;  1LI9 A;  5CED A;  4RX3 A;  4KQR A;  1XKZ A;  3BM6 A;  5IHV A;  5FAS A;  5FQJ A;  3JYI A;  3IH8 A;  3UE3 A;  2Y2H A;  4QD4 A;  3EQU A;  3GMW A;  3E2K A;  3O86 A;  4R3J A;  3VOY A;  1EI5 A;  2QMI A;  3HLC A;  2XQZ A;  3IWI A;  3C4P A;  1NRF A;  4MBF A;  5F83 A;  2OSU A;  4DRT A;  3WS1 A;  1K57 A;  4KG2 A;  4GOG A;  4X56 A;  3WS5 A;  5F1F A;  5HAQ A;  4GZB A;  1ONG A;  1LL9 A;  4L0L A;  4XUX A;  3SOI A;  4KZ3 A;  1W5D A;  5TFQ A;  3HUM A;  4UAA A;  1SKF A;  5GLA A;  3VFH A;  2WGV A;  4E6X A;  1H5X A;  4WZ5 A;  5CEB A;  3PBO A;  1RGZ A;  5GHZ A;  5FAP A;  2CC1 A;  4IVK A;  1H8Z A;  5FQK A;  2WYX A;  3ITA A;  2WAF A;  2XEP A;  1MWT A;  5GL9 A;  2DCF A;  2XK1 A;  3P09 A;  4N1X A;  5DTS A;  5AQ7 A;  3RXW A;  2WGW A;  3SS5 A;  3VOZ A;  2XR0 A;  1JTG A;  4DDY A;  1O7E A;  3G34 A;  2ZC6 B;  4GN2 A;  4OOY A;  4DF6 A;  3NC8 A;  3BRM A;  1HTZ A;  4JF6 A;  5FDH A;  5A92 A;  3UPO A;  4GDB A;  3GRJ A;  2ZMA A;  4WMC D;  1I5Q A;  1K6S A;  2EX6 A;  2Y2O A;  1KGG A;  2ZQ9 A;  3N6I A;  2RL3 A;  5FQQ A;  5KSH A;  1NXY A;  5HAI A;  1K38 A;  4BD0 A;  5FSR A;  1CI8 A;  4S2P A;  3FZC A;  1ERM A;  1M40 A;  4PM9 A;  3CG5 A;  4X69 A;  2G2U A;  3G31 A;  1GCE A;  3WRT A;  5J8X A;  1BLH A;  1Z6F A;  4Y0U A;  1O07 A;  4DE3 A;  3SH9 A;  3MKF A;  3BYD A;  5M1A A;  2WZX A;  3V3R A;  5CHU A;  3UO9 A;  4UA7 A;  4RYE A;  4KZ9 A;  3CZD A;  5FI6 A;  4DE2 A;  1XA7 A;  1PWC A;  4ZJ2 A;  3Q82 A;  3ISG A;  3S22 A;  5A91 A;  3SS3 A;  2EX8 A;  4JPM A;  2WGI A;  3FV7 A;  4JKT A;  3VP1 A;  2WZZ A;  1L0G A;  3AGF A;  1L0E A;  1MBL A;  4GD6 A;  2ZQD A;  2WAD A;  4DXB A;  4DDS A;  3HUO A;  4WMC A;  4XXR A;  1PYY A;  4IVI A;  1CEG A;  2ZJ9 A;  3DW0 A;  5D3O A;  3G2Y A;  1J9M A;  3ZG5 A;  1RP5 A;  1JWZ A;  3HRE A;  5FAQ A;  4ZAM A;  3B3X A;  2Y2M A;  5CGS A;  4HBU A;  5E2G A;  2Y2N A;  3IF6 B;  2QPN A;  5JYO A;  4OPQ A;  4BJP A;  3PBN A;  3W4Q A;  1K55 C;  5M19 A;  4OH0 A;  3MZD A;  2ZC5 B;  2R9W A;  1BSG A;  3QNB A;  4E3L A;  2WK0 A;  1W79 A;  1E3U D;  4WM9 A;  1ES2 A;  1GHM A;  5EPH A;  1DJC A;  5DTK A;  1MWU A;  1PW1 A;  4IBR A;  2VGJ A;  3NDE A;  3LEZ A;  3NBL A;  5EVL A;  3NCK A;  2P9V A;  2XGN A;  3NDG A;  4LV1 A;  4MBK A;  1OME A;  1E4D A;  4S2N C;  3IWQ A;  3LY3 A;  4PM8 A;  1RCJ A;  3PAG A;  3GVB A;  4NK3 A;  4ZJ1 A;  5GLD A;  3VFF A;  3C4O A;  2A3U A;  4YFM A;  1YLW A;  1WYC A;  1KE0 A;  3WRZ A;  1PI4 A;  3V50 A;  2WKH A;  5E2E A;  2H0T A;  4DKI A;  3UY6 A;  1K54 A;  1U60 A;  3WS2 A;  1K25 A;  1BT5 A;  4R4S A;  1SDE A;  1EWZ A;  1XGI A;  1FOF A;  1IYO A;  3N7W A;  4E3I A;  1BLC A;  1W7F A;  3N8R A;  3ZG7 B;  3G32 A;  5GHY A;  4E3M A;  1BZA A;  2B5R A;  4QY6 A;  4GDN A;  4BD1 A;  1E3U A;  1K4E A;  2Z2L B;  2EFU A;  4OLG A;  4RVA A;  4S2N A;  3PTE A;  2H5S A;  3WS4 A;  4BEN A;  3TSG A;  1K56 D;  1IEL A;  2WKI A;  3HL9 A;  2GDN A;  4X53 A;  2X01 A;  2C6W B;  1YMS A;  1AXB A;  1BLP A;  2IWC A;  3HLD A;  3OPL A;  4KZ6 A;  1GA0 A;  1FSY A;  4MLL A;  1YMX A;  4U0T A;  5CTM A;  2Q9N A;  4KQQ A;  4KZ7 A;  3UDF A;  4N1H A;  4E3N A;  4FH2 A;  2ZQ8 A;  3HUN A;  2J9O A;  2J9P A;  4PM6 A;  4UA6 A;  3C7V A;  1BUE A;  4B4X A;  3UNW A;  2WUQ A;  1KVM A;  5EVI B;  2Q9M A;  3MZE A;  1WYB A;  4IBX A;  3SS4 A;  3IWO A;  4DE1 A;  2Y55 A;  4GKU A;  1C3B A;  4EQI A;  1HVB A;  4WEL A;  3QNC A;  3BFC A;  3N8S A;  5CEC A;  3LY4 A;  1FCO A;  2ZC4 B;  2FFF B;  4FCF A;  1NZO A;  1SDN A;  4OP5 A;  4X6T A;  1YLJ A;  5FQM A;  4YIN A;  5DVA A;  2OV5 A;  2BLS A;  4PMA A;  3LCE A;  1IEM A;  4OVD A;  2Y2P A;  1K56 A;  4NET A;  2EXB A;  1L0D A;  1S6R A;  4WEK A;  4K0X A;  5CHJ A;  4WBG A;  3OPR A;  1ES3 A;  1G6A A;  1IYQ A;  3M6H A;  3Q7V B;  1NZU A;  1MY8 A;  4N9L A;  3ZCZ A;  2PU2 A;  1G68 A;  1N9B A;  2H0Y A;  2Y2G A;  3AGD A;  3MBZ A;  4Z9Q A;  3UN7 A;  4BL3 A;  4OOM A;  1JVJ A;  3HVF A;  4E3K A;  1IKG A;  2JBF A;  4ID4 A;  2ZC3 B;  3G2Z A;  1SHV A;  1RGY A;  4P6B A;  4QHC A;  2PU4 A;  4LEN A;  5I94 A;  1ES4 A;  4CJN A;  4O7D A;  2Y2K A;  5G18 A;  1ERQ A;  4U0X A;  3M6B A;  3ZFZ A;  1ZKJ A;  3UDI A;  3VP4 A;  1DJB A;  3IF6 C;  4UHU A;  1ALQ A;  3ZVW A;  3A3I A;  3IXG A;  4OON A;  2ZQA A;  3MXS A;  4QU3 A;  2FFY A;  4C3Q A;  4X68 A;  1FCM A;  1CEF A;  1FQG A;  5CGW A;  3BEB A;  4XUZ A;  3FYZ A;  3RJU A;  4EBP A;  3BEC A;  3VSK A;  1QMF A;  5FI2 A;  4UA9 A;  2I72 A;  1KVL A;  4P87 A;  1MWS A;  1Q2Q A;  4S2I A;  3V5M A;  3M2K A;  3GTC A;  4OPZ A;  5FA7 A;  3E2L A;  1XX2 A;  4JF4 A;  4X55 A;  1KE3 A;  4OOL A;  5AQA A;  5HW3 A;  4OQH A;  4WEJ A;  2BG1 A;  1MKI A;  3HLG A;  3O87 A;  1LLB A;  1K54 C;  3Q07 A;  4EV4 A;  2HDS A;  2HPB A;  3Q81 A;  4PM7 A;  1K4F A;  3VP2 A;  4R3B A;  4FH4 A;  3IF6 A;  3W4O A;  2IWB A;  5E43 A;  1KDW A;  3FWL A;  2G2W A;  4KZ8 A;  1JWV A;  2XLN A;  1Q2P A;  4ZTK A;  3VP3 A;  3VMA A;  3A3J A;  3ZGA B;  1L2S A;  3UDX A;  4Y7P A;  3MXR A;  2HP5 A;  5BOH A;  3C5A A;  3ZG8 B;  1VQQ A;  1TDL A;  2XH9 A;  1SCW A;  2Y91 A;  5E2F A;  2ZLY A;  4DE0 A;  3OCL A;  3V39 A;  3A3D A;  5DF7 A;  3OC2 A;  3DTM A;  4S2K A;  1PZP A;  5EOE A;  5EE8 A;  4LCL A;  5KSC A;  1W8Y A;  3A3E A;  4BQM A;  3ITB A;  1CI9 A;  4E6W A;  5CHM A;  2E8I A;  4WYY A;  4EWF A;  2X02 A;  4H8R A;  3C7U A;  2PBY A;  3BFF A;  3N8L A;  4JXG A;  4OQ0 A;  5FAO A;  5FQI A;  3PBQ A;  5TGF A;  3TOI A;  1YLZ A;  3EQV A;  1E25 A;  1FR1 A;  3S1Y A;  4KZB A;  2ZM0 A;  1GHP A;  3HLB A;  5EVI D;  3PBR A;  2XDM A;  4OKP A;  5DTT A;  2JCH A;  3BFE A;  3NY4 A;  4C6Y A;  4B88 A;  3G35 A;  3OCN A;  3HLE A;  4R1G A;  4KZ4 A;  5EVI C;  4R23 A;  4S2J A;  5CXW A;  3ZDJ A;  3O88 A;  4E3O A;  5TR7 A;  3ZVT A;  5JYP A;  3I7J A;  3IHB A;  3OPP A;  4KG5 A;  1Y54 A;  2ZQC A;  3AGE A;  3IH9 A;  5HX9 A;  5E2H A;  2EFX A;  2EX2 A;  4LCM A;  1KE4 A;  2ZD8 A;  4ZDX A;  1JWP A;  2WAE A;  4KZ5 A;  3O3V A;  4Y0T A;  1WE4 A;  1ESU A;  1XGJ A;  3HLF A;  3OPH A;  1IYP A;  1YQS A;  5GLB A;  1W8Q A;  4FSF A;  4OPR A;  2HDR A;  1VM1 A;  1YLT A;  2J7V A;  5CGX A;  1ZC2 A;  4PPR A;  5HFO A;  3MKE A;  2P74 A;  3UPP A;  3OZH A;  1ERO A;  3ZNY A;  5M18 A;  1LL5 A;  3HLW A;  4U3T A;  3CJM A;  3UE0 A;  2XFT A;  4KEN B;  3GR2 A;  3Q1F A;  5EVI A;  3TG9 A;  1XPB A;  4DXC A;  3MZF A;  5HL1 A;  1K6R A;  5EOO A;  2EXA A;  1PZO A;  1LI0 A;  2Y2L A;  4RA7 A;  3N4I A;  4CPK A;  3BFD A;  2Y4A A;  1GHI A;  2XD5 A;  5F1G A;  2Y59 A;  4JXW A;  2WGW B;  5HAP A;  1YLY A;  4K0W A;  1ES5 A;  1KDS A;  4BLM A;  1FR6 A;  2WKE A;  2XD1 A;  2Z2M B;  2ZM2 A;  3IT9 A;  3G4P A;  4S2M A;  3Q7Z A;  2H10 A;  2V1Z A;  3IXD A;  5DF9 A;  1MPL A;  3BFG A;  4GB7 A;  3QHY A;  1QME A;  4P0M A;  3IXB A;  4S2O A;  3HBR A;  1TDG A;  1FCN A;  3Q7V A;  2V20 A;  1IYS A;  2QZ6 A;  3GV9 A;  3PBT A;  4HES A;  2HDU A;  3S4X A;  4QJG A;  1ZG4 A;  1PWG A;  5F82 A;  4EUZ A;  4A5R A;  3ZG0 A;  3UE1 A;  4QY5 A;  3P98 A;  1XP4 A;  2OLU A;  5U47 A;  3D4F A;  2Y2J A;  1PIO A;  4JLF A;  2DNS A;  2HP9 A;  4OPY A;  5DF8 A;  5FQ9 A;  2Y2Q A;  5HAR A;  5L2F A;  5FI7 A;  1GA9 A;  1NY0 A;  2C5W B;  2RCX A;  5KZH A;  1IKI A;  5KMW A;  2UWX A;  3SH8 A;  5A90 A;  2VGK A;  1DY6 A;  2HDQ A;  5EUA A;  4F94 A;  4C75 A;  1H8Y A;  1KGF A;  1BLS A;  4KG6 A;  1KGE A;  2XFS A;  3GQZ A;  3WS0 A;  4MBH A;  1LHY A;  4ZJ3 A;  2X71 A;  4LV2 A;  3CMZ A;  1DJA A;  1I2S A;  5FAT A;  4B4Z A;  4EBL A;  3NI9 A;  1XXM A;  4BL2 A;  4HEF A;  1MWR A;  3DWZ A;  3IF5 A;  4PM5 A;  3BLS A;  3IHA A;  4GD8 A;  1M6K A;  5AQ9 A;  4Q8I A;  3GSG A;  4R4R A;  2ZC7 A;  3PAE A;  4GNU A;  4D2O A;  3BLM A;  4OLD A;  3VP0 A;  2XF3 A;  4RX2 A;  1NYY A;  3IQA A;  4JXS A;  5EEC A;  1FSW A;  3UPN A;  1I2W A;  5A93 A;  3IXH A;  4P85 A;  5CTN A;  4JBF A;  3RXX A;  1ONH A;  4WZ4 A;  3FKV A;  4JF5 A;  3ZNT A;  4M3K A;  3G30 A; 
#chains in the Genus database with same CATH topology
 3NIA A;  1CK3 A;  4N92 A;  1HZO A;  1N4O A;  4BBV A;  2E8J A;  1DP8 A;  2AVX A;  4JXV A;  4Y17 A;  3CPT B;  4M4X A;  3H9W A;  3ULF A;  4IED A;  3QP1 A;  4ZBE A;  2JC7 A;  1BYW A;  1N9N A;  3NHQ A;  5FEF A;  1F98 A;  4OQG A;  1ZTU A;  4R0Q A;  1F9I A;  3UB9 A;  3M2J A;  1YM1 A;  5HD5 A;  1K57 C;  2L1M A;  4FD8 A;  4B9O A;  4S2L A;  2W3E A;  2OLV A;  3A3F A;  2A49 A;  4OP8 A;  4EXO A;  4EBN A;  4MEZ A;  2IWD A;  1LI9 A;  4RX3 A;  4E04 A;  3JYI A;  4HIA A;  3CUE A;  3UE3 A;  2Y2H A;  4QD4 A;  3GMW A;  3VOY A;  2QMI A;  2GNX A;  1FIL A;  4Y3I A;  4DRT A;  2VZW A;  4R38 A;  4GOG A;  1Y4O A;  3HUM A;  1SKF A;  3VFH A;  4WZ5 A;  1MKM A;  4PHT A;  2DCF A;  2XK1 A;  3RXW A;  2WGW A;  3B42 A;  3VOZ A;  1V9Z A;  1O7E A;  2ZC6 B;  4GN2 A;  3BRM A;  3UPO A;  4GDB A;  2HZ5 A;  1I5Q A;  1K6S A;  2Y2O A;  3N6I A;  5FQQ A;  2RL3 A;  3LI9 A;  1NXY A;  1YKD A;  5HDS A;  5HAI A;  3T4L A;  2W1T A;  3IBR A;  4CLC B;  3ZYT A;  4F3L A;  1ERM A;  4HP4 A;  2G2U A;  1GCE A;  3E98 A;  5J8X A;  1BLH A;  4Y0U A;  3E4P A;  3MKF A;  5M1A A;  4UA7 A;  1XA7 A;  1XFN A;  3ISG A;  2WKR A;  2WGI A;  3FV7 A;  4JKT A;  3VP1 A;  3S7N A;  2OAP 1;  2ZQD A;  4G3K A;  4XXR A;  4KUK A;  2B02 A;  3VV4 A;  3NJA A;  1RP5 A;  4FOF A;  3T1S A;  3EOI A;  4ZAM A;  4X1L A;  2Y2M A;  5CGS A;  2Y2N A;  3CIT A;  3MSH A;  3S7Q A;  4OH0 A;  5FEG A;  2ZC5 B;  1P97 A;  2WK0 A;  1E3U D;  4CLC E;  1T1B A;  3H82 B;  3O5Y A;  2DMW A;  2PBD P;  3CPT A;  2XGN A;  2V0W A;  4LV1 A;  4MBK A;  1E4D A;  5AVF A;  3LY3 A;  4ZJ1 A;  4NK3 A;  1T19 A;  3VFF A;  3C4O A;  3D3O A;  1WYC A;  1VEU B;  3WRZ A;  4NEE D;  4DKI A;  3UY6 A;  3VOL A;  1SDE A;  1IYO A;  3N7W A;  3OOV A;  2M7U A;  4E3M A;  1XJ2 A;  3BWL A;  4BD1 A;  1E3U A;  1K4E A;  4S2N A;  4BEN A;  3TSG A;  1K56 D;  2GDN A;  1G28 A;  2C6W B;  1OTB A;  1YMS A;  4Z1W A;  2IWC A;  3HLD A;  3OPL A;  2JKT M;  4MLL A;  4JGR A;  4CLC D;  3IX8 A;  4KZ7 A;  4KQQ A;  3T12 B;  4X25 A;  4B4X A;  3UNW A;  4IBX A;  3IWO A;  4DE1 A;  2B95 A;  4FCF A;  1NZO A;  1W63 Q;  4X6T A;  1YLJ A;  3DTK A;  4OVD A;  3FPW A;  5AVE A;  2Y2P A;  1K56 A;  4HOI A;  4NET A;  2M7V A;  1UGU A;  1L0D A;  3W2Z A;  5CHJ A;  2PU2 A;  1G68 A;  3UN7 A;  4CQH A;  4CLC A;  1J3W A;  4ID4 A;  3F1O B;  2PU4 A;  1ES4 A;  3T4T A;  2B18 A;  3EWK A;  4U0X A;  1ZKJ A;  3UDI A;  5L10 A;  5HSQ A;  4MN6 A;  4I5S A;  4C3Q A;  3BEB A;  2KLI A;  3LGO A;  4P6Z M;  2I72 A;  1KVL A;  1MWS A;  3GTC A;  3KO6 A;  4HJ3 A;  4OOL A;  5HW3 A;  4WEJ A;  3LFV A;  2ZL1 B;  3Q07 A;  4PM7 A;  1SKO A;  4R3B A;  4FH4 A;  4QPR A;  3IBJ A;  3FC7 A;  3W4O A;  2G2W A;  2KDK A;  2XLN A;  3LIF A;  1L2S A;  3H82 A;  2HP5 A;  4R70 A;  1VQQ A;  1TDL A;  2XH9 A;  1SCW A;  5E2F A;  2ZLY A;  3OCL A;  3V39 A;  4FTX A;  5HWT A;  3LR4 A;  4GLQ A;  5CHM A;  1VEU A;  4WYY A;  3OBF A;  4L9E A;  3C7U A;  1P0Z A;  2PBY A;  3BFF A;  5FAO A;  4BBU A;  4DMZ A;  4EER A;  5JYP A;  3TOI A;  1GHP A;  2XDM A;  4OKP A;  3K3C A;  3G35 A;  5EVI C;  4R23 A;  3ZDJ A;  4Y5F A;  5TR7 A;  3OPP A;  2WKP A;  3IH9 A;  5HX9 A;  1KE4 A;  4EQ1 A;  4ZDX A;  1XGJ A;  3OPH A;  1TS8 A;  3D72 A;  1YLT A;  4Q0H A;  2J7V A;  1LT0 A;  5HFO A;  3MKE A;  3OZH A;  4R3A A;  1PRQ A;  4DXC A;  3MZF A;  5HL1 A;  4FUW A;  1LI0 A;  1GHI A;  5HAP A;  4JXW A;  2JKR I;  3RH8 B;  1KDS A;  4LFU A;  1W63 M;  1FR6 A;  2ZM2 A;  3IT9 A;  3ZQ5 A;  2QHK A;  2NUP C;  3BFG A;  3B47 A;  1QME A;  4EEU A;  3HBR A;  1TDG A;  1F5M A;  2BTF P;  4HH3 A;  1PWG A;  5HPI A;  4A5R A;  3F1O A;  4QY5 A;  5G4Y A;  5HD3 A;  2EA9 A;  3D4F A;  2Y2Q A;  5HAR A;  1GA9 A;  1DY6 A;  5EUA A;  3UME A;  4KG6 A;  3VE4 A;  3UB8 A;  4G3V A;  2R78 A;  5FAT A;  4B4Z A;  2JKF A;  4EBL A;  1XXM A;  2FH5 A;  4XT2 B;  4PM5 A;  4GJ4 A;  4HNB A;  4GHI B;  1N9L A;  4GNU A;  2ZL1 A;  4D2O A;  3H7W B;  3VP0 A;  1NRJ A;  3IQA A;  2V1A A;  3HJK A;  1FSW A;  2VV8 A;  4JXS A;  5CTN A;  5TBM B;  2QJ7 A;  1GSW A;  3LO7 A;  3NEC A;  1HD8 A;  1MZU A;  5HWW A;  1BUL A;  2P9V B;  3SH7 A;  1DRM A;  4N9K A;  4HBT A;  1NYM A;  3DWK A;  3V3S A;  4IHQ A;  4KZA A;  1YLP A;  3KYE A;  2HP6 A;  1PI5 A;  2ZM8 A;  4QB8 A;  3MMH A;  3KSI A;  3LR3 A;  4DJ2 A;  3WWX A;  2P04 A;  4KQR A;  3BM6 A;  5FQJ A;  1T1C A;  2QWS A;  3HLC A;  2OWJ A;  3C4P A;  5F83 A;  3T4J A;  3WS5 A;  1X0O A;  5F1F A;  5HAQ A;  4GZB A;  4XUX A;  3T4K A;  1OJG A;  2LB5 A;  4KZ3 A;  1TS7 A;  4UAA A;  4MMN A;  5CEB A;  1RGZ A;  5FAP A;  1XJ3 A;  2XEP A;  4N1X A;  3P09 A;  5DTS A;  2W3H A;  3G34 A;  2PRF A;  4ESP A;  3NC8 A;  1A0K A;  1HTZ A;  1YSQ A;  3A0R A;  2VEA A;  3GRJ A;  2ZMA A;  2EX6 A;  4EEP A;  5FSR A;  4GS9 B;  5EVE A;  3KYZ A;  4PM9 A;  3CG5 A;  4X69 A;  3G31 A;  2A24 B;  4DE3 A;  3SH9 A;  5CX7 A;  5CHU A;  2W0N A;  4ZJ2 A;  1AWI A;  4JPM A;  1DP9 A;  1N9O A;  2GZA A;  1L0G A;  1YAX A;  4XT2 A;  3HUO A;  4GHI A;  1PYY A;  1TS0 A;  1D06 A;  2ZJ9 A;  3DW0 A;  3H7W A;  5MC7 A;  3G2Y A;  1JWZ A;  3HRE A;  1PFL A;  5E2G A;  4HBU A;  4OPQ A;  3NOU C;  4YWZ A;  1K55 C;  5TBM A;  3QNB A;  3PR6 A;  4E3L A;  2UV0 E;  2J80 A;  4B93 A;  3NBL A;  5EVL A;  3NCK A;  2P9V A;  3LIB A;  2ZMV A;  3LI8 A;  3PAG A;  5GLD A;  2HV1 A;  1KE0 A;  1U60 A;  3WS2 A;  1K25 A;  2PYR A;  4R4S A;  4Q0I A;  4BWI A;  1YPR A;  3JVV A;  4HJ6 A;  3G32 A;  2J3W A;  2B5R A;  4QY6 A;  4GDN A;  4P6Z S;  1D1J A;  2V8F A;  3CI6 A;  4D60 A;  1IEL A;  2V9A A;  4X53 A;  2X01 A;  4GW9 A;  1S4S A;  2HJE A;  1BLP A;  1GA0 A;  2EWV A;  1FSY A;  3NOP C;  4U0T A;  1YMX A;  2Q9N A;  4FH2 A;  2ZQ8 A;  4PM6 A;  1KVM A;  3LID A;  2XSS A;  3FPV A;  3DAV A;  2Y55 A;  1C3B A;  3QNC A;  3BFC A;  3N8S A;  1FCO A;  2ZC4 B;  3LR5 A;  2FFF B;  1SDN A;  4OP5 A;  1G5U A;  2OV5 A;  3LCE A;  4GCZ A;  2O9A A;  3R7W B;  4O0P A;  2PAV P;  4JGP A;  2YKF A;  4K0X A;  3ZCZ A;  3EGX C;  3QP4 A;  5LBR A;  3AGD A;  1N9B A;  2H0Y A;  4BL3 A;  4E3K A;  4GS9 A;  2ZC3 B;  3G2Z A;  4QHC A;  4CJN A;  5G18 A;  1P9R A;  3ZFZ A;  2A24 A;  5EM0 A;  3IF6 C;  1ALQ A;  3ZVW A;  4OON A;  3IXG A;  2ZQA A;  3MXS A;  3KX0 X;  1FCM A;  1CEF A;  2PD8 A;  4ARZ B;  3TE8 A;  3BEC A;  4UA9 A;  4P87 A;  1H8M A;  3E2L A;  1XX2 A;  2L0W A;  4JF4 A;  1GSX A;  4X55 A;  2BG1 A;  3VE3 A;  2MJ6 A;  2HDS A;  3Q81 A;  4DN0 A;  1CF0 A;  3FWL A;  3TJZ C;  4KZ8 A;  1JWV A;  1Q2P A;  3CWF A;  3A3J A;  3UDX A;  3MXR A;  2VLG A;  3C5A A;  5HDC A;  3ZG8 B;  4DE0 A;  5J3W A;  2KOI A;  4ETZ A;  1LL8 A;  4I39 A;  1PZP A;  3A3E A;  4BQM A;  3ITB A;  4E6W A;  5FDS A;  4HI4 A;  4EWF A;  4JXG A;  3PBQ A;  3ZG9 B;  2XRN A;  2ZM0 A;  3PBR A;  2JCH A;  3BFE A;  5C5K A;  3UB5 P;  3HLE A;  5CXW A;  1FIK A;  2CMN A;  3I7J A;  3IHB A;  4WLA A;  3KSH A;  5E2H A;  2EX2 A;  4LCM A;  2A2L A;  4IUH A;  1JWP A;  2WAE A;  3O3V A;  4UQI M;  1ESU A;  3HLF A;  3ICY A;  1IYP A;  5GLB A;  1W8Q A;  4FSF A;  4MDZ A;  1ODV A;  1ZC2 A;  3CAX A;  2VV7 A;  1ERO A;  5M18 A;  4U3T A;  3CJM A;  3UE0 A;  2PDR A;  2ZOI A;  1K6R A;  1HLU P;  3T1X A;  2XD5 A;  5F1G A;  1YSP A;  1YLY A;  5L09 A;  2JHE A;  4BLM A;  2XD1 A;  1JNU A;  3R7W A;  4LRZ E;  3Q7Z A;  1MPL A;  4GB7 A;  3BJN A;  2L4R A;  4BMW A;  2V20 A;  3S4X A;  2HDU A;  3U2A A;  4JLF A;  2Y2J A;  2DNS A;  1ZHH B;  2VX8 A;  2C5W B;  1IKI A;  4QWO A;  5A90 A;  4C75 A;  1KGF A;  4ARZ A;  1KGE A;  1LSV A;  3MQQ A;  3WS0 A;  1VHM A;  3DWZ A;  3U4L P;  3IHA A;  1M6K A;  2PR5 A;  5AQ9 A;  4Q8I A;  3GSG A;  5KIZ A;  3PAE A;  1LSW A;  4RX2 A;  1Z09 A;  2W3F A;  1I2W A;  3KSG A;  4JBF A;  3RXX A;  1ONH A;  2Z6D A;  4JF5 A;  3G30 A;  2R9X A;  3LUQ A;  1BTL A;  1ESI A;  1TVF A;  3W8K A;  2W3D A;  4EES A;  4K91 A;  1PWD A;  3FKW A;  3JPU A;  3CUE C;  4LRX C;  5GLC A;  3TW8 A;  5GHX A;  3S7P A;  1T1A A;  2Y2I A;  3MS6 A;  3VSL A;  2V2F F;  1OTA A;  5FL3 A;  3CLO A;  1PW8 A;  2JE5 A;  5CRF A;  2JN7 A;  5CER A;  2DRW A;  2VKS A;  1MXO A;  4MNR A;  4X1M A;  3ZHH A;  1K55 A;  2VK3 A;  2NUT C;  4WZ5 C;  2EX9 A;  2V0U A;  3LEQ A;  5AJG A;  5IHV A;  3IH8 A;  3E2K A;  4R3J A;  1EI5 A;  1K0K A;  2XQZ A;  3IWI A;  1OTI A;  1NRF A;  4MBF A;  3PXP A;  2OSU A;  3WS1 A;  1K57 A;  4X56 A;  1LL9 A;  3SOI A;  5GLA A;  4E6X A;  3E4Q A;  2HGV A;  3PBO A;  5GHZ A;  4HJ4 A;  3E0Y A;  2J3T D;  4IVK A;  1H8Z A;  2WYX A;  3ITA A;  5GL9 A;  4HY8 A;  5AQ7 A;  3SS5 A;  2XRO A;  5DFY A;  3MQO A;  4DDY A;  4OOY A;  2OOL A;  4JF6 A;  3EGD C;  4WMC D;  4NG2 A;  1K38 A;  1H0M A;  2D02 A;  5EV0 A;  1CI8 A;  1GSV A;  1M40 A;  5HZH A;  2WZX A;  3V3R A;  3UO9 A;  4RYE A;  3A0S A;  3G6O A;  3CZD A;  5FI6 A;  1MC0 A;  4NXB A;  3S22 A;  3LIE A;  3SS3 A;  3V67 A;  1L0E A;  1MBL A;  1XFQ A;  3PYP A;  4GD6 A;  2WAD A;  4LPZ A;  3QP2 A;  4WMC A;  4KUO A;  4IVI A;  4II7 A;  5D3O A;  3ZG5 A;  1J9M A;  1OJ5 A;  2QPN A;  4YOF A;  3LYX A;  3PBN A;  3W4Q A;  1TS6 A;  3K3D A;  5EPH A;  5DTK A;  2VGJ A;  4JGQ A;  3LEZ A;  3E4O A;  4NXG A;  3DTI A;  2QYB A;  3NDG A;  4S2N C;  5IU1 A;  3IWQ A;  4PM8 A;  1RCJ A;  4L9F A;  4EUV A;  4YFM A;  3SZT A;  1NLY A;  1PI4 A;  1XJ4 A;  4HHD A;  5E2E A;  1EWZ A;  1CJF A;  1FOF A;  4E3I A;  1BLC A;  4RQ9 A;  3N8R A;  3ZG7 B;  5DFX A;  1BZA A;  5DJT A;  4RVA A;  2H5S A;  4IJG A;  1AXB A;  2JKR M;  1F2K A;  2HJ9 C;  2V1B A;  3UDF A;  4N1H A;  4E3N A;  2K2N A;  2J9O A;  2J9P A;  2G7U A;  2WUQ A;  4CLC C;  3K2N A;  5EVI B;  3MZE A;  3SS4 A;  3LR0 A;  3F1N B;  3MR0 A;  1KOU A;  1HVB A;  4WEL A;  1S1Z A;  4R6L A;  5CEC A;  1Y28 A;  1D7E A;  4JGO A;  4EU0 A;  4PMA A;  4AFI A;  1S6R A;  5J4E A;  4WEK A;  3OPR A;  1ES3 A;  3F1P B;  4N9L A;  4Z9Q A;  3MBZ A;  3MXQ A;  4MN5 A;  3B33 A;  1IKG A;  1SHV A;  5I94 A;  4LEN A;  1XJ6 A;  4O7D A;  2W1T B;  3M6B A;  1DJB A;  4ZRR A;  3A3I A;  4QU3 A;  4X68 A;  3BQ8 A;  5CGW A;  3FYZ A;  3RJU A;  5FI2 A;  3T50 A;  4UQI S;  2XA7 M;  2Z6C A;  4EET B;  1Q2Q A;  1TF1 A;  3M2K A;  4OPZ A;  4G3W A;  1KE3 A;  3QP5 A;  4OQH A;  1MKI A;  3HLG A;  3O87 A;  1TD5 A;  1LLB A;  1K54 C;  4EV4 A;  2ZBB A;  3QP8 A;  3S7O A;  1K4F A;  4ME4 A;  1L3L A;  5E43 A;  4EW7 A;  3VP3 A;  4ZTK A;  4I38 A;  3KSF A;  2INW A;  3BW6 A;  3OC2 A;  3DTM A;  2YKH A;  4S2K A;  1IFQ A;  4DJ3 A;  5EOE A;  5EE8 A;  5HWV A;  5J7E A;  1LSX A;  4H8R A;  3N8L A;  1E25 A;  1FR1 A;  5EVI D;  3HLB A;  3FG8 A;  5DTT A;  3NY4 A;  4C6Y A;  4B88 A;  3BY9 A;  4HH2 A;  4R1G A;  4KZ4 A;  3O88 A;  4E3O A;  5HPF A;  4I3A A;  4KG5 A;  1Y54 A;  2ZQC A;  2ZD8 A;  1NLZ A;  4KZ5 A;  4Y0T A;  3C38 A;  5IS1 A;  4OPR A;  2HDR A;  1T18 A;  1VM1 A;  2Y8H A;  4WUJ A;  5CGX A;  4PPR A;  3T4O A;  2P74 A;  3ZNY A;  3HLW A;  4HP9 A;  4KEN B;  3GR2 A;  3Q1F A;  3P01 A;  5EVI A;  3TRC A;  2VGL M;  3A0V A;  3F1N A;  5EOO A;  2EXA A;  1VET B;  4RA7 A;  4Y13 A;  4CPK A;  3LIC A;  3BFD A;  2Y4A A;  5F69 A;  2PR6 A;  5DKL A;  2Y59 A;  5G4Z A;  5IT5 A;  2JKT I;  2BAS A;  3BY8 A;  3G4P A;  4S2M A;  2H10 A;  2V1Z A;  5DF9 A;  2J3T C;  4P0M A;  2O0Y A;  4BBT A;  1FCN A;  3F1P A;  4LRY C;  3PBT A;  4PKY G;  4HES A;  4QJG A;  1ZG4 A;  3P98 A;  2K7S A;  1PIO A;  5FQ9 A;  5A8B A;  5L2F A;  4WL9 A;  5FI7 A;  5KZH A;  2RCX A;  5KMW A;  2UWX A;  2VGK A;  4F94 A;  1H8Y A;  2XFS A;  3GQZ A;  4MBH A;  4Q0J A;  2X71 A;  4LV2 A;  3CMZ A;  1I2S A;  5I5L A;  3NI9 A;  3C8C A;  4HEF A;  1MWR A;  4GD8 A;  2K31 A;  3C30 A;  3RFB A;  4R4R A;  3BLM A;  4LLO B;  4OLD A;  2XF3 A;  1NYY A;  5EEC A;  5A93 A;  4WZ4 A;  4M3K A;  4Y15 A;  1SKO B;  1ZG6 A;  4Y0O A;  3HCY A;  2P08 A;  1YT4 A;  1L0F A;  3MF0 A;  2J8Y A;  3W4P A;  3RTY A;  1NJ4 A;  4KQO A;  5AQB A;  4LV0 A;  5HDD A;  4HQA A;  3UB6 A;  4LV3 A;  1S0W A;  1TEM A;  1JTD A;  3MFD A;  1XA1 A;  4I3I A;  4OQI A;  2PD7 A;  2ZQ7 A;  5F68 A;  3PBS A;  4E3J A;  5CED A;  1XKZ A;  5FAS A;  2I9V A;  3EQU A;  3O86 A;  2H28 A;  1H3Q A;  2P7J A;  2VV6 A;  1SZV A;  4KG2 A;  3L9K A;  1ONG A;  4L0L A;  1W5D A;  5TFQ A;  2WGV A;  1H5X A;  1VET A;  2CC1 A;  5FQK A;  1P9W A;  3DTE A;  2WAF A;  5F6A A;  1MWT A;  4NXF A;  1ACF A;  2XR0 A;  3T4Q A;  1JTG A;  2GX5 A;  2QKP A;  4DF6 A;  2PHY A;  5FDH A;  5A92 A;  5KSH A;  1KGG A;  2ZQ9 A;  4BD0 A;  2V8C A;  4S2P A;  1OTE A;  3FZC A;  3WRT A;  5DJU A;  1Z6F A;  1O07 A;  3KYQ A;  3BYD A;  4KZ9 A;  3GEC A;  4DE2 A;  1PWC A;  3Q82 A;  2W27 A;  5A91 A;  2EX8 A;  2WZZ A;  3D9Y A;  3AGF A;  2KX6 A;  4DXB A;  4DDS A;  1CEG A;  4PAU A;  5EFW A;  1OT6 A;  3BQA A;  5FAQ A;  3B3X A;  3IF6 B;  2JKG A;  5JYO A;  4BJP A;  5M19 A;  3MZD A;  2R9W A;  1BSG A;  1V9Y A;  1W79 A;  4WM9 A;  1ES2 A;  1GHM A;  1DJC A;  1MWU A;  1PW1 A;  4IBR A;  3NDE A;  3PHY A;  3T4S A;  4O01 A;  1OME A;  1OT9 A;  3GVB A;  2OWH A;  1VB6 A;  4IUK A;  2A3U A;  1YLW A;  1S67 L;  3MJQ A;  2VA0 A;  3V50 A;  2WKH A;  2H0T A;  1K54 A;  1BT5 A;  2Q0O A;  3R4K A;  1XGI A;  1W7F A;  4WN5 A;  5GHY A;  2ACG A;  2PT7 A;  3EEH A;  2Z2L B;  2EFU A;  2PYP A;  4OLG A;  2XA7 S;  3PTE A;  3WS4 A;  3EEA A;  2WKI A;  3HL9 A;  3UE6 A;  4KZ6 A;  2QJ5 A;  4L9G A;  5CTM A;  1S66 L;  3HUN A;  3T1R A;  4UA6 A;  3C7V A;  1BUE A;  2Q9M A;  1WYB A;  4I3J A;  2O9B A;  4GKU A;  4EQI A;  3LY4 A;  2GJ3 A;  5FQM A;  4YIN A;  5DVA A;  2BLS A;  4H6J B;  1IEM A;  3IX3 A;  5EM1 A;  5F5Y A;  1OTD A;  1STZ A;  3IS2 B;  2EXB A;  4WBG A;  1G6A A;  1IYQ A;  3CHW P;  3M6H A;  1NZU A;  1MY8 A;  3Q7V B;  2Y2G A;  4OOM A;  1JVJ A;  3HVF A;  3IX4 A;  2JBF A;  3DBA A;  4P6B A;  1RGY A;  2Y2K A;  2FZ0 A;  3HJI A;  1ERQ A;  1S1Y A;  3VP4 A;  2M1C A;  4UHU A;  1UWP X;  1S4R A;  2FFY A;  4WF0 A;  1FQG A;  4KQD A;  4XUZ A;  3UMD A;  2ZOH A;  4EBP A;  3VSK A;  1QMF A;  3SW1 A;  4MCW A;  4S2I A;  3V5M A;  5FA7 A;  3NUL A;  5AQA A;  2W3G A;  1OPX A;  3C2W A;  5DKK A;  5HL6 A;  5K5B A;  2HPB A;  2VGL S;  3VP2 A;  3IF6 A;  2IWB A;  1KDW A;  3T1Q B;  3VMA A;  3ZGA B;  4Y7P A;  2LB9 A;  5BOH A;  3JVU A;  2EWW A;  1NWZ A;  2Y91 A;  2VJW A;  3A3D A;  5DF7 A;  5TJJ A;  2O9C A;  4LCL A;  5KSC A;  1W8Y A;  1CI9 A;  4ETX A;  2E8I A;  2X02 A;  4OQ0 A;  4PKY A;  5FQI A;  5TGF A;  1YLZ A;  3EQV A;  3S1Y A;  4KZB A;  4O8G A;  2HF6 A;  1WA9 A;  4NKP A;  2WKQ A;  3OCN A;  4S2J A;  3ZVT A;  2W1R A;  4YNR A;  3UB7 A;  3P7N A;  3AGE A;  2EFX A;  1WE4 A;  2O99 A;  1DP6 A;  1CQA A;  1YQS A;  2IA2 A;  3UPP A;  1LL5 A;  2XFT A;  3TG9 A;  3LIA A;  1XPB A;  1EW0 A;  1PNE A;  5L8M A;  1PZO A;  2Y2L A;  3N4I A;  4LGW A;  4UEY A;  2WGW B;  2ZMF A;  4K0W A;  1ES5 A;  4H6J A;  2WKE A;  2Z2M B;  3GDI A;  1UWN X;  3IS2 A;  3IXD A;  2Y79 A;  3L7H A;  3QHY A;  4MN7 A;  3IXB A;  4S2O A;  3NOT C;  3MFX A;  3OLO A;  3Q7V A;  4Y2F A;  3GV9 A;  1IYS A;  2QZ6 A;  1G6O A;  5F82 A;  4EUZ A;  4F3L B;  4NXE A;  3ZG0 A;  3UE1 A;  1XP4 A;  2OLU A;  5U47 A;  1IOU A;  2HP9 A;  4OPY A;  5DF8 A;  1NY0 A;  5L07 A;  3SH8 A;  2HDQ A;  1BLS A;  2OAQ 1;  4K08 A;  1LHY A;  4ZJ3 A;  1DJA A;  4BL2 A;  3IF5 A;  3QP6 A;  3BLS A;  2D01 A;  2ZC7 A;  3UPN A;  3IXH A;  4P85 A;  3MQ0 A;  3FKV A;  3ZNT A; 
#chains in the Genus database with same CATH homology
 3NIA A;  1CK3 A;  2R9X A;  1HZO A;  4N92 A;  1N4O A;  3LO7 A;  1BTL A;  1HD8 A;  1ESI A;  1ZG6 A;  4Y0O A;  1TVF A;  3W8K A;  4JXV A;  1BUL A;  2P9V B;  1YT4 A;  4K91 A;  1L0F A;  1PWD A;  4IED A;  3SH7 A;  4N9K A;  4HBT A;  1NYM A;  2J8Y A;  3FKW A;  4ZBE A;  3W4P A;  2JC7 A;  3DWK A;  1NJ4 A;  4KQO A;  3V3S A;  5AQB A;  3ZG9 B;  4LV0 A;  5GLC A;  4OQG A;  5GHX A;  4LV3 A;  4R0Q A;  1S0W A;  3M2J A;  4KZA A;  2Y2I A;  1TEM A;  1YLP A;  3VSL A;  2V2F F;  1YM1 A;  1JTD A;  2HP6 A;  1PW8 A;  1K57 C;  2JE5 A;  5CRF A;  1PI5 A;  4FD8 A;  3MFD A;  2ZM8 A;  4QB8 A;  4S2L A;  5CER A;  2DRW A;  1MXO A;  1XA1 A;  2OLV A;  2ZQ7 A;  1K55 A;  2A49 A;  3A3F A;  4MNR A;  4OP8 A;  4OQI A;  3WWX A;  3ZHH A;  4WZ5 C;  2EX9 A;  4EBN A;  4MEZ A;  2IWD A;  3PBS A;  4E3J A;  1LI9 A;  5CED A;  4RX3 A;  4KQR A;  1XKZ A;  3BM6 A;  5IHV A;  5FAS A;  5FQJ A;  3JYI A;  3IH8 A;  3UE3 A;  2Y2H A;  4QD4 A;  3EQU A;  3GMW A;  3E2K A;  3O86 A;  4R3J A;  3VOY A;  1EI5 A;  2QMI A;  3HLC A;  2XQZ A;  3IWI A;  3C4P A;  1NRF A;  4MBF A;  5F83 A;  2OSU A;  4DRT A;  3WS1 A;  1K57 A;  4KG2 A;  4GOG A;  4X56 A;  3WS5 A;  5F1F A;  5HAQ A;  4GZB A;  1ONG A;  1LL9 A;  4L0L A;  4XUX A;  3SOI A;  4KZ3 A;  1W5D A;  5TFQ A;  3HUM A;  4UAA A;  1SKF A;  5GLA A;  3VFH A;  2WGV A;  4E6X A;  1H5X A;  4WZ5 A;  5CEB A;  3PBO A;  1RGZ A;  5GHZ A;  5FAP A;  2CC1 A;  4IVK A;  1H8Z A;  5FQK A;  2WYX A;  3ITA A;  2WAF A;  2XEP A;  1MWT A;  5GL9 A;  2DCF A;  2XK1 A;  3P09 A;  4N1X A;  5DTS A;  5AQ7 A;  3RXW A;  2WGW A;  3SS5 A;  3VOZ A;  2XR0 A;  1JTG A;  4DDY A;  1O7E A;  3G34 A;  2ZC6 B;  4GN2 A;  4OOY A;  4DF6 A;  3NC8 A;  3BRM A;  1HTZ A;  4JF6 A;  5FDH A;  5A92 A;  3UPO A;  4GDB A;  3GRJ A;  2ZMA A;  4WMC D;  1I5Q A;  1K6S A;  2EX6 A;  2Y2O A;  1KGG A;  2ZQ9 A;  3N6I A;  2RL3 A;  5FQQ A;  5KSH A;  1NXY A;  5HAI A;  1K38 A;  4BD0 A;  5FSR A;  1CI8 A;  4S2P A;  3FZC A;  1ERM A;  1M40 A;  4PM9 A;  3CG5 A;  4X69 A;  2G2U A;  3G31 A;  1GCE A;  3WRT A;  5J8X A;  1BLH A;  1Z6F A;  4Y0U A;  1O07 A;  4DE3 A;  3SH9 A;  3MKF A;  3BYD A;  5M1A A;  2WZX A;  3V3R A;  5CHU A;  3UO9 A;  4UA7 A;  4RYE A;  4KZ9 A;  3CZD A;  5FI6 A;  4DE2 A;  1XA7 A;  1PWC A;  4ZJ2 A;  3Q82 A;  3ISG A;  3S22 A;  5A91 A;  3SS3 A;  2EX8 A;  4JPM A;  2WGI A;  3FV7 A;  4JKT A;  3VP1 A;  2WZZ A;  1L0G A;  3AGF A;  1L0E A;  1MBL A;  4GD6 A;  2ZQD A;  2WAD A;  4DXB A;  4DDS A;  3HUO A;  4WMC A;  4XXR A;  1PYY A;  4IVI A;  1CEG A;  2ZJ9 A;  3DW0 A;  5D3O A;  3G2Y A;  1J9M A;  3ZG5 A;  1RP5 A;  1JWZ A;  3HRE A;  5FAQ A;  4ZAM A;  3B3X A;  2Y2M A;  5CGS A;  4HBU A;  5E2G A;  2Y2N A;  3IF6 B;  2QPN A;  5JYO A;  4OPQ A;  4BJP A;  3PBN A;  3W4Q A;  1K55 C;  5M19 A;  4OH0 A;  3MZD A;  2ZC5 B;  2R9W A;  1BSG A;  3QNB A;  4E3L A;  2WK0 A;  1W79 A;  1E3U D;  4WM9 A;  1ES2 A;  1GHM A;  5EPH A;  1DJC A;  5DTK A;  1MWU A;  1PW1 A;  4IBR A;  2VGJ A;  3NDE A;  3LEZ A;  3NBL A;  5EVL A;  3NCK A;  2P9V A;  2XGN A;  3NDG A;  4LV1 A;  4MBK A;  1OME A;  1E4D A;  4S2N C;  3IWQ A;  3LY3 A;  4PM8 A;  1RCJ A;  3PAG A;  3GVB A;  4NK3 A;  4ZJ1 A;  5GLD A;  3VFF A;  3C4O A;  2A3U A;  4YFM A;  1YLW A;  1WYC A;  1KE0 A;  3WRZ A;  1PI4 A;  3V50 A;  2WKH A;  5E2E A;  2H0T A;  4DKI A;  3UY6 A;  1K54 A;  1U60 A;  3WS2 A;  1K25 A;  1BT5 A;  4R4S A;  1SDE A;  1EWZ A;  1XGI A;  1FOF A;  1IYO A;  3N7W A;  4E3I A;  1BLC A;  1W7F A;  3N8R A;  3ZG7 B;  3G32 A;  5GHY A;  4E3M A;  1BZA A;  2B5R A;  4QY6 A;  4GDN A;  4BD1 A;  1E3U A;  1K4E A;  2Z2L B;  2EFU A;  4OLG A;  4RVA A;  4S2N A;  3PTE A;  2H5S A;  3WS4 A;  4BEN A;  3TSG A;  1K56 D;  1IEL A;  2WKI A;  3HL9 A;  2GDN A;  4X53 A;  2X01 A;  2C6W B;  1YMS A;  1AXB A;  1BLP A;  2IWC A;  3HLD A;  3OPL A;  4KZ6 A;  1GA0 A;  1FSY A;  4MLL A;  1YMX A;  4U0T A;  5CTM A;  2Q9N A;  4KQQ A;  4KZ7 A;  3UDF A;  4N1H A;  4E3N A;  4FH2 A;  2ZQ8 A;  3HUN A;  2J9O A;  2J9P A;  4PM6 A;  4UA6 A;  3C7V A;  1BUE A;  4B4X A;  3UNW A;  2WUQ A;  1KVM A;  5EVI B;  2Q9M A;  3MZE A;  1WYB A;  4IBX A;  3SS4 A;  3IWO A;  4DE1 A;  2Y55 A;  4GKU A;  1C3B A;  4EQI A;  1HVB A;  4WEL A;  3QNC A;  3BFC A;  3N8S A;  5CEC A;  3LY4 A;  1FCO A;  2ZC4 B;  2FFF B;  4FCF A;  1NZO A;  1SDN A;  4OP5 A;  4X6T A;  1YLJ A;  5FQM A;  4YIN A;  5DVA A;  2OV5 A;  2BLS A;  4PMA A;  3LCE A;  1IEM A;  4OVD A;  2Y2P A;  1K56 A;  4NET A;  2EXB A;  1L0D A;  1S6R A;  4WEK A;  4K0X A;  5CHJ A;  4WBG A;  3OPR A;  1ES3 A;  1G6A A;  1IYQ A;  3M6H A;  3Q7V B;  1NZU A;  1MY8 A;  4N9L A;  3ZCZ A;  2PU2 A;  1G68 A;  1N9B A;  2H0Y A;  2Y2G A;  3AGD A;  3MBZ A;  4Z9Q A;  3UN7 A;  4BL3 A;  4OOM A;  1JVJ A;  3HVF A;  4E3K A;  1IKG A;  2JBF A;  4ID4 A;  2ZC3 B;  3G2Z A;  1SHV A;  1RGY A;  4P6B A;  4QHC A;  2PU4 A;  4LEN A;  5I94 A;  1ES4 A;  4CJN A;  4O7D A;  2Y2K A;  5G18 A;  1ERQ A;  4U0X A;  3M6B A;  3ZFZ A;  1ZKJ A;  3UDI A;  3VP4 A;  1DJB A;  3IF6 C;  4UHU A;  1ALQ A;  3ZVW A;  3A3I A;  3IXG A;  4OON A;  2ZQA A;  3MXS A;  4QU3 A;  2FFY A;  4C3Q A;  4X68 A;  1FCM A;  1CEF A;  1FQG A;  5CGW A;  3BEB A;  4XUZ A;  3FYZ A;  3RJU A;  4EBP A;  3BEC A;  3VSK A;  1QMF A;  5FI2 A;  4UA9 A;  2I72 A;  1KVL A;  4P87 A;  1MWS A;  1Q2Q A;  4S2I A;  3V5M A;  3M2K A;  3GTC A;  4OPZ A;  5FA7 A;  3E2L A;  1XX2 A;  4JF4 A;  4X55 A;  1KE3 A;  4OOL A;  5AQA A;  5HW3 A;  4OQH A;  4WEJ A;  2BG1 A;  1MKI A;  3HLG A;  3O87 A;  1LLB A;  1K54 C;  3Q07 A;  4EV4 A;  2HDS A;  2HPB A;  3Q81 A;  4PM7 A;  1K4F A;  3VP2 A;  4R3B A;  4FH4 A;  3IF6 A;  3W4O A;  2IWB A;  5E43 A;  1KDW A;  3FWL A;  2G2W A;  4KZ8 A;  1JWV A;  2XLN A;  1Q2P A;  4ZTK A;  3VP3 A;  3VMA A;  3A3J A;  3ZGA B;  1L2S A;  3UDX A;  4Y7P A;  3MXR A;  2HP5 A;  5BOH A;  3C5A A;  3ZG8 B;  1VQQ A;  1TDL A;  2XH9 A;  1SCW A;  2Y91 A;  5E2F A;  2ZLY A;  4DE0 A;  3OCL A;  3V39 A;  3A3D A;  5DF7 A;  3OC2 A;  3DTM A;  4S2K A;  1PZP A;  5EOE A;  5EE8 A;  4LCL A;  5KSC A;  1W8Y A;  3A3E A;  4BQM A;  3ITB A;  1CI9 A;  4E6W A;  5CHM A;  2E8I A;  4WYY A;  4EWF A;  2X02 A;  4H8R A;  3C7U A;  2PBY A;  3BFF A;  3N8L A;  4JXG A;  4OQ0 A;  5FAO A;  5FQI A;  3PBQ A;  5TGF A;  3TOI A;  1YLZ A;  3EQV A;  1E25 A;  1FR1 A;  3S1Y A;  4KZB A;  2ZM0 A;  1GHP A;  3HLB A;  5EVI D;  3PBR A;  2XDM A;  4OKP A;  5DTT A;  2JCH A;  3BFE A;  3NY4 A;  4C6Y A;  4B88 A;  3G35 A;  3OCN A;  3HLE A;  4R1G A;  4KZ4 A;  5EVI C;  4R23 A;  4S2J A;  5CXW A;  3ZDJ A;  3O88 A;  4E3O A;  5TR7 A;  3ZVT A;  5JYP A;  3I7J A;  3IHB A;  3OPP A;  4KG5 A;  1Y54 A;  2ZQC A;  3AGE A;  3IH9 A;  5HX9 A;  5E2H A;  2EFX A;  2EX2 A;  4LCM A;  1KE4 A;  2ZD8 A;  4ZDX A;  1JWP A;  2WAE A;  4KZ5 A;  3O3V A;  4Y0T A;  1WE4 A;  1ESU A;  1XGJ A;  3HLF A;  3OPH A;  1IYP A;  1YQS A;  5GLB A;  1W8Q A;  4FSF A;  4OPR A;  2HDR A;  1VM1 A;  1YLT A;  2J7V A;  5CGX A;  1ZC2 A;  4PPR A;  5HFO A;  3MKE A;  2P74 A;  3UPP A;  3OZH A;  1ERO A;  3ZNY A;  5M18 A;  1LL5 A;  3HLW A;  4U3T A;  3CJM A;  3UE0 A;  2XFT A;  4KEN B;  3GR2 A;  3Q1F A;  5EVI A;  3TG9 A;  1XPB A;  4DXC A;  3MZF A;  5HL1 A;  1K6R A;  5EOO A;  2EXA A;  1PZO A;  1LI0 A;  2Y2L A;  4RA7 A;  3N4I A;  4CPK A;  3BFD A;  2Y4A A;  1GHI A;  2XD5 A;  5F1G A;  2Y59 A;  4JXW A;  2WGW B;  5HAP A;  1YLY A;  4K0W A;  1ES5 A;  1KDS A;  4BLM A;  1FR6 A;  2WKE A;  2XD1 A;  2Z2M B;  2ZM2 A;  3IT9 A;  3G4P A;  4S2M A;  3Q7Z A;  2H10 A;  2V1Z A;  3IXD A;  5DF9 A;  1MPL A;  3BFG A;  4GB7 A;  3QHY A;  1QME A;  4P0M A;  3IXB A;  4S2O A;  3HBR A;  1TDG A;  1FCN A;  3Q7V A;  2V20 A;  1IYS A;  2QZ6 A;  3GV9 A;  3PBT A;  4HES A;  2HDU A;  3S4X A;  4QJG A;  1ZG4 A;  1PWG A;  5F82 A;  4EUZ A;  4A5R A;  3ZG0 A;  3UE1 A;  4QY5 A;  3P98 A;  1XP4 A;  2OLU A;  5U47 A;  3D4F A;  2Y2J A;  1PIO A;  4JLF A;  2DNS A;  2HP9 A;  4OPY A;  5DF8 A;  5FQ9 A;  2Y2Q A;  5HAR A;  5L2F A;  5FI7 A;  1GA9 A;  1NY0 A;  2C5W B;  2RCX A;  5KZH A;  1IKI A;  5KMW A;  2UWX A;  3SH8 A;  5A90 A;  2VGK A;  1DY6 A;  2HDQ A;  5EUA A;  4F94 A;  4C75 A;  1H8Y A;  1KGF A;  1BLS A;  4KG6 A;  1KGE A;  2XFS A;  3GQZ A;  3WS0 A;  4MBH A;  1LHY A;  4ZJ3 A;  2X71 A;  4LV2 A;  3CMZ A;  1DJA A;  1I2S A;  5FAT A;  4B4Z A;  4EBL A;  3NI9 A;  1XXM A;  4BL2 A;  4HEF A;  1MWR A;  3DWZ A;  3IF5 A;  4PM5 A;  3BLS A;  3IHA A;  4GD8 A;  1M6K A;  5AQ9 A;  4Q8I A;  3GSG A;  4R4R A;  2ZC7 A;  3PAE A;  4GNU A;  4D2O A;  3BLM A;  4OLD A;  3VP0 A;  2XF3 A;  4RX2 A;  1NYY A;  3IQA A;  4JXS A;  5EEC A;  1FSW A;  3UPN A;  1I2W A;  5A93 A;  3IXH A;  4P85 A;  5CTN A;  4JBF A;  3RXX A;  1ONH A;  4WZ4 A;  3FKV A;  4JF5 A;  3ZNT A;  4M3K A;  3G30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...