5J7EA

Heag pas domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium voltage-gated channel subfamily H member 1
publication title Crystal Structure of PAS domain from the hEAG Potassium Channel
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 31
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5j7eA00
1S67L 5IU1A 5HD5A 1KOUA 1XFQA 1P97A 2WKRA 2INWA 1WA9A 4HQAA 4RQ9A 2ZOIA 4L9GA 2Z6CA 5HDCA 3BWLA 1P0ZA 2L0WA 4R38A 5TBMB 1D7EA 3BY8A 1S4RA 2L4RA 3K3CA 4GW9A 3UB9A 1XJ2A 5J4EA 1DP6A 3FG8A 1T1CA 2P7JA 4KUOA 4WN5A 4GHIA 3F1OB 4B9OA 2VEAA 4PKYG 2W27A 2PHYA 4JGRA 4BBVA 4NXFA 1N9NA 1T18A 4HHDA 5KIZA 3T50A 4I3JA 4NXEA 3VE3A 1UGUA 2QKPA 3B33A 4HP9A 3GDIA 3LI9A 2D01A 2L1MA 1DRMA 1GSXA 3NOTC 3ICYA 3UMDA 4HNBA 1N9OA 3UE6A 2V1BA 2B02A 4LLOB 1T19A 4I3AA 2A24A 2PYRA 3MXQA 3MQQA 5HD3A 3NJAA 1TS6A 4EEUA 3PHYA 5F6AA 2PD7A 4WLAA 1EW0A 3G6OA 4H6JB 1V9ZA 1OTAA 1XJ6A 3SW1A 4GS9B 3LIEA 3IS2B 4DJ3A 1Y28A 1LSXA 1OT9A 1XFNA 3A0RA 4HH2A 4L9EA 3BY9A 5G4YA 3F1NB 2M1CA 2V9AA 3UB6A 2WKPA 3NOPC 1XJ3A 1OTIA 1F98A 4F3LA 2R78A 5HWWA 2VLGA 4NXGA 4WUJA 2WKQA 3NOUC 3F1PB 4JGOA 3UB7A 3LUQA 3CLOA 3LIAA 3H82A 2JN7A 1X0OA 4HP4A 4EESA 4I3IA 4WL9A 3LIBA 1NWZA 3GECA 2KDKA 5HSQA 1OJ5A 3A0SA 5DJUA 1ODVA 3LIDA 1S1YA 2YKFA 1DP9A 4EERA 3RTYA 4HH3A 1S1ZA 4HJ6A 2OOLA 2V1AA 1JNUA 2CMNA 5HDDA 5IS1A 5HWVA 2H28A 3MJQA 4XT2A 1UWPX 1LSVA 5DKKA 1TS7A 4BBUA 4M4XA 3KX0X 2D02A 3VOLA 2ZOHA 4L9FA 4GHIB 2OWHA 2EA9A 2I9VA 4LPZA 5DKLA 2V0WA 5AVFA 1LSWA 3EWKA 2QJ7A 3E4QA 1S66L 1T1AA 4HI4A 2GJ3A 3MR0A 1GSWA 5TBMA 5I5LA 4I38A 2JHEA 4R6LA 2HV1A 4EEPA 3VE4A 3C2WA 1OTBA 4I39A 4XT2B 5DJTA 2K7SA 1XJ4A 4HJ3A 2J80A 2QJ5A 4WF0A 2KX6A 1S4SA 2A24B 1OTEA 3IBRA 3UMEA 4MN5A 1T1BA 3RH8B 1GSVA 1V9YA 4EW7A 4E04A 2QWSA 5G4ZA 3PYPA 3UB8A 4EXOA 3MQOA 3LI8A 2YKHA 3FC7A 4LRZE 2VV7A 4R3AA 2ZBBA 4GCZA 5AVEA 5J3WA 2VV6A 2OWJA 4DJ2A 5J7EA 4EETB 3H7WA 3ZQ5A 3E4OA 3ULFA 1BYWA 4PKYA 3OLOA 3HJIA 3NHQA 4F3LB 4JGPA 2PD8A 1F9IA 1TS8A 3C8CA 1DP8A 1G28A 1LT0A 5EFWA 3EEHA 2V0UA 4LRXC 4H6JA 1OTDA 2PR5A 2Z6DA 3H82B 3LYXA 4GS9A 2W0NA 5A8BA 1N9LA 3P7NA 1VB6A 5HWTA 3IS2A 3D72A 5HZHA 3K3DA 4I5SA 4KUKA 2VV8A 1UWNX 3H9WA 3F1NA 4MN6A 1MZUA 3A0VA 4HIAA 4EQ1A 1TS0A 4JGQA 5F68A 4LRYC 1OT6A 3H7WB 2PR6A 4BBTA 5F5YA 5HDSA 4NXBA 3F1PA 4YWZA 2PDRA 3HJKA 2BASA 1LL8A 3CAXA 4R70A 1OJGA 2PYPA 3LIFA 4HY8A 3MFXA 3CWFA 2QHKA 3F1OA 3LICA 4HJ4A 4KQDA 4HOIA 1D06A 3E4PA 4K08A 5F69A
chains in the Genus database with same CATH superfamily
1S67L 2UV0E 5HD5A 5EVID 4GZBA 1P97A 2WKRA 1CEFA 3LR4A 3VP0A 3Q82A 4L9GA 1YM1A 5HDCA 1WYBA 3MZEA 3TG9A 4ZJ3A 3LY4A 1L0DA 2L4RA 3K3CA 1HVBA 2JKRI 2G2WA 4OP8A 1NXYA 3T1RA 5CERA 1DP6A 3Q81A 4PM6A 1T1CA 5KMWA 2P7JA 1KGFA 2ZJ9A 3WRZA 1ESUA 4GHIA 3ZDJA 2EX2A 3FWLA 3KSIA 3LY3A 3KO6A 2VEAA 4PKYG 2W27A 3MKFA 4JGRA 3OPHA 4OONA 3LR0A 4OPYA 1I5QA 1T18A 2OAP1 5IHVA 1KVLA 1Z6FA 4ME4A 4I3JA 1DY6A 5AQ9A 4HP9A 3GR2A 2D01A 2Y2NA 1GSXA 1YLTA 4HESA 3MMHA 3ICYA 3L9KA 3ZYTA 2Y55A 5J8XA 3KYQA 4X53A 1N9OA 3UE6A 5KSHA 2ZQAA 1XA1A 1TDLA 2V1BA 3DTEA 3WS1A 4LLOB 4NKPA 3S7NA 5EVIB 3SS3A 2A24A 4ZRRA 3DTKA 3MQQA 4B93A 3UDFA 3NJAA 2PRFA 1TS6A 2HDUA 2ZL1A 5EM0A 3OBFA 2HGVA 4EEUA 5F6AA 3PBOA 4S2JA 1L0FA 4OQGA 2A49A 1MXOA 2V8CA 2Y2OA 5CTNA 2XEPA 1V9ZA 1GHPA 1OTAA 4R1GA 4DN0A 1BUEA 1F2KA 3A3FA 3C4PA 3LIEA 4N1HA 3MSHA 1Q2PA 4EUZA 3HCYA 1OT9A 3BLMA 5AJGA 3DW0A 4P6BA 4HH2A 5FQKA 3HLDA 3BY9A 1CI8A 2V9AA 3UB6A 4X56A 3IF6B 1STZA 3BFDA 2VLGA 3O88A 1H5XA 4IBRA 1BULA 3VMAA 2R9XA 2JKGA 3KSHA 2WKQA 4WUJA 3TW8A 4CLCB 3C7VA 1IFQA 3F1PB 3E0YA 5GHXA 1PW1A 4BD1A 3UB7A 3H82A 1GHMA 2JN7A 3NBLA 3T4KA 4II7A 4HP4A 1SKOA 4X69A 3TJZC 2B18A 3CPTA 4WL9A 2Y91A 4E3MA 4FOFA 5DF8A 2KDKA 4XXRA 5DTSA 5HSQA 1VETA 4Y7PA 2P08A 2EXBA 3A0SA 3I7JA 1LI9A 1PI4A 4KG2A 4HH3A 4BL2A 1ESIA 3WS2A 3GQZA 3AGEA 4PM9A 1LSVA 4MN7A 2P04A 2J3TC 3JPUA 5JYOA 3QP6A 4MNRA 2ZD8A 3GMWA 4R23A 3ZHHA 2OWHA 4PAUA 2XD1A 3GRJA 3LEQA 5AVFA 1F5MA 4OLDA 4HI4A 5FAOA 2VJWA 3S7QA 4FSFA 3CG5A 3VP2A 4Y0UA 4UQIS 3TSGA 4R6LA 4FD8A 1PYYA 1TF1A 3VE4A 4MDZA 1K54C 4QY5A 4I39A 1MWSA 1K54A 4KQOA 5L07A 3UY6A 4HJ3A 4WZ4A 1VQQA 2EX9A 2C5WB 1FCNA 5JYPA 1N4OA 4S2MA 1SKFA 5KZHA 4E3KA 1IKIA 2KX6A 2RCXA 3RFBA 1OPXA 2K31A 1OTEA 2M7VA 3UMEA 1T1BA 1GSVA 3UE3A 4DE0A 1GA0A 3SZTA 5CECA 3RJUA 4GDNA 3TOIA 2BTFP 2ZM8A 3UB8A 3FV7A 1IYQA 3Q7ZA 1GA9A 1K57C 5FQMA 2IWDA 2Y8HA 1K57A 3LI8A 4FH2A 1EROA 3ZCZA 3QHYA 1E3UA 1VEUB 2VV6A 2VGKA 2XROA 2XA7M 3IXDA 1DJCA 5FSRA 2E8IA 2WZZA 4EUVA 5TGFA 2XK1A 4PPRA 3N8RA 4F3LB 4JGPA 1RGYA 2J9OA 3WS4A 3C8CA 1DP8A 1G28A 1LHYA 4H6JA 2PR5A 3ZG5A 2Z6DA 4PM5A 2WK0A 4F94A 2W0NA 3UO9A 2JKFA 3DTIA 4IUKA 4L0LA 2HJEA 3UN7A 4I5SA 3TE8A 3NI9A 3F1NA 1ZKJA 3VSKA 3B47A 5L10A 1ZG4A 4Q0HA 1TDGA 4EWFA 4LRYC 4Y15A 3ZNYA 3B3XA 3WRTA 1PWCA 4EV4A 5HDSA 2Y2HA 5FDSA 5E2EA 5EECA 4OKPA 3EQUA 1JTDA 1GCEA 1KE0A 1ES4A 5DF7A 2BASA 3CAXA 3CHWP 1OJGA 2PYPA 3QNBA 4KQRA 1FSYA 4K08A 1NJ4A 5F69A 3V39A 3ZGAB 3G2ZA 1J3WA 4ETXA 3LO7A 4MCWA 1G68A 1BLSA 1XFQA 5E2FA 2INWA 3T4LA 3A3DA 2MJ6A 3PXPA 5IT5A 5FEGA 3BFFA 2XDMA 3BWLA 4R38A 2NUPC 1HLUP 2W1TB 1M40A 2HP6A 5TBMB 4AFIA 5MC7A 3C7UA 5CGWA 2V2FF 1D7EA 4E6WA 2Y2GA 3OPLA 1KGEA 4GW9A 4XUXA 3VOZA 4JXSA 5J4EA 3UPPA 3ISGA 5HL1A 2ZQ9A 4ARZA 4RX2A 4HEFA 2LB9A 1BLCA 5FATA 3R7WA 3IH8A 2PHYA 3W2ZA 3G32A 2WGIA 1NYMA 1MPLA 1H8ZA 1ZC2A 3CI6A 4Z9QA 3ZFZA 3U4LP 4OLGA 4HHDA 5F83A 5KIZA 3T50A 4GOGA 4E3LA 1FQGA 3VE3A 1AXBA 4MEZA 4U0TA 4OP5A 4JXWA 2ZQ7A 3LI9A 2L1MA 3VP4A 4EBPA 1PWDA 3LEZA 4BMWA 2WKHA 2XQZA 2WUQA 4MMNA 2JKTM 3Q7VA 4WYYA 3GSGA 4GNUA 4X55A 4I3AA 5AQ7A 4WZ5A 2I72A 4E3JA 2XFTA 1YKDA 4Y13A 4UA6A 3VOYA 1CQAA 1SHVA 1D1JA 2Y59A 1EW0A 4Y3IA 3PAEA 1FR6A 3HVFA 3OC2A 4GS9B 1XGIA 3OZHA 5U47A 3IS2B 4DJ3A 1Y28A 4JPMA 2WAFA 2QMIA 4PMAA 3DWZA 4IHQA 1FOFA 3NDEA 1TVFA 2OSUA 5G4YA 5K5BA 1XJ3A 4OQHA 3VV4A 1I2WA 2XLNA 5HWWA 1FILA 4LV0A 2Y2IA 3PTEA 3IH9A 3MF0A 1IOUA 3E98A 4CPKA 3T12B 4JGOA 4A5RA 3HLGA 2Z2LB 3IXGA 2J3TD 1XA7A 3ZNTA 4EESA 4P6ZM 3M2JA 4FTXA 4LV2A 1ACFA 4B4ZA 1NWZA 4GB7A 3IWQA 4WELA 2ZQ8A 1YSQA 1ERQA 5EVEA 1WYCA 5F1FA 4N9LA 1CI9A 4GJ4A 1EWZA 2YKFA 2XH9A 4EERA 3RTYA 3W4OA 1S1ZA 3A3JA 2CMNA 4Y17A 1XX2A 4YFMA 2WZXA 4DRTA 3CZDA 2Y79A 3MJQA 4OOMA 1UWPX 4KZ3A 3ITBA 1IYPA 3V3SA 2VX8A 3IHBA 3OPRA 4E3OA 3WWXA 2JKTI 4M4XA 5D3OA 3SH9A 5BOHA 4KQQA 2WGVA 4IVKA 3BQAA 3UPNA 3IWIA 4L9FA 3SH7A 2I9VA 5DKLA 3K2NA 1HZOA 5TR7A 2Y2LA 5GHYA 3IF5A 4C6YA 2QJ7A 5A91A 5CGSA 1VETB 3T4JA 3HREA 2GJ3A 3MR0A 2VZWA 4UEYA 5E2GA 2C6WB 2HP9A 3M2KA 5FQIA 4D60A 2H5SA 3HUNA 5DTTA 2HV1A 4S2PA 1NLYA 4Z1WA 3MQ0A 4U0XA 5CEBA 2EXAA 4GDBA 4EU0A 3CITA 1W79A 5TJJA 1ES3A 4M3KA 1M6KA 1CEGA 5HARA 1E3UD 5HW3A 3BEBA 3MZDA 3PBQA 2QJ5A 1CK3A 1RGZA 3O3VA 2VGLS 1NY0A 4R0QA 5CHUA 1S4SA 3AGFA 2M7UA 3IBRA 1K6SA 3BYDA 3RH8B 1V9YA 1O7EA 1ONGA 1W8QA 4S2NC 1K25A 4E04A 3UDXA 4S2NA 3QNCA 2BG1A 2P74A 3U2AA 4CQHA 3KSGA 4N92A 5FDHA 1NYYA 4KENB 3VFFA 3FC7A 3LR5A 4BD0A 4LRZE 2VV7A 2JBFA 4NETA 4GCZA 2WGWB 3FKVA 2RL3A 2K2NA 2ZC4B 4JF5A 4EETB 5FI7A 3H7WA 3RXXA 2VK3A 4KZ8A 3NHQA 2O9BA 1F9IA 3NCKA 1LT0A 1JVJA 3D4FA 4UAAA 5GL9A 3EEHA 1K0KA 2P9VB 1H8YA 4R4RA 1U60A 1OTDA 2QPNA 4WEKA 2XF3A 4IEDA 1CF0A 5HZHA 3ZG8B 2JCHA 3K3DA 4NEED 3ITAA 2X02A 1UWNX 4MN6A 1MZUA 2PBDP 1MBLA 4HIAA 4LCLA 4WMCA 4EQ1A 1DJBA 3IF6A 4JGQA 1G6OA 5F68A 5CTMA 3PBTA 2EWWA 3LCEA 1YLYA 3T4QA 3S7OA 2PR6A 2ZC5B 3Q07A 4C3QA 2E8JA 3N6IA 2Y4AA 4CLCC 3AGDA 5F5YA 1PZPA 4CLCA 2BLSA 5DFXA 3UB5P 1JWVA 3F1PA 4E3NA 4DDSA 4GD6A 1BZAA 4PHTA 1LL8A 3B42A 3P98A 4IJGA 4S2IA 1MWUA 3F1OA 3S4XA 1FCMA 3LICA 4DE3A 3N7WA 4HOIA 1D06A 3E4PA 5IU1A 3KSFA 5G18A 1ES5A 2ZMVA 1KOUA 3EGXC 4KZBA 1WA9A 2XGNA 4HQAA 4PM8A 2J7VA 4RQ9A 2Z6CA 4B4XA 5CXWA 3V50A 1YLPA 1S4RA 3MS6A 3SS4A 1KVMA 5M18A 5CHMA 1XJ2A 1IELA 4P0MA 3KYEA 4OOLA 3FG8A 1LLBA 4HBUA 4BLMA 5F1GA 2WKIA 2O0YA 4Q8IA 4KUOA 2H0YA 3IX4A 5M1AA 2EWVA 3DWKA 1KDWA 4JLFA 5L8MA 4O7DA 4NXFA 4OPRA 4KZAA 1K55C 4BENA 1K55A 2DMWA 5A93A 2OLVA 5EPHA 1K56A 1ERMA 3IX8A 3IQAA 3FPWA 4NXEA 1Q2QA 4Q0IA 2XFSA 4C75A 3D9YA 1UGUA 2QKPA 1K6RA 4R3BA 1KE4A 4JKTA 4UA9A 1DRMA 3NOTC 4S2KA 2V8FA 4LGWA 2Y2MA 2PT7A 5DFYA 2GDNA 3D3OA 4HNBA 3UMDA 1HD8A 2WAEA 4S2LA 3RXWA 5CRFA 5DVAA 1TD5A 3HLFA 2B02A 5FA7A 4OVDA 4DE1A 5FQJA 3G34A 5EOOA 4DKIA 1PIOA 3IXBA 1T19A 2PBYA 2PYRA 3MXQA 2H0TA 3HUOA 3QP8A 5HD3A 1E4DA 2UWXA 1PI5A 2FFFB 2R9WA 4WLAA 2HDSA 4NK3A 1XP4A 5M19A 3DBAA 1W5DA 4MLLA 3ZVTA 1XJ6A 3MBZA 5FI6A 1JTGA 4U3TA 5L2FA 3EOIA 5DF9A 4QWOA 4MBHA 3SH8A 1YQSA 4P6ZS 4L9EA 1G6AA 4ZJ2A 2WKPA 2CC1A 1OTIA 4CLCE 3LR3A 3KYZA 4F3LA 2R78A 4KZ4A 2W1RA 3NOUC 3W4PA 3CLOA 3LIAA 4UQIM 3OCNA 2JC7A 3QP1A 2W3GA 3N8SA 3UE1A 3S1YA 4JF4A 5FI2A 4I3IA 3BW6A 3LIBA 1FR1A 1E25A 5HPIA 3GECA 1OJ5A 3NIAA 3BFCA 1ZG6A 2ZMAA 2KOIA 3BJNA 4OPQA 5DJUA 5HAQA 3VP3A 2GZAA 3LIDA 1S1YA 2HP5A 5FASA 5EVLA 3IBJA 1DP9A 2AVXA 5CEDA 2OOLA 3GTCA 5AQBA 2V1AA 5IS1A 5HDDA 3DAVA 5HWVA 5EOEA 2H28A 1MWRA 4XT2A 1SDEA 5DKKA 4N9KA 1TS7A 2OLUA 4JBFA 4ETZA 1K38A 3OOVA 2EX6A 3MKEA 2J9PA 3UDIA 4YNRA 2D02A 1VHMA 5L09A 4GHIB 1ES2A 2V0WA 4KZ5A 5I94A 1YLWA 4WZ5C 3EWKA 2GNXA 3MZFA 5HFOA 1SCWA 5TBMA 1XPBA 1XGJA 1LL9A 5I5LA 4RVAA 4I38A 2HPBA 5CHJA 3V67A 3V3RA 4EEPA 4NG2A 4KZ7A 3GV9A 4PM7A 1Y4OA 2XSSA 4GD8A 2K7SA 3P01A 4ESPA 4Y2FA 2DRWA 3CUEC 2J80A 3CUEA 1MKIA 5EM1A 1MKMA 4EBLA 1W7FA 2FFYA 2X01A 4BWIA 2A24B 4MN5A 3VFHA 3OCLA 3P09A 5FAQA 2ZL1B 4XUZA 4DDYA 4LCMA 3PBRA 1FCOA 4WBGA 4ZTKA 5G4ZA 3PYPA 4EXOA 2J8YA 5FL3A 3MQOA 2GX5A 5HL6A 3MFDA 1P9RA 1YSPA 2Y2QA 3UNWA 1ZHHB 4MBKA 2Q0OA 2QYBA 5GLAA 5J3WA 5F82A 4JXGA 1YMSA 2OWJA 4WMCD 5J7EA 3WS5A 3Q1FA 5CX7A 3O86A 3ULFA 4EBNA 2W3DA 1BYWA 2Y2JA 4PKYA 1PWGA 3OLOA 5CGXA 3GVBA 3ZVWA 3OPPA 3HJIA 3M6HA 1MY8A 1AWIA 4CLCD 4ZDXA 1L0EA 2PU4A 2V0UA 5GLCA 3UE0A 3H82B 3C5AA 3LYXA 4GS9A 4BQMA 3P7NA 1I2SA 2X71A 5TFQA 3IS2A 1SKOB 3D72A 3LGOA 4QHCA 4ZAMA 4X1LA 3CPTB 5LBRA 4KUKA 2VV8A 4UHUA 4D2OA 3NULA 2ZM0A 1JWZA 1TS0A 2WYXA 2EFUA 3BECA 4JXVA 1GHIA 2Q9NA 1W63Q 3T4TA 5FAPA 3H7WB 4BBTA 3CMZA 5HPFA 4EQIA 4E3IA 1P9WA 1XKZA 1PFLA 3C4OA 2ACGA 2PDRA 3HJKA 2ZMFA 4X68A 3SS5A 3W8KA 3PR6A 1N9BA 3L7HA 2VA0A 3LIFA 1RP5A 3CWFA 2QHKA 4GLQA 3VP1A 2XA7S 3ZG9B 5FQQA 4RYEA 5FQ9A 3ZG7B 1FIKA 3JVUA 4LV3A 3T1QB 2G7UA 1YMXA 3G4PA 2HDRA 3IXHA 5GLBA 2XRNA 2ZOIA 2PU2A 1P0ZA 2L0WA 4DXCA 4IUHA 1KGGA 3BM6A 3BY8A 1K56D 3TRCA 3N4IA 2LB5A 1YAXA 3QP2A 4YINA 1LI0A 4HBTA 3UB9A 2IWBA 3G30A 4X1MA 1DJAA 2W3FA 3BLSA 2V1ZA 3EGDC 4WN5A 2EFXA 3M6BA 3VSLA 1K4EA 3F1OB 1L0GA 5EVIC 5EVIA 1KE3A 4B9OA 2Y2PA 4WEJA 1MWTA 2O99A 4BBVA 2J3WA 5C5KA 5HAPA 2XR0A 2FH5A 4H8RA 1N9NA 2O9CA 2IA2A 4K0XA 2DCFA 4K0WA 2B95A 1YLZA 2A3UA 2HZ5A 1H3QA 3G2YA 4GN2A 2ZM2A 1JWPA 3B33A 3HLEA 3CJMA 3GDIA 1PNEA 2XD5A 1NLZA 4QJGA 4QY6A 4FUWA 1A0KA 3JYIA 3IF6C 4DMZA 4Y5FA 1W63M 2Y2KA 3LFVA 4OH0A 2ZC7A 2ZC6B 1YT4A 4ZJ1A 1QMEA 2QZ6A 1XXMA 4R3JA 1MC0A 2ZLYA 4QU3A 4JF6A 2WADA 3PHYA 1NZUA 3HLBA 2PD7A 4LENA 5HAIA 3G6OA 1BLPA 4H6JB 3W4QA 4KG5A 1KDSA 3SW1A 4FCFA 5GHZA 3N8LA 5KSCA 1LSXA 1VM1A 2VKSA 2WGWA 1XFNA 3A0RA 4UA7A 2ZQDA 4OQ0A 3WS0A 2W3EA 3S7PA 4RX3A 3F1NB 2M1CA 5FEFA 3G35A 2IWCA 3NOPC 1NRFA 1F98A 1NRJA 4G3KA 3BRMA 3HL9A 4NXGA 3IT9A 3FYZA 1BSGA 2OAQ1 2P9VA 4BJPA 3LUQA 1BT5A 4B88A 1OMEA 5E2HA 3T4SA 1X0OA 4IBXA 3FPVA 1FSWA 1PW8A 3ZG0A 1PZOA 1ALQA 4QB8A 1IEMA 4QPRA 3E2LA 2HDQA 2Q9MA 1L3LA 2A2LA 5AQAA 2VGLM 3IWOA 1ODVA 2PAVP 1HTZA 3DTMA 1CJFA 4LV1A 2O9AA 5EE8A 4HJ6A 1PRQA 1JNUA 2WKEA 4KG6A 4X6TA 4OQIA 1C3BA 5GLDA 3G31A 2KLIA 2DNSA 4GKUA 3SOIA 3BQ8A 3QP4A 2NUTC 5DTKA 2OV5A 4BBUA 4P87A 1YPRA 4ARZB 3NC8A 1K4FA 3KX0X 1LL5A 3VOLA 2ZOHA 2G2UA 5EUAA 2EA9A 4LPZA 3NDGA 1NZOA 4R4SA 3R7WB 4OOYA 1LSWA 2HF6A 3E4QA 1S66L 1J9MA 1T1AA 3HUMA 1GSWA 3IX3A 2JHEA 1L2SA 3HLWA 4K91A 3O87A 3HBRA 3A3IA 5A90A 4YOFA 3C2WA 1OTBA 3EQVA 5EV0A 4XT2B 3IHAA 1VEUA 5DJTA 3BFGA 3R4KA 2B5RA 4CJNA 1XJ4A 1EI5A 3NECA 2EX8A 1YLJA 3BFEA 3NY4A 4WF0A 3Q7VB 2HJ9C 1ONHA 4BL3A 4Y0TA 1BTLA 1TEMA 3A3EA 4EW7A 1Y54A 3V5MA 3S22A 1WE4A 4G3WA 2QWSA 1Z09A 1S0WA 4DF6A 3O5YA 4QD4A 4O0PA 3PBNA 4G3VA 2ZC3B 2YKHA 4N1XA 4Y0OA 2JKRM 4R3AA 2ZBBA 1W8YA 3MXRA 5AVEA 3T1SA 1BLHA 1QMFA 4O8GA 2FZ0A 3C30A 5HX9A 5A92A 4DJ2A 1SZVA 3PAGA 1S6RA 2VGJA 2ZQCA 3ZQ5A 3E4OA 4P85A 1H8MA 3UPOA 2PD8A 1TS8A 3MXSA 5EFWA 4LRXC 4RA7A 3FZCA 3PBSA 2W3HA 4WM9A 5A8BA 1N9LA 1VB6A 2H10A 5HWTA 3QP5A 2V20A 1SDNA 4O01A 1H0MA 2JE5A 4X25A 4S2OA 4DXBA 4OPZA 1IKGA 1RCJA 5E43A 4ZBEA 3HLCA 3H9WA 3A0VA 1O07A 3T4OA 4Q0JA 4ID4A 2W1TA 3JVVA 4IVIA 1OT6A 4LFUA 4KZ9A 1G5UA 4DE2A 4KZ6A 1IYSA 4NXBA 3C38A 4YWZA 3T1XA 4FH4A 3EEAA 4E6XA 4R70A 3E2KA 4HY8A 3MFXA 1IYOA 2Z2MB 4MBFA 4HJ4A 4KQDA 1ZTUA 3FKWA
chains in the Genus database with same CATH topology
1S67L 5IU1A 3KSFA 2XA7S 4ETXA 4MCWA 5HD5A 3JVUA 2ZMVA 1KOUA 3EGXC 2G7UA 1XFQA 1P97A 2WKRA 2INWA 1WA9A 4HQAA 3T4LA 3LR4A 2MJ6A 3PXPA 5IT5A 2XRNA 4RQ9A 2ZOIA 4L9GA 2Z6CA 5HDCA 3BWLA 1P0ZA 2L0WA 4R38A 2NUPC 2W1TB 4IUHA 5TBMB 4AFIA 5MC7A 1D7EA 3BY8A 1S4RA 2L4RA 3K3CA 3TRCA 4GW9A 2LB5A 1YAXA 2JKRI 3UB9A 1XJ2A 5J4EA 1DP6A 4OOLA 3FG8A 1T1CA 4ARZA 2W3FA 2P7JA 3EGDC 2O0YA 4KUOA 4WN5A 4GHIA 3F1OB 2LB9A 3KSIA 3R7WA 2EWVA 4B9OA 3KO6A 2VEAA 4PKYG 2W27A 4WEJA 2PHYA 4JGRA 2O99A 4BBVA 5L8MA 3W2ZA 2J3WA 5C5KA 4NXFA 3LR0A 2FH5A 1N9NA 2O9CA 2IA2A 1T18A 3CI6A 2DMWA 2OAP1 4HHDA 4ME4A 5KIZA 3T50A 1H3QA 3FPWA 4I3JA 4NXEA 4Q0IA 3VE3A 1UGUA 2QKPA 3B33A 4HP9A 3GDIA 3LI9A 2D01A 1NLZA 2L1MA 1DRMA 1GSXA 3NOTC 2PT7A 3MMHA 3ICYA 5DFYA 3D3OA 4HNBA 3UMDA 3ZYTA 4BMWA 3KYQA 1N9OA 4DMZA 3UE6A 5KSHA 4Y5FA 1W63M 1TD5A 3LFVA 2V1BA 4MMNA 2JKTM 2B02A 4LLOB 4NKPA 1T19A 3S7NA 4I3AA 2A24A 2PYRA 4ZRRA 3MXQA 3MQQA 4B93A 5HD3A 1MC0A 3NJAA 1TS6A 1YKDA 3OBFA 2HGVA 4EEUA 3PHYA 5F6AA 3PBOA 2PD7A 4WLAA 1EW0A 4Y3IA 3G6OA 4H6JB 3DBAA 1V9ZA 1OTAA 3OC2A 1XJ6A 4DN0A 3SW1A 4GS9B 3LIEA 3IS2B 3EOIA 4DJ3A 5DF9A 1Y28A 1LSXA 2VKSA 3HCYA 1OT9A 1XFNA 3A0RA 5AJGA 4HH2A 2W3EA 4IHQA 4P6ZS 4L9EA 3S7PA 3BY9A 5G4YA 3F1NB 2M1CA 2V9AA 3UB6A 5K5BA 2WKPA 1STZA 3NOPC 1XJ3A 1OTIA 4CLCE 3LR3A 3KYZA 1F98A 3VV4A 1NRJA 4F3LA 2R78A 5HWWA 2VLGA 4G3KA 2W1RA 4NXGA 3MF0A 3KSHA 2WKQA 4WUJA 3TW8A 4CLCB 1IOUA 3NOUC 3E98A 1IFQA 2OAQ1 3F1PB 3E0YA 4JGOA 3UB7A 3LUQA 4BJPA 3CLOA 3LIAA 4UQIM 3H82A 3OCNA 2JN7A 2W3GA 3T4KA 4II7A 3T4SA 1X0OA 2J3TD 4HP4A 4EESA 4I3IA 3FPVA 3BW6A 3TJZC 2B18A 4P6ZM 4WL9A 3LIBA 5HPIA 4FOFA 1NWZA 3GECA 4QPRA 2KDKA 5HSQA 1OJ5A 4WELA 1YSQA 2P08A 2A2LA 3A0SA 2VGLM 2KOIA 3BJNA 5DJUA 2GZAA 1ODVA 3LIDA 4GJ4A 1S1YA 3IBJA 2YKFA 1DP9A 4EERA 2O9AA 3RTYA 4HH3A 1S1ZA 4HJ6A 2OOLA 2V1AA 1JNUA 2CMNA 5HDDA 5IS1A 5HWVA 2Y79A 2H28A 3MJQA 4OOMA 4XT2A 1UWPX 1LSVA 5DKKA 4MN7A 1TS7A 2KLIA 2VX8A 2P04A 2J3TC 4ETZA 3BQ8A 2NUTC 3OOVA 4BBUA 2JKTI 4M4XA 4ARZB 3BQAA 3KX0X 4YNRA 2D02A 3VOLA 1VHMA 2ZOHA 4L9FA 4GHIB 2OWHA 2EA9A 2I9VA 4LPZA 3K2NA 5DKLA 2V0WA 4PAUA 3R7WB 5AVFA 1LSWA 2HF6A 3EWKA 2QJ7A 2GNXA 1S66L 1F5MA 3E4QA 1T1AA 3T4JA 4HI4A 2VJWA 2GJ3A 3MR0A 1GSWA 2VZWA 4UEYA 5TBMA 3S7QA 4FSFA 5I5LA 4I38A 4UQIS 2JHEA 4R6LA 3V67A 2HV1A 1NLYA 4EEPA 4YOFA 1TF1A 3C2WA 3VE4A 1OTBA 3EQVA 4MDZA 4Z1WA 3MQ0A 4I39A 4XT2B 4KQOA 4EU0A 2XSSA 3CITA 5DJTA 3R4KA 5TJJA 2K7SA 3P01A 4Y2FA 1XJ4A 4HJ3A 3CUEC 2J80A 3CUEA 3PBQA 2QJ5A 2VGLS 1MKMA 4WF0A 2KX6A 3RFBA 2HJ9C 4BWIA 1S4SA 2A24B 1OPXA 2M7UA 2K31A 1OTEA 3IBRA 2M7VA 3UMEA 4MN5A 3OCLA 1T1BA 3RH8B 1GSVA 1V9YA 3UE3A 4EW7A 4E04A 3PBRA 4G3WA 2QWSA 3O5YA 3U2AA 4O0PA 3KSGA 5G4ZA 4CQHA 3PYPA 3UB8A 4EXOA 3PBNA 5FL3A 4G3VA 2Y8HA 2GX5A 3MQOA 3LI8A 5HL6A 2YKHA 3FC7A 1P9RA 3LR5A 1YSPA 4LRZE 2VV7A 2JKRM 4R3AA 1ZHHB 2ZBBA 4GCZA 2QYBA 5AVEA 5J3WA 2VV6A 4O8GA 2K2NA 2XA7M 2XROA 2FZ0A 3C30A 2OWJA 4DJ2A 5J7EA 4EETB 3H7WA 5CX7A 3ZQ5A 3E4OA 3ULFA 4EUVA 2W3DA 1BYWA 4PKYA 3OLOA 1H8MA 3HJIA 3NHQA 4F3LB 2O9BA 4JGPA 2PD8A 1F9IA 1TS8A 3C8CA 1DP8A 1G28A 1LT0A 4CLCD 5EFWA 3EEHA 2V0UA 4LRXC 4H6JA 1OTDA 2PR5A 2Z6DA 3PBSA 4WEKA 3H82B 3LYXA 4GS9A 2W0NA 2W3HA 5A8BA 1N9LA 3P7NA 1VB6A 4IUKA 5HWTA 3IS2A 4L0LA 2HJEA 3D72A 4O01A 5HZHA 5LBRA 3K3DA 4I5SA 4KUKA 2VV8A 4NEED 3TE8A 1UWNX 3H9WA 3F1NA 4MN6A 1MZUA 3A0VA 4HIAA 4EQ1A 3B47A 3T4OA 1TS0A 4Q0JA 4Q0HA 4JGQA 2W1TA 3JVVA 1G6OA 5F68A 3PBTA 2EWWA 4LRYC 1W63Q 1OT6A 3T4TA 3T4QA 3S7OA 3H7WB 2PR6A 4BBTA 4CLCC 5HPFA 5F5YA 5HDSA 4CLCA 4NXBA 5DFXA 1P9WA 3C38A 3F1PA 3EQUA 4YWZA 2PDRA 3HJKA 2ZMFA 3EEAA 4PHTA 2BASA 1LL8A 3CAXA 3B42A 4R70A 3PR6A 1OJGA 2PYPA 3LIFA 2VA0A 4HY8A 4IJGA 3MFXA 3CWFA 2QHKA 3F1OA 4GLQA 3LICA 4HJ4A 4KQDA 1ZTUA 4HOIA 1D06A 3E4PA 4K08A 5F69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S67 L;  5IU1 A;  5HD5 A;  1KOU A;  1XFQ A;  1P97 A;  2WKR A;  2INW A;  1WA9 A;  4HQA A;  4RQ9 A;  2ZOI A;  4L9G A;  2Z6C A;  5HDC A;  3BWL A;  1P0Z A;  2L0W A;  4R38 A;  5TBM B;  1D7E A;  3BY8 A;  1S4R A;  2L4R A;  3K3C A;  4GW9 A;  3UB9 A;  1XJ2 A;  5J4E A;  1DP6 A;  3FG8 A;  1T1C A;  2P7J A;  4KUO A;  4WN5 A;  4GHI A;  3F1O B;  4B9O A;  2VEA A;  4PKY G;  2W27 A;  2PHY A;  4JGR A;  4BBV A;  4NXF A;  1N9N A;  1T18 A;  4HHD A;  5KIZ A;  3T50 A;  4I3J A;  4NXE A;  3VE3 A;  1UGU A;  2QKP A;  3B33 A;  4HP9 A;  3GDI A;  3LI9 A;  2D01 A;  2L1M A;  1DRM A;  1GSX A;  3NOT C;  3ICY A;  3UMD A;  4HNB A;  1N9O A;  3UE6 A;  2V1B A;  2B02 A;  4LLO B;  1T19 A;  4I3A A;  2A24 A;  2PYR A;  3MXQ A;  3MQQ A;  5HD3 A;  3NJA A;  1TS6 A;  4EEU A;  3PHY A;  5F6A A;  2PD7 A;  4WLA A;  1EW0 A;  3G6O A;  4H6J B;  1V9Z A;  1OTA A;  1XJ6 A;  3SW1 A;  4GS9 B;  3LIE A;  3IS2 B;  4DJ3 A;  1Y28 A;  1LSX A;  1OT9 A;  1XFN A;  3A0R A;  4HH2 A;  4L9E A;  3BY9 A;  5G4Y A;  3F1N B;  2M1C A;  2V9A A;  3UB6 A;  2WKP A;  3NOP C;  1XJ3 A;  1OTI A;  1F98 A;  4F3L A;  2R78 A;  5HWW A;  2VLG A;  4NXG A;  4WUJ A;  2WKQ A;  3NOU C;  3F1P B;  4JGO A;  3UB7 A;  3LUQ A;  3CLO A;  3LIA A;  3H82 A;  2JN7 A;  1X0O A;  4HP4 A;  4EES A;  4I3I A;  4WL9 A;  3LIB A;  1NWZ A;  3GEC A;  2KDK A;  5HSQ A;  1OJ5 A;  3A0S A;  5DJU A;  1ODV A;  3LID A;  1S1Y A;  2YKF A;  1DP9 A;  4EER A;  3RTY A;  4HH3 A;  1S1Z A;  4HJ6 A;  2OOL A;  2V1A A;  1JNU A;  2CMN A;  5HDD A;  5IS1 A;  5HWV A;  2H28 A;  3MJQ A;  4XT2 A;  1UWP X;  1LSV A;  5DKK A;  1TS7 A;  4BBU A;  4M4X A;  3KX0 X;  2D02 A;  3VOL A;  2ZOH A;  4L9F A;  4GHI B;  2OWH A;  2EA9 A;  2I9V A;  4LPZ A;  5DKL A;  2V0W A;  5AVF A;  1LSW A;  3EWK A;  2QJ7 A;  3E4Q A;  1S66 L;  1T1A A;  4HI4 A;  2GJ3 A;  3MR0 A;  1GSW A;  5TBM A;  5I5L A;  4I38 A;  2JHE A;  4R6L A;  2HV1 A;  4EEP A;  3VE4 A;  3C2W A;  1OTB A;  4I39 A;  4XT2 B;  5DJT A;  2K7S A;  1XJ4 A;  4HJ3 A;  2J80 A;  2QJ5 A;  4WF0 A;  2KX6 A;  1S4S A;  2A24 B;  1OTE A;  3IBR A;  3UME A;  4MN5 A;  1T1B A;  3RH8 B;  1GSV A;  1V9Y A;  4EW7 A;  4E04 A;  2QWS A;  5G4Z A;  3PYP A;  3UB8 A;  4EXO A;  3MQO A;  3LI8 A;  2YKH A;  3FC7 A;  4LRZ E;  2VV7 A;  4R3A A;  2ZBB A;  4GCZ A;  5AVE A;  5J3W A;  2VV6 A;  2OWJ A;  4DJ2 A;  5J7E A;  4EET B;  3H7W A;  3ZQ5 A;  3E4O A;  3ULF A;  1BYW A;  4PKY A;  3OLO A;  3HJI A;  3NHQ A;  4F3L B;  4JGP A;  2PD8 A;  1F9I A;  1TS8 A;  3C8C A;  1DP8 A;  1G28 A;  1LT0 A;  5EFW A;  3EEH A;  2V0U A;  4LRX C;  4H6J A;  1OTD A;  2PR5 A;  2Z6D A;  3H82 B;  3LYX A;  4GS9 A;  2W0N A;  5A8B A;  1N9L A;  3P7N A;  1VB6 A;  5HWT A;  3IS2 A;  3D72 A;  5HZH A;  3K3D A;  4I5S A;  4KUK A;  2VV8 A;  1UWN X;  3H9W A;  3F1N A;  4MN6 A;  1MZU A;  3A0V A;  4HIA A;  4EQ1 A;  1TS0 A;  4JGQ A;  5F68 A;  4LRY C;  1OT6 A;  3H7W B;  2PR6 A;  4BBT A;  5F5Y A;  5HDS A;  4NXB A;  3F1P A;  4YWZ A;  2PDR A;  3HJK A;  2BAS A;  1LL8 A;  3CAX A;  4R70 A;  1OJG A;  2PYP A;  3LIF A;  4HY8 A;  3MFX A;  3CWF A;  2QHK A;  3F1O A;  3LIC A;  4HJ4 A;  4KQD A;  4HOI A;  1D06 A;  3E4P A;  4K08 A;  5F69 A; 
#chains in the Genus database with same CATH topology
 1S67 L;  2UV0 E;  5HD5 A;  5EVI D;  4GZB A;  1P97 A;  2WKR A;  1CEF A;  3LR4 A;  3VP0 A;  3Q82 A;  4L9G A;  1YM1 A;  5HDC A;  1WYB A;  3MZE A;  3TG9 A;  4ZJ3 A;  3LY4 A;  1L0D A;  2L4R A;  3K3C A;  1HVB A;  2JKR I;  2G2W A;  4OP8 A;  1NXY A;  3T1R A;  5CER A;  1DP6 A;  3Q81 A;  4PM6 A;  1T1C A;  5KMW A;  2P7J A;  1KGF A;  2ZJ9 A;  3WRZ A;  1ESU A;  4GHI A;  3ZDJ A;  2EX2 A;  3FWL A;  3KSI A;  3LY3 A;  3KO6 A;  2VEA A;  4PKY G;  2W27 A;  3MKF A;  4JGR A;  3OPH A;  4OON A;  3LR0 A;  4OPY A;  1I5Q A;  1T18 A;  2OAP 1;  5IHV A;  1KVL A;  1Z6F A;  4ME4 A;  4I3J A;  1DY6 A;  5AQ9 A;  4HP9 A;  3GR2 A;  2D01 A;  2Y2N A;  1GSX A;  1YLT A;  4HES A;  3MMH A;  3ICY A;  3L9K A;  3ZYT A;  2Y55 A;  5J8X A;  3KYQ A;  4X53 A;  1N9O A;  3UE6 A;  5KSH A;  2ZQA A;  1XA1 A;  1TDL A;  2V1B A;  3DTE A;  3WS1 A;  4LLO B;  4NKP A;  3S7N A;  5EVI B;  3SS3 A;  2A24 A;  4ZRR A;  3DTK A;  3MQQ A;  4B93 A;  3UDF A;  3NJA A;  2PRF A;  1TS6 A;  2HDU A;  2ZL1 A;  5EM0 A;  3OBF A;  2HGV A;  4EEU A;  5F6A A;  3PBO A;  4S2J A;  1L0F A;  4OQG A;  2A49 A;  1MXO A;  2V8C A;  2Y2O A;  5CTN A;  2XEP A;  1V9Z A;  1GHP A;  1OTA A;  4R1G A;  4DN0 A;  1BUE A;  1F2K A;  3A3F A;  3C4P A;  3LIE A;  4N1H A;  3MSH A;  1Q2P A;  4EUZ A;  3HCY A;  1OT9 A;  3BLM A;  5AJG A;  3DW0 A;  4P6B A;  4HH2 A;  5FQK A;  3HLD A;  3BY9 A;  1CI8 A;  2V9A A;  3UB6 A;  4X56 A;  3IF6 B;  1STZ A;  3BFD A;  2VLG A;  3O88 A;  1H5X A;  4IBR A;  1BUL A;  3VMA A;  2R9X A;  2JKG A;  3KSH A;  2WKQ A;  4WUJ A;  3TW8 A;  4CLC B;  3C7V A;  1IFQ A;  3F1P B;  3E0Y A;  5GHX A;  1PW1 A;  4BD1 A;  3UB7 A;  3H82 A;  1GHM A;  2JN7 A;  3NBL A;  3T4K A;  4II7 A;  4HP4 A;  1SKO A;  4X69 A;  3TJZ C;  2B18 A;  3CPT A;  4WL9 A;  2Y91 A;  4E3M A;  4FOF A;  5DF8 A;  2KDK A;  4XXR A;  5DTS A;  5HSQ A;  1VET A;  4Y7P A;  2P08 A;  2EXB A;  3A0S A;  3I7J A;  1LI9 A;  1PI4 A;  4KG2 A;  4HH3 A;  4BL2 A;  1ESI A;  3WS2 A;  3GQZ A;  3AGE A;  4PM9 A;  1LSV A;  4MN7 A;  2P04 A;  2J3T C;  3JPU A;  5JYO A;  3QP6 A;  4MNR A;  2ZD8 A;  3GMW A;  4R23 A;  3ZHH A;  2OWH A;  4PAU A;  2XD1 A;  3GRJ A;  3LEQ A;  5AVF A;  1F5M A;  4OLD A;  4HI4 A;  5FAO A;  2VJW A;  3S7Q A;  4FSF A;  3CG5 A;  3VP2 A;  4Y0U A;  4UQI S;  3TSG A;  4R6L A;  4FD8 A;  1PYY A;  1TF1 A;  3VE4 A;  4MDZ A;  1K54 C;  4QY5 A;  4I39 A;  1MWS A;  1K54 A;  4KQO A;  5L07 A;  3UY6 A;  4HJ3 A;  4WZ4 A;  1VQQ A;  2EX9 A;  2C5W B;  1FCN A;  5JYP A;  1N4O A;  4S2M A;  1SKF A;  5KZH A;  4E3K A;  1IKI A;  2KX6 A;  2RCX A;  3RFB A;  1OPX A;  2K31 A;  1OTE A;  2M7V A;  3UME A;  1T1B A;  1GSV A;  3UE3 A;  4DE0 A;  1GA0 A;  3SZT A;  5CEC A;  3RJU A;  4GDN A;  3TOI A;  2BTF P;  2ZM8 A;  3UB8 A;  3FV7 A;  1IYQ A;  3Q7Z A;  1GA9 A;  1K57 C;  5FQM A;  2IWD A;  2Y8H A;  1K57 A;  3LI8 A;  4FH2 A;  1ERO A;  3ZCZ A;  3QHY A;  1E3U A;  1VEU B;  2VV6 A;  2VGK A;  2XRO A;  2XA7 M;  3IXD A;  1DJC A;  5FSR A;  2E8I A;  2WZZ A;  4EUV A;  5TGF A;  2XK1 A;  4PPR A;  3N8R A;  4F3L B;  4JGP A;  1RGY A;  2J9O A;  3WS4 A;  3C8C A;  1DP8 A;  1G28 A;  1LHY A;  4H6J A;  2PR5 A;  3ZG5 A;  2Z6D A;  4PM5 A;  2WK0 A;  4F94 A;  2W0N A;  3UO9 A;  2JKF A;  3DTI A;  4IUK A;  4L0L A;  2HJE A;  3UN7 A;  4I5S A;  3TE8 A;  3NI9 A;  3F1N A;  1ZKJ A;  3VSK A;  3B47 A;  5L10 A;  1ZG4 A;  4Q0H A;  1TDG A;  4EWF A;  4LRY C;  4Y15 A;  3ZNY A;  3B3X A;  3WRT A;  1PWC A;  4EV4 A;  5HDS A;  2Y2H A;  5FDS A;  5E2E A;  5EEC A;  4OKP A;  3EQU A;  1JTD A;  1GCE A;  1KE0 A;  1ES4 A;  5DF7 A;  2BAS A;  3CAX A;  3CHW P;  1OJG A;  2PYP A;  3QNB A;  4KQR A;  1FSY A;  4K08 A;  1NJ4 A;  5F69 A;  3V39 A;  3ZGA B;  3G2Z A;  1J3W A;  4ETX A;  3LO7 A;  4MCW A;  1G68 A;  1BLS A;  1XFQ A;  5E2F A;  2INW A;  3T4L A;  3A3D A;  2MJ6 A;  3PXP A;  5IT5 A;  5FEG A;  3BFF A;  2XDM A;  3BWL A;  4R38 A;  2NUP C;  1HLU P;  2W1T B;  1M40 A;  2HP6 A;  5TBM B;  4AFI A;  5MC7 A;  3C7U A;  5CGW A;  2V2F F;  1D7E A;  4E6W A;  2Y2G A;  3OPL A;  1KGE A;  4GW9 A;  4XUX A;  3VOZ A;  4JXS A;  5J4E A;  3UPP A;  3ISG A;  5HL1 A;  2ZQ9 A;  4ARZ A;  4RX2 A;  4HEF A;  2LB9 A;  1BLC A;  5FAT A;  3R7W A;  3IH8 A;  2PHY A;  3W2Z A;  3G32 A;  2WGI A;  1NYM A;  1MPL A;  1H8Z A;  1ZC2 A;  3CI6 A;  4Z9Q A;  3ZFZ A;  3U4L P;  4OLG A;  4HHD A;  5F83 A;  5KIZ A;  3T50 A;  4GOG A;  4E3L A;  1FQG A;  3VE3 A;  1AXB A;  4MEZ A;  4U0T A;  4OP5 A;  4JXW A;  2ZQ7 A;  3LI9 A;  2L1M A;  3VP4 A;  4EBP A;  1PWD A;  3LEZ A;  4BMW A;  2WKH A;  2XQZ A;  2WUQ A;  4MMN A;  2JKT M;  3Q7V A;  4WYY A;  3GSG A;  4GNU A;  4X55 A;  4I3A A;  5AQ7 A;  4WZ5 A;  2I72 A;  4E3J A;  2XFT A;  1YKD A;  4Y13 A;  4UA6 A;  3VOY A;  1CQA A;  1SHV A;  1D1J A;  2Y59 A;  1EW0 A;  4Y3I A;  3PAE A;  1FR6 A;  3HVF A;  3OC2 A;  4GS9 B;  1XGI A;  3OZH A;  5U47 A;  3IS2 B;  4DJ3 A;  1Y28 A;  4JPM A;  2WAF A;  2QMI A;  4PMA A;  3DWZ A;  4IHQ A;  1FOF A;  3NDE A;  1TVF A;  2OSU A;  5G4Y A;  5K5B A;  1XJ3 A;  4OQH A;  3VV4 A;  1I2W A;  2XLN A;  5HWW A;  1FIL A;  4LV0 A;  2Y2I A;  3PTE A;  3IH9 A;  3MF0 A;  1IOU A;  3E98 A;  4CPK A;  3T12 B;  4JGO A;  4A5R A;  3HLG A;  2Z2L B;  3IXG A;  2J3T D;  1XA7 A;  3ZNT A;  4EES A;  4P6Z M;  3M2J A;  4FTX A;  4LV2 A;  1ACF A;  4B4Z A;  1NWZ A;  4GB7 A;  3IWQ A;  4WEL A;  2ZQ8 A;  1YSQ A;  1ERQ A;  5EVE A;  1WYC A;  5F1F A;  4N9L A;  1CI9 A;  4GJ4 A;  1EWZ A;  2YKF A;  2XH9 A;  4EER A;  3RTY A;  3W4O A;  1S1Z A;  3A3J A;  2CMN A;  4Y17 A;  1XX2 A;  4YFM A;  2WZX A;  4DRT A;  3CZD A;  2Y79 A;  3MJQ A;  4OOM A;  1UWP X;  4KZ3 A;  3ITB A;  1IYP A;  3V3S A;  2VX8 A;  3IHB A;  3OPR A;  4E3O A;  3WWX A;  2JKT I;  4M4X A;  5D3O A;  3SH9 A;  5BOH A;  4KQQ A;  2WGV A;  4IVK A;  3BQA A;  3UPN A;  3IWI A;  4L9F A;  3SH7 A;  2I9V A;  5DKL A;  3K2N A;  1HZO A;  5TR7 A;  2Y2L A;  5GHY A;  3IF5 A;  4C6Y A;  2QJ7 A;  5A91 A;  5CGS A;  1VET B;  3T4J A;  3HRE A;  2GJ3 A;  3MR0 A;  2VZW A;  4UEY A;  5E2G A;  2C6W B;  2HP9 A;  3M2K A;  5FQI A;  4D60 A;  2H5S A;  3HUN A;  5DTT A;  2HV1 A;  4S2P A;  1NLY A;  4Z1W A;  3MQ0 A;  4U0X A;  5CEB A;  2EXA A;  4GDB A;  4EU0 A;  3CIT A;  1W79 A;  5TJJ A;  1ES3 A;  4M3K A;  1M6K A;  1CEG A;  5HAR A;  1E3U D;  5HW3 A;  3BEB A;  3MZD A;  3PBQ A;  2QJ5 A;  1CK3 A;  1RGZ A;  3O3V A;  2VGL S;  1NY0 A;  4R0Q A;  5CHU A;  1S4S A;  3AGF A;  2M7U A;  3IBR A;  1K6S A;  3BYD A;  3RH8 B;  1V9Y A;  1O7E A;  1ONG A;  1W8Q A;  4S2N C;  1K25 A;  4E04 A;  3UDX A;  4S2N A;  3QNC A;  2BG1 A;  2P74 A;  3U2A A;  4CQH A;  3KSG A;  4N92 A;  5FDH A;  1NYY A;  4KEN B;  3VFF A;  3FC7 A;  3LR5 A;  4BD0 A;  4LRZ E;  2VV7 A;  2JBF A;  4NET A;  4GCZ A;  2WGW B;  3FKV A;  2RL3 A;  2K2N A;  2ZC4 B;  4JF5 A;  4EET B;  5FI7 A;  3H7W A;  3RXX A;  2VK3 A;  4KZ8 A;  3NHQ A;  2O9B A;  1F9I A;  3NCK A;  1LT0 A;  1JVJ A;  3D4F A;  4UAA A;  5GL9 A;  3EEH A;  1K0K A;  2P9V B;  1H8Y A;  4R4R A;  1U60 A;  1OTD A;  2QPN A;  4WEK A;  2XF3 A;  4IED A;  1CF0 A;  5HZH A;  3ZG8 B;  2JCH A;  3K3D A;  4NEE D;  3ITA A;  2X02 A;  1UWN X;  4MN6 A;  1MZU A;  2PBD P;  1MBL A;  4HIA A;  4LCL A;  4WMC A;  4EQ1 A;  1DJB A;  3IF6 A;  4JGQ A;  1G6O A;  5F68 A;  5CTM A;  3PBT A;  2EWW A;  3LCE A;  1YLY A;  3T4Q A;  3S7O A;  2PR6 A;  2ZC5 B;  3Q07 A;  4C3Q A;  2E8J A;  3N6I A;  2Y4A A;  4CLC C;  3AGD A;  5F5Y A;  1PZP A;  4CLC A;  2BLS A;  5DFX A;  3UB5 P;  1JWV A;  3F1P A;  4E3N A;  4DDS A;  4GD6 A;  1BZA A;  4PHT A;  1LL8 A;  3B42 A;  3P98 A;  4IJG A;  4S2I A;  1MWU A;  3F1O A;  3S4X A;  1FCM A;  3LIC A;  4DE3 A;  3N7W A;  4HOI A;  1D06 A;  3E4P A;  5IU1 A;  3KSF A;  5G18 A;  1ES5 A;  2ZMV A;  1KOU A;  3EGX C;  4KZB A;  1WA9 A;  2XGN A;  4HQA A;  4PM8 A;  2J7V A;  4RQ9 A;  2Z6C A;  4B4X A;  5CXW A;  3V50 A;  1YLP A;  1S4R A;  3MS6 A;  3SS4 A;  1KVM A;  5M18 A;  5CHM A;  1XJ2 A;  1IEL A;  4P0M A;  3KYE A;  4OOL A;  3FG8 A;  1LLB A;  4HBU A;  4BLM A;  5F1G A;  2WKI A;  2O0Y A;  4Q8I A;  4KUO A;  2H0Y A;  3IX4 A;  5M1A A;  2EWV A;  3DWK A;  1KDW A;  4JLF A;  5L8M A;  4O7D A;  4NXF A;  4OPR A;  4KZA A;  1K55 C;  4BEN A;  1K55 A;  2DMW A;  5A93 A;  2OLV A;  5EPH A;  1K56 A;  1ERM A;  3IX8 A;  3IQA A;  3FPW A;  4NXE A;  1Q2Q A;  4Q0I A;  2XFS A;  4C75 A;  3D9Y A;  1UGU A;  2QKP A;  1K6R A;  4R3B A;  1KE4 A;  4JKT A;  4UA9 A;  1DRM A;  3NOT C;  4S2K A;  2V8F A;  4LGW A;  2Y2M A;  2PT7 A;  5DFY A;  2GDN A;  3D3O A;  4HNB A;  3UMD A;  1HD8 A;  2WAE A;  4S2L A;  3RXW A;  5CRF A;  5DVA A;  1TD5 A;  3HLF A;  2B02 A;  5FA7 A;  4OVD A;  4DE1 A;  5FQJ A;  3G34 A;  5EOO A;  4DKI A;  1PIO A;  3IXB A;  1T19 A;  2PBY A;  2PYR A;  3MXQ A;  2H0T A;  3HUO A;  3QP8 A;  5HD3 A;  1E4D A;  2UWX A;  1PI5 A;  2FFF B;  2R9W A;  4WLA A;  2HDS A;  4NK3 A;  1XP4 A;  5M19 A;  3DBA A;  1W5D A;  4MLL A;  3ZVT A;  1XJ6 A;  3MBZ A;  5FI6 A;  1JTG A;  4U3T A;  5L2F A;  3EOI A;  5DF9 A;  4QWO A;  4MBH A;  3SH8 A;  1YQS A;  4P6Z S;  4L9E A;  1G6A A;  4ZJ2 A;  2WKP A;  2CC1 A;  1OTI A;  4CLC E;  3LR3 A;  3KYZ A;  4F3L A;  2R78 A;  4KZ4 A;  2W1R A;  3NOU C;  3W4P A;  3CLO A;  3LIA A;  4UQI M;  3OCN A;  2JC7 A;  3QP1 A;  2W3G A;  3N8S A;  3UE1 A;  3S1Y A;  4JF4 A;  5FI2 A;  4I3I A;  3BW6 A;  3LIB A;  1FR1 A;  1E25 A;  5HPI A;  3GEC A;  1OJ5 A;  3NIA A;  3BFC A;  1ZG6 A;  2ZMA A;  2KOI A;  3BJN A;  4OPQ A;  5DJU A;  5HAQ A;  3VP3 A;  2GZA A;  3LID A;  1S1Y A;  2HP5 A;  5FAS A;  5EVL A;  3IBJ A;  1DP9 A;  2AVX A;  5CED A;  2OOL A;  3GTC A;  5AQB A;  2V1A A;  5IS1 A;  5HDD A;  3DAV A;  5HWV A;  5EOE A;  2H28 A;  1MWR A;  4XT2 A;  1SDE A;  5DKK A;  4N9K A;  1TS7 A;  2OLU A;  4JBF A;  4ETZ A;  1K38 A;  3OOV A;  2EX6 A;  3MKE A;  2J9P A;  3UDI A;  4YNR A;  2D02 A;  1VHM A;  5L09 A;  4GHI B;  1ES2 A;  2V0W A;  4KZ5 A;  5I94 A;  1YLW A;  4WZ5 C;  3EWK A;  2GNX A;  3MZF A;  5HFO A;  1SCW A;  5TBM A;  1XPB A;  1XGJ A;  1LL9 A;  5I5L A;  4RVA A;  4I38 A;  2HPB A;  5CHJ A;  3V67 A;  3V3R A;  4EEP A;  4NG2 A;  4KZ7 A;  3GV9 A;  4PM7 A;  1Y4O A;  2XSS A;  4GD8 A;  2K7S A;  3P01 A;  4ESP A;  4Y2F A;  2DRW A;  3CUE C;  2J80 A;  3CUE A;  1MKI A;  5EM1 A;  1MKM A;  4EBL A;  1W7F A;  2FFY A;  2X01 A;  4BWI A;  2A24 B;  4MN5 A;  3VFH A;  3OCL A;  3P09 A;  5FAQ A;  2ZL1 B;  4XUZ A;  4DDY A;  4LCM A;  3PBR A;  1FCO A;  4WBG A;  4ZTK A;  5G4Z A;  3PYP A;  4EXO A;  2J8Y A;  5FL3 A;  3MQO A;  2GX5 A;  5HL6 A;  3MFD A;  1P9R A;  1YSP A;  2Y2Q A;  3UNW A;  1ZHH B;  4MBK A;  2Q0O A;  2QYB A;  5GLA A;  5J3W A;  5F82 A;  4JXG A;  1YMS A;  2OWJ A;  4WMC D;  5J7E A;  3WS5 A;  3Q1F A;  5CX7 A;  3O86 A;  3ULF A;  4EBN A;  2W3D A;  1BYW A;  2Y2J A;  4PKY A;  1PWG A;  3OLO A;  5CGX A;  3GVB A;  3ZVW A;  3OPP A;  3HJI A;  3M6H A;  1MY8 A;  1AWI A;  4CLC D;  4ZDX A;  1L0E A;  2PU4 A;  2V0U A;  5GLC A;  3UE0 A;  3H82 B;  3C5A A;  3LYX A;  4GS9 A;  4BQM A;  3P7N A;  1I2S A;  2X71 A;  5TFQ A;  3IS2 A;  1SKO B;  3D72 A;  3LGO A;  4QHC A;  4ZAM A;  4X1L A;  3CPT B;  5LBR A;  4KUK A;  2VV8 A;  4UHU A;  4D2O A;  3NUL A;  2ZM0 A;  1JWZ A;  1TS0 A;  2WYX A;  2EFU A;  3BEC A;  4JXV A;  1GHI A;  2Q9N A;  1W63 Q;  3T4T A;  5FAP A;  3H7W B;  4BBT A;  3CMZ A;  5HPF A;  4EQI A;  4E3I A;  1P9W A;  1XKZ A;  1PFL A;  3C4O A;  2ACG A;  2PDR A;  3HJK A;  2ZMF A;  4X68 A;  3SS5 A;  3W8K A;  3PR6 A;  1N9B A;  3L7H A;  2VA0 A;  3LIF A;  1RP5 A;  3CWF A;  2QHK A;  4GLQ A;  3VP1 A;  2XA7 S;  3ZG9 B;  5FQQ A;  4RYE A;  5FQ9 A;  3ZG7 B;  1FIK A;  3JVU A;  4LV3 A;  3T1Q B;  2G7U A;  1YMX A;  3G4P A;  2HDR A;  3IXH A;  5GLB A;  2XRN A;  2ZOI A;  2PU2 A;  1P0Z A;  2L0W A;  4DXC A;  4IUH A;  1KGG A;  3BM6 A;  3BY8 A;  1K56 D;  3TRC A;  3N4I A;  2LB5 A;  1YAX A;  3QP2 A;  4YIN A;  1LI0 A;  4HBT A;  3UB9 A;  2IWB A;  3G30 A;  4X1M A;  1DJA A;  2W3F A;  3BLS A;  2V1Z A;  3EGD C;  4WN5 A;  2EFX A;  3M6B A;  3VSL A;  1K4E A;  3F1O B;  1L0G A;  5EVI C;  5EVI A;  1KE3 A;  4B9O A;  2Y2P A;  4WEJ A;  1MWT A;  2O99 A;  4BBV A;  2J3W A;  5C5K A;  5HAP A;  2XR0 A;  2FH5 A;  4H8R A;  1N9N A;  2O9C A;  2IA2 A;  4K0X A;  2DCF A;  4K0W A;  2B95 A;  1YLZ A;  2A3U A;  2HZ5 A;  1H3Q A;  3G2Y A;  4GN2 A;  2ZM2 A;  1JWP A;  3B33 A;  3HLE A;  3CJM A;  3GDI A;  1PNE A;  2XD5 A;  1NLZ A;  4QJG A;  4QY6 A;  4FUW A;  1A0K A;  3JYI A;  3IF6 C;  4DMZ A;  4Y5F A;  1W63 M;  2Y2K A;  3LFV A;  4OH0 A;  2ZC7 A;  2ZC6 B;  1YT4 A;  4ZJ1 A;  1QME A;  2QZ6 A;  1XXM A;  4R3J A;  1MC0 A;  2ZLY A;  4QU3 A;  4JF6 A;  2WAD A;  3PHY A;  1NZU A;  3HLB A;  2PD7 A;  4LEN A;  5HAI A;  3G6O A;  1BLP A;  4H6J B;  3W4Q A;  4KG5 A;  1KDS A;  3SW1 A;  4FCF A;  5GHZ A;  3N8L A;  5KSC A;  1LSX A;  1VM1 A;  2VKS A;  2WGW A;  1XFN A;  3A0R A;  4UA7 A;  2ZQD A;  4OQ0 A;  3WS0 A;  2W3E A;  3S7P A;  4RX3 A;  3F1N B;  2M1C A;  5FEF A;  3G35 A;  2IWC A;  3NOP C;  1NRF A;  1F98 A;  1NRJ A;  4G3K A;  3BRM A;  3HL9 A;  4NXG A;  3IT9 A;  3FYZ A;  1BSG A;  2OAQ 1;  2P9V A;  4BJP A;  3LUQ A;  1BT5 A;  4B88 A;  1OME A;  5E2H A;  3T4S A;  1X0O A;  4IBX A;  3FPV A;  1FSW A;  1PW8 A;  3ZG0 A;  1PZO A;  1ALQ A;  4QB8 A;  1IEM A;  4QPR A;  3E2L A;  2HDQ A;  2Q9M A;  1L3L A;  2A2L A;  5AQA A;  2VGL M;  3IWO A;  1ODV A;  2PAV P;  1HTZ A;  3DTM A;  1CJF A;  4LV1 A;  2O9A A;  5EE8 A;  4HJ6 A;  1PRQ A;  1JNU A;  2WKE A;  4KG6 A;  4X6T A;  4OQI A;  1C3B A;  5GLD A;  3G31 A;  2KLI A;  2DNS A;  4GKU A;  3SOI A;  3BQ8 A;  3QP4 A;  2NUT C;  5DTK A;  2OV5 A;  4BBU A;  4P87 A;  1YPR A;  4ARZ B;  3NC8 A;  1K4F A;  3KX0 X;  1LL5 A;  3VOL A;  2ZOH A;  2G2U A;  5EUA A;  2EA9 A;  4LPZ A;  3NDG A;  1NZO A;  4R4S A;  3R7W B;  4OOY A;  1LSW A;  2HF6 A;  3E4Q A;  1S66 L;  1J9M A;  1T1A A;  3HUM A;  1GSW A;  3IX3 A;  2JHE A;  1L2S A;  3HLW A;  4K91 A;  3O87 A;  3HBR A;  3A3I A;  5A90 A;  4YOF A;  3C2W A;  1OTB A;  3EQV A;  5EV0 A;  4XT2 B;  3IHA A;  1VEU A;  5DJT A;  3BFG A;  3R4K A;  2B5R A;  4CJN A;  1XJ4 A;  1EI5 A;  3NEC A;  2EX8 A;  1YLJ A;  3BFE A;  3NY4 A;  4WF0 A;  3Q7V B;  2HJ9 C;  1ONH A;  4BL3 A;  4Y0T A;  1BTL A;  1TEM A;  3A3E A;  4EW7 A;  1Y54 A;  3V5M A;  3S22 A;  1WE4 A;  4G3W A;  2QWS A;  1Z09 A;  1S0W A;  4DF6 A;  3O5Y A;  4QD4 A;  4O0P A;  3PBN A;  4G3V A;  2ZC3 B;  2YKH A;  4N1X A;  4Y0O A;  2JKR M;  4R3A A;  2ZBB A;  1W8Y A;  3MXR A;  5AVE A;  3T1S A;  1BLH A;  1QMF A;  4O8G A;  2FZ0 A;  3C30 A;  5HX9 A;  5A92 A;  4DJ2 A;  1SZV A;  3PAG A;  1S6R A;  2VGJ A;  2ZQC A;  3ZQ5 A;  3E4O A;  4P85 A;  1H8M A;  3UPO A;  2PD8 A;  1TS8 A;  3MXS A;  5EFW A;  4LRX C;  4RA7 A;  3FZC A;  3PBS A;  2W3H A;  4WM9 A;  5A8B A;  1N9L A;  1VB6 A;  2H10 A;  5HWT A;  3QP5 A;  2V20 A;  1SDN A;  4O01 A;  1H0M A;  2JE5 A;  4X25 A;  4S2O A;  4DXB A;  4OPZ A;  1IKG A;  1RCJ A;  5E43 A;  4ZBE A;  3HLC A;  3H9W A;  3A0V A;  1O07 A;  3T4O A;  4Q0J A;  4ID4 A;  2W1T A;  3JVV A;  4IVI A;  1OT6 A;  4LFU A;  4KZ9 A;  1G5U A;  4DE2 A;  4KZ6 A;  1IYS A;  4NXB A;  3C38 A;  4YWZ A;  3T1X A;  4FH4 A;  3EEA A;  4E6X A;  4R70 A;  3E2K A;  4HY8 A;  3MFX A;  1IYO A;  2Z2M B;  4MBF A;  4HJ4 A;  4KQD A;  1ZTU A;  3FKW A; 
#chains in the Genus database with same CATH homology
 1S67 L;  5IU1 A;  3KSF A;  2XA7 S;  4ETX A;  4MCW A;  5HD5 A;  3JVU A;  2ZMV A;  1KOU A;  3EGX C;  2G7U A;  1XFQ A;  1P97 A;  2WKR A;  2INW A;  1WA9 A;  4HQA A;  3T4L A;  3LR4 A;  2MJ6 A;  3PXP A;  5IT5 A;  2XRN A;  4RQ9 A;  2ZOI A;  4L9G A;  2Z6C A;  5HDC A;  3BWL A;  1P0Z A;  2L0W A;  4R38 A;  2NUP C;  2W1T B;  4IUH A;  5TBM B;  4AFI A;  5MC7 A;  1D7E A;  3BY8 A;  1S4R A;  2L4R A;  3K3C A;  3TRC A;  4GW9 A;  2LB5 A;  1YAX A;  2JKR I;  3UB9 A;  1XJ2 A;  5J4E A;  1DP6 A;  4OOL A;  3FG8 A;  1T1C A;  4ARZ A;  2W3F A;  2P7J A;  3EGD C;  2O0Y A;  4KUO A;  4WN5 A;  4GHI A;  3F1O B;  2LB9 A;  3KSI A;  3R7W A;  2EWV A;  4B9O A;  3KO6 A;  2VEA A;  4PKY G;  2W27 A;  4WEJ A;  2PHY A;  4JGR A;  2O99 A;  4BBV A;  5L8M A;  3W2Z A;  2J3W A;  5C5K A;  4NXF A;  3LR0 A;  2FH5 A;  1N9N A;  2O9C A;  2IA2 A;  1T18 A;  3CI6 A;  2DMW A;  2OAP 1;  4HHD A;  4ME4 A;  5KIZ A;  3T50 A;  1H3Q A;  3FPW A;  4I3J A;  4NXE A;  4Q0I A;  3VE3 A;  1UGU A;  2QKP A;  3B33 A;  4HP9 A;  3GDI A;  3LI9 A;  2D01 A;  1NLZ A;  2L1M A;  1DRM A;  1GSX A;  3NOT C;  2PT7 A;  3MMH A;  3ICY A;  5DFY A;  3D3O A;  4HNB A;  3UMD A;  3ZYT A;  4BMW A;  3KYQ A;  1N9O A;  4DMZ A;  3UE6 A;  5KSH A;  4Y5F A;  1W63 M;  1TD5 A;  3LFV A;  2V1B A;  4MMN A;  2JKT M;  2B02 A;  4LLO B;  4NKP A;  1T19 A;  3S7N A;  4I3A A;  2A24 A;  2PYR A;  4ZRR A;  3MXQ A;  3MQQ A;  4B93 A;  5HD3 A;  1MC0 A;  3NJA A;  1TS6 A;  1YKD A;  3OBF A;  2HGV A;  4EEU A;  3PHY A;  5F6A A;  3PBO A;  2PD7 A;  4WLA A;  1EW0 A;  4Y3I A;  3G6O A;  4H6J B;  3DBA A;  1V9Z A;  1OTA A;  3OC2 A;  1XJ6 A;  4DN0 A;  3SW1 A;  4GS9 B;  3LIE A;  3IS2 B;  3EOI A;  4DJ3 A;  5DF9 A;  1Y28 A;  1LSX A;  2VKS A;  3HCY A;  1OT9 A;  1XFN A;  3A0R A;  5AJG A;  4HH2 A;  2W3E A;  4IHQ A;  4P6Z S;  4L9E A;  3S7P A;  3BY9 A;  5G4Y A;  3F1N B;  2M1C A;  2V9A A;  3UB6 A;  5K5B A;  2WKP A;  1STZ A;  3NOP C;  1XJ3 A;  1OTI A;  4CLC E;  3LR3 A;  3KYZ A;  1F98 A;  3VV4 A;  1NRJ A;  4F3L A;  2R78 A;  5HWW A;  2VLG A;  4G3K A;  2W1R A;  4NXG A;  3MF0 A;  3KSH A;  2WKQ A;  4WUJ A;  3TW8 A;  4CLC B;  1IOU A;  3NOU C;  3E98 A;  1IFQ A;  2OAQ 1;  3F1P B;  3E0Y A;  4JGO A;  3UB7 A;  3LUQ A;  4BJP A;  3CLO A;  3LIA A;  4UQI M;  3H82 A;  3OCN A;  2JN7 A;  2W3G A;  3T4K A;  4II7 A;  3T4S A;  1X0O A;  2J3T D;  4HP4 A;  4EES A;  4I3I A;  3FPV A;  3BW6 A;  3TJZ C;  2B18 A;  4P6Z M;  4WL9 A;  3LIB A;  5HPI A;  4FOF A;  1NWZ A;  3GEC A;  4QPR A;  2KDK A;  5HSQ A;  1OJ5 A;  4WEL A;  1YSQ A;  2P08 A;  2A2L A;  3A0S A;  2VGL M;  2KOI A;  3BJN A;  5DJU A;  2GZA A;  1ODV A;  3LID A;  4GJ4 A;  1S1Y A;  3IBJ A;  2YKF A;  1DP9 A;  4EER A;  2O9A A;  3RTY A;  4HH3 A;  1S1Z A;  4HJ6 A;  2OOL A;  2V1A A;  1JNU A;  2CMN A;  5HDD A;  5IS1 A;  5HWV A;  2Y79 A;  2H28 A;  3MJQ A;  4OOM A;  4XT2 A;  1UWP X;  1LSV A;  5DKK A;  4MN7 A;  1TS7 A;  2KLI A;  2VX8 A;  2P04 A;  2J3T C;  4ETZ A;  3BQ8 A;  2NUT C;  3OOV A;  4BBU A;  2JKT I;  4M4X A;  4ARZ B;  3BQA A;  3KX0 X;  4YNR A;  2D02 A;  3VOL A;  1VHM A;  2ZOH A;  4L9F A;  4GHI B;  2OWH A;  2EA9 A;  2I9V A;  4LPZ A;  3K2N A;  5DKL A;  2V0W A;  4PAU A;  3R7W B;  5AVF A;  1LSW A;  2HF6 A;  3EWK A;  2QJ7 A;  2GNX A;  1S66 L;  1F5M A;  3E4Q A;  1T1A A;  3T4J A;  4HI4 A;  2VJW A;  2GJ3 A;  3MR0 A;  1GSW A;  2VZW A;  4UEY A;  5TBM A;  3S7Q A;  4FSF A;  5I5L A;  4I38 A;  4UQI S;  2JHE A;  4R6L A;  3V67 A;  2HV1 A;  1NLY A;  4EEP A;  4YOF A;  1TF1 A;  3C2W A;  3VE4 A;  1OTB A;  3EQV A;  4MDZ A;  4Z1W A;  3MQ0 A;  4I39 A;  4XT2 B;  4KQO A;  4EU0 A;  2XSS A;  3CIT A;  5DJT A;  3R4K A;  5TJJ A;  2K7S A;  3P01 A;  4Y2F A;  1XJ4 A;  4HJ3 A;  3CUE C;  2J80 A;  3CUE A;  3PBQ A;  2QJ5 A;  2VGL S;  1MKM A;  4WF0 A;  2KX6 A;  3RFB A;  2HJ9 C;  4BWI A;  1S4S A;  2A24 B;  1OPX A;  2M7U A;  2K31 A;  1OTE A;  3IBR A;  2M7V A;  3UME A;  4MN5 A;  3OCL A;  1T1B A;  3RH8 B;  1GSV A;  1V9Y A;  3UE3 A;  4EW7 A;  4E04 A;  3PBR A;  4G3W A;  2QWS A;  3O5Y A;  3U2A A;  4O0P A;  3KSG A;  5G4Z A;  4CQH A;  3PYP A;  3UB8 A;  4EXO A;  3PBN A;  5FL3 A;  4G3V A;  2Y8H A;  2GX5 A;  3MQO A;  3LI8 A;  5HL6 A;  2YKH A;  3FC7 A;  1P9R A;  3LR5 A;  1YSP A;  4LRZ E;  2VV7 A;  2JKR M;  4R3A A;  1ZHH B;  2ZBB A;  4GCZ A;  2QYB A;  5AVE A;  5J3W A;  2VV6 A;  4O8G A;  2K2N A;  2XA7 M;  2XRO A;  2FZ0 A;  3C30 A;  2OWJ A;  4DJ2 A;  5J7E A;  4EET B;  3H7W A;  5CX7 A;  3ZQ5 A;  3E4O A;  3ULF A;  4EUV A;  2W3D A;  1BYW A;  4PKY A;  3OLO A;  1H8M A;  3HJI A;  3NHQ A;  4F3L B;  2O9B A;  4JGP A;  2PD8 A;  1F9I A;  1TS8 A;  3C8C A;  1DP8 A;  1G28 A;  1LT0 A;  4CLC D;  5EFW A;  3EEH A;  2V0U A;  4LRX C;  4H6J A;  1OTD A;  2PR5 A;  2Z6D A;  3PBS A;  4WEK A;  3H82 B;  3LYX A;  4GS9 A;  2W0N A;  2W3H A;  5A8B A;  1N9L A;  3P7N A;  1VB6 A;  4IUK A;  5HWT A;  3IS2 A;  4L0L A;  2HJE A;  3D72 A;  4O01 A;  5HZH A;  5LBR A;  3K3D A;  4I5S A;  4KUK A;  2VV8 A;  4NEE D;  3TE8 A;  1UWN X;  3H9W A;  3F1N A;  4MN6 A;  1MZU A;  3A0V A;  4HIA A;  4EQ1 A;  3B47 A;  3T4O A;  1TS0 A;  4Q0J A;  4Q0H A;  4JGQ A;  2W1T A;  3JVV A;  1G6O A;  5F68 A;  3PBT A;  2EWW A;  4LRY C;  1W63 Q;  1OT6 A;  3T4T A;  3T4Q A;  3S7O A;  3H7W B;  2PR6 A;  4BBT A;  4CLC C;  5HPF A;  5F5Y A;  5HDS A;  4CLC A;  4NXB A;  5DFX A;  1P9W A;  3C38 A;  3F1P A;  3EQU A;  4YWZ A;  2PDR A;  3HJK A;  2ZMF A;  3EEA A;  4PHT A;  2BAS A;  1LL8 A;  3CAX A;  3B42 A;  4R70 A;  3PR6 A;  1OJG A;  2PYP A;  3LIF A;  2VA0 A;  4HY8 A;  4IJG A;  3MFX A;  3CWF A;  2QHK A;  3F1O A;  4GLQ A;  3LIC A;  4HJ4 A;  4KQD A;  1ZTU A;  4HOI A;  1D06 A;  3E4P A;  4K08 A;  5F69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...