1JWZA

Crystal structure of tem-64 beta-lactamase in complex with a boronic acid inhibitor (105)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Evolution of an antibiotic resistance enzyme constrained by stability and activity trade-offs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 99
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jwzA00
2XF3A 4P6BA 2J9PA 4QJGA 4OPRA 2UWXA 2WZXA 1LI9A 1M6KA 3G31A 3OZHA 3LY3A 3IWIA 2V1ZA 1TDGA 2H5SA 2Y2LA 3BFDA 4P87A 4P85A 4UA6A 5HX9A 1JTGA 1FSYA 1K6SA 1BSGA 3C7VA 3M2KA 4MEZA 4WMCD 4ID4A 2Y2PA 3IH8A 4X69A 5HAQA 1ALQA 1PI4A 5GHZA 2ZQAA 3A3JA 1GHIA 1LL5A 3NDGA 2QMIA 5CECA 3SH9A 4KQQA 3VFFA 1FCMA 1K54C 4OH0A 4GD8A 4DE1A 2ZC3B 2XH9A 3GMWA 3FKWA 1E3UD 2WGWB 2WGWA 2XLNA 3LEZA 2WGIA 1VQQA 3JYIA 4OQHA 2P74A 4LV2A 1TVFA 2IWCA 1GA9A 1SCWA 4S2NC 5E2GA 2JCHA 4S2LA 2Y2MA 4E3LA 1YMSA 1XKZA 2H10A 4BD0A 4QB8A 3BFCA 4JBFA 5E43A 2Y2OA 2WUQA 4MBFA 1H8YA 5CHJA 1NY0A 4R1GA 4KZ5A 1NZUA 3VP3A 3SS5A 2WAEA 3MBZA 1MWSA 2C6WB 4JKTA 4BL2A 5CERA 3UDFA 5TGFA 2WAFA 3G34A 4KQRA 2H0YA 5FI2A 3NIAA 4IEDA 3HLFA 2Z2LB 5IHVA 4KZ7A 4OOMA 3MXSA 5CEBA 1XX2A 5DVAA 4K0WA 3GRJA 5FI7A 5FQQA 3FV7A 1L0FA 1BTLA 4OQIA 3UDIA 4E3NA 1HVBA 3P09A 3PTEA 1KVLA 1W8QA 3HLCA 3UE1A 3ZG8B 1PW1A 3ZHHA 3VOYA 3IWQA 1BLCA 4MBHA 5FSRA 3NCKA 4F94A 3IHAA 4YFMA 1ZG4A 1S6RA 2Z2MB 1MXOA 2GDNA 2EFUA 1FCOA 3IF6C 3UPOA 2J9OA 4JXVA 1VM1A 2ZC5B 1HTZA 4K91A 3ZVWA 3BECA 2Q9MA 2R9WA 2Y2IA 1K55A 4BD1A 4H8RA 1DJAA 1CI9A 1SHVA 3PBRA 4OPQA 3ZG0A 3BM6A 1ONGA 5E2HA 2FFFB 3SH8A 2ZLYA 2XK1A 2OV5A 5KSHA 1KDSA 3VFHA 4OONA 3VMAA 1MKIA 1XXMA 1IEMA 1K57C 4Y0UA 1GHPA 1ZC2A 3IXBA 2ZC7A 3ITAA 1DJCA 3CZDA 3IQAA 1YMXA 1WYBA 1YM1A 5DF9A 1BULA 3BFFA 4U0XA 2EX6A 3Q82A 2ZC4B 2Y2GA 2J7VA 1BUEA 4RX3A 4DDSA 5EUAA 4OLDA 1ONHA 4NK3A 3M6HA 4PM8A 2ZC6B 4KZ4A 1H5XA 1MY8A 4WELA 4JF6A 2G2UA 4JXGA 1Z6FA 1GHMA 2HP6A 4LV3A 4Z9QA 4KENB 2H0TA 3S4XA 1DJBA 4QU3A 4JF5A 5L2FA 2HDQA 3CMZA 4EQIA 1ZKJA 5CHUA 5KMWA 3RXWA 1XA1A 4OLGA 4RYEA 1FQGA 1ZG6A 4PM6A 1Q2PA 4DXBA 1BLHA 5CRFA 1K56A 3O87A 4OKPA 1PI5A 3HUOA 4N1XA 3VP0A 4KG2A 3IF5A 2ZM2A 5GLCA 1YLZA 4E3MA 4E6XA 1KE0A 3AGDA 1GCEA 1MWTA 3SS3A 1KE4A 3E2LA 4L0LA 4N1HA 4GKUA 5GLDA 3LO7A 4OPZA 1FOFA 5D3OA 1I2SA 1CK3A 2CC1A 4ZJ2A 2XR0A 3ZG7B 3SH7A 4GZBA 5DTSA 3OPRA 4JF4A 1E25A 4B88A 4XUZA 4GN2A 4IVKA 5HL1A 1W79A 5A90A 2A49A 2EX8A 1K4EA 3HL9A 4R3JA 4E3JA 4Y0OA 4R3BA 5AQAA 4ZAMA 2IWBA 3MZFA 1PW8A 4FH4A 1NRFA 3N7WA 3MXRA 2XGNA 1RGYA 1NJ4A 3O86A 4LCMA 2ZMAA 4OP8A 1ES3A 3DTMA 1K25A 3G4PA 2X02A 1RP5A 1YLYA 3TG9A 3WS0A 3E2KA 5FATA 2PU4A 5DTTA 2BG1A 3EQUA 3VSKA 1NXYA 4Y0TA 5E2EA 4ZTKA 2ZD8A 3WS5A 2Y2QA 3BLSA 1SDNA 1IKGA 4GDBA 5CXWA 5EOEA 3WRZA 4OOYA 3IXGA 1I2WA 2DNSA 4KG6A 1CEGA 3IHBA 4QHCA 1N9BA 3FYZA 1CI8A 5GHXA 3VSLA 4X56A 5HFOA 5A91A 4QY5A 1OMEA 4M3KA 3S1YA 3SOIA 1W7FA 4R4RA 1EI5A 4ZBEA 2BLSA 5DF7A 5FQKA 1C3BA 5EPHA 1KVMA 4OPYA 3LY4A 4S2OA 3ZDJA 3IWOA 5FQ9A 1LI0A 3HLEA 4HESA 1L0EA 2Y2HA 3AGEA 4WM9A 1QMFA 4JXWA 3UPPA 1K56D 4IBRA 2ZM8A 1PZPA 1XP4A 2ZM0A 4CPKA 3HBRA 4R23A 4UAAA 5EVIB 5EVIA 2Y59A 4KZ8A 3HUMA 4PM9A 4IBXA 3C7UA 5FAQA 4B4XA 1MWRA 2HDRA 3B3XA 3G32A 1PYYA 4KZ9A 1AXBA 4K0XA 1BLPA 5FAPA 1IYPA 3WS2A 4BJPA 4BENA 3RXXA 4WZ5C 5FQMA 3MZDA 3BLMA 3C4OA 3CG5A 2DCFA 1LL9A 3VP2A 4U0TA 3ZNTA 4FD8A 2EFXA 5KSCA 4MLLA 3NBLA 2V2FF 2XFSA 3UO9A 1ES2A 5CTMA 5I94A 2QPNA 3PBNA 3NI9A 4QD4A 3W4PA 5F83A 3W4QA 4RA7A 3ZNYA 1ERQA 1ES4A 3UE3A 3OPLA 4P0MA 1FCNA 5TR7A 4E3OA 4PPRA 3HUNA 1YLPA 1BLSA 3A3DA 4DRTA 2J8YA 2PBYA 4LV0A 4LV1A 1BZAA 3N4IA 4KZBA 5FQJA 3QNCA 5KZHA 2WKIA 4WEJA 3WRTA 4PM5A 2HP5A 4DXCA 5EOOA 4YINA 2EX9A 3GTCA 1N4OA 3FZCA 4X6TA 4RX2A 5GLAA 3V39A 5EVLA 5FAOA 4XXRA 1KGGA 3PBOA 1IKIA 1Y54A 4KQOA 3GSGA 3WS4A 2HDUA 3MFDA 4C75A 1RCJA 2XFTA 2B5RA 4DDYA 1TDLA 4PM7A 3VOZA 1JTDA 1G6AA 1L2SA 1I5QA 4WBGA 2C5WB 4LENA 4EWFA 2WZZA 4LCLA 4PMAA 1NZOA 4B4ZA 1O7EA 5F1GA 1RGZA 2VGKA 3OPPA 1G68A 4C3QA 4S2JA 3UPNA 5A92A 3BYDA 5CGWA 3NC8A 5E2FA 3W4OA 4GNUA 3IT9A 4S2KA 1IELA 3I7JA 5J8XA 4OVDA 4KZ6A 5BOHA 1FR6A 3PBQA 5DTKA 2R9XA 3M2JA 3PAEA 2RCXA 4FCFA 2XQZA 3D4FA 3IF6B 2WGVA 3IF6A 5EVID 2ZJ9A 4WZ4A 1YT4A 4WYYA 2FFYA 4O7DA 2A3UA 1FR1A 3G2YA 1KDWA 4S2PA 1ESIA 1K55C 3G2ZA 1YLWA 3Q81A 4Y7PA 4C6YA 4EBNA 1M40A 5AQ9A 1L0DA 1PIOA 1TEMA 1U60A 5EE8A 3AGFA 4DF6A 4UA9A 3EQVA 4OP5A 3HLWA 3GVBA 1WE4A 1K57A 2VGJA 3HREA 1XPBA 4MNRA 4MBKA 4RVAA 4CJNA 4JPMA 1IYSA 1FSWA 2ZQDA 3A3FA 5DF8A 1QMEA 3MZEA 2HDSA 1ES5A 1PWDA 1PWGA 5GHYA 4NETA 2E8IA 1O07A 3TSGA 2OSUA 3Q07A 4EUZA 1KE3A 2EX2A 1J9MA 3A3EA 2Y2KA 4OQ0A 4X68A 3NDEA 3M6BA 5G18A 1Q2QA 3N8RA 5CGSA 1YLJA 5HAPA 2HPBA 2P9VA 2P9VB 4DE3A 3A3IA 3OC2A 2V20A 3G35A 3ZG9B 4ZJ1A 1KGFA 1EWZA 2Y2JA 4KZAA 4BL3A 4EBPA 1CEFA 2JBFA 3SS4A 1LLBA 2X01A 1PWCA 2XEPA 3HLBA 3N8SA 2Y55A 2PU2A 1WYCA 2QZ6A 1H8ZA 2X71A 4XUXA 2OLUA 2IWDA 4N9LA 4U3TA 4E3KA 5CTNA 4N9KA 1NYYA 3Q7ZA 4FSFA 3FWLA 5U47A 1K4FA 4Q8IA 1K6RA 1HD8A 2JC7A 4JXSA 3DWZA 4OOLA 4HEFA 3VP4A 2I72A 2XDMA 3IXHA 5CHMA 2DRWA 1SDEA 4QY6A 2WKEA 2JE5A 1JVJA 3G30A 5F82A 1BT5A 1YLTA 1L0GA 4JLFA 2ZQ7A 1W5DA 3O88A 4KG5A 2WADA 3VP1A 2XD1A 4GD6A 3HLGA 1JWVA 4BLMA 3DW0A 2WK0A 3OPHA 2RL3A 1XGIA 4WMCA 4DKIA 3N6IA 1KGEA 2WKHA 3O3VA 3V3SA 3V3RA 4GDNA 5TFQA 3ZG5A 5FASA 1SKFA 1HZOA 3HLDA 1IYQA 1JWPA 4X55A 1MBLA 5HW3A 3CJMA 2Y4AA 1K54A 4GOGA 3ZCZA 5FDHA 1XGJA 1PZOA 2ZQ9A 1DY6A 3UY6A 1E3UA 3MKEA 5FI6A 3UNWA 1MPLA 3ISGA 2HP9A 3MKFA 4S2MA 3NY4A 4S2NA 4FH2A 5F1FA 5CGXA 4IVIA 5FA7A 1S0WA 3GR2A 3UE0A 3TOIA 1K38A 5GL9A 5AQ7A 3BFEA 3DWKA 3C5AA 1NYMA 3WWXA 4UHUA 3ZVTA 3FKVA 4KZ3A 4D2OA 5EECA 3ITBA 4EBLA 3S22A 3Q1FA 2ZQ8A 3W8KA 3ZFZA 1GA0A 1JWZA 3BEBA 3BRMA 1XA7A 3IH9A 2EXAA 1ERMA 5M1AA 3OCLA 5FQIA 4S2IA 3QNBA 4R0QA 4DE0A 4E6WA 4DE2A 2WYXA 4EV4A 5GLBA 3PBSA 4WEKA 3V5MA 5JYPA 4R4SA 4GB7A 4BQMA 3OCNA 3GQZA 1ESUA 3GV9A 3PAGA 5JYOA 2EXBA 3V50A 1YQSA 5AQBA 4OQGA 3IXDA 3WS1A 4HBTA 3HVFA 4E3IA 4ZDXA 5HAIA 3PBTA 5CEDA 1EROA 4UA7A 2OLVA 3C4PA 5HARA 4X53A 2XD5A 2ZQCA 3BFGA 4N92A 5EVIC 3UDXA 1LHYA 1MWUA 2G2WA 3LCEA 3N8LA 3P98A 3ZGAB 4HBUA 1IYOA 3RJUA 1E4DA 4ZJ3A 5M19A 5A93A 3Q7VB 3Q7VA 3UN7A 1W8YA 3QHYA 4WZ5A 4A5RA 5M18A 2Y91A 2Q9NA 2Y2NA
chains in the Genus database with same CATH superfamily
4P6BA 2J9PA 4OPRA 1M6KA 3G31A 3A0SA 3LY3A 3IWIA 5C5KA 1TDGA 2H5SA 4UA6A 2PRFA 1K6SA 2Y2PA 1ALQA 1PI4A 3H7WA 3H7WB 1NLYA 2QMIA 5CECA 3SH9A 2GZAA 3VFFA 1FCMA 3MF0A 2ZC3B 4WF0A 1VQQA 3JYIA 1DRMA 5J3WA 3KO6A 3L7HA 2GJ3A 1NRJA 4E3LA 4BD0A 1S1ZA 4MBFA 1H8YA 1NY0A 2ZL1A 2ZL1B 1NZUA 3SS5A 1MWSA 4BL2A 4ETZA 3UDFA 3G34A 2H0YA 3NOPC 5FI2A 3HLFA 3MXSA 5CEBA 1XX2A 4K0WA 3GRJA 2JKRI 5AVFA 3ICYA 3P09A 4WUJA 3HLCA 1PW1A 4JGRA 3IWQA 3BQAA 4MBHA 2J3TD 3LICA 1FCOA 2J9OA 2W27A 2ZC5B 4IUHA 2R9WA 3QP6A 1DJAA 2J80A 4P6ZS 3PBRA 2B02A 1ONGA 2B95A 3MQOA 2D01A 3LUQA 2ZC7A 1DJCA 3CZDA 1YMXA 1WYBA 3UB5P 3DTIA 3Q82A 4RX3A 2J7VA 1J3WA 1PNEA 4OLDA 4NK3A 1H5XA 1F2KA 4JF6A 1Z6FA 1GHMA 1KOUA 1DJBA 4EQIA 3SW1A 1TS8A 5CHUA 5KMWA 4PM6A 1ZG6A 1BLHA 4CQHA 4MMNA 4OKPA 3NECA 2ZM2A 3T4OA 3SS3A 4DJ2A 1S67L 3E2LA 1VB6A 3T4KA 2CC1A 4NXEA 4EXOA 4EETB 4XUZA 1W79A 4Q0HA 4E3JA 3JVVA 4ZAMA 2IWBA 3S7QA 1LSXA 1RGYA 2VKSA 5I5LA 4OP8A 2X02A 1RP5A 3E2KA 5FATA 2VX8A 2PU4A 1D1JA 3EQUA 3VSKA 2ZD8A 5EOEA 3WRZA 3MS6A 3HJKA 4I5SA 2DNSA 1MC0A 3IHBA 4QHCA 3LI9A 3OLOA 1CI8A 3E4QA 3VSLA 4X56A 5HFOA 5A91A 4QY5A 3K3CA 3SOIA 5EV0A 5EPHA 4OPYA 2XA7S 3NULA 4YNRA 2W1TB 2W1TA 3IWOA 3ZDJA 2Y2HA 4R23A 5EVIB 4UAAA 5EVIA 3MQQA 5F6AA 2HDRA 1PYYA 2WKQA 3HJIA 2W3FA 4EU0A 1T19A 4PHTA 1OPXA 3OOVA 3C4OA 2JKGA 3CG5A 2EFXA 2XFSA 3KSFA 1ES2A 3A0RA 2WKPA 3W4QA 4P0MA 5TR7A 3MJQA 4PPRA 2J8YA 4KZBA 4WEJA 3WRTA 2EX9A 3FZCA 3V39A 4WLAA 3MXQA 1OTBA 4LRXC 1Y54A 3MFDA 4C75A 4PM7A 3VOZA 1JTDA 4WBGA 1NZOA 1O7EA 3OPPA 2VGKA 2O9AA 3F1NA 3F1NB 3CWFA 1IELA 5J8XA 3EOIA 4KZ6A 2R9XA 3M2JA 1NWZA 2XQZA 3ZYTA 1YT4A 4NXGA 2FFYA 4GS9B 4GS9A 3UB7A 2W3HA 1K55C 4EBNA 5AQ9A 1U60A 4EERA 3EQVA 3HLWA 4NG2A 1WE4A 3HREA 4MN6A 4MNRA 2ZQDA 3A3FA 3LR4A 4NETA 2E8IA 1O07A 4EUZA 3DTKA 2EX2A 1J9MA 3A3EA 3N8RA 4D60A 5IT5A 3FC7A 3RTYA 3A3IA 1NLZA 3TRCA 3ZG9B 3IBRA 2VGLS 4BL3A 4KZAA 2JBFA 2X01A 2L1MA 4HNBA 2Y55A 2PU2A 2IWDA 4RQ9A 5F69A 2VZWA 1GSVA 1NYYA 4NEED 2W3DA 4EW7A 2QYBA 2I72A 2DRWA 4QY6A 2WKEA 5FDSA 2ZQ7A 3O88A 4KG5A 4LGWA 1XJ3A 1JWVA 2RL3A 5DJUA 1KGEA 1IYQA 1JWPA 1K54A 3ZCZA 5FDHA 3PHYA 2QHKA 5FI6A 3UNWA 3EWKA 4GHIB 4GHIA 5F1FA 4FH2A 5CGXA 1G6OA 4JGQA 3CUEC 1PRQA 4LRZE 3PYPA 2NUPC 1JWZA 1XA7A 3IH9A 4B93A 2JHEA 2QWSA 3QP5A 5FQIA 4E6WA 1P0ZA 2B18A 3MR0A 5HDSA 3PBSA 3GV9A 4QWOA 2ZMFA 1AWIA 3IXDA 3PBTA 5CEDA 1EROA 4UA7A 3C4PA 4X53A 3CITA 2XD5A 3BFGA 1OT6A 1LHYA 3FPVA 2P08A 3LCEA 2H28A 5M19A 3UN7A 1K0KA 2VK3A 3LYXA 4HP9A 2XF3A 4QJGA 3OZHA 3JVUA 3BFDA 5HX9A 4P85A 4P87A 2HF6A 1FSYA 1BSGA 5HAQA 2ZQAA 3A3JA 4DE1A 3FKWA 1E3UD 4OQHA 5IU1A 2WGIA 3MMHA 5E2GA 2JCHA 2J3WA 2Y2MA 2FH5A 3IX3A 3BFCA 2Y2OA 3OBFA 2HGVA 2WUQA 4HOIA 4R1GA 4KZ5A 4EUVA 1SKOA 1SKOB 2OAP1 2ZBBA 5CERA 1UWNX 1UGUA 2Z2LB 5FQQA 1BTLA 1HVBA 3PTEA 3ZHHA 4PKYG 1XFNA 3NCKA 4F94A 4KUOA 4YFMA 1S6RA 5FEGA 2GDNA 2EFUA 1TD5A 3C30A 1TF1A 3BECA 4I3IA 4BD1A 1CI9A 4DN0A 3BM6A 3LIBA 5KIZA 5AVEA 2PR5A 2OV5A 1XXMA 4EEPA 1GHPA 2EX6A 2ZMVA 2ZC4B 1BUEA 4DDSA 4PM8A 4WELA 2YKHA 4JXGA 2HP6A 1BYWA 4QU3A 4JF5A 3CMZA 3DAVA 4R70A 5HZHA 3VP0A 4LFUA 3JPUA 4N1HA 4GKUA 1ACFA 3KSGA 1FOFA 4ZJ2A 2O99A 2G7UA 1YAXA 3TE8A 1E25A 2MJ6A 5HL1A 5A90A 2EX8A 1K4EA 3T50A 2CMNA 4Y0OA 4HJ6A 4DJ3A 4FH4A 1NRFA 3KSHA 1NJ4A 2OAQ1 1K25A 3G4PA 1YLYA 2ZOIA 2NUTC 1NXYA 4Y0TA 3WS5A 1SDNA 1IKGA 4GDBA 5CXWA 1T1BA 1I2WA 3T4TA 4KG6A 5GHXA 5HPFA 3RH8B 5FQKA 3LY4A 2DMWA 2O9CA 1G28A 4WM9A 1QMFA 4JXWA 1K56D 4IBRA 3LIDA 3T4LA 1XP4A 1Y28A 2Y59A 3HUMA 4B4XA 3K2NA 3B3XA 2Z6CA 3G32A 1AXBA 3IBJA 2PYRA 2V1AA 1GSXA 1BLPA 5FAPA 1IYPA 5HDDA 3NOTC 1YSPA 2GNXA 3BLMA 3NBLA 3DBAA 1EW0A 3FG8A 5CTMA 3UO9A 3W4PA 3NI9A 3ZNYA 3OPLA 4GCZA 4F3LB 4F3LA 1PFLA 2PDRA 1VHMA 4CLCE 3NHQA 1YLPA 3A3DA 2PBYA 4LV1A 3N4IA 2W3EA 4YINA 4X6TA 4JGPA 5GLAA 5FAOA 3P7NA 3A0VA 2JN7A 1KGGA 1IKIA 2LB9A 1TDLA 4KQDA 1G6AA 1I5QA 4LCLA 2HJEA 4PMAA 4B4ZA 5F1GA 1RGZA 2PHYA 1G68A 4O8GA 5HD3A 5A92A 3NC8A 5E2FA 3W4OA 4GNUA 2V0WA 1S4SA 3R4KA 2RCXA 4FCFA 2KX6A 2ZJ9A 4O7DA 2A3UA 4PAUA 3Q81A 4NXBA 4Y7PA 4C6YA 3P01A 1L0DA 1TEMA 2PT7A 2V9AA 5EE8A 3AGFA 4DF6A 3C8CA 2GX5A 2V1BA 4OP5A 3T1RA 5FEFA 4AFIA 2VGJA 3H82B 1XPBA 3H82A 4MBKA 4CJNA 4JPMA 1IYSA 3GECA 3MZEA 2PD8A 4II7A 3T12B 3LR5A 5DFXA 3KX0X 2K2NA 1HLUP 4WL9A 5CGSA 5HAPA 2P9VA 2P9VB 2R78A 3OC2A 2V20A 3G35A 3VV4A 3F1OB 3F1OA 3SS4A 1LLBA 3HLBA 1WYCA 1LSWA 1H8ZA 2OLUA 2L0WA 3O5YA 4N9LA 3Q7ZA 4FSFA 4JXSA 3DWZA 2V8CA 4HEFA 4OOLA 3CAXA 3VP4A 5F82A 1L0GA 4JLFA 4HIAA 3LIAA 2WADA 2UV0E 3CI6A 2XD1A 3DW0A 1XGIA 2A2LA 2WKHA 3ZG5A 2K7SA 3HLDA 4H6JA 4H6JB 4M4XA 2QJ7A 1DP8A 2ZQ9A 3UY6A 3GDIA 2Q0OA 3E4OA 4MDZA 4S2MA 4S2NA 3GR2A 3LR0A 3TOIA 1K38A 5GL9A 1NYMA 4HJ3A 5DJTA 4UHUA 3UMDA 2O0YA 3FKVA 4KZ3A 3ITBA 2ZQ8A 4Q0IA 2KDKA 3BEBA 1YPRA 4DE0A 4DE2A 4GJ4A 3CLOA 2WYXA 4IUKA 3V5MA 4GB7A 3PAGA 5HDCA 2EXBA 5JYOA 5AQBA 4OQGA 2JKTI 3QP1A 4ZDXA 5HAIA 3RFBA 4YWZA 2OLVA 4YOFA 1MKMA 2ZQCA 2PBDP 1CQAA 1MWUA 3K3DA 3VOLA 3ZGAB 1XFQA 3RJUA 5A93A 4Z1WA 3Q7VB 3Q7VA 2V0UA 4A5RA 2Q9NA 2Y2NA 2EWVA 2OWJA 2WZXA 4G3KA 2IA2A 5HWTA 2Y2LA 1WA9A 3CHWP 1W63Q 4UQIS 3C7VA 4X25A 4WMCD 4ID4A 3IH8A 4X69A 5GHZA 1GHIA 1LL5A 3NDGA 4KQQA 4OH0A 1K54C 3G6OA 2XH9A 3D3OA 2WGWB 2WGWA 2XLNA 2XSSA 4O01A 2P74A 4LV2A 3UE6A 2IWCA 2KOIA 1GA9A 4S2LA 4HP4A 4I39A 1YMSA 2HZ5A 2H10A 4QB8A 5E43A 4HI4A 5CHJA 5A8BA 3VP3A 3MBZA 2C6WB 4KQRA 3NIAA 4IEDA 4CLCC 3BY8A 4KZ7A 4OOMA 3SZTA 5DVAA 4UQIM 1IOUA 3FV7A 5HPIA 1L0FA 2AVXA 3UDIA 3UE1A 3ZG8B 2L4RA 3IHAA 1ZG4A 1MXOA 5HL6A 1ODVA 3UPOA 5LBRA 3IF6C 1VM1A 2Y8HA 2Y2IA 1K55A 4H8RA 4OPQA 1H8MA 5E2HA 2FFFB 3SH8A 1XJ2A 2ZLYA 2XK1A 1VEUB 1VEUA 5KSHA 1LL8A 3VFHA 2VA0A 4I38A 4OONA 1MKIA 1IEMA 3CPTA 3CPTB 1K57C 4Y0UA 1ZC2A 3IXBA 4FUWA 5DKKA 3IQAA 1YM1A 5DF9A 1BULA 4U0XA 2Y2GA 5EUAA 1ONHA 3E4PA 4KZ4A 2E8JA 4KENB 1H3QA 2H0TA 2JKRM 3LIEA 5L2FA 2JKFA 1ZKJA 4G3VA 3RXWA 1XA1A 1OTDA 4Y13A 4OLGA 4RYEA 4DXBA 1OJGA 1F9IA 5CRFA 3O87A 4Y3IA 3LFVA 1YLZA 4E6XA 1KE0A 3AGDA 2PR6A 4NXFA 4L0LA 3LO7A 4OPZA 5D3OA 1I2SA 3SH7A 5HWVA 4GZBA 3OPRA 4B88A 1XJ4A 4IVKA 4Y2FA 3HL9A 4PKYA 1STZA 4R3JA 5TJJA 3MZFA 3KYQA 3N7WA 2W3GA 4UEYA 2M7VA 1V9ZA 5MC7A 5DTTA 2BG1A 5E2EA 3CUEA 1P9RA 2Y2QA 3B42A 3IXGA 1CEGA 1N9BA 2KLIA 5DKLA 3FYZA 1OMEA 4M3KA 1EI5A 2BLSA 5DF7A 1C3BA 3LEQA 4HH3A 1KVMA 1YKDA 1LI0A 3HLEA 3AGEA 2XROA 4MN5A 3MQ0A 2ZM0A 1GSWA 4CPKA 3HBRA 3EEAA 1OTEA 4K08A 4KZ8A 4LRYC 1TS0A 3S7NA 1L3LA 5J4EA 4KZ9A 4K0XA 3PR6A 4I3JA 4WZ5C 3EGXC 4HH2A 2DCFA 1W63M 4U0TA 1DP9A 4FD8A 5KSCA 4MLLA 5F68A 3PBNA 5F83A 3TW8A 4RA7A 1ERQA 3UE3A 1N9LA 3R7WB 3R7WA 3T1QB 3T4JA 1BZAA 5KZHA 2PD7A 5FQJA 4Y15A 2I9VA 2WKIA 4DXCA 4RX2A 3PBOA 4R38A 3UB6A 4KQOA 3WS4A 2HDUA 2XFTA 2INWA 4DDYA 4EWFA 1A0KA 3LI8A 4S2JA 4EEUA 3UPNA 5CGWA 4S2KA 4OVDA 3PBQA 2V8FA 5TBMB 5TBMA 2WGVA 5EVID 4WZ4A 3G2YA 1KDWA 3G2ZA 1CF0A 1YLWA 1M40A 1P97A 1IFQA 1QMEA 2HDSA 1ES5A 5GHYA 4R3AA 4GW9A 1S66L 3MFXA 2Y2KA 1FIKA 3M6BA 1Q2QA 2HPBA 2QJ5A 4DMZA 4I3AA 1KGFA 1EWZA 1DP6A 1CEFA 2JKTM 3VE3A 2O9BA 4XUXA 4U3TA 3FWLA 5U47A 4X1LA 2XDMA 3IXHA 5CHMA 1SDEA 2OOLA 1YLTA 1W5DA 1H0MA 3VP1A 3BW6A 4GD6A 2WK0A 3IS2A 3D72A 3IS2B 2VV7A 3MSHA 1P9WA 3O3VA 4GDNA 1HZOA 2M7UA 4X55A 1MBLA 3CJMA 2Y4AA 3C38A 1XGJA 4HHDA 4L9EA 1E3UA 3LGOA 4HY8A 2EA9A 3PXPA 3MKFA 3NY4A 3NJAA 2W1RA 4IVIA 5FA7A 1S0WA 3UE0A 3VE4A 1MZUA 4BMWA 3DWKA 3WWXA 3ZVTA 3Q1FA 3W8KA 3ZFZA 2K31A 4X1MA 1T18A 1ERMA 1LT0A 2XRNA 1UWPX 4R0QA 5GLBA 4P6ZM 5EVEA 4WEKA 1N9NA 5JYPA 4R4SA 2EWWA 4BQMA 1ESUA 1YQSA 3WS1A 1T1CA 3HVFA 4E3IA 4FOFA 1TS7A 5EVIC 4BBUA 5L8MA 3N8LA 4HBUA 1IYOA 5J7EA 1E4DA 4ZJ3A 3IX8A 1W8YA 3V67A 2Y91A 4QPRA 2ZOHA 2UWXA 1LI9A 4KUKA 2V1ZA 1JTGA 2VLGA 3M2KA 2PAVP 4MEZA 1SZVA 4GD8A 3GMWA 3LIFA 3UB9A 3LEZA 3UMEA 1X0OA 1TVFA 4EQ1A 1SCWA 4S2NC 4R6LA 1XKZA 2FZ0A 4JBFA 1OTAA 2WAEA 4JKTA 5TGFA 2WAFA 1OTIA 4CLCD 2ACGA 5IHVA 5FI7A 1G5UA 1T1AA 4OQIA 4E3NA 5F5YA 1KVLA 1W8QA 3VOYA 1BLCA 5FSRA 2J3TC 2Z2MB 4JXVA 4K91A 3ZVWA 1HTZA 2Q9MA 1TS6A 1SHVA 2YKFA 3ZG0A 4ETXA 4G3WA 5K5BA 1KDSA 4GLQA 3VMAA 3LR3A 3ITAA 5EM1A 3BFFA 2XA7M 3M6HA 2ZC6B 1MY8A 2G2UA 1N9OA 4LV3A 4Z9QA 2A24A 2A24B 3S4XA 1LSVA 2HDQA 4L9FA 2Z6DA 1FQGA 1Q2PA 1K56A 3BQ8A 1PI5A 3HUOA 4N1XA 4KG2A 3IF5A 5GLCA 4E3MA 2PYPA 1GCEA 1MWTA 4ZRRA 1KE4A 5GLDA 2OWHA 4IJGA 3ULFA 1CK3A 2XR0A 3C2WA 2HV1A 3ZG7B 5DTSA 1YSQA 4JF4A 3QP4A 3KYEA 5EM0A 4GN2A 2A49A 4HJ4A 4R3BA 5AQAA 1PW8A 5EFWA 1V9YA 3MXRA 2XGNA 4JGOA 3O86A 4LCMA 4B9OA 2ZMAA 1ES3A 4Y5FA 3DTMA 3TG9A 3WS0A 3BWLA 3ZQ5A 2VEAA 3H9WA 4HQAA 4ZTKA 5FL3A 2M1CA 2VJWA 3BLSA 1XJ6A 4OOYA 4ME4A 4BWIA 3F1PB 3F1PA 5G4ZA 2WKRA 3S1YA 1Z09A 1W7FA 4R4RA 3EEHA 4ZBEA 1VETA 1VETB 2HJ9C 4S2OA 5FQ9A 4HESA 1L0EA 3UPPA 5L09A 3KSIA 2ZM8A 1PZPA 3U4LP 3W2ZA 2BASA 5DFYA 4PM9A 4IBXA 3C7UA 5FAQA 1MWRA 2BTFP 3WS2A 4BJPA 3S7OA 4BENA 3RXXA 5FQMA 3MZDA 1LL9A 3VP2A 3ZNTA 2V2FF 5I94A 2QPNA 4QD4A 2VGLM 1ES4A 1FCNA 4E3OA 1D06A 4IHQA 3HUNA 1BLSA 4DRTA 4LV0A 3B33A 1OJ5A 3QNCA 4PM5A 2HP5A 5EOOA 3GTCA 1N4OA 5EVLA 3D9YA 3HCYA 4XXRA 5L10A 5AJGA 3GSGA 3IX4A 1RCJA 2B5RA 1L2SA 4LLOB 2C5WB 4LENA 4CLCB 4CLCA 2WZZA 4O0PA 2D02A 4BBVA 5IS1A 4C3QA 3T4SA 5HSQA 3BYDA 3IT9A 4ESPA 3I7JA 5BOHA 1FR6A 5DTKA 3PAEA 2QKPA 3DTEA 3D4FA 3IF6B 3IF6A 3E98A 4WYYA 1FR1A 1S4RA 4S2PA 1ESIA 3TJZC 1PIOA 4UA9A 3E0YA 4ARZA 4ARZB 3GVBA 1K57A 2W0NA 4RVAA 1FSWA 3T1SA 5DF8A 3BY9A 1PWDA 1PWGA 1FILA 3TSGA 2LB5A 2OSUA 3NOUC 3Q07A 4WN5A 5CX7A 1KE3A 1F5MA 4OQ0A 4X68A 5G18A 5HD5A 3NDEA 4FTXA 1YLJA 3T1XA 4XT2B 4XT2A 4DE3A 2VV8A 4ZJ1A 2Y2JA 4EBPA 1CJFA 3KYZA 1PWCA 3U2AA 2XEPA 3BJNA 3N8SA 4LPZA 2QZ6A 4MN7A 2X71A 4E3KA 5CTNA 4N9KA 1K4FA 4Q8IA 1K6RA 1HD8A 2JC7A 4BBTA 1OT9A 2JE5A 1JVJA 3G30A 1BT5A 2Y79A 5HWWA 4NKPA 1S1YA 4E04A 3HLGA 4BLMA 3OPHA 4WMCA 4DKIA 3N6IA 3V3SA 3V3RA 5TFQA 1JNUA 5G4YA 1SKFA 5FASA 3EGDC 5HW3A 3QP2A 4GOGA 2VV6A 1PZOA 1DY6A 2P7JA 3MKEA 1ZTUA 1ZHHB 1MPLA 3ISGA 2HP9A 1F98A 3T4QA 5AQ7A 3S7PA 3BFEA 3C5AA 4L9GA 4D2OA 5EECA 4EBLA 3S22A 4Q0JA 1GA0A 3BRMA 2EXAA 5M1AA 3OCLA 1D7EA 3FPWA 4S2IA 3QNBA 4EESA 4EV4A 3OCNA 3GQZA 3B47A 3V50A 4HBTA 4Y17A 3QP8A 5HARA 5L07A 4N92A 3UDXA 3UB8A 2G2WA 3P98A 1Y4OA 4MCWA 3L9KA 2P04A 3QHYA 4WZ5A 5M18A
chains in the Genus database with same CATH topology
2XF3A 4P6BA 2J9PA 4QJGA 4OPRA 2UWXA 2WZXA 1LI9A 1M6KA 3G31A 3OZHA 3LY3A 3IWIA 2V1ZA 1TDGA 2H5SA 2Y2LA 3BFDA 4P87A 4P85A 4UA6A 5HX9A 1JTGA 1FSYA 1K6SA 1BSGA 3C7VA 3M2KA 4MEZA 4WMCD 4ID4A 2Y2PA 3IH8A 4X69A 5HAQA 1ALQA 1PI4A 5GHZA 2ZQAA 3A3JA 1GHIA 1LL5A 3NDGA 2QMIA 5CECA 3SH9A 4KQQA 3VFFA 1FCMA 1K54C 4OH0A 4GD8A 4DE1A 2ZC3B 2XH9A 3GMWA 3FKWA 1E3UD 2WGWB 2WGWA 2XLNA 3LEZA 2WGIA 1VQQA 3JYIA 4OQHA 2P74A 4LV2A 1TVFA 2IWCA 1GA9A 1SCWA 4S2NC 5E2GA 2JCHA 4S2LA 2Y2MA 4E3LA 1YMSA 1XKZA 2H10A 4BD0A 4QB8A 3BFCA 4JBFA 5E43A 2Y2OA 2WUQA 4MBFA 1H8YA 5CHJA 1NY0A 4R1GA 4KZ5A 1NZUA 3VP3A 3SS5A 2WAEA 3MBZA 1MWSA 2C6WB 4JKTA 4BL2A 5CERA 3UDFA 5TGFA 2WAFA 3G34A 4KQRA 2H0YA 5FI2A 3NIAA 4IEDA 3HLFA 2Z2LB 5IHVA 4KZ7A 4OOMA 3MXSA 5CEBA 1XX2A 5DVAA 4K0WA 3GRJA 5FI7A 5FQQA 3FV7A 1L0FA 1BTLA 4OQIA 3UDIA 4E3NA 1HVBA 3P09A 3PTEA 1KVLA 1W8QA 3HLCA 3UE1A 3ZG8B 1PW1A 3ZHHA 3VOYA 3IWQA 1BLCA 4MBHA 5FSRA 3NCKA 4F94A 3IHAA 4YFMA 1ZG4A 1S6RA 2Z2MB 1MXOA 2GDNA 2EFUA 1FCOA 3IF6C 3UPOA 2J9OA 4JXVA 1VM1A 2ZC5B 1HTZA 4K91A 3ZVWA 3BECA 2Q9MA 2R9WA 2Y2IA 1K55A 4BD1A 4H8RA 1DJAA 1CI9A 1SHVA 3PBRA 4OPQA 3ZG0A 3BM6A 1ONGA 5E2HA 2FFFB 3SH8A 2ZLYA 2XK1A 2OV5A 5KSHA 1KDSA 3VFHA 4OONA 3VMAA 1MKIA 1XXMA 1IEMA 1K57C 4Y0UA 1GHPA 1ZC2A 3IXBA 2ZC7A 3ITAA 1DJCA 3CZDA 3IQAA 1YMXA 1WYBA 1YM1A 5DF9A 1BULA 3BFFA 4U0XA 2EX6A 3Q82A 2ZC4B 2Y2GA 2J7VA 1BUEA 4RX3A 4DDSA 5EUAA 4OLDA 1ONHA 4NK3A 3M6HA 4PM8A 2ZC6B 4KZ4A 1H5XA 1MY8A 4WELA 4JF6A 2G2UA 4JXGA 1Z6FA 1GHMA 2HP6A 4LV3A 4Z9QA 4KENB 2H0TA 3S4XA 1DJBA 4QU3A 4JF5A 5L2FA 2HDQA 3CMZA 4EQIA 1ZKJA 5CHUA 5KMWA 3RXWA 1XA1A 4OLGA 4RYEA 1FQGA 1ZG6A 4PM6A 1Q2PA 4DXBA 1BLHA 5CRFA 1K56A 3O87A 4OKPA 1PI5A 3HUOA 4N1XA 3VP0A 4KG2A 3IF5A 2ZM2A 5GLCA 1YLZA 4E3MA 4E6XA 1KE0A 3AGDA 1GCEA 1MWTA 3SS3A 1KE4A 3E2LA 4L0LA 4N1HA 4GKUA 5GLDA 3LO7A 4OPZA 1FOFA 5D3OA 1I2SA 1CK3A 2CC1A 4ZJ2A 2XR0A 3ZG7B 3SH7A 4GZBA 5DTSA 3OPRA 4JF4A 1E25A 4B88A 4XUZA 4GN2A 4IVKA 5HL1A 1W79A 5A90A 2A49A 2EX8A 1K4EA 3HL9A 4R3JA 4E3JA 4Y0OA 4R3BA 5AQAA 4ZAMA 2IWBA 3MZFA 1PW8A 4FH4A 1NRFA 3N7WA 3MXRA 2XGNA 1RGYA 1NJ4A 3O86A 4LCMA 2ZMAA 4OP8A 1ES3A 3DTMA 1K25A 3G4PA 2X02A 1RP5A 1YLYA 3TG9A 3WS0A 3E2KA 5FATA 2PU4A 5DTTA 2BG1A 3EQUA 3VSKA 1NXYA 4Y0TA 5E2EA 4ZTKA 2ZD8A 3WS5A 2Y2QA 3BLSA 1SDNA 1IKGA 4GDBA 5CXWA 5EOEA 3WRZA 4OOYA 3IXGA 1I2WA 2DNSA 4KG6A 1CEGA 3IHBA 4QHCA 1N9BA 3FYZA 1CI8A 5GHXA 3VSLA 4X56A 5HFOA 5A91A 4QY5A 1OMEA 4M3KA 3S1YA 3SOIA 1W7FA 4R4RA 1EI5A 4ZBEA 2BLSA 5DF7A 5FQKA 1C3BA 5EPHA 1KVMA 4OPYA 3LY4A 4S2OA 3ZDJA 3IWOA 5FQ9A 1LI0A 3HLEA 4HESA 1L0EA 2Y2HA 3AGEA 4WM9A 1QMFA 4JXWA 3UPPA 1K56D 4IBRA 2ZM8A 1PZPA 1XP4A 2ZM0A 4CPKA 3HBRA 4R23A 4UAAA 5EVIB 5EVIA 2Y59A 4KZ8A 3HUMA 4PM9A 4IBXA 3C7UA 5FAQA 4B4XA 1MWRA 2HDRA 3B3XA 3G32A 1PYYA 4KZ9A 1AXBA 4K0XA 1BLPA 5FAPA 1IYPA 3WS2A 4BJPA 4BENA 3RXXA 4WZ5C 5FQMA 3MZDA 3BLMA 3C4OA 3CG5A 2DCFA 1LL9A 3VP2A 4U0TA 3ZNTA 4FD8A 2EFXA 5KSCA 4MLLA 3NBLA 2V2FF 2XFSA 3UO9A 1ES2A 5CTMA 5I94A 2QPNA 3PBNA 3NI9A 4QD4A 3W4PA 5F83A 3W4QA 4RA7A 3ZNYA 1ERQA 1ES4A 3UE3A 3OPLA 4P0MA 1FCNA 5TR7A 4E3OA 4PPRA 3HUNA 1YLPA 1BLSA 3A3DA 4DRTA 2J8YA 2PBYA 4LV0A 4LV1A 1BZAA 3N4IA 4KZBA 5FQJA 3QNCA 5KZHA 2WKIA 4WEJA 3WRTA 4PM5A 2HP5A 4DXCA 5EOOA 4YINA 2EX9A 3GTCA 1N4OA 3FZCA 4X6TA 4RX2A 5GLAA 3V39A 5EVLA 5FAOA 4XXRA 1KGGA 3PBOA 1IKIA 1Y54A 4KQOA 3GSGA 3WS4A 2HDUA 3MFDA 4C75A 1RCJA 2XFTA 2B5RA 4DDYA 1TDLA 4PM7A 3VOZA 1JTDA 1G6AA 1L2SA 1I5QA 4WBGA 2C5WB 4LENA 4EWFA 2WZZA 4LCLA 4PMAA 1NZOA 4B4ZA 1O7EA 5F1GA 1RGZA 2VGKA 3OPPA 1G68A 4C3QA 4S2JA 3UPNA 5A92A 3BYDA 5CGWA 3NC8A 5E2FA 3W4OA 4GNUA 3IT9A 4S2KA 1IELA 3I7JA 5J8XA 4OVDA 4KZ6A 5BOHA 1FR6A 3PBQA 5DTKA 2R9XA 3M2JA 3PAEA 2RCXA 4FCFA 2XQZA 3D4FA 3IF6B 2WGVA 3IF6A 5EVID 2ZJ9A 4WZ4A 1YT4A 4WYYA 2FFYA 4O7DA 2A3UA 1FR1A 3G2YA 1KDWA 4S2PA 1ESIA 1K55C 3G2ZA 1YLWA 3Q81A 4Y7PA 4C6YA 4EBNA 1M40A 5AQ9A 1L0DA 1PIOA 1TEMA 1U60A 5EE8A 3AGFA 4DF6A 4UA9A 3EQVA 4OP5A 3HLWA 3GVBA 1WE4A 1K57A 2VGJA 3HREA 1XPBA 4MNRA 4MBKA 4RVAA 4CJNA 4JPMA 1IYSA 1FSWA 2ZQDA 3A3FA 5DF8A 1QMEA 3MZEA 2HDSA 1ES5A 1PWDA 1PWGA 5GHYA 4NETA 2E8IA 1O07A 3TSGA 2OSUA 3Q07A 4EUZA 1KE3A 2EX2A 1J9MA 3A3EA 2Y2KA 4OQ0A 4X68A 3NDEA 3M6BA 5G18A 1Q2QA 3N8RA 5CGSA 1YLJA 5HAPA 2HPBA 2P9VA 2P9VB 4DE3A 3A3IA 3OC2A 2V20A 3G35A 3ZG9B 4ZJ1A 1KGFA 1EWZA 2Y2JA 4KZAA 4BL3A 4EBPA 1CEFA 2JBFA 3SS4A 1LLBA 2X01A 1PWCA 2XEPA 3HLBA 3N8SA 2Y55A 2PU2A 1WYCA 2QZ6A 1H8ZA 2X71A 4XUXA 2OLUA 2IWDA 4N9LA 4U3TA 4E3KA 5CTNA 4N9KA 1NYYA 3Q7ZA 4FSFA 3FWLA 5U47A 1K4FA 4Q8IA 1K6RA 1HD8A 2JC7A 4JXSA 3DWZA 4OOLA 4HEFA 3VP4A 2I72A 2XDMA 3IXHA 5CHMA 2DRWA 1SDEA 4QY6A 2WKEA 2JE5A 1JVJA 3G30A 5F82A 1BT5A 1YLTA 1L0GA 4JLFA 2ZQ7A 1W5DA 3O88A 4KG5A 2WADA 3VP1A 2XD1A 4GD6A 3HLGA 1JWVA 4BLMA 3DW0A 2WK0A 3OPHA 2RL3A 1XGIA 4WMCA 4DKIA 3N6IA 1KGEA 2WKHA 3O3VA 3V3SA 3V3RA 4GDNA 5TFQA 3ZG5A 5FASA 1SKFA 1HZOA 3HLDA 1IYQA 1JWPA 4X55A 1MBLA 5HW3A 3CJMA 2Y4AA 1K54A 4GOGA 3ZCZA 5FDHA 1XGJA 1PZOA 2ZQ9A 1DY6A 3UY6A 1E3UA 3MKEA 5FI6A 3UNWA 1MPLA 3ISGA 2HP9A 3MKFA 4S2MA 3NY4A 4S2NA 4FH2A 5F1FA 5CGXA 4IVIA 5FA7A 1S0WA 3GR2A 3UE0A 3TOIA 1K38A 5GL9A 5AQ7A 3BFEA 3DWKA 3C5AA 1NYMA 3WWXA 4UHUA 3ZVTA 3FKVA 4KZ3A 4D2OA 5EECA 3ITBA 4EBLA 3S22A 3Q1FA 2ZQ8A 3W8KA 3ZFZA 1GA0A 1JWZA 3BEBA 3BRMA 1XA7A 3IH9A 2EXAA 1ERMA 5M1AA 3OCLA 5FQIA 4S2IA 3QNBA 4R0QA 4DE0A 4E6WA 4DE2A 2WYXA 4EV4A 5GLBA 3PBSA 4WEKA 3V5MA 5JYPA 4R4SA 4GB7A 4BQMA 3OCNA 3GQZA 1ESUA 3GV9A 3PAGA 5JYOA 2EXBA 3V50A 1YQSA 5AQBA 4OQGA 3IXDA 3WS1A 4HBTA 3HVFA 4E3IA 4ZDXA 5HAIA 3PBTA 5CEDA 1EROA 4UA7A 2OLVA 3C4PA 5HARA 4X53A 2XD5A 2ZQCA 3BFGA 4N92A 5EVIC 3UDXA 1LHYA 1MWUA 2G2WA 3LCEA 3N8LA 3P98A 3ZGAB 4HBUA 1IYOA 3RJUA 1E4DA 4ZJ3A 5M19A 5A93A 3Q7VB 3Q7VA 3UN7A 1W8YA 3QHYA 4WZ5A 4A5RA 5M18A 2Y91A 2Q9NA 2Y2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XF3 A;  4P6B A;  2J9P A;  4QJG A;  4OPR A;  2UWX A;  2WZX A;  1LI9 A;  1M6K A;  3G31 A;  3OZH A;  3LY3 A;  3IWI A;  2V1Z A;  1TDG A;  2H5S A;  2Y2L A;  3BFD A;  4P87 A;  4P85 A;  4UA6 A;  5HX9 A;  1JTG A;  1FSY A;  1K6S A;  1BSG A;  3C7V A;  3M2K A;  4MEZ A;  4WMC D;  4ID4 A;  2Y2P A;  3IH8 A;  4X69 A;  5HAQ A;  1ALQ A;  1PI4 A;  5GHZ A;  2ZQA A;  3A3J A;  1GHI A;  1LL5 A;  3NDG A;  2QMI A;  5CEC A;  3SH9 A;  4KQQ A;  3VFF A;  1FCM A;  1K54 C;  4OH0 A;  4GD8 A;  4DE1 A;  2ZC3 B;  2XH9 A;  3GMW A;  3FKW A;  1E3U D;  2WGW B;  2WGW A;  2XLN A;  3LEZ A;  2WGI A;  1VQQ A;  3JYI A;  4OQH A;  2P74 A;  4LV2 A;  1TVF A;  2IWC A;  1GA9 A;  1SCW A;  4S2N C;  5E2G A;  2JCH A;  4S2L A;  2Y2M A;  4E3L A;  1YMS A;  1XKZ A;  2H10 A;  4BD0 A;  4QB8 A;  3BFC A;  4JBF A;  5E43 A;  2Y2O A;  2WUQ A;  4MBF A;  1H8Y A;  5CHJ A;  1NY0 A;  4R1G A;  4KZ5 A;  1NZU A;  3VP3 A;  3SS5 A;  2WAE A;  3MBZ A;  1MWS A;  2C6W B;  4JKT A;  4BL2 A;  5CER A;  3UDF A;  5TGF A;  2WAF A;  3G34 A;  4KQR A;  2H0Y A;  5FI2 A;  3NIA A;  4IED A;  3HLF A;  2Z2L B;  5IHV A;  4KZ7 A;  4OOM A;  3MXS A;  5CEB A;  1XX2 A;  5DVA A;  4K0W A;  3GRJ A;  5FI7 A;  5FQQ A;  3FV7 A;  1L0F A;  1BTL A;  4OQI A;  3UDI A;  4E3N A;  1HVB A;  3P09 A;  3PTE A;  1KVL A;  1W8Q A;  3HLC A;  3UE1 A;  3ZG8 B;  1PW1 A;  3ZHH A;  3VOY A;  3IWQ A;  1BLC A;  4MBH A;  5FSR A;  3NCK A;  4F94 A;  3IHA A;  4YFM A;  1ZG4 A;  1S6R A;  2Z2M B;  1MXO A;  2GDN A;  2EFU A;  1FCO A;  3IF6 C;  3UPO A;  2J9O A;  4JXV A;  1VM1 A;  2ZC5 B;  1HTZ A;  4K91 A;  3ZVW A;  3BEC A;  2Q9M A;  2R9W A;  2Y2I A;  1K55 A;  4BD1 A;  4H8R A;  1DJA A;  1CI9 A;  1SHV A;  3PBR A;  4OPQ A;  3ZG0 A;  3BM6 A;  1ONG A;  5E2H A;  2FFF B;  3SH8 A;  2ZLY A;  2XK1 A;  2OV5 A;  5KSH A;  1KDS A;  3VFH A;  4OON A;  3VMA A;  1MKI A;  1XXM A;  1IEM A;  1K57 C;  4Y0U A;  1GHP A;  1ZC2 A;  3IXB A;  2ZC7 A;  3ITA A;  1DJC A;  3CZD A;  3IQA A;  1YMX A;  1WYB A;  1YM1 A;  5DF9 A;  1BUL A;  3BFF A;  4U0X A;  2EX6 A;  3Q82 A;  2ZC4 B;  2Y2G A;  2J7V A;  1BUE A;  4RX3 A;  4DDS A;  5EUA A;  4OLD A;  1ONH A;  4NK3 A;  3M6H A;  4PM8 A;  2ZC6 B;  4KZ4 A;  1H5X A;  1MY8 A;  4WEL A;  4JF6 A;  2G2U A;  4JXG A;  1Z6F A;  1GHM A;  2HP6 A;  4LV3 A;  4Z9Q A;  4KEN B;  2H0T A;  3S4X A;  1DJB A;  4QU3 A;  4JF5 A;  5L2F A;  2HDQ A;  3CMZ A;  4EQI A;  1ZKJ A;  5CHU A;  5KMW A;  3RXW A;  1XA1 A;  4OLG A;  4RYE A;  1FQG A;  1ZG6 A;  4PM6 A;  1Q2P A;  4DXB A;  1BLH A;  5CRF A;  1K56 A;  3O87 A;  4OKP A;  1PI5 A;  3HUO A;  4N1X A;  3VP0 A;  4KG2 A;  3IF5 A;  2ZM2 A;  5GLC A;  1YLZ A;  4E3M A;  4E6X A;  1KE0 A;  3AGD A;  1GCE A;  1MWT A;  3SS3 A;  1KE4 A;  3E2L A;  4L0L A;  4N1H A;  4GKU A;  5GLD A;  3LO7 A;  4OPZ A;  1FOF A;  5D3O A;  1I2S A;  1CK3 A;  2CC1 A;  4ZJ2 A;  2XR0 A;  3ZG7 B;  3SH7 A;  4GZB A;  5DTS A;  3OPR A;  4JF4 A;  1E25 A;  4B88 A;  4XUZ A;  4GN2 A;  4IVK A;  5HL1 A;  1W79 A;  5A90 A;  2A49 A;  2EX8 A;  1K4E A;  3HL9 A;  4R3J A;  4E3J A;  4Y0O A;  4R3B A;  5AQA A;  4ZAM A;  2IWB A;  3MZF A;  1PW8 A;  4FH4 A;  1NRF A;  3N7W A;  3MXR A;  2XGN A;  1RGY A;  1NJ4 A;  3O86 A;  4LCM A;  2ZMA A;  4OP8 A;  1ES3 A;  3DTM A;  1K25 A;  3G4P A;  2X02 A;  1RP5 A;  1YLY A;  3TG9 A;  3WS0 A;  3E2K A;  5FAT A;  2PU4 A;  5DTT A;  2BG1 A;  3EQU A;  3VSK A;  1NXY A;  4Y0T A;  5E2E A;  4ZTK A;  2ZD8 A;  3WS5 A;  2Y2Q A;  3BLS A;  1SDN A;  1IKG A;  4GDB A;  5CXW A;  5EOE A;  3WRZ A;  4OOY A;  3IXG A;  1I2W A;  2DNS A;  4KG6 A;  1CEG A;  3IHB A;  4QHC A;  1N9B A;  3FYZ A;  1CI8 A;  5GHX A;  3VSL A;  4X56 A;  5HFO A;  5A91 A;  4QY5 A;  1OME A;  4M3K A;  3S1Y A;  3SOI A;  1W7F A;  4R4R A;  1EI5 A;  4ZBE A;  2BLS A;  5DF7 A;  5FQK A;  1C3B A;  5EPH A;  1KVM A;  4OPY A;  3LY4 A;  4S2O A;  3ZDJ A;  3IWO A;  5FQ9 A;  1LI0 A;  3HLE A;  4HES A;  1L0E A;  2Y2H A;  3AGE A;  4WM9 A;  1QMF A;  4JXW A;  3UPP A;  1K56 D;  4IBR A;  2ZM8 A;  1PZP A;  1XP4 A;  2ZM0 A;  4CPK A;  3HBR A;  4R23 A;  4UAA A;  5EVI B;  5EVI A;  2Y59 A;  4KZ8 A;  3HUM A;  4PM9 A;  4IBX A;  3C7U A;  5FAQ A;  4B4X A;  1MWR A;  2HDR A;  3B3X A;  3G32 A;  1PYY A;  4KZ9 A;  1AXB A;  4K0X A;  1BLP A;  5FAP A;  1IYP A;  3WS2 A;  4BJP A;  4BEN A;  3RXX A;  4WZ5 C;  5FQM A;  3MZD A;  3BLM A;  3C4O A;  3CG5 A;  2DCF A;  1LL9 A;  3VP2 A;  4U0T A;  3ZNT A;  4FD8 A;  2EFX A;  5KSC A;  4MLL A;  3NBL A;  2V2F F;  2XFS A;  3UO9 A;  1ES2 A;  5CTM A;  5I94 A;  2QPN A;  3PBN A;  3NI9 A;  4QD4 A;  3W4P A;  5F83 A;  3W4Q A;  4RA7 A;  3ZNY A;  1ERQ A;  1ES4 A;  3UE3 A;  3OPL A;  4P0M A;  1FCN A;  5TR7 A;  4E3O A;  4PPR A;  3HUN A;  1YLP A;  1BLS A;  3A3D A;  4DRT A;  2J8Y A;  2PBY A;  4LV0 A;  4LV1 A;  1BZA A;  3N4I A;  4KZB A;  5FQJ A;  3QNC A;  5KZH A;  2WKI A;  4WEJ A;  3WRT A;  4PM5 A;  2HP5 A;  4DXC A;  5EOO A;  4YIN A;  2EX9 A;  3GTC A;  1N4O A;  3FZC A;  4X6T A;  4RX2 A;  5GLA A;  3V39 A;  5EVL A;  5FAO A;  4XXR A;  1KGG A;  3PBO A;  1IKI A;  1Y54 A;  4KQO A;  3GSG A;  3WS4 A;  2HDU A;  3MFD A;  4C75 A;  1RCJ A;  2XFT A;  2B5R A;  4DDY A;  1TDL A;  4PM7 A;  3VOZ A;  1JTD A;  1G6A A;  1L2S A;  1I5Q A;  4WBG A;  2C5W B;  4LEN A;  4EWF A;  2WZZ A;  4LCL A;  4PMA A;  1NZO A;  4B4Z A;  1O7E A;  5F1G A;  1RGZ A;  2VGK A;  3OPP A;  1G68 A;  4C3Q A;  4S2J A;  3UPN A;  5A92 A;  3BYD A;  5CGW A;  3NC8 A;  5E2F A;  3W4O A;  4GNU A;  3IT9 A;  4S2K A;  1IEL A;  3I7J A;  5J8X A;  4OVD A;  4KZ6 A;  5BOH A;  1FR6 A;  3PBQ A;  5DTK A;  2R9X A;  3M2J A;  3PAE A;  2RCX A;  4FCF A;  2XQZ A;  3D4F A;  3IF6 B;  2WGV A;  3IF6 A;  5EVI D;  2ZJ9 A;  4WZ4 A;  1YT4 A;  4WYY A;  2FFY A;  4O7D A;  2A3U A;  1FR1 A;  3G2Y A;  1KDW A;  4S2P A;  1ESI A;  1K55 C;  3G2Z A;  1YLW A;  3Q81 A;  4Y7P A;  4C6Y A;  4EBN A;  1M40 A;  5AQ9 A;  1L0D A;  1PIO A;  1TEM A;  1U60 A;  5EE8 A;  3AGF A;  4DF6 A;  4UA9 A;  3EQV A;  4OP5 A;  3HLW A;  3GVB A;  1WE4 A;  1K57 A;  2VGJ A;  3HRE A;  1XPB A;  4MNR A;  4MBK A;  4RVA A;  4CJN A;  4JPM A;  1IYS A;  1FSW A;  2ZQD A;  3A3F A;  5DF8 A;  1QME A;  3MZE A;  2HDS A;  1ES5 A;  1PWD A;  1PWG A;  5GHY A;  4NET A;  2E8I A;  1O07 A;  3TSG A;  2OSU A;  3Q07 A;  4EUZ A;  1KE3 A;  2EX2 A;  1J9M A;  3A3E A;  2Y2K A;  4OQ0 A;  4X68 A;  3NDE A;  3M6B A;  5G18 A;  1Q2Q A;  3N8R A;  5CGS A;  1YLJ A;  5HAP A;  2HPB A;  2P9V A;  2P9V B;  4DE3 A;  3A3I A;  3OC2 A;  2V20 A;  3G35 A;  3ZG9 B;  4ZJ1 A;  1KGF A;  1EWZ A;  2Y2J A;  4KZA A;  4BL3 A;  4EBP A;  1CEF A;  2JBF A;  3SS4 A;  1LLB A;  2X01 A;  1PWC A;  2XEP A;  3HLB A;  3N8S A;  2Y55 A;  2PU2 A;  1WYC A;  2QZ6 A;  1H8Z A;  2X71 A;  4XUX A;  2OLU A;  2IWD A;  4N9L A;  4U3T A;  4E3K A;  5CTN A;  4N9K A;  1NYY A;  3Q7Z A;  4FSF A;  3FWL A;  5U47 A;  1K4F A;  4Q8I A;  1K6R A;  1HD8 A;  2JC7 A;  4JXS A;  3DWZ A;  4OOL A;  4HEF A;  3VP4 A;  2I72 A;  2XDM A;  3IXH A;  5CHM A;  2DRW A;  1SDE A;  4QY6 A;  2WKE A;  2JE5 A;  1JVJ A;  3G30 A;  5F82 A;  1BT5 A;  1YLT A;  1L0G A;  4JLF A;  2ZQ7 A;  1W5D A;  3O88 A;  4KG5 A;  2WAD A;  3VP1 A;  2XD1 A;  4GD6 A;  3HLG A;  1JWV A;  4BLM A;  3DW0 A;  2WK0 A;  3OPH A;  2RL3 A;  1XGI A;  4WMC A;  4DKI A;  3N6I A;  1KGE A;  2WKH A;  3O3V A;  3V3S A;  3V3R A;  4GDN A;  5TFQ A;  3ZG5 A;  5FAS A;  1SKF A;  1HZO A;  3HLD A;  1IYQ A;  1JWP A;  4X55 A;  1MBL A;  5HW3 A;  3CJM A;  2Y4A A;  1K54 A;  4GOG A;  3ZCZ A;  5FDH A;  1XGJ A;  1PZO A;  2ZQ9 A;  1DY6 A;  3UY6 A;  1E3U A;  3MKE A;  5FI6 A;  3UNW A;  1MPL A;  3ISG A;  2HP9 A;  3MKF A;  4S2M A;  3NY4 A;  4S2N A;  4FH2 A;  5F1F A;  5CGX A;  4IVI A;  5FA7 A;  1S0W A;  3GR2 A;  3UE0 A;  3TOI A;  1K38 A;  5GL9 A;  5AQ7 A;  3BFE A;  3DWK A;  3C5A A;  1NYM A;  3WWX A;  4UHU A;  3ZVT A;  3FKV A;  4KZ3 A;  4D2O A;  5EEC A;  3ITB A;  4EBL A;  3S22 A;  3Q1F A;  2ZQ8 A;  3W8K A;  3ZFZ A;  1GA0 A;  1JWZ A;  3BEB A;  3BRM A;  1XA7 A;  3IH9 A;  2EXA A;  1ERM A;  5M1A A;  3OCL A;  5FQI A;  4S2I A;  3QNB A;  4R0Q A;  4DE0 A;  4E6W A;  4DE2 A;  2WYX A;  4EV4 A;  5GLB A;  3PBS A;  4WEK A;  3V5M A;  5JYP A;  4R4S A;  4GB7 A;  4BQM A;  3OCN A;  3GQZ A;  1ESU A;  3GV9 A;  3PAG A;  5JYO A;  2EXB A;  3V50 A;  1YQS A;  5AQB A;  4OQG A;  3IXD A;  3WS1 A;  4HBT A;  3HVF A;  4E3I A;  4ZDX A;  5HAI A;  3PBT A;  5CED A;  1ERO A;  4UA7 A;  2OLV A;  3C4P A;  5HAR A;  4X53 A;  2XD5 A;  2ZQC A;  3BFG A;  4N92 A;  5EVI C;  3UDX A;  1LHY A;  1MWU A;  2G2W A;  3LCE A;  3N8L A;  3P98 A;  3ZGA B;  4HBU A;  1IYO A;  3RJU A;  1E4D A;  4ZJ3 A;  5M19 A;  5A93 A;  3Q7V B;  3Q7V A;  3UN7 A;  1W8Y A;  3QHY A;  4WZ5 A;  4A5R A;  5M18 A;  2Y91 A;  2Q9N A;  2Y2N A; 
#chains in the Genus database with same CATH topology
 4P6B A;  2J9P A;  4OPR A;  1M6K A;  3G31 A;  3A0S A;  3LY3 A;  3IWI A;  5C5K A;  1TDG A;  2H5S A;  4UA6 A;  2PRF A;  1K6S A;  2Y2P A;  1ALQ A;  1PI4 A;  3H7W A;  3H7W B;  1NLY A;  2QMI A;  5CEC A;  3SH9 A;  2GZA A;  3VFF A;  1FCM A;  3MF0 A;  2ZC3 B;  4WF0 A;  1VQQ A;  3JYI A;  1DRM A;  5J3W A;  3KO6 A;  3L7H A;  2GJ3 A;  1NRJ A;  4E3L A;  4BD0 A;  1S1Z A;  4MBF A;  1H8Y A;  1NY0 A;  2ZL1 A;  2ZL1 B;  1NZU A;  3SS5 A;  1MWS A;  4BL2 A;  4ETZ A;  3UDF A;  3G34 A;  2H0Y A;  3NOP C;  5FI2 A;  3HLF A;  3MXS A;  5CEB A;  1XX2 A;  4K0W A;  3GRJ A;  2JKR I;  5AVF A;  3ICY A;  3P09 A;  4WUJ A;  3HLC A;  1PW1 A;  4JGR A;  3IWQ A;  3BQA A;  4MBH A;  2J3T D;  3LIC A;  1FCO A;  2J9O A;  2W27 A;  2ZC5 B;  4IUH A;  2R9W A;  3QP6 A;  1DJA A;  2J80 A;  4P6Z S;  3PBR A;  2B02 A;  1ONG A;  2B95 A;  3MQO A;  2D01 A;  3LUQ A;  2ZC7 A;  1DJC A;  3CZD A;  1YMX A;  1WYB A;  3UB5 P;  3DTI A;  3Q82 A;  4RX3 A;  2J7V A;  1J3W A;  1PNE A;  4OLD A;  4NK3 A;  1H5X A;  1F2K A;  4JF6 A;  1Z6F A;  1GHM A;  1KOU A;  1DJB A;  4EQI A;  3SW1 A;  1TS8 A;  5CHU A;  5KMW A;  4PM6 A;  1ZG6 A;  1BLH A;  4CQH A;  4MMN A;  4OKP A;  3NEC A;  2ZM2 A;  3T4O A;  3SS3 A;  4DJ2 A;  1S67 L;  3E2L A;  1VB6 A;  3T4K A;  2CC1 A;  4NXE A;  4EXO A;  4EET B;  4XUZ A;  1W79 A;  4Q0H A;  4E3J A;  3JVV A;  4ZAM A;  2IWB A;  3S7Q A;  1LSX A;  1RGY A;  2VKS A;  5I5L A;  4OP8 A;  2X02 A;  1RP5 A;  3E2K A;  5FAT A;  2VX8 A;  2PU4 A;  1D1J A;  3EQU A;  3VSK A;  2ZD8 A;  5EOE A;  3WRZ A;  3MS6 A;  3HJK A;  4I5S A;  2DNS A;  1MC0 A;  3IHB A;  4QHC A;  3LI9 A;  3OLO A;  1CI8 A;  3E4Q A;  3VSL A;  4X56 A;  5HFO A;  5A91 A;  4QY5 A;  3K3C A;  3SOI A;  5EV0 A;  5EPH A;  4OPY A;  2XA7 S;  3NUL A;  4YNR A;  2W1T B;  2W1T A;  3IWO A;  3ZDJ A;  2Y2H A;  4R23 A;  5EVI B;  4UAA A;  5EVI A;  3MQQ A;  5F6A A;  2HDR A;  1PYY A;  2WKQ A;  3HJI A;  2W3F A;  4EU0 A;  1T19 A;  4PHT A;  1OPX A;  3OOV A;  3C4O A;  2JKG A;  3CG5 A;  2EFX A;  2XFS A;  3KSF A;  1ES2 A;  3A0R A;  2WKP A;  3W4Q A;  4P0M A;  5TR7 A;  3MJQ A;  4PPR A;  2J8Y A;  4KZB A;  4WEJ A;  3WRT A;  2EX9 A;  3FZC A;  3V39 A;  4WLA A;  3MXQ A;  1OTB A;  4LRX C;  1Y54 A;  3MFD A;  4C75 A;  4PM7 A;  3VOZ A;  1JTD A;  4WBG A;  1NZO A;  1O7E A;  3OPP A;  2VGK A;  2O9A A;  3F1N A;  3F1N B;  3CWF A;  1IEL A;  5J8X A;  3EOI A;  4KZ6 A;  2R9X A;  3M2J A;  1NWZ A;  2XQZ A;  3ZYT A;  1YT4 A;  4NXG A;  2FFY A;  4GS9 B;  4GS9 A;  3UB7 A;  2W3H A;  1K55 C;  4EBN A;  5AQ9 A;  1U60 A;  4EER A;  3EQV A;  3HLW A;  4NG2 A;  1WE4 A;  3HRE A;  4MN6 A;  4MNR A;  2ZQD A;  3A3F A;  3LR4 A;  4NET A;  2E8I A;  1O07 A;  4EUZ A;  3DTK A;  2EX2 A;  1J9M A;  3A3E A;  3N8R A;  4D60 A;  5IT5 A;  3FC7 A;  3RTY A;  3A3I A;  1NLZ A;  3TRC A;  3ZG9 B;  3IBR A;  2VGL S;  4BL3 A;  4KZA A;  2JBF A;  2X01 A;  2L1M A;  4HNB A;  2Y55 A;  2PU2 A;  2IWD A;  4RQ9 A;  5F69 A;  2VZW A;  1GSV A;  1NYY A;  4NEE D;  2W3D A;  4EW7 A;  2QYB A;  2I72 A;  2DRW A;  4QY6 A;  2WKE A;  5FDS A;  2ZQ7 A;  3O88 A;  4KG5 A;  4LGW A;  1XJ3 A;  1JWV A;  2RL3 A;  5DJU A;  1KGE A;  1IYQ A;  1JWP A;  1K54 A;  3ZCZ A;  5FDH A;  3PHY A;  2QHK A;  5FI6 A;  3UNW A;  3EWK A;  4GHI B;  4GHI A;  5F1F A;  4FH2 A;  5CGX A;  1G6O A;  4JGQ A;  3CUE C;  1PRQ A;  4LRZ E;  3PYP A;  2NUP C;  1JWZ A;  1XA7 A;  3IH9 A;  4B93 A;  2JHE A;  2QWS A;  3QP5 A;  5FQI A;  4E6W A;  1P0Z A;  2B18 A;  3MR0 A;  5HDS A;  3PBS A;  3GV9 A;  4QWO A;  2ZMF A;  1AWI A;  3IXD A;  3PBT A;  5CED A;  1ERO A;  4UA7 A;  3C4P A;  4X53 A;  3CIT A;  2XD5 A;  3BFG A;  1OT6 A;  1LHY A;  3FPV A;  2P08 A;  3LCE A;  2H28 A;  5M19 A;  3UN7 A;  1K0K A;  2VK3 A;  3LYX A;  4HP9 A;  2XF3 A;  4QJG A;  3OZH A;  3JVU A;  3BFD A;  5HX9 A;  4P85 A;  4P87 A;  2HF6 A;  1FSY A;  1BSG A;  5HAQ A;  2ZQA A;  3A3J A;  4DE1 A;  3FKW A;  1E3U D;  4OQH A;  5IU1 A;  2WGI A;  3MMH A;  5E2G A;  2JCH A;  2J3W A;  2Y2M A;  2FH5 A;  3IX3 A;  3BFC A;  2Y2O A;  3OBF A;  2HGV A;  2WUQ A;  4HOI A;  4R1G A;  4KZ5 A;  4EUV A;  1SKO A;  1SKO B;  2OAP 1;  2ZBB A;  5CER A;  1UWN X;  1UGU A;  2Z2L B;  5FQQ A;  1BTL A;  1HVB A;  3PTE A;  3ZHH A;  4PKY G;  1XFN A;  3NCK A;  4F94 A;  4KUO A;  4YFM A;  1S6R A;  5FEG A;  2GDN A;  2EFU A;  1TD5 A;  3C30 A;  1TF1 A;  3BEC A;  4I3I A;  4BD1 A;  1CI9 A;  4DN0 A;  3BM6 A;  3LIB A;  5KIZ A;  5AVE A;  2PR5 A;  2OV5 A;  1XXM A;  4EEP A;  1GHP A;  2EX6 A;  2ZMV A;  2ZC4 B;  1BUE A;  4DDS A;  4PM8 A;  4WEL A;  2YKH A;  4JXG A;  2HP6 A;  1BYW A;  4QU3 A;  4JF5 A;  3CMZ A;  3DAV A;  4R70 A;  5HZH A;  3VP0 A;  4LFU A;  3JPU A;  4N1H A;  4GKU A;  1ACF A;  3KSG A;  1FOF A;  4ZJ2 A;  2O99 A;  2G7U A;  1YAX A;  3TE8 A;  1E25 A;  2MJ6 A;  5HL1 A;  5A90 A;  2EX8 A;  1K4E A;  3T50 A;  2CMN A;  4Y0O A;  4HJ6 A;  4DJ3 A;  4FH4 A;  1NRF A;  3KSH A;  1NJ4 A;  2OAQ 1;  1K25 A;  3G4P A;  1YLY A;  2ZOI A;  2NUT C;  1NXY A;  4Y0T A;  3WS5 A;  1SDN A;  1IKG A;  4GDB A;  5CXW A;  1T1B A;  1I2W A;  3T4T A;  4KG6 A;  5GHX A;  5HPF A;  3RH8 B;  5FQK A;  3LY4 A;  2DMW A;  2O9C A;  1G28 A;  4WM9 A;  1QMF A;  4JXW A;  1K56 D;  4IBR A;  3LID A;  3T4L A;  1XP4 A;  1Y28 A;  2Y59 A;  3HUM A;  4B4X A;  3K2N A;  3B3X A;  2Z6C A;  3G32 A;  1AXB A;  3IBJ A;  2PYR A;  2V1A A;  1GSX A;  1BLP A;  5FAP A;  1IYP A;  5HDD A;  3NOT C;  1YSP A;  2GNX A;  3BLM A;  3NBL A;  3DBA A;  1EW0 A;  3FG8 A;  5CTM A;  3UO9 A;  3W4P A;  3NI9 A;  3ZNY A;  3OPL A;  4GCZ A;  4F3L B;  4F3L A;  1PFL A;  2PDR A;  1VHM A;  4CLC E;  3NHQ A;  1YLP A;  3A3D A;  2PBY A;  4LV1 A;  3N4I A;  2W3E A;  4YIN A;  4X6T A;  4JGP A;  5GLA A;  5FAO A;  3P7N A;  3A0V A;  2JN7 A;  1KGG A;  1IKI A;  2LB9 A;  1TDL A;  4KQD A;  1G6A A;  1I5Q A;  4LCL A;  2HJE A;  4PMA A;  4B4Z A;  5F1G A;  1RGZ A;  2PHY A;  1G68 A;  4O8G A;  5HD3 A;  5A92 A;  3NC8 A;  5E2F A;  3W4O A;  4GNU A;  2V0W A;  1S4S A;  3R4K A;  2RCX A;  4FCF A;  2KX6 A;  2ZJ9 A;  4O7D A;  2A3U A;  4PAU A;  3Q81 A;  4NXB A;  4Y7P A;  4C6Y A;  3P01 A;  1L0D A;  1TEM A;  2PT7 A;  2V9A A;  5EE8 A;  3AGF A;  4DF6 A;  3C8C A;  2GX5 A;  2V1B A;  4OP5 A;  3T1R A;  5FEF A;  4AFI A;  2VGJ A;  3H82 B;  1XPB A;  3H82 A;  4MBK A;  4CJN A;  4JPM A;  1IYS A;  3GEC A;  3MZE A;  2PD8 A;  4II7 A;  3T12 B;  3LR5 A;  5DFX A;  3KX0 X;  2K2N A;  1HLU P;  4WL9 A;  5CGS A;  5HAP A;  2P9V A;  2P9V B;  2R78 A;  3OC2 A;  2V20 A;  3G35 A;  3VV4 A;  3F1O B;  3F1O A;  3SS4 A;  1LLB A;  3HLB A;  1WYC A;  1LSW A;  1H8Z A;  2OLU A;  2L0W A;  3O5Y A;  4N9L A;  3Q7Z A;  4FSF A;  4JXS A;  3DWZ A;  2V8C A;  4HEF A;  4OOL A;  3CAX A;  3VP4 A;  5F82 A;  1L0G A;  4JLF A;  4HIA A;  3LIA A;  2WAD A;  2UV0 E;  3CI6 A;  2XD1 A;  3DW0 A;  1XGI A;  2A2L A;  2WKH A;  3ZG5 A;  2K7S A;  3HLD A;  4H6J A;  4H6J B;  4M4X A;  2QJ7 A;  1DP8 A;  2ZQ9 A;  3UY6 A;  3GDI A;  2Q0O A;  3E4O A;  4MDZ A;  4S2M A;  4S2N A;  3GR2 A;  3LR0 A;  3TOI A;  1K38 A;  5GL9 A;  1NYM A;  4HJ3 A;  5DJT A;  4UHU A;  3UMD A;  2O0Y A;  3FKV A;  4KZ3 A;  3ITB A;  2ZQ8 A;  4Q0I A;  2KDK A;  3BEB A;  1YPR A;  4DE0 A;  4DE2 A;  4GJ4 A;  3CLO A;  2WYX A;  4IUK A;  3V5M A;  4GB7 A;  3PAG A;  5HDC A;  2EXB A;  5JYO A;  5AQB A;  4OQG A;  2JKT I;  3QP1 A;  4ZDX A;  5HAI A;  3RFB A;  4YWZ A;  2OLV A;  4YOF A;  1MKM A;  2ZQC A;  2PBD P;  1CQA A;  1MWU A;  3K3D A;  3VOL A;  3ZGA B;  1XFQ A;  3RJU A;  5A93 A;  4Z1W A;  3Q7V B;  3Q7V A;  2V0U A;  4A5R A;  2Q9N A;  2Y2N A;  2EWV A;  2OWJ A;  2WZX A;  4G3K A;  2IA2 A;  5HWT A;  2Y2L A;  1WA9 A;  3CHW P;  1W63 Q;  4UQI S;  3C7V A;  4X25 A;  4WMC D;  4ID4 A;  3IH8 A;  4X69 A;  5GHZ A;  1GHI A;  1LL5 A;  3NDG A;  4KQQ A;  4OH0 A;  1K54 C;  3G6O A;  2XH9 A;  3D3O A;  2WGW B;  2WGW A;  2XLN A;  2XSS A;  4O01 A;  2P74 A;  4LV2 A;  3UE6 A;  2IWC A;  2KOI A;  1GA9 A;  4S2L A;  4HP4 A;  4I39 A;  1YMS A;  2HZ5 A;  2H10 A;  4QB8 A;  5E43 A;  4HI4 A;  5CHJ A;  5A8B A;  3VP3 A;  3MBZ A;  2C6W B;  4KQR A;  3NIA A;  4IED A;  4CLC C;  3BY8 A;  4KZ7 A;  4OOM A;  3SZT A;  5DVA A;  4UQI M;  1IOU A;  3FV7 A;  5HPI A;  1L0F A;  2AVX A;  3UDI A;  3UE1 A;  3ZG8 B;  2L4R A;  3IHA A;  1ZG4 A;  1MXO A;  5HL6 A;  1ODV A;  3UPO A;  5LBR A;  3IF6 C;  1VM1 A;  2Y8H A;  2Y2I A;  1K55 A;  4H8R A;  4OPQ A;  1H8M A;  5E2H A;  2FFF B;  3SH8 A;  1XJ2 A;  2ZLY A;  2XK1 A;  1VEU B;  1VEU A;  5KSH A;  1LL8 A;  3VFH A;  2VA0 A;  4I38 A;  4OON A;  1MKI A;  1IEM A;  3CPT A;  3CPT B;  1K57 C;  4Y0U A;  1ZC2 A;  3IXB A;  4FUW A;  5DKK A;  3IQA A;  1YM1 A;  5DF9 A;  1BUL A;  4U0X A;  2Y2G A;  5EUA A;  1ONH A;  3E4P A;  4KZ4 A;  2E8J A;  4KEN B;  1H3Q A;  2H0T A;  2JKR M;  3LIE A;  5L2F A;  2JKF A;  1ZKJ A;  4G3V A;  3RXW A;  1XA1 A;  1OTD A;  4Y13 A;  4OLG A;  4RYE A;  4DXB A;  1OJG A;  1F9I A;  5CRF A;  3O87 A;  4Y3I A;  3LFV A;  1YLZ A;  4E6X A;  1KE0 A;  3AGD A;  2PR6 A;  4NXF A;  4L0L A;  3LO7 A;  4OPZ A;  5D3O A;  1I2S A;  3SH7 A;  5HWV A;  4GZB A;  3OPR A;  4B88 A;  1XJ4 A;  4IVK A;  4Y2F A;  3HL9 A;  4PKY A;  1STZ A;  4R3J A;  5TJJ A;  3MZF A;  3KYQ A;  3N7W A;  2W3G A;  4UEY A;  2M7V A;  1V9Z A;  5MC7 A;  5DTT A;  2BG1 A;  5E2E A;  3CUE A;  1P9R A;  2Y2Q A;  3B42 A;  3IXG A;  1CEG A;  1N9B A;  2KLI A;  5DKL A;  3FYZ A;  1OME A;  4M3K A;  1EI5 A;  2BLS A;  5DF7 A;  1C3B A;  3LEQ A;  4HH3 A;  1KVM A;  1YKD A;  1LI0 A;  3HLE A;  3AGE A;  2XRO A;  4MN5 A;  3MQ0 A;  2ZM0 A;  1GSW A;  4CPK A;  3HBR A;  3EEA A;  1OTE A;  4K08 A;  4KZ8 A;  4LRY C;  1TS0 A;  3S7N A;  1L3L A;  5J4E A;  4KZ9 A;  4K0X A;  3PR6 A;  4I3J A;  4WZ5 C;  3EGX C;  4HH2 A;  2DCF A;  1W63 M;  4U0T A;  1DP9 A;  4FD8 A;  5KSC A;  4MLL A;  5F68 A;  3PBN A;  5F83 A;  3TW8 A;  4RA7 A;  1ERQ A;  3UE3 A;  1N9L A;  3R7W B;  3R7W A;  3T1Q B;  3T4J A;  1BZA A;  5KZH A;  2PD7 A;  5FQJ A;  4Y15 A;  2I9V A;  2WKI A;  4DXC A;  4RX2 A;  3PBO A;  4R38 A;  3UB6 A;  4KQO A;  3WS4 A;  2HDU A;  2XFT A;  2INW A;  4DDY A;  4EWF A;  1A0K A;  3LI8 A;  4S2J A;  4EEU A;  3UPN A;  5CGW A;  4S2K A;  4OVD A;  3PBQ A;  2V8F A;  5TBM B;  5TBM A;  2WGV A;  5EVI D;  4WZ4 A;  3G2Y A;  1KDW A;  3G2Z A;  1CF0 A;  1YLW A;  1M40 A;  1P97 A;  1IFQ A;  1QME A;  2HDS A;  1ES5 A;  5GHY A;  4R3A A;  4GW9 A;  1S66 L;  3MFX A;  2Y2K A;  1FIK A;  3M6B A;  1Q2Q A;  2HPB A;  2QJ5 A;  4DMZ A;  4I3A A;  1KGF A;  1EWZ A;  1DP6 A;  1CEF A;  2JKT M;  3VE3 A;  2O9B A;  4XUX A;  4U3T A;  3FWL A;  5U47 A;  4X1L A;  2XDM A;  3IXH A;  5CHM A;  1SDE A;  2OOL A;  1YLT A;  1W5D A;  1H0M A;  3VP1 A;  3BW6 A;  4GD6 A;  2WK0 A;  3IS2 A;  3D72 A;  3IS2 B;  2VV7 A;  3MSH A;  1P9W A;  3O3V A;  4GDN A;  1HZO A;  2M7U A;  4X55 A;  1MBL A;  3CJM A;  2Y4A A;  3C38 A;  1XGJ A;  4HHD A;  4L9E A;  1E3U A;  3LGO A;  4HY8 A;  2EA9 A;  3PXP A;  3MKF A;  3NY4 A;  3NJA A;  2W1R A;  4IVI A;  5FA7 A;  1S0W A;  3UE0 A;  3VE4 A;  1MZU A;  4BMW A;  3DWK A;  3WWX A;  3ZVT A;  3Q1F A;  3W8K A;  3ZFZ A;  2K31 A;  4X1M A;  1T18 A;  1ERM A;  1LT0 A;  2XRN A;  1UWP X;  4R0Q A;  5GLB A;  4P6Z M;  5EVE A;  4WEK A;  1N9N A;  5JYP A;  4R4S A;  2EWW A;  4BQM A;  1ESU A;  1YQS A;  3WS1 A;  1T1C A;  3HVF A;  4E3I A;  4FOF A;  1TS7 A;  5EVI C;  4BBU A;  5L8M A;  3N8L A;  4HBU A;  1IYO A;  5J7E A;  1E4D A;  4ZJ3 A;  3IX8 A;  1W8Y A;  3V67 A;  2Y91 A;  4QPR A;  2ZOH A;  2UWX A;  1LI9 A;  4KUK A;  2V1Z A;  1JTG A;  2VLG A;  3M2K A;  2PAV P;  4MEZ A;  1SZV A;  4GD8 A;  3GMW A;  3LIF A;  3UB9 A;  3LEZ A;  3UME A;  1X0O A;  1TVF A;  4EQ1 A;  1SCW A;  4S2N C;  4R6L A;  1XKZ A;  2FZ0 A;  4JBF A;  1OTA A;  2WAE A;  4JKT A;  5TGF A;  2WAF A;  1OTI A;  4CLC D;  2ACG A;  5IHV A;  5FI7 A;  1G5U A;  1T1A A;  4OQI A;  4E3N A;  5F5Y A;  1KVL A;  1W8Q A;  3VOY A;  1BLC A;  5FSR A;  2J3T C;  2Z2M B;  4JXV A;  4K91 A;  3ZVW A;  1HTZ A;  2Q9M A;  1TS6 A;  1SHV A;  2YKF A;  3ZG0 A;  4ETX A;  4G3W A;  5K5B A;  1KDS A;  4GLQ A;  3VMA A;  3LR3 A;  3ITA A;  5EM1 A;  3BFF A;  2XA7 M;  3M6H A;  2ZC6 B;  1MY8 A;  2G2U A;  1N9O A;  4LV3 A;  4Z9Q A;  2A24 A;  2A24 B;  3S4X A;  1LSV A;  2HDQ A;  4L9F A;  2Z6D A;  1FQG A;  1Q2P A;  1K56 A;  3BQ8 A;  1PI5 A;  3HUO A;  4N1X A;  4KG2 A;  3IF5 A;  5GLC A;  4E3M A;  2PYP A;  1GCE A;  1MWT A;  4ZRR A;  1KE4 A;  5GLD A;  2OWH A;  4IJG A;  3ULF A;  1CK3 A;  2XR0 A;  3C2W A;  2HV1 A;  3ZG7 B;  5DTS A;  1YSQ A;  4JF4 A;  3QP4 A;  3KYE A;  5EM0 A;  4GN2 A;  2A49 A;  4HJ4 A;  4R3B A;  5AQA A;  1PW8 A;  5EFW A;  1V9Y A;  3MXR A;  2XGN A;  4JGO A;  3O86 A;  4LCM A;  4B9O A;  2ZMA A;  1ES3 A;  4Y5F A;  3DTM A;  3TG9 A;  3WS0 A;  3BWL A;  3ZQ5 A;  2VEA A;  3H9W A;  4HQA A;  4ZTK A;  5FL3 A;  2M1C A;  2VJW A;  3BLS A;  1XJ6 A;  4OOY A;  4ME4 A;  4BWI A;  3F1P B;  3F1P A;  5G4Z A;  2WKR A;  3S1Y A;  1Z09 A;  1W7F A;  4R4R A;  3EEH A;  4ZBE A;  1VET A;  1VET B;  2HJ9 C;  4S2O A;  5FQ9 A;  4HES A;  1L0E A;  3UPP A;  5L09 A;  3KSI A;  2ZM8 A;  1PZP A;  3U4L P;  3W2Z A;  2BAS A;  5DFY A;  4PM9 A;  4IBX A;  3C7U A;  5FAQ A;  1MWR A;  2BTF P;  3WS2 A;  4BJP A;  3S7O A;  4BEN A;  3RXX A;  5FQM A;  3MZD A;  1LL9 A;  3VP2 A;  3ZNT A;  2V2F F;  5I94 A;  2QPN A;  4QD4 A;  2VGL M;  1ES4 A;  1FCN A;  4E3O A;  1D06 A;  4IHQ A;  3HUN A;  1BLS A;  4DRT A;  4LV0 A;  3B33 A;  1OJ5 A;  3QNC A;  4PM5 A;  2HP5 A;  5EOO A;  3GTC A;  1N4O A;  5EVL A;  3D9Y A;  3HCY A;  4XXR A;  5L10 A;  5AJG A;  3GSG A;  3IX4 A;  1RCJ A;  2B5R A;  1L2S A;  4LLO B;  2C5W B;  4LEN A;  4CLC B;  4CLC A;  2WZZ A;  4O0P A;  2D02 A;  4BBV A;  5IS1 A;  4C3Q A;  3T4S A;  5HSQ A;  3BYD A;  3IT9 A;  4ESP A;  3I7J A;  5BOH A;  1FR6 A;  5DTK A;  3PAE A;  2QKP A;  3DTE A;  3D4F A;  3IF6 B;  3IF6 A;  3E98 A;  4WYY A;  1FR1 A;  1S4R A;  4S2P A;  1ESI A;  3TJZ C;  1PIO A;  4UA9 A;  3E0Y A;  4ARZ A;  4ARZ B;  3GVB A;  1K57 A;  2W0N A;  4RVA A;  1FSW A;  3T1S A;  5DF8 A;  3BY9 A;  1PWD A;  1PWG A;  1FIL A;  3TSG A;  2LB5 A;  2OSU A;  3NOU C;  3Q07 A;  4WN5 A;  5CX7 A;  1KE3 A;  1F5M A;  4OQ0 A;  4X68 A;  5G18 A;  5HD5 A;  3NDE A;  4FTX A;  1YLJ A;  3T1X A;  4XT2 B;  4XT2 A;  4DE3 A;  2VV8 A;  4ZJ1 A;  2Y2J A;  4EBP A;  1CJF A;  3KYZ A;  1PWC A;  3U2A A;  2XEP A;  3BJN A;  3N8S A;  4LPZ A;  2QZ6 A;  4MN7 A;  2X71 A;  4E3K A;  5CTN A;  4N9K A;  1K4F A;  4Q8I A;  1K6R A;  1HD8 A;  2JC7 A;  4BBT A;  1OT9 A;  2JE5 A;  1JVJ A;  3G30 A;  1BT5 A;  2Y79 A;  5HWW A;  4NKP A;  1S1Y A;  4E04 A;  3HLG A;  4BLM A;  3OPH A;  4WMC A;  4DKI A;  3N6I A;  3V3S A;  3V3R A;  5TFQ A;  1JNU A;  5G4Y A;  1SKF A;  5FAS A;  3EGD C;  5HW3 A;  3QP2 A;  4GOG A;  2VV6 A;  1PZO A;  1DY6 A;  2P7J A;  3MKE A;  1ZTU A;  1ZHH B;  1MPL A;  3ISG A;  2HP9 A;  1F98 A;  3T4Q A;  5AQ7 A;  3S7P A;  3BFE A;  3C5A A;  4L9G A;  4D2O A;  5EEC A;  4EBL A;  3S22 A;  4Q0J A;  1GA0 A;  3BRM A;  2EXA A;  5M1A A;  3OCL A;  1D7E A;  3FPW A;  4S2I A;  3QNB A;  4EES A;  4EV4 A;  3OCN A;  3GQZ A;  3B47 A;  3V50 A;  4HBT A;  4Y17 A;  3QP8 A;  5HAR A;  5L07 A;  4N92 A;  3UDX A;  3UB8 A;  2G2W A;  3P98 A;  1Y4O A;  4MCW A;  3L9K A;  2P04 A;  3QHY A;  4WZ5 A;  5M18 A; 
#chains in the Genus database with same CATH homology
 2XF3 A;  4P6B A;  2J9P A;  4QJG A;  4OPR A;  2UWX A;  2WZX A;  1LI9 A;  1M6K A;  3G31 A;  3OZH A;  3LY3 A;  3IWI A;  2V1Z A;  1TDG A;  2H5S A;  2Y2L A;  3BFD A;  4P87 A;  4P85 A;  4UA6 A;  5HX9 A;  1JTG A;  1FSY A;  1K6S A;  1BSG A;  3C7V A;  3M2K A;  4MEZ A;  4WMC D;  4ID4 A;  2Y2P A;  3IH8 A;  4X69 A;  5HAQ A;  1ALQ A;  1PI4 A;  5GHZ A;  2ZQA A;  3A3J A;  1GHI A;  1LL5 A;  3NDG A;  2QMI A;  5CEC A;  3SH9 A;  4KQQ A;  3VFF A;  1FCM A;  1K54 C;  4OH0 A;  4GD8 A;  4DE1 A;  2ZC3 B;  2XH9 A;  3GMW A;  3FKW A;  1E3U D;  2WGW B;  2WGW A;  2XLN A;  3LEZ A;  2WGI A;  1VQQ A;  3JYI A;  4OQH A;  2P74 A;  4LV2 A;  1TVF A;  2IWC A;  1GA9 A;  1SCW A;  4S2N C;  5E2G A;  2JCH A;  4S2L A;  2Y2M A;  4E3L A;  1YMS A;  1XKZ A;  2H10 A;  4BD0 A;  4QB8 A;  3BFC A;  4JBF A;  5E43 A;  2Y2O A;  2WUQ A;  4MBF A;  1H8Y A;  5CHJ A;  1NY0 A;  4R1G A;  4KZ5 A;  1NZU A;  3VP3 A;  3SS5 A;  2WAE A;  3MBZ A;  1MWS A;  2C6W B;  4JKT A;  4BL2 A;  5CER A;  3UDF A;  5TGF A;  2WAF A;  3G34 A;  4KQR A;  2H0Y A;  5FI2 A;  3NIA A;  4IED A;  3HLF A;  2Z2L B;  5IHV A;  4KZ7 A;  4OOM A;  3MXS A;  5CEB A;  1XX2 A;  5DVA A;  4K0W A;  3GRJ A;  5FI7 A;  5FQQ A;  3FV7 A;  1L0F A;  1BTL A;  4OQI A;  3UDI A;  4E3N A;  1HVB A;  3P09 A;  3PTE A;  1KVL A;  1W8Q A;  3HLC A;  3UE1 A;  3ZG8 B;  1PW1 A;  3ZHH A;  3VOY A;  3IWQ A;  1BLC A;  4MBH A;  5FSR A;  3NCK A;  4F94 A;  3IHA A;  4YFM A;  1ZG4 A;  1S6R A;  2Z2M B;  1MXO A;  2GDN A;  2EFU A;  1FCO A;  3IF6 C;  3UPO A;  2J9O A;  4JXV A;  1VM1 A;  2ZC5 B;  1HTZ A;  4K91 A;  3ZVW A;  3BEC A;  2Q9M A;  2R9W A;  2Y2I A;  1K55 A;  4BD1 A;  4H8R A;  1DJA A;  1CI9 A;  1SHV A;  3PBR A;  4OPQ A;  3ZG0 A;  3BM6 A;  1ONG A;  5E2H A;  2FFF B;  3SH8 A;  2ZLY A;  2XK1 A;  2OV5 A;  5KSH A;  1KDS A;  3VFH A;  4OON A;  3VMA A;  1MKI A;  1XXM A;  1IEM A;  1K57 C;  4Y0U A;  1GHP A;  1ZC2 A;  3IXB A;  2ZC7 A;  3ITA A;  1DJC A;  3CZD A;  3IQA A;  1YMX A;  1WYB A;  1YM1 A;  5DF9 A;  1BUL A;  3BFF A;  4U0X A;  2EX6 A;  3Q82 A;  2ZC4 B;  2Y2G A;  2J7V A;  1BUE A;  4RX3 A;  4DDS A;  5EUA A;  4OLD A;  1ONH A;  4NK3 A;  3M6H A;  4PM8 A;  2ZC6 B;  4KZ4 A;  1H5X A;  1MY8 A;  4WEL A;  4JF6 A;  2G2U A;  4JXG A;  1Z6F A;  1GHM A;  2HP6 A;  4LV3 A;  4Z9Q A;  4KEN B;  2H0T A;  3S4X A;  1DJB A;  4QU3 A;  4JF5 A;  5L2F A;  2HDQ A;  3CMZ A;  4EQI A;  1ZKJ A;  5CHU A;  5KMW A;  3RXW A;  1XA1 A;  4OLG A;  4RYE A;  1FQG A;  1ZG6 A;  4PM6 A;  1Q2P A;  4DXB A;  1BLH A;  5CRF A;  1K56 A;  3O87 A;  4OKP A;  1PI5 A;  3HUO A;  4N1X A;  3VP0 A;  4KG2 A;  3IF5 A;  2ZM2 A;  5GLC A;  1YLZ A;  4E3M A;  4E6X A;  1KE0 A;  3AGD A;  1GCE A;  1MWT A;  3SS3 A;  1KE4 A;  3E2L A;  4L0L A;  4N1H A;  4GKU A;  5GLD A;  3LO7 A;  4OPZ A;  1FOF A;  5D3O A;  1I2S A;  1CK3 A;  2CC1 A;  4ZJ2 A;  2XR0 A;  3ZG7 B;  3SH7 A;  4GZB A;  5DTS A;  3OPR A;  4JF4 A;  1E25 A;  4B88 A;  4XUZ A;  4GN2 A;  4IVK A;  5HL1 A;  1W79 A;  5A90 A;  2A49 A;  2EX8 A;  1K4E A;  3HL9 A;  4R3J A;  4E3J A;  4Y0O A;  4R3B A;  5AQA A;  4ZAM A;  2IWB A;  3MZF A;  1PW8 A;  4FH4 A;  1NRF A;  3N7W A;  3MXR A;  2XGN A;  1RGY A;  1NJ4 A;  3O86 A;  4LCM A;  2ZMA A;  4OP8 A;  1ES3 A;  3DTM A;  1K25 A;  3G4P A;  2X02 A;  1RP5 A;  1YLY A;  3TG9 A;  3WS0 A;  3E2K A;  5FAT A;  2PU4 A;  5DTT A;  2BG1 A;  3EQU A;  3VSK A;  1NXY A;  4Y0T A;  5E2E A;  4ZTK A;  2ZD8 A;  3WS5 A;  2Y2Q A;  3BLS A;  1SDN A;  1IKG A;  4GDB A;  5CXW A;  5EOE A;  3WRZ A;  4OOY A;  3IXG A;  1I2W A;  2DNS A;  4KG6 A;  1CEG A;  3IHB A;  4QHC A;  1N9B A;  3FYZ A;  1CI8 A;  5GHX A;  3VSL A;  4X56 A;  5HFO A;  5A91 A;  4QY5 A;  1OME A;  4M3K A;  3S1Y A;  3SOI A;  1W7F A;  4R4R A;  1EI5 A;  4ZBE A;  2BLS A;  5DF7 A;  5FQK A;  1C3B A;  5EPH A;  1KVM A;  4OPY A;  3LY4 A;  4S2O A;  3ZDJ A;  3IWO A;  5FQ9 A;  1LI0 A;  3HLE A;  4HES A;  1L0E A;  2Y2H A;  3AGE A;  4WM9 A;  1QMF A;  4JXW A;  3UPP A;  1K56 D;  4IBR A;  2ZM8 A;  1PZP A;  1XP4 A;  2ZM0 A;  4CPK A;  3HBR A;  4R23 A;  4UAA A;  5EVI B;  5EVI A;  2Y59 A;  4KZ8 A;  3HUM A;  4PM9 A;  4IBX A;  3C7U A;  5FAQ A;  4B4X A;  1MWR A;  2HDR A;  3B3X A;  3G32 A;  1PYY A;  4KZ9 A;  1AXB A;  4K0X A;  1BLP A;  5FAP A;  1IYP A;  3WS2 A;  4BJP A;  4BEN A;  3RXX A;  4WZ5 C;  5FQM A;  3MZD A;  3BLM A;  3C4O A;  3CG5 A;  2DCF A;  1LL9 A;  3VP2 A;  4U0T A;  3ZNT A;  4FD8 A;  2EFX A;  5KSC A;  4MLL A;  3NBL A;  2V2F F;  2XFS A;  3UO9 A;  1ES2 A;  5CTM A;  5I94 A;  2QPN A;  3PBN A;  3NI9 A;  4QD4 A;  3W4P A;  5F83 A;  3W4Q A;  4RA7 A;  3ZNY A;  1ERQ A;  1ES4 A;  3UE3 A;  3OPL A;  4P0M A;  1FCN A;  5TR7 A;  4E3O A;  4PPR A;  3HUN A;  1YLP A;  1BLS A;  3A3D A;  4DRT A;  2J8Y A;  2PBY A;  4LV0 A;  4LV1 A;  1BZA A;  3N4I A;  4KZB A;  5FQJ A;  3QNC A;  5KZH A;  2WKI A;  4WEJ A;  3WRT A;  4PM5 A;  2HP5 A;  4DXC A;  5EOO A;  4YIN A;  2EX9 A;  3GTC A;  1N4O A;  3FZC A;  4X6T A;  4RX2 A;  5GLA A;  3V39 A;  5EVL A;  5FAO A;  4XXR A;  1KGG A;  3PBO A;  1IKI A;  1Y54 A;  4KQO A;  3GSG A;  3WS4 A;  2HDU A;  3MFD A;  4C75 A;  1RCJ A;  2XFT A;  2B5R A;  4DDY A;  1TDL A;  4PM7 A;  3VOZ A;  1JTD A;  1G6A A;  1L2S A;  1I5Q A;  4WBG A;  2C5W B;  4LEN A;  4EWF A;  2WZZ A;  4LCL A;  4PMA A;  1NZO A;  4B4Z A;  1O7E A;  5F1G A;  1RGZ A;  2VGK A;  3OPP A;  1G68 A;  4C3Q A;  4S2J A;  3UPN A;  5A92 A;  3BYD A;  5CGW A;  3NC8 A;  5E2F A;  3W4O A;  4GNU A;  3IT9 A;  4S2K A;  1IEL A;  3I7J A;  5J8X A;  4OVD A;  4KZ6 A;  5BOH A;  1FR6 A;  3PBQ A;  5DTK A;  2R9X A;  3M2J A;  3PAE A;  2RCX A;  4FCF A;  2XQZ A;  3D4F A;  3IF6 B;  2WGV A;  3IF6 A;  5EVI D;  2ZJ9 A;  4WZ4 A;  1YT4 A;  4WYY A;  2FFY A;  4O7D A;  2A3U A;  1FR1 A;  3G2Y A;  1KDW A;  4S2P A;  1ESI A;  1K55 C;  3G2Z A;  1YLW A;  3Q81 A;  4Y7P A;  4C6Y A;  4EBN A;  1M40 A;  5AQ9 A;  1L0D A;  1PIO A;  1TEM A;  1U60 A;  5EE8 A;  3AGF A;  4DF6 A;  4UA9 A;  3EQV A;  4OP5 A;  3HLW A;  3GVB A;  1WE4 A;  1K57 A;  2VGJ A;  3HRE A;  1XPB A;  4MNR A;  4MBK A;  4RVA A;  4CJN A;  4JPM A;  1IYS A;  1FSW A;  2ZQD A;  3A3F A;  5DF8 A;  1QME A;  3MZE A;  2HDS A;  1ES5 A;  1PWD A;  1PWG A;  5GHY A;  4NET A;  2E8I A;  1O07 A;  3TSG A;  2OSU A;  3Q07 A;  4EUZ A;  1KE3 A;  2EX2 A;  1J9M A;  3A3E A;  2Y2K A;  4OQ0 A;  4X68 A;  3NDE A;  3M6B A;  5G18 A;  1Q2Q A;  3N8R A;  5CGS A;  1YLJ A;  5HAP A;  2HPB A;  2P9V A;  2P9V B;  4DE3 A;  3A3I A;  3OC2 A;  2V20 A;  3G35 A;  3ZG9 B;  4ZJ1 A;  1KGF A;  1EWZ A;  2Y2J A;  4KZA A;  4BL3 A;  4EBP A;  1CEF A;  2JBF A;  3SS4 A;  1LLB A;  2X01 A;  1PWC A;  2XEP A;  3HLB A;  3N8S A;  2Y55 A;  2PU2 A;  1WYC A;  2QZ6 A;  1H8Z A;  2X71 A;  4XUX A;  2OLU A;  2IWD A;  4N9L A;  4U3T A;  4E3K A;  5CTN A;  4N9K A;  1NYY A;  3Q7Z A;  4FSF A;  3FWL A;  5U47 A;  1K4F A;  4Q8I A;  1K6R A;  1HD8 A;  2JC7 A;  4JXS A;  3DWZ A;  4OOL A;  4HEF A;  3VP4 A;  2I72 A;  2XDM A;  3IXH A;  5CHM A;  2DRW A;  1SDE A;  4QY6 A;  2WKE A;  2JE5 A;  1JVJ A;  3G30 A;  5F82 A;  1BT5 A;  1YLT A;  1L0G A;  4JLF A;  2ZQ7 A;  1W5D A;  3O88 A;  4KG5 A;  2WAD A;  3VP1 A;  2XD1 A;  4GD6 A;  3HLG A;  1JWV A;  4BLM A;  3DW0 A;  2WK0 A;  3OPH A;  2RL3 A;  1XGI A;  4WMC A;  4DKI A;  3N6I A;  1KGE A;  2WKH A;  3O3V A;  3V3S A;  3V3R A;  4GDN A;  5TFQ A;  3ZG5 A;  5FAS A;  1SKF A;  1HZO A;  3HLD A;  1IYQ A;  1JWP A;  4X55 A;  1MBL A;  5HW3 A;  3CJM A;  2Y4A A;  1K54 A;  4GOG A;  3ZCZ A;  5FDH A;  1XGJ A;  1PZO A;  2ZQ9 A;  1DY6 A;  3UY6 A;  1E3U A;  3MKE A;  5FI6 A;  3UNW A;  1MPL A;  3ISG A;  2HP9 A;  3MKF A;  4S2M A;  3NY4 A;  4S2N A;  4FH2 A;  5F1F A;  5CGX A;  4IVI A;  5FA7 A;  1S0W A;  3GR2 A;  3UE0 A;  3TOI A;  1K38 A;  5GL9 A;  5AQ7 A;  3BFE A;  3DWK A;  3C5A A;  1NYM A;  3WWX A;  4UHU A;  3ZVT A;  3FKV A;  4KZ3 A;  4D2O A;  5EEC A;  3ITB A;  4EBL A;  3S22 A;  3Q1F A;  2ZQ8 A;  3W8K A;  3ZFZ A;  1GA0 A;  1JWZ A;  3BEB A;  3BRM A;  1XA7 A;  3IH9 A;  2EXA A;  1ERM A;  5M1A A;  3OCL A;  5FQI A;  4S2I A;  3QNB A;  4R0Q A;  4DE0 A;  4E6W A;  4DE2 A;  2WYX A;  4EV4 A;  5GLB A;  3PBS A;  4WEK A;  3V5M A;  5JYP A;  4R4S A;  4GB7 A;  4BQM A;  3OCN A;  3GQZ A;  1ESU A;  3GV9 A;  3PAG A;  5JYO A;  2EXB A;  3V50 A;  1YQS A;  5AQB A;  4OQG A;  3IXD A;  3WS1 A;  4HBT A;  3HVF A;  4E3I A;  4ZDX A;  5HAI A;  3PBT A;  5CED A;  1ERO A;  4UA7 A;  2OLV A;  3C4P A;  5HAR A;  4X53 A;  2XD5 A;  2ZQC A;  3BFG A;  4N92 A;  5EVI C;  3UDX A;  1LHY A;  1MWU A;  2G2W A;  3LCE A;  3N8L A;  3P98 A;  3ZGA B;  4HBU A;  1IYO A;  3RJU A;  1E4D A;  4ZJ3 A;  5M19 A;  5A93 A;  3Q7V B;  3Q7V A;  3UN7 A;  1W8Y A;  3QHY A;  4WZ5 A;  4A5R A;  5M18 A;  2Y91 A;  2Q9N A;  2Y2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...