5J7EA

Heag pas domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
TNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium voltage-gated channel subfamily H member 1
publication title Crystal Structure of PAS domain from the hEAG Potassium Channel
rcsb
source organism Homo sapiens
total genus 31
structure length 109
sequence length 109
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5j7eA00
2INWA 1JNUA 4HQAA 3LI9A 2VLGA 5HDCA 4LRYC 3IBRA 3MR0A 3G6OA 4LRZE 3A0SA 1TS6A 3LIEA 2PYRA 2QKPA 3BY8A 4EQ1A 5F5YA 3T50A 5HSQA 1XJ3A 1WA9A 2H28A 2WKPA 3A0RA 5DKKA 5IS1A 3H82B 3EWKA 1N9OA 2V0WA 5AVEA 2V1BA 1GSXA 3UB7A 4HP9A 4I3AA 2W27A 4RQ9A 1S67L 5G4ZA 1V9ZA 3H82A 1ODVA 4HJ6A 2PD7A 1KOUA 4I5SA 2PR6A 5J4EA 2Z6CA 3MQQA 3C8CA 3B33A 2L0WA 4PKYG 4GHIB 4HY8A 3H7WB 2YKHA 3UB6A 1Y28A 1LSWA 4NXGA 5EFWA 4JGOA 5HWTA 5DJTA 5G4YA 4WN5A 3ZQ5A 4M4XA 4GHIA 3CAXA 3H7WA 1LSXA 3MQOA 3E4PA 4I3IA 1OTDA 2PYPA 2V0UA 4KUOA 3NJAA 1TS0A 1TS7A 2ZOHA 5J3WA 3A0VA 4WLAA 4MN6A 3OLOA 3IS2B 2VV7A 4I38A 2W0NA 2OWHA 3GDIA 4KUKA 4E04A 4K08A 1DP6A 4YWZA 1LSVA 2EA9A 3IS2A 2J80A 5AVFA 3LIAA 3NOTC 2GJ3A 4BBTA 3MXQA 4DJ2A 4HJ4A 3F1PB 4HHDA 1N9NA 3GECA 2R78A 3E4OA 3HJKA 4I3JA 1OTAA 4PKYA 4WUJA 4HP4A 3F1PA 3UB9A 4NXFA 1F98A 1BYWA 4HI4A 1XJ6A 3MFXA 3UE6A 4WL9A 1GSVA 1P0ZA 3LYXA 4F3LB 3K3DA 2JHEA 3K3CA 1D7EA 2YKFA 3BWLA 3E4QA 5F69A 3FG8A 5F68A 2BASA 4F3LA 2QJ7A 4XT2B 2KDKA 1XFQA 1F9IA 1XJ4A 3RTYA 4JGQA 3VOLA 3NHQA 4EXOA 3D72A 4HH3A 1T19A 3KX0X 1NWZA 4L9GA 4XT2A 4BBUA 1VB6A 1LT0A 1T1BA 1X0OA 4WF0A 5HZHA 2PDRA 1MZUA 2B02A 2JN7A 2ZBBA 1OJ5A 4KQDA 1OT6A 2D01A 4R70A 1S66L 4EESA 4GCZA 2OOLA 4NXBA 1T18A 4LLOB 4L9FA 2WKQA 5DKLA 4L9EA 4MN5A 3CLOA 4NXEA 3UMDA 4BBVA 4EETB 1XJ2A 1OTEA 1T1AA 3LIFA 1S4SA 2OWJA 1GSWA 2K7SA 2A24B 5F6AA 3CWFA 1OJGA 5TBMB 5HD5A 3MJQA 1TS8A 2A24A 3PYPA 4I39A 3HJIA 1XFNA 2WKRA 4EEUA 1G28A 1LL8A 5TBMA 1S1ZA 2P7JA 3F1OB 5HD3A 4EEPA 5HDSA 4R3AA 4EERA 2L4RA 1N9LA 3LI8A 4HNBA 3F1OA 4HJ3A 3P7NA 5KIZA 3LUQA 1OT9A 4HIAA 1S4RA 2CMNA 3FC7A 3UB8A 5A8BA 4JGPA 1EW0A 3PHYA 4HOIA 4LPZA 4DJ3A 3BY9A 4EW7A 2VV6A 2ZOIA 5HDDA 3RH8B 3LIDA 3H9WA 1DP8A 2V1AA 2HV1A 4H6JB 1UWPX 2QHKA 3ULFA 2VV8A 1UGUA 1S1YA 1DRMA 4H6JA 3LIBA 1D06A 2I9VA 4JGRA 2KX6A 1V9YA 3NOPC 3UMEA 1OTIA 2VEAA 3EEHA 5IU1A 4R38A 3ICYA 4GW9A 2PR5A 3F1NB 2QJ5A 2PHYA 2D02A 3LICA 4R6LA 5J7EA 4GS9B 1UWNX 2QWSA 5HWVA 3F1NA 1OTBA 1DP9A 4LRXC 5I5LA 5HWWA 1P97A 3SW1A 2M1CA 3VE3A 2L1MA 2V9AA 4GS9A 5DJUA 1T1CA 3VE4A 3C2WA 4B9OA 3NOUC 2Z6DA 4HH2A 2PD8A
chains in the Genus database with same CATH superfamily
2GNXA 2O99A 2K2NA 1H5XA 1AWIA 1IKGA 5JYOA 1ZHHB 2FH5A 3B47A 5TJJA 1GA9A 2VK3A 3LI9A 1XGIA 2GX5A 4Z9QA 3IBRA 1I2WA 5HW3A 1K6SA 4DKIA 4LRZE 3A3JA 1TS6A 3QP1A 3R7WB 5I94A 2WGWA 5E43A 3BY8A 1YMSA 3CI6A 4E3MA 4RX3A 1WA9A 5IS1A 2WKEA 3IWQA 1E3UD 3HUMA 3ITBA 3UB7A 2W27A 4FTXA 4MLLA 2QYBA 5G4ZA 1YM1A 3H82A 2OLUA 1EROA 3HCYA 3RXWA 4X56A 4I5SA 3ZCZA 4PMAA 2JCHA 3PAGA 2DRWA 3GMWA 1F5MA 1G5UA 4PKYG 2EX9A 4GHIB 2P9VA 3H7WB 1LHYA 2ZC7A 2YKHA 3BLSA 4FUWA 3S7OA 5FAPA 3IH9A 2BG1A 3M2JA 4X6TA 2Y8HA 1LSWA 3N8SA 4NXGA 3T4QA 3IT9A 2J3TD 3SH7A 5G4YA 4KG2A 3VP2A 1NYMA 5FI6A 4M4XA 2PRFA 5CGXA 3E4PA 1SDEA 2BTFP 4UA9A 1A0KA 2PAVP 1OTDA 4KUOA 2HP6A 2XGNA 3SS5A 4UA6A 2ZOHA 4MN6A 2VV7A 2W0NA 5M19A 3GDIA 5L8MA 1VEUA 3QP6A 1GHIA 4RVAA 1LSVA 2WUQA 3IS2A 2E8JA 5AJGA 4KZ7A 3WS2A 2XQZA 3IF6B 3SZTA 1W7FA 2H10A 3LGOA 5IHVA 2Y2MA 1FCNA 5LBRA 4JF6A 5CEDA 3HJKA 1KGFA 1K38A 1PWDA 1CEFA 4E3LA 2V20A 4FH4A 2ZM8A 1BYWA 5FI7A 1O7EA 1XJ6A 1L0GA 1BLPA 1P0ZA 3ZHHA 4QY6A 4LCMA 3LYXA 1YQSA 1RGYA 2A3UA 3VP3A 2QPNA 3ZG5A 3IX8A 1HVBA 4GLQA 1IKIA 3FG8A 5F68A 4GN2A 2VGLS 5M1AA 4F3LA 2PT7A 2KDKA 3HBRA 1XJ4A 5EVIB 4HH3A 4Y0UA 2EFXA 3VFHA 1NWZA 1LI0A 3PBSA 4R4SA 4OPZA 1JWZA 4XT2A 4BBUA 2ZM2A 5KMWA 5TR7A 1MZUA 4IEDA 4WELA 2JN7A 2ZBBA 1BZAA 1ONHA 3G4PA 4WMCD 4KQDA 2D01A 3V3RA 3M6BA 4ZRRA 4EESA 5FAOA 1KDWA 2H5SA 3QHYA 4O7DA 1SKFA 4EWFA 4BQMA 3FKVA 3T4LA 2WKQA 3ZNTA 3CLOA 3KYQA 4II7A 1ZG4A 4MCWA 3Q81A 5L07A 1FOFA 1GCEA 4EETB 1T1AA 3DWKA 2ZMAA 3IF5A 1KVLA 1BULA 3UPOA 4D60A 2VZWA 4ETXA 4Q0JA 4PHTA 5F6AA 2HDQA 1NRJA 5FASA 3CWFA 3IWIA 2VGLM 2B18A 3MJQA 3L9KA 5GL9A 2A24A 3HJIA 1ERQA 1XFNA 4PM7A 1BSGA 2C5WB 1SHVA 2J7VA 1NLZA 5HD3A 5FEGA 3HREA 4R3AA 4OQIA 4MBKA 4UEYA 4C75A 2Z2MB 5GHZA 4Y2FA 3LI8A 4HNBA 3UPPA 3HLDA 1ZTUA 1NYYA 4HJ3A 1GA0A 1W8QA 3P7NA 2EX6A 4X68A 5KIZA 1NZUA 3LUQA 1HD8A 4G3WA 2ZC6B 3TW8A 2RL3A 2JKTI 5AQ7A 1FR1A 5FEFA 2GZAA 2VV6A 2ZOIA 2WK0A 3CUEA 5HDDA 3RH8B 3H9WA 5A93A 2X71A 2WKIA 1DJAA 5CECA 4OQGA 2V1AA 5F82A 3O87A 2EXAA 3P01A 4CQHA 2Q0OA 1UGUA 1S1YA 3MZFA 4H6JA 1Q2QA 4PM5A 5A92A 4DE3A 4RA7A 2EX8A 1V9YA 3CJMA 1IEMA 1W63M 3QNCA 1BLCA 3NOPC 3UMEA 4NETA 3SOIA 4G3VA 3MKFA 2Y2IA 1H3QA 2XFTA 2PR5A 3F1NB 4EV4A 2ZD8A 5GLDA 5A90A 3W4OA 3NECA 2WKHA 3BFGA 2R9WA 1CI8A 1H8YA 2D02A 4NK3A 3C4OA 5HWWA 3SW1A 1YLZA 5CGSA 5DTSA 3BECA 4O0PA 4YFMA 4FH2A 2X01A 4GS9A 4HEFA 2QMIA 1YLWA 3C5AA 1XPBA 2PD8A 2INWA 1QMFA 3NIAA 5DF9A 2FFFB 4U0TA 4HQAA 3W8KA 3N8RA 3MFDA 3DW0A 2KOIA 3LEQA 3MR0A 4YNRA 5EOOA 3S22A 4GZBA 1K6RA 3A0SA 4CLCB 3LIEA 5E2GA 4X1MA 4X1LA 3NC8A 3PBNA 2PYRA 2QKPA 4QHCA 4EQ1A 3VMAA 3MKEA 4ETZA 1XJ3A 3R7WA 1K56A 4DE2A 1H8ZA 2WKPA 4B88A 2DNSA 2V0WA 4S2OA 2V1BA 3IHBA 1PZOA 4RQ9A 4Y0TA 5FL3A 3SS3A 1V9ZA 3A3FA 1VM1A 2WYXA 3T4KA 1TEMA 4WBGA 4G3KA 1IFQA 1YLYA 2W1RA 1PRQA 2PR6A 4XUZA 5JYPA 3T12B 2Z6CA 3C7VA 5U47A 4IHQA 1VQQA 3B33A 1ERMA 1CQAA 4QB8A 4LV3A 5FATA 4B4ZA 3JVUA 3ZG7B 1Y28A 3OZHA 2Y2NA 3QP8A 4P6ZM 2ZQDA 5EFWA 4JF5A 4C6YA 5DJTA 3IXGA 3ZQ5A 4GHIA 2OAP1 3G30A 3H7WA 1LSXA 3MQOA 4S2IA 3HVFA 2IWCA 1ACFA 2C6WB 4HESA 5GHYA 4RYEA 4KQRA 4WZ4A 1G6AA 5CGWA 1W63Q 5F83A 1TS7A 5C5KA 3RXXA 3FYZA 5A91A 4I38A 2OWHA 2KLIA 3NY4A 4E04A 4PM9A 4X69A 3CMZA 5FQ9A 4LENA 4R0QA 3LIAA 3FPVA 2G2WA 4OVDA 2GJ3A 3UE1A 2VGJA 4BBTA 2XDMA 5HAQA 2ZC5B 3D9YA 5CXWA 2B95A 3IXHA 5HL1A 4GOGA 2J3TC 2R78A 3I7JA 3IF6A 2B5RA 5DFYA 1OTAA 3T1SA 4Q8IA 4HP4A 4CJNA 4WM9A 1KE0A 3EEAA 3UB9A 1RGZA 4K0WA 3BFFA 1Y54A 3QP5A 3UE6A 4JPMA 1MC0A 3O5YA 1SCWA 1F2KA 1W5DA 4DDYA 3JVVA 2JHEA 3K3CA 3BJNA 4YINA 3ITAA 1BTLA 3E4QA 2NUPC 5FSRA 3Q7VB 4S2NC 5F69A 3KYEA 2OAQ1 3RFBA 4JGQA 2Q9NA 3VOLA 1T19A 4Y0OA 3GV9A 3KX0X 2Y2KA 3ZFZA 4WZ5A 4DRTA 1K57C 3BW6A 3FPWA 2XFSA 3HLFA 4IBRA 5EVIA 1T1BA 4LCLA 1ESUA 2PDRA 2B02A 4UA7A 5DF7A 3SS4A 1SKOB 4LV2A 3TSGA 4BD1A 3EGXC 1TDLA 1S66L 1YLJA 2R9XA 4KZ4A 2Y2QA 1ZG6A 2XF3A 3AGFA 4L9EA 1OMEA 1NY0A 4NXEA 2JKFA 4S2LA 3EQVA 3IQAA 2A49A 1ES4A 1I2SA 4QJGA 2DMWA 2RCXA 2UWXA 2J3WA 3PBRA 3S1YA 2FFYA 1GSWA 4S2KA 2XLNA 3ZG8B 3GSGA 4MBFA 1WYBA 4F94A 1L0EA 3UN7A 4N1HA 2HGVA 3Q7ZA 3ZGAB 2HPBA 5HD5A 2ZQ8A 1TS8A 1M6KA 4PAUA 3EQUA 5AQ9A 2WKRA 4PM8A 4OKPA 3WS0A 5BOHA 2VA0A 4FOFA 1LL8A 3LO7A 1S1ZA 2Y2LA 3F1OB 4KQQA 1PNEA 5CTMA 2XEPA 2L4RA 2O9BA 3UDIA 4LFUA 1N9LA 3LFVA 5KSCA 5CHUA 2Z2LB 3E0YA 2M7VA 2JC7A 2Y2PA 1OT9A 3BQ8A 3SH8A 3T1RA 2CMNA 3FC7A 2O9AA 5A8BA 4JGPA 3P98A 3PHYA 4HOIA 3BY9A 1VETB 4DF6A 3LCEA 3DTMA 3SH9A 2FZ0A 2Y2JA 5CHMA 3G34A 4FCFA 4N1XA 1PZPA 1HLUP 5K5BA 2W3DA 1DP8A 3IH8A 4BD0A 2PU2A 4BL2A 4Y3IA 1KE4A 1PIOA 4L0LA 4ZJ1A 3T4OA 3LR5A 5EV0A 3S7QA 3VOYA 1K56D 3MXSA 1DRMA 1SZVA 4MEZA 3LIBA 3MZDA 1IYSA 1P9WA 1PW8A 3MZEA 1SDNA 1XKZA 1K55C 1U60A 1KE3A 2Y2HA 3PXPA 1OTIA 2HJ9C 4XUXA 3G31A 2NUTC 3DTKA 3PR6A 1L0FA 1ZKJA 4P85A 2QJ5A 1J9MA 3OBFA 1H8MA 4R4RA 2G7UA 1LI9A 2WADA 2VGKA 5E2EA 1JWVA 3IF6C 4OLGA 5HWVA 3F1NA 5EPHA 5I5LA 3V67A 3BEBA 2Y79A 1P97A 4GNUA 1ES5A 2ZJ9A 2H0TA 3VE3A 2Y2OA 2J8YA 4LV1A 4EUVA 2Y59A 2V2FF 5DJUA 1T1CA 2Z6DA 3N7WA 2ZQAA 4JBFA 4EBNA 1TDGA 3HLCA 4BMWA 4K91A 4IUKA 1JNUA 3PBOA 3IWOA 4OOLA 1CEGA 3G35A 5HDCA 5TFQA 4LRYC 5MC7A 4ARZB 1STZA 1K4EA 2J9PA 4N92A 3E2KA 5L2FA 5EVLA 3WWXA 2HP9A 3O86A 5CERA 4KG5A 1BUEA 1YAXA 3PBQA 5HSQA 4ZAMA 4CLCA 1K54A 3A0RA 5DKKA 3QP4A 3EWKA 1N9OA 4ESPA 1GSXA 3IX4A 2XD5A 1YSQA 2Y4AA 1ODVA 5TGFA 4EBLA 1LLBA 3OPLA 3DWZA 3RJUA 5DTTA 2BLSA 3VP1A 4X25A 3C8CA 3G32A 2WAFA 1KGGA 2L0WA 3AGDA 4UAAA 1WE4A 4OOYA 3UB6A 1S0WA 4Y13A 1FSYA 1CK3A 5KZHA 1EWZA 5HWTA 4JGOA 3K2NA 1N4OA 5HARA 1IYQA 4I3IA 2WZXA 3V50A 3GQZA 2ZC3B 1HTZA 5GLCA 2PYPA 2V0UA 1NLYA 5FA7A 4MNRA 5EVID 1PW1A 3A0VA 3D3OA 3UB5P 3OLOA 4PPRA 4WEKA 1XA1A 1YLTA 1PFLA 3UNWA 1DP6A 4YWZA 2JKTM 3CITA 2EA9A 3T1QB 3MBZA 3G2YA 5CX7A 1WYCA 4P6ZS 4R3JA 5AVFA 5HPIA 3UPNA 2V1ZA 3C38A 3ZDJA 2J9OA 3M6HA 4CLCE 4DJ2A 2V8FA 1IELA 4IVIA 4P6BA 4BWIA 3F1PB 3LEZA 4HHDA 3HUOA 3GECA 4E6XA 3AGEA 2EWVA 2LB5A 3OCLA 5FQKA 3NULA 3E4OA 4R3BA 4PKYA 3HLBA 2PBDP 3UY6A 3ZG9B 5HAIA 4Y5FA 4E3IA 4DE1A 2OLVA 1CI9A 1F98A 1BT5A 2P04A 4WYYA 4P0MA 3VOZA 4OH0A 5EVEA 5CHJA 3QNBA 1G6OA 2HJEA 5F1GA 3LR4A 4EUZA 1YSPA 1DJCA 1HZOA 3V3SA 3C4PA 2XR0A 3K3DA 1W79A 3T4SA 2YKFA 1MXOA 1FQGA 1KVMA 2BASA 4ZJ2A 4U3TA 1F9IA 3IXBA 3RTYA 3NHQA 3VSKA 3N6IA 3NDEA 4KZ8A 3JPUA 3A3EA 3Q7VA 2W1TB 3TG9A 2Y55A 4L9GA 4JXSA 3W2ZA 1D1JA 4UQIM 1LT0A 5FQJA 3VP4A 4WF0A 5HZHA 1FCOA 1O07A 1FSWA 1OJ5A 1OT6A 1MKMA 3ZVTA 2OOLA 2HDSA 4NXBA 4YOFA 1SKOA 1LL9A 1I5QA 5DKLA 4MN5A 4DDSA 5FDSA 2ZL1B 4BBVA 3D4FA 1XJ2A 1OTEA 2ZQ9A 3LIFA 3WRTA 1OPXA 3W4QA 4KZ3A 1FR6A 3BRMA 3V39A 5EUAA 4K0XA 2JBFA 3OCNA 1JTGA 1ZC2A 3UE3A 5F1FA 4O8GA 4OOMA 5TBMB 1TVFA 1FIKA 3R4KA 3A3IA 5FDHA 3CPTB 5HFOA 3CUEC 1N9BA 1G28A 4U0XA 2P7JA 3O88A 2IWDA 3OPHA 2X02A 4DXCA 3UDFA 5DTKA 3NI9A 2V8CA 4MMNA 1DY6A 3L7HA 4C3QA 4QWOA 5IT5A 3F1OA 2WZZA 1MPLA 3M2KA 4NKPA 4ZTKA 4NG2A 1CF0A 2ZQCA 3ZVWA 3U2AA 4DN0A 2AVXA 4HIAA 1PWCA 3NDGA 3UB8A 1IOUA 1EW0A 4Y7PA 4LPZA 4E3NA 1K0KA 4JXGA 4N9LA 1Q2PA 3FWLA 2XA7S 3LIDA 3W4PA 3PTEA 1P9RA 4GDNA 2HV1A 1VETA 2JKGA 3OC2A 1RP5A 3MMHA 3UDXA 1EI5A 4CLCD 2VV8A 3HL9A 5HL6A 4BL3A 2ZM0A 2OV5A 3E2LA 2XROA 1D06A 5CTNA 2I9VA 4JGRA 3DTEA 4OPYA 3LR0A 3Q1FA 5EM1A 4E3OA 2KX6A 4E6WA 4GD8A 4JF4A 4EBPA 1S6RA 2VEAA 4Z1WA 3EEHA 5IU1A 3ICYA 4ID4A 4JKTA 4GW9A 5CRFA 1BLHA 3OOVA 2ACGA 4E3JA 1E25A 2PHYA 4IBXA 3VSLA 1TD5A 4EU0A 5DVAA 4QPRA 5L10A 3ZYTA 4R6LA 4FD8A 5J7EA 1UWNX 5GLAA 5DF8A 1YKDA 2HDRA 4LRXC 4OONA 3HLWA 2W3FA 3KO6A 5J8XA 2M1CA 1PWGA 1XP4A 3ZNYA 3BM6A 4DXBA 2UV0E 1NJ4A 2OSUA 3HUNA 2P08A 2XA7M 3BYDA 3N4IA 4S2MA 3NOUC 5M18A 2IWBA 4HH2A 3KSHA 5D3OA 2W3GA 2Q9MA 4ME4A 3TJZC 3WS4A 2WGWB 1AXBA 2VLGA 3VV4A 4D2OA 4GD6A 3VFFA 2K31A 3B3XA 1L3LA 3G6OA 1C3BA 4JXWA 3S4XA 3IXDA 4OQ0A 4XXRA 2QZ6A 3GVBA 5F5YA 4B4XA 3NBLA 3T50A 3V5MA 4ARZA 4QD4A 4OLDA 4AFIA 2W3HA 1DJBA 2H28A 3MQ0A 3H82B 4KZ9A 1XX2A 1YT4A 5AVEA 1KDSA 5AQAA 3S7NA 3G2ZA 3TRCA 4HP9A 2JE5A 4I3AA 1S67L 3Q82A 1J3WA 4X53A 3HLEA 3A3DA 2MJ6A 2P9VB 4HJ6A 3FKWA 2PD7A 1KOUA 4QU3A 4GB7A 5J4EA 3MQQA 3GRJA 4IJGA 5EOEA 3FV7A 3N8LA 4HY8A 3P09A 1ES3A 4ZBEA 4R1GA 2DCFA 5FQQA 4MN7A 5L09A 1VHMA 2I72A 2E8IA 4WN5A 3CAXA 4O01A 4MBHA 2HZ5A 3CHWP 2H0YA 1JWPA 4KZ6A 2EFUA 2ZMVA 4GKUA 2Y91A 3NJAA 1TS0A 1VEUB 3CG5A 4DMZA 2VJWA 5E2FA 5J3WA 1FILA 4R23A 4WLAA 4ZDXA 3IS2B 1PYYA 3LR3A 3BFEA 1MWTA 4GJ4A 4RX2A 4KUKA 4IUHA 1MY8A 4K08A 2J80A 1GHMA 3NOTC 3MXQA 5DFXA 4HJ4A 1L2SA 5HX9A 5EECA 1N9NA 5FAQA 4BENA 5GLBA 3CZDA 4Q0IA 2VKSA 4I3JA 2WAEA 1E3UA 1ONGA 1JVJA 4WUJA 2XRNA 3E98A 3F1PA 4NXFA 4WZ5C 1FCMA 4HI4A 3U4LP 4HBTA 4JLFA 3MFXA 4Y17A 4WL9A 1E4DA 5EVIC 1QMEA 3TE8A 2ZQ7A 1GSVA 3DTIA 4M3KA 3C7UA 4F3LB 3LY4A 1D7EA 3BWLA 2W3EA 1BLSA 4OP8A 2HDUA 3GR2A 3BQAA 2QJ7A 4XT2B 1W8YA 1XFQA 4KZ5A 4IVKA 4EXOA 4KENB 3D72A 1IYPA 2PBYA 4HBUA 1K4FA 1JTDA 3C30A 3BLMA 2EXBA 3WS5A 4X55A 1VB6A 4GDBA 2EWWA 1IYOA 1X0OA 3FZCA 1XA7A 2W1TA 1MWUA 3BFDA 4KZAA 1MBLA 4R70A 2XH9A 4QY5A 3ZG0A 4S2NA 4GCZA 5E2HA 1T18A 4LLOB 1LL5A 2EX2A 2WGVA 4L9FA 2A2LA 3BFCA 4MDZA 3T4TA 3KSGA 3UMDA 1Y4OA 1K57A 5FQIA 4OQHA 2VX8A 5EM0A 1ALQA 2HP5A 4LV0A 1MWSA 2M7UA 3B42A 4Y15A 4OP5A 1S4SA 1YMXA 3ISGA 2ZL1A 2OWJA 4UQIS 4BLMA 2K7SA 2HF6A 2A24B 3IX3A 2JKRI 2PU4A 3OPPA 1NRFA 4S2PA 5HAPA 3WRZA 1OJGA 2XK1A 5EE8A 4H8RA 1XXMA 3EOIA 3PYPA 4I39A 4EEUA 4B93A 1RCJA 3O3VA 3MF0A 3PAEA 5G18A 5TBMA 5CEBA 3Q07A 3JYIA 2GDNA 4EEPA 5HDSA 3CPTA 4UHUA 3MSHA 1L0DA 4EERA 1GHPA 3KSIA 3MS6A 3DAVA 4E3KA 2CC1A 1PI4A 4DE0A 3EGDC 1K25A 5HPFA 1S4RA 1KGEA 3IHAA 2O0YA 1ESIA 1ES2A 4DJ3A 4EW7A 2Y2GA 1YLPA 1MKIA 1CJFA 3GTCA 4WMCA 3IBJA 4KZBA 1NXYA 3TOIA 5FQMA 4PM6A 4EQIA 4NEED 4A5RA 3HLGA 1MWRA 1TF1A 3KYZA 2ZMFA 4H6JB 1UWPX 1G68A 4Q0HA 1H0MA 5AQBA 1YPRA 2P74A 3QP2A 2QHKA 5FI2A 3ULFA 3UE0A 3VP0A 3WS1A 4FSFA 4N9KA 2JKRM 1Z6FA 4OPQA 4R38A 3DBAA 3KSFA 4JXVA 4KQOA 3LY3A 4P87A 4LGWA 2ZLYA 2XSSA 4KG6A 3MXRA 3LICA 3UO9A 4BJPA 2G2UA 4GS9B 1M40A 2QWSA 4S2JA 2LB9A 1OTBA 3T4JA 1DP9A 1PI5A 1XGJA 2XD1A 4OPRA 4CPKA 1NZOA 2IA2A 1K55A 3T1XA 2O9CA 3OPRA 4WEJA 5KSHA 2L1MA 2V9AA 5GHXA 3S7PA 3VE4A 2ZC4B 4CLCC 3C2WA 3NCKA 4B9OA 1K54C 1Z09A 2WGIA 4ZJ3A 3PBTA
chains in the Genus database with same CATH topology
2GNXA 2INWA 2O99A 4BMWA 2K2NA 2W3GA 5DF9A 4IUKA 1JNUA 3PBOA 1ZHHB 2FH5A 3B47A 4ME4A 4HQAA 5TJJA 3TJZC 4OOLA 3LI9A 2VLGA 3VV4A 5HDCA 2GX5A 4LRYC 3IBRA 5MC7A 4ARZB 1STZA 2K31A 2KOIA 3MR0A 4YNRA 3G6OA 4LRZE 3A0SA 1TS6A 3LIEA 3R7WB 4CLCB 3PBNA 2PYRA 2QKPA 3BY8A 4EQ1A 5F5YA 3CI6A 3T50A 4ARZA 1YAXA 3PBQA 4ETZA 5HSQA 4AFIA 1XJ3A 3R7WA 2W3HA 4CLCA 1WA9A 2H28A 2WKPA 3A0RA 3MQ0A 5DKKA 5IS1A 3H82B 3EWKA 1N9OA 2V0WA 5AVEA 3S7NA 2V1BA 1GSXA 3TRCA 3UB7A 4HP9A 4I3AA 2W27A 4RQ9A 1S67L 2QYBA 1YSQA 5FL3A 5G4ZA 1V9ZA 3H82A 1ODVA 3T4KA 2MJ6A 4HJ6A 3HCYA 2PD7A 4G3KA 1KOUA 1IFQA 2W1RA 4I5SA 2PR6A 5J4EA 2Z6CA 3MQQA 3C8CA 4IHQA 1F5MA 3B33A 2L0WA 4IJGA 4PKYG 4GHIB 4HY8A 3H7WB 2YKHA 3UB6A 3JVUA 3S7OA 1Y28A 2Y8HA 1LSWA 4MN7A 4NXGA 4P6ZM 3T4QA 1VHMA 2J3TD 5EFWA 4JGOA 5HWTA 5DJTA 5G4YA 3K2NA 4WN5A 3ZQ5A 4M4XA 4GHIA 2OAP1 3CAXA 3H7WA 4O01A 1LSXA 3MQOA 3E4PA 4I3IA 1OTDA 2PYPA 2V0UA 1NLYA 4KUOA 2ZMVA 3NJAA 1TS0A 1W63Q 1TS7A 4DMZA 2VJWA 2ZOHA 5J3WA 3A0VA 3D3OA 5C5KA 4WLAA 4MN6A 3OLOA 3IS2B 2VV7A 4WEKA 4I38A 3LR3A 2W0NA 2OWHA 4GJ4A 3GDIA 2KLIA 5L8MA 4KUKA 4IUHA 4E04A 4K08A 1DP6A 4YWZA 1LSVA 2JKTM 3CITA 2EA9A 3IS2A 5CX7A 2J80A 4P6ZS 5AJGA 5AVFA 5HPIA 3LIAA 3NOTC 3FPVA 3C38A 2GJ3A 4CLCE 4BBTA 3MXQA 5DFXA 4DJ2A 4HJ4A 4BWIA 3F1PB 4HHDA 1N9NA 3GECA 5LBRA 2EWVA 2LB5A 3OCLA 2J3TC 2R78A 3E4OA 3HJKA 4Q0IA 2VKSA 4I3JA 5DFYA 1OTAA 4PKYA 4WUJA 4HP4A 3EEAA 2XRNA 4Y5FA 3E98A 3F1PA 3UB9A 4NXFA 1F98A 1BYWA 2P04A 4HI4A 1G6OA 2HJEA 1XJ6A 3MFXA 3LR4A 3UE6A 4WL9A 3TE8A 1YSPA 1GSVA 1P0ZA 1MC0A 3O5YA 3LYXA 4F3LB 3K3DA 3JVVA 2JHEA 3K3CA 3BJNA 1D7EA 3T4SA 2YKFA 3E4QA 2W3EA 3BWLA 2NUPC 4GLQA 5F69A 3FG8A 5F68A 3BQAA 2BASA 2VGLS 4F3LA 2QJ7A 2PT7A 4XT2B 2KDKA 1XFQA 1F9IA 2OAQ1 1XJ4A 3RFBA 3RTYA 4JGQA 3VOLA 3NHQA 4EXOA 3D72A 4HH3A 1T19A 3KX0X 1NWZA 3PBSA 2W1TB 3BW6A 3C30A 3FPWA 4L9GA 4XT2A 3W2ZA 4BBUA 1VB6A 4UQIM 2EWWA 1LT0A 1T1BA 1X0OA 4WF0A 5HZHA 2PDRA 1MZUA 2B02A 2JN7A 4WELA 2W1TA 2ZBBA 1OJ5A 4KQDA 1OT6A 2D01A 4R70A 1MKMA 3EGXC 4ZRRA 1S66L 4EESA 4GCZA 2OOLA 4NXBA 1T18A 4LLOB 4YOFA 3T4LA 4L9FA 2WKQA 2A2LA 5DKLA 4L9EA 4MN5A 3CLOA 3KYQA 4MDZA 3T4TA 3KSGA 4NXEA 3UMDA 4II7A 4BBVA 4MCWA 3EQVA 4EETB 1XJ2A 2VX8A 1OTEA 1T1AA 3LIFA 2M7UA 3B42A 1S4SA 1OPXA 2VZWA 2DMWA 4ETXA 2OWJA 2J3WA 3PBRA 4UQIS 1GSWA 2K7SA 4Q0JA 2HF6A 2A24B 2JKRI 3OCNA 4PHTA 5F6AA 1NRJA 3UE3A 3CWFA 4O8GA 1OJGA 4OOMA 2HGVA 5TBMB 2VGLM 5HD5A 2B18A 3MJQA 3R4KA 1TS8A 3EOIA 2A24A 3PYPA 4I39A 3HJIA 3EQUA 4PAUA 1XFNA 2WKRA 4EEUA 4B93A 3MF0A 3CUEC 2VA0A 4FOFA 1G28A 1LL8A 5TBMA 1S1ZA 2P7JA 3F1OB 1NLZA 5HD3A 4EEPA 5HDSA 4R3AA 4EERA 3KSIA 2L4RA 4UEYA 4MMNA 2O9BA 1N9LA 4Y2FA 3LI8A 4HNBA 3LFVA 5IT5A 3F1OA 1ZTUA 4HJ3A 4NKPA 3P7NA 3E0YA 2M7VA 3EGDC 5KIZA 1OT9A 3LUQA 3BQ8A 3U2AA 4DN0A 4HIAA 4G3WA 5HPFA 1S4RA 2CMNA 3FC7A 2O9AA 3TW8A 3UB8A 2JKTI 4JGPA 5A8BA 1IOUA 1EW0A 2O0YA 3PHYA 4HOIA 4LPZA 4DJ3A 3BY9A 2GZAA 4EW7A 2VV6A 2FZ0A 2ZOIA 2XA7S 3CUEA 5HDDA 3RH8B 3IBJA 3LIDA 3H9WA 4NEED 1P9RA 5K5BA 2W3DA 1DP8A 1TF1A 3KYZA 2ZMFA 2V1AA 2HV1A 4H6JB 1UWPX 4Y3IA 4Q0HA 3OC2A 3MMHA 4L0LA 3T4OA 3LR5A 3S7QA 2QHKA 3P01A 4CLCD 4CQHA 3ULFA 2VV8A 1UGUA 1S1YA 5HL6A 4FSFA 1DRMA 4H6JA 3LIBA 1P9WA 1D06A 2XROA 2I9VA 4JGRA 2JKRM 3LR0A 2KX6A 1V9YA 1W63M 3NOPC 3PXPA 3UMEA 1OTIA 2HJ9C 2VEAA 4G3VA 4Z1WA 3EEHA 5IU1A 4R38A 2NUTC 3DBAA 3ICYA 3PR6A 4GW9A 1H3QA 3KSFA 4KQOA 3OOVA 2XSSA 2PR5A 3F1NB 2QJ5A 2PHYA 3OBFA 1TD5A 4EU0A 1H8MA 4QPRA 2G7UA 2D02A 3LICA 3ZYTA 4R6LA 4BJPA 5J7EA 4GS9B 1UWNX 2QWSA 1YKDA 3F1NA 2LB9A 5HWVA 1OTBA 3T4JA 1DP9A 4LRXC 5I5LA 3V67A 2Y79A 5HWWA 2W3FA 3KO6A 1P97A 3SW1A 2M1CA 2IA2A 4O0PA 3VE3A 2O9CA 4EUVA 4WEJA 5KSHA 2L1MA 2V9AA 4GS9A 3S7PA 5DJUA 1T1CA 3VE4A 2P08A 2XA7M 4CLCC 3C2WA 4B9OA 3NOUC 2Z6DA 4HH2A 2PD8A 3PBTA 3KSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2INW A;  1JNU A;  4HQA A;  3LI9 A;  2VLG A;  5HDC A;  4LRY C;  3IBR A;  3MR0 A;  3G6O A;  4LRZ E;  3A0S A;  1TS6 A;  3LIE A;  2PYR A;  2QKP A;  3BY8 A;  4EQ1 A;  5F5Y A;  3T50 A;  5HSQ A;  1XJ3 A;  1WA9 A;  2H28 A;  2WKP A;  3A0R A;  5DKK A;  5IS1 A;  3H82 B;  3EWK A;  1N9O A;  2V0W A;  5AVE A;  2V1B A;  1GSX A;  3UB7 A;  4HP9 A;  4I3A A;  2W27 A;  4RQ9 A;  1S67 L;  5G4Z A;  1V9Z A;  3H82 A;  1ODV A;  4HJ6 A;  2PD7 A;  1KOU A;  4I5S A;  2PR6 A;  5J4E A;  2Z6C A;  3MQQ A;  3C8C A;  3B33 A;  2L0W A;  4PKY G;  4GHI B;  4HY8 A;  3H7W B;  2YKH A;  3UB6 A;  1Y28 A;  1LSW A;  4NXG A;  5EFW A;  4JGO A;  5HWT A;  5DJT A;  5G4Y A;  4WN5 A;  3ZQ5 A;  4M4X A;  4GHI A;  3CAX A;  3H7W A;  1LSX A;  3MQO A;  3E4P A;  4I3I A;  1OTD A;  2PYP A;  2V0U A;  4KUO A;  3NJA A;  1TS0 A;  1TS7 A;  2ZOH A;  5J3W A;  3A0V A;  4WLA A;  4MN6 A;  3OLO A;  3IS2 B;  2VV7 A;  4I38 A;  2W0N A;  2OWH A;  3GDI A;  4KUK A;  4E04 A;  4K08 A;  1DP6 A;  4YWZ A;  1LSV A;  2EA9 A;  3IS2 A;  2J80 A;  5AVF A;  3LIA A;  3NOT C;  2GJ3 A;  4BBT A;  3MXQ A;  4DJ2 A;  4HJ4 A;  3F1P B;  4HHD A;  1N9N A;  3GEC A;  2R78 A;  3E4O A;  3HJK A;  4I3J A;  1OTA A;  4PKY A;  4WUJ A;  4HP4 A;  3F1P A;  3UB9 A;  4NXF A;  1F98 A;  1BYW A;  4HI4 A;  1XJ6 A;  3MFX A;  3UE6 A;  4WL9 A;  1GSV A;  1P0Z A;  3LYX A;  4F3L B;  3K3D A;  2JHE A;  3K3C A;  1D7E A;  2YKF A;  3BWL A;  3E4Q A;  5F69 A;  3FG8 A;  5F68 A;  2BAS A;  4F3L A;  2QJ7 A;  4XT2 B;  2KDK A;  1XFQ A;  1F9I A;  1XJ4 A;  3RTY A;  4JGQ A;  3VOL A;  3NHQ A;  4EXO A;  3D72 A;  4HH3 A;  1T19 A;  3KX0 X;  1NWZ A;  4L9G A;  4XT2 A;  4BBU A;  1VB6 A;  1LT0 A;  1T1B A;  1X0O A;  4WF0 A;  5HZH A;  2PDR A;  1MZU A;  2B02 A;  2JN7 A;  2ZBB A;  1OJ5 A;  4KQD A;  1OT6 A;  2D01 A;  4R70 A;  1S66 L;  4EES A;  4GCZ A;  2OOL A;  4NXB A;  1T18 A;  4LLO B;  4L9F A;  2WKQ A;  5DKL A;  4L9E A;  4MN5 A;  3CLO A;  4NXE A;  3UMD A;  4BBV A;  4EET B;  1XJ2 A;  1OTE A;  1T1A A;  3LIF A;  1S4S A;  2OWJ A;  1GSW A;  2K7S A;  2A24 B;  5F6A A;  3CWF A;  1OJG A;  5TBM B;  5HD5 A;  3MJQ A;  1TS8 A;  2A24 A;  3PYP A;  4I39 A;  3HJI A;  1XFN A;  2WKR A;  4EEU A;  1G28 A;  1LL8 A;  5TBM A;  1S1Z A;  2P7J A;  3F1O B;  5HD3 A;  4EEP A;  5HDS A;  4R3A A;  4EER A;  2L4R A;  1N9L A;  3LI8 A;  4HNB A;  3F1O A;  4HJ3 A;  3P7N A;  5KIZ A;  3LUQ A;  1OT9 A;  4HIA A;  1S4R A;  2CMN A;  3FC7 A;  3UB8 A;  5A8B A;  4JGP A;  1EW0 A;  3PHY A;  4HOI A;  4LPZ A;  4DJ3 A;  3BY9 A;  4EW7 A;  2VV6 A;  2ZOI A;  5HDD A;  3RH8 B;  3LID A;  3H9W A;  1DP8 A;  2V1A A;  2HV1 A;  4H6J B;  1UWP X;  2QHK A;  3ULF A;  2VV8 A;  1UGU A;  1S1Y A;  1DRM A;  4H6J A;  3LIB A;  1D06 A;  2I9V A;  4JGR A;  2KX6 A;  1V9Y A;  3NOP C;  3UME A;  1OTI A;  2VEA A;  3EEH A;  5IU1 A;  4R38 A;  3ICY A;  4GW9 A;  2PR5 A;  3F1N B;  2QJ5 A;  2PHY A;  2D02 A;  3LIC A;  4R6L A;  5J7E A;  4GS9 B;  1UWN X;  2QWS A;  5HWV A;  3F1N A;  1OTB A;  1DP9 A;  4LRX C;  5I5L A;  5HWW A;  1P97 A;  3SW1 A;  2M1C A;  3VE3 A;  2L1M A;  2V9A A;  4GS9 A;  5DJU A;  1T1C A;  3VE4 A;  3C2W A;  4B9O A;  3NOU C;  2Z6D A;  4HH2 A;  2PD8 A; 
#chains in the Genus database with same CATH topology
 2GNX A;  2O99 A;  2K2N A;  1H5X A;  1AWI A;  1IKG A;  5JYO A;  1ZHH B;  2FH5 A;  3B47 A;  5TJJ A;  1GA9 A;  2VK3 A;  3LI9 A;  1XGI A;  2GX5 A;  4Z9Q A;  3IBR A;  1I2W A;  5HW3 A;  1K6S A;  4DKI A;  4LRZ E;  3A3J A;  1TS6 A;  3QP1 A;  3R7W B;  5I94 A;  2WGW A;  5E43 A;  3BY8 A;  1YMS A;  3CI6 A;  4E3M A;  4RX3 A;  1WA9 A;  5IS1 A;  2WKE A;  3IWQ A;  1E3U D;  3HUM A;  3ITB A;  3UB7 A;  2W27 A;  4FTX A;  4MLL A;  2QYB A;  5G4Z A;  1YM1 A;  3H82 A;  2OLU A;  1ERO A;  3HCY A;  3RXW A;  4X56 A;  4I5S A;  3ZCZ A;  4PMA A;  2JCH A;  3PAG A;  2DRW A;  3GMW A;  1F5M A;  1G5U A;  4PKY G;  2EX9 A;  4GHI B;  2P9V A;  3H7W B;  1LHY A;  2ZC7 A;  2YKH A;  3BLS A;  4FUW A;  3S7O A;  5FAP A;  3IH9 A;  2BG1 A;  3M2J A;  4X6T A;  2Y8H A;  1LSW A;  3N8S A;  4NXG A;  3T4Q A;  3IT9 A;  2J3T D;  3SH7 A;  5G4Y A;  4KG2 A;  3VP2 A;  1NYM A;  5FI6 A;  4M4X A;  2PRF A;  5CGX A;  3E4P A;  1SDE A;  2BTF P;  4UA9 A;  1A0K A;  2PAV P;  1OTD A;  4KUO A;  2HP6 A;  2XGN A;  3SS5 A;  4UA6 A;  2ZOH A;  4MN6 A;  2VV7 A;  2W0N A;  5M19 A;  3GDI A;  5L8M A;  1VEU A;  3QP6 A;  1GHI A;  4RVA A;  1LSV A;  2WUQ A;  3IS2 A;  2E8J A;  5AJG A;  4KZ7 A;  3WS2 A;  2XQZ A;  3IF6 B;  3SZT A;  1W7F A;  2H10 A;  3LGO A;  5IHV A;  2Y2M A;  1FCN A;  5LBR A;  4JF6 A;  5CED A;  3HJK A;  1KGF A;  1K38 A;  1PWD A;  1CEF A;  4E3L A;  2V20 A;  4FH4 A;  2ZM8 A;  1BYW A;  5FI7 A;  1O7E A;  1XJ6 A;  1L0G A;  1BLP A;  1P0Z A;  3ZHH A;  4QY6 A;  4LCM A;  3LYX A;  1YQS A;  1RGY A;  2A3U A;  3VP3 A;  2QPN A;  3ZG5 A;  3IX8 A;  1HVB A;  4GLQ A;  1IKI A;  3FG8 A;  5F68 A;  4GN2 A;  2VGL S;  5M1A A;  4F3L A;  2PT7 A;  2KDK A;  3HBR A;  1XJ4 A;  5EVI B;  4HH3 A;  4Y0U A;  2EFX A;  3VFH A;  1NWZ A;  1LI0 A;  3PBS A;  4R4S A;  4OPZ A;  1JWZ A;  4XT2 A;  4BBU A;  2ZM2 A;  5KMW A;  5TR7 A;  1MZU A;  4IED A;  4WEL A;  2JN7 A;  2ZBB A;  1BZA A;  1ONH A;  3G4P A;  4WMC D;  4KQD A;  2D01 A;  3V3R A;  3M6B A;  4ZRR A;  4EES A;  5FAO A;  1KDW A;  2H5S A;  3QHY A;  4O7D A;  1SKF A;  4EWF A;  4BQM A;  3FKV A;  3T4L A;  2WKQ A;  3ZNT A;  3CLO A;  3KYQ A;  4II7 A;  1ZG4 A;  4MCW A;  3Q81 A;  5L07 A;  1FOF A;  1GCE A;  4EET B;  1T1A A;  3DWK A;  2ZMA A;  3IF5 A;  1KVL A;  1BUL A;  3UPO A;  4D60 A;  2VZW A;  4ETX A;  4Q0J A;  4PHT A;  5F6A A;  2HDQ A;  1NRJ A;  5FAS A;  3CWF A;  3IWI A;  2VGL M;  2B18 A;  3MJQ A;  3L9K A;  5GL9 A;  2A24 A;  3HJI A;  1ERQ A;  1XFN A;  4PM7 A;  1BSG A;  2C5W B;  1SHV A;  2J7V A;  1NLZ A;  5HD3 A;  5FEG A;  3HRE A;  4R3A A;  4OQI A;  4MBK A;  4UEY A;  4C75 A;  2Z2M B;  5GHZ A;  4Y2F A;  3LI8 A;  4HNB A;  3UPP A;  3HLD A;  1ZTU A;  1NYY A;  4HJ3 A;  1GA0 A;  1W8Q A;  3P7N A;  2EX6 A;  4X68 A;  5KIZ A;  1NZU A;  3LUQ A;  1HD8 A;  4G3W A;  2ZC6 B;  3TW8 A;  2RL3 A;  2JKT I;  5AQ7 A;  1FR1 A;  5FEF A;  2GZA A;  2VV6 A;  2ZOI A;  2WK0 A;  3CUE A;  5HDD A;  3RH8 B;  3H9W A;  5A93 A;  2X71 A;  2WKI A;  1DJA A;  5CEC A;  4OQG A;  2V1A A;  5F82 A;  3O87 A;  2EXA A;  3P01 A;  4CQH A;  2Q0O A;  1UGU A;  1S1Y A;  3MZF A;  4H6J A;  1Q2Q A;  4PM5 A;  5A92 A;  4DE3 A;  4RA7 A;  2EX8 A;  1V9Y A;  3CJM A;  1IEM A;  1W63 M;  3QNC A;  1BLC A;  3NOP C;  3UME A;  4NET A;  3SOI A;  4G3V A;  3MKF A;  2Y2I A;  1H3Q A;  2XFT A;  2PR5 A;  3F1N B;  4EV4 A;  2ZD8 A;  5GLD A;  5A90 A;  3W4O A;  3NEC A;  2WKH A;  3BFG A;  2R9W A;  1CI8 A;  1H8Y A;  2D02 A;  4NK3 A;  3C4O A;  5HWW A;  3SW1 A;  1YLZ A;  5CGS A;  5DTS A;  3BEC A;  4O0P A;  4YFM A;  4FH2 A;  2X01 A;  4GS9 A;  4HEF A;  2QMI A;  1YLW A;  3C5A A;  1XPB A;  2PD8 A;  2INW A;  1QMF A;  3NIA A;  5DF9 A;  2FFF B;  4U0T A;  4HQA A;  3W8K A;  3N8R A;  3MFD A;  3DW0 A;  2KOI A;  3LEQ A;  3MR0 A;  4YNR A;  5EOO A;  3S22 A;  4GZB A;  1K6R A;  3A0S A;  4CLC B;  3LIE A;  5E2G A;  4X1M A;  4X1L A;  3NC8 A;  3PBN A;  2PYR A;  2QKP A;  4QHC A;  4EQ1 A;  3VMA A;  3MKE A;  4ETZ A;  1XJ3 A;  3R7W A;  1K56 A;  4DE2 A;  1H8Z A;  2WKP A;  4B88 A;  2DNS A;  2V0W A;  4S2O A;  2V1B A;  3IHB A;  1PZO A;  4RQ9 A;  4Y0T A;  5FL3 A;  3SS3 A;  1V9Z A;  3A3F A;  1VM1 A;  2WYX A;  3T4K A;  1TEM A;  4WBG A;  4G3K A;  1IFQ A;  1YLY A;  2W1R A;  1PRQ A;  2PR6 A;  4XUZ A;  5JYP A;  3T12 B;  2Z6C A;  3C7V A;  5U47 A;  4IHQ A;  1VQQ A;  3B33 A;  1ERM A;  1CQA A;  4QB8 A;  4LV3 A;  5FAT A;  4B4Z A;  3JVU A;  3ZG7 B;  1Y28 A;  3OZH A;  2Y2N A;  3QP8 A;  4P6Z M;  2ZQD A;  5EFW A;  4JF5 A;  4C6Y A;  5DJT A;  3IXG A;  3ZQ5 A;  4GHI A;  2OAP 1;  3G30 A;  3H7W A;  1LSX A;  3MQO A;  4S2I A;  3HVF A;  2IWC A;  1ACF A;  2C6W B;  4HES A;  5GHY A;  4RYE A;  4KQR A;  4WZ4 A;  1G6A A;  5CGW A;  1W63 Q;  5F83 A;  1TS7 A;  5C5K A;  3RXX A;  3FYZ A;  5A91 A;  4I38 A;  2OWH A;  2KLI A;  3NY4 A;  4E04 A;  4PM9 A;  4X69 A;  3CMZ A;  5FQ9 A;  4LEN A;  4R0Q A;  3LIA A;  3FPV A;  2G2W A;  4OVD A;  2GJ3 A;  3UE1 A;  2VGJ A;  4BBT A;  2XDM A;  5HAQ A;  2ZC5 B;  3D9Y A;  5CXW A;  2B95 A;  3IXH A;  5HL1 A;  4GOG A;  2J3T C;  2R78 A;  3I7J A;  3IF6 A;  2B5R A;  5DFY A;  1OTA A;  3T1S A;  4Q8I A;  4HP4 A;  4CJN A;  4WM9 A;  1KE0 A;  3EEA A;  3UB9 A;  1RGZ A;  4K0W A;  3BFF A;  1Y54 A;  3QP5 A;  3UE6 A;  4JPM A;  1MC0 A;  3O5Y A;  1SCW A;  1F2K A;  1W5D A;  4DDY A;  3JVV A;  2JHE A;  3K3C A;  3BJN A;  4YIN A;  3ITA A;  1BTL A;  3E4Q A;  2NUP C;  5FSR A;  3Q7V B;  4S2N C;  5F69 A;  3KYE A;  2OAQ 1;  3RFB A;  4JGQ A;  2Q9N A;  3VOL A;  1T19 A;  4Y0O A;  3GV9 A;  3KX0 X;  2Y2K A;  3ZFZ A;  4WZ5 A;  4DRT A;  1K57 C;  3BW6 A;  3FPW A;  2XFS A;  3HLF A;  4IBR A;  5EVI A;  1T1B A;  4LCL A;  1ESU A;  2PDR A;  2B02 A;  4UA7 A;  5DF7 A;  3SS4 A;  1SKO B;  4LV2 A;  3TSG A;  4BD1 A;  3EGX C;  1TDL A;  1S66 L;  1YLJ A;  2R9X A;  4KZ4 A;  2Y2Q A;  1ZG6 A;  2XF3 A;  3AGF A;  4L9E A;  1OME A;  1NY0 A;  4NXE A;  2JKF A;  4S2L A;  3EQV A;  3IQA A;  2A49 A;  1ES4 A;  1I2S A;  4QJG A;  2DMW A;  2RCX A;  2UWX A;  2J3W A;  3PBR A;  3S1Y A;  2FFY A;  1GSW A;  4S2K A;  2XLN A;  3ZG8 B;  3GSG A;  4MBF A;  1WYB A;  4F94 A;  1L0E A;  3UN7 A;  4N1H A;  2HGV A;  3Q7Z A;  3ZGA B;  2HPB A;  5HD5 A;  2ZQ8 A;  1TS8 A;  1M6K A;  4PAU A;  3EQU A;  5AQ9 A;  2WKR A;  4PM8 A;  4OKP A;  3WS0 A;  5BOH A;  2VA0 A;  4FOF A;  1LL8 A;  3LO7 A;  1S1Z A;  2Y2L A;  3F1O B;  4KQQ A;  1PNE A;  5CTM A;  2XEP A;  2L4R A;  2O9B A;  3UDI A;  4LFU A;  1N9L A;  3LFV A;  5KSC A;  5CHU A;  2Z2L B;  3E0Y A;  2M7V A;  2JC7 A;  2Y2P A;  1OT9 A;  3BQ8 A;  3SH8 A;  3T1R A;  2CMN A;  3FC7 A;  2O9A A;  5A8B A;  4JGP A;  3P98 A;  3PHY A;  4HOI A;  3BY9 A;  1VET B;  4DF6 A;  3LCE A;  3DTM A;  3SH9 A;  2FZ0 A;  2Y2J A;  5CHM A;  3G34 A;  4FCF A;  4N1X A;  1PZP A;  1HLU P;  5K5B A;  2W3D A;  1DP8 A;  3IH8 A;  4BD0 A;  2PU2 A;  4BL2 A;  4Y3I A;  1KE4 A;  1PIO A;  4L0L A;  4ZJ1 A;  3T4O A;  3LR5 A;  5EV0 A;  3S7Q A;  3VOY A;  1K56 D;  3MXS A;  1DRM A;  1SZV A;  4MEZ A;  3LIB A;  3MZD A;  1IYS A;  1P9W A;  1PW8 A;  3MZE A;  1SDN A;  1XKZ A;  1K55 C;  1U60 A;  1KE3 A;  2Y2H A;  3PXP A;  1OTI A;  2HJ9 C;  4XUX A;  3G31 A;  2NUT C;  3DTK A;  3PR6 A;  1L0F A;  1ZKJ A;  4P85 A;  2QJ5 A;  1J9M A;  3OBF A;  1H8M A;  4R4R A;  2G7U A;  1LI9 A;  2WAD A;  2VGK A;  5E2E A;  1JWV A;  3IF6 C;  4OLG A;  5HWV A;  3F1N A;  5EPH A;  5I5L A;  3V67 A;  3BEB A;  2Y79 A;  1P97 A;  4GNU A;  1ES5 A;  2ZJ9 A;  2H0T A;  3VE3 A;  2Y2O A;  2J8Y A;  4LV1 A;  4EUV A;  2Y59 A;  2V2F F;  5DJU A;  1T1C A;  2Z6D A;  3N7W A;  2ZQA A;  4JBF A;  4EBN A;  1TDG A;  3HLC A;  4BMW A;  4K91 A;  4IUK A;  1JNU A;  3PBO A;  3IWO A;  4OOL A;  1CEG A;  3G35 A;  5HDC A;  5TFQ A;  4LRY C;  5MC7 A;  4ARZ B;  1STZ A;  1K4E A;  2J9P A;  4N92 A;  3E2K A;  5L2F A;  5EVL A;  3WWX A;  2HP9 A;  3O86 A;  5CER A;  4KG5 A;  1BUE A;  1YAX A;  3PBQ A;  5HSQ A;  4ZAM A;  4CLC A;  1K54 A;  3A0R A;  5DKK A;  3QP4 A;  3EWK A;  1N9O A;  4ESP A;  1GSX A;  3IX4 A;  2XD5 A;  1YSQ A;  2Y4A A;  1ODV A;  5TGF A;  4EBL A;  1LLB A;  3OPL A;  3DWZ A;  3RJU A;  5DTT A;  2BLS A;  3VP1 A;  4X25 A;  3C8C A;  3G32 A;  2WAF A;  1KGG A;  2L0W A;  3AGD A;  4UAA A;  1WE4 A;  4OOY A;  3UB6 A;  1S0W A;  4Y13 A;  1FSY A;  1CK3 A;  5KZH A;  1EWZ A;  5HWT A;  4JGO A;  3K2N A;  1N4O A;  5HAR A;  1IYQ A;  4I3I A;  2WZX A;  3V50 A;  3GQZ A;  2ZC3 B;  1HTZ A;  5GLC A;  2PYP A;  2V0U A;  1NLY A;  5FA7 A;  4MNR A;  5EVI D;  1PW1 A;  3A0V A;  3D3O A;  3UB5 P;  3OLO A;  4PPR A;  4WEK A;  1XA1 A;  1YLT A;  1PFL A;  3UNW A;  1DP6 A;  4YWZ A;  2JKT M;  3CIT A;  2EA9 A;  3T1Q B;  3MBZ A;  3G2Y A;  5CX7 A;  1WYC A;  4P6Z S;  4R3J A;  5AVF A;  5HPI A;  3UPN A;  2V1Z A;  3C38 A;  3ZDJ A;  2J9O A;  3M6H A;  4CLC E;  4DJ2 A;  2V8F A;  1IEL A;  4IVI A;  4P6B A;  4BWI A;  3F1P B;  3LEZ A;  4HHD A;  3HUO A;  3GEC A;  4E6X A;  3AGE A;  2EWV A;  2LB5 A;  3OCL A;  5FQK A;  3NUL A;  3E4O A;  4R3B A;  4PKY A;  3HLB A;  2PBD P;  3UY6 A;  3ZG9 B;  5HAI A;  4Y5F A;  4E3I A;  4DE1 A;  2OLV A;  1CI9 A;  1F98 A;  1BT5 A;  2P04 A;  4WYY A;  4P0M A;  3VOZ A;  4OH0 A;  5EVE A;  5CHJ A;  3QNB A;  1G6O A;  2HJE A;  5F1G A;  3LR4 A;  4EUZ A;  1YSP A;  1DJC A;  1HZO A;  3V3S A;  3C4P A;  2XR0 A;  3K3D A;  1W79 A;  3T4S A;  2YKF A;  1MXO A;  1FQG A;  1KVM A;  2BAS A;  4ZJ2 A;  4U3T A;  1F9I A;  3IXB A;  3RTY A;  3NHQ A;  3VSK A;  3N6I A;  3NDE A;  4KZ8 A;  3JPU A;  3A3E A;  3Q7V A;  2W1T B;  3TG9 A;  2Y55 A;  4L9G A;  4JXS A;  3W2Z A;  1D1J A;  4UQI M;  1LT0 A;  5FQJ A;  3VP4 A;  4WF0 A;  5HZH A;  1FCO A;  1O07 A;  1FSW A;  1OJ5 A;  1OT6 A;  1MKM A;  3ZVT A;  2OOL A;  2HDS A;  4NXB A;  4YOF A;  1SKO A;  1LL9 A;  1I5Q A;  5DKL A;  4MN5 A;  4DDS A;  5FDS A;  2ZL1 B;  4BBV A;  3D4F A;  1XJ2 A;  1OTE A;  2ZQ9 A;  3LIF A;  3WRT A;  1OPX A;  3W4Q A;  4KZ3 A;  1FR6 A;  3BRM A;  3V39 A;  5EUA A;  4K0X A;  2JBF A;  3OCN A;  1JTG A;  1ZC2 A;  3UE3 A;  5F1F A;  4O8G A;  4OOM A;  5TBM B;  1TVF A;  1FIK A;  3R4K A;  3A3I A;  5FDH A;  3CPT B;  5HFO A;  3CUE C;  1N9B A;  1G28 A;  4U0X A;  2P7J A;  3O88 A;  2IWD A;  3OPH A;  2X02 A;  4DXC A;  3UDF A;  5DTK A;  3NI9 A;  2V8C A;  4MMN A;  1DY6 A;  3L7H A;  4C3Q A;  4QWO A;  5IT5 A;  3F1O A;  2WZZ A;  1MPL A;  3M2K A;  4NKP A;  4ZTK A;  4NG2 A;  1CF0 A;  2ZQC A;  3ZVW A;  3U2A A;  4DN0 A;  2AVX A;  4HIA A;  1PWC A;  3NDG A;  3UB8 A;  1IOU A;  1EW0 A;  4Y7P A;  4LPZ A;  4E3N A;  1K0K A;  4JXG A;  4N9L A;  1Q2P A;  3FWL A;  2XA7 S;  3LID A;  3W4P A;  3PTE A;  1P9R A;  4GDN A;  2HV1 A;  1VET A;  2JKG A;  3OC2 A;  1RP5 A;  3MMH A;  3UDX A;  1EI5 A;  4CLC D;  2VV8 A;  3HL9 A;  5HL6 A;  4BL3 A;  2ZM0 A;  2OV5 A;  3E2L A;  2XRO A;  1D06 A;  5CTN A;  2I9V A;  4JGR A;  3DTE A;  4OPY A;  3LR0 A;  3Q1F A;  5EM1 A;  4E3O A;  2KX6 A;  4E6W A;  4GD8 A;  4JF4 A;  4EBP A;  1S6R A;  2VEA A;  4Z1W A;  3EEH A;  5IU1 A;  3ICY A;  4ID4 A;  4JKT A;  4GW9 A;  5CRF A;  1BLH A;  3OOV A;  2ACG A;  4E3J A;  1E25 A;  2PHY A;  4IBX A;  3VSL A;  1TD5 A;  4EU0 A;  5DVA A;  4QPR A;  5L10 A;  3ZYT A;  4R6L A;  4FD8 A;  5J7E A;  1UWN X;  5GLA A;  5DF8 A;  1YKD A;  2HDR A;  4LRX C;  4OON A;  3HLW A;  2W3F A;  3KO6 A;  5J8X A;  2M1C A;  1PWG A;  1XP4 A;  3ZNY A;  3BM6 A;  4DXB A;  2UV0 E;  1NJ4 A;  2OSU A;  3HUN A;  2P08 A;  2XA7 M;  3BYD A;  3N4I A;  4S2M A;  3NOU C;  5M18 A;  2IWB A;  4HH2 A;  3KSH A;  5D3O A;  2W3G A;  2Q9M A;  4ME4 A;  3TJZ C;  3WS4 A;  2WGW B;  1AXB A;  2VLG A;  3VV4 A;  4D2O A;  4GD6 A;  3VFF A;  2K31 A;  3B3X A;  1L3L A;  3G6O A;  1C3B A;  4JXW A;  3S4X A;  3IXD A;  4OQ0 A;  4XXR A;  2QZ6 A;  3GVB A;  5F5Y A;  4B4X A;  3NBL A;  3T50 A;  3V5M A;  4ARZ A;  4QD4 A;  4OLD A;  4AFI A;  2W3H A;  1DJB A;  2H28 A;  3MQ0 A;  3H82 B;  4KZ9 A;  1XX2 A;  1YT4 A;  5AVE A;  1KDS A;  5AQA A;  3S7N A;  3G2Z A;  3TRC A;  4HP9 A;  2JE5 A;  4I3A A;  1S67 L;  3Q82 A;  1J3W A;  4X53 A;  3HLE A;  3A3D A;  2MJ6 A;  2P9V B;  4HJ6 A;  3FKW A;  2PD7 A;  1KOU A;  4QU3 A;  4GB7 A;  5J4E A;  3MQQ A;  3GRJ A;  4IJG A;  5EOE A;  3FV7 A;  3N8L A;  4HY8 A;  3P09 A;  1ES3 A;  4ZBE A;  4R1G A;  2DCF A;  5FQQ A;  4MN7 A;  5L09 A;  1VHM A;  2I72 A;  2E8I A;  4WN5 A;  3CAX A;  4O01 A;  4MBH A;  2HZ5 A;  3CHW P;  2H0Y A;  1JWP A;  4KZ6 A;  2EFU A;  2ZMV A;  4GKU A;  2Y91 A;  3NJA A;  1TS0 A;  1VEU B;  3CG5 A;  4DMZ A;  2VJW A;  5E2F A;  5J3W A;  1FIL A;  4R23 A;  4WLA A;  4ZDX A;  3IS2 B;  1PYY A;  3LR3 A;  3BFE A;  1MWT A;  4GJ4 A;  4RX2 A;  4KUK A;  4IUH A;  1MY8 A;  4K08 A;  2J80 A;  1GHM A;  3NOT C;  3MXQ A;  5DFX A;  4HJ4 A;  1L2S A;  5HX9 A;  5EEC A;  1N9N A;  5FAQ A;  4BEN A;  5GLB A;  3CZD A;  4Q0I A;  2VKS A;  4I3J A;  2WAE A;  1E3U A;  1ONG A;  1JVJ A;  4WUJ A;  2XRN A;  3E98 A;  3F1P A;  4NXF A;  4WZ5 C;  1FCM A;  4HI4 A;  3U4L P;  4HBT A;  4JLF A;  3MFX A;  4Y17 A;  4WL9 A;  1E4D A;  5EVI C;  1QME A;  3TE8 A;  2ZQ7 A;  1GSV A;  3DTI A;  4M3K A;  3C7U A;  4F3L B;  3LY4 A;  1D7E A;  3BWL A;  2W3E A;  1BLS A;  4OP8 A;  2HDU A;  3GR2 A;  3BQA A;  2QJ7 A;  4XT2 B;  1W8Y A;  1XFQ A;  4KZ5 A;  4IVK A;  4EXO A;  4KEN B;  3D72 A;  1IYP A;  2PBY A;  4HBU A;  1K4F A;  1JTD A;  3C30 A;  3BLM A;  2EXB A;  3WS5 A;  4X55 A;  1VB6 A;  4GDB A;  2EWW A;  1IYO A;  1X0O A;  3FZC A;  1XA7 A;  2W1T A;  1MWU A;  3BFD A;  4KZA A;  1MBL A;  4R70 A;  2XH9 A;  4QY5 A;  3ZG0 A;  4S2N A;  4GCZ A;  5E2H A;  1T18 A;  4LLO B;  1LL5 A;  2EX2 A;  2WGV A;  4L9F A;  2A2L A;  3BFC A;  4MDZ A;  3T4T A;  3KSG A;  3UMD A;  1Y4O A;  1K57 A;  5FQI A;  4OQH A;  2VX8 A;  5EM0 A;  1ALQ A;  2HP5 A;  4LV0 A;  1MWS A;  2M7U A;  3B42 A;  4Y15 A;  4OP5 A;  1S4S A;  1YMX A;  3ISG A;  2ZL1 A;  2OWJ A;  4UQI S;  4BLM A;  2K7S A;  2HF6 A;  2A24 B;  3IX3 A;  2JKR I;  2PU4 A;  3OPP A;  1NRF A;  4S2P A;  5HAP A;  3WRZ A;  1OJG A;  2XK1 A;  5EE8 A;  4H8R A;  1XXM A;  3EOI A;  3PYP A;  4I39 A;  4EEU A;  4B93 A;  1RCJ A;  3O3V A;  3MF0 A;  3PAE A;  5G18 A;  5TBM A;  5CEB A;  3Q07 A;  3JYI A;  2GDN A;  4EEP A;  5HDS A;  3CPT A;  4UHU A;  3MSH A;  1L0D A;  4EER A;  1GHP A;  3KSI A;  3MS6 A;  3DAV A;  4E3K A;  2CC1 A;  1PI4 A;  4DE0 A;  3EGD C;  1K25 A;  5HPF A;  1S4R A;  1KGE A;  3IHA A;  2O0Y A;  1ESI A;  1ES2 A;  4DJ3 A;  4EW7 A;  2Y2G A;  1YLP A;  1MKI A;  1CJF A;  3GTC A;  4WMC A;  3IBJ A;  4KZB A;  1NXY A;  3TOI A;  5FQM A;  4PM6 A;  4EQI A;  4NEE D;  4A5R A;  3HLG A;  1MWR A;  1TF1 A;  3KYZ A;  2ZMF A;  4H6J B;  1UWP X;  1G68 A;  4Q0H A;  1H0M A;  5AQB A;  1YPR A;  2P74 A;  3QP2 A;  2QHK A;  5FI2 A;  3ULF A;  3UE0 A;  3VP0 A;  3WS1 A;  4FSF A;  4N9K A;  2JKR M;  1Z6F A;  4OPQ A;  4R38 A;  3DBA A;  3KSF A;  4JXV A;  4KQO A;  3LY3 A;  4P87 A;  4LGW A;  2ZLY A;  2XSS A;  4KG6 A;  3MXR A;  3LIC A;  3UO9 A;  4BJP A;  2G2U A;  4GS9 B;  1M40 A;  2QWS A;  4S2J A;  2LB9 A;  1OTB A;  3T4J A;  1DP9 A;  1PI5 A;  1XGJ A;  2XD1 A;  4OPR A;  4CPK A;  1NZO A;  2IA2 A;  1K55 A;  3T1X A;  2O9C A;  3OPR A;  4WEJ A;  5KSH A;  2L1M A;  2V9A A;  5GHX A;  3S7P A;  3VE4 A;  2ZC4 B;  4CLC C;  3C2W A;  3NCK A;  4B9O A;  1K54 C;  1Z09 A;  2WGI A;  4ZJ3 A;  3PBT A; 
#chains in the Genus database with same CATH homology
 2GNX A;  2INW A;  2O99 A;  4BMW A;  2K2N A;  2W3G A;  5DF9 A;  4IUK A;  1JNU A;  3PBO A;  1ZHH B;  2FH5 A;  3B47 A;  4ME4 A;  4HQA A;  5TJJ A;  3TJZ C;  4OOL A;  3LI9 A;  2VLG A;  3VV4 A;  5HDC A;  2GX5 A;  4LRY C;  3IBR A;  5MC7 A;  4ARZ B;  1STZ A;  2K31 A;  2KOI A;  3MR0 A;  4YNR A;  3G6O A;  4LRZ E;  3A0S A;  1TS6 A;  3LIE A;  3R7W B;  4CLC B;  3PBN A;  2PYR A;  2QKP A;  3BY8 A;  4EQ1 A;  5F5Y A;  3CI6 A;  3T50 A;  4ARZ A;  1YAX A;  3PBQ A;  4ETZ A;  5HSQ A;  4AFI A;  1XJ3 A;  3R7W A;  2W3H A;  4CLC A;  1WA9 A;  2H28 A;  2WKP A;  3A0R A;  3MQ0 A;  5DKK A;  5IS1 A;  3H82 B;  3EWK A;  1N9O A;  2V0W A;  5AVE A;  3S7N A;  2V1B A;  1GSX A;  3TRC A;  3UB7 A;  4HP9 A;  4I3A A;  2W27 A;  4RQ9 A;  1S67 L;  2QYB A;  1YSQ A;  5FL3 A;  5G4Z A;  1V9Z A;  3H82 A;  1ODV A;  3T4K A;  2MJ6 A;  4HJ6 A;  3HCY A;  2PD7 A;  4G3K A;  1KOU A;  1IFQ A;  2W1R A;  4I5S A;  2PR6 A;  5J4E A;  2Z6C A;  3MQQ A;  3C8C A;  4IHQ A;  1F5M A;  3B33 A;  2L0W A;  4IJG A;  4PKY G;  4GHI B;  4HY8 A;  3H7W B;  2YKH A;  3UB6 A;  3JVU A;  3S7O A;  1Y28 A;  2Y8H A;  1LSW A;  4MN7 A;  4NXG A;  4P6Z M;  3T4Q A;  1VHM A;  2J3T D;  5EFW A;  4JGO A;  5HWT A;  5DJT A;  5G4Y A;  3K2N A;  4WN5 A;  3ZQ5 A;  4M4X A;  4GHI A;  2OAP 1;  3CAX A;  3H7W A;  4O01 A;  1LSX A;  3MQO A;  3E4P A;  4I3I A;  1OTD A;  2PYP A;  2V0U A;  1NLY A;  4KUO A;  2ZMV A;  3NJA A;  1TS0 A;  1W63 Q;  1TS7 A;  4DMZ A;  2VJW A;  2ZOH A;  5J3W A;  3A0V A;  3D3O A;  5C5K A;  4WLA A;  4MN6 A;  3OLO A;  3IS2 B;  2VV7 A;  4WEK A;  4I38 A;  3LR3 A;  2W0N A;  2OWH A;  4GJ4 A;  3GDI A;  2KLI A;  5L8M A;  4KUK A;  4IUH A;  4E04 A;  4K08 A;  1DP6 A;  4YWZ A;  1LSV A;  2JKT M;  3CIT A;  2EA9 A;  3IS2 A;  5CX7 A;  2J80 A;  4P6Z S;  5AJG A;  5AVF A;  5HPI A;  3LIA A;  3NOT C;  3FPV A;  3C38 A;  2GJ3 A;  4CLC E;  4BBT A;  3MXQ A;  5DFX A;  4DJ2 A;  4HJ4 A;  4BWI A;  3F1P B;  4HHD A;  1N9N A;  3GEC A;  5LBR A;  2EWV A;  2LB5 A;  3OCL A;  2J3T C;  2R78 A;  3E4O A;  3HJK A;  4Q0I A;  2VKS A;  4I3J A;  5DFY A;  1OTA A;  4PKY A;  4WUJ A;  4HP4 A;  3EEA A;  2XRN A;  4Y5F A;  3E98 A;  3F1P A;  3UB9 A;  4NXF A;  1F98 A;  1BYW A;  2P04 A;  4HI4 A;  1G6O A;  2HJE A;  1XJ6 A;  3MFX A;  3LR4 A;  3UE6 A;  4WL9 A;  3TE8 A;  1YSP A;  1GSV A;  1P0Z A;  1MC0 A;  3O5Y A;  3LYX A;  4F3L B;  3K3D A;  3JVV A;  2JHE A;  3K3C A;  3BJN A;  1D7E A;  3T4S A;  2YKF A;  3E4Q A;  2W3E A;  3BWL A;  2NUP C;  4GLQ A;  5F69 A;  3FG8 A;  5F68 A;  3BQA A;  2BAS A;  2VGL S;  4F3L A;  2QJ7 A;  2PT7 A;  4XT2 B;  2KDK A;  1XFQ A;  1F9I A;  2OAQ 1;  1XJ4 A;  3RFB A;  3RTY A;  4JGQ A;  3VOL A;  3NHQ A;  4EXO A;  3D72 A;  4HH3 A;  1T19 A;  3KX0 X;  1NWZ A;  3PBS A;  2W1T B;  3BW6 A;  3C30 A;  3FPW A;  4L9G A;  4XT2 A;  3W2Z A;  4BBU A;  1VB6 A;  4UQI M;  2EWW A;  1LT0 A;  1T1B A;  1X0O A;  4WF0 A;  5HZH A;  2PDR A;  1MZU A;  2B02 A;  2JN7 A;  4WEL A;  2W1T A;  2ZBB A;  1OJ5 A;  4KQD A;  1OT6 A;  2D01 A;  4R70 A;  1MKM A;  3EGX C;  4ZRR A;  1S66 L;  4EES A;  4GCZ A;  2OOL A;  4NXB A;  1T18 A;  4LLO B;  4YOF A;  3T4L A;  4L9F A;  2WKQ A;  2A2L A;  5DKL A;  4L9E A;  4MN5 A;  3CLO A;  3KYQ A;  4MDZ A;  3T4T A;  3KSG A;  4NXE A;  3UMD A;  4II7 A;  4BBV A;  4MCW A;  3EQV A;  4EET B;  1XJ2 A;  2VX8 A;  1OTE A;  1T1A A;  3LIF A;  2M7U A;  3B42 A;  1S4S A;  1OPX A;  2VZW A;  2DMW A;  4ETX A;  2OWJ A;  2J3W A;  3PBR A;  4UQI S;  1GSW A;  2K7S A;  4Q0J A;  2HF6 A;  2A24 B;  2JKR I;  3OCN A;  4PHT A;  5F6A A;  1NRJ A;  3UE3 A;  3CWF A;  4O8G A;  1OJG A;  4OOM A;  2HGV A;  5TBM B;  2VGL M;  5HD5 A;  2B18 A;  3MJQ A;  3R4K A;  1TS8 A;  3EOI A;  2A24 A;  3PYP A;  4I39 A;  3HJI A;  3EQU A;  4PAU A;  1XFN A;  2WKR A;  4EEU A;  4B93 A;  3MF0 A;  3CUE C;  2VA0 A;  4FOF A;  1G28 A;  1LL8 A;  5TBM A;  1S1Z A;  2P7J A;  3F1O B;  1NLZ A;  5HD3 A;  4EEP A;  5HDS A;  4R3A A;  4EER A;  3KSI A;  2L4R A;  4UEY A;  4MMN A;  2O9B A;  1N9L A;  4Y2F A;  3LI8 A;  4HNB A;  3LFV A;  5IT5 A;  3F1O A;  1ZTU A;  4HJ3 A;  4NKP A;  3P7N A;  3E0Y A;  2M7V A;  3EGD C;  5KIZ A;  1OT9 A;  3LUQ A;  3BQ8 A;  3U2A A;  4DN0 A;  4HIA A;  4G3W A;  5HPF A;  1S4R A;  2CMN A;  3FC7 A;  2O9A A;  3TW8 A;  3UB8 A;  2JKT I;  4JGP A;  5A8B A;  1IOU A;  1EW0 A;  2O0Y A;  3PHY A;  4HOI A;  4LPZ A;  4DJ3 A;  3BY9 A;  2GZA A;  4EW7 A;  2VV6 A;  2FZ0 A;  2ZOI A;  2XA7 S;  3CUE A;  5HDD A;  3RH8 B;  3IBJ A;  3LID A;  3H9W A;  4NEE D;  1P9R A;  5K5B A;  2W3D A;  1DP8 A;  1TF1 A;  3KYZ A;  2ZMF A;  2V1A A;  2HV1 A;  4H6J B;  1UWP X;  4Y3I A;  4Q0H A;  3OC2 A;  3MMH A;  4L0L A;  3T4O A;  3LR5 A;  3S7Q A;  2QHK A;  3P01 A;  4CLC D;  4CQH A;  3ULF A;  2VV8 A;  1UGU A;  1S1Y A;  5HL6 A;  4FSF A;  1DRM A;  4H6J A;  3LIB A;  1P9W A;  1D06 A;  2XRO A;  2I9V A;  4JGR A;  2JKR M;  3LR0 A;  2KX6 A;  1V9Y A;  1W63 M;  3NOP C;  3PXP A;  3UME A;  1OTI A;  2HJ9 C;  2VEA A;  4G3V A;  4Z1W A;  3EEH A;  5IU1 A;  4R38 A;  2NUT C;  3DBA A;  3ICY A;  3PR6 A;  4GW9 A;  1H3Q A;  3KSF A;  4KQO A;  3OOV A;  2XSS A;  2PR5 A;  3F1N B;  2QJ5 A;  2PHY A;  3OBF A;  1TD5 A;  4EU0 A;  1H8M A;  4QPR A;  2G7U A;  2D02 A;  3LIC A;  3ZYT A;  4R6L A;  4BJP A;  5J7E A;  4GS9 B;  1UWN X;  2QWS A;  1YKD A;  3F1N A;  2LB9 A;  5HWV A;  1OTB A;  3T4J A;  1DP9 A;  4LRX C;  5I5L A;  3V67 A;  2Y79 A;  5HWW A;  2W3F A;  3KO6 A;  1P97 A;  3SW1 A;  2M1C A;  2IA2 A;  4O0P A;  3VE3 A;  2O9C A;  4EUV A;  4WEJ A;  5KSH A;  2L1M A;  2V9A A;  4GS9 A;  3S7P A;  5DJU A;  1T1C A;  3VE4 A;  2P08 A;  2XA7 M;  4CLC C;  3C2W A;  4B9O A;  3NOU C;  2Z6D A;  4HH2 A;  2PD8 A;  3PBT A;  3KSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...