2G2WA

Crystal structure of the shv d104k beta-lactamase/beta-lactamase inhibitor protein (blip) complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVKYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Structural and Computational Characterization of the SHV-1 beta-Lactamase-beta-Lactamase Inhibitor Protein Interface.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 93
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2g2wA00
1SHVA 2XR0A 2RL3A 4XXRA 5GL9A 5A90A 3WS2A 3UO9A 5DF8A 2WAEA 3DW0A 3SH8A 2H0TA 3ZGAB 3HLEA 1GA9A 3NDEA 3QHYA 3VP2A 1L0EA 1W79A 2H10A 4JXWA 3MZEA 2V1ZA 3NIAA 3LEZA 4GNUA 4OPQA 4WELA 3WRZA 2Y2MA 4WZ5C 1GHIA 3ZG5A 3GV9A 3EQUA 4JPMA 2RCXA 4PM8A 4UA7A 1BLHA 3G2YA 4KZAA 1MXOA 5GHZA 2ZMAA 4KZ6A 4EV4A 3DWZA 5EVIC 3BFFA 5CTNA 5GLDA 2PU2A 2Y2NA 1BUEA 3LCEA 3ZG7B 1NJ4A 2XD5A 1DJAA 2Q9NA 4WBGA 3W4PA 4U3TA 5EVIA 1IEMA 2Y59A 3HVFA 5AQAA 4KQQA 3VP1A 3GTCA 4IBRA 1NZUA 2HDSA 1PYYA 4BJPA 1N9BA 2H5SA 3FKWA 3IH8A 5CXWA 2Y55A 4E6WA 1LI0A 5FDHA 2HDQA 2Y2JA 1PWDA 4X6TA 3O87A 3Q7ZA 1JTGA 2OLVA 1H8ZA 3Q07A 5FI6A 2WUQA 1ES4A 5EECA 1YMSA 3UPNA 3CG5A 5FQ9A 4IBXA 4GOGA 3V3SA 3BYDA 1XPBA 1YLZA 3HBRA 3O3VA 4N9KA 4RX2A 4DDYA 4KZ4A 1BLSA 1KGFA 1DJCA 3GRJA 2GDNA 5M19A 3PBNA 1FCOA 2BG1A 3NY4A 1LLBA 1L0DA 3GSGA 2P9VB 1MPLA 3IXBA 3P09A 4OP5A 1Q2QA 3UY6A 1IYPA 2C6WB 1Z6FA 4ZAMA 3HLCA 5FI7A 5FQKA 3BFEA 4KZ7A 1IYSA 1RP5A 1E3UD 1CEFA 5E2GA 2I72A 3SH9A 4IVIA 3A3IA 3V39A 2ZD8A 4K91A 5JYOA 4KG6A 4BL3A 1KDSA 2EFUA 3RXWA 5GLCA 3SS4A 2ZC6B 1ERMA 1AXBA 4MBHA 3ZVWA 1MWUA 1EROA 4QB8A 1KGGA 1N4OA 4FH2A 1SKFA 2XK1A 4U0TA 4LCMA 4ZDXA 1NRFA 3ITBA 3IWQA 4FH4A 3Q82A 3NI9A 3UE3A 1PWGA 1K57C 2ZQ7A 1L2SA 1S0WA 2XLNA 3AGFA 1L0GA 3NC8A 1FR1A 4HBUA 4M3KA 5E2FA 2Q9MA 1G6AA 4FSFA 5EPHA 5J8XA 1CEGA 2J9OA 3SS5A 1ALQA 1XA1A 2XQZA 2G2UA 1CK3A 5A93A 2A3UA 3HUOA 4ID4A 3OCNA 1MWSA 2E8IA 1MBLA 4FCFA 2P74A 4JF5A 5TR7A 2EX9A 4QD4A 2J7VA 4DRTA 1PZPA 4KQRA 3HLDA 4KG2A 4CPKA 4K0XA 5CRFA 3GQZA 2ZQDA 1NZOA 1HTZA 5FQQA 4ZJ2A 1LL9A 4JLFA 4R0QA 4R4SA 4BQMA 1PI4A 3IXHA 3N6IA 4OP8A 1G68A 4GD8A 4GDNA 1I2SA 5EUAA 2HP5A 2XDMA 2ZM0A 3UDIA 1K25A 4UA9A 1ERQA 1O7EA 1YLTA 2DRWA 2PBYA 1XKZA 5FQIA 4Q8IA 4JKTA 4MEZA 3CMZA 1NYMA 1OMEA 4GB7A 1KE4A 3IF5A 4KQOA 2ZC7A 4BL2A 4E3JA 2V20A 1Y54A 4LCLA 2X71A 3PBQA 2HP6A 4LV1A 3W8KA 1M6KA 4FD8A 1SCWA 1KDWA 4OLDA 5AQBA 4JBFA 4C3QA 1XA7A 1QMFA 2VGKA 2ZLYA 4LV2A 1YT4A 5HARA 4OQ0A 4ZBEA 3N8SA 1KVLA 1TEMA 3LO7A 1FCMA 4S2NA 5DTSA 5E2EA 3FYZA 3MBZA 5A91A 5U47A 3Q7VA 3IHAA 1ES2A 3VFHA 5FQJA 3MXSA 4E3IA 1E3UA 2H0YA 1GA0A 3G30A 4JXVA 4WZ4A 4L0LA 1RCJA 1VM1A 4N1XA 3M2KA 3ZFZA 2X02A 2JBFA 2JE5A 4DDSA 5EOEA 3BLMA 2QZ6A 3N7WA 2IWDA 2J9PA 3FV7A 1JTDA 5GLBA 1PZOA 1SDEA 3DTMA 2R9XA 3G35A 4XUXA 5HAPA 2DCFA 5F1GA 1BZAA 3G31A 4NK3A 4RA7A 1KE0A 4O7DA 4U0XA 1WYCA 3VOZA 1I5QA 2QPNA 3ZCZA 1PIOA 3V5MA 1JWPA 4IVKA 1LI9A 3HLFA 3PBTA 1HZOA 1VQQA 3C7VA 2EX2A 4PM6A 2ZC5B 1K56D 2XFTA 3N8RA 3UN7A 3PBRA 5EVIB 1GHPA 2WKHA 3GR2A 2OV5A 3G2ZA 2VGJA 2WKEA 4QY6A 4P0MA 1K6SA 4OONA 4R3BA 3VP0A 3N8LA 4DKIA 3Q81A 1MKIA 4LV3A 1FSWA 1XGIA 1JWVA 1U60A 2CC1A 3GMWA 3O86A 2Y2QA 2ZQ9A 4YINA 1ZG4A 2JC7A 2XGNA 5HX9A 5GHYA 1IYQA 5FATA 3Q1FA 5AQ7A 3VOYA 1H5XA 3BECA 4BENA 5HW3A 1IYOA 1W8QA 1BTLA 1K4EA 4R23A 2ZM8A 2A49A 3PBSA 4Y0TA 2JCHA 3FZCA 1RGYA 2R9WA 1YQSA 3BFDA 3M6HA 5GLAA 4N92A 4IEDA 4JXSA 4KZ8A 4DXBA 4DF6A 2PU4A 4YFMA 4OQIA 2Y91A 1YLYA 3UE1A 2FFYA 3A3DA 2J8YA 3IF6A 3HREA 2WAFA 3MZDA 4KZ3A 4N9LA 4ZJ3A 3AGEA 2G2WA 2Z2MB 3MZFA 4KZBA 5DVAA 3D4FA 3UDFA 5DTTA 1M40A 2ZJ9A 4OKPA 2WK0A 1YM1A 3G32A 3VSKA 3M6BA 4P87A 2Z2LB 4KZ5A 5FI2A 4EWFA 1JWZA 4GN2A 1ES3A 5CEDA 3S22A 4OOYA 3ZNTA 1GHMA 4A5RA 5CECA 4WYYA 3JYIA 4PM7A 3HUNA 1DY6A 2EX6A 2Y2HA 4JF6A 3W4OA 4GDBA 1BT5A 1EI5A 3UDXA 4D2OA 3NCKA 1KVMA 2EFXA 4ZTKA 5HL1A 1PI5A 4C6YA 1XXMA 1K54A 3SH7A 3OPPA 3OPRA 3IXDA 2WGIA 3PBOA 4DE3A 5CEBA 4CJNA 3IT9A 2ZC3B 5A92A 5FA7A 4MNRA 3W4QA 4B88A 2B5RA 2DNSA 1K38A 4E3MA 3SS3A 1FQGA 1KE3A 2BLSA 2HP9A 2WGWB 1ONGA 2QMIA 2UWXA 2XD1A 1YLWA 2XEPA 3HUMA 3PAGA 4OOLA 4X53A 3LY4A 5TGFA 3ITAA 1ESUA 1K56A 2ZM2A 4WM9A 4S2OA 2IWBA 1TVFA 1LL5A 2Y2PA 3VP4A 3E2KA 1IKIA 4HBTA 2XH9A 3GVBA 4OQHA 3N4IA 1MY8A 4S2IA 3WWXA 5HFOA 4B4XA 5G18A 4S2NC 1BSGA 1DJBA 4E3NA 3AGDA 4GKUA 3HLWA 5KSCA 4QHCA 4QY5A 3ZHHA 4WMCD 3G4PA 4PM9A 5FAPA 3LY3A 1PWCA 5HAQA 4NETA 3DWKA 4LENA 3A3FA 3MKEA 4Y0UA 1FOFA 3UNWA 1ZC2A 5EVLA 1NYYA 3BLSA 4MBKA 4S2JA 4BD1A 4R1GA 3CJMA 5CHUA 3ZG0A 3A3EA 2Y4AA 3TOIA 4RX3A 3E2LA 1IELA 5KMWA 3FKVA 4WEJA 3G34A 4E3LA 5CERA 2EXBA 3P98A 5M1AA 1KGEA 1MWRA 3A3JA 2ZQ8A 3OZHA 4OPZA 1CI8A 3MXRA 5F82A 4GZBA 3SOIA 2Y2KA 4WEKA 3PTEA 4Y0OA 3Q7VB 1YLJA 3VP3A 4DXCA 4PM5A 3OPHA 5F83A 4WZ5A 1I2WA 1E25A 2WADA 3BEBA 4N1HA 5FSRA 3UPOA 4S2LA 4OVDA 1RGZA 3BFGA 3BRMA 4RVAA 4XUZA 5CGXA 1S6RA 1JVJA 3C7UA 4R4RA 2FFFB 4X69A 1ZKJA 1FSYA 3ZG9B 5KZHA 4KZ9A 2WZXA 4JF4A 3RXXA 1O07A 1QMEA 4Z9QA 1IKGA 4EQIA 1EWZA 1FCNA 2Y2GA 3V3RA 1E4DA 3TSGA 3WS5A 3BFCA 3VSLA 4EBNA 2OSUA 4JXGA 1BLPA 2X01A 3C4PA 2P9VA 1HVBA 4X68A 1K55C 1YLPA 1TDGA 2XF3A 2Y2OA 3IQAA 5BOHA 5HAIA 4X55A 5L2FA 4UA6A 3WS1A 5EE8A 1J9MA 4RYEA 3CZDA 4B4ZA 1K55A 1MWTA 3HL9A 2C5WB 4EUZA 4MBFA 1XX2A 3C4OA 3IF6C 2EX8A 5DF9A 3VFFA 4EBLA 5FQMA 1W7FA 3WS0A 5E2HA 2EXAA 1W8YA 4Y7PA 2XFSA 1XGJA 1WYBA 4GD6A 4HESA 3PAEA 2ZQAA 2ZQCA 3UE0A 5AQ9A 1BULA 1BLCA 2HDUA 4OPYA 3I7JA 4P85A 3B3XA 4P6BA 4X56A 1LHYA 3MKFA 1C3BA 4KG5A 4BD0A 1K4FA 3ZG8B 3TG9A 1HD8A 4DE0A 4WMCA 3HLGA 1PW1A 5DF7A 4UAAA 5EVID 2HDRA 2HPBA 5CHMA 1NXYA 3IF6B 2IWCA 5E43A 3EQVA 4F94A 2ZC4B 3O88A 5IHVA 1K54C 1YMXA 3OC2A 1W5DA 1CI9A 1K6RA 4PMAA 1NY0A 1FR6A 3C5AA 5FASA 3OPLA 5TFQA 5EOOA 3M2JA 4OPRA 4OOMA 5CGSA 1H8YA 4DE2A 5F1FA 1XP4A 3S4XA 5FAQA 3HLBA 3RJUA 1ONHA 4DE1A 2WGVA 4QJGA 1K57A 4HEFA 4E3OA 3BM6A 1WE4A 5CGWA 3UPPA 4H8RA 3IWIA 4QU3A 4S2MA 4UHUA 3MFDA 3V50A 1ES5A 3WRTA 4E3KA 1SDNA 2WGWA 5JYPA 3NDGA 3ISGA 2WYXA 4OLGA 4R3JA 1TDLA 3ZVTA 3ZDJA 4S2KA 1L0FA 2Y2IA 4S2PA 2Y2LA 2OLUA 3IH9A 1ZG6A 1GCEA 3IHBA 5CTMA 4OQGA 5M18A 2V2FF 3QNCA 4K0WA 5FAOA 4BLMA 3FWLA 3NBLA 1PW8A 4KENB 5GHXA 3ZNYA 5CHJA 4EBPA 4MLLA 4E6XA 2WZZA 3QNBA 3S1YA 5KSHA 3OCLA 2WKIA 1Q2PA 3VMAA 4PPRA 5DTKA 4ZJ1A 3IWOA 4LV0A 5I94A 5D3OA 3WS4A 4OH0A 1ESIA 4C75A 3IXGA
chains in the Genus database with same CATH superfamily
4H6JA 2XR0A 2RL3A 3KO6A 3DW0A 3MSHA 4EQ1A 3VP2A 1T18A 1OTAA 3BW6A 2W1TB 2RCXA 1YKDA 3CITA 4PM8A 5HPIA 5TJJA 1MXOA 3KSHA 1TS7A 2Y79A 1IEMA 3VP1A 1N9BA 2H5SA 3FKWA 3IH8A 4DMZA 4E6WA 1LI0A 3U2AA 4X6TA 1PFLA 3O87A 3RFBA 5EECA 5F6AA 4IBXA 2NUPC 3V3SA 1YLZA 3KYQA 3O3VA 4XT2A 4RX2A 5HD5A 1XJ3A 3VOLA 4KQDA 1TS0A 5M19A 3PBNA 1WA9A 2BG1A 3LI8A 1LLBA 1J3WA 1GSWA 2YKHA 3K3CA 1IYPA 4ZAMA 5FQKA 3BFEA 1E3UD 1CEFA 4IVIA 3TRCA 5JYOA 1CQAA 4KG6A 4CLCE 3MR0A 3E98A 5EM1A 1H8MA 1KGGA 4FH2A 1TD5A 1AWIA 2B18A 4U0TA 4ZDXA 2PHYA 3KX0X 5CX7A 2ZQ7A 1L0GA 2GNXA 3DAVA 4R38A 4UQIM 4EESA 4BWIA 5EVEA 2Q9MA 1XA1A 2HJ9C 3MF0A 2XQZA 3F1NB 1CK3A 1MWSA 1MBLA 3VV4A 4JGPA 4KG2A 4K0XA 4R4SA 5HDCA 5EUAA 2WKRA 1O7EA 2DRWA 1XKZA 2KLIA 4HJ6A 1KE4A 3IF5A 4BL2A 3IBJA 3T1SA 2X71A 3PBQA 2VV8A 3W8KA 3LIAA 1QMFA 1YT4A 5HARA 4PAUA 1KVLA 5E2EA 4H6JB 3IHAA 4E3IA 4O0PA 4N1XA 3M2KA 4K08A 2JE5A 3BLMA 3N7WA 3FV7A 2ZL1A 3DTMA 2R9XA 4XUXA 1S66L 1BZAA 3IX3A 4Y17A 4RA7A 2QPNA 4ARZB 3C7VA 2PYPA 2VGJA 2WKEA 4QY6A 1K6SA 4OONA 4R3BA 4FUWA 2Y2QA 2JC7A 1IYQA 5FATA 5HW3A 5IS1A 2AVXA 4XT2B 2ZM8A 3SZTA 2JN7A 3PBSA 3FZCA 2INWA 1RGYA 2R9WA 5GLAA 2J3TD 4EERA 5HWWA 1OT6A 4DF6A 4YFMA 3UE1A 1V9YA 2WAFA 3MZDA 2G2WA 2Z2MB 3D4FA 4BMWA 4WLAA 4OKPA 4GCZA 1ES3A 3S22A 3TW8A 4D60A 4UQIS 2P08A 4PM7A 1EI5A 3NCKA 5HL1A 4C6YA 2WGIA 3PBOA 1G28A 3IT9A 1ODVA 4MNRA 2B5RA 3NJAA 1K38A 3SS3A 2ZOHA 3PAGA 3HUMA 3LY4A 2OOLA 3ITAA 3CUEA 2V8CA 2IWBA 2Y8HA 4NXBA 2PR5A 4B4XA 4S2NC 4E3NA 2XA7M 4QHCA 4QY5A 2Z6CA 5F5YA 3LY3A 4LENA 4Y0UA 5AJGA 2YKFA 5EVLA 4EEUA 4R1GA 1LSVA 1OJ5A 3A3EA 4NEED 4RX3A 3E2LA 4WEJA 2EXBA 3NULA 1KGEA 3LIBA 3MXRA 5IU1A 3C38A 4WEKA 4DJ2A 2JKTM 4MDZA 3UE6A 1E25A 2WADA 3UPOA 1RGZA 3KSFA 3BRMA 2ZL1B 4BBVA 2FFFB 4X69A 3C8CA 1FSYA 3BJNA 4EQIA 3V3RA 1E4DA 4LRYC 1BYWA 3CWFA 3C4PA 1TDGA 2W0NA 3T1XA 5HAIA 4X55A 1K55A 4WF0A 3H9WA 4MBFA 3C4OA 2PDRA 3IF6C 4BBTA 1W7FA 3MXQA 3UB8A 4HH2A 3LIDA 2ZQCA 3UE0A 5AQ9A 4HJ4A 4P6ZS 4P85A 3MKFA 2VX8A 2IA2A 3VE3A 3NHQA 2HDRA 3EQVA 5IHVA 1K54C 4MMNA 1CI9A 4PMAA 1NY0A 3L9KA 4BBUA 5L07A 5TFQA 5G4ZA 3IX8A 3FPVA 5F1FA 4E3OA 2V8FA 3UPPA 4H8RA 4UHUA 1S4SA 3F1OB 4HP4A 3NDGA 2WYXA 4R3JA 4MN6A 3ZDJA 2Y2IA 3KYZA 3T4SA 5HDSA 4OQGA 3KSGA 3QNCA 2WKQA 4KENB 2K2NA 3S1YA 5KSHA 3UB7A 3T50A 4HH3A 3LIFA 4ZJ1A 2VV7A 2XA7S 3WS4A 3H82A 1SHVA 2ZMFA 5GL9A 3WS2A 1SZVA 3SH8A 3HLEA 3NDEA 3QHYA 1W79A 3R7WA 3MZEA 2V1ZA 3MJQA 4OPQA 3S7QA 1N9LA 4WZ5C 3EQUA 4JPMA 3RTYA 1STZA 1BLHA 5GHZA 2V1AA 3DWZA 2W3HA 2EWVA 5GLDA 1BUEA 3LCEA 1NJ4A 2XD5A 2Q9NA 5EVIA 2Y59A 1K0KA 3GTCA 4X1MA 1P9WA 4IBRA 1NZUA 1G5UA 2HDQA 3HJIA 2OLVA 2PAVP 3Q07A 5FI6A 2WUQA 3CG5A 4GOGA 1XFNA 1H3QA 3EGXC 3HBRA 4DDYA 2W3FA 1OJGA 1KGFA 3GRJA 1L0DA 1MPLA 3P09A 1Q2QA 2C6WB 1Z6FA 4KZ7A 1IYSA 4K91A 1KDSA 2EFUA 2A2LA 3RXWA 4JGQA 1G6OA 1SKFA 2XK1A 4LCMA 4E04A 1NRFA 3ITBA 1P97A 2K7SA 4KUOA 5DKLA 1K57C 1L2SA 2XLNA 3FPWA 3NC8A 2KX6A 1FR1A 5E2FA 4CQHA 5J8XA 1ALQA 3HJKA 2A3UA 3HUOA 4EEPA 1MZUA 2EA9A 1PNEA 2VV6A 2E8IA 3JPUA 2P74A 4LRZE 4JF5A 4QPRA 2EX9A 4QD4A 3T1RA 1W63M 4KQRA 5CRFA 4BQMA 1LL9A 4YNRA 4GD8A 3UMDA 3UDIA 1K25A 2V0UA 3QP4A 2GJ3A 4MEZA 1NYMA 1OMEA 2LB9A 2ZC7A 4F3LA 1H0MA 3T4TA 4E3JA 2QHKA 5J4EA 2V20A 4LCLA 2HP6A 1KDWA 5AQBA 1XA7A 2VGKA 2ZLYA 5HPFA 4S2NA 3H82B 4E6XA 3MBZA 5U47A 3VFHA 3Q7VA 3E4PA 3G30A 1RCJA 2J9PA 5DJTA 1SDEA 4HHDA 2O9AA 3TE8A 5F1GA 4G3VA 3EEAA 4JGRA 4U0XA 3V5MA 4Q0IA 4IVKA 1LI9A 3PBTA 3N8RA 4EU0A 2BTFP 5EVIB 1GHPA 3A0RA 4ZRRA 1CF0A 3VP0A 4I38A 3UMEA 3N8LA 5EFWA 3F1PA 1JWVA 1U60A 2CC1A 3O86A 2ZQ9A 4YINA 5TGFA 3VOYA 2UV0E 3MQOA 1H5XA 5L8MA 3BECA 1UWNX 2JCHA 1YQSA 5FDSA 4JXSA 4NXGA 1JNUA 4LGWA 2XRNA 3A3DA 3IF6A 2B95A 3HREA 4N9LA 4KZ3A 1IFQA 5DVAA 4KZBA 2PD8A 3UDFA 1M40A 1L3LA 2ZJ9A 2E8JA 2JKFA 2JKGA 2ZOIA 5A8BA 3G32A 3M6BA 4P87A 5HL6A 1JWZA 3ZNTA 4A5RA 4WYYA 3JYIA 1DY6A 2Y2HA 2FH5A 3W4OA 2WKPA 1BT5A 3P7NA 3UDXA 4D2OA 1PI5A 1K54A 4DE3A 3OPPA 2L4RA 3OPRA 5A92A 3UB9A 1XFQA 2DNSA 1S1ZA 1FILA 2BLSA 3NECA 5LBRA 2WGWB 2XD1A 4X53A 4WM9A 3VP4A 4S2OA 4IUKA 2HJEA 3E2KA 4II7A 4OQHA 1EW0A 3N4IA 3PR6A 1FIKA 1X0OA 4GKUA 3IS2A 5FAPA 5HAQA 2LB5A 3IX4A 4NETA 4L9GA 3MKEA 1ZC2A 4F3LB 1NYYA 3BLSA 3R4KA 3B33A 2A24A 3CJMA 3QP2A 3TOIA 2Y4AA 3B47A 5KMWA 4QWOA 5I5LA 1OTDA 2ZQ8A 1CI8A 3GECA 2Y2KA 3LR3A 3Q7VB 3ULFA 4PM5A 4WZ5A 4PHTA 4N1HA 4NXEA 1LSWA 1TS8A 2O0YA 5KZHA 4KZ9A 1O07A 1EWZA 5AVFA 3WS5A 4JXGA 1BLPA 2JKRI 2X01A 3E4OA 2XF3A 2Y2OA 1OPXA 4ETXA 5EE8A 1J9MA 4RYEA 4L9EA 1W63Q 4EUZA 2EX8A 4ESPA 4EETB 1IOUA 3F1PB 3WS0A 5E2HA 4P6ZM 2EXAA 3BQAA 1XGJA 4GD6A 5TBMA 3PAEA 4OPYA 4P6BA 3TJZC 1LHYA 5G4YA 4KG5A 3QP6A 4WMCA 1PW1A 5EVID 3O5YA 5CHMA 5E43A 3IF6B 2JHEA 4KUKA 2P04A 3OC2A 5FASA 3C5AA 4OOMA 4OPRA 5CGSA 1KOUA 1ONHA 2WGVA 1TS6A 1K57A 2PT7A 3BM6A 2HV1A 5CGWA 1N9NA 4QU3A 4S2MA 1ES5A 3WRTA 1TDLA 3ZVTA 1F98A 1ZG6A 1GCEA 5CTMA 2V2FF 4LLOB 3ZNYA 4MLLA 2WZZA 1YSPA 3OCLA 1Q2PA 3VMAA 4L9FA 4PPRA 3IWOA 5I94A 2P7JA 2H28A 3GDIA 3IXGA 1DP9A 5A90A 3CHWP 3UO9A 5DF8A 3PYPA 1L0EA 2H10A 4JXWA 3B42A 3KSIA 1D1JA 1VHMA 3LEZA 2ZBBA 4GNUA 3IS2B 3WRZA 1GHIA 3ZG5A 4AFIA 4MCWA 1F2KA 4GS9A 3G2YA 4KZAA 4X1LA 2A24B 2PU2A 2Y2NA 4WBGA 4U3TA 2CMNA 1YAXA 1PYYA 3CI6A 4BJPA 5FDHA 2Y2JA 2M1CA 3Q7ZA 4NG2A 1JTGA 1H8ZA 4HQAA 3DBAA 3NOUC 1YMSA 3JVUA 2BASA 4CLCC 3BYDA 5FEGA 4N9KA 4KZ4A 1BLSA 2V1BA 1FCOA 3NY4A 1NLYA 2ZMVA 5FL3A 5FI7A 3HLCA 4I5SA 5E2GA 3SH9A 2I72A 3A3IA 2ZD8A 3K3DA 2PR6A 2PYRA 5HZHA 1AXBA 4MBHA 3ZVWA 1MWUA 1EROA 5TBMB 1T1BA 3IWQA 1T1CA 4FH4A 3Q82A 3UE3A 1PWGA 3AGFA 1VEUA 3CPTA 4HBUA 4FSFA 5AVEA 2EWWA 3RH8B 2HGVA 1GSVA 3OCNA 4FCFA 2M7UA 5TR7A 2J7VA 3KYEA 4DRTA 2VGLM 5FQQA 1V9ZA 4JLFA 4R0QA 3CLOA 4GDNA 1I2SA 2XDMA 5HWTA 4UA9A 2OWHA 1YLTA 5FQIA 2D01A 3CMZA 3D72A 4O8GA 1P0ZA 1Y54A 4I3JA 1M6KA 4FD8A 4G3KA 1SCWA 4OLDA 2OAQ1 3A0VA 4OQ0A 4ZBEA 2W1TA 1TEMA 3LO7A 5DTSA 4DDSA 3FYZA 1ES2A 3MXSA 2H0YA 4WZ4A 4JXVA 4L0LA 1VM1A 5K5BA 2X02A 5EOEA 2QZ6A 2VA0A 5HAPA 2VJWA 1TF1A 4NK3A 4GS9B 3VOZA 3ZCZA 1VQQA 2XFTA 4ME4A 3UN7A 3PBRA 3GR2A 5EM0A 3G2ZA 4DKIA 3Q81A 1MKIA 1P9RA 4LV3A 3UB5P 1XGIA 3GMWA 1ZG4A 5AQ7A 3E0YA 2JKTI 3PXPA 4NXFA 1Y4OA 1K4EA 4EXOA 4Y0TA 4N92A 4IEDA 4DXBA 2PU4A 2PD7A 4OQIA 1NLZA 2Y91A 5BOHA 2J8YA 1D06A 3MQ0A 4YOFA 4ZJ3A 3MZFA 1S4RA 4JGOA 5DTTA 4I3AA 3NOPC 1YM1A 3OOVA 3VSKA 2W1RA 2Z2LB 4KZ5A 4EWFA 3V67A 3LI9A 4LFUA 5CECA 3LEQA 4GDBA 2OAP1 1KVMA 2V9AA 3E4QA 1XXMA 3IXDA 3CPTB 4Y15A 5CEBA 5FA7A 2Q0OA 2VGLS 3W4QA 4B93A 1PRQA 4PKYG 1FQGA 2HP9A 4HNBA 2XEPA 1YLWA 4HI4A 2ACGA 1K56A 3QP1A 1DRMA 4HBTA 3GVBA 3WWXA 5HFOA 5G18A 1XJ4A 3SW1A 3HLWA 3DTIA 3IBRA 4WMCD 3FC7A 4PM9A 3D3OA 4MBKA 5CHUA 1IELA 3FKVA 1OTEA 3R7WB 3LR5A 3P98A 5M1AA 1MWRA 2B02A 1HLUP 3T1QB 2VEAA 5F82A 3SOIA 3T12B 4Y0OA 1YLJA 1MKMA 2JKRM 3VP3A 1SKOA 4Y5FA 3MFXA 4EW7A 4ARZA 5FSRA 4S2LA 4R6LA 3BFGA 4GW9A 4RVAA 1S6RA 3C7UA 4GJ4A 4R4RA 3EOIA 1ZKJA 2WZXA 4JF4A 3RXXA 1QMEA 1IKGA 3DTKA 2Y2GA 4FTXA 1ZHHB 4Y13A 3T4KA 4LPZA 3H7WA 2P9VA 4X68A 1HVBA 1K55C 4Y2FA 1DP8A 3WS1A 2MJ6A 4B4ZA 1MWTA 3HL9A 2C5WB 1XX2A 5DF9A 4EBLA 3LR4A 5FQMA 4CLCA 1S1YA 2FZ0A 1W8YA 4Y7PA 2XFSA 1WYBA 4HESA 4IJGA 2ZQAA 1BULA 2O9CA 3B3XA 2VZWA 3TG9A 1HD8A 4DE0A 4DN0A 2R78A 5DF7A 4UAAA 1UWPX 2GX5A 4Q0HA 2W3DA 1MC0A 3MS6A 1YMXA 1W5DA 1DP6A 3M2JA 1H8YA 1ZTUA 2W27A 3BQ8A 4DE2A 3S4XA 3T4JA 1UGUA 4HEFA 5IT5A 3IWIA 3MFDA 4OLGA 4S2KA 4S2PA 2Y2LA 2OLUA 2QKPA 3IHBA 4K0WA 5FAOA 3FWLA 3NBLA 5CHJA 1D7EA 4M4XA 1T19A 4RQ9A 2WKIA 5DTKA 3D9YA 4LV0A 5M18A 1VETA 2J3TC 4XXRA 2WAEA 1ACFA 2H0TA 3BY9A 3ZGAB 1GA9A 1OT9A 3NIAA 1GSXA 4WELA 2Y2MA 3OLOA 3GV9A 2HZ5A 3S7NA 5L09A 4UA7A 2ZMAA 4KZ6A 4EV4A 5EVIC 3BFFA 4MN7A 5CTNA 3ZG7B 1DJAA 3K2NA 3W4PA 3HVFA 5AQAA 4KQQA 2HDSA 4FOFA 5CXWA 2Y55A 4HJ3A 2GZAA 1SKOB 1PWDA 1ES4A 2OWJA 3UPNA 5FQ9A 4HY8A 3T4OA 1XPBA 4HIAA 1DJCA 2GDNA 1F9IA 5HDDA 3C2WA 3PHYA 3GSGA 3H7WB 2P9VB 4DJ3A 3IXBA 4OP5A 3UY6A 1CJFA 1Z09A 5HSQA 1OTIA 2M7VA 1RP5A 3V39A 4BL3A 2QWSA 5GLCA 3SS4A 4HP9A 2ZC6B 1ERMA 4CLCB 4IHQA 4QB8A 1N4OA 3BWLA 3LUQA 3L7HA 2VKSA 3W2ZA 5DFYA 3NI9A 4MN5A 1S0WA 1N9OA 4M3KA 1G6AA 5EPHA 1CEGA 2J9OA 3SS5A 2G2UA 5A93A 4ID4A 3F1OA 1PZPA 3HLDA 4CPKA 3GQZA 2ZQDA 1NZOA 1HTZA 4ZJ2A 1PI4A 3IXHA 3N6IA 4OP8A 1G68A 4Z1WA 2HP5A 2ZM0A 1ERQA 2PBYA 2W3GA 4LRXC 3EEHA 5F68A 4JKTA 4Q8IA 2PBDP 4GB7A 1Y28A 4KQOA 5FEFA 5EV0A 4LV1A 1YPRA 2XROA 4JBFA 4C3QA 4LV2A 3ZQ5A 3N8SA 5A91A 1FCMA 1VETB 2L1MA 5FQJA 1E3UA 1GA0A 1YSQA 3ZFZA 2JBFA 2IWDA 4HOIA 1JTDA 1VB6A 2VK3A 4IUHA 5GLBA 1PZOA 3G35A 3A0SA 2DCFA 2W3EA 4Q0JA 3G31A 1KE0A 4O7DA 1WYCA 1I5QA 1PIOA 1JWPA 5L10A 5J7EA 5DKKA 3HLFA 1HZOA 2XSSA 2EX2A 4PM6A 2ZC5B 1K56D 2J80A 2WKHA 4GHIA 1LT0A 4P0MA 5MC7A 3HCYA 5J3WA 3LIEA 1FSWA 2OV5A 2XGNA 5HX9A 5GHYA 3Q1FA 3LFVA 4BENA 1IYOA 2O9BA 1W8QA 1BTLA 4R23A 2A49A 1LL8A 4X25A 4YWZA 3BFDA 3M6HA 4KZ8A 4WN5A 3JVVA 3T4QA 3DTEA 1YLYA 2FFYA 5HD3A 2VLGA 3AGEA 4G3WA 2WK0A 3EGDC 5FI2A 5DJUA 4GN2A 5CEDA 4OOYA 1XJ6A 3OBFA 1GHMA 4PKYA 3LICA 3HUNA 2EX6A 4JF6A 2O99A 3CAXA 3ICYA 2EFXA 4ZTKA 3SH7A 5F69A 1S67L 1T1AA 4CJNA 4B9OA 2ZC3B 4B88A 1NRJA 2NUTC 3G6OA 4E3MA 3LYXA 1KE3A 2QMIA 1ONGA 2UWXA 3VE4A 4CLCD 4OOLA 1LSXA 2DMWA 2QJ7A 1ESUA 2ZM2A 1TVFA 1LL5A 2Y2PA 1IKIA 3P01A 2XH9A 1MY8A 3LGOA 4S2IA 3T4LA 1BSGA 1DJBA 5KSCA 3AGDA 3ZHHA 3G4PA 1PWCA 2I9VA 3DWKA 3A3FA 1FOFA 3UNWA 2HF6A 4S2JA 4BD1A 3ZG0A 2QYBA 4E3LA 3G34A 5CERA 4Y3IA 2PRFA 3A3JA 3LR0A 3OZHA 4OPZA 2V0WA 4GZBA 5HWVA 2J3WA 3PTEA 4UEYA 4DXCA 2K31A 3OPHA 5F83A 1I2WA 2L0WA 3BEBA 3MMHA 4OVDA 1F5MA 2D02A 4XUZA 5CGXA 1JVJA 3UB6A 3ZG9B 1A0KA 4ETZA 4Z9QA 3C30A 1FCNA 3FG8A 3TSGA 3BFCA 3VSLA 4EBNA 2OSUA 1YLPA 4NKPA 3IQAA 5L2FA 4UA6A 4EUVA 3CZDA 4GHIB 3VFFA 1XJ2A 3MQQA 3NOTC 4I39A 3QP5A 2QJ5A 4WL9A 1BLCA 2HDUA 3I7JA 4X56A 1C3BA 5DFXA 5C5KA 4BD0A 1K4FA 3ZG8B 4O01A 3HLGA 3ZYTA 3QP8A 5KIZA 2KDKA 2G7UA 2HPBA 4WUJA 3S7PA 1NXYA 4F94A 2IWCA 2ZC4B 3O88A 4I3IA 2Z6DA 3BY8A 3F1NA 1K6RA 1FR6A 3OPLA 1VEUB 5EOOA 1XP4A 5FAQA 3HLBA 3RJUA 4DE1A 4GLQA 4QJGA 3EWKA 1WE4A 3CUEC 3V50A 4R70A 5JYPA 4E3KA 1SDNA 2WGWA 3ISGA 4R3AA 1L0FA 3IH9A 4BLMA 3S7OA 1PW8A 4EBPA 5GHXA 2KOIA 3U4LP 3QNBA 1OTBA 1NWZA 5D3OA 4OH0A 1ESIA 4C75A
chains in the Genus database with same CATH topology
1SHVA 2XR0A 2RL3A 4XXRA 5GL9A 5A90A 3WS2A 3UO9A 5DF8A 2WAEA 3DW0A 3SH8A 2H0TA 3ZGAB 3HLEA 1GA9A 3NDEA 3QHYA 3VP2A 1L0EA 1W79A 2H10A 4JXWA 3MZEA 2V1ZA 3NIAA 3LEZA 4GNUA 4OPQA 4WELA 3WRZA 2Y2MA 4WZ5C 1GHIA 3ZG5A 3GV9A 3EQUA 4JPMA 2RCXA 4PM8A 4UA7A 1BLHA 3G2YA 4KZAA 1MXOA 5GHZA 2ZMAA 4KZ6A 4EV4A 3DWZA 5EVIC 3BFFA 5CTNA 5GLDA 2PU2A 2Y2NA 1BUEA 3LCEA 3ZG7B 1NJ4A 2XD5A 1DJAA 2Q9NA 4WBGA 3W4PA 4U3TA 5EVIA 1IEMA 2Y59A 3HVFA 5AQAA 4KQQA 3VP1A 3GTCA 4IBRA 1NZUA 2HDSA 1PYYA 4BJPA 1N9BA 2H5SA 3FKWA 3IH8A 5CXWA 2Y55A 4E6WA 1LI0A 5FDHA 2HDQA 2Y2JA 1PWDA 4X6TA 3O87A 3Q7ZA 1JTGA 2OLVA 1H8ZA 3Q07A 5FI6A 2WUQA 1ES4A 5EECA 1YMSA 3UPNA 3CG5A 5FQ9A 4IBXA 4GOGA 3V3SA 3BYDA 1XPBA 1YLZA 3HBRA 3O3VA 4N9KA 4RX2A 4DDYA 4KZ4A 1BLSA 1KGFA 1DJCA 3GRJA 2GDNA 5M19A 3PBNA 1FCOA 2BG1A 3NY4A 1LLBA 1L0DA 3GSGA 2P9VB 1MPLA 3IXBA 3P09A 4OP5A 1Q2QA 3UY6A 1IYPA 2C6WB 1Z6FA 4ZAMA 3HLCA 5FI7A 5FQKA 3BFEA 4KZ7A 1IYSA 1RP5A 1E3UD 1CEFA 5E2GA 2I72A 3SH9A 4IVIA 3A3IA 3V39A 2ZD8A 4K91A 5JYOA 4KG6A 4BL3A 1KDSA 2EFUA 3RXWA 5GLCA 3SS4A 2ZC6B 1ERMA 1AXBA 4MBHA 3ZVWA 1MWUA 1EROA 4QB8A 1KGGA 1N4OA 4FH2A 1SKFA 2XK1A 4U0TA 4LCMA 4ZDXA 1NRFA 3ITBA 3IWQA 4FH4A 3Q82A 3NI9A 3UE3A 1PWGA 1K57C 2ZQ7A 1L2SA 1S0WA 2XLNA 3AGFA 1L0GA 3NC8A 1FR1A 4HBUA 4M3KA 5E2FA 2Q9MA 1G6AA 4FSFA 5EPHA 5J8XA 1CEGA 2J9OA 3SS5A 1ALQA 1XA1A 2XQZA 2G2UA 1CK3A 5A93A 2A3UA 3HUOA 4ID4A 3OCNA 1MWSA 2E8IA 1MBLA 4FCFA 2P74A 4JF5A 5TR7A 2EX9A 4QD4A 2J7VA 4DRTA 1PZPA 4KQRA 3HLDA 4KG2A 4CPKA 4K0XA 5CRFA 3GQZA 2ZQDA 1NZOA 1HTZA 5FQQA 4ZJ2A 1LL9A 4JLFA 4R0QA 4R4SA 4BQMA 1PI4A 3IXHA 3N6IA 4OP8A 1G68A 4GD8A 4GDNA 1I2SA 5EUAA 2HP5A 2XDMA 2ZM0A 3UDIA 1K25A 4UA9A 1ERQA 1O7EA 1YLTA 2DRWA 2PBYA 1XKZA 5FQIA 4Q8IA 4JKTA 4MEZA 3CMZA 1NYMA 1OMEA 4GB7A 1KE4A 3IF5A 4KQOA 2ZC7A 4BL2A 4E3JA 2V20A 1Y54A 4LCLA 2X71A 3PBQA 2HP6A 4LV1A 3W8KA 1M6KA 4FD8A 1SCWA 1KDWA 4OLDA 5AQBA 4JBFA 4C3QA 1XA7A 1QMFA 2VGKA 2ZLYA 4LV2A 1YT4A 5HARA 4OQ0A 4ZBEA 3N8SA 1KVLA 1TEMA 3LO7A 1FCMA 4S2NA 5DTSA 5E2EA 3FYZA 3MBZA 5A91A 5U47A 3Q7VA 3IHAA 1ES2A 3VFHA 5FQJA 3MXSA 4E3IA 1E3UA 2H0YA 1GA0A 3G30A 4JXVA 4WZ4A 4L0LA 1RCJA 1VM1A 4N1XA 3M2KA 3ZFZA 2X02A 2JBFA 2JE5A 4DDSA 5EOEA 3BLMA 2QZ6A 3N7WA 2IWDA 2J9PA 3FV7A 1JTDA 5GLBA 1PZOA 1SDEA 3DTMA 2R9XA 3G35A 4XUXA 5HAPA 2DCFA 5F1GA 1BZAA 3G31A 4NK3A 4RA7A 1KE0A 4O7DA 4U0XA 1WYCA 3VOZA 1I5QA 2QPNA 3ZCZA 1PIOA 3V5MA 1JWPA 4IVKA 1LI9A 3HLFA 3PBTA 1HZOA 1VQQA 3C7VA 2EX2A 4PM6A 2ZC5B 1K56D 2XFTA 3N8RA 3UN7A 3PBRA 5EVIB 1GHPA 2WKHA 3GR2A 2OV5A 3G2ZA 2VGJA 2WKEA 4QY6A 4P0MA 1K6SA 4OONA 4R3BA 3VP0A 3N8LA 4DKIA 3Q81A 1MKIA 4LV3A 1FSWA 1XGIA 1JWVA 1U60A 2CC1A 3GMWA 3O86A 2Y2QA 2ZQ9A 4YINA 1ZG4A 2JC7A 2XGNA 5HX9A 5GHYA 1IYQA 5FATA 3Q1FA 5AQ7A 3VOYA 1H5XA 3BECA 4BENA 5HW3A 1IYOA 1W8QA 1BTLA 1K4EA 4R23A 2ZM8A 2A49A 3PBSA 4Y0TA 2JCHA 3FZCA 1RGYA 2R9WA 1YQSA 3BFDA 3M6HA 5GLAA 4N92A 4IEDA 4JXSA 4KZ8A 4DXBA 4DF6A 2PU4A 4YFMA 4OQIA 2Y91A 1YLYA 3UE1A 2FFYA 3A3DA 2J8YA 3IF6A 3HREA 2WAFA 3MZDA 4KZ3A 4N9LA 4ZJ3A 3AGEA 2G2WA 2Z2MB 3MZFA 4KZBA 5DVAA 3D4FA 3UDFA 5DTTA 1M40A 2ZJ9A 4OKPA 2WK0A 1YM1A 3G32A 3VSKA 3M6BA 4P87A 2Z2LB 4KZ5A 5FI2A 4EWFA 1JWZA 4GN2A 1ES3A 5CEDA 3S22A 4OOYA 3ZNTA 1GHMA 4A5RA 5CECA 4WYYA 3JYIA 4PM7A 3HUNA 1DY6A 2EX6A 2Y2HA 4JF6A 3W4OA 4GDBA 1BT5A 1EI5A 3UDXA 4D2OA 3NCKA 1KVMA 2EFXA 4ZTKA 5HL1A 1PI5A 4C6YA 1XXMA 1K54A 3SH7A 3OPPA 3OPRA 3IXDA 2WGIA 3PBOA 4DE3A 5CEBA 4CJNA 3IT9A 2ZC3B 5A92A 5FA7A 4MNRA 3W4QA 4B88A 2B5RA 2DNSA 1K38A 4E3MA 3SS3A 1FQGA 1KE3A 2BLSA 2HP9A 2WGWB 1ONGA 2QMIA 2UWXA 2XD1A 1YLWA 2XEPA 3HUMA 3PAGA 4OOLA 4X53A 3LY4A 5TGFA 3ITAA 1ESUA 1K56A 2ZM2A 4WM9A 4S2OA 2IWBA 1TVFA 1LL5A 2Y2PA 3VP4A 3E2KA 1IKIA 4HBTA 2XH9A 3GVBA 4OQHA 3N4IA 1MY8A 4S2IA 3WWXA 5HFOA 4B4XA 5G18A 4S2NC 1BSGA 1DJBA 4E3NA 3AGDA 4GKUA 3HLWA 5KSCA 4QHCA 4QY5A 3ZHHA 4WMCD 3G4PA 4PM9A 5FAPA 3LY3A 1PWCA 5HAQA 4NETA 3DWKA 4LENA 3A3FA 3MKEA 4Y0UA 1FOFA 3UNWA 1ZC2A 5EVLA 1NYYA 3BLSA 4MBKA 4S2JA 4BD1A 4R1GA 3CJMA 5CHUA 3ZG0A 3A3EA 2Y4AA 3TOIA 4RX3A 3E2LA 1IELA 5KMWA 3FKVA 4WEJA 3G34A 4E3LA 5CERA 2EXBA 3P98A 5M1AA 1KGEA 1MWRA 3A3JA 2ZQ8A 3OZHA 4OPZA 1CI8A 3MXRA 5F82A 4GZBA 3SOIA 2Y2KA 4WEKA 3PTEA 4Y0OA 3Q7VB 1YLJA 3VP3A 4DXCA 4PM5A 3OPHA 5F83A 4WZ5A 1I2WA 1E25A 2WADA 3BEBA 4N1HA 5FSRA 3UPOA 4S2LA 4OVDA 1RGZA 3BFGA 3BRMA 4RVAA 4XUZA 5CGXA 1S6RA 1JVJA 3C7UA 4R4RA 2FFFB 4X69A 1ZKJA 1FSYA 3ZG9B 5KZHA 4KZ9A 2WZXA 4JF4A 3RXXA 1O07A 1QMEA 4Z9QA 1IKGA 4EQIA 1EWZA 1FCNA 2Y2GA 3V3RA 1E4DA 3TSGA 3WS5A 3BFCA 3VSLA 4EBNA 2OSUA 4JXGA 1BLPA 2X01A 3C4PA 2P9VA 1HVBA 4X68A 1K55C 1YLPA 1TDGA 2XF3A 2Y2OA 3IQAA 5BOHA 5HAIA 4X55A 5L2FA 4UA6A 3WS1A 5EE8A 1J9MA 4RYEA 3CZDA 4B4ZA 1K55A 1MWTA 3HL9A 2C5WB 4EUZA 4MBFA 1XX2A 3C4OA 3IF6C 2EX8A 5DF9A 3VFFA 4EBLA 5FQMA 1W7FA 3WS0A 5E2HA 2EXAA 1W8YA 4Y7PA 2XFSA 1XGJA 1WYBA 4GD6A 4HESA 3PAEA 2ZQAA 2ZQCA 3UE0A 5AQ9A 1BULA 1BLCA 2HDUA 4OPYA 3I7JA 4P85A 3B3XA 4P6BA 4X56A 1LHYA 3MKFA 1C3BA 4KG5A 4BD0A 1K4FA 3ZG8B 3TG9A 1HD8A 4DE0A 4WMCA 3HLGA 1PW1A 5DF7A 4UAAA 5EVID 2HDRA 2HPBA 5CHMA 1NXYA 3IF6B 2IWCA 5E43A 3EQVA 4F94A 2ZC4B 3O88A 5IHVA 1K54C 1YMXA 3OC2A 1W5DA 1CI9A 1K6RA 4PMAA 1NY0A 1FR6A 3C5AA 5FASA 3OPLA 5TFQA 5EOOA 3M2JA 4OPRA 4OOMA 5CGSA 1H8YA 4DE2A 5F1FA 1XP4A 3S4XA 5FAQA 3HLBA 3RJUA 1ONHA 4DE1A 2WGVA 4QJGA 1K57A 4HEFA 4E3OA 3BM6A 1WE4A 5CGWA 3UPPA 4H8RA 3IWIA 4QU3A 4S2MA 4UHUA 3MFDA 3V50A 1ES5A 3WRTA 4E3KA 1SDNA 2WGWA 5JYPA 3NDGA 3ISGA 2WYXA 4OLGA 4R3JA 1TDLA 3ZVTA 3ZDJA 4S2KA 1L0FA 2Y2IA 4S2PA 2Y2LA 2OLUA 3IH9A 1ZG6A 1GCEA 3IHBA 5CTMA 4OQGA 5M18A 2V2FF 3QNCA 4K0WA 5FAOA 4BLMA 3FWLA 3NBLA 1PW8A 4KENB 5GHXA 3ZNYA 5CHJA 4EBPA 4MLLA 4E6XA 2WZZA 3QNBA 3S1YA 5KSHA 3OCLA 2WKIA 1Q2PA 3VMAA 4PPRA 5DTKA 4ZJ1A 3IWOA 4LV0A 5I94A 5D3OA 3WS4A 4OH0A 1ESIA 4C75A 3IXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHV A;  2XR0 A;  2RL3 A;  4XXR A;  5GL9 A;  5A90 A;  3WS2 A;  3UO9 A;  5DF8 A;  2WAE A;  3DW0 A;  3SH8 A;  2H0T A;  3ZGA B;  3HLE A;  1GA9 A;  3NDE A;  3QHY A;  3VP2 A;  1L0E A;  1W79 A;  2H10 A;  4JXW A;  3MZE A;  2V1Z A;  3NIA A;  3LEZ A;  4GNU A;  4OPQ A;  4WEL A;  3WRZ A;  2Y2M A;  4WZ5 C;  1GHI A;  3ZG5 A;  3GV9 A;  3EQU A;  4JPM A;  2RCX A;  4PM8 A;  4UA7 A;  1BLH A;  3G2Y A;  4KZA A;  1MXO A;  5GHZ A;  2ZMA A;  4KZ6 A;  4EV4 A;  3DWZ A;  5EVI C;  3BFF A;  5CTN A;  5GLD A;  2PU2 A;  2Y2N A;  1BUE A;  3LCE A;  3ZG7 B;  1NJ4 A;  2XD5 A;  1DJA A;  2Q9N A;  4WBG A;  3W4P A;  4U3T A;  5EVI A;  1IEM A;  2Y59 A;  3HVF A;  5AQA A;  4KQQ A;  3VP1 A;  3GTC A;  4IBR A;  1NZU A;  2HDS A;  1PYY A;  4BJP A;  1N9B A;  2H5S A;  3FKW A;  3IH8 A;  5CXW A;  2Y55 A;  4E6W A;  1LI0 A;  5FDH A;  2HDQ A;  2Y2J A;  1PWD A;  4X6T A;  3O87 A;  3Q7Z A;  1JTG A;  2OLV A;  1H8Z A;  3Q07 A;  5FI6 A;  2WUQ A;  1ES4 A;  5EEC A;  1YMS A;  3UPN A;  3CG5 A;  5FQ9 A;  4IBX A;  4GOG A;  3V3S A;  3BYD A;  1XPB A;  1YLZ A;  3HBR A;  3O3V A;  4N9K A;  4RX2 A;  4DDY A;  4KZ4 A;  1BLS A;  1KGF A;  1DJC A;  3GRJ A;  2GDN A;  5M19 A;  3PBN A;  1FCO A;  2BG1 A;  3NY4 A;  1LLB A;  1L0D A;  3GSG A;  2P9V B;  1MPL A;  3IXB A;  3P09 A;  4OP5 A;  1Q2Q A;  3UY6 A;  1IYP A;  2C6W B;  1Z6F A;  4ZAM A;  3HLC A;  5FI7 A;  5FQK A;  3BFE A;  4KZ7 A;  1IYS A;  1RP5 A;  1E3U D;  1CEF A;  5E2G A;  2I72 A;  3SH9 A;  4IVI A;  3A3I A;  3V39 A;  2ZD8 A;  4K91 A;  5JYO A;  4KG6 A;  4BL3 A;  1KDS A;  2EFU A;  3RXW A;  5GLC A;  3SS4 A;  2ZC6 B;  1ERM A;  1AXB A;  4MBH A;  3ZVW A;  1MWU A;  1ERO A;  4QB8 A;  1KGG A;  1N4O A;  4FH2 A;  1SKF A;  2XK1 A;  4U0T A;  4LCM A;  4ZDX A;  1NRF A;  3ITB A;  3IWQ A;  4FH4 A;  3Q82 A;  3NI9 A;  3UE3 A;  1PWG A;  1K57 C;  2ZQ7 A;  1L2S A;  1S0W A;  2XLN A;  3AGF A;  1L0G A;  3NC8 A;  1FR1 A;  4HBU A;  4M3K A;  5E2F A;  2Q9M A;  1G6A A;  4FSF A;  5EPH A;  5J8X A;  1CEG A;  2J9O A;  3SS5 A;  1ALQ A;  1XA1 A;  2XQZ A;  2G2U A;  1CK3 A;  5A93 A;  2A3U A;  3HUO A;  4ID4 A;  3OCN A;  1MWS A;  2E8I A;  1MBL A;  4FCF A;  2P74 A;  4JF5 A;  5TR7 A;  2EX9 A;  4QD4 A;  2J7V A;  4DRT A;  1PZP A;  4KQR A;  3HLD A;  4KG2 A;  4CPK A;  4K0X A;  5CRF A;  3GQZ A;  2ZQD A;  1NZO A;  1HTZ A;  5FQQ A;  4ZJ2 A;  1LL9 A;  4JLF A;  4R0Q A;  4R4S A;  4BQM A;  1PI4 A;  3IXH A;  3N6I A;  4OP8 A;  1G68 A;  4GD8 A;  4GDN A;  1I2S A;  5EUA A;  2HP5 A;  2XDM A;  2ZM0 A;  3UDI A;  1K25 A;  4UA9 A;  1ERQ A;  1O7E A;  1YLT A;  2DRW A;  2PBY A;  1XKZ A;  5FQI A;  4Q8I A;  4JKT A;  4MEZ A;  3CMZ A;  1NYM A;  1OME A;  4GB7 A;  1KE4 A;  3IF5 A;  4KQO A;  2ZC7 A;  4BL2 A;  4E3J A;  2V20 A;  1Y54 A;  4LCL A;  2X71 A;  3PBQ A;  2HP6 A;  4LV1 A;  3W8K A;  1M6K A;  4FD8 A;  1SCW A;  1KDW A;  4OLD A;  5AQB A;  4JBF A;  4C3Q A;  1XA7 A;  1QMF A;  2VGK A;  2ZLY A;  4LV2 A;  1YT4 A;  5HAR A;  4OQ0 A;  4ZBE A;  3N8S A;  1KVL A;  1TEM A;  3LO7 A;  1FCM A;  4S2N A;  5DTS A;  5E2E A;  3FYZ A;  3MBZ A;  5A91 A;  5U47 A;  3Q7V A;  3IHA A;  1ES2 A;  3VFH A;  5FQJ A;  3MXS A;  4E3I A;  1E3U A;  2H0Y A;  1GA0 A;  3G30 A;  4JXV A;  4WZ4 A;  4L0L A;  1RCJ A;  1VM1 A;  4N1X A;  3M2K A;  3ZFZ A;  2X02 A;  2JBF A;  2JE5 A;  4DDS A;  5EOE A;  3BLM A;  2QZ6 A;  3N7W A;  2IWD A;  2J9P A;  3FV7 A;  1JTD A;  5GLB A;  1PZO A;  1SDE A;  3DTM A;  2R9X A;  3G35 A;  4XUX A;  5HAP A;  2DCF A;  5F1G A;  1BZA A;  3G31 A;  4NK3 A;  4RA7 A;  1KE0 A;  4O7D A;  4U0X A;  1WYC A;  3VOZ A;  1I5Q A;  2QPN A;  3ZCZ A;  1PIO A;  3V5M A;  1JWP A;  4IVK A;  1LI9 A;  3HLF A;  3PBT A;  1HZO A;  1VQQ A;  3C7V A;  2EX2 A;  4PM6 A;  2ZC5 B;  1K56 D;  2XFT A;  3N8R A;  3UN7 A;  3PBR A;  5EVI B;  1GHP A;  2WKH A;  3GR2 A;  2OV5 A;  3G2Z A;  2VGJ A;  2WKE A;  4QY6 A;  4P0M A;  1K6S A;  4OON A;  4R3B A;  3VP0 A;  3N8L A;  4DKI A;  3Q81 A;  1MKI A;  4LV3 A;  1FSW A;  1XGI A;  1JWV A;  1U60 A;  2CC1 A;  3GMW A;  3O86 A;  2Y2Q A;  2ZQ9 A;  4YIN A;  1ZG4 A;  2JC7 A;  2XGN A;  5HX9 A;  5GHY A;  1IYQ A;  5FAT A;  3Q1F A;  5AQ7 A;  3VOY A;  1H5X A;  3BEC A;  4BEN A;  5HW3 A;  1IYO A;  1W8Q A;  1BTL A;  1K4E A;  4R23 A;  2ZM8 A;  2A49 A;  3PBS A;  4Y0T A;  2JCH A;  3FZC A;  1RGY A;  2R9W A;  1YQS A;  3BFD A;  3M6H A;  5GLA A;  4N92 A;  4IED A;  4JXS A;  4KZ8 A;  4DXB A;  4DF6 A;  2PU4 A;  4YFM A;  4OQI A;  2Y91 A;  1YLY A;  3UE1 A;  2FFY A;  3A3D A;  2J8Y A;  3IF6 A;  3HRE A;  2WAF A;  3MZD A;  4KZ3 A;  4N9L A;  4ZJ3 A;  3AGE A;  2G2W A;  2Z2M B;  3MZF A;  4KZB A;  5DVA A;  3D4F A;  3UDF A;  5DTT A;  1M40 A;  2ZJ9 A;  4OKP A;  2WK0 A;  1YM1 A;  3G32 A;  3VSK A;  3M6B A;  4P87 A;  2Z2L B;  4KZ5 A;  5FI2 A;  4EWF A;  1JWZ A;  4GN2 A;  1ES3 A;  5CED A;  3S22 A;  4OOY A;  3ZNT A;  1GHM A;  4A5R A;  5CEC A;  4WYY A;  3JYI A;  4PM7 A;  3HUN A;  1DY6 A;  2EX6 A;  2Y2H A;  4JF6 A;  3W4O A;  4GDB A;  1BT5 A;  1EI5 A;  3UDX A;  4D2O A;  3NCK A;  1KVM A;  2EFX A;  4ZTK A;  5HL1 A;  1PI5 A;  4C6Y A;  1XXM A;  1K54 A;  3SH7 A;  3OPP A;  3OPR A;  3IXD A;  2WGI A;  3PBO A;  4DE3 A;  5CEB A;  4CJN A;  3IT9 A;  2ZC3 B;  5A92 A;  5FA7 A;  4MNR A;  3W4Q A;  4B88 A;  2B5R A;  2DNS A;  1K38 A;  4E3M A;  3SS3 A;  1FQG A;  1KE3 A;  2BLS A;  2HP9 A;  2WGW B;  1ONG A;  2QMI A;  2UWX A;  2XD1 A;  1YLW A;  2XEP A;  3HUM A;  3PAG A;  4OOL A;  4X53 A;  3LY4 A;  5TGF A;  3ITA A;  1ESU A;  1K56 A;  2ZM2 A;  4WM9 A;  4S2O A;  2IWB A;  1TVF A;  1LL5 A;  2Y2P A;  3VP4 A;  3E2K A;  1IKI A;  4HBT A;  2XH9 A;  3GVB A;  4OQH A;  3N4I A;  1MY8 A;  4S2I A;  3WWX A;  5HFO A;  4B4X A;  5G18 A;  4S2N C;  1BSG A;  1DJB A;  4E3N A;  3AGD A;  4GKU A;  3HLW A;  5KSC A;  4QHC A;  4QY5 A;  3ZHH A;  4WMC D;  3G4P A;  4PM9 A;  5FAP A;  3LY3 A;  1PWC A;  5HAQ A;  4NET A;  3DWK A;  4LEN A;  3A3F A;  3MKE A;  4Y0U A;  1FOF A;  3UNW A;  1ZC2 A;  5EVL A;  1NYY A;  3BLS A;  4MBK A;  4S2J A;  4BD1 A;  4R1G A;  3CJM A;  5CHU A;  3ZG0 A;  3A3E A;  2Y4A A;  3TOI A;  4RX3 A;  3E2L A;  1IEL A;  5KMW A;  3FKV A;  4WEJ A;  3G34 A;  4E3L A;  5CER A;  2EXB A;  3P98 A;  5M1A A;  1KGE A;  1MWR A;  3A3J A;  2ZQ8 A;  3OZH A;  4OPZ A;  1CI8 A;  3MXR A;  5F82 A;  4GZB A;  3SOI A;  2Y2K A;  4WEK A;  3PTE A;  4Y0O A;  3Q7V B;  1YLJ A;  3VP3 A;  4DXC A;  4PM5 A;  3OPH A;  5F83 A;  4WZ5 A;  1I2W A;  1E25 A;  2WAD A;  3BEB A;  4N1H A;  5FSR A;  3UPO A;  4S2L A;  4OVD A;  1RGZ A;  3BFG A;  3BRM A;  4RVA A;  4XUZ A;  5CGX A;  1S6R A;  1JVJ A;  3C7U A;  4R4R A;  2FFF B;  4X69 A;  1ZKJ A;  1FSY A;  3ZG9 B;  5KZH A;  4KZ9 A;  2WZX A;  4JF4 A;  3RXX A;  1O07 A;  1QME A;  4Z9Q A;  1IKG A;  4EQI A;  1EWZ A;  1FCN A;  2Y2G A;  3V3R A;  1E4D A;  3TSG A;  3WS5 A;  3BFC A;  3VSL A;  4EBN A;  2OSU A;  4JXG A;  1BLP A;  2X01 A;  3C4P A;  2P9V A;  1HVB A;  4X68 A;  1K55 C;  1YLP A;  1TDG A;  2XF3 A;  2Y2O A;  3IQA A;  5BOH A;  5HAI A;  4X55 A;  5L2F A;  4UA6 A;  3WS1 A;  5EE8 A;  1J9M A;  4RYE A;  3CZD A;  4B4Z A;  1K55 A;  1MWT A;  3HL9 A;  2C5W B;  4EUZ A;  4MBF A;  1XX2 A;  3C4O A;  3IF6 C;  2EX8 A;  5DF9 A;  3VFF A;  4EBL A;  5FQM A;  1W7F A;  3WS0 A;  5E2H A;  2EXA A;  1W8Y A;  4Y7P A;  2XFS A;  1XGJ A;  1WYB A;  4GD6 A;  4HES A;  3PAE A;  2ZQA A;  2ZQC A;  3UE0 A;  5AQ9 A;  1BUL A;  1BLC A;  2HDU A;  4OPY A;  3I7J A;  4P85 A;  3B3X A;  4P6B A;  4X56 A;  1LHY A;  3MKF A;  1C3B A;  4KG5 A;  4BD0 A;  1K4F A;  3ZG8 B;  3TG9 A;  1HD8 A;  4DE0 A;  4WMC A;  3HLG A;  1PW1 A;  5DF7 A;  4UAA A;  5EVI D;  2HDR A;  2HPB A;  5CHM A;  1NXY A;  3IF6 B;  2IWC A;  5E43 A;  3EQV A;  4F94 A;  2ZC4 B;  3O88 A;  5IHV A;  1K54 C;  1YMX A;  3OC2 A;  1W5D A;  1CI9 A;  1K6R A;  4PMA A;  1NY0 A;  1FR6 A;  3C5A A;  5FAS A;  3OPL A;  5TFQ A;  5EOO A;  3M2J A;  4OPR A;  4OOM A;  5CGS A;  1H8Y A;  4DE2 A;  5F1F A;  1XP4 A;  3S4X A;  5FAQ A;  3HLB A;  3RJU A;  1ONH A;  4DE1 A;  2WGV A;  4QJG A;  1K57 A;  4HEF A;  4E3O A;  3BM6 A;  1WE4 A;  5CGW A;  3UPP A;  4H8R A;  3IWI A;  4QU3 A;  4S2M A;  4UHU A;  3MFD A;  3V50 A;  1ES5 A;  3WRT A;  4E3K A;  1SDN A;  2WGW A;  5JYP A;  3NDG A;  3ISG A;  2WYX A;  4OLG A;  4R3J A;  1TDL A;  3ZVT A;  3ZDJ A;  4S2K A;  1L0F A;  2Y2I A;  4S2P A;  2Y2L A;  2OLU A;  3IH9 A;  1ZG6 A;  1GCE A;  3IHB A;  5CTM A;  4OQG A;  5M18 A;  2V2F F;  3QNC A;  4K0W A;  5FAO A;  4BLM A;  3FWL A;  3NBL A;  1PW8 A;  4KEN B;  5GHX A;  3ZNY A;  5CHJ A;  4EBP A;  4MLL A;  4E6X A;  2WZZ A;  3QNB A;  3S1Y A;  5KSH A;  3OCL A;  2WKI A;  1Q2P A;  3VMA A;  4PPR A;  5DTK A;  4ZJ1 A;  3IWO A;  4LV0 A;  5I94 A;  5D3O A;  3WS4 A;  4OH0 A;  1ESI A;  4C75 A;  3IXG A; 
#chains in the Genus database with same CATH topology
 4H6J A;  2XR0 A;  2RL3 A;  3KO6 A;  3DW0 A;  3MSH A;  4EQ1 A;  3VP2 A;  1T18 A;  1OTA A;  3BW6 A;  2W1T B;  2RCX A;  1YKD A;  3CIT A;  4PM8 A;  5HPI A;  5TJJ A;  1MXO A;  3KSH A;  1TS7 A;  2Y79 A;  1IEM A;  3VP1 A;  1N9B A;  2H5S A;  3FKW A;  3IH8 A;  4DMZ A;  4E6W A;  1LI0 A;  3U2A A;  4X6T A;  1PFL A;  3O87 A;  3RFB A;  5EEC A;  5F6A A;  4IBX A;  2NUP C;  3V3S A;  1YLZ A;  3KYQ A;  3O3V A;  4XT2 A;  4RX2 A;  5HD5 A;  1XJ3 A;  3VOL A;  4KQD A;  1TS0 A;  5M19 A;  3PBN A;  1WA9 A;  2BG1 A;  3LI8 A;  1LLB A;  1J3W A;  1GSW A;  2YKH A;  3K3C A;  1IYP A;  4ZAM A;  5FQK A;  3BFE A;  1E3U D;  1CEF A;  4IVI A;  3TRC A;  5JYO A;  1CQA A;  4KG6 A;  4CLC E;  3MR0 A;  3E98 A;  5EM1 A;  1H8M A;  1KGG A;  4FH2 A;  1TD5 A;  1AWI A;  2B18 A;  4U0T A;  4ZDX A;  2PHY A;  3KX0 X;  5CX7 A;  2ZQ7 A;  1L0G A;  2GNX A;  3DAV A;  4R38 A;  4UQI M;  4EES A;  4BWI A;  5EVE A;  2Q9M A;  1XA1 A;  2HJ9 C;  3MF0 A;  2XQZ A;  3F1N B;  1CK3 A;  1MWS A;  1MBL A;  3VV4 A;  4JGP A;  4KG2 A;  4K0X A;  4R4S A;  5HDC A;  5EUA A;  2WKR A;  1O7E A;  2DRW A;  1XKZ A;  2KLI A;  4HJ6 A;  1KE4 A;  3IF5 A;  4BL2 A;  3IBJ A;  3T1S A;  2X71 A;  3PBQ A;  2VV8 A;  3W8K A;  3LIA A;  1QMF A;  1YT4 A;  5HAR A;  4PAU A;  1KVL A;  5E2E A;  4H6J B;  3IHA A;  4E3I A;  4O0P A;  4N1X A;  3M2K A;  4K08 A;  2JE5 A;  3BLM A;  3N7W A;  3FV7 A;  2ZL1 A;  3DTM A;  2R9X A;  4XUX A;  1S66 L;  1BZA A;  3IX3 A;  4Y17 A;  4RA7 A;  2QPN A;  4ARZ B;  3C7V A;  2PYP A;  2VGJ A;  2WKE A;  4QY6 A;  1K6S A;  4OON A;  4R3B A;  4FUW A;  2Y2Q A;  2JC7 A;  1IYQ A;  5FAT A;  5HW3 A;  5IS1 A;  2AVX A;  4XT2 B;  2ZM8 A;  3SZT A;  2JN7 A;  3PBS A;  3FZC A;  2INW A;  1RGY A;  2R9W A;  5GLA A;  2J3T D;  4EER A;  5HWW A;  1OT6 A;  4DF6 A;  4YFM A;  3UE1 A;  1V9Y A;  2WAF A;  3MZD A;  2G2W A;  2Z2M B;  3D4F A;  4BMW A;  4WLA A;  4OKP A;  4GCZ A;  1ES3 A;  3S22 A;  3TW8 A;  4D60 A;  4UQI S;  2P08 A;  4PM7 A;  1EI5 A;  3NCK A;  5HL1 A;  4C6Y A;  2WGI A;  3PBO A;  1G28 A;  3IT9 A;  1ODV A;  4MNR A;  2B5R A;  3NJA A;  1K38 A;  3SS3 A;  2ZOH A;  3PAG A;  3HUM A;  3LY4 A;  2OOL A;  3ITA A;  3CUE A;  2V8C A;  2IWB A;  2Y8H A;  4NXB A;  2PR5 A;  4B4X A;  4S2N C;  4E3N A;  2XA7 M;  4QHC A;  4QY5 A;  2Z6C A;  5F5Y A;  3LY3 A;  4LEN A;  4Y0U A;  5AJG A;  2YKF A;  5EVL A;  4EEU A;  4R1G A;  1LSV A;  1OJ5 A;  3A3E A;  4NEE D;  4RX3 A;  3E2L A;  4WEJ A;  2EXB A;  3NUL A;  1KGE A;  3LIB A;  3MXR A;  5IU1 A;  3C38 A;  4WEK A;  4DJ2 A;  2JKT M;  4MDZ A;  3UE6 A;  1E25 A;  2WAD A;  3UPO A;  1RGZ A;  3KSF A;  3BRM A;  2ZL1 B;  4BBV A;  2FFF B;  4X69 A;  3C8C A;  1FSY A;  3BJN A;  4EQI A;  3V3R A;  1E4D A;  4LRY C;  1BYW A;  3CWF A;  3C4P A;  1TDG A;  2W0N A;  3T1X A;  5HAI A;  4X55 A;  1K55 A;  4WF0 A;  3H9W A;  4MBF A;  3C4O A;  2PDR A;  3IF6 C;  4BBT A;  1W7F A;  3MXQ A;  3UB8 A;  4HH2 A;  3LID A;  2ZQC A;  3UE0 A;  5AQ9 A;  4HJ4 A;  4P6Z S;  4P85 A;  3MKF A;  2VX8 A;  2IA2 A;  3VE3 A;  3NHQ A;  2HDR A;  3EQV A;  5IHV A;  1K54 C;  4MMN A;  1CI9 A;  4PMA A;  1NY0 A;  3L9K A;  4BBU A;  5L07 A;  5TFQ A;  5G4Z A;  3IX8 A;  3FPV A;  5F1F A;  4E3O A;  2V8F A;  3UPP A;  4H8R A;  4UHU A;  1S4S A;  3F1O B;  4HP4 A;  3NDG A;  2WYX A;  4R3J A;  4MN6 A;  3ZDJ A;  2Y2I A;  3KYZ A;  3T4S A;  5HDS A;  4OQG A;  3KSG A;  3QNC A;  2WKQ A;  4KEN B;  2K2N A;  3S1Y A;  5KSH A;  3UB7 A;  3T50 A;  4HH3 A;  3LIF A;  4ZJ1 A;  2VV7 A;  2XA7 S;  3WS4 A;  3H82 A;  1SHV A;  2ZMF A;  5GL9 A;  3WS2 A;  1SZV A;  3SH8 A;  3HLE A;  3NDE A;  3QHY A;  1W79 A;  3R7W A;  3MZE A;  2V1Z A;  3MJQ A;  4OPQ A;  3S7Q A;  1N9L A;  4WZ5 C;  3EQU A;  4JPM A;  3RTY A;  1STZ A;  1BLH A;  5GHZ A;  2V1A A;  3DWZ A;  2W3H A;  2EWV A;  5GLD A;  1BUE A;  3LCE A;  1NJ4 A;  2XD5 A;  2Q9N A;  5EVI A;  2Y59 A;  1K0K A;  3GTC A;  4X1M A;  1P9W A;  4IBR A;  1NZU A;  1G5U A;  2HDQ A;  3HJI A;  2OLV A;  2PAV P;  3Q07 A;  5FI6 A;  2WUQ A;  3CG5 A;  4GOG A;  1XFN A;  1H3Q A;  3EGX C;  3HBR A;  4DDY A;  2W3F A;  1OJG A;  1KGF A;  3GRJ A;  1L0D A;  1MPL A;  3P09 A;  1Q2Q A;  2C6W B;  1Z6F A;  4KZ7 A;  1IYS A;  4K91 A;  1KDS A;  2EFU A;  2A2L A;  3RXW A;  4JGQ A;  1G6O A;  1SKF A;  2XK1 A;  4LCM A;  4E04 A;  1NRF A;  3ITB A;  1P97 A;  2K7S A;  4KUO A;  5DKL A;  1K57 C;  1L2S A;  2XLN A;  3FPW A;  3NC8 A;  2KX6 A;  1FR1 A;  5E2F A;  4CQH A;  5J8X A;  1ALQ A;  3HJK A;  2A3U A;  3HUO A;  4EEP A;  1MZU A;  2EA9 A;  1PNE A;  2VV6 A;  2E8I A;  3JPU A;  2P74 A;  4LRZ E;  4JF5 A;  4QPR A;  2EX9 A;  4QD4 A;  3T1R A;  1W63 M;  4KQR A;  5CRF A;  4BQM A;  1LL9 A;  4YNR A;  4GD8 A;  3UMD A;  3UDI A;  1K25 A;  2V0U A;  3QP4 A;  2GJ3 A;  4MEZ A;  1NYM A;  1OME A;  2LB9 A;  2ZC7 A;  4F3L A;  1H0M A;  3T4T A;  4E3J A;  2QHK A;  5J4E A;  2V20 A;  4LCL A;  2HP6 A;  1KDW A;  5AQB A;  1XA7 A;  2VGK A;  2ZLY A;  5HPF A;  4S2N A;  3H82 B;  4E6X A;  3MBZ A;  5U47 A;  3VFH A;  3Q7V A;  3E4P A;  3G30 A;  1RCJ A;  2J9P A;  5DJT A;  1SDE A;  4HHD A;  2O9A A;  3TE8 A;  5F1G A;  4G3V A;  3EEA A;  4JGR A;  4U0X A;  3V5M A;  4Q0I A;  4IVK A;  1LI9 A;  3PBT A;  3N8R A;  4EU0 A;  2BTF P;  5EVI B;  1GHP A;  3A0R A;  4ZRR A;  1CF0 A;  3VP0 A;  4I38 A;  3UME A;  3N8L A;  5EFW A;  3F1P A;  1JWV A;  1U60 A;  2CC1 A;  3O86 A;  2ZQ9 A;  4YIN A;  5TGF A;  3VOY A;  2UV0 E;  3MQO A;  1H5X A;  5L8M A;  3BEC A;  1UWN X;  2JCH A;  1YQS A;  5FDS A;  4JXS A;  4NXG A;  1JNU A;  4LGW A;  2XRN A;  3A3D A;  3IF6 A;  2B95 A;  3HRE A;  4N9L A;  4KZ3 A;  1IFQ A;  5DVA A;  4KZB A;  2PD8 A;  3UDF A;  1M40 A;  1L3L A;  2ZJ9 A;  2E8J A;  2JKF A;  2JKG A;  2ZOI A;  5A8B A;  3G32 A;  3M6B A;  4P87 A;  5HL6 A;  1JWZ A;  3ZNT A;  4A5R A;  4WYY A;  3JYI A;  1DY6 A;  2Y2H A;  2FH5 A;  3W4O A;  2WKP A;  1BT5 A;  3P7N A;  3UDX A;  4D2O A;  1PI5 A;  1K54 A;  4DE3 A;  3OPP A;  2L4R A;  3OPR A;  5A92 A;  3UB9 A;  1XFQ A;  2DNS A;  1S1Z A;  1FIL A;  2BLS A;  3NEC A;  5LBR A;  2WGW B;  2XD1 A;  4X53 A;  4WM9 A;  3VP4 A;  4S2O A;  4IUK A;  2HJE A;  3E2K A;  4II7 A;  4OQH A;  1EW0 A;  3N4I A;  3PR6 A;  1FIK A;  1X0O A;  4GKU A;  3IS2 A;  5FAP A;  5HAQ A;  2LB5 A;  3IX4 A;  4NET A;  4L9G A;  3MKE A;  1ZC2 A;  4F3L B;  1NYY A;  3BLS A;  3R4K A;  3B33 A;  2A24 A;  3CJM A;  3QP2 A;  3TOI A;  2Y4A A;  3B47 A;  5KMW A;  4QWO A;  5I5L A;  1OTD A;  2ZQ8 A;  1CI8 A;  3GEC A;  2Y2K A;  3LR3 A;  3Q7V B;  3ULF A;  4PM5 A;  4WZ5 A;  4PHT A;  4N1H A;  4NXE A;  1LSW A;  1TS8 A;  2O0Y A;  5KZH A;  4KZ9 A;  1O07 A;  1EWZ A;  5AVF A;  3WS5 A;  4JXG A;  1BLP A;  2JKR I;  2X01 A;  3E4O A;  2XF3 A;  2Y2O A;  1OPX A;  4ETX A;  5EE8 A;  1J9M A;  4RYE A;  4L9E A;  1W63 Q;  4EUZ A;  2EX8 A;  4ESP A;  4EET B;  1IOU A;  3F1P B;  3WS0 A;  5E2H A;  4P6Z M;  2EXA A;  3BQA A;  1XGJ A;  4GD6 A;  5TBM A;  3PAE A;  4OPY A;  4P6B A;  3TJZ C;  1LHY A;  5G4Y A;  4KG5 A;  3QP6 A;  4WMC A;  1PW1 A;  5EVI D;  3O5Y A;  5CHM A;  5E43 A;  3IF6 B;  2JHE A;  4KUK A;  2P04 A;  3OC2 A;  5FAS A;  3C5A A;  4OOM A;  4OPR A;  5CGS A;  1KOU A;  1ONH A;  2WGV A;  1TS6 A;  1K57 A;  2PT7 A;  3BM6 A;  2HV1 A;  5CGW A;  1N9N A;  4QU3 A;  4S2M A;  1ES5 A;  3WRT A;  1TDL A;  3ZVT A;  1F98 A;  1ZG6 A;  1GCE A;  5CTM A;  2V2F F;  4LLO B;  3ZNY A;  4MLL A;  2WZZ A;  1YSP A;  3OCL A;  1Q2P A;  3VMA A;  4L9F A;  4PPR A;  3IWO A;  5I94 A;  2P7J A;  2H28 A;  3GDI A;  3IXG A;  1DP9 A;  5A90 A;  3CHW P;  3UO9 A;  5DF8 A;  3PYP A;  1L0E A;  2H10 A;  4JXW A;  3B42 A;  3KSI A;  1D1J A;  1VHM A;  3LEZ A;  2ZBB A;  4GNU A;  3IS2 B;  3WRZ A;  1GHI A;  3ZG5 A;  4AFI A;  4MCW A;  1F2K A;  4GS9 A;  3G2Y A;  4KZA A;  4X1L A;  2A24 B;  2PU2 A;  2Y2N A;  4WBG A;  4U3T A;  2CMN A;  1YAX A;  1PYY A;  3CI6 A;  4BJP A;  5FDH A;  2Y2J A;  2M1C A;  3Q7Z A;  4NG2 A;  1JTG A;  1H8Z A;  4HQA A;  3DBA A;  3NOU C;  1YMS A;  3JVU A;  2BAS A;  4CLC C;  3BYD A;  5FEG A;  4N9K A;  4KZ4 A;  1BLS A;  2V1B A;  1FCO A;  3NY4 A;  1NLY A;  2ZMV A;  5FL3 A;  5FI7 A;  3HLC A;  4I5S A;  5E2G A;  3SH9 A;  2I72 A;  3A3I A;  2ZD8 A;  3K3D A;  2PR6 A;  2PYR A;  5HZH A;  1AXB A;  4MBH A;  3ZVW A;  1MWU A;  1ERO A;  5TBM B;  1T1B A;  3IWQ A;  1T1C A;  4FH4 A;  3Q82 A;  3UE3 A;  1PWG A;  3AGF A;  1VEU A;  3CPT A;  4HBU A;  4FSF A;  5AVE A;  2EWW A;  3RH8 B;  2HGV A;  1GSV A;  3OCN A;  4FCF A;  2M7U A;  5TR7 A;  2J7V A;  3KYE A;  4DRT A;  2VGL M;  5FQQ A;  1V9Z A;  4JLF A;  4R0Q A;  3CLO A;  4GDN A;  1I2S A;  2XDM A;  5HWT A;  4UA9 A;  2OWH A;  1YLT A;  5FQI A;  2D01 A;  3CMZ A;  3D72 A;  4O8G A;  1P0Z A;  1Y54 A;  4I3J A;  1M6K A;  4FD8 A;  4G3K A;  1SCW A;  4OLD A;  2OAQ 1;  3A0V A;  4OQ0 A;  4ZBE A;  2W1T A;  1TEM A;  3LO7 A;  5DTS A;  4DDS A;  3FYZ A;  1ES2 A;  3MXS A;  2H0Y A;  4WZ4 A;  4JXV A;  4L0L A;  1VM1 A;  5K5B A;  2X02 A;  5EOE A;  2QZ6 A;  2VA0 A;  5HAP A;  2VJW A;  1TF1 A;  4NK3 A;  4GS9 B;  3VOZ A;  3ZCZ A;  1VQQ A;  2XFT A;  4ME4 A;  3UN7 A;  3PBR A;  3GR2 A;  5EM0 A;  3G2Z A;  4DKI A;  3Q81 A;  1MKI A;  1P9R A;  4LV3 A;  3UB5 P;  1XGI A;  3GMW A;  1ZG4 A;  5AQ7 A;  3E0Y A;  2JKT I;  3PXP A;  4NXF A;  1Y4O A;  1K4E A;  4EXO A;  4Y0T A;  4N92 A;  4IED A;  4DXB A;  2PU4 A;  2PD7 A;  4OQI A;  1NLZ A;  2Y91 A;  5BOH A;  2J8Y A;  1D06 A;  3MQ0 A;  4YOF A;  4ZJ3 A;  3MZF A;  1S4R A;  4JGO A;  5DTT A;  4I3A A;  3NOP C;  1YM1 A;  3OOV A;  3VSK A;  2W1R A;  2Z2L B;  4KZ5 A;  4EWF A;  3V67 A;  3LI9 A;  4LFU A;  5CEC A;  3LEQ A;  4GDB A;  2OAP 1;  1KVM A;  2V9A A;  3E4Q A;  1XXM A;  3IXD A;  3CPT B;  4Y15 A;  5CEB A;  5FA7 A;  2Q0O A;  2VGL S;  3W4Q A;  4B93 A;  1PRQ A;  4PKY G;  1FQG A;  2HP9 A;  4HNB A;  2XEP A;  1YLW A;  4HI4 A;  2ACG A;  1K56 A;  3QP1 A;  1DRM A;  4HBT A;  3GVB A;  3WWX A;  5HFO A;  5G18 A;  1XJ4 A;  3SW1 A;  3HLW A;  3DTI A;  3IBR A;  4WMC D;  3FC7 A;  4PM9 A;  3D3O A;  4MBK A;  5CHU A;  1IEL A;  3FKV A;  1OTE A;  3R7W B;  3LR5 A;  3P98 A;  5M1A A;  1MWR A;  2B02 A;  1HLU P;  3T1Q B;  2VEA A;  5F82 A;  3SOI A;  3T12 B;  4Y0O A;  1YLJ A;  1MKM A;  2JKR M;  3VP3 A;  1SKO A;  4Y5F A;  3MFX A;  4EW7 A;  4ARZ A;  5FSR A;  4S2L A;  4R6L A;  3BFG A;  4GW9 A;  4RVA A;  1S6R A;  3C7U A;  4GJ4 A;  4R4R A;  3EOI A;  1ZKJ A;  2WZX A;  4JF4 A;  3RXX A;  1QME A;  1IKG A;  3DTK A;  2Y2G A;  4FTX A;  1ZHH B;  4Y13 A;  3T4K A;  4LPZ A;  3H7W A;  2P9V A;  4X68 A;  1HVB A;  1K55 C;  4Y2F A;  1DP8 A;  3WS1 A;  2MJ6 A;  4B4Z A;  1MWT A;  3HL9 A;  2C5W B;  1XX2 A;  5DF9 A;  4EBL A;  3LR4 A;  5FQM A;  4CLC A;  1S1Y A;  2FZ0 A;  1W8Y A;  4Y7P A;  2XFS A;  1WYB A;  4HES A;  4IJG A;  2ZQA A;  1BUL A;  2O9C A;  3B3X A;  2VZW A;  3TG9 A;  1HD8 A;  4DE0 A;  4DN0 A;  2R78 A;  5DF7 A;  4UAA A;  1UWP X;  2GX5 A;  4Q0H A;  2W3D A;  1MC0 A;  3MS6 A;  1YMX A;  1W5D A;  1DP6 A;  3M2J A;  1H8Y A;  1ZTU A;  2W27 A;  3BQ8 A;  4DE2 A;  3S4X A;  3T4J A;  1UGU A;  4HEF A;  5IT5 A;  3IWI A;  3MFD A;  4OLG A;  4S2K A;  4S2P A;  2Y2L A;  2OLU A;  2QKP A;  3IHB A;  4K0W A;  5FAO A;  3FWL A;  3NBL A;  5CHJ A;  1D7E A;  4M4X A;  1T19 A;  4RQ9 A;  2WKI A;  5DTK A;  3D9Y A;  4LV0 A;  5M18 A;  1VET A;  2J3T C;  4XXR A;  2WAE A;  1ACF A;  2H0T A;  3BY9 A;  3ZGA B;  1GA9 A;  1OT9 A;  3NIA A;  1GSX A;  4WEL A;  2Y2M A;  3OLO A;  3GV9 A;  2HZ5 A;  3S7N A;  5L09 A;  4UA7 A;  2ZMA A;  4KZ6 A;  4EV4 A;  5EVI C;  3BFF A;  4MN7 A;  5CTN A;  3ZG7 B;  1DJA A;  3K2N A;  3W4P A;  3HVF A;  5AQA A;  4KQQ A;  2HDS A;  4FOF A;  5CXW A;  2Y55 A;  4HJ3 A;  2GZA A;  1SKO B;  1PWD A;  1ES4 A;  2OWJ A;  3UPN A;  5FQ9 A;  4HY8 A;  3T4O A;  1XPB A;  4HIA A;  1DJC A;  2GDN A;  1F9I A;  5HDD A;  3C2W A;  3PHY A;  3GSG A;  3H7W B;  2P9V B;  4DJ3 A;  3IXB A;  4OP5 A;  3UY6 A;  1CJF A;  1Z09 A;  5HSQ A;  1OTI A;  2M7V A;  1RP5 A;  3V39 A;  4BL3 A;  2QWS A;  5GLC A;  3SS4 A;  4HP9 A;  2ZC6 B;  1ERM A;  4CLC B;  4IHQ A;  4QB8 A;  1N4O A;  3BWL A;  3LUQ A;  3L7H A;  2VKS A;  3W2Z A;  5DFY A;  3NI9 A;  4MN5 A;  1S0W A;  1N9O A;  4M3K A;  1G6A A;  5EPH A;  1CEG A;  2J9O A;  3SS5 A;  2G2U A;  5A93 A;  4ID4 A;  3F1O A;  1PZP A;  3HLD A;  4CPK A;  3GQZ A;  2ZQD A;  1NZO A;  1HTZ A;  4ZJ2 A;  1PI4 A;  3IXH A;  3N6I A;  4OP8 A;  1G68 A;  4Z1W A;  2HP5 A;  2ZM0 A;  1ERQ A;  2PBY A;  2W3G A;  4LRX C;  3EEH A;  5F68 A;  4JKT A;  4Q8I A;  2PBD P;  4GB7 A;  1Y28 A;  4KQO A;  5FEF A;  5EV0 A;  4LV1 A;  1YPR A;  2XRO A;  4JBF A;  4C3Q A;  4LV2 A;  3ZQ5 A;  3N8S A;  5A91 A;  1FCM A;  1VET B;  2L1M A;  5FQJ A;  1E3U A;  1GA0 A;  1YSQ A;  3ZFZ A;  2JBF A;  2IWD A;  4HOI A;  1JTD A;  1VB6 A;  2VK3 A;  4IUH A;  5GLB A;  1PZO A;  3G35 A;  3A0S A;  2DCF A;  2W3E A;  4Q0J A;  3G31 A;  1KE0 A;  4O7D A;  1WYC A;  1I5Q A;  1PIO A;  1JWP A;  5L10 A;  5J7E A;  5DKK A;  3HLF A;  1HZO A;  2XSS A;  2EX2 A;  4PM6 A;  2ZC5 B;  1K56 D;  2J80 A;  2WKH A;  4GHI A;  1LT0 A;  4P0M A;  5MC7 A;  3HCY A;  5J3W A;  3LIE A;  1FSW A;  2OV5 A;  2XGN A;  5HX9 A;  5GHY A;  3Q1F A;  3LFV A;  4BEN A;  1IYO A;  2O9B A;  1W8Q A;  1BTL A;  4R23 A;  2A49 A;  1LL8 A;  4X25 A;  4YWZ A;  3BFD A;  3M6H A;  4KZ8 A;  4WN5 A;  3JVV A;  3T4Q A;  3DTE A;  1YLY A;  2FFY A;  5HD3 A;  2VLG A;  3AGE A;  4G3W A;  2WK0 A;  3EGD C;  5FI2 A;  5DJU A;  4GN2 A;  5CED A;  4OOY A;  1XJ6 A;  3OBF A;  1GHM A;  4PKY A;  3LIC A;  3HUN A;  2EX6 A;  4JF6 A;  2O99 A;  3CAX A;  3ICY A;  2EFX A;  4ZTK A;  3SH7 A;  5F69 A;  1S67 L;  1T1A A;  4CJN A;  4B9O A;  2ZC3 B;  4B88 A;  1NRJ A;  2NUT C;  3G6O A;  4E3M A;  3LYX A;  1KE3 A;  2QMI A;  1ONG A;  2UWX A;  3VE4 A;  4CLC D;  4OOL A;  1LSX A;  2DMW A;  2QJ7 A;  1ESU A;  2ZM2 A;  1TVF A;  1LL5 A;  2Y2P A;  1IKI A;  3P01 A;  2XH9 A;  1MY8 A;  3LGO A;  4S2I A;  3T4L A;  1BSG A;  1DJB A;  5KSC A;  3AGD A;  3ZHH A;  3G4P A;  1PWC A;  2I9V A;  3DWK A;  3A3F A;  1FOF A;  3UNW A;  2HF6 A;  4S2J A;  4BD1 A;  3ZG0 A;  2QYB A;  4E3L A;  3G34 A;  5CER A;  4Y3I A;  2PRF A;  3A3J A;  3LR0 A;  3OZH A;  4OPZ A;  2V0W A;  4GZB A;  5HWV A;  2J3W A;  3PTE A;  4UEY A;  4DXC A;  2K31 A;  3OPH A;  5F83 A;  1I2W A;  2L0W A;  3BEB A;  3MMH A;  4OVD A;  1F5M A;  2D02 A;  4XUZ A;  5CGX A;  1JVJ A;  3UB6 A;  3ZG9 B;  1A0K A;  4ETZ A;  4Z9Q A;  3C30 A;  1FCN A;  3FG8 A;  3TSG A;  3BFC A;  3VSL A;  4EBN A;  2OSU A;  1YLP A;  4NKP A;  3IQA A;  5L2F A;  4UA6 A;  4EUV A;  3CZD A;  4GHI B;  3VFF A;  1XJ2 A;  3MQQ A;  3NOT C;  4I39 A;  3QP5 A;  2QJ5 A;  4WL9 A;  1BLC A;  2HDU A;  3I7J A;  4X56 A;  1C3B A;  5DFX A;  5C5K A;  4BD0 A;  1K4F A;  3ZG8 B;  4O01 A;  3HLG A;  3ZYT A;  3QP8 A;  5KIZ A;  2KDK A;  2G7U A;  2HPB A;  4WUJ A;  3S7P A;  1NXY A;  4F94 A;  2IWC A;  2ZC4 B;  3O88 A;  4I3I A;  2Z6D A;  3BY8 A;  3F1N A;  1K6R A;  1FR6 A;  3OPL A;  1VEU B;  5EOO A;  1XP4 A;  5FAQ A;  3HLB A;  3RJU A;  4DE1 A;  4GLQ A;  4QJG A;  3EWK A;  1WE4 A;  3CUE C;  3V50 A;  4R70 A;  5JYP A;  4E3K A;  1SDN A;  2WGW A;  3ISG A;  4R3A A;  1L0F A;  3IH9 A;  4BLM A;  3S7O A;  1PW8 A;  4EBP A;  5GHX A;  2KOI A;  3U4L P;  3QNB A;  1OTB A;  1NWZ A;  5D3O A;  4OH0 A;  1ESI A;  4C75 A; 
#chains in the Genus database with same CATH homology
 1SHV A;  2XR0 A;  2RL3 A;  4XXR A;  5GL9 A;  5A90 A;  3WS2 A;  3UO9 A;  5DF8 A;  2WAE A;  3DW0 A;  3SH8 A;  2H0T A;  3ZGA B;  3HLE A;  1GA9 A;  3NDE A;  3QHY A;  3VP2 A;  1L0E A;  1W79 A;  2H10 A;  4JXW A;  3MZE A;  2V1Z A;  3NIA A;  3LEZ A;  4GNU A;  4OPQ A;  4WEL A;  3WRZ A;  2Y2M A;  4WZ5 C;  1GHI A;  3ZG5 A;  3GV9 A;  3EQU A;  4JPM A;  2RCX A;  4PM8 A;  4UA7 A;  1BLH A;  3G2Y A;  4KZA A;  1MXO A;  5GHZ A;  2ZMA A;  4KZ6 A;  4EV4 A;  3DWZ A;  5EVI C;  3BFF A;  5CTN A;  5GLD A;  2PU2 A;  2Y2N A;  1BUE A;  3LCE A;  3ZG7 B;  1NJ4 A;  2XD5 A;  1DJA A;  2Q9N A;  4WBG A;  3W4P A;  4U3T A;  5EVI A;  1IEM A;  2Y59 A;  3HVF A;  5AQA A;  4KQQ A;  3VP1 A;  3GTC A;  4IBR A;  1NZU A;  2HDS A;  1PYY A;  4BJP A;  1N9B A;  2H5S A;  3FKW A;  3IH8 A;  5CXW A;  2Y55 A;  4E6W A;  1LI0 A;  5FDH A;  2HDQ A;  2Y2J A;  1PWD A;  4X6T A;  3O87 A;  3Q7Z A;  1JTG A;  2OLV A;  1H8Z A;  3Q07 A;  5FI6 A;  2WUQ A;  1ES4 A;  5EEC A;  1YMS A;  3UPN A;  3CG5 A;  5FQ9 A;  4IBX A;  4GOG A;  3V3S A;  3BYD A;  1XPB A;  1YLZ A;  3HBR A;  3O3V A;  4N9K A;  4RX2 A;  4DDY A;  4KZ4 A;  1BLS A;  1KGF A;  1DJC A;  3GRJ A;  2GDN A;  5M19 A;  3PBN A;  1FCO A;  2BG1 A;  3NY4 A;  1LLB A;  1L0D A;  3GSG A;  2P9V B;  1MPL A;  3IXB A;  3P09 A;  4OP5 A;  1Q2Q A;  3UY6 A;  1IYP A;  2C6W B;  1Z6F A;  4ZAM A;  3HLC A;  5FI7 A;  5FQK A;  3BFE A;  4KZ7 A;  1IYS A;  1RP5 A;  1E3U D;  1CEF A;  5E2G A;  2I72 A;  3SH9 A;  4IVI A;  3A3I A;  3V39 A;  2ZD8 A;  4K91 A;  5JYO A;  4KG6 A;  4BL3 A;  1KDS A;  2EFU A;  3RXW A;  5GLC A;  3SS4 A;  2ZC6 B;  1ERM A;  1AXB A;  4MBH A;  3ZVW A;  1MWU A;  1ERO A;  4QB8 A;  1KGG A;  1N4O A;  4FH2 A;  1SKF A;  2XK1 A;  4U0T A;  4LCM A;  4ZDX A;  1NRF A;  3ITB A;  3IWQ A;  4FH4 A;  3Q82 A;  3NI9 A;  3UE3 A;  1PWG A;  1K57 C;  2ZQ7 A;  1L2S A;  1S0W A;  2XLN A;  3AGF A;  1L0G A;  3NC8 A;  1FR1 A;  4HBU A;  4M3K A;  5E2F A;  2Q9M A;  1G6A A;  4FSF A;  5EPH A;  5J8X A;  1CEG A;  2J9O A;  3SS5 A;  1ALQ A;  1XA1 A;  2XQZ A;  2G2U A;  1CK3 A;  5A93 A;  2A3U A;  3HUO A;  4ID4 A;  3OCN A;  1MWS A;  2E8I A;  1MBL A;  4FCF A;  2P74 A;  4JF5 A;  5TR7 A;  2EX9 A;  4QD4 A;  2J7V A;  4DRT A;  1PZP A;  4KQR A;  3HLD A;  4KG2 A;  4CPK A;  4K0X A;  5CRF A;  3GQZ A;  2ZQD A;  1NZO A;  1HTZ A;  5FQQ A;  4ZJ2 A;  1LL9 A;  4JLF A;  4R0Q A;  4R4S A;  4BQM A;  1PI4 A;  3IXH A;  3N6I A;  4OP8 A;  1G68 A;  4GD8 A;  4GDN A;  1I2S A;  5EUA A;  2HP5 A;  2XDM A;  2ZM0 A;  3UDI A;  1K25 A;  4UA9 A;  1ERQ A;  1O7E A;  1YLT A;  2DRW A;  2PBY A;  1XKZ A;  5FQI A;  4Q8I A;  4JKT A;  4MEZ A;  3CMZ A;  1NYM A;  1OME A;  4GB7 A;  1KE4 A;  3IF5 A;  4KQO A;  2ZC7 A;  4BL2 A;  4E3J A;  2V20 A;  1Y54 A;  4LCL A;  2X71 A;  3PBQ A;  2HP6 A;  4LV1 A;  3W8K A;  1M6K A;  4FD8 A;  1SCW A;  1KDW A;  4OLD A;  5AQB A;  4JBF A;  4C3Q A;  1XA7 A;  1QMF A;  2VGK A;  2ZLY A;  4LV2 A;  1YT4 A;  5HAR A;  4OQ0 A;  4ZBE A;  3N8S A;  1KVL A;  1TEM A;  3LO7 A;  1FCM A;  4S2N A;  5DTS A;  5E2E A;  3FYZ A;  3MBZ A;  5A91 A;  5U47 A;  3Q7V A;  3IHA A;  1ES2 A;  3VFH A;  5FQJ A;  3MXS A;  4E3I A;  1E3U A;  2H0Y A;  1GA0 A;  3G30 A;  4JXV A;  4WZ4 A;  4L0L A;  1RCJ A;  1VM1 A;  4N1X A;  3M2K A;  3ZFZ A;  2X02 A;  2JBF A;  2JE5 A;  4DDS A;  5EOE A;  3BLM A;  2QZ6 A;  3N7W A;  2IWD A;  2J9P A;  3FV7 A;  1JTD A;  5GLB A;  1PZO A;  1SDE A;  3DTM A;  2R9X A;  3G35 A;  4XUX A;  5HAP A;  2DCF A;  5F1G A;  1BZA A;  3G31 A;  4NK3 A;  4RA7 A;  1KE0 A;  4O7D A;  4U0X A;  1WYC A;  3VOZ A;  1I5Q A;  2QPN A;  3ZCZ A;  1PIO A;  3V5M A;  1JWP A;  4IVK A;  1LI9 A;  3HLF A;  3PBT A;  1HZO A;  1VQQ A;  3C7V A;  2EX2 A;  4PM6 A;  2ZC5 B;  1K56 D;  2XFT A;  3N8R A;  3UN7 A;  3PBR A;  5EVI B;  1GHP A;  2WKH A;  3GR2 A;  2OV5 A;  3G2Z A;  2VGJ A;  2WKE A;  4QY6 A;  4P0M A;  1K6S A;  4OON A;  4R3B A;  3VP0 A;  3N8L A;  4DKI A;  3Q81 A;  1MKI A;  4LV3 A;  1FSW A;  1XGI A;  1JWV A;  1U60 A;  2CC1 A;  3GMW A;  3O86 A;  2Y2Q A;  2ZQ9 A;  4YIN A;  1ZG4 A;  2JC7 A;  2XGN A;  5HX9 A;  5GHY A;  1IYQ A;  5FAT A;  3Q1F A;  5AQ7 A;  3VOY A;  1H5X A;  3BEC A;  4BEN A;  5HW3 A;  1IYO A;  1W8Q A;  1BTL A;  1K4E A;  4R23 A;  2ZM8 A;  2A49 A;  3PBS A;  4Y0T A;  2JCH A;  3FZC A;  1RGY A;  2R9W A;  1YQS A;  3BFD A;  3M6H A;  5GLA A;  4N92 A;  4IED A;  4JXS A;  4KZ8 A;  4DXB A;  4DF6 A;  2PU4 A;  4YFM A;  4OQI A;  2Y91 A;  1YLY A;  3UE1 A;  2FFY A;  3A3D A;  2J8Y A;  3IF6 A;  3HRE A;  2WAF A;  3MZD A;  4KZ3 A;  4N9L A;  4ZJ3 A;  3AGE A;  2G2W A;  2Z2M B;  3MZF A;  4KZB A;  5DVA A;  3D4F A;  3UDF A;  5DTT A;  1M40 A;  2ZJ9 A;  4OKP A;  2WK0 A;  1YM1 A;  3G32 A;  3VSK A;  3M6B A;  4P87 A;  2Z2L B;  4KZ5 A;  5FI2 A;  4EWF A;  1JWZ A;  4GN2 A;  1ES3 A;  5CED A;  3S22 A;  4OOY A;  3ZNT A;  1GHM A;  4A5R A;  5CEC A;  4WYY A;  3JYI A;  4PM7 A;  3HUN A;  1DY6 A;  2EX6 A;  2Y2H A;  4JF6 A;  3W4O A;  4GDB A;  1BT5 A;  1EI5 A;  3UDX A;  4D2O A;  3NCK A;  1KVM A;  2EFX A;  4ZTK A;  5HL1 A;  1PI5 A;  4C6Y A;  1XXM A;  1K54 A;  3SH7 A;  3OPP A;  3OPR A;  3IXD A;  2WGI A;  3PBO A;  4DE3 A;  5CEB A;  4CJN A;  3IT9 A;  2ZC3 B;  5A92 A;  5FA7 A;  4MNR A;  3W4Q A;  4B88 A;  2B5R A;  2DNS A;  1K38 A;  4E3M A;  3SS3 A;  1FQG A;  1KE3 A;  2BLS A;  2HP9 A;  2WGW B;  1ONG A;  2QMI A;  2UWX A;  2XD1 A;  1YLW A;  2XEP A;  3HUM A;  3PAG A;  4OOL A;  4X53 A;  3LY4 A;  5TGF A;  3ITA A;  1ESU A;  1K56 A;  2ZM2 A;  4WM9 A;  4S2O A;  2IWB A;  1TVF A;  1LL5 A;  2Y2P A;  3VP4 A;  3E2K A;  1IKI A;  4HBT A;  2XH9 A;  3GVB A;  4OQH A;  3N4I A;  1MY8 A;  4S2I A;  3WWX A;  5HFO A;  4B4X A;  5G18 A;  4S2N C;  1BSG A;  1DJB A;  4E3N A;  3AGD A;  4GKU A;  3HLW A;  5KSC A;  4QHC A;  4QY5 A;  3ZHH A;  4WMC D;  3G4P A;  4PM9 A;  5FAP A;  3LY3 A;  1PWC A;  5HAQ A;  4NET A;  3DWK A;  4LEN A;  3A3F A;  3MKE A;  4Y0U A;  1FOF A;  3UNW A;  1ZC2 A;  5EVL A;  1NYY A;  3BLS A;  4MBK A;  4S2J A;  4BD1 A;  4R1G A;  3CJM A;  5CHU A;  3ZG0 A;  3A3E A;  2Y4A A;  3TOI A;  4RX3 A;  3E2L A;  1IEL A;  5KMW A;  3FKV A;  4WEJ A;  3G34 A;  4E3L A;  5CER A;  2EXB A;  3P98 A;  5M1A A;  1KGE A;  1MWR A;  3A3J A;  2ZQ8 A;  3OZH A;  4OPZ A;  1CI8 A;  3MXR A;  5F82 A;  4GZB A;  3SOI A;  2Y2K A;  4WEK A;  3PTE A;  4Y0O A;  3Q7V B;  1YLJ A;  3VP3 A;  4DXC A;  4PM5 A;  3OPH A;  5F83 A;  4WZ5 A;  1I2W A;  1E25 A;  2WAD A;  3BEB A;  4N1H A;  5FSR A;  3UPO A;  4S2L A;  4OVD A;  1RGZ A;  3BFG A;  3BRM A;  4RVA A;  4XUZ A;  5CGX A;  1S6R A;  1JVJ A;  3C7U A;  4R4R A;  2FFF B;  4X69 A;  1ZKJ A;  1FSY A;  3ZG9 B;  5KZH A;  4KZ9 A;  2WZX A;  4JF4 A;  3RXX A;  1O07 A;  1QME A;  4Z9Q A;  1IKG A;  4EQI A;  1EWZ A;  1FCN A;  2Y2G A;  3V3R A;  1E4D A;  3TSG A;  3WS5 A;  3BFC A;  3VSL A;  4EBN A;  2OSU A;  4JXG A;  1BLP A;  2X01 A;  3C4P A;  2P9V A;  1HVB A;  4X68 A;  1K55 C;  1YLP A;  1TDG A;  2XF3 A;  2Y2O A;  3IQA A;  5BOH A;  5HAI A;  4X55 A;  5L2F A;  4UA6 A;  3WS1 A;  5EE8 A;  1J9M A;  4RYE A;  3CZD A;  4B4Z A;  1K55 A;  1MWT A;  3HL9 A;  2C5W B;  4EUZ A;  4MBF A;  1XX2 A;  3C4O A;  3IF6 C;  2EX8 A;  5DF9 A;  3VFF A;  4EBL A;  5FQM A;  1W7F A;  3WS0 A;  5E2H A;  2EXA A;  1W8Y A;  4Y7P A;  2XFS A;  1XGJ A;  1WYB A;  4GD6 A;  4HES A;  3PAE A;  2ZQA A;  2ZQC A;  3UE0 A;  5AQ9 A;  1BUL A;  1BLC A;  2HDU A;  4OPY A;  3I7J A;  4P85 A;  3B3X A;  4P6B A;  4X56 A;  1LHY A;  3MKF A;  1C3B A;  4KG5 A;  4BD0 A;  1K4F A;  3ZG8 B;  3TG9 A;  1HD8 A;  4DE0 A;  4WMC A;  3HLG A;  1PW1 A;  5DF7 A;  4UAA A;  5EVI D;  2HDR A;  2HPB A;  5CHM A;  1NXY A;  3IF6 B;  2IWC A;  5E43 A;  3EQV A;  4F94 A;  2ZC4 B;  3O88 A;  5IHV A;  1K54 C;  1YMX A;  3OC2 A;  1W5D A;  1CI9 A;  1K6R A;  4PMA A;  1NY0 A;  1FR6 A;  3C5A A;  5FAS A;  3OPL A;  5TFQ A;  5EOO A;  3M2J A;  4OPR A;  4OOM A;  5CGS A;  1H8Y A;  4DE2 A;  5F1F A;  1XP4 A;  3S4X A;  5FAQ A;  3HLB A;  3RJU A;  1ONH A;  4DE1 A;  2WGV A;  4QJG A;  1K57 A;  4HEF A;  4E3O A;  3BM6 A;  1WE4 A;  5CGW A;  3UPP A;  4H8R A;  3IWI A;  4QU3 A;  4S2M A;  4UHU A;  3MFD A;  3V50 A;  1ES5 A;  3WRT A;  4E3K A;  1SDN A;  2WGW A;  5JYP A;  3NDG A;  3ISG A;  2WYX A;  4OLG A;  4R3J A;  1TDL A;  3ZVT A;  3ZDJ A;  4S2K A;  1L0F A;  2Y2I A;  4S2P A;  2Y2L A;  2OLU A;  3IH9 A;  1ZG6 A;  1GCE A;  3IHB A;  5CTM A;  4OQG A;  5M18 A;  2V2F F;  3QNC A;  4K0W A;  5FAO A;  4BLM A;  3FWL A;  3NBL A;  1PW8 A;  4KEN B;  5GHX A;  3ZNY A;  5CHJ A;  4EBP A;  4MLL A;  4E6X A;  2WZZ A;  3QNB A;  3S1Y A;  5KSH A;  3OCL A;  2WKI A;  1Q2P A;  3VMA A;  4PPR A;  5DTK A;  4ZJ1 A;  3IWO A;  4LV0 A;  5I94 A;  5D3O A;  3WS4 A;  4OH0 A;  1ESI A;  4C75 A;  3IXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...