1JWZA

Crystal structure of tem-64 beta-lactamase in complex with a boronic acid inhibitor (105)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Evolution of an antibiotic resistance enzyme constrained by stability and activity trade-offs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 99
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1jwzA00
1E25A 1FCMA 1KGGA 4Y0UA 4QB8A 2A3UA 5FATA 2ZC3B 1K56A 3LY4A 3IHBA 4S2OA 4JKTA 3PBQA 4MBFA 1PIOA 4PPRA 1MWSA 3BLSA 3PBOA 1PZOA 3ZGAB 2OSUA 5FI7A 1PW1A 3BLMA 4OH0A 4RA7A 3W4PA 4N9LA 4OP8A 5DTSA 3NDEA 3ZG7B 2Z2MB 2ZQCA 5DTKA 3P98A 4MBHA 4OQGA 4S2IA 4X69A 3BFDA 3TG9A 1TVFA 4QY5A 2WGVA 3GQZA 2DCFA 4A5RA 3IWOA 4R0QA 3G31A 3PTEA 3ZFZA 5EVIA 4HESA 1BZAA 1BT5A 1MPLA 2WADA 3QHYA 3GRJA 3OPRA 2EX9A 3OC2A 3C7VA 1J9MA 3ZG0A 3ITBA 4M3KA 3V50A 3G2YA 5TGFA 4ZTKA 5AQ7A 3IF6B 4KZ7A 4R3BA 1GCEA 3MFDA 4KQOA 4OPYA 3A3EA 4OQHA 3E2LA 4RX3A 1FSWA 4GD6A 2H5SA 4DE0A 4QD4A 1I5QA 4PM5A 2HP5A 1IYOA 1PWDA 2CC1A 4E3KA 1DJAA 1ESIA 2ZD8A 2E8IA 5FAQA 3UPOA 4QHCA 4PM8A 4BD1A 3WS5A 4XUXA 3S1YA 4S2JA 4WZ4A 2HDUA 2OLUA 5EE8A 2JBFA 3MKEA 5HL1A 5HAPA 2VGKA 1HZOA 1MY8A 1QMEA 2JC7A 4HEFA 2C5WB 3GR2A 1LI0A 3IH9A 4OONA 5CRFA 5CECA 3BRMA 3MKFA 4IBXA 4DE2A 1FR1A 2QZ6A 1DJCA 1SHVA 3E2KA 4N1XA 1K38A 5IHVA 2Y2HA 5E2GA 4FH4A 1H5XA 3UN7A 3WS2A 4P87A 1YM1A 3BECA 3N8LA 1PI5A 5GLBA 2WK0A 3UDFA 4KZAA 2ZM8A 5FI6A 3S22A 4X53A 4LCLA 3I7JA 5A92A 4OOMA 2XFSA 4E3OA 3IT9A 1BTLA 3A3DA 5DF8A 1KE3A 4YFMA 3M2KA 5J8XA 4DE1A 1Y54A 4EBPA 3BM6A 5FQMA 4R4SA 1JWZA 2WGIA 5KSCA 3C4OA 4DF6A 4JF6A 1RCJA 3UDIA 4KZ9A 4KZBA 1IKGA 5DVAA 3MBZA 3BFEA 5EVIC 1U60A 3C4PA 5FQQA 4JXSA 1CK3A 3Q7VA 4E3JA 4LCMA 4R23A 1L0EA 1YT4A 3C5AA 3UE1A 3Q82A 5GLDA 4U3TA 1K6RA 3PBRA 3EQVA 1K56D 1YLJA 3HLGA 3PBTA 4R4RA 3VSKA 3ZVWA 2H10A 5DF7A 1NY0A 4JXWA 3IXGA 3ZCZA 2ZC5B 1LHYA 4OPZA 3WRZA 5F83A 5EECA 2P74A 2A49A 1JWPA 3PAEA 4JXVA 5M19A 4B4ZA 3FWLA 4FD8A 4E3MA 3PAGA 3W8KA 3UY6A 3O86A 1ES4A 4P0MA 3VMAA 1PI4A 3IH8A 1SCWA 2RL3A 3P09A 1PWCA 1HTZA 2FFFB 4KQQA 1XGIA 1OMEA 4PMAA 2ZQ7A 1IEMA 3DW0A 4GZBA 5GHYA 2Y2MA 3SS3A 1YQSA 4ZJ1A 1BUEA 2PBYA 2Z2LB 2H0YA 3JYIA 1XP4A 2QPNA 3GV9A 5EVID 5A91A 2OV5A 3UPNA 3VP1A 1QMFA 3M6HA 2P9VA 2WZZA 4Y7PA 4MBKA 4KG5A 1YMSA 1E3UD 2C6WB 2HP9A 1XXMA 2ZM2A 3NCKA 4IVKA 3VOYA 4KZ8A 4X55A 3CMZA 2XGNA 5CTNA 2WAFA 5HX9A 2Y2PA 4B4XA 2HDRA 2ZC6B 4EV4A 5CEBA 1AXBA 2WUQA 3IWIA 4E6WA 5A90A 5HAQA 3N8SA 2UWXA 2Y4AA 3WRTA 2Y91A 5EPHA 4JLFA 4Z9QA 1YMXA 2XEPA 1FCOA 2WGWA 4WEKA 2ZM0A 4X56A 1JWVA 3G2ZA 1IYPA 1FQGA 3VP4A 1G6AA 1MXOA 2WZXA 3CG5A 5DF9A 3G35A 5GLCA 4UA9A 2EX6A 4Y0OA 3PBSA 2ZJ9A 3SS4A 1BLHA 4NK3A 1DY6A 3VFFA 3HUOA 5L2FA 4S2PA 4EQIA 2EFXA 4DXCA 5I94A 2XK1A 1MKIA 2GDNA 5CHMA 1MWUA 3ZNYA 4QY6A 4UA7A 4S2NA 2EXAA 3NY4A 5M18A 3ZG8B 1LLBA 3NIAA 2XF3A 1ZG4A 1SKFA 3GTCA 1H8YA 1KVMA 1N9BA 1ESUA 3M2JA 4E3LA 3AGDA 3VSLA 4UHUA 3MZDA 3MZEA 3LO7A 4QJGA 2I72A 1XGJA 3FZCA 1WYCA 4CPKA 5CEDA 3FYZA 4BL3A 1L0FA 2RCXA 1H8ZA 4S2KA 1CI8A 5HAIA 2Y2JA 3V3RA 5KZHA 1MWTA 3UE3A 1SDEA 3V5MA 2X01A 3OCNA 2ZLYA 1KGEA 3RXXA 2XDMA 4KZ6A 3VP3A 1L2SA 2V2FF 1N4OA 3AGFA 3WS4A 1TDGA 4B88A 3HREA 3ZG5A 4WZ5A 1LL9A 1CI9A 1RP5A 2PU4A 2WYXA 4UAAA 5U47A 4JF5A 4MNRA 5F1GA 3NBLA 3UO9A 2XD1A 3ZG9B 1NYMA 2HDSA 5TFQA 3HLEA 3SS5A 1YLPA 3GSGA 2EX8A 5FQKA 1ONHA 1PZPA 5FQ9A 1IELA 3HVFA 5E2HA 1BLPA 4DKIA 4R3JA 3GVBA 3WS1A 3IHAA 2PU2A 5F1FA 2JE5A 3FKWA 1FCNA 2BG1A 3N7WA 3N6IA 4GDBA 1W5DA 4E3IA 5AQAA 2IWBA 5CXWA 1GHIA 1YLYA 2XD5A 4EWFA 3MXRA 1BSGA 3SH8A 2WKEA 2ZQAA 4FH2A 4IVIA 4S2NC 4BL2A 1IYSA 1S0WA 2J8YA 5CGWA 1FOFA 4YINA 5FQJA 2ZC4B 1ZC2A 2ZQDA 2QMIA 4LV1A 3QNCA 5EVIB 5AQBA 3PBNA 4E6XA 5A93A 2Y55A 2X02A 3OPHA 4LV0A 3EQUA 4GDNA 4FCFA 1KDWA 2XQZA 3HLWA 1ES3A 3ZNTA 4BD0A 1GA9A 1ONGA 3MZFA 4GN2A 2ZQ8A 1NRFA 3WWXA 4C75A 2XH9A 3BEBA 2XFTA 4CJNA 5CERA 5CHUA 3NI9A 4OQ0A 5E43A 1HVBA 2Q9MA 3DWKA 2Y2IA 3Q1FA 3IF6A 1FSYA 1LL5A 5FQIA 1MWRA 4DDYA 4GNUA 4XXRA 5D3OA 3HLCA 4WZ5C 4OKPA 4RVAA 4N9KA 4BJPA 1BLCA 1XX2A 4N1HA 4PM7A 3TSGA 4MLLA 2Y2KA 1O07A 3HBRA 5E2EA 3W4QA 3BYDA 4JBFA 4DE3A 2WAEA 1KE4A 4WMCA 2H0TA 1EWZA 3IXDA 5FDHA 1YLTA 1EI5A 4KQRA 1GHMA 1RGYA 3S4XA 4KZ3A 3VFHA 1G68A 4MEZA 3UDXA 1ES2A 1LI9A 2DRWA 4OQIA 3A3IA 1VQQA 3Q81A 2IWCA 4DXBA 3OPPA 2J9OA 3SOIA 5KSHA 2Y2GA 4U0XA 1M6KA 5CHJA 3ZVTA 1BULA 3IWQA 4JPMA 3B3XA 5FAOA 3HUNA 4C3QA 1Q2PA 2J7VA 4LV3A 4OP5A 1ES5A 1IKIA 5EOEA 3VP2A 5EUAA 4HBTA 3IXHA 5FASA 3G32A 1K55A 1KE0A 2Y2QA 3VOZA 3C7UA 4C6YA 5G18A 4WEJA 1PWGA 4HBUA 4H8RA 1JVJA 3OCLA 1CEFA 3O88A 4BLMA 1O7EA 1YLWA 2Y59A 3Q7VB 1MBLA 1NXYA 3LY3A 4L0LA 3AGEA 2IWDA 4GOGA 1PYYA 1DJBA 4P6BA 2Y2LA 5FSRA 1WYBA 3LCEA 3RJUA 1ERQA 4IEDA 4WM9A 4WYYA 2VGJA 3FV7A 1XKZA 1M40A 3ZHHA 1K54A 4OOLA 3HUMA 4BENA 1ALQA 4OLGA 3G4PA 4RX2A 3Q07A 3IF6C 2J9PA 3IF5A 1NYYA 4GB7A 4DRTA 1E3UA 1NJ4A 1S6RA 2V1ZA 5JYOA 4ZDXA 1EROA 4DDSA 3V39A 1Q2QA 2JCHA 4O7DA 1XA1A 1JTDA 4X68A 1I2SA 4K91A 4D2OA 5FAPA 4P85A 4K0WA 1NZUA 4FSFA 1VM1A 3M6BA 2R9WA 1L0DA 3VP0A 5DTTA 1KDSA 2EXBA 4KENB 4KG2A 1C3BA 1JTGA 1TDLA 2P9VB 3IXBA 3A3JA 4GD8A 4PM6A 1W79A 4S2LA 4EUZA 5GLAA 4EBNA 4OOYA 2FFYA 2HP6A 3G34A 3MXSA 4ZBEA 1YLZA 3HLFA 1HD8A 1K57C 1IYQA 2R9XA 4PM9A 4N92A 3SH9A 1W8YA 2WGWB 4K0XA 4KG6A 4JXGA 3OPLA 4Q8IA 2Y2OA 1FR6A 3FKVA 1CEGA 1K55C 3DTMA 4X6TA 5CGSA 1RGZA 4KZ4A 1XPBA 4Y0TA 2ZC7A 4JF4A 1XA7A 2BLSA 2EFUA 2XR0A 2V20A 4OPQA 1K4FA 4WMCD 5CGXA 3IQAA 4ID4A 1PW8A 4ZAMA 1W7FA 5BOHA 5GHXA 4QU3A 5TR7A 4F94A 1TEMA 3HLBA 2Y2NA 4RYEA 3ZDJA 5JYPA 1K6SA 3BFCA 2WKIA 3OZHA 2Q9NA 2X71A 2B5RA 4IBRA 2WKHA 4OVDA 2ZQ9A 3HL9A 1K54C 3UNWA 2XLNA 5E2FA 5EVLA 4KZ5A 1K25A 2ZMAA 3NDGA 4ZJ3A 4ZJ2A 3GMWA 3CZDA 4WBGA 4GKUA 1BLSA 2G2UA 1NZOA 4LV2A 4LENA 1Z6FA 3UPPA 3N4IA 3Q7ZA 1GHPA 1ZG6A 3O87A 3D4FA 4BQMA 4UA6A 1GA0A 5M1AA 5F82A 3SH7A 3CJMA 1KGFA 1E4DA 1W8QA 1ERMA 3ITAA 4OLDA 5FI2A 3V3SA 3N8RA 2OLVA 1L0GA 2G2WA 3O3VA 2HDQA 5KMWA 2EX2A 5FA7A 3QNBA 1I2WA 3BFGA 1WE4A 1KVLA 3DWZA 3G30A 3HLDA 4E3NA 4R1GA 5AQ9A 5EOOA 3LEZA 1SDNA 5HARA 3A3FA 5HW3A 3W4OA 3WS0A 5GHZA 4U0TA 3UE0A 4OPRA 5GL9A 1ZKJA 4NETA 1K57A 3ISGA 5CTMA 4XUZA 3TOIA 4EBLA 4WELA 3RXWA 4S2MA 3NC8A 2HPBA 3BFFA 2DNSA 5HFOA 1K4EA
chains in the Genus database with same CATH superfamily
1E25A 2ZC3B 3IHBA 5C5KA 2VJWA 4PKYA 3BLSA 4YOFA 5FI7A 3BLMA 4OH0A 4RA7A 2M7UA 4N9LA 4OP8A 3TRCA 2JKRM 5L8MA 3NDEA 3ZG7B 3UE6A 5DTKA 3TG9A 3E0YA 2DCFA 4R0QA 4WF0A 5G4YA 1MPLA 4NG2A 3LI9A 1UWPX 5AQ7A 4R3BA 1P9RA 2HJ9C 4DE0A 3H82B 4QD4A 5HD5A 1PWDA 2CC1A 2CMNA 5FAQA 2O99A 5L07A 3ULFA 2JC7A 4HEFA 2C5WB 3GR2A 1LI0A 5CECA 4IBXA 2OAP1 3E2KA 1K38A 5IHVA 2WK0A 3B42A 2ZM8A 4LCLA 4OOMA 2EA9A 1TD5A 5AVEA 3BM6A 5FQMA 2W1TA 4JF6A 4KZ9A 4LRZE 5EVIC 1U60A 5FQQA 4JXSA 1CK3A 4HJ6A 1L0EA 3Q82A 4HQAA 3HLGA 2JN7A 3EGXC 2H10A 4IJGA 4HP4A 3KX0X 1X0OA 4X25A 2KOIA 3D3OA 3E98A 4JXVA 5M19A 5J4EA 4K08A 2QHKA 3UY6A 1ES4A 2QJ7A 1VEUA 4KQQA 2J3TC 4GZBA 3DW0A 4LLOB 1DP8A 3JYIA 4H6JA 3UPNA 1QMFA 3M6HA 4KG5A 2C6WB 3VOYA 1FIKA 3CMZA 2WAFA 2HDRA 4KUOA 1AXBA 5A90A 2Y4AA 4JLFA 4HIAA 1YMXA 2XEPA 1ZHHB 1JWVA 3VP4A 3G35A 4B9OA 3VFFA 1A0KA 2EFXA 4G3KA 4FOFA 4S2NA 2EXAA 3NY4A 1LLBA 3NIAA 4E3LA 4NEED 3MZDA 5IT5A 2I72A 1XGJA 3FZCA 1WYCA 5KZHA 4HOIA 3OCNA 2V2FF 3WS4A 5AJGA 1CI9A 3LR5A 4UAAA 5F1GA 4EU0A 3NBLA 4JGPA 2HDSA 4Q0IA 1PZPA 3T4LA 1IELA 1BLPA 3KSIA 3VV4A 3GVBA 5F1FA 3MF0A 3FKWA 4Y17A 3CAXA 1GHIA 4EWFA 1UWNX 1T1BA 3DTEA 2PT7A 4BL2A 1IYSA 1S0WA 3U4LP 5FL3A 1T19A 2HGVA 5EVIB 5AQBA 3PBNA 3E4PA 4EEUA 1NLZA 2JKGA 3UB5P 1ONGA 4GN2A 1NRFA 3EWKA 4CJNA 3RTYA 5CERA 3NI9A 2VGLM 5HDCA 4UEYA 4Y15A 5FQIA 4GNUA 1MZUA 3HLCA 4OKPA 3D9YA 4PM7A 3TSGA 2M1CA 2Y2KA 2LB5A 3HBRA 3W4QA 3T4OA 2ZMFA 4JBFA 1EWZA 1G68A 2DRWA 3Q81A 2IWCA 4DXBA 3UB8A 2Y2GA 4U0XA 3IWQA 4YWZA 4LV3A 4OP5A 1ES5A 1IKIA 5EOEA 5EUAA 3IXHA 3G32A 3H7WB 4BBTA 1KE0A 3C7UA 5G18A 1PWGA 4HBUA 4H8RA 1JVJA 5HSQA 2Y59A 3Q7VB 4MN7A 3A0VA 1OPXA 3CHWP 3AGEA 3TW8A 2Y2LA 1J3WA 1ERQA 1XKZA 1M40A 4L9EA 3LYXA 4RX2A 3IF6C 4GB7A 4DRTA 2V1ZA 1S6RA 5JYOA 4ZDXA 1EROA 3T4SA 2I9VA 3B47A 4NXEA 1XA1A 4X68A 1YSPA 5DTTA 2EXBA 4HJ4A 4UQIM 3WRZA 2P9VB 3IXBA 5JYPA 3BW6A 2FFYA 2VV7A 1F2KA 1HD8A 4ESPA 4PM9A 4N92A 3SH9A 2WGWB 4K0XA 2Y2OA 4F3LB 3T12B 1CEGA 4GS9B 3DTMA 3PXPA 3EOIA 1RGZA 4KZ4A 4JF4A 2BLSA 5HZHA 2V20A 1W63Q 4ID4A 5BOHA 1W7FA 1TEMA 3BFCA 2WKHA 3HL9A 4LGWA 3NDGA 3LIEA 1G28A 3GMWA 4DJ3A 1BLSA 1NZOA 4LV2A 1Z6FA 3Q7ZA 3O87A 4BQMA 3CUEC 1Y4OA 5F82A 3SH7A 3CJMA 1F9IA 2O9BA 2PYPA 4OLDA 3V3SA 3T4TA 3N8RA 2OLVA 1DP6A 2VX8A 5KMWA 3T4KA 3OBFA 1KVLA 3HLDA 4I3AA 3W4OA 2JKTI 4Y13A 3KYZA 4NETA 4WELA 3RXWA 1KE4A 3VE3A 2BG1A 3LGOA 3F1NB 2P04A 5FATA 3PBQA 1W63M 5TJJA 1PIOA 4P6ZM 3F1PA 2PD7A 3B33A 5TBMA 3C2WA 3ZGAB 1PW1A 3BJNA 3W4PA 3BQ8A 3P98A 4S2IA 1TVFA 3G31A 3PTEA 3ZFZA 1L3LA 3PHYA 4HESA 5DKKA 1LL8A 2WKQA 3QHYA 3GRJA 3LR4A 3OC2A 3ZG0A 3V50A 3CUEA 3G2YA 4ZTKA 3RFBA 3IF6B 4BWIA 3MFDA 4KQOA 4OQHA 4RX3A 3E2LA 1FSWA 2H5SA 1I5QA 2HP5A 2VEAA 5EFWA 3R7WA 5KIZA 3WS5A 4XUXA 2OWHA 3MKEA 2KLIA 2VGKA 2Y8HA 1QMEA 3MXQA 4OONA 3BRMA 3MKFA 3T1QB 5MC7A 5F69A 2QZ6A 2Y2HA 2VGLS 4FH4A 1H3QA 1YM1A 2ZL1B 3N8LA 3UDFA 4KZAA 5FI6A 3S22A 1PFLA 4X53A 4WL9A 2XFSA 4X1LA 2W1RA 4YFMA 3IS2B 1XJ6A 4DE1A 1Y54A 5HL6A 3MQOA 4R4SA 1JWZA 5KSCA 4DF6A 2A24A 1RCJA 2PAVP 3UDIA 1SKOB 5DVAA 3BFEA 1T1AA 2PDRA 4KQDA 3EQVA 3PBTA 3ZVWA 1NY0A 3IXGA 2G7UA 2ZC5B 1LHYA 3PAEA 4XT2B 3PAGA 1AWIA 3P7NA 4E3MA 1D06A 3O86A 4AFIA 3P09A 2RL3A 1HTZA 2W3GA 2VLGA 2ZQ7A 3VE4A 1YQSA 4D60A 2PBYA 3R7WB 2H0YA 2QPNA 3GV9A 5I5LA 4CQHA 4Y7PA 4MN6A 2HP9A 3VOLA 4X55A 2XGNA 4O8GA 5HX9A 3SZTA 4EV4A 5CEBA 1GSWA 3IWIA 2WUQA 2UWXA 3WRTA 2Y91A 5EPHA 1FCOA 1IYPA 1FQGA 1OT6A 1G6AA 1MXOA 5GLCA 4UQIS 3O5YA 5LBRA 3UMEA 2L1MA 5L2FA 4DXCA 5I94A 2XK1A 5CHMA 3BY9A 4UA7A 4B93A 3NOUC 1H8MA 4BBUA 1ZG4A 2K2NA 1H8YA 1ESUA 1OTEA 3AGDA 3UB6A 3MZEA 2OOLA 3LO7A 1KOUA 5CEDA 2RCXA 5HAIA 1H8ZA 3V3RA 3RH8B 5FEGA 3T1SA 1KGEA 3VP3A 4ETXA 3L9KA 3QP1A 4B88A 3HREA 2OAQ1 3ZG5A 1RP5A 2PU4A 2VZWA 4JF5A 4FTXA 3UO9A 2XD1A 3ZG9B 5HD3A 5TFQA 1YLPA 3GSGA 1ONHA 4I39A 5E2HA 3HVFA 4DKIA 3NHQA 3IHAA 2JE5A 3LIBA 4GDBA 1ODVA 3LICA 5CXWA 3MJQA 1NLYA 4L9GA 3MXRA 3SH8A 2WKEA 3F1OA 4FH2A 4IVIA 4S2NC 5CGWA 1ZC2A 2ZQDA 3T50A 3QNCA 5A93A 4FCFA 1GA9A 4P6ZS 3UB9A 3BEBA 5DJTA 1FILA 3Q1FA 3BY8A 3ZYTA 4CLCA 4DDYA 3QP6A 4N9KA 1BLCA 1XX2A 4MLLA 3QP8A 3BYDA 3MQQA 3IBRA 3IXDA 5FDHA 1YLTA 1GHMA 3CITA 2ZBBA 4MEZA 1LI9A 4I3IA 1VQQA 3SOIA 5KSHA 2WKRA 3HUNA 4M4XA 1VHMA 4HBTA 1K55A 2Y2QA 3S7QA 2W1TB 4C6YA 4BLMA 1O7EA 1YLWA 2R78A 3JPUA 4WN5A 1MBLA 3LY3A 3K3DA 4GOGA 1ACFA 5FSRA 1WYBA 3IX4A 2PR6A 4WYYA 1V9YA 2V9AA 3ZHHA 1K54A 4OOLA 5DFYA 3HUMA 5HWTA 1S1YA 4OLGA 2J9PA 1LT0A 1P97A 2Z6CA 1E3UA 1VEUB 4O7DA 4K91A 4D2OA 1VM1A 2XSSA 4H6JB 1DP9A 3KSFA 3VP0A 4HI4A 4KG2A 1TDLA 4GD8A 4S2LA 3LR0A 4EBNA 4OOYA 5FDSA 3KYEA 2HP6A 3G34A 2HZ5A 3E4OA 3MXSA 3HLFA 1K0KA 1IYQA 4JGRA 4Q8IA 4CLCD 5J7EA 1FR6A 2MJ6A 4MN5A 4Y0TA 2VV8A 2XRNA 1K4FA 4KUKA 4QU3A 2Y2NA 4RYEA 4Y2FA 3IX8A 3OZHA 2X71A 4IBRA 4OVDA 2XLNA 3DAVA 3NOTC 3CZDA 1S4RA 4G3VA 2G2UA 3N4IA 2PD8A 1ZG6A 5M1AA 1GA0A 4WUJA 5A8BA 3LEQA 3IX3A 1ERMA 1OJGA 2HF6A 2G2WA 3KO6A 5FA7A 3QNBA 4Y3IA 3BFGA 3EGDC 3DWZA 2XA7M 4R1GA 5AQ9A 5EOOA 2L0WA 4BBVA 5HARA 3A3FA 5HW3A 4MDZA 5GHZA 5IU1A 1S4SA 1ZKJA 3ISGA 4EBLA 4NKPA 3A0SA 4S2MA 1EW0A 3BFFA 1MKMA 1VETA 1KGGA 3LY4A 1VB6A 4PPRA 1XJ4A 1PZOA 2OSUA 4EXOA 3QP4A 2Z2MB 4MBHA 4OQGA 4X69A 2B95A 2K7SA 2WGVA 3GQZA 4A5RA 3MFXA 1BZAA 3KSHA 2EX9A 3U2AA 1SZVA 4KZ7A 2W3EA 2ZOHA 4OPYA 3A3EA 4GD6A 4PM5A 1DJAA 2ZD8A 5F6AA 2E8IA 3UPOA 2EWVA 4QHCA 4PM8A 4BD1A 4RQ9A 2KX6A 2HDUA 5EE8A 2JBFA 2W3HA 2PHYA 1T18A 1SHVA 1H5XA 3UN7A 3WS2A 2JKRI 1PI5A 5GLBA 4CLCE 1VETB 3I7JA 3FC7A 1BTLA 5J8XA 3P01A 3JVUA 2WGIA 3C4OA 4KZBA 1IKGA 3MBZA 2PBDP 3LFVA 3C5AA 2HV1A 2NUTC 3KSGA 4R6LA 5DF7A 4I3JA 3V67A 5EECA 1N9LA 4EW7A 5EV0A 4B4ZA 3FWLA 1OTDA 3W8KA 3VMAA 4P0MA 1SCWA 4PMAA 2FFFB 1XGIA 1IEMA 3CPTA 4EEPA 2Y2MA 3SS3A 4ZJ1A 1BUEA 4ZRRA 2Z2LB 1XP4A 1MC0A 2OV5A 3VP1A 5EM0A 4LFUA 4MBKA 1YMSA 3QP5A 1XXMA 3NCKA 3EEHA 1YKDA 2P08A 2Y2PA 4B4XA 4WLAA 2EWWA 4E6WA 3N8SA 3MS6A 3PYPA 1YSQA 4WEKA 4X56A 4NXGA 2FH5A 2WZXA 1V9ZA 1XJ2A 4Y0OA 3PBSA 2ZJ9A 1BLHA 4NK3A 1DY6A 5F68A 3HUOA 4S2PA 2Y79A 1MKIA 2GDNA 1T1CA 5M18A 2XF3A 1SKFA 3GTCA 1KVMA 3M2JA 3VSLA 5L10A 5DKLA 1G5UA 4CPKA 3FYZA 4BL3A 1L0FA 4GHIA 4S2KA 2D02A 1MWTA 3V5MA 2ZLYA 3RXXA 2INWA 2XDMA 1L2SA 2H28A 1YPRA 1TDGA 2PR5A 4WZ5A 2WYXA 2AVXA 5U47A 1CQAA 4EERA 3SS5A 2EX8A 4PAUA 3LUQA 2J3WA 4R3JA 4L9FA 3WS1A 2VK3A 3F1PB 5TBMB 3N7WA 4EUVA 1W5DA 2XA7S 4NXFA 3MSHA 1YLYA 2XD5A 3HCYA 1BSGA 1H0MA 2ZQAA 2J8YA 1FOFA 2W27A 4LV1A 2Y55A 2X02A 3OPHA 4LV0A 3EQUA 4GDNA 1KDWA 2XQZA 3HLWA 3ZNTA 4GCZA 2ZQ8A 3WWXA 2XFTA 1S67L 3MR0A 3C8CA 5E43A 2V0UA 2Y2IA 2PRFA 1Z09A 1LL5A 1TS8A 1MWRA 3T1RA 4XXRA 3LIAA 3H82A 4RVAA 1O07A 2ACGA 3S7PA 3QP2A 4HH2A 4HY8A 2K31A 3MMHA 2QWSA 3TJZC 1RGYA 3S4XA 1YAXA 2XROA 1ES2A 3OPPA 1M6KA 5CHJA 1BULA 4JPMA 5FAOA 1Q2PA 2J7VA 3C30A 5HDSA 2UV0E 3VP2A 2P7JA 1OTBA 2A24B 4GW9A 2W3DA 4L0LA 1CJFA 4Q0JA 1PYYA 4O01A 4P6BA 1OJ5A 2BTFP 4Y5FA 4IEDA 3FV7A 4BENA 1ALQA 4EQ1A 4CLCC 1NYYA 1CF0A 1NJ4A 4DDSA 3V39A 3T4JA 2JCHA 1JTDA 4EESA 5HPFA 1I2SA 5FAPA 4K0WA 1NZUA 4FSFA 3M6BA 2R9WA 1L0DA 4KENB 1TF1A 4PM6A 3A3JA 4EUZA 5GLAA 4Q0HA 4ARZA 1S1ZA 4JXGA 3OPLA 3A0RA 1K55C 3MQ0A 4GJ4A 1XPBA 2JKTM 2ZC7A 2EFUA 3S7OA 5TR7A 4PHTA 3HLBA 3K3CA 4DN0A 2W3FA 2WKIA 2Q9NA 3OLOA 2B5RA 1K54C 3UNWA 5EVLA 4ZJ3A 2B02A 2ZMAA 3T4QA 4GKUA 4ETZA 3UPPA 3D4FA 2Z6DA 1W8QA 1E4DA 1OTAA 3ITAA 4R3AA 2HJEA 5FI2A 4Z1WA 1L0GA 3O3VA 2EX2A 4G3WA 4QWOA 1OT9A 1WE4A 3G30A 4E3NA 3LEZA 3WS0A 3UE0A 1N9OA 2JHEA 2HPBA 3O88A 2DNSA 5HFOA 1FCMA 4Y0UA 1LSXA 4QB8A 2A3UA 4ARZB 1K56A 3FPVA 4S2OA 4JKTA 4MBFA 1MWSA 3PBOA 3DTKA 2V0WA 2BASA 3F1OB 4BMWA 4HH3A 5DTSA 2ZQCA 2LB9A 3BFDA 4QY5A 3IWOA 2NUPC 2V1AA 5EVIA 2J80A 4I38A 1BT5A 2WADA 3OPRA 3C7VA 1J9MA 3ITBA 4M3KA 5TGFA 1JNUA 1GCEA 4CLCB 1IYOA 4E3KA 1ESIA 3CWFA 4QPRA 5EM1A 3T1XA 3S1YA 4S2JA 5FEFA 4HHDA 4WZ4A 4II7A 1TS6A 2KDKA 2OLUA 5HL1A 5HAPA 1HZOA 1MY8A 3IH9A 2O9CA 5CRFA 4DE2A 1FR1A 1DJCA 4N1XA 5E2GA 1IOUA 5K5BA 3LI8A 2D01A 4P87A 3BECA 3UMDA 3LR3A 5A92A 3SW1A 4E3OA 3IT9A 3A3DA 3HJKA 1LSVA 3S7NA 5DF8A 1KE3A 3M2KA 2V8FA 4IHQA 2IA2A 4MMNA 4EBPA 3H7WA 3DTIA 3D72A 3C4PA 4GLQA 3Q7VA 1PRQA 4E3JA 4LCMA 4R23A 1YT4A 3UE1A 5GLDA 4U3TA 1K6RA 3PBRA 4R4RA 1K56D 1YLJA 2ZMVA 3VSKA 4JXWA 3ZCZA 1UGUA 4OPZA 2E8JA 5F83A 2P74A 2A49A 1JWPA 4LRXC 1NWZA 4FD8A 1GSVA 2L4RA 1PI4A 3IH8A 1PWCA 2GNXA 1OMEA 5GHYA 2WKPA 2GZAA 5EVID 5A91A 2DMWA 5L09A 2P9VA 2WZZA 1E3UD 2ZM2A 3JVVA 4IVKA 4KZ8A 5CTNA 2OWJA 1G6OA 2ZC6B 5HAQA 3NULA 1XFNA 4Z9QA 2WGWA 2ZM0A 5HDDA 5IS1A 3G2ZA 4F3LA 3CG5A 5DF9A 1N9NA 4GS9A 1HLUP 2J3TD 4UA9A 2EX6A 3SS4A 3H9WA 4EQIA 1TS0A 1MWUA 5J3WA 3ZNYA 4QY6A 4E04A 2PYRA 3ZG8B 1BYWA 3HJIA 2O9AA 3CI6A 1N9BA 4R38A 2Q0OA 2FZ0A 1P9WA 4UHUA 3BWLA 1XJ3A 4QJGA 3CLOA 1D7EA 4R70A 3FG8A 3KYQA 1CI8A 2Y2JA 3UE3A 1SDEA 3TE8A 2X01A 4KZ6A 1N4OA 3AGFA 4HP9A 4HNBA 1LL9A 2VV6A 4MNRA 2GX5A 2QKPA 4LRYC 2VA0A 1NYMA 3HLEA 5FQKA 4ME4A 1S66L 5FQ9A 1ZTUA 4O0PA 4EETB 3IBJA 3F1NA 2PU2A 1STZA 1FCNA 4E3IA 3FPWA 3N6IA 5AQAA 2IWBA 1TS7A 4YINA 5FQJA 2A2LA 2ZC4B 2QMIA 3L7HA 5F5YA 1IFQA 4I5SA 4E6XA 1ES3A 4BD0A 1OTIA 3MZFA 4C75A 2XH9A 3NJAA 5CHUA 4OQ0A 1HVBA 2Q9MA 3DWKA 3IF6A 1FSYA 4JGQA 5D3OA 5CX7A 2B18A 4WZ5C 4BJPA 4N1HA 1F98A 5E2EA 2YKFA 5DJUA 4DE3A 3NOPC 1XFQA 2WAEA 4WMCA 2M7VA 2H0TA 4FUWA 1EI5A 4KQRA 4KZ3A 2VKSA 3VFHA 3UDXA 4OQIA 3A3IA 4X1MA 2J9OA 1P0ZA 3ZVTA 2ZL1A 3B3XA 1F5MA 4C3QA 5HWWA 3NECA 2V1BA 4DJ2A 5DFXA 5FASA 3VOZA 1WA9A 4WEJA 3IS2A 3OCLA 1CEFA 3LIDA 3GDIA 3ZQ5A 3PR6A 1NXYA 2IWDA 1DJBA 1SKOA 2QJ5A 4YNRA 3LCEA 3RJUA 5HPIA 4WM9A 2VGJA 3E4QA 3G4PA 3Q07A 3IF5A 4JGOA 3K2NA 3EEAA 1Q2QA 3CPTB 2O0YA 1Y28A 4XT2A 3C38A 4P85A 1NRJA 1KDSA 2QYBA 4X6TA 1C3BA 1JTGA 3OOVA 1W79A 1PNEA 3BQAA 4IUHA 5HWVA 4ZBEA 1YLZA 1K57C 4MCWA 2R9XA 4IUKA 4NXBA 1W8YA 4KG6A 2V8CA 4PKYG 2GJ3A 3FKVA 3GECA 1LSWA 5CGSA 3DBAA 1XA7A 2W0NA 2XR0A 3R4KA 4OPQA 4WMCD 5CGXA 3IQAA 4ZAMA 1PW8A 3UB7A 5GHXA 4F94A 3ZDJA 1K6SA 3W2ZA 2ZQ9A 3ICYA 5E2FA 4KZ5A 1K25A 4ZJ2A 4WBGA 4LENA 1GHPA 4UA6A 4LPZA 4GHIB 2JKFA 1DRMA 1KGFA 5G4ZA 2ZOIA 3G6OA 5EVEA 1GSXA 2HDQA 1I2WA 2YKHA 4HJ3A 5AVFA 3LIFA 1SDNA 4U0TA 4DMZA 4OPRA 5GL9A 1K57A 5CTMA 3TOIA 4XUZA 3NC8A 1D1JA 1K4EA
chains in the Genus database with same CATH topology
1E25A 1FCMA 1KGGA 4Y0UA 4QB8A 2A3UA 5FATA 2ZC3B 1K56A 3LY4A 3IHBA 4S2OA 4JKTA 3PBQA 4MBFA 1PIOA 4PPRA 1MWSA 3BLSA 3PBOA 1PZOA 3ZGAB 2OSUA 5FI7A 1PW1A 3BLMA 4OH0A 4RA7A 3W4PA 4N9LA 4OP8A 5DTSA 3NDEA 3ZG7B 2Z2MB 2ZQCA 5DTKA 3P98A 4MBHA 4OQGA 4S2IA 4X69A 3BFDA 3TG9A 1TVFA 4QY5A 2WGVA 3GQZA 2DCFA 4A5RA 3IWOA 4R0QA 3G31A 3PTEA 3ZFZA 5EVIA 4HESA 1BZAA 1BT5A 1MPLA 2WADA 3QHYA 3GRJA 3OPRA 2EX9A 3OC2A 3C7VA 1J9MA 3ZG0A 3ITBA 4M3KA 3V50A 3G2YA 5TGFA 4ZTKA 5AQ7A 3IF6B 4KZ7A 4R3BA 1GCEA 3MFDA 4KQOA 4OPYA 3A3EA 4OQHA 3E2LA 4RX3A 1FSWA 4GD6A 2H5SA 4DE0A 4QD4A 1I5QA 4PM5A 2HP5A 1IYOA 1PWDA 2CC1A 4E3KA 1DJAA 1ESIA 2ZD8A 2E8IA 5FAQA 3UPOA 4QHCA 4PM8A 4BD1A 3WS5A 4XUXA 3S1YA 4S2JA 4WZ4A 2HDUA 2OLUA 5EE8A 2JBFA 3MKEA 5HL1A 5HAPA 2VGKA 1HZOA 1MY8A 1QMEA 2JC7A 4HEFA 2C5WB 3GR2A 1LI0A 3IH9A 4OONA 5CRFA 5CECA 3BRMA 3MKFA 4IBXA 4DE2A 1FR1A 2QZ6A 1DJCA 1SHVA 3E2KA 4N1XA 1K38A 5IHVA 2Y2HA 5E2GA 4FH4A 1H5XA 3UN7A 3WS2A 4P87A 1YM1A 3BECA 3N8LA 1PI5A 5GLBA 2WK0A 3UDFA 4KZAA 2ZM8A 5FI6A 3S22A 4X53A 4LCLA 3I7JA 5A92A 4OOMA 2XFSA 4E3OA 3IT9A 1BTLA 3A3DA 5DF8A 1KE3A 4YFMA 3M2KA 5J8XA 4DE1A 1Y54A 4EBPA 3BM6A 5FQMA 4R4SA 1JWZA 2WGIA 5KSCA 3C4OA 4DF6A 4JF6A 1RCJA 3UDIA 4KZ9A 4KZBA 1IKGA 5DVAA 3MBZA 3BFEA 5EVIC 1U60A 3C4PA 5FQQA 4JXSA 1CK3A 3Q7VA 4E3JA 4LCMA 4R23A 1L0EA 1YT4A 3C5AA 3UE1A 3Q82A 5GLDA 4U3TA 1K6RA 3PBRA 3EQVA 1K56D 1YLJA 3HLGA 3PBTA 4R4RA 3VSKA 3ZVWA 2H10A 5DF7A 1NY0A 4JXWA 3IXGA 3ZCZA 2ZC5B 1LHYA 4OPZA 3WRZA 5F83A 5EECA 2P74A 2A49A 1JWPA 3PAEA 4JXVA 5M19A 4B4ZA 3FWLA 4FD8A 4E3MA 3PAGA 3W8KA 3UY6A 3O86A 1ES4A 4P0MA 3VMAA 1PI4A 3IH8A 1SCWA 2RL3A 3P09A 1PWCA 1HTZA 2FFFB 4KQQA 1XGIA 1OMEA 4PMAA 2ZQ7A 1IEMA 3DW0A 4GZBA 5GHYA 2Y2MA 3SS3A 1YQSA 4ZJ1A 1BUEA 2PBYA 2Z2LB 2H0YA 3JYIA 1XP4A 2QPNA 3GV9A 5EVID 5A91A 2OV5A 3UPNA 3VP1A 1QMFA 3M6HA 2P9VA 2WZZA 4Y7PA 4MBKA 4KG5A 1YMSA 1E3UD 2C6WB 2HP9A 1XXMA 2ZM2A 3NCKA 4IVKA 3VOYA 4KZ8A 4X55A 3CMZA 2XGNA 5CTNA 2WAFA 5HX9A 2Y2PA 4B4XA 2HDRA 2ZC6B 4EV4A 5CEBA 1AXBA 2WUQA 3IWIA 4E6WA 5A90A 5HAQA 3N8SA 2UWXA 2Y4AA 3WRTA 2Y91A 5EPHA 4JLFA 4Z9QA 1YMXA 2XEPA 1FCOA 2WGWA 4WEKA 2ZM0A 4X56A 1JWVA 3G2ZA 1IYPA 1FQGA 3VP4A 1G6AA 1MXOA 2WZXA 3CG5A 5DF9A 3G35A 5GLCA 4UA9A 2EX6A 4Y0OA 3PBSA 2ZJ9A 3SS4A 1BLHA 4NK3A 1DY6A 3VFFA 3HUOA 5L2FA 4S2PA 4EQIA 2EFXA 4DXCA 5I94A 2XK1A 1MKIA 2GDNA 5CHMA 1MWUA 3ZNYA 4QY6A 4UA7A 4S2NA 2EXAA 3NY4A 5M18A 3ZG8B 1LLBA 3NIAA 2XF3A 1ZG4A 1SKFA 3GTCA 1H8YA 1KVMA 1N9BA 1ESUA 3M2JA 4E3LA 3AGDA 3VSLA 4UHUA 3MZDA 3MZEA 3LO7A 4QJGA 2I72A 1XGJA 3FZCA 1WYCA 4CPKA 5CEDA 3FYZA 4BL3A 1L0FA 2RCXA 1H8ZA 4S2KA 1CI8A 5HAIA 2Y2JA 3V3RA 5KZHA 1MWTA 3UE3A 1SDEA 3V5MA 2X01A 3OCNA 2ZLYA 1KGEA 3RXXA 2XDMA 4KZ6A 3VP3A 1L2SA 2V2FF 1N4OA 3AGFA 3WS4A 1TDGA 4B88A 3HREA 3ZG5A 4WZ5A 1LL9A 1CI9A 1RP5A 2PU4A 2WYXA 4UAAA 5U47A 4JF5A 4MNRA 5F1GA 3NBLA 3UO9A 2XD1A 3ZG9B 1NYMA 2HDSA 5TFQA 3HLEA 3SS5A 1YLPA 3GSGA 2EX8A 5FQKA 1ONHA 1PZPA 5FQ9A 1IELA 3HVFA 5E2HA 1BLPA 4DKIA 4R3JA 3GVBA 3WS1A 3IHAA 2PU2A 5F1FA 2JE5A 3FKWA 1FCNA 2BG1A 3N7WA 3N6IA 4GDBA 1W5DA 4E3IA 5AQAA 2IWBA 5CXWA 1GHIA 1YLYA 2XD5A 4EWFA 3MXRA 1BSGA 3SH8A 2WKEA 2ZQAA 4FH2A 4IVIA 4S2NC 4BL2A 1IYSA 1S0WA 2J8YA 5CGWA 1FOFA 4YINA 5FQJA 2ZC4B 1ZC2A 2ZQDA 2QMIA 4LV1A 3QNCA 5EVIB 5AQBA 3PBNA 4E6XA 5A93A 2Y55A 2X02A 3OPHA 4LV0A 3EQUA 4GDNA 4FCFA 1KDWA 2XQZA 3HLWA 1ES3A 3ZNTA 4BD0A 1GA9A 1ONGA 3MZFA 4GN2A 2ZQ8A 1NRFA 3WWXA 4C75A 2XH9A 3BEBA 2XFTA 4CJNA 5CERA 5CHUA 3NI9A 4OQ0A 5E43A 1HVBA 2Q9MA 3DWKA 2Y2IA 3Q1FA 3IF6A 1FSYA 1LL5A 5FQIA 1MWRA 4DDYA 4GNUA 4XXRA 5D3OA 3HLCA 4WZ5C 4OKPA 4RVAA 4N9KA 4BJPA 1BLCA 1XX2A 4N1HA 4PM7A 3TSGA 4MLLA 2Y2KA 1O07A 3HBRA 5E2EA 3W4QA 3BYDA 4JBFA 4DE3A 2WAEA 1KE4A 4WMCA 2H0TA 1EWZA 3IXDA 5FDHA 1YLTA 1EI5A 4KQRA 1GHMA 1RGYA 3S4XA 4KZ3A 3VFHA 1G68A 4MEZA 3UDXA 1ES2A 1LI9A 2DRWA 4OQIA 3A3IA 1VQQA 3Q81A 2IWCA 4DXBA 3OPPA 2J9OA 3SOIA 5KSHA 2Y2GA 4U0XA 1M6KA 5CHJA 3ZVTA 1BULA 3IWQA 4JPMA 3B3XA 5FAOA 3HUNA 4C3QA 1Q2PA 2J7VA 4LV3A 4OP5A 1ES5A 1IKIA 5EOEA 3VP2A 5EUAA 4HBTA 3IXHA 5FASA 3G32A 1K55A 1KE0A 2Y2QA 3VOZA 3C7UA 4C6YA 5G18A 4WEJA 1PWGA 4HBUA 4H8RA 1JVJA 3OCLA 1CEFA 3O88A 4BLMA 1O7EA 1YLWA 2Y59A 3Q7VB 1MBLA 1NXYA 3LY3A 4L0LA 3AGEA 2IWDA 4GOGA 1PYYA 1DJBA 4P6BA 2Y2LA 5FSRA 1WYBA 3LCEA 3RJUA 1ERQA 4IEDA 4WM9A 4WYYA 2VGJA 3FV7A 1XKZA 1M40A 3ZHHA 1K54A 4OOLA 3HUMA 4BENA 1ALQA 4OLGA 3G4PA 4RX2A 3Q07A 3IF6C 2J9PA 3IF5A 1NYYA 4GB7A 4DRTA 1E3UA 1NJ4A 1S6RA 2V1ZA 5JYOA 4ZDXA 1EROA 4DDSA 3V39A 1Q2QA 2JCHA 4O7DA 1XA1A 1JTDA 4X68A 1I2SA 4K91A 4D2OA 5FAPA 4P85A 4K0WA 1NZUA 4FSFA 1VM1A 3M6BA 2R9WA 1L0DA 3VP0A 5DTTA 1KDSA 2EXBA 4KENB 4KG2A 1C3BA 1JTGA 1TDLA 2P9VB 3IXBA 3A3JA 4GD8A 4PM6A 1W79A 4S2LA 4EUZA 5GLAA 4EBNA 4OOYA 2FFYA 2HP6A 3G34A 3MXSA 4ZBEA 1YLZA 3HLFA 1HD8A 1K57C 1IYQA 2R9XA 4PM9A 4N92A 3SH9A 1W8YA 2WGWB 4K0XA 4KG6A 4JXGA 3OPLA 4Q8IA 2Y2OA 1FR6A 3FKVA 1CEGA 1K55C 3DTMA 4X6TA 5CGSA 1RGZA 4KZ4A 1XPBA 4Y0TA 2ZC7A 4JF4A 1XA7A 2BLSA 2EFUA 2XR0A 2V20A 4OPQA 1K4FA 4WMCD 5CGXA 3IQAA 4ID4A 1PW8A 4ZAMA 1W7FA 5BOHA 5GHXA 4QU3A 5TR7A 4F94A 1TEMA 3HLBA 2Y2NA 4RYEA 3ZDJA 5JYPA 1K6SA 3BFCA 2WKIA 3OZHA 2Q9NA 2X71A 2B5RA 4IBRA 2WKHA 4OVDA 2ZQ9A 3HL9A 1K54C 3UNWA 2XLNA 5E2FA 5EVLA 4KZ5A 1K25A 2ZMAA 3NDGA 4ZJ3A 4ZJ2A 3GMWA 3CZDA 4WBGA 4GKUA 1BLSA 2G2UA 1NZOA 4LV2A 4LENA 1Z6FA 3UPPA 3N4IA 3Q7ZA 1GHPA 1ZG6A 3O87A 3D4FA 4BQMA 4UA6A 1GA0A 5M1AA 5F82A 3SH7A 3CJMA 1KGFA 1E4DA 1W8QA 1ERMA 3ITAA 4OLDA 5FI2A 3V3SA 3N8RA 2OLVA 1L0GA 2G2WA 3O3VA 2HDQA 5KMWA 2EX2A 5FA7A 3QNBA 1I2WA 3BFGA 1WE4A 1KVLA 3DWZA 3G30A 3HLDA 4E3NA 4R1GA 5AQ9A 5EOOA 3LEZA 1SDNA 5HARA 3A3FA 5HW3A 3W4OA 3WS0A 5GHZA 4U0TA 3UE0A 4OPRA 5GL9A 1ZKJA 4NETA 1K57A 3ISGA 5CTMA 4XUZA 3TOIA 4EBLA 4WELA 3RXWA 4S2MA 3NC8A 2HPBA 3BFFA 2DNSA 5HFOA 1K4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E25 A;  1FCM A;  1KGG A;  4Y0U A;  4QB8 A;  2A3U A;  5FAT A;  2ZC3 B;  1K56 A;  3LY4 A;  3IHB A;  4S2O A;  4JKT A;  3PBQ A;  4MBF A;  1PIO A;  4PPR A;  1MWS A;  3BLS A;  3PBO A;  1PZO A;  3ZGA B;  2OSU A;  5FI7 A;  1PW1 A;  3BLM A;  4OH0 A;  4RA7 A;  3W4P A;  4N9L A;  4OP8 A;  5DTS A;  3NDE A;  3ZG7 B;  2Z2M B;  2ZQC A;  5DTK A;  3P98 A;  4MBH A;  4OQG A;  4S2I A;  4X69 A;  3BFD A;  3TG9 A;  1TVF A;  4QY5 A;  2WGV A;  3GQZ A;  2DCF A;  4A5R A;  3IWO A;  4R0Q A;  3G31 A;  3PTE A;  3ZFZ A;  5EVI A;  4HES A;  1BZA A;  1BT5 A;  1MPL A;  2WAD A;  3QHY A;  3GRJ A;  3OPR A;  2EX9 A;  3OC2 A;  3C7V A;  1J9M A;  3ZG0 A;  3ITB A;  4M3K A;  3V50 A;  3G2Y A;  5TGF A;  4ZTK A;  5AQ7 A;  3IF6 B;  4KZ7 A;  4R3B A;  1GCE A;  3MFD A;  4KQO A;  4OPY A;  3A3E A;  4OQH A;  3E2L A;  4RX3 A;  1FSW A;  4GD6 A;  2H5S A;  4DE0 A;  4QD4 A;  1I5Q A;  4PM5 A;  2HP5 A;  1IYO A;  1PWD A;  2CC1 A;  4E3K A;  1DJA A;  1ESI A;  2ZD8 A;  2E8I A;  5FAQ A;  3UPO A;  4QHC A;  4PM8 A;  4BD1 A;  3WS5 A;  4XUX A;  3S1Y A;  4S2J A;  4WZ4 A;  2HDU A;  2OLU A;  5EE8 A;  2JBF A;  3MKE A;  5HL1 A;  5HAP A;  2VGK A;  1HZO A;  1MY8 A;  1QME A;  2JC7 A;  4HEF A;  2C5W B;  3GR2 A;  1LI0 A;  3IH9 A;  4OON A;  5CRF A;  5CEC A;  3BRM A;  3MKF A;  4IBX A;  4DE2 A;  1FR1 A;  2QZ6 A;  1DJC A;  1SHV A;  3E2K A;  4N1X A;  1K38 A;  5IHV A;  2Y2H A;  5E2G A;  4FH4 A;  1H5X A;  3UN7 A;  3WS2 A;  4P87 A;  1YM1 A;  3BEC A;  3N8L A;  1PI5 A;  5GLB A;  2WK0 A;  3UDF A;  4KZA A;  2ZM8 A;  5FI6 A;  3S22 A;  4X53 A;  4LCL A;  3I7J A;  5A92 A;  4OOM A;  2XFS A;  4E3O A;  3IT9 A;  1BTL A;  3A3D A;  5DF8 A;  1KE3 A;  4YFM A;  3M2K A;  5J8X A;  4DE1 A;  1Y54 A;  4EBP A;  3BM6 A;  5FQM A;  4R4S A;  1JWZ A;  2WGI A;  5KSC A;  3C4O A;  4DF6 A;  4JF6 A;  1RCJ A;  3UDI A;  4KZ9 A;  4KZB A;  1IKG A;  5DVA A;  3MBZ A;  3BFE A;  5EVI C;  1U60 A;  3C4P A;  5FQQ A;  4JXS A;  1CK3 A;  3Q7V A;  4E3J A;  4LCM A;  4R23 A;  1L0E A;  1YT4 A;  3C5A A;  3UE1 A;  3Q82 A;  5GLD A;  4U3T A;  1K6R A;  3PBR A;  3EQV A;  1K56 D;  1YLJ A;  3HLG A;  3PBT A;  4R4R A;  3VSK A;  3ZVW A;  2H10 A;  5DF7 A;  1NY0 A;  4JXW A;  3IXG A;  3ZCZ A;  2ZC5 B;  1LHY A;  4OPZ A;  3WRZ A;  5F83 A;  5EEC A;  2P74 A;  2A49 A;  1JWP A;  3PAE A;  4JXV A;  5M19 A;  4B4Z A;  3FWL A;  4FD8 A;  4E3M A;  3PAG A;  3W8K A;  3UY6 A;  3O86 A;  1ES4 A;  4P0M A;  3VMA A;  1PI4 A;  3IH8 A;  1SCW A;  2RL3 A;  3P09 A;  1PWC A;  1HTZ A;  2FFF B;  4KQQ A;  1XGI A;  1OME A;  4PMA A;  2ZQ7 A;  1IEM A;  3DW0 A;  4GZB A;  5GHY A;  2Y2M A;  3SS3 A;  1YQS A;  4ZJ1 A;  1BUE A;  2PBY A;  2Z2L B;  2H0Y A;  3JYI A;  1XP4 A;  2QPN A;  3GV9 A;  5EVI D;  5A91 A;  2OV5 A;  3UPN A;  3VP1 A;  1QMF A;  3M6H A;  2P9V A;  2WZZ A;  4Y7P A;  4MBK A;  4KG5 A;  1YMS A;  1E3U D;  2C6W B;  2HP9 A;  1XXM A;  2ZM2 A;  3NCK A;  4IVK A;  3VOY A;  4KZ8 A;  4X55 A;  3CMZ A;  2XGN A;  5CTN A;  2WAF A;  5HX9 A;  2Y2P A;  4B4X A;  2HDR A;  2ZC6 B;  4EV4 A;  5CEB A;  1AXB A;  2WUQ A;  3IWI A;  4E6W A;  5A90 A;  5HAQ A;  3N8S A;  2UWX A;  2Y4A A;  3WRT A;  2Y91 A;  5EPH A;  4JLF A;  4Z9Q A;  1YMX A;  2XEP A;  1FCO A;  2WGW A;  4WEK A;  2ZM0 A;  4X56 A;  1JWV A;  3G2Z A;  1IYP A;  1FQG A;  3VP4 A;  1G6A A;  1MXO A;  2WZX A;  3CG5 A;  5DF9 A;  3G35 A;  5GLC A;  4UA9 A;  2EX6 A;  4Y0O A;  3PBS A;  2ZJ9 A;  3SS4 A;  1BLH A;  4NK3 A;  1DY6 A;  3VFF A;  3HUO A;  5L2F A;  4S2P A;  4EQI A;  2EFX A;  4DXC A;  5I94 A;  2XK1 A;  1MKI A;  2GDN A;  5CHM A;  1MWU A;  3ZNY A;  4QY6 A;  4UA7 A;  4S2N A;  2EXA A;  3NY4 A;  5M18 A;  3ZG8 B;  1LLB A;  3NIA A;  2XF3 A;  1ZG4 A;  1SKF A;  3GTC A;  1H8Y A;  1KVM A;  1N9B A;  1ESU A;  3M2J A;  4E3L A;  3AGD A;  3VSL A;  4UHU A;  3MZD A;  3MZE A;  3LO7 A;  4QJG A;  2I72 A;  1XGJ A;  3FZC A;  1WYC A;  4CPK A;  5CED A;  3FYZ A;  4BL3 A;  1L0F A;  2RCX A;  1H8Z A;  4S2K A;  1CI8 A;  5HAI A;  2Y2J A;  3V3R A;  5KZH A;  1MWT A;  3UE3 A;  1SDE A;  3V5M A;  2X01 A;  3OCN A;  2ZLY A;  1KGE A;  3RXX A;  2XDM A;  4KZ6 A;  3VP3 A;  1L2S A;  2V2F F;  1N4O A;  3AGF A;  3WS4 A;  1TDG A;  4B88 A;  3HRE A;  3ZG5 A;  4WZ5 A;  1LL9 A;  1CI9 A;  1RP5 A;  2PU4 A;  2WYX A;  4UAA A;  5U47 A;  4JF5 A;  4MNR A;  5F1G A;  3NBL A;  3UO9 A;  2XD1 A;  3ZG9 B;  1NYM A;  2HDS A;  5TFQ A;  3HLE A;  3SS5 A;  1YLP A;  3GSG A;  2EX8 A;  5FQK A;  1ONH A;  1PZP A;  5FQ9 A;  1IEL A;  3HVF A;  5E2H A;  1BLP A;  4DKI A;  4R3J A;  3GVB A;  3WS1 A;  3IHA A;  2PU2 A;  5F1F A;  2JE5 A;  3FKW A;  1FCN A;  2BG1 A;  3N7W A;  3N6I A;  4GDB A;  1W5D A;  4E3I A;  5AQA A;  2IWB A;  5CXW A;  1GHI A;  1YLY A;  2XD5 A;  4EWF A;  3MXR A;  1BSG A;  3SH8 A;  2WKE A;  2ZQA A;  4FH2 A;  4IVI A;  4S2N C;  4BL2 A;  1IYS A;  1S0W A;  2J8Y A;  5CGW A;  1FOF A;  4YIN A;  5FQJ A;  2ZC4 B;  1ZC2 A;  2ZQD A;  2QMI A;  4LV1 A;  3QNC A;  5EVI B;  5AQB A;  3PBN A;  4E6X A;  5A93 A;  2Y55 A;  2X02 A;  3OPH A;  4LV0 A;  3EQU A;  4GDN A;  4FCF A;  1KDW A;  2XQZ A;  3HLW A;  1ES3 A;  3ZNT A;  4BD0 A;  1GA9 A;  1ONG A;  3MZF A;  4GN2 A;  2ZQ8 A;  1NRF A;  3WWX A;  4C75 A;  2XH9 A;  3BEB A;  2XFT A;  4CJN A;  5CER A;  5CHU A;  3NI9 A;  4OQ0 A;  5E43 A;  1HVB A;  2Q9M A;  3DWK A;  2Y2I A;  3Q1F A;  3IF6 A;  1FSY A;  1LL5 A;  5FQI A;  1MWR A;  4DDY A;  4GNU A;  4XXR A;  5D3O A;  3HLC A;  4WZ5 C;  4OKP A;  4RVA A;  4N9K A;  4BJP A;  1BLC A;  1XX2 A;  4N1H A;  4PM7 A;  3TSG A;  4MLL A;  2Y2K A;  1O07 A;  3HBR A;  5E2E A;  3W4Q A;  3BYD A;  4JBF A;  4DE3 A;  2WAE A;  1KE4 A;  4WMC A;  2H0T A;  1EWZ A;  3IXD A;  5FDH A;  1YLT A;  1EI5 A;  4KQR A;  1GHM A;  1RGY A;  3S4X A;  4KZ3 A;  3VFH A;  1G68 A;  4MEZ A;  3UDX A;  1ES2 A;  1LI9 A;  2DRW A;  4OQI A;  3A3I A;  1VQQ A;  3Q81 A;  2IWC A;  4DXB A;  3OPP A;  2J9O A;  3SOI A;  5KSH A;  2Y2G A;  4U0X A;  1M6K A;  5CHJ A;  3ZVT A;  1BUL A;  3IWQ A;  4JPM A;  3B3X A;  5FAO A;  3HUN A;  4C3Q A;  1Q2P A;  2J7V A;  4LV3 A;  4OP5 A;  1ES5 A;  1IKI A;  5EOE A;  3VP2 A;  5EUA A;  4HBT A;  3IXH A;  5FAS A;  3G32 A;  1K55 A;  1KE0 A;  2Y2Q A;  3VOZ A;  3C7U A;  4C6Y A;  5G18 A;  4WEJ A;  1PWG A;  4HBU A;  4H8R A;  1JVJ A;  3OCL A;  1CEF A;  3O88 A;  4BLM A;  1O7E A;  1YLW A;  2Y59 A;  3Q7V B;  1MBL A;  1NXY A;  3LY3 A;  4L0L A;  3AGE A;  2IWD A;  4GOG A;  1PYY A;  1DJB A;  4P6B A;  2Y2L A;  5FSR A;  1WYB A;  3LCE A;  3RJU A;  1ERQ A;  4IED A;  4WM9 A;  4WYY A;  2VGJ A;  3FV7 A;  1XKZ A;  1M40 A;  3ZHH A;  1K54 A;  4OOL A;  3HUM A;  4BEN A;  1ALQ A;  4OLG A;  3G4P A;  4RX2 A;  3Q07 A;  3IF6 C;  2J9P A;  3IF5 A;  1NYY A;  4GB7 A;  4DRT A;  1E3U A;  1NJ4 A;  1S6R A;  2V1Z A;  5JYO A;  4ZDX A;  1ERO A;  4DDS A;  3V39 A;  1Q2Q A;  2JCH A;  4O7D A;  1XA1 A;  1JTD A;  4X68 A;  1I2S A;  4K91 A;  4D2O A;  5FAP A;  4P85 A;  4K0W A;  1NZU A;  4FSF A;  1VM1 A;  3M6B A;  2R9W A;  1L0D A;  3VP0 A;  5DTT A;  1KDS A;  2EXB A;  4KEN B;  4KG2 A;  1C3B A;  1JTG A;  1TDL A;  2P9V B;  3IXB A;  3A3J A;  4GD8 A;  4PM6 A;  1W79 A;  4S2L A;  4EUZ A;  5GLA A;  4EBN A;  4OOY A;  2FFY A;  2HP6 A;  3G34 A;  3MXS A;  4ZBE A;  1YLZ A;  3HLF A;  1HD8 A;  1K57 C;  1IYQ A;  2R9X A;  4PM9 A;  4N92 A;  3SH9 A;  1W8Y A;  2WGW B;  4K0X A;  4KG6 A;  4JXG A;  3OPL A;  4Q8I A;  2Y2O A;  1FR6 A;  3FKV A;  1CEG A;  1K55 C;  3DTM A;  4X6T A;  5CGS A;  1RGZ A;  4KZ4 A;  1XPB A;  4Y0T A;  2ZC7 A;  4JF4 A;  1XA7 A;  2BLS A;  2EFU A;  2XR0 A;  2V20 A;  4OPQ A;  1K4F A;  4WMC D;  5CGX A;  3IQA A;  4ID4 A;  1PW8 A;  4ZAM A;  1W7F A;  5BOH A;  5GHX A;  4QU3 A;  5TR7 A;  4F94 A;  1TEM A;  3HLB A;  2Y2N A;  4RYE A;  3ZDJ A;  5JYP A;  1K6S A;  3BFC A;  2WKI A;  3OZH A;  2Q9N A;  2X71 A;  2B5R A;  4IBR A;  2WKH A;  4OVD A;  2ZQ9 A;  3HL9 A;  1K54 C;  3UNW A;  2XLN A;  5E2F A;  5EVL A;  4KZ5 A;  1K25 A;  2ZMA A;  3NDG A;  4ZJ3 A;  4ZJ2 A;  3GMW A;  3CZD A;  4WBG A;  4GKU A;  1BLS A;  2G2U A;  1NZO A;  4LV2 A;  4LEN A;  1Z6F A;  3UPP A;  3N4I A;  3Q7Z A;  1GHP A;  1ZG6 A;  3O87 A;  3D4F A;  4BQM A;  4UA6 A;  1GA0 A;  5M1A A;  5F82 A;  3SH7 A;  3CJM A;  1KGF A;  1E4D A;  1W8Q A;  1ERM A;  3ITA A;  4OLD A;  5FI2 A;  3V3S A;  3N8R A;  2OLV A;  1L0G A;  2G2W A;  3O3V A;  2HDQ A;  5KMW A;  2EX2 A;  5FA7 A;  3QNB A;  1I2W A;  3BFG A;  1WE4 A;  1KVL A;  3DWZ A;  3G30 A;  3HLD A;  4E3N A;  4R1G A;  5AQ9 A;  5EOO A;  3LEZ A;  1SDN A;  5HAR A;  3A3F A;  5HW3 A;  3W4O A;  3WS0 A;  5GHZ A;  4U0T A;  3UE0 A;  4OPR A;  5GL9 A;  1ZKJ A;  4NET A;  1K57 A;  3ISG A;  5CTM A;  4XUZ A;  3TOI A;  4EBL A;  4WEL A;  3RXW A;  4S2M A;  3NC8 A;  2HPB A;  3BFF A;  2DNS A;  5HFO A;  1K4E A; 
#chains in the Genus database with same CATH topology
 1E25 A;  2ZC3 B;  3IHB A;  5C5K A;  2VJW A;  4PKY A;  3BLS A;  4YOF A;  5FI7 A;  3BLM A;  4OH0 A;  4RA7 A;  2M7U A;  4N9L A;  4OP8 A;  3TRC A;  2JKR M;  5L8M A;  3NDE A;  3ZG7 B;  3UE6 A;  5DTK A;  3TG9 A;  3E0Y A;  2DCF A;  4R0Q A;  4WF0 A;  5G4Y A;  1MPL A;  4NG2 A;  3LI9 A;  1UWP X;  5AQ7 A;  4R3B A;  1P9R A;  2HJ9 C;  4DE0 A;  3H82 B;  4QD4 A;  5HD5 A;  1PWD A;  2CC1 A;  2CMN A;  5FAQ A;  2O99 A;  5L07 A;  3ULF A;  2JC7 A;  4HEF A;  2C5W B;  3GR2 A;  1LI0 A;  5CEC A;  4IBX A;  2OAP 1;  3E2K A;  1K38 A;  5IHV A;  2WK0 A;  3B42 A;  2ZM8 A;  4LCL A;  4OOM A;  2EA9 A;  1TD5 A;  5AVE A;  3BM6 A;  5FQM A;  2W1T A;  4JF6 A;  4KZ9 A;  4LRZ E;  5EVI C;  1U60 A;  5FQQ A;  4JXS A;  1CK3 A;  4HJ6 A;  1L0E A;  3Q82 A;  4HQA A;  3HLG A;  2JN7 A;  3EGX C;  2H10 A;  4IJG A;  4HP4 A;  3KX0 X;  1X0O A;  4X25 A;  2KOI A;  3D3O A;  3E98 A;  4JXV A;  5M19 A;  5J4E A;  4K08 A;  2QHK A;  3UY6 A;  1ES4 A;  2QJ7 A;  1VEU A;  4KQQ A;  2J3T C;  4GZB A;  3DW0 A;  4LLO B;  1DP8 A;  3JYI A;  4H6J A;  3UPN A;  1QMF A;  3M6H A;  4KG5 A;  2C6W B;  3VOY A;  1FIK A;  3CMZ A;  2WAF A;  2HDR A;  4KUO A;  1AXB A;  5A90 A;  2Y4A A;  4JLF A;  4HIA A;  1YMX A;  2XEP A;  1ZHH B;  1JWV A;  3VP4 A;  3G35 A;  4B9O A;  3VFF A;  1A0K A;  2EFX A;  4G3K A;  4FOF A;  4S2N A;  2EXA A;  3NY4 A;  1LLB A;  3NIA A;  4E3L A;  4NEE D;  3MZD A;  5IT5 A;  2I72 A;  1XGJ A;  3FZC A;  1WYC A;  5KZH A;  4HOI A;  3OCN A;  2V2F F;  3WS4 A;  5AJG A;  1CI9 A;  3LR5 A;  4UAA A;  5F1G A;  4EU0 A;  3NBL A;  4JGP A;  2HDS A;  4Q0I A;  1PZP A;  3T4L A;  1IEL A;  1BLP A;  3KSI A;  3VV4 A;  3GVB A;  5F1F A;  3MF0 A;  3FKW A;  4Y17 A;  3CAX A;  1GHI A;  4EWF A;  1UWN X;  1T1B A;  3DTE A;  2PT7 A;  4BL2 A;  1IYS A;  1S0W A;  3U4L P;  5FL3 A;  1T19 A;  2HGV A;  5EVI B;  5AQB A;  3PBN A;  3E4P A;  4EEU A;  1NLZ A;  2JKG A;  3UB5 P;  1ONG A;  4GN2 A;  1NRF A;  3EWK A;  4CJN A;  3RTY A;  5CER A;  3NI9 A;  2VGL M;  5HDC A;  4UEY A;  4Y15 A;  5FQI A;  4GNU A;  1MZU A;  3HLC A;  4OKP A;  3D9Y A;  4PM7 A;  3TSG A;  2M1C A;  2Y2K A;  2LB5 A;  3HBR A;  3W4Q A;  3T4O A;  2ZMF A;  4JBF A;  1EWZ A;  1G68 A;  2DRW A;  3Q81 A;  2IWC A;  4DXB A;  3UB8 A;  2Y2G A;  4U0X A;  3IWQ A;  4YWZ A;  4LV3 A;  4OP5 A;  1ES5 A;  1IKI A;  5EOE A;  5EUA A;  3IXH A;  3G32 A;  3H7W B;  4BBT A;  1KE0 A;  3C7U A;  5G18 A;  1PWG A;  4HBU A;  4H8R A;  1JVJ A;  5HSQ A;  2Y59 A;  3Q7V B;  4MN7 A;  3A0V A;  1OPX A;  3CHW P;  3AGE A;  3TW8 A;  2Y2L A;  1J3W A;  1ERQ A;  1XKZ A;  1M40 A;  4L9E A;  3LYX A;  4RX2 A;  3IF6 C;  4GB7 A;  4DRT A;  2V1Z A;  1S6R A;  5JYO A;  4ZDX A;  1ERO A;  3T4S A;  2I9V A;  3B47 A;  4NXE A;  1XA1 A;  4X68 A;  1YSP A;  5DTT A;  2EXB A;  4HJ4 A;  4UQI M;  3WRZ A;  2P9V B;  3IXB A;  5JYP A;  3BW6 A;  2FFY A;  2VV7 A;  1F2K A;  1HD8 A;  4ESP A;  4PM9 A;  4N92 A;  3SH9 A;  2WGW B;  4K0X A;  2Y2O A;  4F3L B;  3T12 B;  1CEG A;  4GS9 B;  3DTM A;  3PXP A;  3EOI A;  1RGZ A;  4KZ4 A;  4JF4 A;  2BLS A;  5HZH A;  2V20 A;  1W63 Q;  4ID4 A;  5BOH A;  1W7F A;  1TEM A;  3BFC A;  2WKH A;  3HL9 A;  4LGW A;  3NDG A;  3LIE A;  1G28 A;  3GMW A;  4DJ3 A;  1BLS A;  1NZO A;  4LV2 A;  1Z6F A;  3Q7Z A;  3O87 A;  4BQM A;  3CUE C;  1Y4O A;  5F82 A;  3SH7 A;  3CJM A;  1F9I A;  2O9B A;  2PYP A;  4OLD A;  3V3S A;  3T4T A;  3N8R A;  2OLV A;  1DP6 A;  2VX8 A;  5KMW A;  3T4K A;  3OBF A;  1KVL A;  3HLD A;  4I3A A;  3W4O A;  2JKT I;  4Y13 A;  3KYZ A;  4NET A;  4WEL A;  3RXW A;  1KE4 A;  3VE3 A;  2BG1 A;  3LGO A;  3F1N B;  2P04 A;  5FAT A;  3PBQ A;  1W63 M;  5TJJ A;  1PIO A;  4P6Z M;  3F1P A;  2PD7 A;  3B33 A;  5TBM A;  3C2W A;  3ZGA B;  1PW1 A;  3BJN A;  3W4P A;  3BQ8 A;  3P98 A;  4S2I A;  1TVF A;  3G31 A;  3PTE A;  3ZFZ A;  1L3L A;  3PHY A;  4HES A;  5DKK A;  1LL8 A;  2WKQ A;  3QHY A;  3GRJ A;  3LR4 A;  3OC2 A;  3ZG0 A;  3V50 A;  3CUE A;  3G2Y A;  4ZTK A;  3RFB A;  3IF6 B;  4BWI A;  3MFD A;  4KQO A;  4OQH A;  4RX3 A;  3E2L A;  1FSW A;  2H5S A;  1I5Q A;  2HP5 A;  2VEA A;  5EFW A;  3R7W A;  5KIZ A;  3WS5 A;  4XUX A;  2OWH A;  3MKE A;  2KLI A;  2VGK A;  2Y8H A;  1QME A;  3MXQ A;  4OON A;  3BRM A;  3MKF A;  3T1Q B;  5MC7 A;  5F69 A;  2QZ6 A;  2Y2H A;  2VGL S;  4FH4 A;  1H3Q A;  1YM1 A;  2ZL1 B;  3N8L A;  3UDF A;  4KZA A;  5FI6 A;  3S22 A;  1PFL A;  4X53 A;  4WL9 A;  2XFS A;  4X1L A;  2W1R A;  4YFM A;  3IS2 B;  1XJ6 A;  4DE1 A;  1Y54 A;  5HL6 A;  3MQO A;  4R4S A;  1JWZ A;  5KSC A;  4DF6 A;  2A24 A;  1RCJ A;  2PAV P;  3UDI A;  1SKO B;  5DVA A;  3BFE A;  1T1A A;  2PDR A;  4KQD A;  3EQV A;  3PBT A;  3ZVW A;  1NY0 A;  3IXG A;  2G7U A;  2ZC5 B;  1LHY A;  3PAE A;  4XT2 B;  3PAG A;  1AWI A;  3P7N A;  4E3M A;  1D06 A;  3O86 A;  4AFI A;  3P09 A;  2RL3 A;  1HTZ A;  2W3G A;  2VLG A;  2ZQ7 A;  3VE4 A;  1YQS A;  4D60 A;  2PBY A;  3R7W B;  2H0Y A;  2QPN A;  3GV9 A;  5I5L A;  4CQH A;  4Y7P A;  4MN6 A;  2HP9 A;  3VOL A;  4X55 A;  2XGN A;  4O8G A;  5HX9 A;  3SZT A;  4EV4 A;  5CEB A;  1GSW A;  3IWI A;  2WUQ A;  2UWX A;  3WRT A;  2Y91 A;  5EPH A;  1FCO A;  1IYP A;  1FQG A;  1OT6 A;  1G6A A;  1MXO A;  5GLC A;  4UQI S;  3O5Y A;  5LBR A;  3UME A;  2L1M A;  5L2F A;  4DXC A;  5I94 A;  2XK1 A;  5CHM A;  3BY9 A;  4UA7 A;  4B93 A;  3NOU C;  1H8M A;  4BBU A;  1ZG4 A;  2K2N A;  1H8Y A;  1ESU A;  1OTE A;  3AGD A;  3UB6 A;  3MZE A;  2OOL A;  3LO7 A;  1KOU A;  5CED A;  2RCX A;  5HAI A;  1H8Z A;  3V3R A;  3RH8 B;  5FEG A;  3T1S A;  1KGE A;  3VP3 A;  4ETX A;  3L9K A;  3QP1 A;  4B88 A;  3HRE A;  2OAQ 1;  3ZG5 A;  1RP5 A;  2PU4 A;  2VZW A;  4JF5 A;  4FTX A;  3UO9 A;  2XD1 A;  3ZG9 B;  5HD3 A;  5TFQ A;  1YLP A;  3GSG A;  1ONH A;  4I39 A;  5E2H A;  3HVF A;  4DKI A;  3NHQ A;  3IHA A;  2JE5 A;  3LIB A;  4GDB A;  1ODV A;  3LIC A;  5CXW A;  3MJQ A;  1NLY A;  4L9G A;  3MXR A;  3SH8 A;  2WKE A;  3F1O A;  4FH2 A;  4IVI A;  4S2N C;  5CGW A;  1ZC2 A;  2ZQD A;  3T50 A;  3QNC A;  5A93 A;  4FCF A;  1GA9 A;  4P6Z S;  3UB9 A;  3BEB A;  5DJT A;  1FIL A;  3Q1F A;  3BY8 A;  3ZYT A;  4CLC A;  4DDY A;  3QP6 A;  4N9K A;  1BLC A;  1XX2 A;  4MLL A;  3QP8 A;  3BYD A;  3MQQ A;  3IBR A;  3IXD A;  5FDH A;  1YLT A;  1GHM A;  3CIT A;  2ZBB A;  4MEZ A;  1LI9 A;  4I3I A;  1VQQ A;  3SOI A;  5KSH A;  2WKR A;  3HUN A;  4M4X A;  1VHM A;  4HBT A;  1K55 A;  2Y2Q A;  3S7Q A;  2W1T B;  4C6Y A;  4BLM A;  1O7E A;  1YLW A;  2R78 A;  3JPU A;  4WN5 A;  1MBL A;  3LY3 A;  3K3D A;  4GOG A;  1ACF A;  5FSR A;  1WYB A;  3IX4 A;  2PR6 A;  4WYY A;  1V9Y A;  2V9A A;  3ZHH A;  1K54 A;  4OOL A;  5DFY A;  3HUM A;  5HWT A;  1S1Y A;  4OLG A;  2J9P A;  1LT0 A;  1P97 A;  2Z6C A;  1E3U A;  1VEU B;  4O7D A;  4K91 A;  4D2O A;  1VM1 A;  2XSS A;  4H6J B;  1DP9 A;  3KSF A;  3VP0 A;  4HI4 A;  4KG2 A;  1TDL A;  4GD8 A;  4S2L A;  3LR0 A;  4EBN A;  4OOY A;  5FDS A;  3KYE A;  2HP6 A;  3G34 A;  2HZ5 A;  3E4O A;  3MXS A;  3HLF A;  1K0K A;  1IYQ A;  4JGR A;  4Q8I A;  4CLC D;  5J7E A;  1FR6 A;  2MJ6 A;  4MN5 A;  4Y0T A;  2VV8 A;  2XRN A;  1K4F A;  4KUK A;  4QU3 A;  2Y2N A;  4RYE A;  4Y2F A;  3IX8 A;  3OZH A;  2X71 A;  4IBR A;  4OVD A;  2XLN A;  3DAV A;  3NOT C;  3CZD A;  1S4R A;  4G3V A;  2G2U A;  3N4I A;  2PD8 A;  1ZG6 A;  5M1A A;  1GA0 A;  4WUJ A;  5A8B A;  3LEQ A;  3IX3 A;  1ERM A;  1OJG A;  2HF6 A;  2G2W A;  3KO6 A;  5FA7 A;  3QNB A;  4Y3I A;  3BFG A;  3EGD C;  3DWZ A;  2XA7 M;  4R1G A;  5AQ9 A;  5EOO A;  2L0W A;  4BBV A;  5HAR A;  3A3F A;  5HW3 A;  4MDZ A;  5GHZ A;  5IU1 A;  1S4S A;  1ZKJ A;  3ISG A;  4EBL A;  4NKP A;  3A0S A;  4S2M A;  1EW0 A;  3BFF A;  1MKM A;  1VET A;  1KGG A;  3LY4 A;  1VB6 A;  4PPR A;  1XJ4 A;  1PZO A;  2OSU A;  4EXO A;  3QP4 A;  2Z2M B;  4MBH A;  4OQG A;  4X69 A;  2B95 A;  2K7S A;  2WGV A;  3GQZ A;  4A5R A;  3MFX A;  1BZA A;  3KSH A;  2EX9 A;  3U2A A;  1SZV A;  4KZ7 A;  2W3E A;  2ZOH A;  4OPY A;  3A3E A;  4GD6 A;  4PM5 A;  1DJA A;  2ZD8 A;  5F6A A;  2E8I A;  3UPO A;  2EWV A;  4QHC A;  4PM8 A;  4BD1 A;  4RQ9 A;  2KX6 A;  2HDU A;  5EE8 A;  2JBF A;  2W3H A;  2PHY A;  1T18 A;  1SHV A;  1H5X A;  3UN7 A;  3WS2 A;  2JKR I;  1PI5 A;  5GLB A;  4CLC E;  1VET B;  3I7J A;  3FC7 A;  1BTL A;  5J8X A;  3P01 A;  3JVU A;  2WGI A;  3C4O A;  4KZB A;  1IKG A;  3MBZ A;  2PBD P;  3LFV A;  3C5A A;  2HV1 A;  2NUT C;  3KSG A;  4R6L A;  5DF7 A;  4I3J A;  3V67 A;  5EEC A;  1N9L A;  4EW7 A;  5EV0 A;  4B4Z A;  3FWL A;  1OTD A;  3W8K A;  3VMA A;  4P0M A;  1SCW A;  4PMA A;  2FFF B;  1XGI A;  1IEM A;  3CPT A;  4EEP A;  2Y2M A;  3SS3 A;  4ZJ1 A;  1BUE A;  4ZRR A;  2Z2L B;  1XP4 A;  1MC0 A;  2OV5 A;  3VP1 A;  5EM0 A;  4LFU A;  4MBK A;  1YMS A;  3QP5 A;  1XXM A;  3NCK A;  3EEH A;  1YKD A;  2P08 A;  2Y2P A;  4B4X A;  4WLA A;  2EWW A;  4E6W A;  3N8S A;  3MS6 A;  3PYP A;  1YSQ A;  4WEK A;  4X56 A;  4NXG A;  2FH5 A;  2WZX A;  1V9Z A;  1XJ2 A;  4Y0O A;  3PBS A;  2ZJ9 A;  1BLH A;  4NK3 A;  1DY6 A;  5F68 A;  3HUO A;  4S2P A;  2Y79 A;  1MKI A;  2GDN A;  1T1C A;  5M18 A;  2XF3 A;  1SKF A;  3GTC A;  1KVM A;  3M2J A;  3VSL A;  5L10 A;  5DKL A;  1G5U A;  4CPK A;  3FYZ A;  4BL3 A;  1L0F A;  4GHI A;  4S2K A;  2D02 A;  1MWT A;  3V5M A;  2ZLY A;  3RXX A;  2INW A;  2XDM A;  1L2S A;  2H28 A;  1YPR A;  1TDG A;  2PR5 A;  4WZ5 A;  2WYX A;  2AVX A;  5U47 A;  1CQA A;  4EER A;  3SS5 A;  2EX8 A;  4PAU A;  3LUQ A;  2J3W A;  4R3J A;  4L9F A;  3WS1 A;  2VK3 A;  3F1P B;  5TBM B;  3N7W A;  4EUV A;  1W5D A;  2XA7 S;  4NXF A;  3MSH A;  1YLY A;  2XD5 A;  3HCY A;  1BSG A;  1H0M A;  2ZQA A;  2J8Y A;  1FOF A;  2W27 A;  4LV1 A;  2Y55 A;  2X02 A;  3OPH A;  4LV0 A;  3EQU A;  4GDN A;  1KDW A;  2XQZ A;  3HLW A;  3ZNT A;  4GCZ A;  2ZQ8 A;  3WWX A;  2XFT A;  1S67 L;  3MR0 A;  3C8C A;  5E43 A;  2V0U A;  2Y2I A;  2PRF A;  1Z09 A;  1LL5 A;  1TS8 A;  1MWR A;  3T1R A;  4XXR A;  3LIA A;  3H82 A;  4RVA A;  1O07 A;  2ACG A;  3S7P A;  3QP2 A;  4HH2 A;  4HY8 A;  2K31 A;  3MMH A;  2QWS A;  3TJZ C;  1RGY A;  3S4X A;  1YAX A;  2XRO A;  1ES2 A;  3OPP A;  1M6K A;  5CHJ A;  1BUL A;  4JPM A;  5FAO A;  1Q2P A;  2J7V A;  3C30 A;  5HDS A;  2UV0 E;  3VP2 A;  2P7J A;  1OTB A;  2A24 B;  4GW9 A;  2W3D A;  4L0L A;  1CJF A;  4Q0J A;  1PYY A;  4O01 A;  4P6B A;  1OJ5 A;  2BTF P;  4Y5F A;  4IED A;  3FV7 A;  4BEN A;  1ALQ A;  4EQ1 A;  4CLC C;  1NYY A;  1CF0 A;  1NJ4 A;  4DDS A;  3V39 A;  3T4J A;  2JCH A;  1JTD A;  4EES A;  5HPF A;  1I2S A;  5FAP A;  4K0W A;  1NZU A;  4FSF A;  3M6B A;  2R9W A;  1L0D A;  4KEN B;  1TF1 A;  4PM6 A;  3A3J A;  4EUZ A;  5GLA A;  4Q0H A;  4ARZ A;  1S1Z A;  4JXG A;  3OPL A;  3A0R A;  1K55 C;  3MQ0 A;  4GJ4 A;  1XPB A;  2JKT M;  2ZC7 A;  2EFU A;  3S7O A;  5TR7 A;  4PHT A;  3HLB A;  3K3C A;  4DN0 A;  2W3F A;  2WKI A;  2Q9N A;  3OLO A;  2B5R A;  1K54 C;  3UNW A;  5EVL A;  4ZJ3 A;  2B02 A;  2ZMA A;  3T4Q A;  4GKU A;  4ETZ A;  3UPP A;  3D4F A;  2Z6D A;  1W8Q A;  1E4D A;  1OTA A;  3ITA A;  4R3A A;  2HJE A;  5FI2 A;  4Z1W A;  1L0G A;  3O3V A;  2EX2 A;  4G3W A;  4QWO A;  1OT9 A;  1WE4 A;  3G30 A;  4E3N A;  3LEZ A;  3WS0 A;  3UE0 A;  1N9O A;  2JHE A;  2HPB A;  3O88 A;  2DNS A;  5HFO A;  1FCM A;  4Y0U A;  1LSX A;  4QB8 A;  2A3U A;  4ARZ B;  1K56 A;  3FPV A;  4S2O A;  4JKT A;  4MBF A;  1MWS A;  3PBO A;  3DTK A;  2V0W A;  2BAS A;  3F1O B;  4BMW A;  4HH3 A;  5DTS A;  2ZQC A;  2LB9 A;  3BFD A;  4QY5 A;  3IWO A;  2NUP C;  2V1A A;  5EVI A;  2J80 A;  4I38 A;  1BT5 A;  2WAD A;  3OPR A;  3C7V A;  1J9M A;  3ITB A;  4M3K A;  5TGF A;  1JNU A;  1GCE A;  4CLC B;  1IYO A;  4E3K A;  1ESI A;  3CWF A;  4QPR A;  5EM1 A;  3T1X A;  3S1Y A;  4S2J A;  5FEF A;  4HHD A;  4WZ4 A;  4II7 A;  1TS6 A;  2KDK A;  2OLU A;  5HL1 A;  5HAP A;  1HZO A;  1MY8 A;  3IH9 A;  2O9C A;  5CRF A;  4DE2 A;  1FR1 A;  1DJC A;  4N1X A;  5E2G A;  1IOU A;  5K5B A;  3LI8 A;  2D01 A;  4P87 A;  3BEC A;  3UMD A;  3LR3 A;  5A92 A;  3SW1 A;  4E3O A;  3IT9 A;  3A3D A;  3HJK A;  1LSV A;  3S7N A;  5DF8 A;  1KE3 A;  3M2K A;  2V8F A;  4IHQ A;  2IA2 A;  4MMN A;  4EBP A;  3H7W A;  3DTI A;  3D72 A;  3C4P A;  4GLQ A;  3Q7V A;  1PRQ A;  4E3J A;  4LCM A;  4R23 A;  1YT4 A;  3UE1 A;  5GLD A;  4U3T A;  1K6R A;  3PBR A;  4R4R A;  1K56 D;  1YLJ A;  2ZMV A;  3VSK A;  4JXW A;  3ZCZ A;  1UGU A;  4OPZ A;  2E8J A;  5F83 A;  2P74 A;  2A49 A;  1JWP A;  4LRX C;  1NWZ A;  4FD8 A;  1GSV A;  2L4R A;  1PI4 A;  3IH8 A;  1PWC A;  2GNX A;  1OME A;  5GHY A;  2WKP A;  2GZA A;  5EVI D;  5A91 A;  2DMW A;  5L09 A;  2P9V A;  2WZZ A;  1E3U D;  2ZM2 A;  3JVV A;  4IVK A;  4KZ8 A;  5CTN A;  2OWJ A;  1G6O A;  2ZC6 B;  5HAQ A;  3NUL A;  1XFN A;  4Z9Q A;  2WGW A;  2ZM0 A;  5HDD A;  5IS1 A;  3G2Z A;  4F3L A;  3CG5 A;  5DF9 A;  1N9N A;  4GS9 A;  1HLU P;  2J3T D;  4UA9 A;  2EX6 A;  3SS4 A;  3H9W A;  4EQI A;  1TS0 A;  1MWU A;  5J3W A;  3ZNY A;  4QY6 A;  4E04 A;  2PYR A;  3ZG8 B;  1BYW A;  3HJI A;  2O9A A;  3CI6 A;  1N9B A;  4R38 A;  2Q0O A;  2FZ0 A;  1P9W A;  4UHU A;  3BWL A;  1XJ3 A;  4QJG A;  3CLO A;  1D7E A;  4R70 A;  3FG8 A;  3KYQ A;  1CI8 A;  2Y2J A;  3UE3 A;  1SDE A;  3TE8 A;  2X01 A;  4KZ6 A;  1N4O A;  3AGF A;  4HP9 A;  4HNB A;  1LL9 A;  2VV6 A;  4MNR A;  2GX5 A;  2QKP A;  4LRY C;  2VA0 A;  1NYM A;  3HLE A;  5FQK A;  4ME4 A;  1S66 L;  5FQ9 A;  1ZTU A;  4O0P A;  4EET B;  3IBJ A;  3F1N A;  2PU2 A;  1STZ A;  1FCN A;  4E3I A;  3FPW A;  3N6I A;  5AQA A;  2IWB A;  1TS7 A;  4YIN A;  5FQJ A;  2A2L A;  2ZC4 B;  2QMI A;  3L7H A;  5F5Y A;  1IFQ A;  4I5S A;  4E6X A;  1ES3 A;  4BD0 A;  1OTI A;  3MZF A;  4C75 A;  2XH9 A;  3NJA A;  5CHU A;  4OQ0 A;  1HVB A;  2Q9M A;  3DWK A;  3IF6 A;  1FSY A;  4JGQ A;  5D3O A;  5CX7 A;  2B18 A;  4WZ5 C;  4BJP A;  4N1H A;  1F98 A;  5E2E A;  2YKF A;  5DJU A;  4DE3 A;  3NOP C;  1XFQ A;  2WAE A;  4WMC A;  2M7V A;  2H0T A;  4FUW A;  1EI5 A;  4KQR A;  4KZ3 A;  2VKS A;  3VFH A;  3UDX A;  4OQI A;  3A3I A;  4X1M A;  2J9O A;  1P0Z A;  3ZVT A;  2ZL1 A;  3B3X A;  1F5M A;  4C3Q A;  5HWW A;  3NEC A;  2V1B A;  4DJ2 A;  5DFX A;  5FAS A;  3VOZ A;  1WA9 A;  4WEJ A;  3IS2 A;  3OCL A;  1CEF A;  3LID A;  3GDI A;  3ZQ5 A;  3PR6 A;  1NXY A;  2IWD A;  1DJB A;  1SKO A;  2QJ5 A;  4YNR A;  3LCE A;  3RJU A;  5HPI A;  4WM9 A;  2VGJ A;  3E4Q A;  3G4P A;  3Q07 A;  3IF5 A;  4JGO A;  3K2N A;  3EEA A;  1Q2Q A;  3CPT B;  2O0Y A;  1Y28 A;  4XT2 A;  3C38 A;  4P85 A;  1NRJ A;  1KDS A;  2QYB A;  4X6T A;  1C3B A;  1JTG A;  3OOV A;  1W79 A;  1PNE A;  3BQA A;  4IUH A;  5HWV A;  4ZBE A;  1YLZ A;  1K57 C;  4MCW A;  2R9X A;  4IUK A;  4NXB A;  1W8Y A;  4KG6 A;  2V8C A;  4PKY G;  2GJ3 A;  3FKV A;  3GEC A;  1LSW A;  5CGS A;  3DBA A;  1XA7 A;  2W0N A;  2XR0 A;  3R4K A;  4OPQ A;  4WMC D;  5CGX A;  3IQA A;  4ZAM A;  1PW8 A;  3UB7 A;  5GHX A;  4F94 A;  3ZDJ A;  1K6S A;  3W2Z A;  2ZQ9 A;  3ICY A;  5E2F A;  4KZ5 A;  1K25 A;  4ZJ2 A;  4WBG A;  4LEN A;  1GHP A;  4UA6 A;  4LPZ A;  4GHI B;  2JKF A;  1DRM A;  1KGF A;  5G4Z A;  2ZOI A;  3G6O A;  5EVE A;  1GSX A;  2HDQ A;  1I2W A;  2YKH A;  4HJ3 A;  5AVF A;  3LIF A;  1SDN A;  4U0T A;  4DMZ A;  4OPR A;  5GL9 A;  1K57 A;  5CTM A;  3TOI A;  4XUZ A;  3NC8 A;  1D1J A;  1K4E A; 
#chains in the Genus database with same CATH homology
 1E25 A;  1FCM A;  1KGG A;  4Y0U A;  4QB8 A;  2A3U A;  5FAT A;  2ZC3 B;  1K56 A;  3LY4 A;  3IHB A;  4S2O A;  4JKT A;  3PBQ A;  4MBF A;  1PIO A;  4PPR A;  1MWS A;  3BLS A;  3PBO A;  1PZO A;  3ZGA B;  2OSU A;  5FI7 A;  1PW1 A;  3BLM A;  4OH0 A;  4RA7 A;  3W4P A;  4N9L A;  4OP8 A;  5DTS A;  3NDE A;  3ZG7 B;  2Z2M B;  2ZQC A;  5DTK A;  3P98 A;  4MBH A;  4OQG A;  4S2I A;  4X69 A;  3BFD A;  3TG9 A;  1TVF A;  4QY5 A;  2WGV A;  3GQZ A;  2DCF A;  4A5R A;  3IWO A;  4R0Q A;  3G31 A;  3PTE A;  3ZFZ A;  5EVI A;  4HES A;  1BZA A;  1BT5 A;  1MPL A;  2WAD A;  3QHY A;  3GRJ A;  3OPR A;  2EX9 A;  3OC2 A;  3C7V A;  1J9M A;  3ZG0 A;  3ITB A;  4M3K A;  3V50 A;  3G2Y A;  5TGF A;  4ZTK A;  5AQ7 A;  3IF6 B;  4KZ7 A;  4R3B A;  1GCE A;  3MFD A;  4KQO A;  4OPY A;  3A3E A;  4OQH A;  3E2L A;  4RX3 A;  1FSW A;  4GD6 A;  2H5S A;  4DE0 A;  4QD4 A;  1I5Q A;  4PM5 A;  2HP5 A;  1IYO A;  1PWD A;  2CC1 A;  4E3K A;  1DJA A;  1ESI A;  2ZD8 A;  2E8I A;  5FAQ A;  3UPO A;  4QHC A;  4PM8 A;  4BD1 A;  3WS5 A;  4XUX A;  3S1Y A;  4S2J A;  4WZ4 A;  2HDU A;  2OLU A;  5EE8 A;  2JBF A;  3MKE A;  5HL1 A;  5HAP A;  2VGK A;  1HZO A;  1MY8 A;  1QME A;  2JC7 A;  4HEF A;  2C5W B;  3GR2 A;  1LI0 A;  3IH9 A;  4OON A;  5CRF A;  5CEC A;  3BRM A;  3MKF A;  4IBX A;  4DE2 A;  1FR1 A;  2QZ6 A;  1DJC A;  1SHV A;  3E2K A;  4N1X A;  1K38 A;  5IHV A;  2Y2H A;  5E2G A;  4FH4 A;  1H5X A;  3UN7 A;  3WS2 A;  4P87 A;  1YM1 A;  3BEC A;  3N8L A;  1PI5 A;  5GLB A;  2WK0 A;  3UDF A;  4KZA A;  2ZM8 A;  5FI6 A;  3S22 A;  4X53 A;  4LCL A;  3I7J A;  5A92 A;  4OOM A;  2XFS A;  4E3O A;  3IT9 A;  1BTL A;  3A3D A;  5DF8 A;  1KE3 A;  4YFM A;  3M2K A;  5J8X A;  4DE1 A;  1Y54 A;  4EBP A;  3BM6 A;  5FQM A;  4R4S A;  1JWZ A;  2WGI A;  5KSC A;  3C4O A;  4DF6 A;  4JF6 A;  1RCJ A;  3UDI A;  4KZ9 A;  4KZB A;  1IKG A;  5DVA A;  3MBZ A;  3BFE A;  5EVI C;  1U60 A;  3C4P A;  5FQQ A;  4JXS A;  1CK3 A;  3Q7V A;  4E3J A;  4LCM A;  4R23 A;  1L0E A;  1YT4 A;  3C5A A;  3UE1 A;  3Q82 A;  5GLD A;  4U3T A;  1K6R A;  3PBR A;  3EQV A;  1K56 D;  1YLJ A;  3HLG A;  3PBT A;  4R4R A;  3VSK A;  3ZVW A;  2H10 A;  5DF7 A;  1NY0 A;  4JXW A;  3IXG A;  3ZCZ A;  2ZC5 B;  1LHY A;  4OPZ A;  3WRZ A;  5F83 A;  5EEC A;  2P74 A;  2A49 A;  1JWP A;  3PAE A;  4JXV A;  5M19 A;  4B4Z A;  3FWL A;  4FD8 A;  4E3M A;  3PAG A;  3W8K A;  3UY6 A;  3O86 A;  1ES4 A;  4P0M A;  3VMA A;  1PI4 A;  3IH8 A;  1SCW A;  2RL3 A;  3P09 A;  1PWC A;  1HTZ A;  2FFF B;  4KQQ A;  1XGI A;  1OME A;  4PMA A;  2ZQ7 A;  1IEM A;  3DW0 A;  4GZB A;  5GHY A;  2Y2M A;  3SS3 A;  1YQS A;  4ZJ1 A;  1BUE A;  2PBY A;  2Z2L B;  2H0Y A;  3JYI A;  1XP4 A;  2QPN A;  3GV9 A;  5EVI D;  5A91 A;  2OV5 A;  3UPN A;  3VP1 A;  1QMF A;  3M6H A;  2P9V A;  2WZZ A;  4Y7P A;  4MBK A;  4KG5 A;  1YMS A;  1E3U D;  2C6W B;  2HP9 A;  1XXM A;  2ZM2 A;  3NCK A;  4IVK A;  3VOY A;  4KZ8 A;  4X55 A;  3CMZ A;  2XGN A;  5CTN A;  2WAF A;  5HX9 A;  2Y2P A;  4B4X A;  2HDR A;  2ZC6 B;  4EV4 A;  5CEB A;  1AXB A;  2WUQ A;  3IWI A;  4E6W A;  5A90 A;  5HAQ A;  3N8S A;  2UWX A;  2Y4A A;  3WRT A;  2Y91 A;  5EPH A;  4JLF A;  4Z9Q A;  1YMX A;  2XEP A;  1FCO A;  2WGW A;  4WEK A;  2ZM0 A;  4X56 A;  1JWV A;  3G2Z A;  1IYP A;  1FQG A;  3VP4 A;  1G6A A;  1MXO A;  2WZX A;  3CG5 A;  5DF9 A;  3G35 A;  5GLC A;  4UA9 A;  2EX6 A;  4Y0O A;  3PBS A;  2ZJ9 A;  3SS4 A;  1BLH A;  4NK3 A;  1DY6 A;  3VFF A;  3HUO A;  5L2F A;  4S2P A;  4EQI A;  2EFX A;  4DXC A;  5I94 A;  2XK1 A;  1MKI A;  2GDN A;  5CHM A;  1MWU A;  3ZNY A;  4QY6 A;  4UA7 A;  4S2N A;  2EXA A;  3NY4 A;  5M18 A;  3ZG8 B;  1LLB A;  3NIA A;  2XF3 A;  1ZG4 A;  1SKF A;  3GTC A;  1H8Y A;  1KVM A;  1N9B A;  1ESU A;  3M2J A;  4E3L A;  3AGD A;  3VSL A;  4UHU A;  3MZD A;  3MZE A;  3LO7 A;  4QJG A;  2I72 A;  1XGJ A;  3FZC A;  1WYC A;  4CPK A;  5CED A;  3FYZ A;  4BL3 A;  1L0F A;  2RCX A;  1H8Z A;  4S2K A;  1CI8 A;  5HAI A;  2Y2J A;  3V3R A;  5KZH A;  1MWT A;  3UE3 A;  1SDE A;  3V5M A;  2X01 A;  3OCN A;  2ZLY A;  1KGE A;  3RXX A;  2XDM A;  4KZ6 A;  3VP3 A;  1L2S A;  2V2F F;  1N4O A;  3AGF A;  3WS4 A;  1TDG A;  4B88 A;  3HRE A;  3ZG5 A;  4WZ5 A;  1LL9 A;  1CI9 A;  1RP5 A;  2PU4 A;  2WYX A;  4UAA A;  5U47 A;  4JF5 A;  4MNR A;  5F1G A;  3NBL A;  3UO9 A;  2XD1 A;  3ZG9 B;  1NYM A;  2HDS A;  5TFQ A;  3HLE A;  3SS5 A;  1YLP A;  3GSG A;  2EX8 A;  5FQK A;  1ONH A;  1PZP A;  5FQ9 A;  1IEL A;  3HVF A;  5E2H A;  1BLP A;  4DKI A;  4R3J A;  3GVB A;  3WS1 A;  3IHA A;  2PU2 A;  5F1F A;  2JE5 A;  3FKW A;  1FCN A;  2BG1 A;  3N7W A;  3N6I A;  4GDB A;  1W5D A;  4E3I A;  5AQA A;  2IWB A;  5CXW A;  1GHI A;  1YLY A;  2XD5 A;  4EWF A;  3MXR A;  1BSG A;  3SH8 A;  2WKE A;  2ZQA A;  4FH2 A;  4IVI A;  4S2N C;  4BL2 A;  1IYS A;  1S0W A;  2J8Y A;  5CGW A;  1FOF A;  4YIN A;  5FQJ A;  2ZC4 B;  1ZC2 A;  2ZQD A;  2QMI A;  4LV1 A;  3QNC A;  5EVI B;  5AQB A;  3PBN A;  4E6X A;  5A93 A;  2Y55 A;  2X02 A;  3OPH A;  4LV0 A;  3EQU A;  4GDN A;  4FCF A;  1KDW A;  2XQZ A;  3HLW A;  1ES3 A;  3ZNT A;  4BD0 A;  1GA9 A;  1ONG A;  3MZF A;  4GN2 A;  2ZQ8 A;  1NRF A;  3WWX A;  4C75 A;  2XH9 A;  3BEB A;  2XFT A;  4CJN A;  5CER A;  5CHU A;  3NI9 A;  4OQ0 A;  5E43 A;  1HVB A;  2Q9M A;  3DWK A;  2Y2I A;  3Q1F A;  3IF6 A;  1FSY A;  1LL5 A;  5FQI A;  1MWR A;  4DDY A;  4GNU A;  4XXR A;  5D3O A;  3HLC A;  4WZ5 C;  4OKP A;  4RVA A;  4N9K A;  4BJP A;  1BLC A;  1XX2 A;  4N1H A;  4PM7 A;  3TSG A;  4MLL A;  2Y2K A;  1O07 A;  3HBR A;  5E2E A;  3W4Q A;  3BYD A;  4JBF A;  4DE3 A;  2WAE A;  1KE4 A;  4WMC A;  2H0T A;  1EWZ A;  3IXD A;  5FDH A;  1YLT A;  1EI5 A;  4KQR A;  1GHM A;  1RGY A;  3S4X A;  4KZ3 A;  3VFH A;  1G68 A;  4MEZ A;  3UDX A;  1ES2 A;  1LI9 A;  2DRW A;  4OQI A;  3A3I A;  1VQQ A;  3Q81 A;  2IWC A;  4DXB A;  3OPP A;  2J9O A;  3SOI A;  5KSH A;  2Y2G A;  4U0X A;  1M6K A;  5CHJ A;  3ZVT A;  1BUL A;  3IWQ A;  4JPM A;  3B3X A;  5FAO A;  3HUN A;  4C3Q A;  1Q2P A;  2J7V A;  4LV3 A;  4OP5 A;  1ES5 A;  1IKI A;  5EOE A;  3VP2 A;  5EUA A;  4HBT A;  3IXH A;  5FAS A;  3G32 A;  1K55 A;  1KE0 A;  2Y2Q A;  3VOZ A;  3C7U A;  4C6Y A;  5G18 A;  4WEJ A;  1PWG A;  4HBU A;  4H8R A;  1JVJ A;  3OCL A;  1CEF A;  3O88 A;  4BLM A;  1O7E A;  1YLW A;  2Y59 A;  3Q7V B;  1MBL A;  1NXY A;  3LY3 A;  4L0L A;  3AGE A;  2IWD A;  4GOG A;  1PYY A;  1DJB A;  4P6B A;  2Y2L A;  5FSR A;  1WYB A;  3LCE A;  3RJU A;  1ERQ A;  4IED A;  4WM9 A;  4WYY A;  2VGJ A;  3FV7 A;  1XKZ A;  1M40 A;  3ZHH A;  1K54 A;  4OOL A;  3HUM A;  4BEN A;  1ALQ A;  4OLG A;  3G4P A;  4RX2 A;  3Q07 A;  3IF6 C;  2J9P A;  3IF5 A;  1NYY A;  4GB7 A;  4DRT A;  1E3U A;  1NJ4 A;  1S6R A;  2V1Z A;  5JYO A;  4ZDX A;  1ERO A;  4DDS A;  3V39 A;  1Q2Q A;  2JCH A;  4O7D A;  1XA1 A;  1JTD A;  4X68 A;  1I2S A;  4K91 A;  4D2O A;  5FAP A;  4P85 A;  4K0W A;  1NZU A;  4FSF A;  1VM1 A;  3M6B A;  2R9W A;  1L0D A;  3VP0 A;  5DTT A;  1KDS A;  2EXB A;  4KEN B;  4KG2 A;  1C3B A;  1JTG A;  1TDL A;  2P9V B;  3IXB A;  3A3J A;  4GD8 A;  4PM6 A;  1W79 A;  4S2L A;  4EUZ A;  5GLA A;  4EBN A;  4OOY A;  2FFY A;  2HP6 A;  3G34 A;  3MXS A;  4ZBE A;  1YLZ A;  3HLF A;  1HD8 A;  1K57 C;  1IYQ A;  2R9X A;  4PM9 A;  4N92 A;  3SH9 A;  1W8Y A;  2WGW B;  4K0X A;  4KG6 A;  4JXG A;  3OPL A;  4Q8I A;  2Y2O A;  1FR6 A;  3FKV A;  1CEG A;  1K55 C;  3DTM A;  4X6T A;  5CGS A;  1RGZ A;  4KZ4 A;  1XPB A;  4Y0T A;  2ZC7 A;  4JF4 A;  1XA7 A;  2BLS A;  2EFU A;  2XR0 A;  2V20 A;  4OPQ A;  1K4F A;  4WMC D;  5CGX A;  3IQA A;  4ID4 A;  1PW8 A;  4ZAM A;  1W7F A;  5BOH A;  5GHX A;  4QU3 A;  5TR7 A;  4F94 A;  1TEM A;  3HLB A;  2Y2N A;  4RYE A;  3ZDJ A;  5JYP A;  1K6S A;  3BFC A;  2WKI A;  3OZH A;  2Q9N A;  2X71 A;  2B5R A;  4IBR A;  2WKH A;  4OVD A;  2ZQ9 A;  3HL9 A;  1K54 C;  3UNW A;  2XLN A;  5E2F A;  5EVL A;  4KZ5 A;  1K25 A;  2ZMA A;  3NDG A;  4ZJ3 A;  4ZJ2 A;  3GMW A;  3CZD A;  4WBG A;  4GKU A;  1BLS A;  2G2U A;  1NZO A;  4LV2 A;  4LEN A;  1Z6F A;  3UPP A;  3N4I A;  3Q7Z A;  1GHP A;  1ZG6 A;  3O87 A;  3D4F A;  4BQM A;  4UA6 A;  1GA0 A;  5M1A A;  5F82 A;  3SH7 A;  3CJM A;  1KGF A;  1E4D A;  1W8Q A;  1ERM A;  3ITA A;  4OLD A;  5FI2 A;  3V3S A;  3N8R A;  2OLV A;  1L0G A;  2G2W A;  3O3V A;  2HDQ A;  5KMW A;  2EX2 A;  5FA7 A;  3QNB A;  1I2W A;  3BFG A;  1WE4 A;  1KVL A;  3DWZ A;  3G30 A;  3HLD A;  4E3N A;  4R1G A;  5AQ9 A;  5EOO A;  3LEZ A;  1SDN A;  5HAR A;  3A3F A;  5HW3 A;  3W4O A;  3WS0 A;  5GHZ A;  4U0T A;  3UE0 A;  4OPR A;  5GL9 A;  1ZKJ A;  4NET A;  1K57 A;  3ISG A;  5CTM A;  4XUZ A;  3TOI A;  4EBL A;  4WEL A;  3RXW A;  4S2M A;  3NC8 A;  2HPB A;  3BFF A;  2DNS A;  5HFO A;  1K4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...