1JWZA

Crystal structure of tem-64 beta-lactamase in complex with a boronic acid inhibitor (105)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
publication title Evolution of an antibiotic resistance enzyme constrained by stability and activity trade-offs.
pubmed doi rcsb
source organism Escherichia coli
total genus 99
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jwzA00
4MEZA 3BFDA 5E2HA 4B4ZA 3IF6B 4K91A 1LHYA 4DXBA 5AQAA 5KZHA 2EXBA 4KQQA 4KZ4A 4Q8IA 3P09A 3M6HA 4QD4A 1W7FA 4KZAA 3UE0A 3UN7A 4JF5A 1ERQA 4GDNA 2J8YA 5CERA 3VP2A 2XDMA 2UWXA 1NYMA 3MZEA 1KE0A 3N8LA 4DRTA 4JLFA 3BFFA 1K25A 4KZ3A 2JC7A 4ID4A 4JXWA 1GA0A 3WRZA 4R4SA 3C4PA 1SCWA 4EBLA 4QJGA 3DTMA 2IWBA 2ZM0A 3HLBA 2FFFB 1NRFA 1PZOA 1MBLA 3TSGA 2EX9A 1YM1A 5CECA 1TVFA 1H8YA 1KVLA 1I5QA 4N9LA 3IWOA 3NDGA 4GN2A 2OLVA 4OVDA 4EV4A 4BL3A 3WS1A 5FQ9A 2BLSA 1L0DA 1GA9A 3GTCA 4C75A 2DCFA 3M2KA 4R4RA 1RGZA 2HDSA 4NK3A 5A90A 1JTDA 1GHIA 3IH9A 3SS5A 4PM7A 4MBHA 1AXBA 2CC1A 1ONHA 3LO7A 1MWTA 1RP5A 1W79A 3QHYA 2ZMAA 4Y0OA 4E3IA 1NYYA 3PBNA 4X53A 4HEFA 3IH8A 2ZC5B 1EROA 4RA7A 2EX8A 5EPHA 4KZ8A 2ZLYA 2IWCA 4R23A 5A92A 1QMEA 1M6KA 4S2OA 3O3VA 4QHCA 3S1YA 1E3UA 3O88A 5FQMA 4KENB 1MWUA 1NY0A 2QZ6A 3VSLA 1DJAA 1RCJA 1YQSA 3A3DA 4X68A 1K55A 4LCMA 5GLDA 2C5WB 4CJNA 5CGSA 3FKVA 2XLNA 3I7JA 3IHBA 4FSFA 3MZFA 3PBQA 5A91A 3UPPA 2HDRA 4DE0A 4EWFA 1EI5A 5M19A 3GRJA 1SDEA 1I2SA 4L0LA 2ZC4B 5FSRA 3ZG7B 3ZHHA 5FASA 4R0QA 2XD1A 4F94A 4GNUA 5FI7A 3NI9A 1NZOA 2A49A 1E3UD 1CEFA 2V1ZA 4DE3A 1VM1A 4N1HA 3Q7ZA 3PAGA 1YLJA 3S22A 2G2WA 4E6XA 1IKGA 2ZQ9A 3C5AA 2ZM8A 5EVIA 2VGJA 3FYZA 4JXVA 2EX6A 2XQZA 4UA7A 4P87A 3BFCA 4PMAA 3UE1A 3HLEA 1N9BA 4FH2A 5EVIB 4JXGA 5FI2A 3NDEA 1MPLA 4WELA 2ZQCA 4PM5A 3HLCA 3BFGA 1XP4A 4KG2A 1PW8A 2X01A 4GDBA 2C6WB 2WGVA 4OKPA 3SS4A 5FQIA 1HD8A 2X02A 4KZ5A 4OP5A 4RX3A 5AQBA 1M40A 2XR0A 3ZGAB 2XK1A 5EVID 1FCOA 3S4XA 2Z2LB 2PU4A 3E2LA 1N4OA 2J9OA 1HZOA 3NCKA 3PTEA 3VP1A 1ERMA 1RGYA 3ISGA 3HUOA 4JF4A 4O7DA 3WS4A 2WGWA 3N4IA 4GZBA 3G4PA 4ZJ2A 1WYBA 1NXYA 3QNCA 3PBRA 5GHXA 2Y2JA 1K38A 3AGDA 3LY4A 4OOMA 4GD6A 1KGGA 3C7VA 4WM9A 2JE5A 5I94A 3HL9A 4X6TA 2WADA 5CHUA 4RYEA 4WBGA 4CPKA 3PBOA 4K0XA 4ZAMA 3IF6A 3OPLA 4E3MA 4QY5A 3CMZA 1EWZA 5DF7A 1FR1A 4Y0UA 4JPMA 5CHJA 1QMFA 3VFFA 1ZC2A 2HDUA 3ZDJA 3WRTA 5F1FA 1Q2QA 2Y4AA 3M6BA 4GOGA 3Q1FA 3UO9A 4PM8A 2ZM2A 3OPHA 4Z9QA 4K0WA 3G32A 3WS5A 3EQUA 5BOHA 1TEMA 5HFOA 2WZXA 1XGIA 2WKEA 2V20A 4A5RA 1ALQA 4OPRA 2J7VA 4WZ4A 5D3OA 1PWDA 3G35A 4S2NA 5M1AA 2ZJ9A 5J8XA 3GV9A 1L0GA 3MKFA 3AGFA 1HTZA 1K55C 1BULA 4C3QA 1ES4A 5GHYA 5TGFA 3IWQA 2R9XA 3GVBA 2ZD8A 1TDGA 4BD0A 2X71A 1XX2A 3GR2A 5CHMA 3MBZA 5JYPA 3ZVTA 5CTMA 5F82A 1YMSA 2I72A 4GKUA 3N8SA 4ZJ1A 4EBPA 2B5RA 3DWZA 4QY6A 5GLAA 1Z6FA 2EFUA 3VP0A 3G2ZA 3MXSA 1K57A 2Y2NA 3UDXA 1XA1A 5FI6A 4KZ9A 5GL9A 2ZC3B 3HREA 1LI9A 1IEMA 1JWVA 3ZG0A 1YLWA 5EVIC 3W4QA 5E43A 5E2EA 3IXBA 4FD8A 4U3TA 5FQKA 1LI0A 3W4PA 4HBTA 4M3KA 3BRMA 1BTLA 3ZVWA 1W8QA 3IWIA 3WWXA 4OLGA 4E6WA 2Y2QA 3QNBA 3MFDA 1LL5A 4EUZA 1ES3A 1FR6A 2PBYA 2Y2KA 4GD8A 4OQGA 1CI9A 3EQVA 1MWRA 4IEDA 3RXXA 1K54A 5EUAA 5M18A 2Y2MA 3VOYA 3HBRA 3O86A 1MY8A 3VP4A 4P6BA 3G30A 4JF6A 1CK3A 1BLCA 1CEGA 1DY6A 1YLPA 2HPBA 1KDSA 3A3IA 3BLSA 1YT4A 1BLHA 3HLDA 5EOEA 4DE1A 3BFEA 5AQ9A 3V50A 1LL9A 1GHMA 3IXHA 3ZG9B 3UE3A 3WS2A 3PBSA 5GLCA 2Y2PA 5A93A 2Z2MB 4B88A 4OP8A 5E2GA 4E3JA 5FDHA 1KE3A 1L2SA 4OOLA 3V39A 2OV5A 5DF8A 2VGKA 3TG9A 2P9VB 4BD1A 3NIAA 1YMXA 4OPQA 3IF6C 3MKEA 2EFXA 5HW3A 4YFMA 5HAIA 3N7WA 5IHVA 3IHAA 3B3XA 1U60A 2XEPA 4N9KA 4B4XA 4X55A 1IYPA 1KDWA 1OMEA 1BLPA 1PW1A 2EXAA 2Q9NA 1YLTA 3IT9A 5FQQA 3V3SA 4C6YA 4IBXA 4EQIA 2E8IA 3FZCA 4OOYA 3LCEA 4HESA 1ESIA 3BLMA 3IQAA 5CXWA 5F1GA 3IXDA 1GHPA 1ZG6A 3JYIA 3NBLA 3W8KA 3A3EA 2RCXA 2Y2HA 1PWGA 4IVKA 4KG6A 1ZKJA 2J9PA 3UDIA 1PZPA 1ZG4A 3FWLA 1SKFA 4S2NC 1H8ZA 1J9MA 2H0YA 1JTGA 2WK0A 1BLSA 4UAAA 2XFSA 3GMWA 2ZQ7A 2H10A 1O7EA 4PM6A 4WMCA 3G2YA 4D2OA 4H8RA 4QB8A 2ZC7A 1XXMA 2DRWA 1PI5A 2HDQA 4E3OA 2ZC6B 3RXWA 3Q7VB 1K4EA 1K6RA 1IYQA 5KMWA 5TFQA 4S2PA 4DDSA 1ES2A 3E2KA 1XKZA 1K57C 1JVJA 1TDLA 3CZDA 3N8RA 2WUQA 3MXRA 5HL1A 4JBFA 4WMCD 3SH8A 3SH9A 1FQGA 2P74A 4U0TA 3D4FA 5HAQA 4LV1A 1KE4A 4DKIA 1MWSA 4MBFA 4N1XA 1K6SA 4WEKA 4Y0TA 2XGNA 3O87A 1E4DA 5EE8A 1K56A 3OC2A 3BECA 3CG5A 5DTSA 3TOIA 1L0EA 2DNSA 4UA6A 2Y59A 5KSCA 1XPBA 2WAFA 4DE2A 2A3UA 5DF9A 1VQQA 2Y2OA 1BZAA 4OH0A 3WS0A 3UPOA 4WZ5A 3PAEA 1K54C 1Q2PA 1NJ4A 1MKIA 4R1GA 4P85A 4IBRA 1Y54A 4S2MA 1K56D 1O07A 4EBNA 5JYOA 1CI8A 3OCNA 3HVFA 4P0MA 4BJPA 5GHZA 4ZJ3A 4OLDA 3UDFA 1W5DA 1LLBA 3OPRA 4LV3A 1PI4A 4MLLA 4E3KA 3BEBA 4S2KA 1DJCA 1HVBA 1YLZA 2PU2A 4UHUA 3RJUA 3ZFZA 3M2JA 1ESUA 5CGWA 3VP3A 2XH9A 4GB7A 4DDYA 4ZDXA 3N6IA 3Q82A 4UA9A 3UNWA 5F83A 3AGEA 4OQHA 4OPYA 2WKHA 2BG1A 3Q81A 1WE4A 4MBKA 2OLUA 5CGXA 4FH4A 4HBUA 5HX9A 4S2IA 2ZQ8A 2XF3A 2H0TA 4JXSA 1PIOA 3C4OA 1XA7A 4IVIA 4ZBEA 1C3BA 3VOZA 3HUNA 1ONGA 4MNRA 3OPPA 4KZ6A 4XUZA 2OSUA 1S0WA 2JCHA 1H5XA 2WYXA 3V5MA 5HAPA 5GLBA 2XD5A 5FAQA 1KVMA 2QPNA 2HP9A 5G18A 3A3JA 3DWKA 1NZUA 1BSGA 3CJMA 1E25A 4JKTA 4KZBA 5CTNA 5DTTA 4NETA 2ZQDA 5FAOA 3Q07A 3ZG5A 2H5SA 2GDNA 1FCNA 4U0XA 1MXOA 3UPNA 4YINA 1BT5A 5EOOA 1WYCA 1BUEA 1DJBA 1FSYA 3ZCZA 3HLWA 2P9VA 4QU3A 3SH7A 3NC8A 3HLGA 3LEZA 4LENA 4KQOA 3PBTA 1PWCA 4R3JA 2ZQAA 4S2LA 2EX2A 2WZZA 1S6RA 4KG5A 5FQJA 4E3NA 4S2JA 2HP5A 4OONA 5CEDA 1IYSA 3ITAA 4OQ0A 4RVAA 5FAPA 1I2WA 1PYYA 2JBFA 2R9WA 4KQRA 5HARA 3MZDA 1XGJA 5U47A 2Y55A 3P98A 4WYYA 4BQMA 2QMIA 2FFYA 3GQZA 5L2FA 1KGEA 2HP6A 4BENA 3C7UA 2WAEA 2Q9MA 4XUXA 4BL2A 1IKIA 4WZ5C 4R3BA 1SDNA 2WGIA 3A3FA 3Q7VA 1ES5A 1FSWA 3BYDA 4X69A 1IELA 2IWDA 3VFHA 3ZG8B 1W8YA 2WKIA 2V2FF 5FATA 5KSHA 3BM6A 4LCLA 4OQIA 1G6AA 4Y7PA 5AQ7A 5EVLA 2XFTA 3LY3A 4DF6A 2Y2GA 4ZTKA 1FOFA 3SOIA 3W4OA 3OZHA 3VMAA 2RL3A 3SS3A 3GSGA 3HUMA 5EECA 2Y2IA 4WEJA 2G2UA 1KGFA 3HLFA 3ZNTA 2Y2LA 4LV2A 3NY4A 3VSKA 3G31A 1YLYA 3DW0A 4FCFA 1SHVA 1JWZA 3G34A 3IF5A 4BLMA 4KZ7A 4LV0A 5CRFA 2WGWB 5DVAA 3V3RA 1IYOA 1GCEA 4OPZA 4XXRA 4X56A 5DTKA 5TR7A 1JWPA 1FCMA 4RX2A 5CEBA 4PM9A 4PPRA 3ZNYA 3FKWA 3ITBA 3IXGA 2Y91A 5E2FA 4E3LA 3OCLA 4N92A 4DXCA 5FA7A 1G68A 1L0FA 3UY6A 1K4FA 3FV7A
chains in the Genus database with same CATH superfamily
3BFDA 4B4ZA 4DXBA 2W3EA 3RH8B 1TS8A 4KZ4A 3P09A 4KZAA 4BWIA 4R3AA 4WUJA 4GDNA 4GHIB 1F2KA 2Z6DA 2XROA 3C4PA 1TF1A 2FFFB 1MBLA 5CECA 1OPXA 4EV4A 4BL3A 3WS1A 3M2KA 4R4RA 5A90A 4X1LA 4JGRA 4CLCE 2O0YA 3SS5A 4PM7A 1WA9A 4MN7A 4HI4A 2ZC5B 5EPHA 2W3FA 2IWCA 2PYPA 4S2OA 1MWUA 5EVEA 4M4XA 1OTAA 5TBMB 5GLDA 5CGSA 3IHBA 5A91A 3UPPA 1NRJA 1Z09A 1EI5A 5M19A 1SDEA 1I2SA 2ZC4B 5FSRA 3ZG7B 4F94A 5FI7A 3LUQA 2OOLA 1T19A 4HH2A 5F6AA 2ZL1B 4E6XA 2ZM8A 2VGJA 3FPWA 3FYZA 4UA7A 5J3WA 1N9BA 4FH2A 3NDEA 3HLCA 2PR5A 2KX6A 2W1TA 4OKPA 2WGVA 5FQIA 1T1BA 1M40A 2XR0A 2XK1A 5EVID 3LR3A 1FILA 4R6LA 2Z2LB 3E2LA 3G6OA 2J9OA 1HZOA 3RTYA 3E98A 3WS4A 3G4PA 4ZJ2A 2PD8A 5J4EA 1NXYA 2HV1A 3PBRA 2Y2JA 3LY4A 1S1YA 4GD6A 2OWHA 5EM0A 4RYEA 3T1XA 3T4TA 4CPKA 3OBFA 5HWWA 4ZAMA 3OPLA 5DF7A 1LSWA 4Y0UA 3VFFA 1Q2QA 3M6BA 3Q1FA 2ZOHA 1LSVA 4GHIA 4Z9QA 3WS5A 5BOHA 1XGIA 2WKEA 3BQAA 2JKTM 2B02A 4EU0A 5CX7A 5J8XA 4Y15A 3GV9A 2R78A 3MKFA 3AGFA 1K55C 1ES4A 5GHYA 3W2ZA 1XX2A 3GR2A 4EXOA 1F98A 5HL6A 1Z6FA 1W63Q 3F1NB 2QYBA 2Y2NA 2VLGA 3CPTA 4EESA 5EVIC 3W4QA 4U3TA 5DJTA 5FQKA 2V1AA 3BRMA 1W8QA 3QNBA 4EUZA 1ES3A 4I3IA 2V1BA 1CI9A 3LI8A 4JGQA 1MWRA 4DJ3A 5TBMA 5DKKA 1K54A 3VOYA 3O86A 1MY8A 3LIFA 3NULA 1CK3A 1DY6A 3HLDA 4ME4A 3IX3A 1BLHA 5EOEA 3V50A 3S7PA 2ZL1A 4E3JA 3QP5A 5FDHA 1OTIA 2OV5A 2IA2A 1YMXA 3IF6C 5HW3A 2XEPA 4B4XA 4X55A 1KDWA 1BLPA 1PW1A 3CI6A 4HESA 2WKQA 5F1GA 4BENA 3QP4A 5DJUA 3UDIA 3FWLA 1J9MA 2WK0A 4D2OA 4DJ2A 4H8RA 1XXMA 2HDQA 2ZC6B 1IYQA 1T1AA 4DDSA 1XKZA 1TDLA 3SH8A 3BY9A 3D4FA 4LV1A 4Y0TA 2XGNA 1E4DA 2P04A 4DE2A 4BBTA 2A3UA 3PHYA 1VQQA 2Y2OA 4OH0A 4WZ5A 2VGLM 4Q0JA 4R1GA 2QJ5A 2J80A 2O9CA 1CI8A 1S66L 3OCNA 5GHZA 3F1NA 1LLBA 2G7UA 3OPRA 4UHUA 2OAQ1 2Y79A 3T1SA 3UNWA 3B42A 2JKTI 1F5MA 4HNBA 3Q81A 4H6JA 1YPRA 5HX9A 3GECA 3C4OA 2WKRA 1L3LA 2V8FA 2PBDP 4B9OA 3VOZA 2BASA 2OSUA 2JCHA 1S1ZA 5F69A 1NWZA 2XD5A 1KVMA 5G18A 3A3JA 1BSGA 1SKOB 2VV6A 1FCNA 1PFLA 2A24B 3UPNA 4XT2B 1DJBA 3ZCZA 2A2LA 1OTEA 1XJ4A 1LL8A 1MKMA 4R3JA 2EA9A 2WZZA 4KG5A 4S2JA 3LIBA 1IYSA 3IBRA 2QJ7A 4NXFA 2W1RA 5FAPA 5HARA 3D72A 1XGJA 2Y55A 3P98A 4BQMA 1KGEA 2HP6A 2ZMVA 4BL2A 2WGIA 5KZHA 3ZG8B 1IELA 2IWDA 1OT6A 2Q0OA 4Y13A 4LCLA 5EVLA 3MQQA 4DF6A 2Y2GA 4ZTKA 3MFXA 3VMAA 3H9WA 2B95A 1HLUP 5IT5A 3CAXA 3G31A 1P97A 2MJ6A 3LIDA 3V3RA 4OPZA 1YKDA 1FCMA 4RX2A 4PPRA 4HOIA 3OOVA 2V0UA 3KYEA 1UWPX 5FA7A 3CHWP 2K2NA 5AVFA 3IF6B 4K91A 3IBJA 5HPIA 2EXBA 4Q8IA 1TD5A 3UN7A 4JF5A 5CERA 3QP1A 5HDSA 1KE0A 4JLFA 1K25A 3A0VA 4LRYC 3WRZA 5HPFA 4QJGA 3KSFA 4NXBA 2IWBA 2ZM0A 3HLBA 4PKYA 1NRFA 2EX9A 1I5QA 1OT9A 2OLVA 4OVDA 5FQ9A 3GTCA 4C75A 3P7NA 2HDSA 2VA0A 4PHTA 2CC1A 3LFVA 1SKOA 1MWTA 1RP5A 3PBNA 3HJKA 2A24A 3HJIA 4XT2A 1SZVA 1UGUA 2ZLYA 4R23A 5A92A 3O3VA 4QHCA 1NY0A 3UMEA 2QZ6A 3LYXA 4P6ZM 1DJAA 4X1MA 3VSLA 1K55A 3ICYA 3FKVA 3ZQ5A 4DE0A 3MZFA 3PBQA 2WKPA 4L0LA 3ZHHA 1H8MA 4GNUA 5TJJA 3BY8A 1E3UD 2VGLS 2V1ZA 3NOPC 3E4QA 4DE3A 1YLJA 1IKGA 2PAVP 3C5AA 5EVIA 1T1CA 4P87A 4Y3IA 3UE1A 3H7WB 3BFGA 1XP4A 4YWZA 4GDBA 3E0YA 2W1TB 4WN5A 4OP5A 3ZGAB 2PU4A 1N4OA 3LEQA 3HUOA 4JF4A 4O7DA 5FL3A 2LB5A 4MDZA 1T18A 5GHXA 4K08A 5L8MA 2WADA 4RQ9A 1S67L 3PBOA 4K0XA 3IF6A 4E3MA 3CMZA 5CHJA 4JPMA 2L0WA 4HY8A 1ZC2A 3ZDJA 2Y4AA 1Y28A 4PM8A 1VB6A 2I9VA 5DFYA 1GSWA 4OPRA 1EW0A 4WZ4A 5D3OA 3T4KA 5DKLA 3D9YA 2ZJ9A 3IS2B 3VE3A 1HTZA 1BULA 3IWQA 3N8SA 4I39A 4ZJ1A 2EWVA 2B5RA 5GLAA 2EFUA 3G2ZA 5IU1A 4LGWA 1XA1A 4KZ9A 4KUOA 1IEMA 1JWVA 5FEGA 2W3HA 3CPTB 3DTKA 1W63M 1ODVA 4D60A 3W4PA 4HH3A 4OLGA 3KSHA 2K31A 3MFDA 2PBYA 3BWLA 4OQGA 3EQVA 4IEDA 3MF0A 2J3WA 3RXXA 3VV4A 5M18A 1D06A 3HBRA 4P6BA 3G30A 1YLPA 3A3IA 3BLSA 4L9FA 5AQ9A 3UMDA 1LL9A 3ZG9B 3WS2A 2OAP1 5A93A 1P9WA 4OP8A 3JVUA 1A0KA 1KE3A 3PXPA 5DF8A 2VGKA 2P9VB 4BD1A 1XJ6A 2EFXA 3H7WA 5IHVA 3B3XA 3LIEA 2W3GA 3IT9A 3LR0A 5FQQA 4C6YA 3IXDA 1GHPA 1ZG6A 3JYIA 1LT0A 4HIAA 3NJAA 3W8KA 3A3EA 4IVKA 4KG6A 1ZKJA 1PZPA 1ZG4A 2YKHA 4S2NC 1MC0A 1H8ZA 1JTGA 4UAAA 2XFSA 1TS6A 3G2YA 4FOFA 3RXWA 4Z1WA 2XRNA 1K4EA 1IOUA 5HDCA 4S2PA 1ES2A 1K57C 3CZDA 4UQIM 2WUQA 4NEED 5HL1A 4JBFA 4WMCD 2VX8A 3ULFA 4IJGA 5HAQA 1KE4A 1DP9A 3CLOA 4MN5A 4P6ZS 3LGOA 3BECA 1L0EA 4UA6A 5KSCA 3IS2A 2YKFA 2GZAA 1BZAA 3R7WA 3QP6A 1GSXA 3VE4A 3PAEA 3UB7A 4P85A 4P0MA 3HVFA 5K5BA 1W5DA 3L9KA 2PU2A 3M2JA 1ESUA 4GB7A 4DDYA 2JKGA 4ZDXA 2KDKA 3N6IA 4OQHA 3R4KA 5EV0A 2OLUA 2XF3A 2H0TA 3K3CA 4H6JB 1XA7A 2NUPC 4ZBEA 5HWVA 3HUNA 3OPPA 4XUZA 2WYXA 2PRFA 4LLOB 5FAQA 2HP9A 3KYZA 3CJMA 4JKTA 5DTTA 4NETA 2ZQDA 4EERA 3CWFA 3ZG5A 1G28A 3EEAA 1WYCA 3E4OA 2P9VA 3SH7A 3DAVA 3TE8A 3NC8A 3HLGA 5MC7A 2ZQAA 4S2LA 1CJFA 3NOTC 5F68A 3ITAA 4OQ0A 2D01A 1S4RA 1PYYA 5U47A 3C7UA 2Q9MA 4XUXA 4CLCD 2ZOIA 3DTIA 1SDNA 2WKIA 3BM6A 4OQIA 1G6AA 2XFTA 3LY3A 3OZHA 3SS3A 1N9OA 3MS6A 5G4ZA 4WEJA 1KGFA 4HQAA 4LRZE 3VSKA 3DW0A 1V9YA 3IF5A 4BLMA 4G3KA 5F5YA 4LV0A 5CRFA 4X56A 1JWPA 5CEBA 4JGPA 1YSPA 4LFUA 5E2FA 1G68A 4O0PA 3T4QA 3KYQA 5AQAA 4QD4A 4WL9A 3UE0A 1GSVA 1ERQA 2J8YA 3VP2A 1VETA 2XDMA 2UWXA 1NYMA 4YNRA 4DRTA 4JXWA 3C38A 2ZMFA 4CLCC 1TVFA 1H8YA 1KVLA 3IWOA 4GJ4A 3BJNA 2Z6CA 3CITA 1GA9A 1G5UA 3IH9A 4F3LB 4MBHA 1AXBA 4ETZA 4GCZA 4ETXA 4Y0OA 4UQIS 2ZMAA 3IH8A 1EROA 1K0KA 2EX8A 4I5SA 4KZ8A 1IFQA 1E3UA 3LICA 3O88A 1VHMA 5FQMA 1RCJA 1YQSA 3A3DA 4HJ4A 4EUVA 4LCMA 4GW9A 4G3VA 4EWFA 1DP6A 2HDRA 4X25A 1H0MA 3NI9A 1NZOA 2A49A 3HCYA 4N1HA 3Q7ZA 3S22A 1CF0A 2G2WA 2ZQ9A 2XQZA 3BFCA 3HLEA 5EVIB 4JXGA 4WELA 1MPLA 4PM5A 2ZQCA 4KG2A 5HWTA 1PW8A 3SS4A 2X02A 4KZ5A 4RX3A 5AQBA 2ZBBA 3T1RA 1FCOA 3NCKA 3EGXC 1ERMA 3H82B 4GLQA 2GNXA 5HZHA 4GZBA 1OJGA 2PHYA 3AGDA 1G6OA 4NG2A 4WM9A 2KLIA 4WBGA 3C8CA 1EWZA 1FR1A 1LSXA 2HDUA 2HF6A 3UO9A 3T4LA 2ZM2A 4K0WA 3G32A 2PT7A 1XJ3A 1TEMA 5HFOA 4A5RA 1FIKA 4S2NA 1K4FA 2CMNA 2VV7A 2R9XA 2ZD8A 5CHMA 5JYPA 3ZVTA 5CTMA 1YMSA 2UV0E 3LR4A 4EBPA 3VOLA 4QY6A 2PR6A 3O5YA 4QWOA 1K57A 3UB6A 5FI6A 4F3LA 2ZC3B 3HREA 1YLWA 5E43A 5E2EA 4BBUA 5L07A 1LI0A 1DP8A 3L7HA 3WWXA 4G3WA 1LL5A 3MQOA 4GD8A 3K2NA 4MCWA 2Y2MA 4I3AA 2VJWA 4PAUA 4HJ6A 3VP4A 4JF6A 1BLCA 1CEGA 2HPBA 1YT4A 5EM1A 3BFEA 3BQ8A 1GHMA 3IXHA 2V0WA 3C2WA 3PBSA 2Y2PA 4B88A 5E2GA 1L2SA 4OOLA 3V39A 2P08A 3TRCA 5IS1A 5HAIA 1AWIA 4N9KA 2KOIA 1YLTA 4CLCB 4OOYA 3BLMA 3IQAA 3SW1A 2RCXA 1SKFA 3H82A 2H0YA 1BLSA 2ZQ7A 3MXQA 3A0RA 2H10A 1O7EA 4WMCA 2ZC7A 2AVXA 4UEYA 5KMWA 5TFQA 3JVVA 2LB9A 4AFIA 3MXRA 1NLYA 4EQ1A 1OTDA 4FTXA 3E4PA 1FQGA 2P74A 4N1XA 4WEKA 1K6SA 3O87A 4LPZA 3OC2A 3CG5A 2DNSA 4EETB 1XPBA 2WAFA 3ZYTA 3UPOA 5HD5A 3R7WB 5L09A 4S2MA 1K56D 1O07A 3KO6A 5JYOA 4ZJ3A 3UDFA 4MLLA 2XA7M 4S2KA 1DJCA 1HVBA 1YLZA 4NXEA 3MSHA 3SZTA 3ZFZA 2VKSA 3UB9A 4IUHA 4UA9A 4FUWA 3AGEA 2WKHA 3U4LP 1BYWA 1WE4A 4MBKA 5CGXA 4FH4A 4HBUA 2ZQ8A 4JXSA 4IVIA 3T4OA 4KQDA 1ONGA 4KZ6A 2JHEA 3V5MA 1H5XA 3KSIA 1P9RA 5HAPA 3TW8A 4WLAA 2QPNA 5C5KA 3B47A 1E25A 2H28A 5FAOA 3Q07A 2JKFA 2H5SA 3MJQA 2M7VA 4YINA 1PRQA 5EOOA 3HLWA 2INWA 5I5LA 3PBTA 1PWCA 2EX2A 3S7QA 4CLCA 3FG8A 1J3WA 2O9AA 3LR5A 2GJ3A 3CUEA 1I2WA 2JBFA 4Q0IA 3MZDA 5HDDA 2QMIA 2FFYA 1D7EA 2JKRM 5DFXA 3A3FA 1ES5A 4X69A 4GS9B 2V2FF 4O01A 1H3QA 3W4OA 2B18A 4BMWA 5J7EA 3HUMA 5EECA 2G2UA 2K7SA 3FC7A 2W3DA 3HLFA 3ZNTA 2QWSA 4LV2A 1YLYA 1JWZA 1TS0A 4KZ7A 4MMNA 2WGWB 1IYOA 1GCEA 2D02A 4XXRA 1XFNA 2M7UA 1F9IA 1N9LA 4E3LA 3A0SA 4DXCA 1L0FA 3UY6A 4DN0A 3FV7A 4LRXC 4MEZA 5E2HA 4PKYG 1LHYA 2GX5A 4KQQA 1TS7A 2HJEA 3M6HA 1S4SA 1JNUA 1W7FA 3MZEA 3N8LA 1XFQA 3BFFA 1VETB 3BW6A 4KZ3A 2JC7A 4ID4A 1GA0A 4IHQA 4KUKA 4R4SA 4HHDA 3PR6A 1SCWA 3EWKA 4EBLA 3DTMA 2BTFP 1PZOA 3TSGA 1YM1A 5FEFA 3U2AA 4N9LA 4R38A 3NDGA 4GN2A 3P01A 2BLSA 1L0DA 2DCFA 3T4JA 1RGZA 4NK3A 4E04A 1JTDA 1GHIA 5EFWA 3LO7A 3NOUC 1ONHA 3QHYA 1W79A 4E3IA 1NYYA 2HZ5A 1YSQA 4X53A 4HEFA 4RA7A 1QMEA 1M6KA 1KOUA 2HJ9C 3LI9A 3S1YA 4I3JA 2FH5A 4KENB 3IX8A 4X68A 2C5WB 4Y5FA 4CJNA 2XLNA 3I7JA 4FSFA 3GRJA 4EW7A 5FASA 4R0QA 2XD1A 1CEFA 4ESPA 3S7NA 2V9AA 1VM1A 3PAGA 1UWNX 4B93A 4R70A 4IUKA 4GS9A 2XA7S 4JXVA 2EX6A 4PMAA 2VK3A 5FI2A 2EWWA 2X01A 2C6WB 1HD8A 4JGOA 3QP8A 5KIZA 3S4XA 2HGVA 4MN6A 3PTEA 3VP1A 1RGYA 3ISGA 4II7A 1VEUB 2WGWA 2JKRI 3N4IA 1X0OA 4ZRRA 1WYBA 3QNCA 3QP2A 1K38A 4OOMA 1KGGA 3C7VA 3DBAA 3IX4A 2JE5A 5I94A 3HL9A 4X6TA 5CHUA 4QY5A 3FPVA 1QMFA 3F1PB 5F1FA 3WRTA 4GOGA 3KSGA 3OPHA 3EQUA 2WZXA 2V20A 1ALQA 2J7VA 3MQ0A 1PWDA 3G35A 5M1AA 1YAXA 1L0GA 4C3QA 5TGFA 4BD0A 3GVBA 1TDGA 1Y4OA 2X71A 3UE6A 3TJZC 3MBZA 5F82A 2VV8A 2I72A 4GKUA 2V8CA 1V9ZA 3DWZA 3CUEC 3VP0A 3MXSA 4L9EA 3UDXA 5GL9A 2JN7A 3PYPA 1LI9A 3ZG0A 3IXBA 4FD8A 1CQAA 1STZA 4HBTA 4M3KA 4Y17A 1BTLA 3ZVWA 3IWIA 4E6WA 2Y2QA 1FR6A 2VEAA 2Y2KA 3JPUA 2W27A 4WF0A 4EEUA 5EUAA 2J3TD 2PD7A 3LIAA 3K3DA 5A8BA 4Q0HA 1XJ2A 1KDSA 4DE1A 3OLOA 4ARZB 3UE3A 5GLCA 2Z2MB 2P7JA 2FZ0A 3T50A 4NXGA 3TG9A 3NIAA 4OPQA 3MKEA 4YFMA 3N7WA 3IHAA 1U60A 1IYPA 3F1OB 1OMEA 3V3SA 2EXAA 2Q9NA 4IBXA 4EQIA 2E8IA 3FZCA 2VZWA 3LCEA 1ESIA 5CXWA 3GDIA 3UB5P 2DMWA 4E3NA 3NBLA 2Y2HA 1PWGA 3DTEA 2J9PA 1OJ5A 1VEUA 3GMWA 2Y8HA 3MMHA 4PM6A 4QB8A 1ZHHB 2DRWA 1PI5A 4E3OA 3Q7VB 1K6RA 3EEHA 3E2KA 1JVJA 3N8RA 3D3OA 3SH9A 3F1PA 4U0TA 4I38A 4O8GA 4DKIA 1D1JA 1MWSA 4MBFA 2J3TC 4BBVA 5EE8A 1K56A 5DTSA 3TOIA 2ACGA 2Y59A 3KX0X 5LBRA 5DF9A 3T1QB 3WS0A 1MZUA 1K54C 1Q2PA 1NJ4A 1MKIA 4IBRA 1Y54A 4Y2FA 4EBNA 4BJPA 4OLDA 2OWJA 4LV3A 1PI4A 4E3KA 4HP4A 3BEBA 3RJUA 3NECA 5CGWA 3VP3A 3NHQA 2XH9A 1DRMA 2PYRA 3Q82A 5F83A 1ZTUA 4OPYA 1PNEA 2BG1A 3S7OA 1P0ZA 4S2IA 1NLZA 1PIOA 4HP9A 1C3BA 2L1MA 3EGDC 4MNRA 1S0WA 3MR0A 5GLBA 4ARZA 3DWKA 1NZUA 2QKPA 5CTNA 4KZBA 4YOFA 2GDNA 2M1CA 4U0XA 1MXOA 1BT5A 1BUEA 1FSYA 2O9BA 2PDRA 4QU3A 4L9GA 2NUTC 2L4RA 5AJGA 3LEZA 4LENA 4KQOA 5L10A 2W0NA 3F1OA 5FQJA 1S6RA 2HP5A 4OONA 5CEDA 4QPRA 4RVAA 3V67A 2R9WA 5G4YA 3UB8A 4WYYA 2E8JA 3GQZA 5L2FA 2WAEA 1IKIA 4WZ5C 4R3BA 1OTBA 4EEPA 3Q7VA 1FSWA 3BYDA 3VFHA 1ACFA 1W8YA 5FATA 3C30A 5KSHA 4Y7PA 5AQ7A 1FOFA 3SOIA 5AVEA 4HJ3A 4DMZA 2RL3A 3GSGA 5FDSA 2Y2IA 3B33A 2Y2LA 3NY4A 4FCFA 1SHVA 4NKPA 3G34A 5HD3A 2QHKA 3EOIA 4CQHA 5DVAA 3T12B 5DTKA 5TR7A 4PM9A 3ZNYA 3FKWA 3ITBA 3IXGA 3T4SA 2Y91A 3OCLA 1N9NA 5HSQA 4N92A 2XSSA 2O99A 4KQRA 3RFBA
chains in the Genus database with same CATH topology
4MEZA 3BFDA 5E2HA 4B4ZA 3IF6B 4K91A 1LHYA 4DXBA 5AQAA 5KZHA 2EXBA 4KQQA 4KZ4A 4Q8IA 3P09A 3M6HA 4QD4A 1W7FA 4KZAA 3UE0A 3UN7A 4JF5A 1ERQA 4GDNA 2J8YA 5CERA 3VP2A 2XDMA 2UWXA 1NYMA 3MZEA 1KE0A 3N8LA 4DRTA 4JLFA 3BFFA 1K25A 4KZ3A 2JC7A 4ID4A 4JXWA 1GA0A 3WRZA 4R4SA 3C4PA 1SCWA 4EBLA 4QJGA 3DTMA 2IWBA 2ZM0A 3HLBA 2FFFB 1NRFA 1PZOA 1MBLA 3TSGA 2EX9A 1YM1A 5CECA 1TVFA 1H8YA 1KVLA 1I5QA 4N9LA 3IWOA 3NDGA 4GN2A 2OLVA 4OVDA 4EV4A 4BL3A 3WS1A 5FQ9A 2BLSA 1L0DA 1GA9A 3GTCA 4C75A 2DCFA 3M2KA 4R4RA 1RGZA 2HDSA 4NK3A 5A90A 1JTDA 1GHIA 3IH9A 3SS5A 4PM7A 4MBHA 1AXBA 2CC1A 1ONHA 3LO7A 1MWTA 1RP5A 1W79A 3QHYA 2ZMAA 4Y0OA 4E3IA 1NYYA 3PBNA 4X53A 4HEFA 3IH8A 2ZC5B 1EROA 4RA7A 2EX8A 5EPHA 4KZ8A 2ZLYA 2IWCA 4R23A 5A92A 1QMEA 1M6KA 4S2OA 3O3VA 4QHCA 3S1YA 1E3UA 3O88A 5FQMA 4KENB 1MWUA 1NY0A 2QZ6A 3VSLA 1DJAA 1RCJA 1YQSA 3A3DA 4X68A 1K55A 4LCMA 5GLDA 2C5WB 4CJNA 5CGSA 3FKVA 2XLNA 3I7JA 3IHBA 4FSFA 3MZFA 3PBQA 5A91A 3UPPA 2HDRA 4DE0A 4EWFA 1EI5A 5M19A 3GRJA 1SDEA 1I2SA 4L0LA 2ZC4B 5FSRA 3ZG7B 3ZHHA 5FASA 4R0QA 2XD1A 4F94A 4GNUA 5FI7A 3NI9A 1NZOA 2A49A 1E3UD 1CEFA 2V1ZA 4DE3A 1VM1A 4N1HA 3Q7ZA 3PAGA 1YLJA 3S22A 2G2WA 4E6XA 1IKGA 2ZQ9A 3C5AA 2ZM8A 5EVIA 2VGJA 3FYZA 4JXVA 2EX6A 2XQZA 4UA7A 4P87A 3BFCA 4PMAA 3UE1A 3HLEA 1N9BA 4FH2A 5EVIB 4JXGA 5FI2A 3NDEA 1MPLA 4WELA 2ZQCA 4PM5A 3HLCA 3BFGA 1XP4A 4KG2A 1PW8A 2X01A 4GDBA 2C6WB 2WGVA 4OKPA 3SS4A 5FQIA 1HD8A 2X02A 4KZ5A 4OP5A 4RX3A 5AQBA 1M40A 2XR0A 3ZGAB 2XK1A 5EVID 1FCOA 3S4XA 2Z2LB 2PU4A 3E2LA 1N4OA 2J9OA 1HZOA 3NCKA 3PTEA 3VP1A 1ERMA 1RGYA 3ISGA 3HUOA 4JF4A 4O7DA 3WS4A 2WGWA 3N4IA 4GZBA 3G4PA 4ZJ2A 1WYBA 1NXYA 3QNCA 3PBRA 5GHXA 2Y2JA 1K38A 3AGDA 3LY4A 4OOMA 4GD6A 1KGGA 3C7VA 4WM9A 2JE5A 5I94A 3HL9A 4X6TA 2WADA 5CHUA 4RYEA 4WBGA 4CPKA 3PBOA 4K0XA 4ZAMA 3IF6A 3OPLA 4E3MA 4QY5A 3CMZA 1EWZA 5DF7A 1FR1A 4Y0UA 4JPMA 5CHJA 1QMFA 3VFFA 1ZC2A 2HDUA 3ZDJA 3WRTA 5F1FA 1Q2QA 2Y4AA 3M6BA 4GOGA 3Q1FA 3UO9A 4PM8A 2ZM2A 3OPHA 4Z9QA 4K0WA 3G32A 3WS5A 3EQUA 5BOHA 1TEMA 5HFOA 2WZXA 1XGIA 2WKEA 2V20A 4A5RA 1ALQA 4OPRA 2J7VA 4WZ4A 5D3OA 1PWDA 3G35A 4S2NA 5M1AA 2ZJ9A 5J8XA 3GV9A 1L0GA 3MKFA 3AGFA 1HTZA 1K55C 1BULA 4C3QA 1ES4A 5GHYA 5TGFA 3IWQA 2R9XA 3GVBA 2ZD8A 1TDGA 4BD0A 2X71A 1XX2A 3GR2A 5CHMA 3MBZA 5JYPA 3ZVTA 5CTMA 5F82A 1YMSA 2I72A 4GKUA 3N8SA 4ZJ1A 4EBPA 2B5RA 3DWZA 4QY6A 5GLAA 1Z6FA 2EFUA 3VP0A 3G2ZA 3MXSA 1K57A 2Y2NA 3UDXA 1XA1A 5FI6A 4KZ9A 5GL9A 2ZC3B 3HREA 1LI9A 1IEMA 1JWVA 3ZG0A 1YLWA 5EVIC 3W4QA 5E43A 5E2EA 3IXBA 4FD8A 4U3TA 5FQKA 1LI0A 3W4PA 4HBTA 4M3KA 3BRMA 1BTLA 3ZVWA 1W8QA 3IWIA 3WWXA 4OLGA 4E6WA 2Y2QA 3QNBA 3MFDA 1LL5A 4EUZA 1ES3A 1FR6A 2PBYA 2Y2KA 4GD8A 4OQGA 1CI9A 3EQVA 1MWRA 4IEDA 3RXXA 1K54A 5EUAA 5M18A 2Y2MA 3VOYA 3HBRA 3O86A 1MY8A 3VP4A 4P6BA 3G30A 4JF6A 1CK3A 1BLCA 1CEGA 1DY6A 1YLPA 2HPBA 1KDSA 3A3IA 3BLSA 1YT4A 1BLHA 3HLDA 5EOEA 4DE1A 3BFEA 5AQ9A 3V50A 1LL9A 1GHMA 3IXHA 3ZG9B 3UE3A 3WS2A 3PBSA 5GLCA 2Y2PA 5A93A 2Z2MB 4B88A 4OP8A 5E2GA 4E3JA 5FDHA 1KE3A 1L2SA 4OOLA 3V39A 2OV5A 5DF8A 2VGKA 3TG9A 2P9VB 4BD1A 3NIAA 1YMXA 4OPQA 3IF6C 3MKEA 2EFXA 5HW3A 4YFMA 5HAIA 3N7WA 5IHVA 3IHAA 3B3XA 1U60A 2XEPA 4N9KA 4B4XA 4X55A 1IYPA 1KDWA 1OMEA 1BLPA 1PW1A 2EXAA 2Q9NA 1YLTA 3IT9A 5FQQA 3V3SA 4C6YA 4IBXA 4EQIA 2E8IA 3FZCA 4OOYA 3LCEA 4HESA 1ESIA 3BLMA 3IQAA 5CXWA 5F1GA 3IXDA 1GHPA 1ZG6A 3JYIA 3NBLA 3W8KA 3A3EA 2RCXA 2Y2HA 1PWGA 4IVKA 4KG6A 1ZKJA 2J9PA 3UDIA 1PZPA 1ZG4A 3FWLA 1SKFA 4S2NC 1H8ZA 1J9MA 2H0YA 1JTGA 2WK0A 1BLSA 4UAAA 2XFSA 3GMWA 2ZQ7A 2H10A 1O7EA 4PM6A 4WMCA 3G2YA 4D2OA 4H8RA 4QB8A 2ZC7A 1XXMA 2DRWA 1PI5A 2HDQA 4E3OA 2ZC6B 3RXWA 3Q7VB 1K4EA 1K6RA 1IYQA 5KMWA 5TFQA 4S2PA 4DDSA 1ES2A 3E2KA 1XKZA 1K57C 1JVJA 1TDLA 3CZDA 3N8RA 2WUQA 3MXRA 5HL1A 4JBFA 4WMCD 3SH8A 3SH9A 1FQGA 2P74A 4U0TA 3D4FA 5HAQA 4LV1A 1KE4A 4DKIA 1MWSA 4MBFA 4N1XA 1K6SA 4WEKA 4Y0TA 2XGNA 3O87A 1E4DA 5EE8A 1K56A 3OC2A 3BECA 3CG5A 5DTSA 3TOIA 1L0EA 2DNSA 4UA6A 2Y59A 5KSCA 1XPBA 2WAFA 4DE2A 2A3UA 5DF9A 1VQQA 2Y2OA 1BZAA 4OH0A 3WS0A 3UPOA 4WZ5A 3PAEA 1K54C 1Q2PA 1NJ4A 1MKIA 4R1GA 4P85A 4IBRA 1Y54A 4S2MA 1K56D 1O07A 4EBNA 5JYOA 1CI8A 3OCNA 3HVFA 4P0MA 4BJPA 5GHZA 4ZJ3A 4OLDA 3UDFA 1W5DA 1LLBA 3OPRA 4LV3A 1PI4A 4MLLA 4E3KA 3BEBA 4S2KA 1DJCA 1HVBA 1YLZA 2PU2A 4UHUA 3RJUA 3ZFZA 3M2JA 1ESUA 5CGWA 3VP3A 2XH9A 4GB7A 4DDYA 4ZDXA 3N6IA 3Q82A 4UA9A 3UNWA 5F83A 3AGEA 4OQHA 4OPYA 2WKHA 2BG1A 3Q81A 1WE4A 4MBKA 2OLUA 5CGXA 4FH4A 4HBUA 5HX9A 4S2IA 2ZQ8A 2XF3A 2H0TA 4JXSA 1PIOA 3C4OA 1XA7A 4IVIA 4ZBEA 1C3BA 3VOZA 3HUNA 1ONGA 4MNRA 3OPPA 4KZ6A 4XUZA 2OSUA 1S0WA 2JCHA 1H5XA 2WYXA 3V5MA 5HAPA 5GLBA 2XD5A 5FAQA 1KVMA 2QPNA 2HP9A 5G18A 3A3JA 3DWKA 1NZUA 1BSGA 3CJMA 1E25A 4JKTA 4KZBA 5CTNA 5DTTA 4NETA 2ZQDA 5FAOA 3Q07A 3ZG5A 2H5SA 2GDNA 1FCNA 4U0XA 1MXOA 3UPNA 4YINA 1BT5A 5EOOA 1WYCA 1BUEA 1DJBA 1FSYA 3ZCZA 3HLWA 2P9VA 4QU3A 3SH7A 3NC8A 3HLGA 3LEZA 4LENA 4KQOA 3PBTA 1PWCA 4R3JA 2ZQAA 4S2LA 2EX2A 2WZZA 1S6RA 4KG5A 5FQJA 4E3NA 4S2JA 2HP5A 4OONA 5CEDA 1IYSA 3ITAA 4OQ0A 4RVAA 5FAPA 1I2WA 1PYYA 2JBFA 2R9WA 4KQRA 5HARA 3MZDA 1XGJA 5U47A 2Y55A 3P98A 4WYYA 4BQMA 2QMIA 2FFYA 3GQZA 5L2FA 1KGEA 2HP6A 4BENA 3C7UA 2WAEA 2Q9MA 4XUXA 4BL2A 1IKIA 4WZ5C 4R3BA 1SDNA 2WGIA 3A3FA 3Q7VA 1ES5A 1FSWA 3BYDA 4X69A 1IELA 2IWDA 3VFHA 3ZG8B 1W8YA 2WKIA 2V2FF 5FATA 5KSHA 3BM6A 4LCLA 4OQIA 1G6AA 4Y7PA 5AQ7A 5EVLA 2XFTA 3LY3A 4DF6A 2Y2GA 4ZTKA 1FOFA 3SOIA 3W4OA 3OZHA 3VMAA 2RL3A 3SS3A 3GSGA 3HUMA 5EECA 2Y2IA 4WEJA 2G2UA 1KGFA 3HLFA 3ZNTA 2Y2LA 4LV2A 3NY4A 3VSKA 3G31A 1YLYA 3DW0A 4FCFA 1SHVA 1JWZA 3G34A 3IF5A 4BLMA 4KZ7A 4LV0A 5CRFA 2WGWB 5DVAA 3V3RA 1IYOA 1GCEA 4OPZA 4XXRA 4X56A 5DTKA 5TR7A 1JWPA 1FCMA 4RX2A 5CEBA 4PM9A 4PPRA 3ZNYA 3FKWA 3ITBA 3IXGA 2Y91A 5E2FA 4E3LA 3OCLA 4N92A 4DXCA 5FA7A 1G68A 1L0FA 3UY6A 1K4FA 3FV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEZ A;  3BFD A;  5E2H A;  4B4Z A;  3IF6 B;  4K91 A;  1LHY A;  4DXB A;  5AQA A;  5KZH A;  2EXB A;  4KQQ A;  4KZ4 A;  4Q8I A;  3P09 A;  3M6H A;  4QD4 A;  1W7F A;  4KZA A;  3UE0 A;  3UN7 A;  4JF5 A;  1ERQ A;  4GDN A;  2J8Y A;  5CER A;  3VP2 A;  2XDM A;  2UWX A;  1NYM A;  3MZE A;  1KE0 A;  3N8L A;  4DRT A;  4JLF A;  3BFF A;  1K25 A;  4KZ3 A;  2JC7 A;  4ID4 A;  4JXW A;  1GA0 A;  3WRZ A;  4R4S A;  3C4P A;  1SCW A;  4EBL A;  4QJG A;  3DTM A;  2IWB A;  2ZM0 A;  3HLB A;  2FFF B;  1NRF A;  1PZO A;  1MBL A;  3TSG A;  2EX9 A;  1YM1 A;  5CEC A;  1TVF A;  1H8Y A;  1KVL A;  1I5Q A;  4N9L A;  3IWO A;  3NDG A;  4GN2 A;  2OLV A;  4OVD A;  4EV4 A;  4BL3 A;  3WS1 A;  5FQ9 A;  2BLS A;  1L0D A;  1GA9 A;  3GTC A;  4C75 A;  2DCF A;  3M2K A;  4R4R A;  1RGZ A;  2HDS A;  4NK3 A;  5A90 A;  1JTD A;  1GHI A;  3IH9 A;  3SS5 A;  4PM7 A;  4MBH A;  1AXB A;  2CC1 A;  1ONH A;  3LO7 A;  1MWT A;  1RP5 A;  1W79 A;  3QHY A;  2ZMA A;  4Y0O A;  4E3I A;  1NYY A;  3PBN A;  4X53 A;  4HEF A;  3IH8 A;  2ZC5 B;  1ERO A;  4RA7 A;  2EX8 A;  5EPH A;  4KZ8 A;  2ZLY A;  2IWC A;  4R23 A;  5A92 A;  1QME A;  1M6K A;  4S2O A;  3O3V A;  4QHC A;  3S1Y A;  1E3U A;  3O88 A;  5FQM A;  4KEN B;  1MWU A;  1NY0 A;  2QZ6 A;  3VSL A;  1DJA A;  1RCJ A;  1YQS A;  3A3D A;  4X68 A;  1K55 A;  4LCM A;  5GLD A;  2C5W B;  4CJN A;  5CGS A;  3FKV A;  2XLN A;  3I7J A;  3IHB A;  4FSF A;  3MZF A;  3PBQ A;  5A91 A;  3UPP A;  2HDR A;  4DE0 A;  4EWF A;  1EI5 A;  5M19 A;  3GRJ A;  1SDE A;  1I2S A;  4L0L A;  2ZC4 B;  5FSR A;  3ZG7 B;  3ZHH A;  5FAS A;  4R0Q A;  2XD1 A;  4F94 A;  4GNU A;  5FI7 A;  3NI9 A;  1NZO A;  2A49 A;  1E3U D;  1CEF A;  2V1Z A;  4DE3 A;  1VM1 A;  4N1H A;  3Q7Z A;  3PAG A;  1YLJ A;  3S22 A;  2G2W A;  4E6X A;  1IKG A;  2ZQ9 A;  3C5A A;  2ZM8 A;  5EVI A;  2VGJ A;  3FYZ A;  4JXV A;  2EX6 A;  2XQZ A;  4UA7 A;  4P87 A;  3BFC A;  4PMA A;  3UE1 A;  3HLE A;  1N9B A;  4FH2 A;  5EVI B;  4JXG A;  5FI2 A;  3NDE A;  1MPL A;  4WEL A;  2ZQC A;  4PM5 A;  3HLC A;  3BFG A;  1XP4 A;  4KG2 A;  1PW8 A;  2X01 A;  4GDB A;  2C6W B;  2WGV A;  4OKP A;  3SS4 A;  5FQI A;  1HD8 A;  2X02 A;  4KZ5 A;  4OP5 A;  4RX3 A;  5AQB A;  1M40 A;  2XR0 A;  3ZGA B;  2XK1 A;  5EVI D;  1FCO A;  3S4X A;  2Z2L B;  2PU4 A;  3E2L A;  1N4O A;  2J9O A;  1HZO A;  3NCK A;  3PTE A;  3VP1 A;  1ERM A;  1RGY A;  3ISG A;  3HUO A;  4JF4 A;  4O7D A;  3WS4 A;  2WGW A;  3N4I A;  4GZB A;  3G4P A;  4ZJ2 A;  1WYB A;  1NXY A;  3QNC A;  3PBR A;  5GHX A;  2Y2J A;  1K38 A;  3AGD A;  3LY4 A;  4OOM A;  4GD6 A;  1KGG A;  3C7V A;  4WM9 A;  2JE5 A;  5I94 A;  3HL9 A;  4X6T A;  2WAD A;  5CHU A;  4RYE A;  4WBG A;  4CPK A;  3PBO A;  4K0X A;  4ZAM A;  3IF6 A;  3OPL A;  4E3M A;  4QY5 A;  3CMZ A;  1EWZ A;  5DF7 A;  1FR1 A;  4Y0U A;  4JPM A;  5CHJ A;  1QMF A;  3VFF A;  1ZC2 A;  2HDU A;  3ZDJ A;  3WRT A;  5F1F A;  1Q2Q A;  2Y4A A;  3M6B A;  4GOG A;  3Q1F A;  3UO9 A;  4PM8 A;  2ZM2 A;  3OPH A;  4Z9Q A;  4K0W A;  3G32 A;  3WS5 A;  3EQU A;  5BOH A;  1TEM A;  5HFO A;  2WZX A;  1XGI A;  2WKE A;  2V20 A;  4A5R A;  1ALQ A;  4OPR A;  2J7V A;  4WZ4 A;  5D3O A;  1PWD A;  3G35 A;  4S2N A;  5M1A A;  2ZJ9 A;  5J8X A;  3GV9 A;  1L0G A;  3MKF A;  3AGF A;  1HTZ A;  1K55 C;  1BUL A;  4C3Q A;  1ES4 A;  5GHY A;  5TGF A;  3IWQ A;  2R9X A;  3GVB A;  2ZD8 A;  1TDG A;  4BD0 A;  2X71 A;  1XX2 A;  3GR2 A;  5CHM A;  3MBZ A;  5JYP A;  3ZVT A;  5CTM A;  5F82 A;  1YMS A;  2I72 A;  4GKU A;  3N8S A;  4ZJ1 A;  4EBP A;  2B5R A;  3DWZ A;  4QY6 A;  5GLA A;  1Z6F A;  2EFU A;  3VP0 A;  3G2Z A;  3MXS A;  1K57 A;  2Y2N A;  3UDX A;  1XA1 A;  5FI6 A;  4KZ9 A;  5GL9 A;  2ZC3 B;  3HRE A;  1LI9 A;  1IEM A;  1JWV A;  3ZG0 A;  1YLW A;  5EVI C;  3W4Q A;  5E43 A;  5E2E A;  3IXB A;  4FD8 A;  4U3T A;  5FQK A;  1LI0 A;  3W4P A;  4HBT A;  4M3K A;  3BRM A;  1BTL A;  3ZVW A;  1W8Q A;  3IWI A;  3WWX A;  4OLG A;  4E6W A;  2Y2Q A;  3QNB A;  3MFD A;  1LL5 A;  4EUZ A;  1ES3 A;  1FR6 A;  2PBY A;  2Y2K A;  4GD8 A;  4OQG A;  1CI9 A;  3EQV A;  1MWR A;  4IED A;  3RXX A;  1K54 A;  5EUA A;  5M18 A;  2Y2M A;  3VOY A;  3HBR A;  3O86 A;  1MY8 A;  3VP4 A;  4P6B A;  3G30 A;  4JF6 A;  1CK3 A;  1BLC A;  1CEG A;  1DY6 A;  1YLP A;  2HPB A;  1KDS A;  3A3I A;  3BLS A;  1YT4 A;  1BLH A;  3HLD A;  5EOE A;  4DE1 A;  3BFE A;  5AQ9 A;  3V50 A;  1LL9 A;  1GHM A;  3IXH A;  3ZG9 B;  3UE3 A;  3WS2 A;  3PBS A;  5GLC A;  2Y2P A;  5A93 A;  2Z2M B;  4B88 A;  4OP8 A;  5E2G A;  4E3J A;  5FDH A;  1KE3 A;  1L2S A;  4OOL A;  3V39 A;  2OV5 A;  5DF8 A;  2VGK A;  3TG9 A;  2P9V B;  4BD1 A;  3NIA A;  1YMX A;  4OPQ A;  3IF6 C;  3MKE A;  2EFX A;  5HW3 A;  4YFM A;  5HAI A;  3N7W A;  5IHV A;  3IHA A;  3B3X A;  1U60 A;  2XEP A;  4N9K A;  4B4X A;  4X55 A;  1IYP A;  1KDW A;  1OME A;  1BLP A;  1PW1 A;  2EXA A;  2Q9N A;  1YLT A;  3IT9 A;  5FQQ A;  3V3S A;  4C6Y A;  4IBX A;  4EQI A;  2E8I A;  3FZC A;  4OOY A;  3LCE A;  4HES A;  1ESI A;  3BLM A;  3IQA A;  5CXW A;  5F1G A;  3IXD A;  1GHP A;  1ZG6 A;  3JYI A;  3NBL A;  3W8K A;  3A3E A;  2RCX A;  2Y2H A;  1PWG A;  4IVK A;  4KG6 A;  1ZKJ A;  2J9P A;  3UDI A;  1PZP A;  1ZG4 A;  3FWL A;  1SKF A;  4S2N C;  1H8Z A;  1J9M A;  2H0Y A;  1JTG A;  2WK0 A;  1BLS A;  4UAA A;  2XFS A;  3GMW A;  2ZQ7 A;  2H10 A;  1O7E A;  4PM6 A;  4WMC A;  3G2Y A;  4D2O A;  4H8R A;  4QB8 A;  2ZC7 A;  1XXM A;  2DRW A;  1PI5 A;  2HDQ A;  4E3O A;  2ZC6 B;  3RXW A;  3Q7V B;  1K4E A;  1K6R A;  1IYQ A;  5KMW A;  5TFQ A;  4S2P A;  4DDS A;  1ES2 A;  3E2K A;  1XKZ A;  1K57 C;  1JVJ A;  1TDL A;  3CZD A;  3N8R A;  2WUQ A;  3MXR A;  5HL1 A;  4JBF A;  4WMC D;  3SH8 A;  3SH9 A;  1FQG A;  2P74 A;  4U0T A;  3D4F A;  5HAQ A;  4LV1 A;  1KE4 A;  4DKI A;  1MWS A;  4MBF A;  4N1X A;  1K6S A;  4WEK A;  4Y0T A;  2XGN A;  3O87 A;  1E4D A;  5EE8 A;  1K56 A;  3OC2 A;  3BEC A;  3CG5 A;  5DTS A;  3TOI A;  1L0E A;  2DNS A;  4UA6 A;  2Y59 A;  5KSC A;  1XPB A;  2WAF A;  4DE2 A;  2A3U A;  5DF9 A;  1VQQ A;  2Y2O A;  1BZA A;  4OH0 A;  3WS0 A;  3UPO A;  4WZ5 A;  3PAE A;  1K54 C;  1Q2P A;  1NJ4 A;  1MKI A;  4R1G A;  4P85 A;  4IBR A;  1Y54 A;  4S2M A;  1K56 D;  1O07 A;  4EBN A;  5JYO A;  1CI8 A;  3OCN A;  3HVF A;  4P0M A;  4BJP A;  5GHZ A;  4ZJ3 A;  4OLD A;  3UDF A;  1W5D A;  1LLB A;  3OPR A;  4LV3 A;  1PI4 A;  4MLL A;  4E3K A;  3BEB A;  4S2K A;  1DJC A;  1HVB A;  1YLZ A;  2PU2 A;  4UHU A;  3RJU A;  3ZFZ A;  3M2J A;  1ESU A;  5CGW A;  3VP3 A;  2XH9 A;  4GB7 A;  4DDY A;  4ZDX A;  3N6I A;  3Q82 A;  4UA9 A;  3UNW A;  5F83 A;  3AGE A;  4OQH A;  4OPY A;  2WKH A;  2BG1 A;  3Q81 A;  1WE4 A;  4MBK A;  2OLU A;  5CGX A;  4FH4 A;  4HBU A;  5HX9 A;  4S2I A;  2ZQ8 A;  2XF3 A;  2H0T A;  4JXS A;  1PIO A;  3C4O A;  1XA7 A;  4IVI A;  4ZBE A;  1C3B A;  3VOZ A;  3HUN A;  1ONG A;  4MNR A;  3OPP A;  4KZ6 A;  4XUZ A;  2OSU A;  1S0W A;  2JCH A;  1H5X A;  2WYX A;  3V5M A;  5HAP A;  5GLB A;  2XD5 A;  5FAQ A;  1KVM A;  2QPN A;  2HP9 A;  5G18 A;  3A3J A;  3DWK A;  1NZU A;  1BSG A;  3CJM A;  1E25 A;  4JKT A;  4KZB A;  5CTN A;  5DTT A;  4NET A;  2ZQD A;  5FAO A;  3Q07 A;  3ZG5 A;  2H5S A;  2GDN A;  1FCN A;  4U0X A;  1MXO A;  3UPN A;  4YIN A;  1BT5 A;  5EOO A;  1WYC A;  1BUE A;  1DJB A;  1FSY A;  3ZCZ A;  3HLW A;  2P9V A;  4QU3 A;  3SH7 A;  3NC8 A;  3HLG A;  3LEZ A;  4LEN A;  4KQO A;  3PBT A;  1PWC A;  4R3J A;  2ZQA A;  4S2L A;  2EX2 A;  2WZZ A;  1S6R A;  4KG5 A;  5FQJ A;  4E3N A;  4S2J A;  2HP5 A;  4OON A;  5CED A;  1IYS A;  3ITA A;  4OQ0 A;  4RVA A;  5FAP A;  1I2W A;  1PYY A;  2JBF A;  2R9W A;  4KQR A;  5HAR A;  3MZD A;  1XGJ A;  5U47 A;  2Y55 A;  3P98 A;  4WYY A;  4BQM A;  2QMI A;  2FFY A;  3GQZ A;  5L2F A;  1KGE A;  2HP6 A;  4BEN A;  3C7U A;  2WAE A;  2Q9M A;  4XUX A;  4BL2 A;  1IKI A;  4WZ5 C;  4R3B A;  1SDN A;  2WGI A;  3A3F A;  3Q7V A;  1ES5 A;  1FSW A;  3BYD A;  4X69 A;  1IEL A;  2IWD A;  3VFH A;  3ZG8 B;  1W8Y A;  2WKI A;  2V2F F;  5FAT A;  5KSH A;  3BM6 A;  4LCL A;  4OQI A;  1G6A A;  4Y7P A;  5AQ7 A;  5EVL A;  2XFT A;  3LY3 A;  4DF6 A;  2Y2G A;  4ZTK A;  1FOF A;  3SOI A;  3W4O A;  3OZH A;  3VMA A;  2RL3 A;  3SS3 A;  3GSG A;  3HUM A;  5EEC A;  2Y2I A;  4WEJ A;  2G2U A;  1KGF A;  3HLF A;  3ZNT A;  2Y2L A;  4LV2 A;  3NY4 A;  3VSK A;  3G31 A;  1YLY A;  3DW0 A;  4FCF A;  1SHV A;  1JWZ A;  3G34 A;  3IF5 A;  4BLM A;  4KZ7 A;  4LV0 A;  5CRF A;  2WGW B;  5DVA A;  3V3R A;  1IYO A;  1GCE A;  4OPZ A;  4XXR A;  4X56 A;  5DTK A;  5TR7 A;  1JWP A;  1FCM A;  4RX2 A;  5CEB A;  4PM9 A;  4PPR A;  3ZNY A;  3FKW A;  3ITB A;  3IXG A;  2Y91 A;  5E2F A;  4E3L A;  3OCL A;  4N92 A;  4DXC A;  5FA7 A;  1G68 A;  1L0F A;  3UY6 A;  1K4F A;  3FV7 A; 
#chains in the Genus database with same CATH topology
 3BFD A;  4B4Z A;  4DXB A;  2W3E A;  3RH8 B;  1TS8 A;  4KZ4 A;  3P09 A;  4KZA A;  4BWI A;  4R3A A;  4WUJ A;  4GDN A;  4GHI B;  1F2K A;  2Z6D A;  2XRO A;  3C4P A;  1TF1 A;  2FFF B;  1MBL A;  5CEC A;  1OPX A;  4EV4 A;  4BL3 A;  3WS1 A;  3M2K A;  4R4R A;  5A90 A;  4X1L A;  4JGR A;  4CLC E;  2O0Y A;  3SS5 A;  4PM7 A;  1WA9 A;  4MN7 A;  4HI4 A;  2ZC5 B;  5EPH A;  2W3F A;  2IWC A;  2PYP A;  4S2O A;  1MWU A;  5EVE A;  4M4X A;  1OTA A;  5TBM B;  5GLD A;  5CGS A;  3IHB A;  5A91 A;  3UPP A;  1NRJ A;  1Z09 A;  1EI5 A;  5M19 A;  1SDE A;  1I2S A;  2ZC4 B;  5FSR A;  3ZG7 B;  4F94 A;  5FI7 A;  3LUQ A;  2OOL A;  1T19 A;  4HH2 A;  5F6A A;  2ZL1 B;  4E6X A;  2ZM8 A;  2VGJ A;  3FPW A;  3FYZ A;  4UA7 A;  5J3W A;  1N9B A;  4FH2 A;  3NDE A;  3HLC A;  2PR5 A;  2KX6 A;  2W1T A;  4OKP A;  2WGV A;  5FQI A;  1T1B A;  1M40 A;  2XR0 A;  2XK1 A;  5EVI D;  3LR3 A;  1FIL A;  4R6L A;  2Z2L B;  3E2L A;  3G6O A;  2J9O A;  1HZO A;  3RTY A;  3E98 A;  3WS4 A;  3G4P A;  4ZJ2 A;  2PD8 A;  5J4E A;  1NXY A;  2HV1 A;  3PBR A;  2Y2J A;  3LY4 A;  1S1Y A;  4GD6 A;  2OWH A;  5EM0 A;  4RYE A;  3T1X A;  3T4T A;  4CPK A;  3OBF A;  5HWW A;  4ZAM A;  3OPL A;  5DF7 A;  1LSW A;  4Y0U A;  3VFF A;  1Q2Q A;  3M6B A;  3Q1F A;  2ZOH A;  1LSV A;  4GHI A;  4Z9Q A;  3WS5 A;  5BOH A;  1XGI A;  2WKE A;  3BQA A;  2JKT M;  2B02 A;  4EU0 A;  5CX7 A;  5J8X A;  4Y15 A;  3GV9 A;  2R78 A;  3MKF A;  3AGF A;  1K55 C;  1ES4 A;  5GHY A;  3W2Z A;  1XX2 A;  3GR2 A;  4EXO A;  1F98 A;  5HL6 A;  1Z6F A;  1W63 Q;  3F1N B;  2QYB A;  2Y2N A;  2VLG A;  3CPT A;  4EES A;  5EVI C;  3W4Q A;  4U3T A;  5DJT A;  5FQK A;  2V1A A;  3BRM A;  1W8Q A;  3QNB A;  4EUZ A;  1ES3 A;  4I3I A;  2V1B A;  1CI9 A;  3LI8 A;  4JGQ A;  1MWR A;  4DJ3 A;  5TBM A;  5DKK A;  1K54 A;  3VOY A;  3O86 A;  1MY8 A;  3LIF A;  3NUL A;  1CK3 A;  1DY6 A;  3HLD A;  4ME4 A;  3IX3 A;  1BLH A;  5EOE A;  3V50 A;  3S7P A;  2ZL1 A;  4E3J A;  3QP5 A;  5FDH A;  1OTI A;  2OV5 A;  2IA2 A;  1YMX A;  3IF6 C;  5HW3 A;  2XEP A;  4B4X A;  4X55 A;  1KDW A;  1BLP A;  1PW1 A;  3CI6 A;  4HES A;  2WKQ A;  5F1G A;  4BEN A;  3QP4 A;  5DJU A;  3UDI A;  3FWL A;  1J9M A;  2WK0 A;  4D2O A;  4DJ2 A;  4H8R A;  1XXM A;  2HDQ A;  2ZC6 B;  1IYQ A;  1T1A A;  4DDS A;  1XKZ A;  1TDL A;  3SH8 A;  3BY9 A;  3D4F A;  4LV1 A;  4Y0T A;  2XGN A;  1E4D A;  2P04 A;  4DE2 A;  4BBT A;  2A3U A;  3PHY A;  1VQQ A;  2Y2O A;  4OH0 A;  4WZ5 A;  2VGL M;  4Q0J A;  4R1G A;  2QJ5 A;  2J80 A;  2O9C A;  1CI8 A;  1S66 L;  3OCN A;  5GHZ A;  3F1N A;  1LLB A;  2G7U A;  3OPR A;  4UHU A;  2OAQ 1;  2Y79 A;  3T1S A;  3UNW A;  3B42 A;  2JKT I;  1F5M A;  4HNB A;  3Q81 A;  4H6J A;  1YPR A;  5HX9 A;  3GEC A;  3C4O A;  2WKR A;  1L3L A;  2V8F A;  2PBD P;  4B9O A;  3VOZ A;  2BAS A;  2OSU A;  2JCH A;  1S1Z A;  5F69 A;  1NWZ A;  2XD5 A;  1KVM A;  5G18 A;  3A3J A;  1BSG A;  1SKO B;  2VV6 A;  1FCN A;  1PFL A;  2A24 B;  3UPN A;  4XT2 B;  1DJB A;  3ZCZ A;  2A2L A;  1OTE A;  1XJ4 A;  1LL8 A;  1MKM A;  4R3J A;  2EA9 A;  2WZZ A;  4KG5 A;  4S2J A;  3LIB A;  1IYS A;  3IBR A;  2QJ7 A;  4NXF A;  2W1R A;  5FAP A;  5HAR A;  3D72 A;  1XGJ A;  2Y55 A;  3P98 A;  4BQM A;  1KGE A;  2HP6 A;  2ZMV A;  4BL2 A;  2WGI A;  5KZH A;  3ZG8 B;  1IEL A;  2IWD A;  1OT6 A;  2Q0O A;  4Y13 A;  4LCL A;  5EVL A;  3MQQ A;  4DF6 A;  2Y2G A;  4ZTK A;  3MFX A;  3VMA A;  3H9W A;  2B95 A;  1HLU P;  5IT5 A;  3CAX A;  3G31 A;  1P97 A;  2MJ6 A;  3LID A;  3V3R A;  4OPZ A;  1YKD A;  1FCM A;  4RX2 A;  4PPR A;  4HOI A;  3OOV A;  2V0U A;  3KYE A;  1UWP X;  5FA7 A;  3CHW P;  2K2N A;  5AVF A;  3IF6 B;  4K91 A;  3IBJ A;  5HPI A;  2EXB A;  4Q8I A;  1TD5 A;  3UN7 A;  4JF5 A;  5CER A;  3QP1 A;  5HDS A;  1KE0 A;  4JLF A;  1K25 A;  3A0V A;  4LRY C;  3WRZ A;  5HPF A;  4QJG A;  3KSF A;  4NXB A;  2IWB A;  2ZM0 A;  3HLB A;  4PKY A;  1NRF A;  2EX9 A;  1I5Q A;  1OT9 A;  2OLV A;  4OVD A;  5FQ9 A;  3GTC A;  4C75 A;  3P7N A;  2HDS A;  2VA0 A;  4PHT A;  2CC1 A;  3LFV A;  1SKO A;  1MWT A;  1RP5 A;  3PBN A;  3HJK A;  2A24 A;  3HJI A;  4XT2 A;  1SZV A;  1UGU A;  2ZLY A;  4R23 A;  5A92 A;  3O3V A;  4QHC A;  1NY0 A;  3UME A;  2QZ6 A;  3LYX A;  4P6Z M;  1DJA A;  4X1M A;  3VSL A;  1K55 A;  3ICY A;  3FKV A;  3ZQ5 A;  4DE0 A;  3MZF A;  3PBQ A;  2WKP A;  4L0L A;  3ZHH A;  1H8M A;  4GNU A;  5TJJ A;  3BY8 A;  1E3U D;  2VGL S;  2V1Z A;  3NOP C;  3E4Q A;  4DE3 A;  1YLJ A;  1IKG A;  2PAV P;  3C5A A;  5EVI A;  1T1C A;  4P87 A;  4Y3I A;  3UE1 A;  3H7W B;  3BFG A;  1XP4 A;  4YWZ A;  4GDB A;  3E0Y A;  2W1T B;  4WN5 A;  4OP5 A;  3ZGA B;  2PU4 A;  1N4O A;  3LEQ A;  3HUO A;  4JF4 A;  4O7D A;  5FL3 A;  2LB5 A;  4MDZ A;  1T18 A;  5GHX A;  4K08 A;  5L8M A;  2WAD A;  4RQ9 A;  1S67 L;  3PBO A;  4K0X A;  3IF6 A;  4E3M A;  3CMZ A;  5CHJ A;  4JPM A;  2L0W A;  4HY8 A;  1ZC2 A;  3ZDJ A;  2Y4A A;  1Y28 A;  4PM8 A;  1VB6 A;  2I9V A;  5DFY A;  1GSW A;  4OPR A;  1EW0 A;  4WZ4 A;  5D3O A;  3T4K A;  5DKL A;  3D9Y A;  2ZJ9 A;  3IS2 B;  3VE3 A;  1HTZ A;  1BUL A;  3IWQ A;  3N8S A;  4I39 A;  4ZJ1 A;  2EWV A;  2B5R A;  5GLA A;  2EFU A;  3G2Z A;  5IU1 A;  4LGW A;  1XA1 A;  4KZ9 A;  4KUO A;  1IEM A;  1JWV A;  5FEG A;  2W3H A;  3CPT B;  3DTK A;  1W63 M;  1ODV A;  4D60 A;  3W4P A;  4HH3 A;  4OLG A;  3KSH A;  2K31 A;  3MFD A;  2PBY A;  3BWL A;  4OQG A;  3EQV A;  4IED A;  3MF0 A;  2J3W A;  3RXX A;  3VV4 A;  5M18 A;  1D06 A;  3HBR A;  4P6B A;  3G30 A;  1YLP A;  3A3I A;  3BLS A;  4L9F A;  5AQ9 A;  3UMD A;  1LL9 A;  3ZG9 B;  3WS2 A;  2OAP 1;  5A93 A;  1P9W A;  4OP8 A;  3JVU A;  1A0K A;  1KE3 A;  3PXP A;  5DF8 A;  2VGK A;  2P9V B;  4BD1 A;  1XJ6 A;  2EFX A;  3H7W A;  5IHV A;  3B3X A;  3LIE A;  2W3G A;  3IT9 A;  3LR0 A;  5FQQ A;  4C6Y A;  3IXD A;  1GHP A;  1ZG6 A;  3JYI A;  1LT0 A;  4HIA A;  3NJA A;  3W8K A;  3A3E A;  4IVK A;  4KG6 A;  1ZKJ A;  1PZP A;  1ZG4 A;  2YKH A;  4S2N C;  1MC0 A;  1H8Z A;  1JTG A;  4UAA A;  2XFS A;  1TS6 A;  3G2Y A;  4FOF A;  3RXW A;  4Z1W A;  2XRN A;  1K4E A;  1IOU A;  5HDC A;  4S2P A;  1ES2 A;  1K57 C;  3CZD A;  4UQI M;  2WUQ A;  4NEE D;  5HL1 A;  4JBF A;  4WMC D;  2VX8 A;  3ULF A;  4IJG A;  5HAQ A;  1KE4 A;  1DP9 A;  3CLO A;  4MN5 A;  4P6Z S;  3LGO A;  3BEC A;  1L0E A;  4UA6 A;  5KSC A;  3IS2 A;  2YKF A;  2GZA A;  1BZA A;  3R7W A;  3QP6 A;  1GSX A;  3VE4 A;  3PAE A;  3UB7 A;  4P85 A;  4P0M A;  3HVF A;  5K5B A;  1W5D A;  3L9K A;  2PU2 A;  3M2J A;  1ESU A;  4GB7 A;  4DDY A;  2JKG A;  4ZDX A;  2KDK A;  3N6I A;  4OQH A;  3R4K A;  5EV0 A;  2OLU A;  2XF3 A;  2H0T A;  3K3C A;  4H6J B;  1XA7 A;  2NUP C;  4ZBE A;  5HWV A;  3HUN A;  3OPP A;  4XUZ A;  2WYX A;  2PRF A;  4LLO B;  5FAQ A;  2HP9 A;  3KYZ A;  3CJM A;  4JKT A;  5DTT A;  4NET A;  2ZQD A;  4EER A;  3CWF A;  3ZG5 A;  1G28 A;  3EEA A;  1WYC A;  3E4O A;  2P9V A;  3SH7 A;  3DAV A;  3TE8 A;  3NC8 A;  3HLG A;  5MC7 A;  2ZQA A;  4S2L A;  1CJF A;  3NOT C;  5F68 A;  3ITA A;  4OQ0 A;  2D01 A;  1S4R A;  1PYY A;  5U47 A;  3C7U A;  2Q9M A;  4XUX A;  4CLC D;  2ZOI A;  3DTI A;  1SDN A;  2WKI A;  3BM6 A;  4OQI A;  1G6A A;  2XFT A;  3LY3 A;  3OZH A;  3SS3 A;  1N9O A;  3MS6 A;  5G4Z A;  4WEJ A;  1KGF A;  4HQA A;  4LRZ E;  3VSK A;  3DW0 A;  1V9Y A;  3IF5 A;  4BLM A;  4G3K A;  5F5Y A;  4LV0 A;  5CRF A;  4X56 A;  1JWP A;  5CEB A;  4JGP A;  1YSP A;  4LFU A;  5E2F A;  1G68 A;  4O0P A;  3T4Q A;  3KYQ A;  5AQA A;  4QD4 A;  4WL9 A;  3UE0 A;  1GSV A;  1ERQ A;  2J8Y A;  3VP2 A;  1VET A;  2XDM A;  2UWX A;  1NYM A;  4YNR A;  4DRT A;  4JXW A;  3C38 A;  2ZMF A;  4CLC C;  1TVF A;  1H8Y A;  1KVL A;  3IWO A;  4GJ4 A;  3BJN A;  2Z6C A;  3CIT A;  1GA9 A;  1G5U A;  3IH9 A;  4F3L B;  4MBH A;  1AXB A;  4ETZ A;  4GCZ A;  4ETX A;  4Y0O A;  4UQI S;  2ZMA A;  3IH8 A;  1ERO A;  1K0K A;  2EX8 A;  4I5S A;  4KZ8 A;  1IFQ A;  1E3U A;  3LIC A;  3O88 A;  1VHM A;  5FQM A;  1RCJ A;  1YQS A;  3A3D A;  4HJ4 A;  4EUV A;  4LCM A;  4GW9 A;  4G3V A;  4EWF A;  1DP6 A;  2HDR A;  4X25 A;  1H0M A;  3NI9 A;  1NZO A;  2A49 A;  3HCY A;  4N1H A;  3Q7Z A;  3S22 A;  1CF0 A;  2G2W A;  2ZQ9 A;  2XQZ A;  3BFC A;  3HLE A;  5EVI B;  4JXG A;  4WEL A;  1MPL A;  4PM5 A;  2ZQC A;  4KG2 A;  5HWT A;  1PW8 A;  3SS4 A;  2X02 A;  4KZ5 A;  4RX3 A;  5AQB A;  2ZBB A;  3T1R A;  1FCO A;  3NCK A;  3EGX C;  1ERM A;  3H82 B;  4GLQ A;  2GNX A;  5HZH A;  4GZB A;  1OJG A;  2PHY A;  3AGD A;  1G6O A;  4NG2 A;  4WM9 A;  2KLI A;  4WBG A;  3C8C A;  1EWZ A;  1FR1 A;  1LSX A;  2HDU A;  2HF6 A;  3UO9 A;  3T4L A;  2ZM2 A;  4K0W A;  3G32 A;  2PT7 A;  1XJ3 A;  1TEM A;  5HFO A;  4A5R A;  1FIK A;  4S2N A;  1K4F A;  2CMN A;  2VV7 A;  2R9X A;  2ZD8 A;  5CHM A;  5JYP A;  3ZVT A;  5CTM A;  1YMS A;  2UV0 E;  3LR4 A;  4EBP A;  3VOL A;  4QY6 A;  2PR6 A;  3O5Y A;  4QWO A;  1K57 A;  3UB6 A;  5FI6 A;  4F3L A;  2ZC3 B;  3HRE A;  1YLW A;  5E43 A;  5E2E A;  4BBU A;  5L07 A;  1LI0 A;  1DP8 A;  3L7H A;  3WWX A;  4G3W A;  1LL5 A;  3MQO A;  4GD8 A;  3K2N A;  4MCW A;  2Y2M A;  4I3A A;  2VJW A;  4PAU A;  4HJ6 A;  3VP4 A;  4JF6 A;  1BLC A;  1CEG A;  2HPB A;  1YT4 A;  5EM1 A;  3BFE A;  3BQ8 A;  1GHM A;  3IXH A;  2V0W A;  3C2W A;  3PBS A;  2Y2P A;  4B88 A;  5E2G A;  1L2S A;  4OOL A;  3V39 A;  2P08 A;  3TRC A;  5IS1 A;  5HAI A;  1AWI A;  4N9K A;  2KOI A;  1YLT A;  4CLC B;  4OOY A;  3BLM A;  3IQA A;  3SW1 A;  2RCX A;  1SKF A;  3H82 A;  2H0Y A;  1BLS A;  2ZQ7 A;  3MXQ A;  3A0R A;  2H10 A;  1O7E A;  4WMC A;  2ZC7 A;  2AVX A;  4UEY A;  5KMW A;  5TFQ A;  3JVV A;  2LB9 A;  4AFI A;  3MXR A;  1NLY A;  4EQ1 A;  1OTD A;  4FTX A;  3E4P A;  1FQG A;  2P74 A;  4N1X A;  4WEK A;  1K6S A;  3O87 A;  4LPZ A;  3OC2 A;  3CG5 A;  2DNS A;  4EET B;  1XPB A;  2WAF A;  3ZYT A;  3UPO A;  5HD5 A;  3R7W B;  5L09 A;  4S2M A;  1K56 D;  1O07 A;  3KO6 A;  5JYO A;  4ZJ3 A;  3UDF A;  4MLL A;  2XA7 M;  4S2K A;  1DJC A;  1HVB A;  1YLZ A;  4NXE A;  3MSH A;  3SZT A;  3ZFZ A;  2VKS A;  3UB9 A;  4IUH A;  4UA9 A;  4FUW A;  3AGE A;  2WKH A;  3U4L P;  1BYW A;  1WE4 A;  4MBK A;  5CGX A;  4FH4 A;  4HBU A;  2ZQ8 A;  4JXS A;  4IVI A;  3T4O A;  4KQD A;  1ONG A;  4KZ6 A;  2JHE A;  3V5M A;  1H5X A;  3KSI A;  1P9R A;  5HAP A;  3TW8 A;  4WLA A;  2QPN A;  5C5K A;  3B47 A;  1E25 A;  2H28 A;  5FAO A;  3Q07 A;  2JKF A;  2H5S A;  3MJQ A;  2M7V A;  4YIN A;  1PRQ A;  5EOO A;  3HLW A;  2INW A;  5I5L A;  3PBT A;  1PWC A;  2EX2 A;  3S7Q A;  4CLC A;  3FG8 A;  1J3W A;  2O9A A;  3LR5 A;  2GJ3 A;  3CUE A;  1I2W A;  2JBF A;  4Q0I A;  3MZD A;  5HDD A;  2QMI A;  2FFY A;  1D7E A;  2JKR M;  5DFX A;  3A3F A;  1ES5 A;  4X69 A;  4GS9 B;  2V2F F;  4O01 A;  1H3Q A;  3W4O A;  2B18 A;  4BMW A;  5J7E A;  3HUM A;  5EEC A;  2G2U A;  2K7S A;  3FC7 A;  2W3D A;  3HLF A;  3ZNT A;  2QWS A;  4LV2 A;  1YLY A;  1JWZ A;  1TS0 A;  4KZ7 A;  4MMN A;  2WGW B;  1IYO A;  1GCE A;  2D02 A;  4XXR A;  1XFN A;  2M7U A;  1F9I A;  1N9L A;  4E3L A;  3A0S A;  4DXC A;  1L0F A;  3UY6 A;  4DN0 A;  3FV7 A;  4LRX C;  4MEZ A;  5E2H A;  4PKY G;  1LHY A;  2GX5 A;  4KQQ A;  1TS7 A;  2HJE A;  3M6H A;  1S4S A;  1JNU A;  1W7F A;  3MZE A;  3N8L A;  1XFQ A;  3BFF A;  1VET B;  3BW6 A;  4KZ3 A;  2JC7 A;  4ID4 A;  1GA0 A;  4IHQ A;  4KUK A;  4R4S A;  4HHD A;  3PR6 A;  1SCW A;  3EWK A;  4EBL A;  3DTM A;  2BTF P;  1PZO A;  3TSG A;  1YM1 A;  5FEF A;  3U2A A;  4N9L A;  4R38 A;  3NDG A;  4GN2 A;  3P01 A;  2BLS A;  1L0D A;  2DCF A;  3T4J A;  1RGZ A;  4NK3 A;  4E04 A;  1JTD A;  1GHI A;  5EFW A;  3LO7 A;  3NOU C;  1ONH A;  3QHY A;  1W79 A;  4E3I A;  1NYY A;  2HZ5 A;  1YSQ A;  4X53 A;  4HEF A;  4RA7 A;  1QME A;  1M6K A;  1KOU A;  2HJ9 C;  3LI9 A;  3S1Y A;  4I3J A;  2FH5 A;  4KEN B;  3IX8 A;  4X68 A;  2C5W B;  4Y5F A;  4CJN A;  2XLN A;  3I7J A;  4FSF A;  3GRJ A;  4EW7 A;  5FAS A;  4R0Q A;  2XD1 A;  1CEF A;  4ESP A;  3S7N A;  2V9A A;  1VM1 A;  3PAG A;  1UWN X;  4B93 A;  4R70 A;  4IUK A;  4GS9 A;  2XA7 S;  4JXV A;  2EX6 A;  4PMA A;  2VK3 A;  5FI2 A;  2EWW A;  2X01 A;  2C6W B;  1HD8 A;  4JGO A;  3QP8 A;  5KIZ A;  3S4X A;  2HGV A;  4MN6 A;  3PTE A;  3VP1 A;  1RGY A;  3ISG A;  4II7 A;  1VEU B;  2WGW A;  2JKR I;  3N4I A;  1X0O A;  4ZRR A;  1WYB A;  3QNC A;  3QP2 A;  1K38 A;  4OOM A;  1KGG A;  3C7V A;  3DBA A;  3IX4 A;  2JE5 A;  5I94 A;  3HL9 A;  4X6T A;  5CHU A;  4QY5 A;  3FPV A;  1QMF A;  3F1P B;  5F1F A;  3WRT A;  4GOG A;  3KSG A;  3OPH A;  3EQU A;  2WZX A;  2V20 A;  1ALQ A;  2J7V A;  3MQ0 A;  1PWD A;  3G35 A;  5M1A A;  1YAX A;  1L0G A;  4C3Q A;  5TGF A;  4BD0 A;  3GVB A;  1TDG A;  1Y4O A;  2X71 A;  3UE6 A;  3TJZ C;  3MBZ A;  5F82 A;  2VV8 A;  2I72 A;  4GKU A;  2V8C A;  1V9Z A;  3DWZ A;  3CUE C;  3VP0 A;  3MXS A;  4L9E A;  3UDX A;  5GL9 A;  2JN7 A;  3PYP A;  1LI9 A;  3ZG0 A;  3IXB A;  4FD8 A;  1CQA A;  1STZ A;  4HBT A;  4M3K A;  4Y17 A;  1BTL A;  3ZVW A;  3IWI A;  4E6W A;  2Y2Q A;  1FR6 A;  2VEA A;  2Y2K A;  3JPU A;  2W27 A;  4WF0 A;  4EEU A;  5EUA A;  2J3T D;  2PD7 A;  3LIA A;  3K3D A;  5A8B A;  4Q0H A;  1XJ2 A;  1KDS A;  4DE1 A;  3OLO A;  4ARZ B;  3UE3 A;  5GLC A;  2Z2M B;  2P7J A;  2FZ0 A;  3T50 A;  4NXG A;  3TG9 A;  3NIA A;  4OPQ A;  3MKE A;  4YFM A;  3N7W A;  3IHA A;  1U60 A;  1IYP A;  3F1O B;  1OME A;  3V3S A;  2EXA A;  2Q9N A;  4IBX A;  4EQI A;  2E8I A;  3FZC A;  2VZW A;  3LCE A;  1ESI A;  5CXW A;  3GDI A;  3UB5 P;  2DMW A;  4E3N A;  3NBL A;  2Y2H A;  1PWG A;  3DTE A;  2J9P A;  1OJ5 A;  1VEU A;  3GMW A;  2Y8H A;  3MMH A;  4PM6 A;  4QB8 A;  1ZHH B;  2DRW A;  1PI5 A;  4E3O A;  3Q7V B;  1K6R A;  3EEH A;  3E2K A;  1JVJ A;  3N8R A;  3D3O A;  3SH9 A;  3F1P A;  4U0T A;  4I38 A;  4O8G A;  4DKI A;  1D1J A;  1MWS A;  4MBF A;  2J3T C;  4BBV A;  5EE8 A;  1K56 A;  5DTS A;  3TOI A;  2ACG A;  2Y59 A;  3KX0 X;  5LBR A;  5DF9 A;  3T1Q B;  3WS0 A;  1MZU A;  1K54 C;  1Q2P A;  1NJ4 A;  1MKI A;  4IBR A;  1Y54 A;  4Y2F A;  4EBN A;  4BJP A;  4OLD A;  2OWJ A;  4LV3 A;  1PI4 A;  4E3K A;  4HP4 A;  3BEB A;  3RJU A;  3NEC A;  5CGW A;  3VP3 A;  3NHQ A;  2XH9 A;  1DRM A;  2PYR A;  3Q82 A;  5F83 A;  1ZTU A;  4OPY A;  1PNE A;  2BG1 A;  3S7O A;  1P0Z A;  4S2I A;  1NLZ A;  1PIO A;  4HP9 A;  1C3B A;  2L1M A;  3EGD C;  4MNR A;  1S0W A;  3MR0 A;  5GLB A;  4ARZ A;  3DWK A;  1NZU A;  2QKP A;  5CTN A;  4KZB A;  4YOF A;  2GDN A;  2M1C A;  4U0X A;  1MXO A;  1BT5 A;  1BUE A;  1FSY A;  2O9B A;  2PDR A;  4QU3 A;  4L9G A;  2NUT C;  2L4R A;  5AJG A;  3LEZ A;  4LEN A;  4KQO A;  5L10 A;  2W0N A;  3F1O A;  5FQJ A;  1S6R A;  2HP5 A;  4OON A;  5CED A;  4QPR A;  4RVA A;  3V67 A;  2R9W A;  5G4Y A;  3UB8 A;  4WYY A;  2E8J A;  3GQZ A;  5L2F A;  2WAE A;  1IKI A;  4WZ5 C;  4R3B A;  1OTB A;  4EEP A;  3Q7V A;  1FSW A;  3BYD A;  3VFH A;  1ACF A;  1W8Y A;  5FAT A;  3C30 A;  5KSH A;  4Y7P A;  5AQ7 A;  1FOF A;  3SOI A;  5AVE A;  4HJ3 A;  4DMZ A;  2RL3 A;  3GSG A;  5FDS A;  2Y2I A;  3B33 A;  2Y2L A;  3NY4 A;  4FCF A;  1SHV A;  4NKP A;  3G34 A;  5HD3 A;  2QHK A;  3EOI A;  4CQH A;  5DVA A;  3T12 B;  5DTK A;  5TR7 A;  4PM9 A;  3ZNY A;  3FKW A;  3ITB A;  3IXG A;  3T4S A;  2Y91 A;  3OCL A;  1N9N A;  5HSQ A;  4N92 A;  2XSS A;  2O99 A;  4KQR A;  3RFB A; 
#chains in the Genus database with same CATH homology
 4MEZ A;  3BFD A;  5E2H A;  4B4Z A;  3IF6 B;  4K91 A;  1LHY A;  4DXB A;  5AQA A;  5KZH A;  2EXB A;  4KQQ A;  4KZ4 A;  4Q8I A;  3P09 A;  3M6H A;  4QD4 A;  1W7F A;  4KZA A;  3UE0 A;  3UN7 A;  4JF5 A;  1ERQ A;  4GDN A;  2J8Y A;  5CER A;  3VP2 A;  2XDM A;  2UWX A;  1NYM A;  3MZE A;  1KE0 A;  3N8L A;  4DRT A;  4JLF A;  3BFF A;  1K25 A;  4KZ3 A;  2JC7 A;  4ID4 A;  4JXW A;  1GA0 A;  3WRZ A;  4R4S A;  3C4P A;  1SCW A;  4EBL A;  4QJG A;  3DTM A;  2IWB A;  2ZM0 A;  3HLB A;  2FFF B;  1NRF A;  1PZO A;  1MBL A;  3TSG A;  2EX9 A;  1YM1 A;  5CEC A;  1TVF A;  1H8Y A;  1KVL A;  1I5Q A;  4N9L A;  3IWO A;  3NDG A;  4GN2 A;  2OLV A;  4OVD A;  4EV4 A;  4BL3 A;  3WS1 A;  5FQ9 A;  2BLS A;  1L0D A;  1GA9 A;  3GTC A;  4C75 A;  2DCF A;  3M2K A;  4R4R A;  1RGZ A;  2HDS A;  4NK3 A;  5A90 A;  1JTD A;  1GHI A;  3IH9 A;  3SS5 A;  4PM7 A;  4MBH A;  1AXB A;  2CC1 A;  1ONH A;  3LO7 A;  1MWT A;  1RP5 A;  1W79 A;  3QHY A;  2ZMA A;  4Y0O A;  4E3I A;  1NYY A;  3PBN A;  4X53 A;  4HEF A;  3IH8 A;  2ZC5 B;  1ERO A;  4RA7 A;  2EX8 A;  5EPH A;  4KZ8 A;  2ZLY A;  2IWC A;  4R23 A;  5A92 A;  1QME A;  1M6K A;  4S2O A;  3O3V A;  4QHC A;  3S1Y A;  1E3U A;  3O88 A;  5FQM A;  4KEN B;  1MWU A;  1NY0 A;  2QZ6 A;  3VSL A;  1DJA A;  1RCJ A;  1YQS A;  3A3D A;  4X68 A;  1K55 A;  4LCM A;  5GLD A;  2C5W B;  4CJN A;  5CGS A;  3FKV A;  2XLN A;  3I7J A;  3IHB A;  4FSF A;  3MZF A;  3PBQ A;  5A91 A;  3UPP A;  2HDR A;  4DE0 A;  4EWF A;  1EI5 A;  5M19 A;  3GRJ A;  1SDE A;  1I2S A;  4L0L A;  2ZC4 B;  5FSR A;  3ZG7 B;  3ZHH A;  5FAS A;  4R0Q A;  2XD1 A;  4F94 A;  4GNU A;  5FI7 A;  3NI9 A;  1NZO A;  2A49 A;  1E3U D;  1CEF A;  2V1Z A;  4DE3 A;  1VM1 A;  4N1H A;  3Q7Z A;  3PAG A;  1YLJ A;  3S22 A;  2G2W A;  4E6X A;  1IKG A;  2ZQ9 A;  3C5A A;  2ZM8 A;  5EVI A;  2VGJ A;  3FYZ A;  4JXV A;  2EX6 A;  2XQZ A;  4UA7 A;  4P87 A;  3BFC A;  4PMA A;  3UE1 A;  3HLE A;  1N9B A;  4FH2 A;  5EVI B;  4JXG A;  5FI2 A;  3NDE A;  1MPL A;  4WEL A;  2ZQC A;  4PM5 A;  3HLC A;  3BFG A;  1XP4 A;  4KG2 A;  1PW8 A;  2X01 A;  4GDB A;  2C6W B;  2WGV A;  4OKP A;  3SS4 A;  5FQI A;  1HD8 A;  2X02 A;  4KZ5 A;  4OP5 A;  4RX3 A;  5AQB A;  1M40 A;  2XR0 A;  3ZGA B;  2XK1 A;  5EVI D;  1FCO A;  3S4X A;  2Z2L B;  2PU4 A;  3E2L A;  1N4O A;  2J9O A;  1HZO A;  3NCK A;  3PTE A;  3VP1 A;  1ERM A;  1RGY A;  3ISG A;  3HUO A;  4JF4 A;  4O7D A;  3WS4 A;  2WGW A;  3N4I A;  4GZB A;  3G4P A;  4ZJ2 A;  1WYB A;  1NXY A;  3QNC A;  3PBR A;  5GHX A;  2Y2J A;  1K38 A;  3AGD A;  3LY4 A;  4OOM A;  4GD6 A;  1KGG A;  3C7V A;  4WM9 A;  2JE5 A;  5I94 A;  3HL9 A;  4X6T A;  2WAD A;  5CHU A;  4RYE A;  4WBG A;  4CPK A;  3PBO A;  4K0X A;  4ZAM A;  3IF6 A;  3OPL A;  4E3M A;  4QY5 A;  3CMZ A;  1EWZ A;  5DF7 A;  1FR1 A;  4Y0U A;  4JPM A;  5CHJ A;  1QMF A;  3VFF A;  1ZC2 A;  2HDU A;  3ZDJ A;  3WRT A;  5F1F A;  1Q2Q A;  2Y4A A;  3M6B A;  4GOG A;  3Q1F A;  3UO9 A;  4PM8 A;  2ZM2 A;  3OPH A;  4Z9Q A;  4K0W A;  3G32 A;  3WS5 A;  3EQU A;  5BOH A;  1TEM A;  5HFO A;  2WZX A;  1XGI A;  2WKE A;  2V20 A;  4A5R A;  1ALQ A;  4OPR A;  2J7V A;  4WZ4 A;  5D3O A;  1PWD A;  3G35 A;  4S2N A;  5M1A A;  2ZJ9 A;  5J8X A;  3GV9 A;  1L0G A;  3MKF A;  3AGF A;  1HTZ A;  1K55 C;  1BUL A;  4C3Q A;  1ES4 A;  5GHY A;  5TGF A;  3IWQ A;  2R9X A;  3GVB A;  2ZD8 A;  1TDG A;  4BD0 A;  2X71 A;  1XX2 A;  3GR2 A;  5CHM A;  3MBZ A;  5JYP A;  3ZVT A;  5CTM A;  5F82 A;  1YMS A;  2I72 A;  4GKU A;  3N8S A;  4ZJ1 A;  4EBP A;  2B5R A;  3DWZ A;  4QY6 A;  5GLA A;  1Z6F A;  2EFU A;  3VP0 A;  3G2Z A;  3MXS A;  1K57 A;  2Y2N A;  3UDX A;  1XA1 A;  5FI6 A;  4KZ9 A;  5GL9 A;  2ZC3 B;  3HRE A;  1LI9 A;  1IEM A;  1JWV A;  3ZG0 A;  1YLW A;  5EVI C;  3W4Q A;  5E43 A;  5E2E A;  3IXB A;  4FD8 A;  4U3T A;  5FQK A;  1LI0 A;  3W4P A;  4HBT A;  4M3K A;  3BRM A;  1BTL A;  3ZVW A;  1W8Q A;  3IWI A;  3WWX A;  4OLG A;  4E6W A;  2Y2Q A;  3QNB A;  3MFD A;  1LL5 A;  4EUZ A;  1ES3 A;  1FR6 A;  2PBY A;  2Y2K A;  4GD8 A;  4OQG A;  1CI9 A;  3EQV A;  1MWR A;  4IED A;  3RXX A;  1K54 A;  5EUA A;  5M18 A;  2Y2M A;  3VOY A;  3HBR A;  3O86 A;  1MY8 A;  3VP4 A;  4P6B A;  3G30 A;  4JF6 A;  1CK3 A;  1BLC A;  1CEG A;  1DY6 A;  1YLP A;  2HPB A;  1KDS A;  3A3I A;  3BLS A;  1YT4 A;  1BLH A;  3HLD A;  5EOE A;  4DE1 A;  3BFE A;  5AQ9 A;  3V50 A;  1LL9 A;  1GHM A;  3IXH A;  3ZG9 B;  3UE3 A;  3WS2 A;  3PBS A;  5GLC A;  2Y2P A;  5A93 A;  2Z2M B;  4B88 A;  4OP8 A;  5E2G A;  4E3J A;  5FDH A;  1KE3 A;  1L2S A;  4OOL A;  3V39 A;  2OV5 A;  5DF8 A;  2VGK A;  3TG9 A;  2P9V B;  4BD1 A;  3NIA A;  1YMX A;  4OPQ A;  3IF6 C;  3MKE A;  2EFX A;  5HW3 A;  4YFM A;  5HAI A;  3N7W A;  5IHV A;  3IHA A;  3B3X A;  1U60 A;  2XEP A;  4N9K A;  4B4X A;  4X55 A;  1IYP A;  1KDW A;  1OME A;  1BLP A;  1PW1 A;  2EXA A;  2Q9N A;  1YLT A;  3IT9 A;  5FQQ A;  3V3S A;  4C6Y A;  4IBX A;  4EQI A;  2E8I A;  3FZC A;  4OOY A;  3LCE A;  4HES A;  1ESI A;  3BLM A;  3IQA A;  5CXW A;  5F1G A;  3IXD A;  1GHP A;  1ZG6 A;  3JYI A;  3NBL A;  3W8K A;  3A3E A;  2RCX A;  2Y2H A;  1PWG A;  4IVK A;  4KG6 A;  1ZKJ A;  2J9P A;  3UDI A;  1PZP A;  1ZG4 A;  3FWL A;  1SKF A;  4S2N C;  1H8Z A;  1J9M A;  2H0Y A;  1JTG A;  2WK0 A;  1BLS A;  4UAA A;  2XFS A;  3GMW A;  2ZQ7 A;  2H10 A;  1O7E A;  4PM6 A;  4WMC A;  3G2Y A;  4D2O A;  4H8R A;  4QB8 A;  2ZC7 A;  1XXM A;  2DRW A;  1PI5 A;  2HDQ A;  4E3O A;  2ZC6 B;  3RXW A;  3Q7V B;  1K4E A;  1K6R A;  1IYQ A;  5KMW A;  5TFQ A;  4S2P A;  4DDS A;  1ES2 A;  3E2K A;  1XKZ A;  1K57 C;  1JVJ A;  1TDL A;  3CZD A;  3N8R A;  2WUQ A;  3MXR A;  5HL1 A;  4JBF A;  4WMC D;  3SH8 A;  3SH9 A;  1FQG A;  2P74 A;  4U0T A;  3D4F A;  5HAQ A;  4LV1 A;  1KE4 A;  4DKI A;  1MWS A;  4MBF A;  4N1X A;  1K6S A;  4WEK A;  4Y0T A;  2XGN A;  3O87 A;  1E4D A;  5EE8 A;  1K56 A;  3OC2 A;  3BEC A;  3CG5 A;  5DTS A;  3TOI A;  1L0E A;  2DNS A;  4UA6 A;  2Y59 A;  5KSC A;  1XPB A;  2WAF A;  4DE2 A;  2A3U A;  5DF9 A;  1VQQ A;  2Y2O A;  1BZA A;  4OH0 A;  3WS0 A;  3UPO A;  4WZ5 A;  3PAE A;  1K54 C;  1Q2P A;  1NJ4 A;  1MKI A;  4R1G A;  4P85 A;  4IBR A;  1Y54 A;  4S2M A;  1K56 D;  1O07 A;  4EBN A;  5JYO A;  1CI8 A;  3OCN A;  3HVF A;  4P0M A;  4BJP A;  5GHZ A;  4ZJ3 A;  4OLD A;  3UDF A;  1W5D A;  1LLB A;  3OPR A;  4LV3 A;  1PI4 A;  4MLL A;  4E3K A;  3BEB A;  4S2K A;  1DJC A;  1HVB A;  1YLZ A;  2PU2 A;  4UHU A;  3RJU A;  3ZFZ A;  3M2J A;  1ESU A;  5CGW A;  3VP3 A;  2XH9 A;  4GB7 A;  4DDY A;  4ZDX A;  3N6I A;  3Q82 A;  4UA9 A;  3UNW A;  5F83 A;  3AGE A;  4OQH A;  4OPY A;  2WKH A;  2BG1 A;  3Q81 A;  1WE4 A;  4MBK A;  2OLU A;  5CGX A;  4FH4 A;  4HBU A;  5HX9 A;  4S2I A;  2ZQ8 A;  2XF3 A;  2H0T A;  4JXS A;  1PIO A;  3C4O A;  1XA7 A;  4IVI A;  4ZBE A;  1C3B A;  3VOZ A;  3HUN A;  1ONG A;  4MNR A;  3OPP A;  4KZ6 A;  4XUZ A;  2OSU A;  1S0W A;  2JCH A;  1H5X A;  2WYX A;  3V5M A;  5HAP A;  5GLB A;  2XD5 A;  5FAQ A;  1KVM A;  2QPN A;  2HP9 A;  5G18 A;  3A3J A;  3DWK A;  1NZU A;  1BSG A;  3CJM A;  1E25 A;  4JKT A;  4KZB A;  5CTN A;  5DTT A;  4NET A;  2ZQD A;  5FAO A;  3Q07 A;  3ZG5 A;  2H5S A;  2GDN A;  1FCN A;  4U0X A;  1MXO A;  3UPN A;  4YIN A;  1BT5 A;  5EOO A;  1WYC A;  1BUE A;  1DJB A;  1FSY A;  3ZCZ A;  3HLW A;  2P9V A;  4QU3 A;  3SH7 A;  3NC8 A;  3HLG A;  3LEZ A;  4LEN A;  4KQO A;  3PBT A;  1PWC A;  4R3J A;  2ZQA A;  4S2L A;  2EX2 A;  2WZZ A;  1S6R A;  4KG5 A;  5FQJ A;  4E3N A;  4S2J A;  2HP5 A;  4OON A;  5CED A;  1IYS A;  3ITA A;  4OQ0 A;  4RVA A;  5FAP A;  1I2W A;  1PYY A;  2JBF A;  2R9W A;  4KQR A;  5HAR A;  3MZD A;  1XGJ A;  5U47 A;  2Y55 A;  3P98 A;  4WYY A;  4BQM A;  2QMI A;  2FFY A;  3GQZ A;  5L2F A;  1KGE A;  2HP6 A;  4BEN A;  3C7U A;  2WAE A;  2Q9M A;  4XUX A;  4BL2 A;  1IKI A;  4WZ5 C;  4R3B A;  1SDN A;  2WGI A;  3A3F A;  3Q7V A;  1ES5 A;  1FSW A;  3BYD A;  4X69 A;  1IEL A;  2IWD A;  3VFH A;  3ZG8 B;  1W8Y A;  2WKI A;  2V2F F;  5FAT A;  5KSH A;  3BM6 A;  4LCL A;  4OQI A;  1G6A A;  4Y7P A;  5AQ7 A;  5EVL A;  2XFT A;  3LY3 A;  4DF6 A;  2Y2G A;  4ZTK A;  1FOF A;  3SOI A;  3W4O A;  3OZH A;  3VMA A;  2RL3 A;  3SS3 A;  3GSG A;  3HUM A;  5EEC A;  2Y2I A;  4WEJ A;  2G2U A;  1KGF A;  3HLF A;  3ZNT A;  2Y2L A;  4LV2 A;  3NY4 A;  3VSK A;  3G31 A;  1YLY A;  3DW0 A;  4FCF A;  1SHV A;  1JWZ A;  3G34 A;  3IF5 A;  4BLM A;  4KZ7 A;  4LV0 A;  5CRF A;  2WGW B;  5DVA A;  3V3R A;  1IYO A;  1GCE A;  4OPZ A;  4XXR A;  4X56 A;  5DTK A;  5TR7 A;  1JWP A;  1FCM A;  4RX2 A;  5CEB A;  4PM9 A;  4PPR A;  3ZNY A;  3FKW A;  3ITB A;  3IXG A;  2Y91 A;  5E2F A;  4E3L A;  3OCL A;  4N92 A;  4DXC A;  5FA7 A;  1G68 A;  1L0F A;  3UY6 A;  1K4F A;  3FV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...