5J7EA

Heag pas domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of PAS domain from the hEAG Potassium Channel
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Potassium voltage-gated channel subfamily H member 1
total genus 31
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5j7eA00
1XFQA 1OT9A 2JN7A 2QWSA 1DRMA 2VEAA 3LIAA 3F1NB 1VB6A 3B33A 4GW9A 4EQ1A 2V1BA 2GJ3A 4HIAA 2VV7A 4YWZA 2ZOHA 1P97A 3LIFA 4NXBA 3UE6A 4F3LA 1UWPX 2P7JA 4GHIB 3RTYA 5J7EA 2PR5A 4I3JA 1N9OA 1EW0A 1LT0A 4EW7A 2I9VA 1XJ6A 2ZBBA 4HJ4A 2INWA 4LLOB 5J3WA 4HNBA 5TBMA 3VE4A 4HQAA 1TS6A 3MXQA 1D7EA 5DKLA 4DJ3A 3GECA 3NOUC 5HDDA 1TS8A 2J80A 4L9FA 4HOIA 1F9IA 4MN6A 4HY8A 3VOLA 3BWLA 1S66L 2KDKA 3H82A 4I3IA 3LI8A 4JGOA 2L4RA 2ZOIA 2V1AA 1S4RA 2YKHA 3MJQA 3OLOA 1GSXA 3MQOA 3PYPA 3C2WA 4HI4A 4L9EA 2QJ7A 4I38A 3RH8B 1JNUA 4EESA 4EERA 1GSVA 3ICYA 3KX0X 2V0UA 1TS7A 2CMNA 3E4OA 4NXFA 3ZQ5A 4KUOA 4H6JA 4H6JB 5HWTA 2PD8A 1MZUA 2L0WA 3A0VA 3ULFA 4PKYA 3UB8A 3UB9A 1LSWA 4KQDA 4EEUA 4LRXC 5HWWA 4JGPA 1ODVA 1V9ZA 4EXOA 2H28A 1LL8A 2JHEA 3HJKA 4NXEA 3BY8A 3PHYA 1N9NA 4L9GA 1N9LA 5TBMB 4JGRA 2OOLA 5I5LA 3VE3A 2OWJA 2VLGA 2W0NA 3MR0A 5HDSA 4HP9A 2OWHA 4WUJA 1T18A 3A0RA 3CWFA 3K3CA 2A24A 4MN5A 4GCZA 3F1NA 5F68A 1UWNX 1S4SA 2BASA 2WKQA 2QJ5A 4NXGA 2A24B 2WKPA 5IS1A 4BBTA 3F1OA 4GHIA 2PYRA 3D72A 3UMEA 4EETB 1DP6A 3E4QA 4B9OA 5HZHA 2PYPA 5G4YA 3CAXA 5HDCA 4PKYG 3MQQA 2L1MA 5KIZA 3LI9A 2KX6A 5HD5A 2K7SA 1OT6A 4EEPA 2D02A 3IS2A 5F5YA 1GSWA 1KOUA 1LSXA 4I5SA 1OJ5A 1X0OA 1DP8A 4WL9A 1T1AA 4K08A 2Z6CA 1OTEA 4RQ9A 4WLAA 4E04A 4M4XA 1XJ2A 1G28A 3A0SA 1NWZA 3LYXA 4LRZE 1XFNA 1LSVA 4R70A 1OTBA 1OTDA 3H9WA 5AVEA 5A8BA 5G4ZA 1OTAA 3F1PB 1T1BA 4I3AA 4BBVA 5EFWA 3P7NA 4HH3A 2V0WA 4BBUA 3NOPC 5F69A 4LPZA 2VV6A 2Z6DA 3H82B 2QKPA 5DKKA 4XT2A 1UGUA 5HD3A 4HJ6A 4F3LB 3CLOA 4DJ2A 1BYWA 3C8CA 3LIEA 3BY9A 1F98A 1T19A 3HJIA 2YKFA 2W27A 3NOTC 3LICA 2B02A 2PR6A 2V9AA 4HH2A 1WA9A 2VV8A 1XJ3A 4HP4A 5IU1A 5DJTA 4XT2B 5J4EA 2R78A 2PD7A 3LUQA 1P0ZA 4KUKA 5HWVA 2M1CA 3UB6A 3K3DA 1XJ4A 1V9YA 5F6AA 1DP9A 4I39A 3T50A 4R6LA 3H7WA 1D06A 1T1CA 3IBRA 3EEHA 4WN5A 3UB7A 1OTIA 1TS0A 3MFXA 5DJUA 2QHKA 2HV1A 1OJGA 3LIDA 3NHQA 1S1ZA 3F1PA 4JGQA 2D01A 3IS2B 3G6OA 4GS9B 1S1YA 3GDIA 1Y28A 4WF0A 3UMDA 3SW1A 3NJAA 3LIBA 4R38A 5AVFA 5HSQA 2WKRA 3H7WB 3FG8A 3EWKA 2PHYA 2PDRA 3FC7A 4HHDA 1S67L 2EA9A 3E4PA 4LRYC 4GS9A 4R3AA 3F1OB 4HJ3A
chains in the Genus database with same CATH superfamily
1ES5A 3PXPA 2JN7A 3CUEA 4E3MA 4EQ1A 1EI5A 3MZDA 3A3FA 5J7EA 2PR5A 3CHWP 2J3TD 3TE8A 2Y55A 1RP5A 1KVLA 4DJ3A 2QPNA 2B18A 3NOUC 3VSLA 4I3IA 4D2OA 3S7NA 1YMSA 4IBRA 4LV1A 2ZC5B 2Y4AA 2C6WB 4KUOA 4H6JB 2PD8A 3A0VA 5M19A 1DJBA 3PBSA 2JKFA 3MR0A 5AQAA 5HL1A 2VZWA 4Y13A 3HBRA 1DP6A 3JVVA 3CAXA 2GX5A 3BQAA 4PKYG 5KSCA 2WGWB 2JCHA 2D02A 3IHBA 5F5YA 2Z2MB 5JYPA 5HARA 5M1AA 4GB7A 3O3VA 4X68A 3G35A 3SS4A 5FEGA 1VEUB 1E4DA 1EROA 4WBGA 2MJ6A 3BLSA 2V1ZA 1W8YA 4HP4A 3EGDC 3R7WB 4M3KA 4YNRA 4F94A 5L2FA 3UE1A 3EEHA 4XUZA 2W3GA 1S1ZA 3T1XA 4IUHA 3IS2B 1W63Q 1S1YA 1TDGA 3QP4A 2WK0A 4HJ3A 1FCOA 1XFQA 5CEDA 3PR6A 4H8RA 3F1NB 4EV4A 2JKRM 4EUVA 4S2LA 4WZ5A 1ZKJA 1TS8A 4BL2A 4HI4A 2XK1A 1XKZA 4JXVA 1L0FA 3ULFA 3T4LA 2I72A 3T12B 2J3TC 4ETXA 5FI2A 3BY8A 3FPVA 3PBTA 2ZC7A 4JGRA 4GDNA 3EQVA 4LV3A 5F68A 1I2SA 2Y2OA 3U4LP 1L0EA 4BQMA 4FOFA 4ARZA 1E3UD 1P9WA 1ES4A 5GLAA 3IF6C 4FTXA 4O7DA 4I5SA 1L2SA 4RQ9A 5L09A 5FQIA 2QMIA 2H10A 3NBLA 3NC8A 2G2WA 3DWZA 1T1BA 4JXSA 3ISGA 4Y3IA 2PBDP 4QB8A 4NETA 4OQ0A 1UGUA 4Y0TA 4QHCA 4JKTA 4EQIA 3BY9A 2ZC6B 1L0GA 1HZOA 1XJ3A 3KYQA 3A3IA 2ZQAA 3OOVA 1I5QA 3T50A 4WN5A 2ZL1B 3GTCA 3ZVTA 3BW6A 2D01A 3CPTB 5BOHA 3UMDA 2EX2A 3GRJA 4OQGA 1FCMA 4KENB 4Z9QA 1D1JA 4BL3A 1H3QA 3OPLA 2WGVA 5FAPA 4HIAA 4S2KA 1PNEA 1XJ6A 5TJJA 3A3DA 3VFHA 2W1TB 4Y0UA 2HP5A 2OLVA 1TF1A 4HY8A 2KDKA 3MJQA 3KX0X 4IHQA 5FA7A 4EXOA 1Z09A 3OPPA 5I5LA 1F5MA 5M18A 4KZAA 2A24A 1PYYA 4GCZA 5AJGA 3LO7A 3MXSA 4LV2A 1Z6FA 3T4QA 1FIKA 5MC7A 1CF0A 1TEMA 3N4IA 3UDIA 1FSWA 2PYPA 2E8JA 2VA0A 2KX6A 3VFFA 4X55A 1X0OA 4P6ZM 1T1AA 4K08A 3V5MA 1NXYA 2J9PA 4E04A 3BFFA 1NWZA 3PBRA 1F2KA 3LEZA 4GKUA 2IWCA 5DTTA 3NOPC 2O9CA 4Q0JA 1YLYA 1YLTA 4N1XA 2Y2HA 4UQIM 4WMCA 3ZG0A 1NYYA 3LICA 2HGVA 4DE3A 4KUKA 3HREA 3UB6A 4RX2A 1BZAA 4BJPA 2VGLS 3M6BA 3RXWA 1Q2QA 3N6IA 4GDBA 3WS4A 1BT5A 2ZMAA 3FG8A 1K56D 1YLPA 2XEPA 4LV0A 2B95A 3E2LA 4Y15A 4L0LA 3HUMA 2V1BA 1J3WA 5FDSA 1P97A 2AVXA 4U3TA 1VHMA 1LL5A 3P98A 3OCLA 2QYBA 2H5SA 3LR0A 2P08A 3H82A 3RTYA 2V1AA 1S4RA 2Y2MA 3C4OA 4G3WA 3RH8B 1K6RA 2M7UA 4GZBA 1PI4A 3CZDA 4UHUA 4MMNA 5GLBA 3PHYA 3WS0A 2J9OA 4HP9A 4P85A 5JYOA 2XD5A 3CWFA 4MN5A 5A93A 1M6KA 4FUWA 4WYYA 4UA7A 2C5WB 4X25A 3RFBA 4C3QA 2XR0A 4EETB 5G4YA 4N9LA 2WZZA 5CTNA 4EWFA 1OJ5A 4E3OA 3LY4A 1OTEA 3MSHA 1XGIA 1PZOA 2GNXA 3D9YA 1ES3A 3QP2A 5G4ZA 4Y17A 3F1PB 3KSGA 4QY6A 4HH3A 1SDNA 4PM9A 3O86A 1YPRA 2QKPA 2Y2GA 1LI0A 5FI7A 1K4EA 3HLGA 2W27A 3C5AA 2PR6A 2P9VB 5A92A 3SH8A 1NJ4A 3B47A 3S7QA 1MXOA 4DE0A 1D06A 5GHYA 4KZ6A 5C5KA 3W4PA 4KZ4A 3N7WA 5F1GA 5EVIA 4KG2A 4P87A 4DN0A 1TVFA 2PT7A 2PDRA 1K6SA 3T1SA 2A49A 3QP5A 3HLEA 1VETA 5TBMA 3WRTA 3M6HA 4S2OA 3IXGA 1XPBA 1IKIA 1CK3A 2VX8A 2CMNA 1LLBA 5HWTA 2L0WA 3S4XA 3VP2A 2OV5A 1JVJA 1ODVA 3HJKA 4N9KA 1ESIA 3R4KA 4WUJA 4E3LA 4G3KA 4XXRA 3C7UA 2ZQ9A 3KSHA 5CHJA 2HP9A 3LY3A 3NECA 2QJ5A 3DTEA 3SH9A 4K0WA 3WRZA 5CERA 5FEFA 3FV7A 3IS2A 3MBZA 3KSFA 3NULA 4KG5A 5EV0A 4GN2A 4M4XA 3JYIA 3C4PA 4HEFA 4B4ZA 3WWXA 4Y0OA 4EBNA 2Y59A 4HESA 3GMWA 4ZAMA 1ONHA 2WYXA 4G3VA 3LR3A 2W3HA 4GJ4A 4QY5A 1RCJA 1HVBA 3LUQA 2XD1A 1V9YA 3IF6B 3VSKA 1IELA 1KE4A 3MFXA 3FWLA 3FPWA 5HAPA 1WYBA 1NRJA 3C7VA 3UPPA 3HL9A 4HNBA 4CLCB 1Q2PA 2P7JA 1ZG4A 4I3JA 1N9OA 2XROA 1L3LA 3MFDA 5CTMA 1S66L 3RXXA 4JGOA 2L4RA 3W4QA 5HPFA 1JNUA 1GSVA 1K4FA 3E4OA 1KDWA 3WS5A 4OQHA 4CLCC 3KYZA 3G34A 4ZJ3A 4OPQA 1YT4A 3IQAA 4DRTA 3T1RA 2K31A 2OWJA 1T18A 4OLDA 3WS1A 3VMAA 2A24B 5TFQA 4BBTA 3F1OA 3MS6A 1MY8A 3HUOA 2XDMA 3KO6A 1GSWA 2Z2LB 3MMHA 1K0KA 5TR7A 5KMWA 4DE2A 2WAEA 4X6TA 2O9BA 4LRZE 1XP4A 5FATA 1NY0A 1ACFA 5EOEA 2W3EA 3OPRA 3ZVWA 3TJZC 3IX3A 4PM6A 1PI5A 4B4XA 4E6WA 5FL3A 1SKFA 4IBXA 1GCEA 1NRFA 1JWVA 2FFFB 5FQ9A 3QP1A 3E0YA 3UE3A 4E3IA 3G4PA 5HAIA 4C6YA 1NZOA 4OLGA 3LCEA 4K91A 3TG9A 3H7WB 2Y2PA 4MDZA 1LT0A 2EA9A 4PAUA 4JF6A 2QWSA 1XXMA 2ZMVA 4YWZA 2ZOHA 1TDLA 4NXBA 2ZQDA 2XRNA 3FKWA 1U60A 3BFCA 2XFSA 4QD4A 1F9IA 4QWOA 1ALQA 3VOLA 3DTKA 2WKHA 2QJ7A 4O8GA 4WEKA 1KE3A 1WE4A 3OBFA 3RJUA 1XA7A 1YAXA 3ZGAB 4YINA 1KGEA 4ARZB 3BRMA 2J7VA 2JC7A 4X69A 2WGWA 3B42A 4DDYA 4ZRRA 1XX2A 1SKOB 3UMEA 3UO9A 4ZJ2A 1WYCA 1O7EA 4GLQA 3W2ZA 3A3JA 5CECA 2JBFA 5HD5A 5CGSA 3HLCA 1FOFA 4PMAA 1IKGA 3Q07A 1W7FA 3A0SA 1OTBA 1C3BA 2VK3A 1PRQA 4OPRA 5GLCA 3VP1A 1K57A 1Y54A 1YLWA 3JVUA 2KLIA 3QP6A 2Z6DA 4E3KA 3UDXA 2ZC4B 3LR4A 4HJ6A 1BYWA 1SCWA 5DTKA 2V8FA 2VV8A 4E6XA 1P0ZA 4DDSA 4CLCA 1XJ4A 4FH4A 2HJEA 4OQIA 1DJAA 3ZNTA 4PM5A 5EOOA 4B88A 3FKVA 2ZLYA 2DMWA 3UNWA 1Y28A 5AVFA 1E25A 2ZM0A 4JXWA 4HHDA 4IVKA 2Q9MA 3C30A 3LIAA 2HDQA 3DBAA 3PBNA 4E3JA 1NYMA 2XA7M 3IH8A 5EECA 1BSGA 2INWA 1PFLA 4KZ9A 2G2UA 2WGIA 3KYEA 3CUEC 5AQBA 2OSUA 1NZUA 1O07A 2EX9A 4DJ2A 1GSXA 3O88A 4I38A 2BTFP 3ICYA 3G2YA 1TS7A 4OONA 1FILA 3DWKA 4PKYA 2IWBA 3S22A 5HWVA 3HUNA 4KZ5A 4MBFA 5A91A 2EX8A 2OWHA 1M40A 2ZM8A 3K3CA 3F1NA 4DKIA 1FQGA 4HBTA 3SH7A 3MKEA 1RGYA 3G32A 1ERQA 3DW0A 2W1RA 4BD0A 1OT6A 2Q9NA 4OOYA 4Y5FA 1L0DA 1KGFA 4XUXA 2EFXA 5EFWA 3P7NA 2P74A 3IX4A 3IF6A 1IEMA 2VV6A 3T1QB 2LB9A 3LFVA 3UN7A 3CLOA 3HJIA 1VEUA 2V9AA 1HTZA 4NKPA 3FYZA 2R78A 2PD7A 1CQAA 2M1CA 1DP9A 5CEBA 4P6ZS 2HP6A 5GHZA 1YM1A 1ZG6A 3LIBA 2WKRA 3OC2A 3GVBA 3T4TA 2IA2A 3D4FA 1EWZA 3HCYA 1VB6A 3B33A 2VV7A 3CG5A 2HPBA 5GHXA 4CLCE 3Q7VB 2OAP1 4FH2A 2J8YA 5CHUA 1H8YA 4PPRA 4ZTKA 4R23A 5CGXA 4BWIA 2XF3A 3UE0A 1K25A 5EVIC 3UB7A 3OLOA 3MXRA 4K0XA 3MQOA 4L9EA 3V39A 5E2HA 4LRXC 1V9ZA 3CI6A 5TBMB 3D3OA 1N9NA 5LBRA 4P0MA 2ZD8A 4CLCD 2RCXA 3WS2A 2BASA 4KZ7A 1KVMA 2E8IA 2Q0OA 1N9BA 4KZ3A 2Y2KA 5HZHA 5F1FA 3ZG5A 3NDEA 1K55C 3LI9A 1LSXA 2R9WA 2WKEA 2GZAA 4DF6A 3HVFA 3VOYA 1G5UA 4PM7A 4I3AA 2NUPC 2W1TA 4Z1WA 1MC0A 3ITBA 4OOMA 3BYDA 4YFMA 2PRFA 3DAVA 5HD3A 1W63M 1H8ZA 2Y8HA 4HBUA 1T19A 4GNUA 4HQAA 1LL9A 1MWTA 1FR1A 3AGEA 2Y79A 3K3DA 4QU3A 3UDFA 1J9MA 4OKPA 3VP3A 4WELA 3G6OA 3AGDA 2ZC3B 5DFXA 3SS5A 2JKRI 3EGXC 4Q8IA 2GJ3A 3LIFA 4WMCD 5AQ9A 4OPYA 3ZFZA 2I9VA 2ZBBA 4RA7A 4UAAA 3DTIA 3NIAA 4X1MA 4HOIA 1YSQA 3HLFA 5L8MA 3ZQ5A 3LI8A 1IYPA 1S6RA 1ZTUA 4R1GA 3K2NA 4H6JA 2HZ5A 4EEUA 1RGZA 1HLUP 2V8CA 3LR5A 2VGKA 5FAOA 4KQQA 4PHTA 3BEBA 2W0NA 5HDSA 1DJCA 4OP8A 3IT9A 4QPRA 5FASA 4NXGA 2WKPA 1VETB 4EU0A 1XA1A 2K7SA 2HDUA 4S2MA 4WL9A 2VJWA 4R4RA 2ZL1A 4WLAA 4S2NC 2W3DA 3CJMA 3A3EA 5K5BA 3SOIA 2V0WA 3DTMA 3H82B 4KZBA 5CRFA 3GSGA 3HLBA 2B02A 2BLSA 2HDSA 4OPZA 2ACGA 3BFEA 2HV1A 1OJGA 2XSSA 3U2AA 3P01A 4BD1A 3EWKA 3F1OB 2A3UA 2ZQCA 1JWPA 4KZ8A 3ZG8B 5E2EA 5CHMA 2O99A 2FFYA 5CX7A 1SZVA 4MNRA 3VE4A 2OLUA 1TS6A 3IWOA 5L07A 5A90A 4IEDA 4MN6A 3BWLA 3UB5P 3ZHHA 4JGPA 4MN7A 3PTEA 2H28A 4NXEA 4L9GA 2OOLA 4S2JA 2VGJA 4GD6A 4X56A 1Y4OA 1K54C 1ZC2A 2WKQA 3SZTA 4DE1A 5FSRA 4IJGA 4CJNA 3GV9A 3P09A 1IYQA 4S2IA 2XA7S 3IBJA 2Z6CA 1YLZA 1YKDA 3L9KA 2Y2JA 4R70A 1YLJA 5A8BA 4BMWA 1GHMA 5AQ7A 5F69A 5CGWA 3T4JA 5DKKA 5IHVA 3C8CA 5J4EA 3HLWA 1CJFA 1FSYA 1PZPA 1S0WA 3T4SA 3KSIA 4R6LA 4Q0HA 3LEQA 3GQZA 2KOIA 3Q7ZA 4OVDA 3M2JA 3V3RA 4WF0A 5KZHA 4HH2A 5FQJA 1W79A 3M2KA 4GS9A 3GR2A 1TD5A 1CI8A 2PAVP 4JXGA 1BTLA 2EWWA 3MF0A 4N1HA 4EW7A 3IHAA 3MXQA 2J3WA 3C38A 3L7HA 3PBQA 1P9RA 4LENA 1MKMA 3IWQA 3IF5A 2R9XA 1BLSA 1ERMA 4EBPA 2X02A 2V2FF 5HWWA 1PWGA 5IT5A 5G18A 4KG6A 3BLMA 3UY6A 1CI9A 4ETZA 4B9OA 5EVIB 1DP8A 3S7OA 1IYOA 3OPHA 1XFNA 2ZQ7A 1BLCA 5FQQA 5AVEA 5HW3A 3Q81A 1W5DA 2UWXA 3HLDA 1OPXA 4ZDXA 3NY4A 4P6BA 3Q82A 1CEFA 1GHIA 3Q1FA 4XT2A 4F3LB 1F98A 3NOTC 4EERA 4DXBA 2WADA 3IXDA 4UA6A 4XT2B 3VOZA 4LCLA 5F6AA 4X53A 2DCFA 5DF9A 1H5XA 3H7WA 2Y2LA 1G68A 5D3OA 1TS0A 4CQHA 1IOUA 4D60A 1STZA 4WM9A 2XLNA 3MQ0A 4C75A 4NG2A 4S2PA 2V20A 3E4PA 3ZG7B 5DF8A 5F83A 5L10A 3BM6A 5FAQA 4GW9A 2CC1A 4R3BA 1BUEA 3UE6A 4F3LA 3G31A 1UWPX 3AGFA 1EW0A 4LLOB 2P9VA 1CEGA 1AWIA 4L9FA 3EEAA 1H8MA 3VV4A 2VKSA 2LB5A 4BLMA 2EXBA 2ZM2A 1KGGA 1LSWA 1W8QA 2ZMFA 1ONGA 2XFTA 1PWCA 3IH9A 3LGOA 1MWRA 4RX3A 4X1LA 1OMEA 2O0YA 3D72A 4YOFA 1ESUA 3G2ZA 1BULA 1KOUA 1FCNA 1G28A 1K57C 3V3SA 1XGJA 4ZBEA 1JTGA 4IVIA 1H0MA 5GLDA 2FZ0A 3W8KA 4OOLA 3S1YA 5EVID 3R7WA 2HDRA 4MBHA 3BFDA 4GOGA 4WZ4A 4CPKA 1SDEA 3TSGA 5DFYA 3ZYTA 2QHKA 1MBLA 3CPTA 5EM1A 4UQIS 4Y2FA 4B93A 3NCKA 3FC7A 1MPLA 1IFQA 4WZ5C 4MLLA 2VEAA 3PBOA 4JF4A 3TOIA 2GDNA 3IXHA 3B3XA 5DKLA 2J80A 4A5RA 3G30A 2ZOIA 2H0YA 4ESPA 3C2WA 2BG1A 4EESA 4JBFA 2V0UA 4Q0IA 3T4KA 1MZUA 1NLZA 3UB9A 3UB8A 3N8RA 1GHPA 1E3UA 4WEJA 5EVEA 2JKGA 2PU4A 1N9LA 3QNBA 4O0PA 3NDGA 1DY6A 1QMEA 4IUKA 3A0RA 3S7PA 3MZEA 1S4SA 1PW1A 1BLHA 2ZQ8A 2PYRA 4GHIA 3E4QA 3V50A 5HDCA 3SS3A 4EUZA 4Y7PA 5KIZA 4OP5A 3E2KA 4RYEA 4EEPA 3V67A 3QP8A 2WZXA 3ZDJA 4KQOA 3LYXA 1LSVA 3QHYA 1MWSA 4FSFA 3W4OA 4AFIA 2JE5A 2PBYA 3IX8A 4S2NA 4BBVA 3TRCA 2QZ6A 4BBUA 1K56A 4JF5A 1ES2A 3PAGA 1K54A 3BJNA 4KQDA 4NEED 2O9AA 1I2WA 1BLPA 1WA9A 4LCMA 5DJTA 5E43A 3JPUA 4MEZA 4ID4A 4I39A 1T1CA 4DXCA 4LFUA 2Y2NA 2EWVA 3N8SA 4R38A 4DMZA 4EBLA 4O01A 5HX9A 5TGFA 4PM8A 4RVAA 2PHYA 4LRYC 4R3AA 1S67L 2WAFA 3VP0A 1MKIA 1OT9A 4ZJ1A 5U47A 2Y91A 5I94A 2WKIA 3FZCA 5J3WA 4II7A 5HDDA 3BFGA 3PAEA 2H0TA 3PYPA 5E2GA 5FI6A 4NXFA 5EPHA 4R3JA 4LGWA 2W3FA 5EUAA 2RL3A 4BENA 1G6OA 3NI9A 4MCWA 3MKFA 1PWDA 1IYSA 4QJGA 3BQ8A 1SKOA 3VP4A 2DNSA 1GA0A 1UWNX 1YMXA 5IS1A 4GD8A 3QNCA 2P04A 2X71A 3UPOA 1SHVA 2L1MA 3UPNA 3TW8A 3OZHA 2A2LA 5E2FA 2X01A 3EOIA 5FQKA 1OTDA 3H9WA 3OCNA 5DTSA 4U0TA 1OTAA 1AXBA 1K38A 4KQRA 3O87A 2XQZA 5HL6A 4OH0A 5HPIA 3BECA 5F82A 2WUQA 5FQMA 5IU1A 4JLFA 4ME4A 1OTIA 2Y2QA 1KE0A 3LIDA 5GL9A 2EXAA 1VM1A 4GS9B 3GDIA 5FDHA 4E3NA 1N4OA 5HSQA 2VGLM 1FR6A 2JKTI 3O5YA 2NUTC 3T4OA 3ITAA 4NK3A 1GA9A 1DRMA 3CITA 3MZFA 2K2NA 3E98A 2B5RA 2G7UA 4GHIB 4FCFA 2M7VA 2HJ9C 4HJ4A 3CMZA 1D7EA 3GECA 4R0QA 2FH5A 3I7JA 4R4SA 1LI9A 1PW8A 2YKHA 2Y2IA 4MBKA 4JPMA 2PU2A 1LL8A 2EFUA 2JHEA 3ZCZA 2EX6A 5HFOA 3VE3A 2VLGA 4U0XA 1PIOA 5EM0A 1VQQA 2IWDA 1QMFA 1MWUA 1LHYA 3IXBA 4UA9A 3MQQA 5HAQA 3IWIA 2XH9A 1XJ2A 1JTDA 3ZNYA 2OAQ1 3N8LA 1K55A 5CXWA 2DRWA 1YQSA 5J8XA 3Q7VA 4LPZA 5DVAA 5DF7A 1HD8A 5KSHA 2HF6A 3LIEA 4UEYA 2YKFA 3EQUA 5EE8A 1JWZA 2UV0E 1A0KA 1NLYA 3ZG9B 1YSPA 4FD8A 3IBRA 1ZHHB 4N92A 5DJUA 3NHQA 3F1PA 2ZJ9A 4JGQA 3SW1A 3NJAA 1KDSA 1G6AA 2JKTM 5EVLA 2XGNA
chains in the Genus database with same CATH topology
2IA2A 3PXPA 2JN7A 3CUEA 3HCYA 1VB6A 3B33A 4GW9A 4EQ1A 2VV7A 3UE6A 4F3LA 1UWPX 5J7EA 2PR5A 1EW0A 2J3TD 4CLCE 4LLOB 5TBMA 3TE8A 2OAP1 4DJ3A 2B18A 3NOUC 4L9FA 3EEAA 1H8MA 3VV4A 4BWIA 2VKSA 4I3IA 3UB7A 2LB5A 3OLOA 3S7NA 3MQOA 4L9EA 2VX8A 2CMNA 4KUOA 4H6JB 5HWTA 2PD8A 2L0WA 3A0VA 1LSWA 4LRXC 2ZMFA 1ODVA 1V9ZA 3CI6A 3HJKA 3PBSA 5TBMB 3D3OA 1N9NA 5LBRA 3MR0A 3R4KA 4WUJA 4G3KA 4CLCD 2VZWA 3KSHA 2BASA 2QJ5A 2O0YA 3D72A 1DP6A 5HZHA 3JVVA 3CAXA 2GX5A 3BQAA 4PKYG 4YOFA 3LI9A 2D02A 3IS2A 5F5YA 1KOUA 1LSXA 3KSFA 4M4XA 1G28A 2GZAA 4I3AA 2NUPC 2W1TA 2FZ0A 4Z1WA 1MC0A 4OOLA 4OOMA 3R7WA 5HD3A 1W63M 4G3VA 2Y8HA 2MJ6A 3LR3A 2W3HA 1T19A 4GJ4A 4HQAA 4HP4A 3EGDC 3LUQA 3R7WB 2Y79A 3K3DA 1V9YA 4YNRA 3EEHA 2W3GA 5DFYA 3MFXA 3ZYTA 2QHKA 3FPWA 1S1ZA 4WELA 4IUHA 3IS2B 3G6OA 1W63Q 1S1YA 4UQIS 1NRJA 4Y2FA 4B93A 5DFXA 3FC7A 2JKRI 1IFQA 4HNBA 4HJ3A 4CLCB 1XFQA 3EGXC 3PR6A 2VEAA 3F1NB 2JKRM 2GJ3A 4EUVA 3LIFA 3PBOA 2P7JA 4I3JA 1N9OA 2XROA 2I9VA 2ZBBA 5DKLA 1TS8A 2J80A 4HOIA 1YSQA 1S66L 3ZQ5A 4JGOA 5L8MA 3LI8A 2L4RA 2ZOIA 4HI4A 5HPFA 1ZTUA 3C2WA 1JNUA 4EESA 1GSVA 3K2NA 2V0UA 3E4OA 4Q0IA 3T4KA 3ULFA 4H6JA 1MZUA 1NLZA 3T4LA 3UB9A 3UB8A 4EEUA 2J3TC 4CLCC 4ETXA 3KYZA 4WEJA 3BY8A 3FPVA 3PBTA 1N9LA 3LR5A 4JGRA 4PHTA 2K31A 2OWJA 2W0NA 4O0PA 3EQVA 5HDSA 4IUKA 1T18A 3A0RA 3S7PA 4QPRA 5F68A 1S4SA 4NXGA 2A24B 2WKPA 4BBTA 3F1OA 4GHIA 2PYRA 3E4QA 4FOFA 4ARZA 5HDCA 4EU0A 1P9WA 3KO6A 5KIZA 2K7SA 4EEPA 3V67A 1GSWA 4I5SA 2VJWA 4WL9A 4RQ9A 3MMHA 4WLAA 2W3DA 4KQOA 2O9BA 3LYXA 4LRZE 1LSVA 4FSFA 4AFIA 2W3EA 5K5BA 1T1BA 4Y3IA 4BBVA 3TJZC 3TRCA 2V0WA 4BBUA 5FL3A 3H82B 1UGUA 3BY9A 3BJNA 4KQDA 4NEED 2O9AA 2B02A 1WA9A 1XJ3A 3KYQA 5DJTA 3OOVA 3E0YA 4I39A 3T50A 3UE3A 4WN5A 1T1CA 2HV1A 1OJGA 2EWVA 2XSSA 3BW6A 2D01A 3U2AA 3P01A 3UMDA 4R38A 4DMZA 4O01A 3H7WB 4MDZA 3EWKA 2PHYA 4LRYC 4R3AA 1LT0A 1S67L 2EA9A 4PAUA 3F1OB 1OT9A 2QWSA 1H3QA 4HIAA 2ZMVA 4YWZA 2ZOHA 4NXBA 2O99A 5CX7A 2XRNA 1XJ6A 5TJJA 5J3WA 3VE4A 1TS6A 2W1TB 4II7A 5HDDA 1F9IA 4MN6A 1TF1A 4HY8A 3BWLA 2KDKA 3VOLA 3MJQA 3PYPA 2QJ7A 4O8GA 4WEKA 3KX0X 4IHQA 4NXFA 3OBFA 2W3FA 4JGPA 4MN7A 4EXOA 1G6OA 2H28A 4NXEA 1YAXA 4L9GA 4MCWA 5I5LA 2OOLA 4ARZB 1F5MA 3BQ8A 2A24A 4GCZA 5AJGA 3B42A 1UWNX 2WKQA 4ZRRA 3T4QA 5IS1A 5MC7A 3UMEA 2P04A 4GLQA 3W2ZA 2PYPA 4IJGA 2VA0A 2L1MA 2KX6A 5HD5A 2XA7S 1X0OA 3IBJA 4P6ZM 1T1AA 4K08A 2Z6CA 3TW8A 1YKDA 4E04A 2A2LA 3A0SA 3EOIA 1NWZA 4R70A 3PBRA 1OTBA 1OTDA 3H9WA 5A8BA 3OCNA 1OTAA 4BMWA 3JVUA 2KLIA 3NOPC 2O9CA 4Q0JA 5F69A 5HL6A 4UQIM 2Z6DA 3T4JA 5HPIA 5DKKA 3LR4A 4HJ6A 1BYWA 3C8CA 3LICA 5IU1A 2VV8A 5J4EA 2HGVA 1P0ZA 4KUKA 3T4SA 3UB6A 4CLCA 1XJ4A 3KSIA 4R6LA 4Q0HA 2HJEA 4ME4A 4BJPA 1OTIA 2VGLS 2KOIA 3LIDA 4GS9B 2DMWA 3GDIA 1Y28A 4WF0A 5AVFA 5HSQA 2VGLM 2JKTI 3FG8A 3O5YA 4HHDA 2NUTC 4HH2A 4GS9A 3T4OA 1TD5A 3C30A 1DRMA 3LIAA 3CITA 4L0LA 2V1BA 3PBNA 3DBAA 2EWWA 2K2NA 3E98A 3MF0A 1P97A 2G7UA 4GHIB 2M7VA 2XA7M 1VHMA 4EW7A 2HJ9C 4HJ4A 2INWA 3OCLA 3MXQA 2QYBA 1D7EA 2J3WA 3C38A 3GECA 2FH5A 3PBQA 1P9RA 3LR0A 2P08A 1MKMA 3CUEC 3H82A 3RTYA 4DJ2A 2V1AA 1S4RA 2YKHA 1GSXA 4G3WA 3RH8B 4I38A 2M7UA 3ICYA 1TS7A 4PKYA 5HWWA 4MMNA 5IT5A 1LL8A 2JHEA 5HWVA 3PHYA 3VE3A 2VLGA 4HP9A 2OWHA 3CWFA 3K3CA 4MN5A 3F1NA 3RFBA 4ETZA 4EETB 4B9OA 5G4YA 3MQQA 2W1RA 1OT6A 1OJ5A 1DP8A 3S7OA 1OTEA 1XJ2A 2GNXA 4Y5FA 2OAQ1 1XFNA 5AVEA 5G4ZA 3F1PB 3KSGA 5EFWA 3P7NA 4HH3A 1OPXA 4LPZA 2VV6A 2LB9A 3LFVA 2QKPA 5KSHA 4XT2A 2HF6A 4F3LB 3CLOA 3LIEA 3HJIA 1F98A 4UEYA 3NOTC 2YKFA 2W27A 4EERA 2PR6A 2V9AA 3EQUA 4NKPA 4XT2B 2R78A 2PD7A 1NLYA 2M1CA 1YSPA 3B47A 5F6AA 1DP9A 5DF9A 3S7QA 3H7WA 1D06A 4P6ZS 3IBRA 1TS0A 4CQHA 1ZHHB 1IOUA 5DJUA 1STZA 5C5KA 3NHQA 3F1PA 4JGQA 3SW1A 4DN0A 3NJAA 3LIBA 3MQ0A 2WKRA 2JKTM 3OC2A 2PT7A 2PDRA 3E4PA 3T4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFQ A;  1OT9 A;  2JN7 A;  2QWS A;  1DRM A;  2VEA A;  3LIA A;  3F1N B;  1VB6 A;  3B33 A;  4GW9 A;  4EQ1 A;  2V1B A;  2GJ3 A;  4HIA A;  2VV7 A;  4YWZ A;  2ZOH A;  1P97 A;  3LIF A;  4NXB A;  3UE6 A;  4F3L A;  1UWP X;  2P7J A;  4GHI B;  3RTY A;  5J7E A;  2PR5 A;  4I3J A;  1N9O A;  1EW0 A;  1LT0 A;  4EW7 A;  2I9V A;  1XJ6 A;  2ZBB A;  4HJ4 A;  2INW A;  4LLO B;  5J3W A;  4HNB A;  5TBM A;  3VE4 A;  4HQA A;  1TS6 A;  3MXQ A;  1D7E A;  5DKL A;  4DJ3 A;  3GEC A;  3NOU C;  5HDD A;  1TS8 A;  2J80 A;  4L9F A;  4HOI A;  1F9I A;  4MN6 A;  4HY8 A;  3VOL A;  3BWL A;  1S66 L;  2KDK A;  3H82 A;  4I3I A;  3LI8 A;  4JGO A;  2L4R A;  2ZOI A;  2V1A A;  1S4R A;  2YKH A;  3MJQ A;  3OLO A;  1GSX A;  3MQO A;  3PYP A;  3C2W A;  4HI4 A;  4L9E A;  2QJ7 A;  4I38 A;  3RH8 B;  1JNU A;  4EES A;  4EER A;  1GSV A;  3ICY A;  3KX0 X;  2V0U A;  1TS7 A;  2CMN A;  3E4O A;  4NXF A;  3ZQ5 A;  4KUO A;  4H6J A;  4H6J B;  5HWT A;  2PD8 A;  1MZU A;  2L0W A;  3A0V A;  3ULF A;  4PKY A;  3UB8 A;  3UB9 A;  1LSW A;  4KQD A;  4EEU A;  4LRX C;  5HWW A;  4JGP A;  1ODV A;  1V9Z A;  4EXO A;  2H28 A;  1LL8 A;  2JHE A;  3HJK A;  4NXE A;  3BY8 A;  3PHY A;  1N9N A;  4L9G A;  1N9L A;  5TBM B;  4JGR A;  2OOL A;  5I5L A;  3VE3 A;  2OWJ A;  2VLG A;  2W0N A;  3MR0 A;  5HDS A;  4HP9 A;  2OWH A;  4WUJ A;  1T18 A;  3A0R A;  3CWF A;  3K3C A;  2A24 A;  4MN5 A;  4GCZ A;  3F1N A;  5F68 A;  1UWN X;  1S4S A;  2BAS A;  2WKQ A;  2QJ5 A;  4NXG A;  2A24 B;  2WKP A;  5IS1 A;  4BBT A;  3F1O A;  4GHI A;  2PYR A;  3D72 A;  3UME A;  4EET B;  1DP6 A;  3E4Q A;  4B9O A;  5HZH A;  2PYP A;  5G4Y A;  3CAX A;  5HDC A;  4PKY G;  3MQQ A;  2L1M A;  5KIZ A;  3LI9 A;  2KX6 A;  5HD5 A;  2K7S A;  1OT6 A;  4EEP A;  2D02 A;  3IS2 A;  5F5Y A;  1GSW A;  1KOU A;  1LSX A;  4I5S A;  1OJ5 A;  1X0O A;  1DP8 A;  4WL9 A;  1T1A A;  4K08 A;  2Z6C A;  1OTE A;  4RQ9 A;  4WLA A;  4E04 A;  4M4X A;  1XJ2 A;  1G28 A;  3A0S A;  1NWZ A;  3LYX A;  4LRZ E;  1XFN A;  1LSV A;  4R70 A;  1OTB A;  1OTD A;  3H9W A;  5AVE A;  5A8B A;  5G4Z A;  1OTA A;  3F1P B;  1T1B A;  4I3A A;  4BBV A;  5EFW A;  3P7N A;  4HH3 A;  2V0W A;  4BBU A;  3NOP C;  5F69 A;  4LPZ A;  2VV6 A;  2Z6D A;  3H82 B;  2QKP A;  5DKK A;  4XT2 A;  1UGU A;  5HD3 A;  4HJ6 A;  4F3L B;  3CLO A;  4DJ2 A;  1BYW A;  3C8C A;  3LIE A;  3BY9 A;  1F98 A;  1T19 A;  3HJI A;  2YKF A;  2W27 A;  3NOT C;  3LIC A;  2B02 A;  2PR6 A;  2V9A A;  4HH2 A;  1WA9 A;  2VV8 A;  1XJ3 A;  4HP4 A;  5IU1 A;  5DJT A;  4XT2 B;  5J4E A;  2R78 A;  2PD7 A;  3LUQ A;  1P0Z A;  4KUK A;  5HWV A;  2M1C A;  3UB6 A;  3K3D A;  1XJ4 A;  1V9Y A;  5F6A A;  1DP9 A;  4I39 A;  3T50 A;  4R6L A;  3H7W A;  1D06 A;  1T1C A;  3IBR A;  3EEH A;  4WN5 A;  3UB7 A;  1OTI A;  1TS0 A;  3MFX A;  5DJU A;  2QHK A;  2HV1 A;  1OJG A;  3LID A;  3NHQ A;  1S1Z A;  3F1P A;  4JGQ A;  2D01 A;  3IS2 B;  3G6O A;  4GS9 B;  1S1Y A;  3GDI A;  1Y28 A;  4WF0 A;  3UMD A;  3SW1 A;  3NJA A;  3LIB A;  4R38 A;  5AVF A;  5HSQ A;  2WKR A;  3H7W B;  3FG8 A;  3EWK A;  2PHY A;  2PDR A;  3FC7 A;  4HHD A;  1S67 L;  2EA9 A;  3E4P A;  4LRY C;  4GS9 A;  4R3A A;  3F1O B;  4HJ3 A; 
#chains in the Genus database with same CATH topology
 1ES5 A;  3PXP A;  2JN7 A;  3CUE A;  4E3M A;  4EQ1 A;  1EI5 A;  3MZD A;  3A3F A;  5J7E A;  2PR5 A;  3CHW P;  2J3T D;  3TE8 A;  2Y55 A;  1RP5 A;  1KVL A;  4DJ3 A;  2QPN A;  2B18 A;  3NOU C;  3VSL A;  4I3I A;  4D2O A;  3S7N A;  1YMS A;  4IBR A;  4LV1 A;  2ZC5 B;  2Y4A A;  2C6W B;  4KUO A;  4H6J B;  2PD8 A;  3A0V A;  5M19 A;  1DJB A;  3PBS A;  2JKF A;  3MR0 A;  5AQA A;  5HL1 A;  2VZW A;  4Y13 A;  3HBR A;  1DP6 A;  3JVV A;  3CAX A;  2GX5 A;  3BQA A;  4PKY G;  5KSC A;  2WGW B;  2JCH A;  2D02 A;  3IHB A;  5F5Y A;  2Z2M B;  5JYP A;  5HAR A;  5M1A A;  4GB7 A;  3O3V A;  4X68 A;  3G35 A;  3SS4 A;  5FEG A;  1VEU B;  1E4D A;  1ERO A;  4WBG A;  2MJ6 A;  3BLS A;  2V1Z A;  1W8Y A;  4HP4 A;  3EGD C;  3R7W B;  4M3K A;  4YNR A;  4F94 A;  5L2F A;  3UE1 A;  3EEH A;  4XUZ A;  2W3G A;  1S1Z A;  3T1X A;  4IUH A;  3IS2 B;  1W63 Q;  1S1Y A;  1TDG A;  3QP4 A;  2WK0 A;  4HJ3 A;  1FCO A;  1XFQ A;  5CED A;  3PR6 A;  4H8R A;  3F1N B;  4EV4 A;  2JKR M;  4EUV A;  4S2L A;  4WZ5 A;  1ZKJ A;  1TS8 A;  4BL2 A;  4HI4 A;  2XK1 A;  1XKZ A;  4JXV A;  1L0F A;  3ULF A;  3T4L A;  2I72 A;  3T12 B;  2J3T C;  4ETX A;  5FI2 A;  3BY8 A;  3FPV A;  3PBT A;  2ZC7 A;  4JGR A;  4GDN A;  3EQV A;  4LV3 A;  5F68 A;  1I2S A;  2Y2O A;  3U4L P;  1L0E A;  4BQM A;  4FOF A;  4ARZ A;  1E3U D;  1P9W A;  1ES4 A;  5GLA A;  3IF6 C;  4FTX A;  4O7D A;  4I5S A;  1L2S A;  4RQ9 A;  5L09 A;  5FQI A;  2QMI A;  2H10 A;  3NBL A;  3NC8 A;  2G2W A;  3DWZ A;  1T1B A;  4JXS A;  3ISG A;  4Y3I A;  2PBD P;  4QB8 A;  4NET A;  4OQ0 A;  1UGU A;  4Y0T A;  4QHC A;  4JKT A;  4EQI A;  3BY9 A;  2ZC6 B;  1L0G A;  1HZO A;  1XJ3 A;  3KYQ A;  3A3I A;  2ZQA A;  3OOV A;  1I5Q A;  3T50 A;  4WN5 A;  2ZL1 B;  3GTC A;  3ZVT A;  3BW6 A;  2D01 A;  3CPT B;  5BOH A;  3UMD A;  2EX2 A;  3GRJ A;  4OQG A;  1FCM A;  4KEN B;  4Z9Q A;  1D1J A;  4BL3 A;  1H3Q A;  3OPL A;  2WGV A;  5FAP A;  4HIA A;  4S2K A;  1PNE A;  1XJ6 A;  5TJJ A;  3A3D A;  3VFH A;  2W1T B;  4Y0U A;  2HP5 A;  2OLV A;  1TF1 A;  4HY8 A;  2KDK A;  3MJQ A;  3KX0 X;  4IHQ A;  5FA7 A;  4EXO A;  1Z09 A;  3OPP A;  5I5L A;  1F5M A;  5M18 A;  4KZA A;  2A24 A;  1PYY A;  4GCZ A;  5AJG A;  3LO7 A;  3MXS A;  4LV2 A;  1Z6F A;  3T4Q A;  1FIK A;  5MC7 A;  1CF0 A;  1TEM A;  3N4I A;  3UDI A;  1FSW A;  2PYP A;  2E8J A;  2VA0 A;  2KX6 A;  3VFF A;  4X55 A;  1X0O A;  4P6Z M;  1T1A A;  4K08 A;  3V5M A;  1NXY A;  2J9P A;  4E04 A;  3BFF A;  1NWZ A;  3PBR A;  1F2K A;  3LEZ A;  4GKU A;  2IWC A;  5DTT A;  3NOP C;  2O9C A;  4Q0J A;  1YLY A;  1YLT A;  4N1X A;  2Y2H A;  4UQI M;  4WMC A;  3ZG0 A;  1NYY A;  3LIC A;  2HGV A;  4DE3 A;  4KUK A;  3HRE A;  3UB6 A;  4RX2 A;  1BZA A;  4BJP A;  2VGL S;  3M6B A;  3RXW A;  1Q2Q A;  3N6I A;  4GDB A;  3WS4 A;  1BT5 A;  2ZMA A;  3FG8 A;  1K56 D;  1YLP A;  2XEP A;  4LV0 A;  2B95 A;  3E2L A;  4Y15 A;  4L0L A;  3HUM A;  2V1B A;  1J3W A;  5FDS A;  1P97 A;  2AVX A;  4U3T A;  1VHM A;  1LL5 A;  3P98 A;  3OCL A;  2QYB A;  2H5S A;  3LR0 A;  2P08 A;  3H82 A;  3RTY A;  2V1A A;  1S4R A;  2Y2M A;  3C4O A;  4G3W A;  3RH8 B;  1K6R A;  2M7U A;  4GZB A;  1PI4 A;  3CZD A;  4UHU A;  4MMN A;  5GLB A;  3PHY A;  3WS0 A;  2J9O A;  4HP9 A;  4P85 A;  5JYO A;  2XD5 A;  3CWF A;  4MN5 A;  5A93 A;  1M6K A;  4FUW A;  4WYY A;  4UA7 A;  2C5W B;  4X25 A;  3RFB A;  4C3Q A;  2XR0 A;  4EET B;  5G4Y A;  4N9L A;  2WZZ A;  5CTN A;  4EWF A;  1OJ5 A;  4E3O A;  3LY4 A;  1OTE A;  3MSH A;  1XGI A;  1PZO A;  2GNX A;  3D9Y A;  1ES3 A;  3QP2 A;  5G4Z A;  4Y17 A;  3F1P B;  3KSG A;  4QY6 A;  4HH3 A;  1SDN A;  4PM9 A;  3O86 A;  1YPR A;  2QKP A;  2Y2G A;  1LI0 A;  5FI7 A;  1K4E A;  3HLG A;  2W27 A;  3C5A A;  2PR6 A;  2P9V B;  5A92 A;  3SH8 A;  1NJ4 A;  3B47 A;  3S7Q A;  1MXO A;  4DE0 A;  1D06 A;  5GHY A;  4KZ6 A;  5C5K A;  3W4P A;  4KZ4 A;  3N7W A;  5F1G A;  5EVI A;  4KG2 A;  4P87 A;  4DN0 A;  1TVF A;  2PT7 A;  2PDR A;  1K6S A;  3T1S A;  2A49 A;  3QP5 A;  3HLE A;  1VET A;  5TBM A;  3WRT A;  3M6H A;  4S2O A;  3IXG A;  1XPB A;  1IKI A;  1CK3 A;  2VX8 A;  2CMN A;  1LLB A;  5HWT A;  2L0W A;  3S4X A;  3VP2 A;  2OV5 A;  1JVJ A;  1ODV A;  3HJK A;  4N9K A;  1ESI A;  3R4K A;  4WUJ A;  4E3L A;  4G3K A;  4XXR A;  3C7U A;  2ZQ9 A;  3KSH A;  5CHJ A;  2HP9 A;  3LY3 A;  3NEC A;  2QJ5 A;  3DTE A;  3SH9 A;  4K0W A;  3WRZ A;  5CER A;  5FEF A;  3FV7 A;  3IS2 A;  3MBZ A;  3KSF A;  3NUL A;  4KG5 A;  5EV0 A;  4GN2 A;  4M4X A;  3JYI A;  3C4P A;  4HEF A;  4B4Z A;  3WWX A;  4Y0O A;  4EBN A;  2Y59 A;  4HES A;  3GMW A;  4ZAM A;  1ONH A;  2WYX A;  4G3V A;  3LR3 A;  2W3H A;  4GJ4 A;  4QY5 A;  1RCJ A;  1HVB A;  3LUQ A;  2XD1 A;  1V9Y A;  3IF6 B;  3VSK A;  1IEL A;  1KE4 A;  3MFX A;  3FWL A;  3FPW A;  5HAP A;  1WYB A;  1NRJ A;  3C7V A;  3UPP A;  3HL9 A;  4HNB A;  4CLC B;  1Q2P A;  2P7J A;  1ZG4 A;  4I3J A;  1N9O A;  2XRO A;  1L3L A;  3MFD A;  5CTM A;  1S66 L;  3RXX A;  4JGO A;  2L4R A;  3W4Q A;  5HPF A;  1JNU A;  1GSV A;  1K4F A;  3E4O A;  1KDW A;  3WS5 A;  4OQH A;  4CLC C;  3KYZ A;  3G34 A;  4ZJ3 A;  4OPQ A;  1YT4 A;  3IQA A;  4DRT A;  3T1R A;  2K31 A;  2OWJ A;  1T18 A;  4OLD A;  3WS1 A;  3VMA A;  2A24 B;  5TFQ A;  4BBT A;  3F1O A;  3MS6 A;  1MY8 A;  3HUO A;  2XDM A;  3KO6 A;  1GSW A;  2Z2L B;  3MMH A;  1K0K A;  5TR7 A;  5KMW A;  4DE2 A;  2WAE A;  4X6T A;  2O9B A;  4LRZ E;  1XP4 A;  5FAT A;  1NY0 A;  1ACF A;  5EOE A;  2W3E A;  3OPR A;  3ZVW A;  3TJZ C;  3IX3 A;  4PM6 A;  1PI5 A;  4B4X A;  4E6W A;  5FL3 A;  1SKF A;  4IBX A;  1GCE A;  1NRF A;  1JWV A;  2FFF B;  5FQ9 A;  3QP1 A;  3E0Y A;  3UE3 A;  4E3I A;  3G4P A;  5HAI A;  4C6Y A;  1NZO A;  4OLG A;  3LCE A;  4K91 A;  3TG9 A;  3H7W B;  2Y2P A;  4MDZ A;  1LT0 A;  2EA9 A;  4PAU A;  4JF6 A;  2QWS A;  1XXM A;  2ZMV A;  4YWZ A;  2ZOH A;  1TDL A;  4NXB A;  2ZQD A;  2XRN A;  3FKW A;  1U60 A;  3BFC A;  2XFS A;  4QD4 A;  1F9I A;  4QWO A;  1ALQ A;  3VOL A;  3DTK A;  2WKH A;  2QJ7 A;  4O8G A;  4WEK A;  1KE3 A;  1WE4 A;  3OBF A;  3RJU A;  1XA7 A;  1YAX A;  3ZGA B;  4YIN A;  1KGE A;  4ARZ B;  3BRM A;  2J7V A;  2JC7 A;  4X69 A;  2WGW A;  3B42 A;  4DDY A;  4ZRR A;  1XX2 A;  1SKO B;  3UME A;  3UO9 A;  4ZJ2 A;  1WYC A;  1O7E A;  4GLQ A;  3W2Z A;  3A3J A;  5CEC A;  2JBF A;  5HD5 A;  5CGS A;  3HLC A;  1FOF A;  4PMA A;  1IKG A;  3Q07 A;  1W7F A;  3A0S A;  1OTB A;  1C3B A;  2VK3 A;  1PRQ A;  4OPR A;  5GLC A;  3VP1 A;  1K57 A;  1Y54 A;  1YLW A;  3JVU A;  2KLI A;  3QP6 A;  2Z6D A;  4E3K A;  3UDX A;  2ZC4 B;  3LR4 A;  4HJ6 A;  1BYW A;  1SCW A;  5DTK A;  2V8F A;  2VV8 A;  4E6X A;  1P0Z A;  4DDS A;  4CLC A;  1XJ4 A;  4FH4 A;  2HJE A;  4OQI A;  1DJA A;  3ZNT A;  4PM5 A;  5EOO A;  4B88 A;  3FKV A;  2ZLY A;  2DMW A;  3UNW A;  1Y28 A;  5AVF A;  1E25 A;  2ZM0 A;  4JXW A;  4HHD A;  4IVK A;  2Q9M A;  3C30 A;  3LIA A;  2HDQ A;  3DBA A;  3PBN A;  4E3J A;  1NYM A;  2XA7 M;  3IH8 A;  5EEC A;  1BSG A;  2INW A;  1PFL A;  4KZ9 A;  2G2U A;  2WGI A;  3KYE A;  3CUE C;  5AQB A;  2OSU A;  1NZU A;  1O07 A;  2EX9 A;  4DJ2 A;  1GSX A;  3O88 A;  4I38 A;  2BTF P;  3ICY A;  3G2Y A;  1TS7 A;  4OON A;  1FIL A;  3DWK A;  4PKY A;  2IWB A;  3S22 A;  5HWV A;  3HUN A;  4KZ5 A;  4MBF A;  5A91 A;  2EX8 A;  2OWH A;  1M40 A;  2ZM8 A;  3K3C A;  3F1N A;  4DKI A;  1FQG A;  4HBT A;  3SH7 A;  3MKE A;  1RGY A;  3G32 A;  1ERQ A;  3DW0 A;  2W1R A;  4BD0 A;  1OT6 A;  2Q9N A;  4OOY A;  4Y5F A;  1L0D A;  1KGF A;  4XUX A;  2EFX A;  5EFW A;  3P7N A;  2P74 A;  3IX4 A;  3IF6 A;  1IEM A;  2VV6 A;  3T1Q B;  2LB9 A;  3LFV A;  3UN7 A;  3CLO A;  3HJI A;  1VEU A;  2V9A A;  1HTZ A;  4NKP A;  3FYZ A;  2R78 A;  2PD7 A;  1CQA A;  2M1C A;  1DP9 A;  5CEB A;  4P6Z S;  2HP6 A;  5GHZ A;  1YM1 A;  1ZG6 A;  3LIB A;  2WKR A;  3OC2 A;  3GVB A;  3T4T A;  2IA2 A;  3D4F A;  1EWZ A;  3HCY A;  1VB6 A;  3B33 A;  2VV7 A;  3CG5 A;  2HPB A;  5GHX A;  4CLC E;  3Q7V B;  2OAP 1;  4FH2 A;  2J8Y A;  5CHU A;  1H8Y A;  4PPR A;  4ZTK A;  4R23 A;  5CGX A;  4BWI A;  2XF3 A;  3UE0 A;  1K25 A;  5EVI C;  3UB7 A;  3OLO A;  3MXR A;  4K0X A;  3MQO A;  4L9E A;  3V39 A;  5E2H A;  4LRX C;  1V9Z A;  3CI6 A;  5TBM B;  3D3O A;  1N9N A;  5LBR A;  4P0M A;  2ZD8 A;  4CLC D;  2RCX A;  3WS2 A;  2BAS A;  4KZ7 A;  1KVM A;  2E8I A;  2Q0O A;  1N9B A;  4KZ3 A;  2Y2K A;  5HZH A;  5F1F A;  3ZG5 A;  3NDE A;  1K55 C;  3LI9 A;  1LSX A;  2R9W A;  2WKE A;  2GZA A;  4DF6 A;  3HVF A;  3VOY A;  1G5U A;  4PM7 A;  4I3A A;  2NUP C;  2W1T A;  4Z1W A;  1MC0 A;  3ITB A;  4OOM A;  3BYD A;  4YFM A;  2PRF A;  3DAV A;  5HD3 A;  1W63 M;  1H8Z A;  2Y8H A;  4HBU A;  1T19 A;  4GNU A;  4HQA A;  1LL9 A;  1MWT A;  1FR1 A;  3AGE A;  2Y79 A;  3K3D A;  4QU3 A;  3UDF A;  1J9M A;  4OKP A;  3VP3 A;  4WEL A;  3G6O A;  3AGD A;  2ZC3 B;  5DFX A;  3SS5 A;  2JKR I;  3EGX C;  4Q8I A;  2GJ3 A;  3LIF A;  4WMC D;  5AQ9 A;  4OPY A;  3ZFZ A;  2I9V A;  2ZBB A;  4RA7 A;  4UAA A;  3DTI A;  3NIA A;  4X1M A;  4HOI A;  1YSQ A;  3HLF A;  5L8M A;  3ZQ5 A;  3LI8 A;  1IYP A;  1S6R A;  1ZTU A;  4R1G A;  3K2N A;  4H6J A;  2HZ5 A;  4EEU A;  1RGZ A;  1HLU P;  2V8C A;  3LR5 A;  2VGK A;  5FAO A;  4KQQ A;  4PHT A;  3BEB A;  2W0N A;  5HDS A;  1DJC A;  4OP8 A;  3IT9 A;  4QPR A;  5FAS A;  4NXG A;  2WKP A;  1VET B;  4EU0 A;  1XA1 A;  2K7S A;  2HDU A;  4S2M A;  4WL9 A;  2VJW A;  4R4R A;  2ZL1 A;  4WLA A;  4S2N C;  2W3D A;  3CJM A;  3A3E A;  5K5B A;  3SOI A;  2V0W A;  3DTM A;  3H82 B;  4KZB A;  5CRF A;  3GSG A;  3HLB A;  2B02 A;  2BLS A;  2HDS A;  4OPZ A;  2ACG A;  3BFE A;  2HV1 A;  1OJG A;  2XSS A;  3U2A A;  3P01 A;  4BD1 A;  3EWK A;  3F1O B;  2A3U A;  2ZQC A;  1JWP A;  4KZ8 A;  3ZG8 B;  5E2E A;  5CHM A;  2O99 A;  2FFY A;  5CX7 A;  1SZV A;  4MNR A;  3VE4 A;  2OLU A;  1TS6 A;  3IWO A;  5L07 A;  5A90 A;  4IED A;  4MN6 A;  3BWL A;  3UB5 P;  3ZHH A;  4JGP A;  4MN7 A;  3PTE A;  2H28 A;  4NXE A;  4L9G A;  2OOL A;  4S2J A;  2VGJ A;  4GD6 A;  4X56 A;  1Y4O A;  1K54 C;  1ZC2 A;  2WKQ A;  3SZT A;  4DE1 A;  5FSR A;  4IJG A;  4CJN A;  3GV9 A;  3P09 A;  1IYQ A;  4S2I A;  2XA7 S;  3IBJ A;  2Z6C A;  1YLZ A;  1YKD A;  3L9K A;  2Y2J A;  4R70 A;  1YLJ A;  5A8B A;  4BMW A;  1GHM A;  5AQ7 A;  5F69 A;  5CGW A;  3T4J A;  5DKK A;  5IHV A;  3C8C A;  5J4E A;  3HLW A;  1CJF A;  1FSY A;  1PZP A;  1S0W A;  3T4S A;  3KSI A;  4R6L A;  4Q0H A;  3LEQ A;  3GQZ A;  2KOI A;  3Q7Z A;  4OVD A;  3M2J A;  3V3R A;  4WF0 A;  5KZH A;  4HH2 A;  5FQJ A;  1W79 A;  3M2K A;  4GS9 A;  3GR2 A;  1TD5 A;  1CI8 A;  2PAV P;  4JXG A;  1BTL A;  2EWW A;  3MF0 A;  4N1H A;  4EW7 A;  3IHA A;  3MXQ A;  2J3W A;  3C38 A;  3L7H A;  3PBQ A;  1P9R A;  4LEN A;  1MKM A;  3IWQ A;  3IF5 A;  2R9X A;  1BLS A;  1ERM A;  4EBP A;  2X02 A;  2V2F F;  5HWW A;  1PWG A;  5IT5 A;  5G18 A;  4KG6 A;  3BLM A;  3UY6 A;  1CI9 A;  4ETZ A;  4B9O A;  5EVI B;  1DP8 A;  3S7O A;  1IYO A;  3OPH A;  1XFN A;  2ZQ7 A;  1BLC A;  5FQQ A;  5AVE A;  5HW3 A;  3Q81 A;  1W5D A;  2UWX A;  3HLD A;  1OPX A;  4ZDX A;  3NY4 A;  4P6B A;  3Q82 A;  1CEF A;  1GHI A;  3Q1F A;  4XT2 A;  4F3L B;  1F98 A;  3NOT C;  4EER A;  4DXB A;  2WAD A;  3IXD A;  4UA6 A;  4XT2 B;  3VOZ A;  4LCL A;  5F6A A;  4X53 A;  2DCF A;  5DF9 A;  1H5X A;  3H7W A;  2Y2L A;  1G68 A;  5D3O A;  1TS0 A;  4CQH A;  1IOU A;  4D60 A;  1STZ A;  4WM9 A;  2XLN A;  3MQ0 A;  4C75 A;  4NG2 A;  4S2P A;  2V20 A;  3E4P A;  3ZG7 B;  5DF8 A;  5F83 A;  5L10 A;  3BM6 A;  5FAQ A;  4GW9 A;  2CC1 A;  4R3B A;  1BUE A;  3UE6 A;  4F3L A;  3G31 A;  1UWP X;  3AGF A;  1EW0 A;  4LLO B;  2P9V A;  1CEG A;  1AWI A;  4L9F A;  3EEA A;  1H8M A;  3VV4 A;  2VKS A;  2LB5 A;  4BLM A;  2EXB A;  2ZM2 A;  1KGG A;  1LSW A;  1W8Q A;  2ZMF A;  1ONG A;  2XFT A;  1PWC A;  3IH9 A;  3LGO A;  1MWR A;  4RX3 A;  4X1L A;  1OME A;  2O0Y A;  3D72 A;  4YOF A;  1ESU A;  3G2Z A;  1BUL A;  1KOU A;  1FCN A;  1G28 A;  1K57 C;  3V3S A;  1XGJ A;  4ZBE A;  1JTG A;  4IVI A;  1H0M A;  5GLD A;  2FZ0 A;  3W8K A;  4OOL A;  3S1Y A;  5EVI D;  3R7W A;  2HDR A;  4MBH A;  3BFD A;  4GOG A;  4WZ4 A;  4CPK A;  1SDE A;  3TSG A;  5DFY A;  3ZYT A;  2QHK A;  1MBL A;  3CPT A;  5EM1 A;  4UQI S;  4Y2F A;  4B93 A;  3NCK A;  3FC7 A;  1MPL A;  1IFQ A;  4WZ5 C;  4MLL A;  2VEA A;  3PBO A;  4JF4 A;  3TOI A;  2GDN A;  3IXH A;  3B3X A;  5DKL A;  2J80 A;  4A5R A;  3G30 A;  2ZOI A;  2H0Y A;  4ESP A;  3C2W A;  2BG1 A;  4EES A;  4JBF A;  2V0U A;  4Q0I A;  3T4K A;  1MZU A;  1NLZ A;  3UB9 A;  3UB8 A;  3N8R A;  1GHP A;  1E3U A;  4WEJ A;  5EVE A;  2JKG A;  2PU4 A;  1N9L A;  3QNB A;  4O0P A;  3NDG A;  1DY6 A;  1QME A;  4IUK A;  3A0R A;  3S7P A;  3MZE A;  1S4S A;  1PW1 A;  1BLH A;  2ZQ8 A;  2PYR A;  4GHI A;  3E4Q A;  3V50 A;  5HDC A;  3SS3 A;  4EUZ A;  4Y7P A;  5KIZ A;  4OP5 A;  3E2K A;  4RYE A;  4EEP A;  3V67 A;  3QP8 A;  2WZX A;  3ZDJ A;  4KQO A;  3LYX A;  1LSV A;  3QHY A;  1MWS A;  4FSF A;  3W4O A;  4AFI A;  2JE5 A;  2PBY A;  3IX8 A;  4S2N A;  4BBV A;  3TRC A;  2QZ6 A;  4BBU A;  1K56 A;  4JF5 A;  1ES2 A;  3PAG A;  1K54 A;  3BJN A;  4KQD A;  4NEE D;  2O9A A;  1I2W A;  1BLP A;  1WA9 A;  4LCM A;  5DJT A;  5E43 A;  3JPU A;  4MEZ A;  4ID4 A;  4I39 A;  1T1C A;  4DXC A;  4LFU A;  2Y2N A;  2EWV A;  3N8S A;  4R38 A;  4DMZ A;  4EBL A;  4O01 A;  5HX9 A;  5TGF A;  4PM8 A;  4RVA A;  2PHY A;  4LRY C;  4R3A A;  1S67 L;  2WAF A;  3VP0 A;  1MKI A;  1OT9 A;  4ZJ1 A;  5U47 A;  2Y91 A;  5I94 A;  2WKI A;  3FZC A;  5J3W A;  4II7 A;  5HDD A;  3BFG A;  3PAE A;  2H0T A;  3PYP A;  5E2G A;  5FI6 A;  4NXF A;  5EPH A;  4R3J A;  4LGW A;  2W3F A;  5EUA A;  2RL3 A;  4BEN A;  1G6O A;  3NI9 A;  4MCW A;  3MKF A;  1PWD A;  1IYS A;  4QJG A;  3BQ8 A;  1SKO A;  3VP4 A;  2DNS A;  1GA0 A;  1UWN X;  1YMX A;  5IS1 A;  4GD8 A;  3QNC A;  2P04 A;  2X71 A;  3UPO A;  1SHV A;  2L1M A;  3UPN A;  3TW8 A;  3OZH A;  2A2L A;  5E2F A;  2X01 A;  3EOI A;  5FQK A;  1OTD A;  3H9W A;  3OCN A;  5DTS A;  4U0T A;  1OTA A;  1AXB A;  1K38 A;  4KQR A;  3O87 A;  2XQZ A;  5HL6 A;  4OH0 A;  5HPI A;  3BEC A;  5F82 A;  2WUQ A;  5FQM A;  5IU1 A;  4JLF A;  4ME4 A;  1OTI A;  2Y2Q A;  1KE0 A;  3LID A;  5GL9 A;  2EXA A;  1VM1 A;  4GS9 B;  3GDI A;  5FDH A;  4E3N A;  1N4O A;  5HSQ A;  2VGL M;  1FR6 A;  2JKT I;  3O5Y A;  2NUT C;  3T4O A;  3ITA A;  4NK3 A;  1GA9 A;  1DRM A;  3CIT A;  3MZF A;  2K2N A;  3E98 A;  2B5R A;  2G7U A;  4GHI B;  4FCF A;  2M7V A;  2HJ9 C;  4HJ4 A;  3CMZ A;  1D7E A;  3GEC A;  4R0Q A;  2FH5 A;  3I7J A;  4R4S A;  1LI9 A;  1PW8 A;  2YKH A;  2Y2I A;  4MBK A;  4JPM A;  2PU2 A;  1LL8 A;  2EFU A;  2JHE A;  3ZCZ A;  2EX6 A;  5HFO A;  3VE3 A;  2VLG A;  4U0X A;  1PIO A;  5EM0 A;  1VQQ A;  2IWD A;  1QMF A;  1MWU A;  1LHY A;  3IXB A;  4UA9 A;  3MQQ A;  5HAQ A;  3IWI A;  2XH9 A;  1XJ2 A;  1JTD A;  3ZNY A;  2OAQ 1;  3N8L A;  1K55 A;  5CXW A;  2DRW A;  1YQS A;  5J8X A;  3Q7V A;  4LPZ A;  5DVA A;  5DF7 A;  1HD8 A;  5KSH A;  2HF6 A;  3LIE A;  4UEY A;  2YKF A;  3EQU A;  5EE8 A;  1JWZ A;  2UV0 E;  1A0K A;  1NLY A;  3ZG9 B;  1YSP A;  4FD8 A;  3IBR A;  1ZHH B;  4N92 A;  5DJU A;  3NHQ A;  3F1P A;  2ZJ9 A;  4JGQ A;  3SW1 A;  3NJA A;  1KDS A;  1G6A A;  2JKT M;  5EVL A;  2XGN A; 
#chains in the Genus database with same CATH homology
 2IA2 A;  3PXP A;  2JN7 A;  3CUE A;  3HCY A;  1VB6 A;  3B33 A;  4GW9 A;  4EQ1 A;  2VV7 A;  3UE6 A;  4F3L A;  1UWP X;  5J7E A;  2PR5 A;  1EW0 A;  2J3T D;  4CLC E;  4LLO B;  5TBM A;  3TE8 A;  2OAP 1;  4DJ3 A;  2B18 A;  3NOU C;  4L9F A;  3EEA A;  1H8M A;  3VV4 A;  4BWI A;  2VKS A;  4I3I A;  3UB7 A;  2LB5 A;  3OLO A;  3S7N A;  3MQO A;  4L9E A;  2VX8 A;  2CMN A;  4KUO A;  4H6J B;  5HWT A;  2PD8 A;  2L0W A;  3A0V A;  1LSW A;  4LRX C;  2ZMF A;  1ODV A;  1V9Z A;  3CI6 A;  3HJK A;  3PBS A;  5TBM B;  3D3O A;  1N9N A;  5LBR A;  3MR0 A;  3R4K A;  4WUJ A;  4G3K A;  4CLC D;  2VZW A;  3KSH A;  2BAS A;  2QJ5 A;  2O0Y A;  3D72 A;  1DP6 A;  5HZH A;  3JVV A;  3CAX A;  2GX5 A;  3BQA A;  4PKY G;  4YOF A;  3LI9 A;  2D02 A;  3IS2 A;  5F5Y A;  1KOU A;  1LSX A;  3KSF A;  4M4X A;  1G28 A;  2GZA A;  4I3A A;  2NUP C;  2W1T A;  2FZ0 A;  4Z1W A;  1MC0 A;  4OOL A;  4OOM A;  3R7W A;  5HD3 A;  1W63 M;  4G3V A;  2Y8H A;  2MJ6 A;  3LR3 A;  2W3H A;  1T19 A;  4GJ4 A;  4HQA A;  4HP4 A;  3EGD C;  3LUQ A;  3R7W B;  2Y79 A;  3K3D A;  1V9Y A;  4YNR A;  3EEH A;  2W3G A;  5DFY A;  3MFX A;  3ZYT A;  2QHK A;  3FPW A;  1S1Z A;  4WEL A;  4IUH A;  3IS2 B;  3G6O A;  1W63 Q;  1S1Y A;  4UQI S;  1NRJ A;  4Y2F A;  4B93 A;  5DFX A;  3FC7 A;  2JKR I;  1IFQ A;  4HNB A;  4HJ3 A;  4CLC B;  1XFQ A;  3EGX C;  3PR6 A;  2VEA A;  3F1N B;  2JKR M;  2GJ3 A;  4EUV A;  3LIF A;  3PBO A;  2P7J A;  4I3J A;  1N9O A;  2XRO A;  2I9V A;  2ZBB A;  5DKL A;  1TS8 A;  2J80 A;  4HOI A;  1YSQ A;  1S66 L;  3ZQ5 A;  4JGO A;  5L8M A;  3LI8 A;  2L4R A;  2ZOI A;  4HI4 A;  5HPF A;  1ZTU A;  3C2W A;  1JNU A;  4EES A;  1GSV A;  3K2N A;  2V0U A;  3E4O A;  4Q0I A;  3T4K A;  3ULF A;  4H6J A;  1MZU A;  1NLZ A;  3T4L A;  3UB9 A;  3UB8 A;  4EEU A;  2J3T C;  4CLC C;  4ETX A;  3KYZ A;  4WEJ A;  3BY8 A;  3FPV A;  3PBT A;  1N9L A;  3LR5 A;  4JGR A;  4PHT A;  2K31 A;  2OWJ A;  2W0N A;  4O0P A;  3EQV A;  5HDS A;  4IUK A;  1T18 A;  3A0R A;  3S7P A;  4QPR A;  5F68 A;  1S4S A;  4NXG A;  2A24 B;  2WKP A;  4BBT A;  3F1O A;  4GHI A;  2PYR A;  3E4Q A;  4FOF A;  4ARZ A;  5HDC A;  4EU0 A;  1P9W A;  3KO6 A;  5KIZ A;  2K7S A;  4EEP A;  3V67 A;  1GSW A;  4I5S A;  2VJW A;  4WL9 A;  4RQ9 A;  3MMH A;  4WLA A;  2W3D A;  4KQO A;  2O9B A;  3LYX A;  4LRZ E;  1LSV A;  4FSF A;  4AFI A;  2W3E A;  5K5B A;  1T1B A;  4Y3I A;  4BBV A;  3TJZ C;  3TRC A;  2V0W A;  4BBU A;  5FL3 A;  3H82 B;  1UGU A;  3BY9 A;  3BJN A;  4KQD A;  4NEE D;  2O9A A;  2B02 A;  1WA9 A;  1XJ3 A;  3KYQ A;  5DJT A;  3OOV A;  3E0Y A;  4I39 A;  3T50 A;  3UE3 A;  4WN5 A;  1T1C A;  2HV1 A;  1OJG A;  2EWV A;  2XSS A;  3BW6 A;  2D01 A;  3U2A A;  3P01 A;  3UMD A;  4R38 A;  4DMZ A;  4O01 A;  3H7W B;  4MDZ A;  3EWK A;  2PHY A;  4LRY C;  4R3A A;  1LT0 A;  1S67 L;  2EA9 A;  4PAU A;  3F1O B;  1OT9 A;  2QWS A;  1H3Q A;  4HIA A;  2ZMV A;  4YWZ A;  2ZOH A;  4NXB A;  2O99 A;  5CX7 A;  2XRN A;  1XJ6 A;  5TJJ A;  5J3W A;  3VE4 A;  1TS6 A;  2W1T B;  4II7 A;  5HDD A;  1F9I A;  4MN6 A;  1TF1 A;  4HY8 A;  3BWL A;  2KDK A;  3VOL A;  3MJQ A;  3PYP A;  2QJ7 A;  4O8G A;  4WEK A;  3KX0 X;  4IHQ A;  4NXF A;  3OBF A;  2W3F A;  4JGP A;  4MN7 A;  4EXO A;  1G6O A;  2H28 A;  4NXE A;  1YAX A;  4L9G A;  4MCW A;  5I5L A;  2OOL A;  4ARZ B;  1F5M A;  3BQ8 A;  2A24 A;  4GCZ A;  5AJG A;  3B42 A;  1UWN X;  2WKQ A;  4ZRR A;  3T4Q A;  5IS1 A;  5MC7 A;  3UME A;  2P04 A;  4GLQ A;  3W2Z A;  2PYP A;  4IJG A;  2VA0 A;  2L1M A;  2KX6 A;  5HD5 A;  2XA7 S;  1X0O A;  3IBJ A;  4P6Z M;  1T1A A;  4K08 A;  2Z6C A;  3TW8 A;  1YKD A;  4E04 A;  2A2L A;  3A0S A;  3EOI A;  1NWZ A;  4R70 A;  3PBR A;  1OTB A;  1OTD A;  3H9W A;  5A8B A;  3OCN A;  1OTA A;  4BMW A;  3JVU A;  2KLI A;  3NOP C;  2O9C A;  4Q0J A;  5F69 A;  5HL6 A;  4UQI M;  2Z6D A;  3T4J A;  5HPI A;  5DKK A;  3LR4 A;  4HJ6 A;  1BYW A;  3C8C A;  3LIC A;  5IU1 A;  2VV8 A;  5J4E A;  2HGV A;  1P0Z A;  4KUK A;  3T4S A;  3UB6 A;  4CLC A;  1XJ4 A;  3KSI A;  4R6L A;  4Q0H A;  2HJE A;  4ME4 A;  4BJP A;  1OTI A;  2VGL S;  2KOI A;  3LID A;  4GS9 B;  2DMW A;  3GDI A;  1Y28 A;  4WF0 A;  5AVF A;  5HSQ A;  2VGL M;  2JKT I;  3FG8 A;  3O5Y A;  4HHD A;  2NUT C;  4HH2 A;  4GS9 A;  3T4O A;  1TD5 A;  3C30 A;  1DRM A;  3LIA A;  3CIT A;  4L0L A;  2V1B A;  3PBN A;  3DBA A;  2EWW A;  2K2N A;  3E98 A;  3MF0 A;  1P97 A;  2G7U A;  4GHI B;  2M7V A;  2XA7 M;  1VHM A;  4EW7 A;  2HJ9 C;  4HJ4 A;  2INW A;  3OCL A;  3MXQ A;  2QYB A;  1D7E A;  2J3W A;  3C38 A;  3GEC A;  2FH5 A;  3PBQ A;  1P9R A;  3LR0 A;  2P08 A;  1MKM A;  3CUE C;  3H82 A;  3RTY A;  4DJ2 A;  2V1A A;  1S4R A;  2YKH A;  1GSX A;  4G3W A;  3RH8 B;  4I38 A;  2M7U A;  3ICY A;  1TS7 A;  4PKY A;  5HWW A;  4MMN A;  5IT5 A;  1LL8 A;  2JHE A;  5HWV A;  3PHY A;  3VE3 A;  2VLG A;  4HP9 A;  2OWH A;  3CWF A;  3K3C A;  4MN5 A;  3F1N A;  3RFB A;  4ETZ A;  4EET B;  4B9O A;  5G4Y A;  3MQQ A;  2W1R A;  1OT6 A;  1OJ5 A;  1DP8 A;  3S7O A;  1OTE A;  1XJ2 A;  2GNX A;  4Y5F A;  2OAQ 1;  1XFN A;  5AVE A;  5G4Z A;  3F1P B;  3KSG A;  5EFW A;  3P7N A;  4HH3 A;  1OPX A;  4LPZ A;  2VV6 A;  2LB9 A;  3LFV A;  2QKP A;  5KSH A;  4XT2 A;  2HF6 A;  4F3L B;  3CLO A;  3LIE A;  3HJI A;  1F98 A;  4UEY A;  3NOT C;  2YKF A;  2W27 A;  4EER A;  2PR6 A;  2V9A A;  3EQU A;  4NKP A;  4XT2 B;  2R78 A;  2PD7 A;  1NLY A;  2M1C A;  1YSP A;  3B47 A;  5F6A A;  1DP9 A;  5DF9 A;  3S7Q A;  3H7W A;  1D06 A;  4P6Z S;  3IBR A;  1TS0 A;  4CQH A;  1ZHH B;  1IOU A;  5DJU A;  1STZ A;  5C5K A;  3NHQ A;  3F1P A;  4JGQ A;  3SW1 A;  4DN0 A;  3NJA A;  3LIB A;  3MQ0 A;  2WKR A;  2JKT M;  3OC2 A;  2PT7 A;  2PDR A;  3E4P A;  3T4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...